4C4ZA

Crystal structure of human bifunctional epoxide hydroxylase 2 complexed with a8
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
318
structure length
318
Chain Sequence
TSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Combination of Spin Diffusion Methods for the Determination of Protein-Ligand Complex Structural Ensembles.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
total genus 108
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c4zA00
1YA8A 2BUCA 1E8MA 3DJYA 5D3ZA 2W22A 1EI9A 1DWPA 4BRSA 3EQ9A 3AIMA 4C87A 1WHTA 1XZFA 3MGAA 1EDEA 3ESCA 2XQKA 2ZYSA 2ZYHA 3C8HA 4UBIA 3WKCA 3WLAA 2W6CX 4X3CA 3QM1A 2G4LA 2WFLA 5DYYA 1BROA 1JKMA 3PICA 3DS8A 5JAUA 2VTVA 1HL7A 1UZAA 1CVLA 4GEGA 1F8UA 3R3WA 2WG0A 1VE7A 4G4GA 5IVKA 2RHTA 3FSGA 1ZIXA 2DQYA 4KEAA 4Y2UA 4NMWA 2HA4A 4H7HA 4FDMA 1PV1A 4G9EA 1WB6A 2BJHA 3VKFA 4DYHA 4AO7A 4G1FA 1QIJA 3F8SA 1EDDA 1SOMA 4K6GA 4EHBA 1BS9A 5DYWA 4KAJA 4B83A 1KU6A 1L7AA 2OCKA 5JD4A 2VQ6A 2QM0A 1UWCA 3O9MA 1VXOA 2GYVA 2AJBA 3C6XA 4HZGA 4EY8A 4L0CA 2IITA 3RLIA 1THTA 4M0EA 2WKWA 5JATA 2WHRA 1YB6A 5AI8A 3OPMA 3PFCA 1XQXA 2O2GA 2HFKA 3ICVA 2HA0A 3W9UA 4BTLA 2GYWA 2OPHA 4FFWA 3BE8A 2Z5GA 3KXPA 4B81A 5JADA 5T4EA 3V9AA 3WL7A 1Q83A 4HS9A 3C45A 1VXRA 3ESAA 2WUEA 2RI6A 4YASA 5K3EA 4L72A 1FJ2A 2HA2A 4HXFB 3FOBA 2AJCA 5K3DA 5ALRA 5ALDA 2HADA 3V1LA 4OSEA 1EDBA 5HKAA 3ICWA 4J0JA 5BWCA 2B9VA 2PX6A 4YK7A 1H23A 1LPAB 3WK5A 3C5WP 4CCWA 3WL6A 3IUJA 1T4MA 5ALEA 5CT8A 3PUHA 5I9IA 1TCCA 2FX5A 2H7CA 1UKAA 4XIIA 3HABA 1GKLA 3JW8A 3H18A 1ETHA 1EK2A 1MU0A 5I7UA 5JD6A 1EVQA 1A7UA 4KE8A 4CG1A 3VJMA 4N8SA 1ORWA 3B12A 4DNOA 2UZ0A 4RNCA 1W6RA 2XUPA 4DSAA 3QZUA 4Y2PA 4J0HA 3WWOA 3LCRA 1QLWA 1VA4A 4MYSA 2ONCA 4DNQA 2O7VA 1CUBA 5DJ5A 5LZ8A 5LP1A 2WG2A 2BUAA 3FBWA 4OB6A 1NU6A 4ARBA 3PI6A 1UXOA 1Y7HA 2WTNA 1EH5A 4WFIA 4MWTA 5AI4A 4LXGA 4B82A 2YXPX 4EA6A 3HJUA 1CR6A 4B9AA 5DYTA 5HCUA 1PJAA 4BP8A 2OGSA 5HF9A 5FLKA 4C6HA 1XKLA 2LIPA 2WUDA 3R3VA 2BUBA 3HLKA 3HYSA 4X71A 1LPOA 4C4XA 5HF6A 3AZQA 2XLBA 3N0TA 2XUOA 1CUXA 1W76A 3ILSA 1CQWA 5CT9A 3WK8A 3FSGD 5D3KA 5JALA 2XQIA 5KWJA 1EHYA 3WJ1A 2OLEA 5JYCA 1BN7A 1MPXA 3G0DA 2HIHA 1IZ7A 1F6WA 3TEJA 1DQYA 2HRQA 1DINA 1DT5A 1R1DA 1ZGBA 3I2HA 3PE6A 5AIBA 1DWOA 1R88A 1H2YA 2QT9A 5AKHA 4Y2RA 1PFQA 1UK6A 3WWDA 1JT2A 4KR0A 1AZWA 1MT3A 2R11A 1SCIA 5AHXA 2ACEA 5AK6A 4KJXA 3MVEA 3TRDA 1YA4A 2EDAA 2RGUA 2WIJA 3ANTA 5IVIA 3T52A 5CTAA 1M33A 4HTAA 2XMBA 2PPLA 3CN7A 3ZV7A 2E3JA 1IUPA 3RM3A 4BC0A 4BE4A 2RAUA 1J1IA 1I6WA 1YASA 4U2DA 5A7FA 5EFZA 1YS1X 4GXNA 4AO8A 2JGJA 4EBBA 1VKHA 5ALQA 4RE6A 1CV2A 1LZLA 1AGYA 3DCNA 4HXEB 2ZYIA 1XQWA 2YH2A 1CUFA 3H1AA 4EB0A 5FDFA 3D2BA 2WFZA 5ALLA 1HLGA 1GGVA 5ALHA 4A5SA 4JH0A 2PUJA 2I03A 1G42A 1HPLA 5HQ3A 4KE6A 3DL7A 3QPCA 4U2BA 3H2IA 5F4ZA 1AMNA 5E4JA 2JIDA 5AKGA 3GZJA 3I1YA 1ACJA 1XZDA 1GQSA 4X6UA 2XUJA 4LKOA 3QPDA 1ZD3A 3K2IA 5JANA 3DYVA 1ZI9A 4QDUA 1CUZA 2G63A 2X76A 1F0PA 2OCLA 1AX9A 5LKRA 4CG2A 2YASA 3VVMA 4P08A 2CB9A 1YS2X 4DMCA 3R3YA 1BRTA 1YAHA 4UHBA 3GBSA 2XQGA 4E11A 4KE9A 3WKBA 3BXPA 3VDXA 1JMYA 2CEKA 3IVMA 1W4LA 3IBTA 5ALKA 4E15A 4OU4A 2WHPB 2VT7A 5ALGA 2WIGA 4IQ4A 2ZYRA 3DOHA 4MEAA 4U2CA 5AJHA 3D5EA 5AKEA 4WJLA 3WYNA 5EHXA 2PL5A 2BGRA 3STWA 3H2KA 1XZIA 4FFVA 3SC2A 4MQMA 5FP0A 3ZI7A 1A8QA 3FAKA 1VE6A 2FJPA 3BJMA 1QGED 2QS9A 2WIKA 1H2XA 2JF0A 3W06A 2Y6VA 4ITVA 4H7JA 3QYJA 4FMPA 1W1IA 4HRXA 4FLMA 4I19A 3RK4A 3STTA 3ZLUA 2I78A 4B80A 2HU7A 1XQVA 3O9VA 3R40A 2D5LA 4TVKA 2R8BA 2JGEA 4EY4A 1CUDA 3G0CA 4K6HA 1XLVA 1YCDA 1ZJ4A 1FSSA 4X90A 1C7IA 1YAJA 2OCGA 4ZWNA 1EXWA 3H19A 1TCBA 4F60A 1DX4A 3R41A 3G02A 2I3ZA 5LZ2A 4QNNA 2CMFA 2HA6A 1H2WA 1QONA 1OXMA 1JJIA 1A8UA 3BIXA 1VOTA 4LXHA 3OTQA 4FNGA 3GUUA 5HK8A 1MX5A 4UHCA 2OCIA 5HFNA 1LPBB 5AK3A 1DWQA 1ODSA 3I2IA 4PQEA 3WL8A 3DOIA 3ZLVA 3NWOA 5AK5A 4X92A 3AZOA 3S2ZA 3KOOA 5LYYA 4DMFA 1NU8A 2G5TA 2WJ3A 1ZI8A 4J03A 2ACKA 2O2IA 3B3QA 4N8DA 3QMVA 1AKNA 1BE0A 1HDEA 3G8YA 1YB7A 3AZPA 3ZPXA 3D3NA 1UOOA 3OC0A 5HK9A 1LBSA 1DT3A 4O08A 3DKKA 4C01A 4KYVA 3CCCA 4PSUA 3E4DA 4FBLA 5ALMA 5ISMA 1Q0RA 1E8NA 1CUUA 2VA9A 4P93A 1UOQA 3I6ZA 1TIBA 4GI1A 1E8DA 2Y2VA 1GPLA 4J0IA 2O2HA 1WCYA 3IUQA 1BCSA 2WIFA 3TJMA 4FWBA 3L1HA 4UBKA 1W52X 2ZJ6A 2C5FA 1UK9A 1H22A 1MX1A 5AO9A 1RP1A 2JEZA 2XDWA 4IH9A 3FCYA 4HAIA 4UPDA 3MUOA 2IIVA 2WJ6A 2BGNA 4AN0A 3IA2A 3LLCA 4BRZA 3RKSA 3HRHA 4RGYA 3I6YA 4ZXFA 2JGFA 4ZI5A 4WY8A 3VISA 4BDSA 1LNSA 3PUIA 2OQVA 2PBLA 4E46A 1OILA 3V48A 3C87A 3UUEA 5ALTA 2FJ0A 3GFFA 5AM3A 3QPAA 5JAPA 2C7BA 1XZCA 5CURA 4UBOA 3U0VA 2PUHA 4B6GA 1XZHA 2HU8A 1IUNA 4GBGA 3FYTA 5AOAA 5LZ7A 2EDCA 4CIAA 3Q8WA 1CFJA 4RE5A 1UFOA 2XB6A 3C5VA 2VSQA 2OGTA 1AC5A 2B61A 3WI7A 3WWPA 3KD2A 1Z68A 3O4GA 5CRIA 2EEPA 4Q3LA 3AUKA 3B5EA 3OOSA 2PVSA 3KDAA 2O7RA 4LYDA 4X94A 3WK4A 5FV4A 5AI0A 2XUQA 3I2GA 3IIIA 3PFBA 2GYUA 5LIPA 4H35A 1L7RA 4BE9A 2CZQA 5CH5A 2K2QB 1TCAA 4PF1A 4K5QA 2WUFA 1Y37A 3NOXA 4LXIA 3H2HA 4QDXA 4ZV9A 1H2ZA 1Q0ZA 5K3FB 3QBJA 2WFMA 4BBZA 2BFNA 5AKYA 3G9UA 3F97A 1AUOA 4MXDA 4XX1A 1WB5A 3MUNA 4HVTA 2G5PA 3H04A 1XZJA 4A16A 4DMKA 3WA7A 