4C4ZA

Crystal structure of human bifunctional epoxide hydroxylase 2 complexed with a8
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
318
structure length
318
Chain Sequence
b'TSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
publication title A Combination of Spin Diffusion Methods for the Determination of Protein-Ligand Complex Structural Ensembles.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 108
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c4zA00
4Y9SA 2GYUA 2JGKA 1RYYA 2DR0A 4XX1A 3G0IA 4X71A 3BDIA 1EK1A 1E3QA 5EHXA 5IVDA 1J06A 3I28A 4QEKA 4HTAA 3FWHA 3WZLA 4DTCA 3L1JA 3FSGA 2BCEA 3KSRA 4CIAA 4BVLA 3FAKA 1FFCA 5FV4A 3VJLA 5JARA 1BRTA 4BCDA 5EIEA 4H7EA 4EBBA 4B81A 1W52X 4AX4A 3WLAA 3DLTA 1YCDA 2IX9A 4X94A 1E5TA 4H7KA 1XLWA 3G02A 4QDZA 3TGLA 2WSLA 3U1TA 2AJLI 1UKAA 4EHBA 5ALVA 4BBZA 2WUGA 1C4XA 3WKBA 1AGYA 1UFOA 5FPQA 3WK9A 3ANTA 3I2GA 3WL8A 4AZ3A 5I9IA 4XIIA 2GYVA 4W1SA 3B12A 3DOIA 1XZEA 4DNOA 4C01A 3QVMA 2HFJA 3V9AA 2QS9A 2VSQA 3D5EA 2VTVA 4MWSA 4Q3OA 4UFOA 5JZBA 1MO2A 4CG3A 3WL5A 2G63A 1UWCA 3O0DA 1CUWA 4HXEB 1OCEA 4NMWA 4PSCA 3WK5A 4BB0A 4G9EA 3BDVA 5JADA 4B85A 1HQDA 4L72A 3AZQA 2V98A 4KAJA 5EGNA 2QOEA 3ZLUA 5AI9A 3WWPA 5CMLA 3FOBA 5FLKA 3GUUA 1QIIA 2JGIA 4K6HA 5HF5A 5K5EA 3BIXA 4X93A 2BUAA 3E1GA 5A7HA 1YS1X 1DTEA 3DJYA 1SCKA 3R3YA 3SK0A 3EQ9A 1UOQA 3D0KA 1EX9A 3G9ZA 3QM1A 2RONA 1QIEA 2RHTA 4KACA 1CUXA 3R3WA 5AICA 2XQGA 1JKMA 5JAPA 1UKBA 1XZFA 1LNSA 4FTWA 5K3EA 4CIBA 2JIDA 4A23A 3STXA 5EHQA 2HADA 1XZAA 3FYTA 4F21A 1AURA 3BJRA 2XUHA 3WKCA 1O6GA 2XUFA 6YASA 1QIHA 2YXPX 5LZ2A 4AZ0A 2VT7A 2JEZA 4KJXA 5LZ8A 2CMFA 4FWBA 2AXEA 4HS9A 1QJ4A 2XMDA 4WY8A 1UOPA 3NOXA 4UBOA 5AI5A 1G42A 3ESAA 4JYMA 5HFNA 5CH5A 2OGSA 2BUCA 4HXGA 3WKAA 3STWA 3FVRA 3N0TA 4UBIA 