1G66A 1Y7IA 2GZSA 4AXBA 1ACLA 2RHWA 3HC7A 5A7GA 1T2NA 1MNAA 4K2AA 2VJDA 2WU3A 1WB4A 3G9ZA 1QIFA 3R3ZA 2JEYA 5AKKA 1ORVA 4OB7A 4X6YA 1YSCA 3OM8A 4Q05A 4NVRA 3AIOA 4YPVA 3C8DA 2X5XA 4BCCA 2C58A 1LPNA 3YASA 4TPKA 4J3JA 1QIGA 5T4FA 3RARA 4BVJA 3M81A 4Z49A 4DMHA 2ORYA 4B9EA 1N8SA 1MO2A 4B7ZA 4PW0A 4IHAA 2PSDA 3DD5A 3DYIA 1IVYA 5DLPA 3R3XA 1MX9A 1N1MA 3WQHA 3AINA 1B41A 3ESDA 1XZBA 5ESRA 5EI5A 5JAOA 1VA5A 4BCDA 5JARA 5EIEA 2I3DA 1LPSA 1XLUA 2XQJA 3R0VA 3F96A 4UHHA 4EY5A 4CIBA 4N8EA 1GZ7A 4N5IX 4IH1A 2ZSHA 5EHQA 5JAHA 2ES4A 2PM8A 4DIUA 3WZMA 3L1JA 3G0GA 1JU3A 4GW3A 4IH4A 4L9AA 2HU5A 2XI4A 2HHAA 4S0XA 1WM1A 2DQZA 3D7RA 2QXTA 3HXKA 2ZVDA 2J3DA 3WJ2A 3R3UA 5CT4A 3QH4A 3WIBA 4WDRA 2Z3WA 3E3AA 4W9RA 1CRLA 4NS4A 1SCQA 4JYPA 4UHDA 4ZV7A 3FVRA 1DX6A 1QFMA 3Q0TA 1XRQA 1XROA 2WSLA 1C7JA 1CIJA 7YASA 1JFRA 1CPYA 5AI6A 4AZ3A 3C6YA 5A7HA 4KACA 2XQFA 3NGMA 5IVDA 2ZSIA 4XJVA 5E2IA 1P0PA 5BV7A 4FLEA 2GBIA 5SYNA 3AFIA 2V9ZA 1WPRA 1VJ5A 4C89A 4F21A 3EQ7A 5KWIA 1MTZA 2XMZA 4BC1A 3WK6A 5I8PA 1OCEA 3O4IA 3BF7A 5DNVA 2FUKA 3ZLTA 3EBLA 5IKXA 4EUSA 5AKIA 4J0GA 3FCXA 1BEZA 5J3JA 5HFAA 5AK4A 2DR0A 3A2NA 5AKLA 1C4XA 4Y9SA 1CUSA 4M0FA 3BJRA 2B4KA 4Y2VA 1E89A 3EF3A 1XZEA 4OD0A 2PSHA 3U1TA 4OPMA 4Q3KA 4EY7A 2Z8XA 2OAEA 4RPCA 5LZ4A 4QZVA 2HM7A 2XUKA 3WL5A 1J06A 2WHPA 5CBKA 4M0MA 4FNMA 3D2CA 2HRRA 2BCEA 5AOBA 3O95A 2V96A 1CUCA 1XKTA 1DU4A 1L7QA 4U2EA 4ZREA 3DEAA 4OB8A 4UUQA 4NZZA 2H1IA 2GBCA 1MAAA 3HACA 4IO0A 3I1IA 4UFPA 1XFDA 3BIWA 4H77A 5LLSA 4BYMA 4H7IA 1EX9A 4CG3A 1MJ5A 5AI9A 1USWA 3S8YA 4QLAA 5CH8A 1ODTC 4MJ3A 4PSCA 5AI5A 1ZIYA 4DTCA 1XZAA 1TK3A 1VLQA 4X00A 2VEOA 1GPKA 2WILA 1QJ4A 4DM7A 4B0OA 4ARAA 1S8OA 5AP9A 4JNCA 3ZWQA 3HSSA 2H9YA 3BDVA 2QRUA 2GBFA 5YASA 2ZJ7A 1X2BA 1XQYA 4BVLA 1UKCA 2OQIA 5DTIA 2Y6UA 3WMRA 3X3HA 2DHDA 1K63A 5JZBA 3FLEA 4GDMA 4UBJA 1CUEA 5AM4A 3GELA 2ECFA 2XMQA 2H7XA 5CXXA 4P9NA 2XE4A 5C8VA 4CI9A 2PSFA 2QXUA 4BATA 1QIHA 4AZ0A 3V1NA 4BZZA 2XMSA 2QR5A 1UKBA 1CUWA 2PU5A 4ROTA 4AQDA 3LIPA 1X70A 5LZ5A 1FFCA 4BZWA 1LLFA 4Q34A 4AN1A 3D59A 3IUNA 3AILA 4EY6A 1XZKA 1HQDA 2WTMA 1XRLA 3GA7A 1UK8A 3W04A 2QJWA 5A62A 4K6KA 2WIDA 2JGIA 3K6KA 3O4JA 4J0KA 4W1RA 2ROQA 1O6GA 4CFSA 1K8QA 3WA6A 4E14A 4A23A 4FHZA 4F5ZA 1UOPA 3QMWA 4LYEA 1QIEA 1E66A 4KRYA 5LKAA 4B85A 4C88A 4DGQA 2NW6A 2Y2UA 1GQRA 2VT6A 1JJFA 4L3WA 3AJAA 3VVLA 4G8BA 4Y2TA 3FLBA 1K4YA 4AMZA 1XRPA 5D6OA 5ALYA 3WK9A 5ALSA 3H2GA 1QIKA 3D0KA 3WK7A 1AQLA 3GROA 4X95A 3O4HA 2XMRA 2WM2A 1CLEA 2HFJA 4DSZA 4BVKA 4QEKA 2WHQA 4UBLA 5ALIA 2DFPA 5HF8A 1XRRA 1TRHA 4BAUA 4DLNA 1JMKC 1QO9A 1FFDA 1U65A 3DQZA 2WUGA 4H7EA 1XZLA 2C5GA 5ALJA 3I28A 4FBMA 1R50A 5ALZA 4JEIA 4YX9A 1XZGA 3V1KA 1DTEA 3FLAA 5AIAA 1QO7A 5ALXA 3DL4A 4V2IA 1MN6A 1D07A 4MWSA 1LGYA 2GBGA 2VF2A 3W2TA 2X8BA 4FOLA 3D2AA 3WKDA 1N5RA 3HEAA 4MEBA 4KRXA 1NX9A 3KSRA 3CN9A 2WLSA 4UHFA 4UBMA 3H2JA 4GLBA 1XRMA 4MQLA 3FVTA 1JU4A 5FOQA 1ZOIA 4W63A 4MYDA 1LPPA 2Y1KA 1KU0A 5JD5A 1RYYA 2B20A 1JI3A 1KEZA 2RONA 2AJDA 2BKLA 5AOCA 5D7BA 3M3DA 5IVHA 4OCZA 1EVEA 4GHWA 1CEXA 5CW2A 4XWGA 1CUAA 4INZA 3NUZA 1IZ8A 1ODCA 2XLCA 5ALFA 4J0DA 3E1GA 5BOVA 3E0XA 2CBGA 2ZJFA 2D0DA 4J0CA 1WPXA 2Z3ZA 5K3CA 1QE3A 4OYYA 1B6GA 2QTBA 5AM0A 1BEEA 2HA5A 4HRYA 6YASA 2JGKA 1BCRA 4BCBA 3STUA 1CUGA 4B0PA 1XRNA 5CT5A 4AO6A 2XMGA 5E4TA 5ALOA 4UFNA 5C8ZA 3G0BA 2IX9A 3OG9A 4W1PA 3D4LA 3PDCA 2RIPA 2VJAA 2WJ4A 4PO3X 4Y2XA 1WHSA 1YR2A 2DSNA 1P0MA 2JBWA 2AXEA 4U2GA 4QDZA 2QZPA 4UFOA 2GZRA 1THGA 3FYUC 4N5HX 3H0CA 1IUOA 2QOEA 4TGLA 5EIAA 5ALNA 2XUDA 4C4ZA 4LHEA 5DWDA 5A2GA 3QVMA 1ISPA 4PNZA 1E3QA 4WCVA 4I4CA 2AJ8A 1U8EA 3PF9A 5JIBA 1BN6A 1O6FA 4UHEA 3STYA 4FKBA 1K6EA 5T4BA 2VATA 1CUJA 3I2JA 3BDIA 3H17A 4C4YA 3IULA 4WDQA 5ALUA 2HL6A 1E5TA 4BP9A 3C43A 4KAFA 5CT6A 4H7KA 5AM2A 1HBJA 2DHEA 1TAHA 5K3AA 5LZ9A 3BWXA 3BF8A 1MAHA 3G9XA 3QITA 4EZIA 5DNUA 5KBYA 4ZRDA 3M83A 2C0PA 3WIOA 5IH7A 5JASA 4Y2QA 4AMYA 4H7DA 3HI4A 4AX4A 3A70A 4F0JA 3F98A 4H0CA 4FTWA 3G0IA 4BAGA 4QDOA 3N2ZB 3WWEA 2JGLA 3T4UA 1U2EA 4GWLA 3F67A 5T4HA 3WKEA 3K9BA 2XMDA 4G8CA 2QJRA 1HKHA 2DCMA 1QOZA 2HA3A 1EK1A 1ZD5A 3L1IA 4DNFA 3STXA 5AKXA 2XUFA 1LBTA 3I2FA 4QDTA 5HF5A 1R9MA 3O0DA 3STVA 1ZD2P 3C70A 4OUKX 4JUIA 2CUTA 3A6ZA 1IMJA 2JGMA 2XT0A 4HXGA 5ALWA 3P2MA 5EIHA 4H7FA 5DTJA 5CMLA 2WFLB 4WFKA 5HZGA 4QA9A 2OGZA 4CCYB 3W05A 4I3FA 1R3DA 3DDUA 1UK7A 4BDTA 4PV7A 4X97A 4P92A 4QWWA 3C6BA 3LIIA 1GKKA 3AIKA 2QUBA 5AICA 1QIIA 2J4FA 2QUAA 5A6VA 4DNPA 1FFEA 1CUVA 5FPQA 1LPMA 3SK0A 4OU5A 4H18A 5AKZA 4J7AA 1ZD4A 3KWJA 3DLTA 5C8XA 4BB0A 1P0IA 3FWHA 1TKRA 2P8SA 1WOMA 1XLWA 4BAZA 5DNWA 3VJKA 1EB9A 3PF8A 5C7YA 4WY5A 1QFSA 5FPPA 5EHNA 2J3QA 4X7BA 5FRDA 1GXSA 2PSJA 1EB8A 3JYHA 2XMCA 3W9BA 2XUIA 2QVBA 1P0QA 5AM5A 4QE3A 1DQZA 1ZI6A 2CKMA 4U2FA 2Q0XA 2DHCA 1W75A 2VAVA 1X2EA 5HQ3B 3CCBA 4W1SA 1UT6A 5E4YA 1J07A 1GT6A 1N5MA 3LS2A 2H7YA 2PSEA 5A71A 2PU7A 2C4HA 3SX4A 1CUHA 3FNBA 4JYMA 4ZGBA 5ALPA 2BAGA 1ZJ5A 3ED1A 1J2EA 1QTIA 1SCKA 3ANSA 3KWFA 3F9CA 1R9NA 5AH0A 4G4JA 2OXEA 4G5XA 3ESBA 3LP5A 1QZ3A 3FYUA 3A2LA 4GECA 2VJCA 5BWBA 4G8DA 5AKJA 3WWCA 1LZKA 2QKYA 2QMQA 3IURA 1EINA 4QLOA 3G9TA 1U4NA 3WKAA 4Y2YA 2YYSA 4KE7A 2AJLI 2VJBA 4X93A 5EHZA 3WZLA 5FXMA 1G4HA 3HZOA 4KAAA 1EA5A 2XUGA 3I6MA 4G4IA 3JWEA 4OYLA 1R4ZA 1SFRA 1XZMA 1SC9A 3FYUB 5JZ9A 1QTRA 3DKRA 1GPNA 4BTVA 1F0NA 3M82A 2V97A 4WFJA 3G7NA 2HDWA 3TGLA 2WQZA 1K5PA 1JJBA 5CH3A 1VZ3A 5CXUA 4LIPD 1ZGCA 1ZICA 3OURA 4XVCA 4Y2JA 1QIMA 4X91A 5KREA 2HA7A 3IDAA 4Q82A 1A88A 4FLFA 1Q84A 5K3BA 4CCYA 1TQHA 4Q3OA 2Z8ZA 4QWMA 1QIDA 5SYMA 3BL8A 1CQZA 2XUAA 1RWQA 4G9GA 3EQ8A 4B84A 5C81A 5ALVA 3CXUA 1CUIA 3QMMA 1MNQA 2WU4A 2PKYX 3IUMA 2XUHA 1VZ2A 2C0QA 4X85A 3C6ZA 3EIOA 5H3HA 3SWWA 2WG1A 5FKJA 2J4CA 2VAXA 3VJLA 5EGNA 4ETWA 3VXKA 2CJPA 5FUMA 5HKBA 2OAGA 1AURA 1G5FA 5K5EA 3H1BA 1CUYA 4PSDA 1BU8A 3A2MA 3DNMA 5AM1A 3WYDA 4UBNA 3IB3A 4Q1VA 3V1MA 4AB1A 4Y2SA 1FFBA 4Y7DA 5K3FA 2V98A 1A8SA 5JZSA 4W1QA 1FFAA 4D9JA 2OG1A 4X6XA 3UMJA 3UUFA 3I2KA
chains in the Genus database with same CATH superfamily
1UWKA 2CUZA 2CL7X 3M6UA 3Q5DA 1XXHB 4HOYA 3TIGA 5IPFA 1M1NB 1D2NA 4RWZA 2A4KA 4X62B 1RWMA 2HJ9A 5JHGB 4WPGA 3JAMA 3QEAZ 3H5WA 3IFSA 4OK6A 1DWPA 4A2WA 1UAGA 4I3HA 4C9BA 2HTFA 4C87A 4BB5A 3GY0A 3SIPA 1WHTA 4RXUA 2UV8A 3IAXA 4DSUA 1VJCA 4AUNA 1EFPA 3K32A 4XKJA 5JAQA 1XZFA 3BD8A 3L7CA 4MB6A 2F7SA 1TMYA 4CF7A 2ZYHA 3C8HA 3NPMA 2WI8A 5LUAA 3GJYA 3EOBI 3HH8A 1L5SA 3Q1KA 4D9MA 1PI3A 2PEZA 4PYKA 4X3CA 5THQA 4I46A 2PLNA 1IRIA 4H16A 3QM1A 4GGOA 4JLNA 1Z4OA 4GLLA 2G4LA 4DBZA 1L4HA 3C7DB 5HSGA 5DYYA 2UYYA 4HVLA 4FILA 5K6RA 1LH0A 4PBSA 2UYHA 2BD0A 4KLNA 4LXTA 1E1CA 4NRDA 1NBHA 4R2KA 4WXPA 1V4VA 2C77A 5J1TB 3REFA 2G7ZA 4OQXA 1QYWA 4K9DA 4Y6PA 5DVZA 4ARVA 4JI1B 4MQFB 1O96B 3ICOA 2IUSA 3AF4A 3JU3A 4D0SA 4YP1A 3NJ4A 4XQGA 2C5EA 5FBLB 4DLAA 1X1AA 3EZXA 4KEAA 3L8GA 4Y2UA 4ESHA 1N2OA 3EE6A 4Z4EA 1J0BA 4NMWA 4AWAA 2BI7A 5CVCA 1C3JA 1KA9H 4X41A 3ZIUA 1H3FA 1Q7RA 1IE3A 4JYAB 1U1FA 3M5WA 2QX9A 1GTG1 4G9EA 1JIUA 1CQIB 5BO5A 4L8FA 2DTDA 4L2IA 4HN2A 3BGWA 4ON9A 2QTAA 3TL2A 4N18A 2I66A 3QIVA 1X74A 1RZVA 3LL4A 3ZCSA 4AMVA 2OB2A 4EHBA 4OMFG 4HEHA 4DDWA 2LCIA 2VDMB 1TC1A 1XTIA 1B23P 4KAJA 4B83A 1JI0A 1KU6A 5EQTA 1L7AA 2AKYA 1AH2A 1RAAA 5EINA 4GVPA 5HDBB 1OB2A 1KJ9A 1U9YA 1CY6A 3K31A 3U3DA 2I54A 2PPVA 4RH1A 3C6XA 1DXOA 4O63O 3HO8A 3M4NA 3COJA 4EY8A 4PYQA 3B6EA 1MJGM 5IJ9A 1SCUB 1SU4A 2A5GA 2ZRGA 3RLIA 1B1AA 3D3QA 4YAGA 3P2YA 1O6CA 4W5WA 1CULC 1E7SA 2P65A 4DCNA 2EFJA 2WHRA 1YB6A 4BQEA 5A0TA 2YWBA 3BERA 4FYXA 5I47A 5KOYA 1ECBA 1ZINA 3EWAA 5AI8A 4B46A 3F74A 1GCOA 2AR9A 2PA0A 2RHBA 4CF4A 2O57A 4D6YA 3S8MA 1WETA 4FZJA 3U44B 2PH3A 2HFKA 4G5QA 3WHPA 4C05A 1U99A 3O2QB 3JQEA 4F12A 1TTHA 2I33A 1VPTA 4XJSA 1GVHA 3TQOA 1SHLA 1HX7A 2HA0A 5DIZA 3AETB 1JJ7A 4AJHA 1BJRE 1RPZA 1GD1O 4BTLA 1JG7A 4REQA 3N53A 3L2OB 2D8AA 1K4MA 4WX2B 4EJSA 5E7IA 3ZE1B 1RAHA 1ZAYA 4OLFA 3JV7A 2GYWA 2DSTA 1YVDA 4RY8A 5TQ0B 5BXYA 2VZ0A 3UJ9A 3DZKA 4FFWA 2YFQA 1GZ3A 4Q15A 3G1UA 3DE2X 5LQNA 1A2BA 3GUZA 4ABYA 1AMOA 2P1DA 4YTEA 1NL3A 4OYRA 2X4IA 3DHWC 5F21A 2JEOA 1LS6A 1KKLA 4KRGA 3DVAA 3LXUX 4HVAA 2AVDA 1G17A 1SN7A 5ICMA 2DPXA 5E9AA 5F7XA 3D1LA 3GT3A 5B4TA 5M7EA 3RIEA 3NM6B 4BV8A 3EIXA 1VXRA 3ESAA 1HYEA 4E2XA 3CH6A 4EGFA 4WGGA 4DIFA 4B2LA 2WAMA 2OT3B 5D1NA 4BZPA 1KP2A 5DN9A 2EF0A 2HA2A 4J94A 1Z5UA 3UT5A 3EGDB 1VLLA 3WL4A 2AJCA 4MQ4A 3DWEX 5ALRA 2AN9A 2D2VA 2WSIA 2ZLBA 1SU6A 3G8CA 2OFPA 1DMRA 4GX5A 4IXWA 3EIQA 4FGLA 1NUPA 3IV6A 3FF4A 3OX1A 3ECAA 5FAXA 4FEGA 4NEQA 4NZYA 3KPWA 1ZXLA 4HQRA 3O1HB 4J0JA 3TTXA 5K8LA 1RVDA 4IF4A 1U2GA 1L4NA 5BWCA 1XKQA 2B9VA 3AL0C 1UC8A 1LPAB 4KN8A 5LBTA 1MX3A 2H2IA 3KSUA 2FQXA 2F62A 3HV0A 3FCCA 4RDIA 5C1BA 5CEEA 5C7OO 3T3NA 5ALEA 1W0KA 5CA1A 4OHFA 1UPCA 2BIFA 4DUZB 3K9NA 2H7CA 1T0PA 1UKAA 2I9PA 2EBFX 1W88B 2XE7A 4ND7A 5A05A 4CPDA 4ZCMA 3JW8A 4JI4B 3V3TA 1EK2A 5CHYA 3PGMA 2R7NA 4I81A 4DR6B 3QPWA 1EGMB 2H1WA 4RZ2A 3UMSA 3LH5A 3QX3A 3FVWA 1PRYA 2OHFA 4RC9A 3MUFA 3SQLA 1Q1GA 4M76B 4AKEA 1D4AA 4ZKDA 1A7UA 1Z5ZA 2AK3A 3TPZA 2PD4A 1KARA 5DP2A 3VJMA 1S1MA 3JD0A 3NRJA 4LDPA 5FPKA 1FVFA 2XX3A 3VKWA 3WIVA 1OI4A 2GAFA 4DR3B 4RNCA 3L7DA 4YAKA 3D8NA 3ZVRA 3RS3A 1LU9A 2GTPA 5THKA 4JLVA 1Z4KA 1G5RA 1TO6A 1TX4B 1TADA 4P7GA 5JJLA 3MMZA 4XYEA 1EFRA 1MB3A 3HJRA 5K6AA 1TB4A 3UK2A 1AZSC 3LCRA 1QLWA 2FGJA 1RCFA 3VI3B 2RH5A 3TM4A 4UXIA 4DNQA 2WV7A 5DJ5A 5LP1A 4B2YA 1Y8AA 2DFNA 2WG2A 4I08A 3OQ1A 4FYJA 4EUHA 1U7DA 3EVCA 4PAWA 3HDHA 5F12A 2BELA 2BOVA 2X42A 3AI2A 5DLYA 5DXJA 1D2AA 2LIVA 4DWJA 1MRSA 3RVPA 4ARBA 3PI6A 4RHTA 1XNRB 2HLDD 4B5KA 3ZU3A 4G37A 2RCNA 1NY5A 4ED9A 3ZI0A 2WTNA 2FI1A 3PRYA 4GWKA 1UMKA 3KKKA 2QLTA 1IN5A 4JT9A 3BTSA 4KPGA 4WJZA 2O5CA 1KJIA 4JB2A 4LE2A 5K2MA 4WFIA 4MWTA 5AI4A 2AN5A 2HHCA 3TWOA 2GCPA 4LXGA 4B82A 2WMDA 4D4MA 3HJUA 1CR6A 2VEDA 4QGFA 3K0SA 2R87A 5LNK1 4FCWA 2QF7A 2VWPA 5DRTA 5GIPE 3PSHA 4E5MA 4Y0AA 5HMLA 2NZYA 2H1HA 1PQPA 2PWYA 2V7TA 3EXFA 5KNLA 1G0OA 4JT2A 4TYNA 2FN9A 3QYPA 4X64B 3D5QA 2PUGA 4C6HA 1YL5A 2HCTA 2FKAA 4Y6RA 1Z0SA 4P58A 3Q9NA 2WUDA 2B1QA 2JHGA 4MS1A 4CEHA 3SYTA 4YB8A 1PR1A 1NLUA 2IZ5A 1F2TB 2KX7A 2ZSDA 1DAEA 2FPSA 2VSFA 3DVQX 3AZQA 3PKZA 3O8OB 3R5SA 4MRAA 4XVRA 4LGVA 4JGGA 2XLBA 2HIAA 5E2BA 2IEZA 