4BP9A 2VAXA 4JEIA 5A71A 2ZSIA 3BE8A 3MUNA 2HA0A 5EFZA 4MQMA 1C7JA 1MX5A 2OCGA 4U2FA 5K3BA 3GZJA 4GW3A 3FSGD 3WWCA 1IMJA 1AMNA 1EK2A 4V2IA 3ICVA 3WK8A 5HF9A 4K2AA 3JYHA 4DNQA 2C0QA 5JYCA 5AKZA 3STVA 1CLEA 4H7JA 1WOMA 1QIFA 4DM7A 1UK8A 2XI4A 1R9NA 4ARBA 4J0CA 3IBTA 3VDXA 1BEZA 4J03A 1HLGA 1H2ZA 5AK3A 3W04A 4NS4A 4ZRDA 4FNGA 3R3VA 1EDEA 3RK4A 1OILA 2C0PA 4AO6A 1I6WA 2CB9A 5DYTA 1YS2X 2WJ4A 4BRZA 2DQYA 4W1PA 1ODSA 1GPNA 5DJ5A 2ECFA 2V9ZA 5ALOA 4JH0A 2WTNA 4OSEA 4RPCA 4BTVA 4X00A 2XMZA 4X85A 1TCAA 3A2LA 2XUDA 5ALRA 5EHNA 4MQLA 1X2EA 1DWQA 3PF8A 5AOBA 4MEBA 5CH8A 3H1BA 1XZHA 2GBFA 2DHDA 1ZI9A 4WFJA 1G5FA 2YH2A 1WB6A 2V97A 1EXWA 2YASA 4X6YA 1HBJA 2VAVA 4Y2JA 4PSUA 5HFAA 3O4GA 4EY6A 5KWIA 2J4FA 1EB9A 3AZOA 3C45A 1A8QA 2JBWA 5EI5A 3G9XA 1BEEA 3H18A 3D3NA 3WK6A 4N8SA 5SYMA 1LZLA 5D7BA 3FLEA 4C89A 1ORVA 4LXGA 4AXBA 4Q82A 1JI3A 2QRUA 1ZI8A 3AIKA 4YASA 2HA6A 4UBKA 1RWQA 1BROA 2WIJA 4E46A 3LCRA 5IVKA 4N8DA 4WCVA 1MAHA 3R0VA 4X7BA 4J0KA 5D3KA 4QDOA 1NU8A 1F6WA 3C5VA 2XQJA 1XRRA 3C43A 5ISMA 4JYPA 1ZGCA 1BCSA 1CRLA 1IUOA 3TRDA 3MUOA 3F8SA 3NGMA 2O7VA 5KBYA 1THGA 2H9YA 2PUHA 2ONCA 1EH5A 4J0HA 1P0MA 5LKRA 2ZVDA 3I6MA 3N2ZB 2I3ZA 1XZJA 4C4YA 2HL6A 5CT6A 1A7UA 1XZDA 1EA5A 3WMRA 1FFAA 1EDBA 1TK3A 1QLWA 3H2IA 1CV2A 2B4KA 4OUKX 2JF0A 5YASA 4FFWA 4DSAA 2J3DA 3IB3A 2DHCA 3O95A 3OPMA 3QMMA 1GXSA 3QMWA 1SCQA 1EI9A 2ES4A 1H2WA 4ITVA 1ZD5A 2R8BA 2WHRA 2QJWA 5T4BA 4AO8A 3PUIA 1ZIYA 5AOAA 4P93A 4B0OA 4XJVA 5K3DA 5CT4A 2DFPA 5KREA 1EVQA 5HKBA 1XQYA 3WQHA 3KXPA 5E4YA 2WQZA 1XZLA 3ZLTA 5LZ7A 3P2MA 3QMVA 5LP1A 4IH9A 4C88A 4FBMA 1JT2A 3DCNA 2IIVA 2D5LA 4H77A 4I19A 5ALSA 1FFDA 1YA4A 1G4HA 3WI7A 4Y2XA 4OB6A 1CQZA 4DYHA 1J07A 4J0IA 4P92A 2PU7A 2ZSHA 4UHHA 2JGJA 3EBLA 2XQKA 1QIGA 1W4LA 5FP0A 4B82A 3FLBA 1DX6A 5CT9A 5ALQA 3Q0TA 3GELA 5DWDA 1FFBA 3VJMA 4PQEA 4KAFA 2JGFA 3H19A 3C6BA 3PICA 4GHWA 5DNUA 4DMKA 3STUA 2XUGA 5ALJA 4UBJA 4ZGBA 1LPPA 1XQVA 2EEPA 1PFQA 5A2GA 4KYVA 1NU6A 3NWOA 3WL6A 4ZV9A 1CUGA 4RNCA 1N5RA 4DSZA 3G0GA 3PE6A 4CCWA 4X97A 5AIAA 1CUDA 4X90A 2XLBA 3K2IA 1YA8A 3H04A 2PSJA 1N1MA 4Q05A 2IITA 3DYIA 1P0PA 4ZREA 2ORYA 2QT9A 3C6ZA 5J3JA 2OAEA 2E3JA 5ESRA 4XVCA 2NW6A 1ISPA 1T2NA 3BF7A 3F98A 3I2HA 3CN7A 5BV7A 2C4HA 5DNVA 5HF6A 1ODCA 1GZ7A 4KR0A 1CUCA 3HLKA 4QDUA 1MPXA 4RGYA 3BXPA 1K5PA 4IO0A 4B9EA 5BWCA 2QZPA 4BAZA 1VXOA 4Y2TA 4X6UA 2CJPA 1TAHA 1XLVA 3FNBA 1ZD3A 5AM2A 1Q0RA 4CI9A 2QXUA 4BATA 1L7AA 3OC0A 1Q83A 2ROQA 5E4TA 1CEXA 2WKWA 4IQ4A 2JEYA 1JJIA 1XZKA 5AK4A 3STYA 3H0CA 2WFMA 4C4XA 4BTLA 2J3QA 3BJMA 4ZI5A 1Y7IA 1XRLA 1CUVA 4OYYA 1XKLA 5AKLA 4DNPA 1PJAA 3ESBA 3AILA 3R3UA 3R41A 3G8YA 2OCIA 3KWFA 3WWEA 2JGLA 5AIBA 5C8ZA 1DINA 2HFKA 5C7YA 3C8DA 1CUAA 4U2EA 3SWWA 2GYWA 5C8VA 1EB8A 5AI4A 1Y37A 4UFPA 1J1IA 2ZJ6A 3WWDA 3LLCA 1F0NA 2WUEA 2Z8ZA 3O9MA 1S8OA 2WG2A 5ALZA 3C5WP 3WK7A 4LYEA 5ALMA 3WYDA 5T4FA 3AINA 2WFLB 3G0CA 3IUNA 3HXKA 2CBGA 1LPOA 3VVLA 4QZVA 4Q34A 2XE4A 2Z5GA 1XZGA 5SYNA 4X91A 1QFMA 2WUDA 4BAGA 1HDEA 2WIDA 5CT5A 2V96A 1LPSA 1EINA 1WM1A 5DTJA 2QTBA 5AK5A 5ALKA 3T4UA 1DT3A 1QTIA 4FMPA 3UMJA 3OG9A 1IZ8A 1IZ7A 1QE3A 4G8DA 4BE4A 4O08A 5ALHA 5IVHA 3SX4A 1XZCA 4C6HA 4F0JA 2I78A 1ETHA 4MXDA 5JAOA 4HAIA 4L9AA 3ESCA 2PUJA 3EQ8A 4DIUA 2I03A 3A2NA 1N8SA 1LPAB 3R3XA 3O4HA 2CEKA 2XUKA 2J4CA 3ZI7A 3JWEA 3QBJA 4G4GA 5HK8A 4E14A 3CCCA 1T4MA 3OURA 2VJCA 5DNWA 1DWPA 4E15A 3KD2A 2LIPA 1GKLA 3W9UA 2X5XA 4FLEA 1DX4A 1P0IA 4AN1A 3G7NA 5HQ3B 2Y6UA 4AO7A 5ALTA 2PSFA 1CPYA 3A70A 1Y7HA 4Y7DA 4WDQA 4B0PA 4IHAA 2FJ0A 4HZGA 1CUZA 5HZGA 4QLAA 2CUTA 1Q0ZA 4NVRA 1BN7A 3VXKA 3G0DA 5LIPA 2XQIA 5AKHA 4OU4A 3CN9A 