2XUOA 1KDRA 2VCHA 1EVLA 3KEOA 5IJ0B 4H9GA 4AG6A 3DBRB 1CQWA 2REQB 3PXUA 1WSBA 1K7SN 3FSGD 3GD7A 3H97A 5CDFA 4GICA 4Q1FA 2QYOA 1FP1D 1V7QA 2MMCA 2X19A 5JALA 1YB4A 3SHTA 3WJ1A 3WRXA 5EWLA 5F1YA 3USCS 3A1VA 4GYYA 4Z4HA 1G3UA 3EIWA 4NIMA 3X1MA 5DM60 3LKBA 1TU0A 5ICGA 2ZT6A 4XYMA 4IVPA 3KV3O 1T9KA 4GZLA 1F6WA 2IDZA 4QELA 1Q0LA 1WEKA 1ZGAA 1VFPA 1JKXA 2VNHA 2V7EA 1N0WA 1V3UA 2ZT5A 3HCOA 3VZDA 5BN5B 3KC2A 1U1GA 1VI5A 1SHJA 2NV2B 2WR8A 4IVNA 4RK4A 1DCKA 1TAUA 5GOTA 4KGXA 1P7WA 1DT5A 1P5ZB 2G09A 3AOEA 1TT7A 4TKZA 5AIBA 4J3NA 4IDNA 3IEUA 3T0GA 1JPNA 2K7FA 3DG9A 2LKCA 4RHCA 1X8JA 9GPBA 3RC9A 2ZJAA 5JNUA 4ZP1A 1OH7A 3G88A 3L77A 3TTWA 2WF8A 1PFQA 4Y18A 3V4LA 2Q4BA 1GDDA 1JT2A 1LSUA 3P9PA 1PL8A 1H2BA 5AVOA 5I4BA 1EHIA 2R11A 1ZOSA 4CKBB 2P40A 3KDSE 5LWHA 2VXYA 5IJ9B 4QUAA 1WMDA 4KJXA 3OEED 4XOUA 4R71A 1CHDA 4DIKA 4INPA 3TRDA 5CX1A 5I5EA 3ZVMA 4FINA 3OKAA 2WIJA 1Z2OX 2B6HA 2NAPA 3ZYZA 1I6MA 4LCJA 4PN3A 4DJJA 1X42A 2E6KA 2XNDA 1MB2A 1Y1PA 5G1OA 3GF4A 3RC1A 3ANTA 4I3GA 4EI8A 1Q3KA 2FLWA 2VXOA 3T52A 1V5GA 3WGQA 5KI6A 1Z0FA 2REXB 1ND5A 3L49A 3L5OA 3WLMA 1R6VA 4E5SA 4F4FA 4HTAA 3ZD8A 3CN7A 4FOPA 3PA6A 3ZV7A 1J5XA 1WQ3A 4K9RA 3UAOA 3H1EA 3PHJA 4N40A 3SCZA 5FJJA 1YS9A 2RAUA 2ZBFA 2RJNA 3P5BA 4UCQA 1WU7A 1I6WA 3GAAA 3KD3A 4YFYA 5BSEA 3EPLA 2Z98A 3QV1A 2UZ1B 5A7FA 2FQWA 5G0VA 1BNCA 1JDTA 4QT4A 1R4MB 1YZLA 3FRJA 4ZCRA 4L4UA 1HDOA 2PRYA 2O8NA 1LA2A 1NV8A 3L0YA 3PUJA 4US1R 2ZJ2A 2BEWB 3A58B 3W1VA 3F6PA 4TS9A 2QLBA 2CLMB 1W1WA 3LC0A 3QWAA 2GFHA 5ITZA 4QVIA 3WSVA 1SNYA 4LZJA 1GDHA 1LDMA 1CQIA 1IULA 1LZLA 5AFSA 5JSZA 5J2TB 3B1FA 2C9YA 1ENZA 4BLPA 4N0PA 1WXQA 2QDKA 2YUTA 3QY0A 2ZYIA 3ROMA 3ER8A 2WTXA 5ERXA 3RTCA 2FPIA 2YH2A 3ZEIA 3LKZA 4F6RA 2LTAA 3D4IA 1B76A 3CRZA 1N75A 2BMJA 1CY7A 1DQSA 2MINA 3AJDA 4JU9A 4G0NA 1KAMA 4R8MA 5HGJA 3U4HA 4XAQA 3I0NA 3FPHA 1S02A 4MARA 3ZNNA 1TK9A 4QTXA 5ALLA 4A0RA 3LPNA 2OORA 1YTLA 3N8IA 5SY4A 4QUHA 4KOAA 3CM0A 1NNEA 1NVXQ 1G6OA 2I6FA 3DOOA 4L0MA 1QFZA 2D5IA 3CLSC 5JLAA 1JSXA 3L4BA 2PUJA 4OA5A 1TTTA 1G6HA 5DYNA 1CDEA 1T29A 1ZW1A 5PGMA 3KXLA 3MHPA 4E70A 3WL3A 3QPCA 3WC4A 4U2BA 1CZLA 3F6SA 4K81B 3A7DA 5B30A 4WNIA 1VJTA 5F4ZA 1OX6A 4E5NA 3AR2A 3PC2A 2PYIA 3KOUA 5DTRA 1UFRA 3I1YA 1XZDA 1UPTA 4N5LA 4U7WA 3BHJA 3CRVA 3GJ7A 3DFFA 4PR0A 4X84A 4DXAA 4HH0A 2XUJA 4KQJA 4R8SA 1Y5MA 2Y4NA 1F0KA 1R5BA 4FZ5A 2QL6A 1XTSA 1FNSA 1J4AA 3CYFA 3DLPX 3QPDA 5TF0A 3K2IA 3JQRA 1MG5A 3F1LA 2ZUVA 3ZCQA 1PD0A 1JEDA 3RUHA 3LLMA 3VAYA 1ZI9A 3ELWA 3BGVA 3FGZA 2IU0A 2CT8A 5FA5A 3F47A 3VHRA 5FFMA 2SNIE 4JKYA 5ADHA 3O82A 4M9SA 5CM9C 1QH9A 5BRNA 4BNYA 1E6LA 2XTMA 1GPDG 4CKWB 5FBQB 3TLMA 3PTAA 1QGAA 2QTGA 2YS7A 1X7ZA 5B6JA 4H2DA 5LKRA 4G0QA 2XITA 3G5LA 4YT5A 1JHAA 3SNKA 5K6TA 1BH6A 2BGKA 1QKJA 4Y8VA 3R7AA 3E18A 5T6MA 3CY6A 4ZT7A 1JBQA 2X0KA 5JWRA 1YDEA 4QHTA 5KX5F 2QRQA 1QGYA 1WDWB 1RKVA 4MV1A 2CB9A 2DE0X 2TYSB 2YWJA 5B1DA 4A15A 3I6IA 2ZWAA 1SBYA 4AAYA 3VU8A 1AV6A 4PBRA 3HXOA 1LTKA 4FZ3A 3UMFA 1KVTA 1TUBB 4QOHA 2XPCA 4UC0A 1PVDA 1G64A 1HF3A 1XCLA 4OG2A 3ZHCA 4A92A 5BW5A 2DTXA 4TKVA 1NMQA 3HSYA 1ZK1A 1C0PA 3I5UA 2NSHA 2ZCVA 2HK9A 3PGXA 2EZ4A 1JMYA 3VUFA 1W4LA 1CQPA 5B6PA 1X7WA 5JSKA 1PK8A 1ISFA 2ZCUA 2DAPA 3AERA 1C0LA 4HWGA 4YH1A 3QUBA 3M4YA 4EMTA 2WHPB 5EESA 2WAXA 1OFHA 3I2YX 4M0CA 1NT4A 2PX5A 2FSVC 1SKYE 4HNGA 1GRNA 4N0QA 3TAHA 3WYNA 3O83A 1TJPB 3PDIB 1D7AA 2PL5A 1W0KD 1S3FA 2BGRA 1JEAA 1B2LA 2XYPA 1IPEA 3M3HA 4A8JC 4TMKA 3H9UA 3VX3A 5E1MA 3SDSA 1BE8A 1WPQA 5FUWA 5K4HA 3GLKA 2WM3A 2H4ZA 5FP0A 5EIBC 1C1XB 1A8QA 4NNOA 4RY2A 3TXXA 1RTTA 4RJKA 4PVCA 1Q6ZA 4LYFA 4ER7A 1CJMA 4PPYA 3VUEA 5ABPA 3RCBA 1PFKA 1Z4IA 4IDHA 3SC6A 2YIJA 1I0IA 1ESNA 1NUAA 3UN1A 2QS9A 4NCJA 4RADA 5D3MB 2WIKA 2O0JA 4JOSA 2I4TA 1FPMA 5A4AA 5B2ZA 4EZEA 4QTZA 5BSRA 1GRVA 4ITVA 2E4UA 4H7JA 4WZAE 2I1WA 1AM4D 4FUQA 1NVVQ 2ZXEA 3L4KA 4NU5A 4AKTA 4ZTZB 4HRXA 4MDHA 3ZI4A 5B4VA 3F49S 4I19A 2H00A 3RK4A 4PHGA 3TIIA 4EHAA 4QX6A 1W88A 1IH8A 1TA0A 4KGVA 4M7OA 5JXGA 4MKRA 5K4GA 1T34A 3C3CA 4NV3A 2YV3A 3K0KA 3H4IA 5GY7A 2J87A 1CSEE 3BSFA 2E18A 2R8BA 3HL0A 4J07A 4UZFA 4CM1A 4BO4A 3K7EA 1KYVA 1Q1BA 3RRNA 4LF7B 1UF9A 3HNOA 4HH3C 3P2OA 4RQTA 1A4RA 2Q5CA 1P4AA 4A5OA 4BEBA 3U19A 4MUMA 4DBLE 1XLVA 3TIFA 2WVAA 1YCDA 1J8QA 3THSA 2PZEA 2J9ZB 1YQGA 2YIDA 1NOIA 1BFUA 2F3SA 1SEVA 2ODBA 3FTFA 3N5KA 1YAJA 1K27A 2OCGA 1PJRA 3PQDA 2VQDA 4D45A 5E2AA 5HZHA 4QFMA 2ZAMA 3A6PC 3KOMA 4HG2A 1DV2A 2PZBA 5DBGA 3KQYA 4ZAGA 1TCBA 2PO5A 4FYWA 5GP1A 4YNBA 2OMKA 4F60A 4G9BA 1BMFA 3GQVA 1W47A 2VHZA 3RGWS 1VL1A 1DRJA 3R41A 1G6KA 1IC6A 2ZIWB 1UQUA 2JGRA 2GJ9A 3GGSA 2B30A 3G2NA 3RTDA 3M6FA 3S68A 2P4SA 3CRMA 3G7UA 4WLEA 5F7ZA 2AN3A 3HXQA 1S96A 2ANBA 4ANFA 1COZA 1E9FA 1H2WA 2N0SA 2PRIA 2R6ZA 3D4OA 3QKRA 3QUTA 1Y3FE 4HJRA 5I01A 1M34A 3PEUA 1NN5A 2MSLA 5KNDD 4JKIA 4QU9A 1IK6A 1AF4A 1KYXA 4YCDA 5FNVF 3BIXA 3LLSA 2Y05A 2RAFA 1NPYA 4CQLB 4F1WA 5H83A 1HI9A 2FGKA 1F4VA 4LJ7A 4N54A 1L8QA 1N5OX 3D6NB 4X44A 4FNGA 4ZD6A 2EP8A 2GAAA 2AZTA 2HF8A 1EFKA 3A9TA 1L5MA 1JDBB 1LBHA 1VRCA 3F3MA 3IKLA 1KZ6A 4PRZA 3P9KA 3GBVA 4BLVA 1ZUNB 4DXDA 3TNDA 2FLKA 4FCCA 