2VEOA 3H2HA 5HK9A 1TIBA 1QIKA 4DMFA 5BOVA 5E4JA 3F97A 5T4EA 4OB8A 2OCKA 4OD0A 4LYDA 5KWJA 1H2YA 5LZ4A 2XUAA 4BP8A 4I3FA 1B41A 3UUFA 4BC0A 1L7RA 4GI1A 3R40A 4Z49A 4G9GA 2XQFA 3H2KA 4X6XA 4YK7A 3STTA 1U4NA 1CUYA 4GWLA 5ALFA 2OCLA 1LBTA 1DQYA 1AX9A 4ZXFA 3M81A 1R1DA 1HKHA 3WIBA 1ACLA 3S8YA 1ZOIA 1MTZA 3HACA 1VZ2A 2C5FA 1MX9A 1MJ5A 3GBSA 3HABA 3FVTA 5DTIA 1JU4A 5AO9A 2DQZA 4N5HX 1VOTA 4BRSA 3L1HA 2PVSA 4ZWNA 1XZMA 2HA3A 1BE0A 4AMYA 3D2CA 1UK7A 3PUHA 5C81A 5HQ3A 5AI6A 1EVEA 5CRIA 2G5PA 2OGTA 4P9NA 5EIHA 2XB6A 1QGED 5AM5A 5ALUA 4G4IA 4F5ZA 4M0FA 1U8EA 4W1RA 4F60A 5ALNA 4X3CA 4ETWA 2O2HA 5LLSA 4B6GA 2XMBA 1OXMA 3V1NA 2PL5A 5AKKA 2PSDA 2H7CA 2PSEA 3A6ZA 1K8QA 3LIIA 1VA4A 2GZSA 3VJKA 2C5GA 1QIDA 4Q3KA 3O4IA 4FOLA 2XUJA 1TQHA 5JIBA 2PKYX 3KDAA 3CXUA 1GPLA 4TVKA 1LPBB 2FUKA 5JD5A 3WA6A 1F8UA 5D3ZA 2QM0A 3W06A 2JGMA 5D6OA 4HRYA 3CCBA 1ZGBA 4N8EA 5E2IA 4QDTA 3ZLVA 4KEAA 1SCIA 3G0BA 1GPKA 5AKIA 3H2JA 2QR5A 4PO3X 2AJ8A 5FUMA 4PSDA 2ACKA 1FJ2A 2AJBA 2WILA 4H7HA 3HI4A 1WB4A 3VKFA 1JFRA 3LIPA 5HKAA 4PV7A 2HU8A 4RE5A 3DDUA 5ALLA 4B83A 5AI8A 1X70A 4Y2YA 2QUBA 4GEGA 3U0VA 4BCBA 3SC2A 5AM4A 4CG2A 4WY5A 2B9VA 1CUSA 2PM8A 2VA9A 2X76A 4FKBA 4H18A 1WB5A 3GROA 5K3CA 2R11A 2WIKA 1IVYA 2I3DA 5EHZA 1W1IA 4DMCA 3IDAA 3LP5A 5C8XA 4UHFA 5LZ5A 4KE8A 1GQRA 3FBWA 3ZV7A 4LIPD 4BVJA 2RAUA 3V1MA 4KRXA 2EDAA 1W6RA 3I2JA 1KU6A 3EF3A 3RARA 4BZWA 2QXTA 3T52A 1C7IA 4QWWA 2HIHA 1YAHA 2RIPA 4AN0A 5ALXA 5IKXA 3ILSA 1K6EA 2XUQA 4MYDA 1QFSA 2C7BA 3O9VA 5AKEA 3RKSA 2H7YA 3V1KA 5H3HA 5JD6A 4GXNA 1IUPA 4A16A 2BAGA 4FDMA 2Y1KA 3DKKA 3F9CA 1XRNA 2ZJFA 5BWBA 5JATA 4N5IX 4U2DA 2OQIA 2G5TA 4INZA 4U2GA 1W76A 2XMRA 1CVLA 2HHAA 3PF9A 4Y2RA 5A62A 3OTQA 5ALGA 4KAAA 4DNFA 5ALWA 1VZ3A 3ANSA 4AB1A 4HXFB 1ZD4A 1ZIXA 5FRDA 3BF8A 5EIAA 3QYJA 3FYUB 3HRHA 1E8NA 2VT6A 4W63A 5AKJA 5I8PA 2JGEA 1MX1A 4H0CA 4QLOA 1H2XA 1LZKA 1LBSA 3HJUA 2PX6A 4H35A 5T4HA 2WTMA 1E89A 3W2TA 3A2MA 4HVTA 2HDWA 3QH4A 5JD4A 4UFNA 5AI0A 3DD5A 2WG0A 1IUNA 1R9MA 1YB6A 1Q84A 4E11A 3LS2A 1D07A 1BCRA 4Q3LA 5ALYA 1JMYA 1E66A 2HU5A 5AOCA 4J3JA 3HEAA 1VA5A 3WJ2A 2WG1A 2QJRA 2WHQA 5JANA 1UT6A 4PF1A 3HC7A 3D2AA 3IIIA 3QZUA 3VISA 1B6GA 3JW8A 3K6KA 1J2EA 3DQZA 1XQWA 4Y2QA 1P0QA 4C4ZA 2OGZA 3QPDA 1XQXA 3OM8A 4WJLA 4B80A 1N5MA 1ORWA 1UZAA 2QVBA 1QONA 2WJ6A 2WM2A 5FOQA 2ZYSA 4H7IA 1WPRA 3C70A 1JJBA 3HSSA 1XZBA 5CBKA 1ZI6A 1VLQA 3I1YA 3K9BA 1H23A 1HL7A 2ZYIA 3F67A 4AQDA 4GECA 1MU0A 2O2GA 4G5XA 4X92A 1JJFA 3R3ZA 3B3QA 4J7AA 2WUFA 3X3HA 3AIOA 5AP9A 3PI6A 4UBLA 3NUZA 5JAUA 3FYUA 4GDMA 4NZZA 1XLUA 4Y2UA 3DOHA 2XUOA 4WDRA 1DT5A 1EHYA 2BFNA 5AM1A 7YASA 1USWA 1CQWA 1CIJA 4EZIA 4BDTA 1ODTC 5ALIA 3RLIA 4WFIA 5LZ9A 1VKHA 3IUMA 4BC1A 1ZJ5A 4J0DA 3H1AA 4B7ZA 2ZYHA 4G1FA 3I2KA 1MNAA 2UZ0A 5ALDA 1CUFA 1JMKC 3WZMA 4BCCA 1K63A 4Y2VA 2Z3WA 1YR2A 1XRQA 2Z3ZA 5AKXA 3C6YA 3MVEA 4FLMA 4K6GA 4EA6A 4BE9A 3FCYA 1AUOA 2VJDA 3AFIA 4IH4A 4G8CA 5DYYA 3M83A 2O7RA 2Z8XA 2XMQA 2XMGA 3E3AA 2WFZA 4HRXA 5K3AA 4I4CA 4L0CA 3BL8A 4DLNA 2Y2VA 2HRQA 3OOSA 1QOZA 4KE9A 4CCYB 1U2EA 3WKDA 4OPMA 5FPPA 3AJAA 4LXIA 1MNQA 5DLPA 1AC5A 1LGYA 3I1IA 4W9RA 4EY7A 4EY5A 1F0PA 3V48A 5CW2A 3PDCA 2WLSA 4FLFA 5CXUA 1R88A 4MYSA 5IH7A 2XUIA 4MEAA 4TGLA 3ZWQA 4J0GA 1E8DA 1GKKA 2VQ6A 1KU0A 4BVKA 4BYMA 3E0XA 1CUHA 3W05A 4D9JA 5CTAA 4BDSA 3WJ1A 1UK6A 3EQ7A 3V1LA 3EIOA 2RHWA 1CR6A 2XT0A 3WL7A 4DMHA 1XROA 2CKMA 4EY4A 2BJHA 1UK9A 3DS8A 4UBNA 1DWOA 1UXOA 2WHPB 5CXXA 3IVMA 5AJHA 4PNZA 1CUIA 2WFLA 3GA7A 1NX9A 2OAGA 2ACEA 3G9UA 3ESDA 3IA2A 5AKYA 1VJ5A 1YB7A 4U2BA 2OPHA 3H2GA 2BKLA 3PFBA 3FCXA 1A8SA 3HZOA 2HM7A 1U65A 3RM3A 1CUJA 1SOMA 