3UH0A 3DBHA 1PDVA 1NW5A 2EGUA 2P5YA 1LV7A 3PHBE 1ORDA 4BMCA 1XTRA 3O8RA 4EHDA 3I34X 1X80B 2A1UA 2B5VA 2W98A 2FH5B 1A2KC 3AC0A 3I2IA 4PQEA 3AF2A 1L6IA 1OWNA 3NWOA 7MHTA 2B5WA 4FFBB 1EUYA 2VHQA 2ZP1A 2E4XA 2OWDA 2QRKA 3LX8A 1I7DA 3BCRA 1YDFA 8MHTA 4RK7A 4BV2A 1TQDA 3D5TA 3HS3A 1CR2A 3TW4A 3NIWA 1GNTA 1W44A 4PY2A 2DBYA 4IDDA 4NNPA 2CMDA 3ZV3A 1M66A 2EW1A 5DX0A 3ZWPA 4N03A 4LJ6A 1F2DA 1WZUA 5AVTA 3GXBA 4R9SA 3NDPA 4UUPA 5DIFA 1IBRA 1NHGA 4ZRNA 3S3TA 2E21A 1ZI8A 3DE3X 2O2YA 4JP8A 5JI2E 4J03A 3HHPA 4KLAA 1GPAA 2P2GA 1WV0A 2B4RO 1V1RA 1V9CA 3DZCA 3GEDA 3KR1A 3MRTA 5BRAA 2NO5A 5AW2A 5KO2A 1TJYA 3P0RA 2JFBA 2QTWB 4N8DA 3DCYA 4NF2A 5KYWA 1JU9A 3W4IA 1RWBA 1IHYA 1WD7A 2FSVA 2VBFA 3MWDA 4XM1A 1GFIA 1R8JA 2OCPA 2QWXA 2WD7A 3LYHA 1YB7A 4DGSA 4MYCA 5LCXA 1KZHA 2A5DA 1SIWA 1QH8A 3NR2A 3BJIC 1UMDB 5TIIA 2ZB4A 3EZ7A 2G25A 3SPXA 4BJ6A 3O8CA 1M72A 2O5RA 1LBSA 5I7EA 3TCXB 1FSFA 3QF7A 3I42A 1L8XA 3E4DA 3MNFA 4PSUA 5ALMA 1CF4A 1JYEA 1W25A 3LQFA 4NEHB 2PDAA 5ISMA 4P93A 4CL2A 2BSAA 3LUBA 4CMCA 5CDUA 1R0SA 2QTLA 4NCKA 1T5SA 4HX2A 1QMPA 1RZ3A 3EA5A 4ND1A 1OYVA 2C5AA 2CLOB 2IXTA 3EEBA 1NTOA 5EC8A 1UFQA 3O4RA 5U4QA 1O7JA 1E9BA 4PLGA 4C20A 4V0LA 1J20A 4P5DA 2JGDA 2Y2VA 1EWQA 4R5HA 3IQFA 2P2YA 4KN5A 4ZEOA 2UUCB 1EX6A 4JLWA 3CZ9A 3RPEA 1SVUA 3NTVA 2EQAA 4DCMA 4C7KA 2X3UA 1OX4A 2DTEA 3C24A 5D7NA 5LVAA 1WY5A 4YAWA 3IVGA 2VRWA 1MV8A 3QE0A 4KR6A 4M7WA 1UM8A 2BZ1A 3V2UA 4C1NA 1XCGB 1L1EA 3E7DA 1OH8A 2QD4A 4M9RA 2REBA 3O2NA 4KDFA 1OLXB 2QSJA 2XWJI 5E8JA 5EL0A 4GZ6A 3C3DA 2VYQA 4L1KA 2YMPA 3TI9A 4WLUA 3HYNA 3DR3A 4QXPA 1E4YA 4Q21A 4L8WB 3EB9A 4A8TA 1RP1A 2CDNA 2FN3A 2JEZA 1HNWB 3AR6A 2W6PA 3PNQA 3VNRA 3AHEA 3FTEA 1KVQA 5JSZB 2QMYA 3BXFA 4N12A 3VU0A 2HN9A 2ASVA 1LK7A 1OI3A 3BH7A 2F43A 4Z9BA 1QX3A 3G17A 5FJIA 3IA2A 1T13A 3CJTA 2WB4A 3LLCA 4EPWA 4E22A 2H5JA 1N6IA 3CEHA 3A9VA 3N6XA 4RGYA 5D6NA 3I6YA 3JZFA 4R41A 4II7A 1XCPA 4Q9JA 4B7UA 4CKEB 1EYZA 2FE4A 3KAJA 2B78A 4W5TA 3KQHA 4DQUA 4JQZA 1LNSA 4IR7A 4BLSA 2OQVA 4K9QA 1GT91 4OLBA 4H4EA 1ZX1A 2VLIA 5BW4A 5AM3A 5FNZA 5LA6B 1Z0JA 2PJDA 2QM8A 4W4TA 4AUKA 3AHIA 4X8LA 4TZ6A 1ML3A 1GZVA 1DQPA 2Q49A 4DY6A 1NBOA 3RREA 1ZN2A 3WNCA 3B6JA 1UMCA 2ZJ8A 1Y81A 2CLLB 5CURA 4GX2A 5U1PA 2QRLA 2D54A 3F9RA 4HNUA 2C78A 3W1EA 4BNMA 2ORWA 2IYAA 1AB6A 4MWDA 2I2WA 2CJWA 5KNCH 5KYUB 4Y9UA 3X1DA 3THXA 4N6OA 3B1VA 4NMMA 1JECA 1VG9B 4B6GA 3QSYA 2HU8A 3MWKA 4BVBA 2V6JA 1EGQA 5A5FA 4IIEA 3LQ1A 3EVZA 3FYTA 3GDHA 5DNCA 2AW3A 2R84A 5LZ7A 5K2OA 4R1LA 3LGXA 4FT4A 1I36A 4JYCA 4MCIA 2Y3IA 4YFVA 5KAMA 4CIAA 4LS3A 1RBQA 5EP3A 3SSAA 1VIYA 4L0QA 3IEIA 2JVIA 1IQRA 1KEVA 1WRBA 5KWVA 1V47A 1LK0A 3DZFA 5KNBH 2IPLA 4GS5A 3ES9A 3WWPA 2B61A 1HEYA 3WI7A 4M0UA 1Z68A 3O4GA 5CRIA 4XVUA 1WU8A 2NOAA 2ZDQA 3I04M 5JYBA 1SZJG 3AUKA 4Q3LA 5A3VA 3DE0X 2D3TA 3ERCA 1P7YA 2WNHA 3DEIA 3PYLA 3LG2A 3V4PB 5FT9A 4G25A 3FI0A 4WK4B 3OOSA 1U0TA 3P1JA 2XCIA 4B40A 1R66A 2VAWA 5C7IO 1QYRA 1U8TA 3EA0A 1HUQA 5AQ1A 3SZRA 8ADHA 1FLAA 4PX9A 2YUIA 3IIIA 1X94A 2GYUA 2PKWA 1W5AA 2MOKA 4HB2A 1FFSA 3SJCA 3ZWOA 3MGBA 2YZ7A 3EUEA 1R16A 1ZW6A 5IAAA 2BR3A 5KINB 4OKIA 2QD3A 3TTUA 1L7RA 5KTTA 4D92A 2JAWA 2AOWA 2GUWA 1FJHA 2B1IA 1DG3A 2CNWA 3DDOA 4KXMA 4MLDA 4WKOA 4BX2A 2CZQA 1QV7A 1JNXX 3BSSA 3V97A 2QYTA 4CUZA 2AE1A 4AMUA 4AJKA 1UOEA 4CDMA 1EHCA 1AGRA 1Z6TA 2I7TA 1G4AE 4R1UA 4NQRA 3NNSA 2VZEA 2NZ8A 1SPBS 3FDZB 2GN0A 1GXSB 3A9WA 2F9LA 2D1QA 4KDRA 5LQCA 1H2ZA 1H85A 4BBZA 1YVRA 2BFNA 5DEIA 1KK2A 1IBLB 3F97A 1WNTA 2ZIFA 3KX2A 2ZJ3A 1NONA 4BMPB 1ODIA 2ATXA 2A86A 2EBWA 4MXDA 1N7JA 4DCSA 2O20A 4Y1EA 1NI4A 1WWKA 1P1RA 1C2TA 4HNAB 5AHWA 3UHJA 4AY5A 1BW9A 4HVTA 2GAIA 1XMXA 2PRSA 5KOHA 2Z9CA 3U49A 5HX7A 1NI5A 1SBCA 3QUQA 4QL3A 1JMVA 3RF7A 4CLRB 1Z47A 3FWKA 4YCAA 5H4GA 2FKNA 5C37A 4U39A 1RIIA 4GLFA 4D82A 5K45A 3TB4A 3DAFA 2BZGA 1L5YA 3SYNA 3WV5A 3WSTA 1G66A 3E48A 1Y7IA 4P4LA 4V3BA 4EHJA 3AHHA 3ZZTA 1WOYA 2GZSA 1Q3TA 1GZ6A 3IUSA 1F8GA 2GFIA 1KI1A 2IP2A 3P2IA 4EY3A 5KX5B 3QTLA 4FEAA 1PJCA 3HC7A 2C92A 5KHAA 1T2NA 2HIGA 1V7ZA 1MNAA 5BYBA 2GJSA 3DBOB 1KFJB 4IFBA 2A3RA 2VJDA 2WU3A 1DOZA 3F2VA 1S9DA 4GOKA 4I6JA 2G6BA 3BMCB 4FYMA 1I1NA 3R3ZA 4QULA 1NURA 2DC1A 121PA 1ORVA 2WK1A 1KIFA 3P0JA 3A6LA 4K6FA 4PICA 2GJKA 3LLVA 1YSCA 3OT5A 2QQ0A 1I6LA 2Y71A 4ZJYA 3GOQA 4DEXA 1JQAA 5DM2A 3WLRA 4UM9B 1DAOA 1WUHS 5CG1A 3NWBA 5MFZA 2DPGA 2X5XA 4DMMA 1BCSB 1OASA 4MLPA 2AFHA 3EMDA 4TPKA 4WNAB 1YI0A 2VHVA 2CSXA 3DE5X 4RYDA 4DS3A 4L7VA 3UGJA 2I6QA 1QIGA 2CYCA 3DQQA 1W7AA 1PSWA 3EUWA 1CWUA 3TE7A 2GA9A 5FWXA 521PA 4BQSA 1M2JA 3KEMA 4D4HA 1S2NA 2IY7A 3NNNA 1H9AA 1U8UA 2ORYA 2H1RA 4LY3A 1LWOA 4B9EA 3FKSA 1QDLB 3L0IB 4U00A 4ASUA 4URXR 3G2LA 2Q6KA 5D01A 1GNPA 3B8HA 4HNSA 3DD5A 3EAFA 2BBTA 1MOZA 4KREA 3FZEA 3L6UA 5H5JA 2RSLA 2DPYA 1VQ1A 1PD1A 4MIYA 5DLPA 2RGWA 4F72A 4LBZA 1JYSA 1TOAA 2WQ7A 1FMCA 2H5IA 4D8WA 4ER3A 4F38A 2OZPA 1N1MA 1ZUNA 5BUQA 2A57A 1W8DA 4G1BA 3MIIA 4Z7OB 1IUKA 2OP0A 3BK1A 3V4OA 5BSKA 1JR2A 2YQZA 4BMOB 5BXQC 4JC5A 5TMEA 2C4NA 1BRMA 1KOFA 4B6QA 5JAOA 5TS2A 2DR3A 1SWVA 1BMTA 3A37A 4INJA 3ZU5A 5KKNB 1MV5A 3IAM6 5TPZD 3EJ6A 1KO1A 4H3VA 2XQJA 1XVLA 3NVDA 2P77A 3F96A 1IATA 3R0VA 4UHHA 3TX2A 3TBFA 1IAQA 4NOLA 5AJWA 2ODWA 2ZRBA 4EY5A 1CX9B 4LOKA 5KNCA 1RI5A 3MT9A 3TTYA 4RKEA 3IAAA 1VKJA 1KS9A 2NQTA 3R24A 3ZQJA 5IDXA 3KR2A 1YU9A 2ODEA 2ZE5A 2OESA 1RPAA 2ZYVX 3ELDA 3GFVA 3VO9A 2HBRA 1GTJ1 4JVMA 2NSJA 2ES4A 3A4MA 4NOKA 3NTUA 1HDCA 5EHQA 1P9WA 3C85A 5F5XA 5B57C 2VR1A 3OZBA 2GVNA 5BQ3A 5L3VA 2ZROA 4DLYA 5BNWA 2B4AA 1SU7A 4FONA 1FFGA 5B3AA 2O7QA 5CB4B 4QYWA 3COPA 4FXPA 3DHVA 3QKIA 2BSXA 3GEHA 1GCUA 1PGQA 4JB0A 2JFHA 5BQOA 2X0EA 1FNCA 3C1UA 4J91A 1M0WA 3L8DA 3F6RA 1OFGA 2BR4A 3CLUC 1LW6E 1ZM9A 2P5SA 1GQFA 1PSDA 3LYAA 3V7NA 5EMKA 1R4AA 2YRXA 2YW9A 3L0DA 2GK7A 3F3SA 4GW3A 2C8VA 2AC4A 4ID3A 1UEIA 2HU5A 4KBFA 2H08A 4HF7A 1ATIA 2HHAA 3BMOA 4OJYA 4BUCA 4S0XA 4X0EA 3T3HA 2IPOA 4QRHA 2Q2QA 3LT2A 3ZY5A 3ND7A 4EW1A 1NF8A 2AEEA 3FPGA 4B4OA 2QXTA 3HXKA 1QH1A 3GJ6A 3L4SO 4HQNA 5IUKC 1NBEA 1GILA 1IOVA 1P1KA 2C2XA 2GGSA 5BY2A 3R8FA 2VHTA 1VGQA 4M0PA 2ZTUA 4PAQA 4FR5A 3L04A 4DUYB 3EGIA 3DFMA 4ITRC 3KLPX 4QBKA 3HKDA 5CT4A 4BP3A 3LXRA 1JFTA 5I4IA 4L5IA 4PG4A 3NAGA 4GLOA 3U81A 3TOSA 3E3AA 4W9RA 5CG2A 4HGRA 3TZCA 1G7SA 4ECEA 2V9CA 3EVDA 4IMPA 4WI1A 1UXGA 3AR8A 4LGMA 1AB5A 3VYWA 2EJCA 1GL3A 1J22A 1UBCA 1XRQA 2O1SA 3FPFA 4XDHA 3ROKA 3WGIA 1C7JA 1CIJA 1CLUA 3JQ7A 3JQAB 3U7QA 3V4RA 3BJEA 3FPCA 1S2MA 4A82A 1JFRA 3AQIA 1CPYA 4NE9A 4EJFA 3T7IA 3C6YA 3M4JA 3SJZA 3AUTA 3WDMA 3ILVA 1W5SA 2XQFA 1IBMB 4EG1A 2GPTA 2ZSIA 3O8QB 3JAWA 2BEKA 1IOLA 3AVOA 3GFQA 1S8FA 3X0DA 1LQTA 1EM8B 2P6MA 5K8VA 4HUQA 2PZGA 3LW7A 4JQOA 4OP2A 3WLKX 1E99A 4FLEA 2GBIA 4TN5A 4OMDA 4GAEA 4R31A 3GNTA 4N6GA 1UMBB 1ZGHA 1ECLA 5SYNA 3ZY4A 3AHGA 3OTOB 2ZBGA 3T9CA 3KSBC 3ZE6A 2P78A 3RANA 4C7MA 4F21A 5FI5A 3VGPA 2QTNA 4URFA 4QFCA 4FKZA 2CVOA 4LY6A 1HKUA 1V1RB 3O84A 3RT9A 4EB8A 1SCAA 1OWOA 3RWOA 1G8KA 4ZCLA 2J5XA 3WB2A 5KEIA 5ELXA 1O95D 3PT9A 5DM0A 4BC1A 2XA1A 1E3MA 3B13B 2JFFA 1OCEA 4BKOA 2WT9A 3PHLA 5EP2A 3ROQA 2CMGA 3PZRA 4HGQA 4HGPA 1BFDA 4MV7A 1W73A 3DGEC 3JQCA 1A9QA 4OHKA 5HIAA 5C4MA 3MWEB 5DO9A 2PYZA 1UPFA 2GD6A 4JFAA 2J30A 2PT9A 4ZT4A 4G89A 4HY3A 2QK4A 4PAGA 1NJ8A 1C3OA 1MW9X 5BUCA 4XEHA 2VUIB 2YQ5A 4FEEA 5DULA 2PUWA 4ZQBA 1SVLA 1CUSA 1Y1QA 3E4CA 4GSLA 3CWQA 4TLEA 4Y9SA 3KKZA 4YMLA 2IYFA 4Q3EA 4HAVA 2B4KA 2DMRA 5ALUA 3KHTA 3IT3A 4L28A 1PYDA 6ADHA 4IDPA 2VTKA 3ONFA 3HUUA 1KBZA 4FFDA 3AVVA 3C7CB 1KI2A 4NU0A 3X1YA 4XJTA 3NWJA 5EYPA 5EQJB 2NTJA 2J41A 3L1VA 2IY8A 5HMMA 1BKYA 2Z8XA 1KYIA 2H48A 1W5FA 2IYLD 1YHNA 3R5FA 5LZ4A 4O0MA 2I3GA 3L0ZA 4FZRA 1TJNA 2FZGA 3W2IA 2HM7A 1I4WA 1RCUA 3PWTA 4LYGA 2DUWA 2YMQA 4A91A 4AJJA 1M1XB 4FJ0A 4YRBA 2GKSA 4KR7A 2XKJE 1OX4B 3PFHA 3P9QA 3ESZA 4YCMA 1DAHA 3D2CA 4FDVA 3RFFA 4I0WB 3TH5A 3V46A 3E22A 1A7KA 4OLJA 3VYVA 4YECA 4GOJA 4AWBA 3U09A 2PUCA 3GGCA 1TDJA 4ZEMA 1MB0A 2OCDA 4NDNE 1Q22A 2V3CC 3V1TC 4L2IB 2QVZX 1S01A 1D5WA 2YRFA 4KGZA 1DC5A 3WQRA 2H1IA 3E27A 2GNPA 3PFWO 1PLKA 1Y8RB 1ONNA 1SUCA 4UFPA 3MK31 5F35A 3HJBA 5AW4A 1HYQA 2E55A 2MINB 2FW7A 3BIWA 1CP3A 2X5KO 1EK6A 4H7IA 4KLCA 4XE5A 4NBKA 4OXNA 5BWLA 4BPBA 1UAAA 4G1EB 3L9XA 5EMNA 1EX9A 2PH1A 3DW1X 2WF9A 4YQZA 5CYGA 1Y7TA 2FRXA 3KPJA 3WB0A 1E2BA 1USWA 1FY2A 1EJ6A 1XTBA 5CH8A 1P9OA 4QBFA 5JDIC 3F5MA 3T1HB 1ZIYA 2C8KA 3DUWA 1HFJA 4KO2S 1E2KA 3DB1A 5C1IA 1A4IA 1HH4A 4R8LA 2JLUA 2BPOA 4B3FX 2IOFK 1SBTA 3PEEA 1ZA2A 4MTCA 3TS1A 1I4TD 2HIMA 2PJRA 1SAYA 1UADA 2O2XA 5CNJA 4LC9A 1L7VC 1SB9A 2OTCA 3LY9A 1BW9B 4O2BA 1HE2A 1GPKA 5BWNA 2ZXUA 3LAWA 4GFDA 3ZGOA 4F8YA 4R0MA 2FG5A 4UE3S 4KFUA 3VPXA 2R44A 4YAJA 4EUNA 2XYQA 2VJKA 5LQAA 4ARAA 1E2UA 2C1EA 3Q7IA 1QGDA 3G5TA 3WNBA 2AI2A 3U9LA 3H86A 1Y48E 4QASA 3KQVA 3KS9A 2XCRB 4RJTA 2PLFA 1Z8DA 2XCLA 1MO3A 2XWSA 5CCXA 2DUNA 4BVLA 4CR6A 3B1JA 2AFIE 1KPHA 4E5YA 5KTPA 2JCYA 1DEXA 4IFEA 1W49A 1Z45A 2Y6UA 1BU5A 2HGZA 3X3HA 1TM3E 5HJEA 1K63A 3NKFA 2W0SA 5JZBA 1F3LA 1UBKS 1CY0A 1XALA 1Y3DE 4Q4DA 3L7IA 4GDMA 2UVDA 3EWNA 3MTGA 4Q7EA 2KYRA 5DE3A 3SEFA 3TLBA 2GXSA 1QHHA 1RLJA 2IYQA 2QVCA 4MRMB 4BE7B 4UBJA 4FBGA 3OZUA 1P19A 4I2VA 3MB8A 3OD5A 1PJZA 2ZJYA 4MVJG 5CPFA 4EHIA 4MUAA 2PQ6A 1I1QB 5B5SA 2MHCA 4TLCA 1ZIDA 3ZGZA 4DARA 1JH8A 1UJNA 1LLCA 2Q5LA 2OD2A 2B3DA 2H7XA 2HPZA 2VJYA 2XMQA 1HTTA 1O8CA 2Y1EA 4PHFA 4YI3A 5BT9A 2ZVPX 3VVCA 1PEAA 5JRZA 1S2DA 3NKLA 3TECE 2Y1WA 1II9A 2B8EA 2HMVA 1NKTA 4CF5A 3LBFA 5KMGA 2JFXA 1JIJA 3GLHA 2IPNA 3ZDZB 3U7EB 3TLJA 1VL0A 5HJ5A 1JIQA 2ORIA 5GOZA 1T4CB 2QW0X 1J24A 1UQRA 2XMSA 3LUFA 4M9ZA 4ZVTA 2G76A 3WB1A 2EARA 2GESA 3LNTA 5CXQA 2Y4OA 5EJFA 3AEZA 4TMVA 2PU5A 3AVWA 4AG3A 5DM4A 3BN3A 2YFHA 1Z88A 4H6WA 1I3LA 4AQDA 2EBUA 1QYVA 3HDQA 5DLDA 1X70A 1SVIA 4IIDA 4QC2A 5LZ5A 2EFCB 1EGAA 2GQ0A 1C7QA 4KWHA 2RFLA 4BZWA 4NKRA 4AN1A 1QAOA 1YOVB 3KSDO 3UUWA 3U7HB 1ISHA 1EFVA 2P41A 3AILA 4XD7A 2PNJA 5BNZA 1BJTA 1YXMA 2HX1A 2RC6A 1XYGA 2F67A 2NT3A 3SHOA 1UK8A 1ID8A 4YJ2B 5G3YA 1YRLA 4RV9A 2R48A 3RU7A 1Z74A 2QJWA 4TTIA 4ZJZA 3Q9SA 3K70C 4NHEA 2IBSA 3B6IA 1M6EX 3K0BA 4YO8A 4DWVA 2P1RA 3FETA 1UZUA 4Q01A 4C6TB 3JD3A 4ENUA 3O4JA 3OLVA 1JRLA 1REQB 6CHYA 1VIVA 1JLMA 1U2RA 2OV1A 4M36A 1UJ5A 5BYKA 3EC1A 1E1MA 3I64A 4KG7A 