1G66A 1BS9A 3AIMA 1PV1A 1ACJA 1DU4A 3L1IA 2XDWA 1CUBA 5AH0A 1RP1A 3WA7A 2G4LA 4JNCA 1JU3A 2PPLA 4QE3A 3C6XA 2PBLA 2GBCA 3BWXA 4FHZA 3WIOA 1XZIA 1TCCA 1M33A 4CCYA 1THTA 5JZSA 2HU7A 1WHSA 1AKNA 3C87A 4QA9A 1YAJA 3TJMA 4UHBA 5LYYA 5FDFA 3DYVA 2YYSA 4H7FA 2QKYA 3ZPXA 1KEZA 2ZYRA 4FNMA 4UUQA 1XRMA 2DSNA 1X2BA 1GT6A 1E8MA 5IVIA 3I6ZA 1ZD2P 3DL7A 3I6YA 4XWGA 4A5SA 1TKRA 4LHEA 2X8BA 1CUUA 4DGQA 3AUKA 4OYLA 5F4ZA 1TCBA 3IULA 5ALEA 3DEAA 2EDCA 3E4DA 4ARAA 5CURA 1LPMA 4UPDA 1XRPA 3G9TA 3QITA 2WIGA 4Y2SA 3IUJA 1VE7A 5K3FB 2WHPA 1TRHA 2WU3A 2Y2UA 3WKEA 4RE6A 1AZWA 5A7FA 1VE6A 4L3WA 2OQVA 2O2IA 1QIJA 5AM0A 1LPNA 2XLCA 1EDDA 3HYSA 2QUAA 4YX9A 2AJDA 4G4JA 1GGVA 1H22A 1R3DA 4P08A 4C87A 2RI6A 1R4ZA 2B20A 2OLEA 1MT3A 1BN6A 1CFJA 2Y6VA 2H1IA 2HA2A 2VJAA 5CT8A 1BU8A 2WU4A 2W6CX 1ZJ4A 1QIMA 2WIFA 1FSSA 2PSHA 5AK6A 1QZ3A 4QNNA 5JZ9A 2FX5A 2VATA 3MGAA 4Y2PA 4W1QA 2BGNA 2Q0XA 1HPLA 2DHEA 2B61A 4M0MA 5CH3A 2H7XA 5FXMA 1VXRA 3IUQA 3S2ZA 2HRRA 3DL4A 1SC9A 3C8HA 3D7RA 1O6FA 2ZJ7A 3GFFA 4ROTA 1XKTA 5FKJA 1WCYA 4BAUA 5JAHA 4GBGA 4M0EA 4IH1A 5ALPA 2VJBA 4K6KA 2D0DA 3KOOA 2GZRA 4MJ3A 2WJ3A 4GLBA 2OXEA 1QO7A 1Z68A 3YASA 4KE6A 3I2FA 3PFCA 5K3FA 4UHEA 4CG1A 2BGRA 3QPCA 1LLFA 4KRYA 2BUBA 4B9AA 2OG1A 1DQZA 1XFDA 3D59A 5AM3A 1QO9A 3WK4A 4PW0A 3VVMA 4EY8A 4QDXA 3B5EA 4X95A 3M3DA 2GBIA 2XMCA 1YASA 1YSCA 1MAAA 2FJPA 1SFRA 5HCUA 3M82A 2XMSA 4EUSA 1AQLA 2XUPA 4B84A 1UOOA 4MWTA 3WWOA 1L7QA 2VF2A 5JASA 4UHCA 1GQSA 4FBLA 2P8SA 4TPKA 4Q1VA 4JUIA 3F96A 3IURA 5A6VA 5HF8A 1W75A 3FYUC 2C58A 2W22A 4G8BA 2AJCA 2K2QB 4WFKA 1FFEA 3W9BA 1CUEA 5JALA 4S0XA 5LKAA 2GBGA 4FFVA 3I2IA 3D2BA 3DNMA 5AKGA 4K5QA 1WHTA 3ICWA 3H17A 1A88A 4KE7A 2PU5A 3WYNA 1WPXA 4OCZA 2QMQA 4UHDA 4QWMA 2DCMA 4UBMA 2HA7A 3O4JA 3TEJA 4J0JA 4CFSA 4EB0A 3UUEA 3DKRA 5A7GA 1R50A 3AZPA 4LKOA 3D4LA 4LXHA 1K4YA 3FLAA 1A8UA 1ZICA 4OB7A 2HA5A 2HA4A 3QPAA 4YPVA 4OU5A 5I7UA 1MN6A 5DYWA 2RGUA 3KWJA 1QTRA 1UKCA 4H7DA 3Q8WA 4AMZA 3ED1A 4U2CA 4BZZA 5AHXA 3BIWA 2CZQA 4ZV7A