4BNUA 3NEPX 2P7HA 3P4XA 1YS6A 4TQAA 4WFQA 3JVIA 3JQ7B 3ZLJA 3PUXA 1E0SA 4TL6A 3HB7A 4J90A 3H84A 5K1ZA 4LJRA 5EPUA 1JR6A 1FYEA 1PNOA 1T3SA 3VR1A 2Y0BA 3O8QA 4E14A 3P7MA 4EFKA 5JLJA 4RVDA 3THWA 1YZUA 4F5ZA 4ZVOA 2I5PO 4IMJB 3NKVA 4OX9Y 2P0AA 1JZQA 3JQGB 1DIAA 2GMWA 4ZAWA 1E66A 4XM0A 2QZ4A 4XARA 4ZVKA 5LKAA 2YMMA 4EJ0A 1NXTA 1BHSA 3QA3E 4JASB 1MH9A 2FOXA 2NW6A 4AK9A 3TQQA 1CS0B 1GQRA 2QTVA 4RANA 2VT6A 2WWVD 1LI5A 4TXLA 1JJFA 3SVTA 2R8OA 4IUCS 4O2AA 4L3WA 2WAAA 3AFNA 3QP9A 4RCZA 1VTKA 2JLAA 1BO6A 1SULA 2Q1SA 4UKDA 3EPPA 2X9VA 5KKAA 4AJ4A 4BO6A 2COUA 3T95A 1KSJA 3IHWA 1YR1A 1SO8A 3FLBA 3OA2A 1Q0TA 1UCFA 3DKPA 3PDUA 1VMKA 3G2HA 2BSQA 2WMYA 2H54A 3SOPA 3WK9A 1MHPA 2J48A 2V1XA 4OP1A 2ZR9A 4TT3A 3FRIA 3UENA 1G2OA 4CQLA 5B55A 2VJLA 4KMRA 4M0DA 2NVBA 5CCBA 3ELUA 4IF6A 4OHPA 1XELA 3GG2A 5DWVA 4QEKA 3QF4B 5HIIA 2D0PB 2X15A 1Q19A 2I8AA 1XMIA 3K2BA 3K1AA 3KYJB 4IKOA 4LQCA 3SMQA 4POAA 4K88A 2NUAB 1SEPA 4NBLA 1T9CA 1Q74A 4KQKA 1A96A 1XRRA 4N3GA 1NQVA 4NL4H 3TOZA 4PRLA 4MUIA 3RSGA 5BSUA 4BAUA 4DLNA 2OENG 2WWWA 1RJFA 5EXPA 3QW2A 4HMOA 5DNYB 2RHJA 4H7EA 1XZLA 5IK2A 3I01M 1U28A 5CU7A 4AECA 1WF3A 4O8CA 4V0QA 1KR2A 2RCYA 4U9HS 5H3CA 3CLHA 3AEYA 2AD1A 3OSUA 4OREX 3UAZA 3L4BC 4JU8A 4WZBE 3UFXB 4XIJA 3N07A 3A3NA 4IEFB 4HPJB 3AUYA 1V8BA 1JE1A 3BXEA 1TD9A 1N3LA 1U2ZA 5DKFA 3V1KA 5KOJB 4KK4A 3FUWA 1DTEA 2J5QA 1U94A 1U6KA 2B3TA 2PAFA 2R4QA 3CLRD 1I9CA 3IEKA 4L4RA 3NFRA 5CVTA 2BFOA 2ZEJA 2CXTA 4RMJA 1X7YA 4PYJA 1FB5A 2PD6A 4KITB 3SZ3A 2IEAA 2QA5A 4NBTA 3FF1A 3KLMX 2D8MA 4INOA 3CVWA 4C6SA 3ZDFA 4HQ0A 3BXOA 3QA9A 5KYWB 5ERGB 3SLRA 2BF7A 1LGYA 2Q3MA 4FW8A 4XUEA 5AD1A 2FMHA 5B4UA 2IHZA 1K92A 4ONEA 2WWYA 3K94A 1IXZA 4MVJE 3RLFA 3RVOA 1SXJC 2CZCA 3RVNA 2BGIA 3DSRA 3L40A 5BV1A 3WKDA 4RTSA 1QRTA 4H7PA 4KZKA 5F9MA 1XU7A 4MEBA 1ZMBA 1US8B 4NABA 4KRXA 1N2EA 3KUKA 3P96A 4WTOA 2MTBA 1U0HC 1GU1A 1NXXA 4K1XA 4M1KA 4OMUA 4UHFA 5FIUA 2CCJA 3BXZA 3OJXA 2IS4A 1NMEA 4ZAFA 1K3UB 5KTRA 2HLHA 3HGQA 5BUZA 4BO2A 1T5DX 3TEMA 2X0JA 3RU2A 1I5EA 3FHLA 5K0SA 1ISMA 2AD5A 3MJSA 2ZI3A 3L0CA 1P72A 4PLHA 1E1RA 1REQA 3K15A 1UDCA 4MYDA 4W63A 3W5UA 1LPPA 1C80A 2F3RA 3QNWA 2Y1KA 4ENRA 1OWLA 1XP5A 2Z1DA 4FGSA 1DG1G 2JVKA 4N0MA 1L3BA 5JD5A 4K0KB 3KEQA 3ZU6A 2B5OA 5DHAA 1EJ0A 1AQJA 4Z6KA 2AX3A 3DLBA 2Z08A 3AW9A 1ZYUA 3SBXA 1CJTC 4C0QC 4TZTA 5ER6A 2PUAA 2RONA 3JYOA 4KN6A 2Q6LA 5K0FA 1S9HA 4BNKA 2WMOB 2Z2XA 1A9TA 3QX8A 5AOCA 1NZFA 1SKQA 5HM6A 3M3DA 1TQ2A 3WGZA 2WY2D 5A3QA 2G67A 3EH2A 1R0WA 2HSEA 1D0VA 3G5MA 3I09A 1CEXA 3S99A 3SF8A 1IAVA 3MGCA 4ER6A 3ZVKA 4PM4A 1XZ8A 1KXJA 4DSOA 1JE0A 1T0IA 2RHHA 3EN0A 3K9WA 3NDIA 1XN4A 1QKKA 4JK3A 4ZXPA 2OV2A 2I4LA 1ESMA 3THRA 1KSFX 2XRZA 3UOWA 1ELOA 4GI5A 4INZA 4YAIA 5J1SB 5HBRA 1YDGA 3QVJA 1C0IA 1ODCA 1QFXA 1V3TA 2FW6A 4UEQA 1J2JA 3ZHZA 4V0SA 3NUQA 1Z37A 1B7GO 3FUXA 4J0DA 4OUDA 3VTKA 4JUDX 2ZVJA 5IBQA 4DV7B 2WF6A 1XQ6A 2WOOA 3EVNA 4BFZA 4EAQA 4NOMA 4QODA 1XPUA 2CBGA 5CVEA 1CDOA 1Q0UA 2W6MA 5H9WA 4RJIA 5LLDA 2HPAA 4J0CA 1T10A 4LC0A 3WYFA 3N39C 1C7EA 5K3CA 3SF0A 3VR5H 4A36A 1C0EA 3RT1A 1F6BA 2O4CA 3GBPA 4X20A 4PO9A 3FVVA 2X13A 4BJ1A 4RULA 2JFWA 3B78A 1UBGA 3QNMA 1U2PA 1VDZA 1GG2A 4K6MA 3AYZB 2QN2A 4K46A 1P2BA 3EZLA 4OM7A 1YZHA 4I4IA 1E7YA 1F2UB 2BMVA 2GPNA 4IQFA 2JGKA 3LP8A 2BP7A 3Q2KA 2A9FA 3ZKWA 1QBKC 1TAQA 1MDBA 4KQ9A 1J1ZA 3STUA 1RAIA 4B0PA 4LCBA 1KI7A 2Z56A 3TXYA 1A9ZA 1II8B 2AL7A 4GSYA 1F5SA 4MULA 4J2HA 4KPYA 2H07A 2YRWA 8GPBA 3R77A 2WIBA 5JCPA 1TU3A 5ALOA 4JMLA 1BVYF 2J1LA 1G8MA 1X1CA 2TRSB 3AL2A 3GGGA 4GX0A 3KYCB 4HEA6 5I9SA 5K3SA 2B94A 1K3TA 3QVGB 2GN1A 4W1PA 3PDCA 2Y0PA 4G09A 3Q7TA 1C1DA 3ICCA 5HZMA 5LU9A 4RVNA 1GVNB 4C76A 3I8XA 4KXXA 4PO3X 3EW7A 2DBRA 1X7GA 3BB4A 1A8PA 3DV0B 1YR2A 4ZI7A 4OX9B 5EZ6B 3IC5A 1P0MA 2JBWA 4P1ZA 3T7AA 4UUOA 4U2GA 3F1KA 2FDXA 2AUMA 1O5IA 2GBLC 1ZCAA 3DULA 3E8SA 3NEYA 4I9FA 4PPNA 4N5HX 4KJZA 4UFOA 5FFFA 1AA6A 4S04A 1V37A 3PNOA 1XA4A 4AX8A 3L0SA 1Z0KA 1E5VA 1N1DA 2FN7A 1P4RA 1Y33E 1DUSA 1YQXA 3DBLB 3DDSA 4KXLA 4LWQA 4NY1A 5JNTA 3FGPA 5EIAA 1D6SA 5AHRA 5B64A 1QUEA 4JBIA 4ZVRA 4R2WA 4O4JA 5CYOA 2V7QA 4HYTA 4C4ZA 4HNHA 2NGRA 3UV6A 3QY9A 3AERB 2BJWA 3HCDA 3QVMA 5GVSA 4W6ZA 3SS8A 5H81A 3G68A 4S35A 4WADA 3TPFA 1UC4B 5F5NA 4ZO9A 2EZ9A 1XZNA 2I65A 1T4GA 4BX8A 1Z12A 5JXIA 1SZCA 4PNZA 5CJPA 1E3QA 2O8VA 3ZOZA 2QY9A 2L17A 2YY6A 4Z99A 4HAYA 4HFJA 1HE4A 3UJPA 3UZUA 2CB0A 3MWLA 4GZ5A 1C3VA 2WD7B 4CLEA 1BN6A 3NHLA 3JQFC 3MAAC 4HDMB 5HFJA 1S6YA 2FMXA 3IYLW 1JXMA 3KFLA 1Q7BA 4UHEA 2B92A 3PRJA 4LBWA 3QELA 4LF8B 3FDJA 1QM5A 5T4BA 2RI1A 4GBED 3VR4H 4L4YA 1A77A 3M0EA 4XQ9A 2VYVD 4NYMR 2CHFA 2NPFA 2B34A 5C2JB 2J5KA 2C8JA 2OR3A 4QQNA 3DXFA 1JFFA 3PTZA 4PPGA 2F64A 3IULA 3IXLA 3KQLA 3CLRC 1N0IA 3FJYA 2ZR7A 5JNRA 3C43A 3DZBA 4KAFA 5EKUA 4B4WA 5AM2A 4UNRA 2CE2X 4R4JA 4OBWA 1HBJA 3B9BA 1TAHA 3VOSA 3IIJA 5CB8A 2J8ZA 2JLRA 4GMKA 3GH1A 3DZJA 3AEXA 4LRUA 3IQDB 1N7HA 3G9XA 5KBYA 3QITA 3EPKA 4JMPA 5KDDA 5FBRB 3KUCA 2C0PA 3TW0A 3SQWA 2Q2OA 3GWZA 1SQ6A 4TM7A 1F2VA 1P80A 5KS2A 5CVJA 1TYZA 3PGJA 1MAVA 2O1WA 4IV5A 3KJXA 1IDOA 2QUJA 2XGOA 1FF9A 4H7DA 3HI4A 1DCMA 3GN2A 4LWOA 1IJFA 2I22A 4KX3A 1J2UA 1VMIA 2E0IA 1NVWQ 3R9XB 2BFFB 2OZLB 3F98A 4H0CA 2DFVA 3EDOA 1SCNE 3W77A 5HVNA 2XXBA 3G0IA 4I4TA 1W4BA 2FZ5A 1N1GA 2IHUA 2YV4A 1EXDA 2QW8A 3V8VA 5F98A 3WY9A 1GFWA 1EQUA 5HILA 1GV0A 1GKYA 1EE1A 2JH9A 3TQCA 3SJAA 3GEEA 5LQKA 4YHHB 1WZEA 3T5AA 3GJXC 3OF2A 4XX0A 1Y6JA 5HM8A 2R1ZA 2QP4A 3A4LA 4QXQA 4ES6A 2HQSA 3CRNA 3PE4A 3T4UA 2L69A 1W5TA 4FR0A 2QB5A 2OCYC 3F67A 3LQRA 1QK4A 5AXAA 3L84A 3ITKA 2QLLA 4IEIA 2VPQA 3E2MA 4RSGA 1PEKE 2H4JA 2VDOB 1D3AA 2XRYA 4UNQA 3K9BA 3WLEA 2ZRMA 4UDOA 3TSOA 3NC0C 3WKEA 3HCCA 4XWTA 2XMDA 4IZ6A 4EAAA 5A9TA 4G8CA 5IXJA 3BQ9A 1HKHA 4L50A 1PGNA 3RTAA 5FOTA 2DCMA 4C21A 4U7DA 1OU4A 2CL6X 4NCIA 1EK1A 5BYJA 1B73A 3MWJA 4J1QA 1X77A 2DPHA 3TNFA 4NFSA 3QU5A 4D8XA 4M1ZA 1SC4A 3PQ4A 5LWQA 1DTSA 4TS1A 1NUTA 3BPSA 1Z39A 3O4VA 4LZOA 2Z3VA 1QPGA 2ZSKA 4DNFA 5AVSA 3U6KA 5C1OA 1U63A 3I9V6 2ZPUA 1S2OA 4EEKA 1P1CA 4OQQA 3RBAA 2EFDB 2QU8A 3EFHA 3I2FA 4UZSA 3UT0A 3VKUA 5DMXA 5LA6A 3UMVA 1X0VA 2B2CA 3FYHA 3A6ZA 1CF2O 1E64A 4MI1A 3GJRA 2VP6A 2JGMA 3PFNA 4MUBA 4QOSA 4N9WA 5IT4A 5JVDA 3SQXA 4QM6A 3P2MA 1G55A 5EIHA 2AWNA 1OI2A 3MAJA 3URKA 5FWDA 4CI0B 5FWNA 5DP1A 1VCIA 1WDKA 5G1NA 5IKOA 2ZIXA 2WFLB 3L0PA 1QWOA 3GH3A 2HJVA 2GM5A 2Q5QA 4LJLA 3W05A 1IPFA 1X1EA 4IHQA 3KT3A 3HCPA 4D26A 1JPJA 1L1FA 2IHNA 1E6CA 4F6CA 4PLPA 2A0UA 1IIRA 2X2FA 1P7ZA 4M38A 4XA8A 4DLRA 4PV7A 1AKVA 2AQHA 4KFCA 4MK4A 2XGJA 1L5QA 1TMGE 2VPPA 2BHNA 1RKXA 1UBUS 4RCVA 4X97A 3ZZUA 5IYZB 3O0TA 4TX1A 1AS0A 4QUJA 5TQ0A 3GLHE 1C9JA 3NH6A 1PQYA 1E6MA 3PLAE 1GKKA 3NWPA 4CCAA 3PPWA 1QC5B 1IVNA 3RSSA 4F8EA 1R6UA 2ZUUA 1ZY2A 5CK4A 5DLEA 3ZJUA 3C6QA 4LOLA 4ZVSA 4MV6A 4P4UA 3UA3A 3LKDA 1FFEA 2F00A 3U3MA 1XA3A 1CUVA 5ADWA 1ODLA 4YCNA 5FPQA 3D31A 4DPKA 1CZOA 1T8YA 2W8BA 3E9MA 2IX3A 1R37A 2MT9A 2OZEA 4HWSA 1WXWA 3RTEA 3SU8A 2O8CA 3ETJA 4MPJA 4OU5A 3BREA 3SK0A 3HWWA 1P9LA 1E3WA 1P81A 1OFIA 1CQJB 1Z33A 2I7CA 2ZT8A 5DHSA 2XQVA 5C8XA 4RWEA 1X9HA 1KJZA 1TZBA 3DMGA 1KDPA 2C42A 1M7GA 4E13A 5FPTA 2Z9DA 4BEJA 4GXTA 4GI2A 1ZNXA 3GUCA 4LQDA 2P8SA 5DGCA 5E1BA 1XR3A 2ZWPA 1GAXA 5IEJA 1C81A 4AZVA 1RLTA 4EUKA 1W4RA 3H2YA 3R3JA 2VHXA 1PNTA 3NHJA 3CNNA 4CM8A 5BV8A 5CFRA 1N57A 1U3DA 4DV0B 1QDUA 1Y1KE 3OM0A 3PF8A 1Z8FA 1ZM4A 4TQUS 4WY5A 5AW9A 3Q7EA 3KZCA 2GK6A 1EP1B 2H2FA 2H9IA 3LGSA 5FPPA 1IBSA 3O3NB 4P0PB 4IS2A 4X7BA 3BQNB 2BTQB 5FRDA 4RKWA 3IT1A 3A1EA 5CA1B 1GXSA 1RWVA 4GOND 1C8LA 1EB8A 3E81A 4YQFA 3CZRA 2ERCA 4LVUA 2Z8YM 4MQ5A 4R1MA 3R74A 4BO1A 3GLIB 1PN3A 1A27A 1RMQA 3KQUA 1NKSA 1PBNA 4JIMA 4LSGA 2QVBA 2CJWB 2PWAA 2XNHA 3LT0A 4G86A 4M1OA 4R54A 1BMFD 2NO6A 2YVLA 2O8FA 4IO1A 4IXNA 3G6WA 4KDEA 1U4OA 3C8MA 3K09C 3CJRA 4QFBA 1U3VA 4RFLA 4XPIB 5C80A 2DHCA 1IHPA 3ZCTA 3FUVA 4EEZA 1W75A 2D3WA 3I30X 2VAVA 3CNBA 1I3CA 3COVA 5MN4A 1KWKA 4W7SA 5EIXA 2N47A 1UT6A 5E4YA 4P33A 3V5NA 3A4NA 4JLDA 3S5JA 4OI0A 5AW5A 5DT9A 3GAFA 4QYTA 2PSEA 5LQUA 1T4DA 2PU7A 1MBZA 4ZT5A 4HAXA 3SX4A 3Q1LA 1ADJA 4MRVA 1GNSA 3R6TA 3TLAA 4ZGBA 3AEUB 1S0UA 4KR9A 1J99A 3MUEA 5ALPA 2D06A 3H5AA 3RRJA 3FMFA 4FMDB 3LY8A 5A6SA 1UUFA 4NULA 4EB6A 5DCLA 1E18A 1NMXA 2E87A 4OFWA 3GIDA 4RFVA 1L4FA 2XOXA 3ANSA 5C52B 3GWGA 2K5UA 3P8ZA 3FHOA 1R9NA 3QSGA 4ZYTA 4ZT6A 4R7TA 4U8HA 4B47A 4PBTA 1CNFA 2CHQA 3MELA 7AT1A 3LP5A 5DGTA 1M74A 3KOYA 1GSHA 4OAPA 3KTOA 4ENSA 4FEYA 4JEUA 3NO4A 5D5HA 1RS0A 4MGZR 2J5RA 4FNOA 3O8OA 3RUIA 1C30B 2YWCA 4EITA 4PG6A 5IP5A 2BE9A 5MGBA 2VJCA 1ID1A 4G8DA 4P4TA 1JFFB 1PDOA 2VL7A 1ZCBA 3ZQ4A 2FR0A 2MSKA 4IDEA 1LZKA 4DMUB 3PR1A 2QKYA 5IT9A 4NK5A 1ZM7A 2B4QA 2QMQA 1HQKA 1Q11A 3GRRA 2FEKA 1LV8A 2JIOA 3B3AA 5A06A 2JDID 2CXOA 4UEJA 4ZYXA 1VBNA 4NONA 1QQ6A 3WLJA 4XYGA 3DCIA 4KYTA 1NJFA 4XRGA 5EKXA 4KE7A 2YYSA 4OAOA 2AJLI 4YI5A 1BX0A 2F8SA 3WZLA 3L06A 4H1UA 4IL5A 1OXUA 3U2QA 4QOJA 1X7ZB 2IZ1A 2L19A 3QFHA 4CF6A 2MMGA 1DLIA 2BFCA 1NPDA 4D5EA 3B2NA 4R1OA 1I32A 1Z35A 2VBGA 2MYTA 3LT1A 1T6NA 3SXJA 3ZLBA 4E08A 5IX8A 3IODA 1NZDA 5GONA 1X1QA 3IDFA 1XZMA 2DUUA 3L92A 4GMHA 3CO5A 3PL1A 4DPMA 4U6SA 4P31A 3SSNA 3FYUB 4XDZA 5HRUA 1R5OA 4IDQA 5JS6A 2XZPA 1OC4A 4M1QA 1Q12A 4BTVA 3KWLA 2O4UX 2V97A 3USES 2ZKIA 3SC3A 1M2WA 2VYND 1H05A 1WSDA 3KVNA 3M89A 3FNFA 4JA0A 4KXQA 1NRWA 4ZHQF 3TGLA 4CM9D 1THMA 5CHEA 4UU0A 2OUKA 3FYSA 1K5PA 4BFUA 4NR0A 1HE8B 1VBMA 1ZNWA 2D2FA 3KZXA 3RV4A 3QKTA 2C5HA 1YDWA 1QH0A 1ZGCA 3D64A 4BRWA 4EPRA 1AKRA 2W71A 1VLHA 2ODAA 1YE3A 3GX1A 3HU2A 5IM4A 2DCUA 2Q5OA 4GI7A 1JBKA 1KI3A 4L73A 3PCRB 3OE7D 4Y2JA 5KDOA 1QIMA 4MPPA 3N0VA 2PZLA 4X91A 2CNBA 2GPAA 5TY0A 2NN3C 3K9LA 1PVOA 4UUMA 4HMQA 1SHUX 4WESA 1Q84A 4I50F 3HKDB 4I5DA 2MYPA 3L8EA 4D7AA 1HNZB 3SZLA 2ID9A 1PNQA 2J85A 2ZI4A 4Q3OA 3B1XA 2B7BA 3QPBA 2VF4X 1GQOA 3GMSA 3D6FA 3HDGA 3N8GA 1RI1A 2QG9A 3V6MA 3TLKA 1K9SA 1DXQA 3M3PA 4GF5A 4EK9A 5L9AA 1CQZA 4IOJA 2QEQA 1JWAB 2NU9B 3V34A 1CIVA 4X1YB 4F2GA 3DE6X 4R2MA 2E4AA 4B84A 1Q0PA 3K09A 3ASVA 3IHLA 5ALVA 2WKQA 4JITA 3CXUA 4FGWA 4XPZA 5MF6A 3RRXA 3E5RA 4Y1FA 1OW3B 2PKYX 1W0JD 3W5BA 5C5IA 3LY5A 1IG3A 4U9IS 4H59A 3W6OA 1P4GA 2E82A 3DC2A 4RD1A 1PZHA 2HC9A 2VXCA 4BBAA 2C0QA 3K1JA 3PVZA 3EIOA 4IDAA 4MQEA