chains in the Genus database with same CATH superfamily
1W59A 4UOEA 5EE9A 5F98A 4P7JA 4Q4HB 3ICEA 3KKLA 4EZEA 1PJ8A 3HCRA 2QF7A 1M7GA 4XX1A 3D6UA 6GPBA 3G0IA 2IPAB 1XAIA 1NULA 3BDIA 4OJKA 3RHSA 4DR7B 3LBFA 3EZLA 2QLNA 5L3ZA 3GLUA 3QJGA 2GGSA 3KYCB 4ZCSA 3VSAA 5EHXA 4GLOA 2E48A 5CM9C 4Z9XA 1OVGA 5FBHA 5FADA 3CX7A 4HTAA 4GU5A 2IUUA 2CLLB 3A05A 1XPJA 4RJJA 1H9BA 3EEQA 2AG1A 4D4JA 1GCGA 2BCEA 4KR3A 4QFDA 1AOXA 1Z0SA 1DRJA 2ET6A 4J16C 4KW7A 3K70B 3FYCA 4N6GA 1PYDA 4AROA 5KQGA 2FX2A 2QTHA 2RI1A 3WBJA 3J80A 4JP1A 1SQ0A 2QG6A 1WLSA 5EYPA 4EJ6A 3Q5GA 4HNUA 5TPZA 1RVDA 4ZT4A 2FFRA 2AR9A 4B81A 2ZUFA 2RIRA 5LYJF 4BLVA 4AX4A 1Z6GA 2C4WA 1NP3A 1D2CA 2VP3A 1L4UA 3DLTA 4H31A 4O3FA 1T2VA 2WB4A 4DLYA 3KYDB 2VJLA 2ZTHA 3CLUD 4V0SA 2VHCA 4GZLA 4YAFA 4YXWA 4M83A 4IIYA 1OI4A 4NCKA 4KXMA 2OP1A 3M2PA 4H4DA 4QFCA 3KAJA 4XLTA 1Z8NA 3OT4A 2WSLA 1TIPA 3U1TA 4IMRA 5K8TA 3TGLA 2BR5A 2FN7A 2V58A 3USES 2BEKA 3NBQA 2AH5A 4PBRA 2Q4EA 4A8HA 3W5SA 2C7OA 2ADMA 1GPJA 2RGBA 3E81A 3I4LA 3D7SA 3BGSA 5T7BA 1M2VB 1OLSB 2PBZA 2HQOA 4K7JA 5I4BA 2WF5A 1NSFA 2WUGA 1C4XA 5A4AA 2DY1A 3TIXB 1RQPA 1SAYA 2HV8A 2VSXA 4R8KA 4CM9A 1G4AE 2HWUA 3GH1A 4G3XA 4GP6A 3ANTA 5JMWA 1RM0A 3GIDA 3FM9A 4IBOA 1IWOA 3GT0A 1JAZA 2FWNA 1RRCA 2EW1A 4O5OA 3SBXA 3ZHYA 3E35A 5I9IA 4OKIA 2R60A 4XWAA 4PLFA 3RV3A 4GKAA 5I7EA 4JV5B 2RSLA 4LVUA 1DIRA 1XALA 2DMRA 1I1HA 1PFGA 3K5IA 1QOQB 4RF5A 3AHIA 4OX9Y 3EUAA 5BV2P 1MVLA 2VWPA 4CFZA 5JCZA 4WBNB 2HFJA 2CBXA 5D8DA 2A0KA 2GN2A 3O8NA 3FHLA 2VSQA 4HADA 3G6KA 2PT5A 4PYOA 4WN9A 5DN9A 2VTVA 2Y9MB 3QF4A 1LEHA 4U9IS 4B3JA 4HGYA 3IDFA 4XX0A 3EGDA 3ISVA 4HD8A 4Z4QA 2Y67A 2Q07A 1P1KA 4PNEA 1QX4A 4D42A 4OJYA 4ENTA 2HCFA 3F6RA 1K3UB 2WZQA 4MUHA 3L46A 2PH5A 5JFOA 4OQEA 4C7BA 1Q0HA 1UQRA 2WWTA 3MFQA 1JDZA 2O52A 4YRKA 3TXYA 5JZVA 3AWDA 3OZWA 1B8NA 1OCEA 3G7SA 5B6PA 1N57A 1S8NA 3WK5A 3SHQA 1U9YA 3DHEA 4YRNA 2DM6A 4XR9A 3PUYA 2CVHA 2RKBA 1H1LA 3AOEA 2E6KA 1AB5A 2EJBA 1VI2A 1JMVA 2ZAOA 3DTVD 5JOQA 4B85A 2IBTA 3LTEA 1KDRA 3OCJA 2WC1A 4FB5A 2QG9A 1UWKA 4KAJA 1CW2B 3U1BA 2C3YA 4KXQA 4UAJA 3QKSA 5JJKA 3LLVA 4OGGA 4FHGA 5AI9A 1Y7LA 2RBKA 2FPXA 5CMLA 3U5ZB 4NNOA 1GY8A 3MQ2A 3FOBA 3ILHA 4TV9F 3I4CA 2XDAA 1D9ZA 5FLKA 3KJNA 3L2OB 2JGIA 4K6HA 1CS0B 3KSMA 3L7KA 3KUUA 5EQDA 1DC6A 3O94A 1GUAA 4YIKA 4QPZA 5KNBD 3SPXA 1A2KC 2GHQA 3C97A 1MV8A 1SCJA 2I66A 4MOWA 4D99A 3T5BA 4EX6A 4X93A 3D02A 1RC8A 1XELA 4D0LB 3JASB 2CFTA 5A7HA 3DOJA 1WPQA 3L0BA 5D1HA 1DTEA 4BFVA 4D46A 4KYUA 3GN1A 5EE5B 3WDSA 1SCKA 1FDOA 4AG6A 1K75A 1NT2A 4LHSA 2QN9A 5G53C 3KDSE 1JDUA 3JQ8A 5I3CA 3D0KA 4S1NA 1HLDA 4RZUA 3ZE2B 5K03A 1EEHA 4ASUA 1J8VA 3TH5A 5DFAA 5FWXA 1OFHA 2RONA 1E4EB 1TU0A 4UCQA 2RCYA 4PC1A 4JBWA 2QT1A 1DAIA 3G2LA 4NEQA 2FZ4A 3ZEIA 3ZGXA 1MW8X 1TVKB 4JJ6A 2JW5A 1D6JA 4TMFA 5CA1A 4DT1B 4RH0A 4CM8A 1MJNA 1O5IA 1NAHA 5JAZA 3PPYA 1I2CA 2PX5A 2YJZA 3VR4H 2F1HA 3K1AA 1W8DA 1FFGA 2ZDHA 3LKVA 2O5EA 4NZ9A 3PV0A 1AUXA 5FI3A 5LD2C 1ZCZA 3F3KA 3F71A 3NLLA 2BFBA 4JLMA 2TSYB 2ZR9A 3IAM1 3JQRA 4A23A 2RGEA 1OAKA 4HWSA 4ND7A 2X77A 2H1VA 3EG9B 2VUHB 3BHNA 3G2PA 1RBMA 2QP9X 4FIDA 1XZAA 2JA1A 2HIAA 5DZSA 2IOQA 3R9KA 1SNYA 5G1OA 1XJ5A 1PD0A 4WZAA 2YRXA 3T61A 4H9GA 4EGCB 2W8BA 3OOHA 2B6HA 2OMKA 3QFHA 4JLWA 4POAA 2VTBB 1GRVA 4U5QA 1NG9A 1W29A 2XH8A 2ZYWX 4GWKA 1YI0A 2ZUDA 2XSZA 4G2TA 4AT1A 2FPWA 4UUOA 1MVOA 3N2GB 4B2PA 1WV0A 3D4PA 4C0WA 1J5XA 1JALA 1BAPA 1U2RA 4UATA 5EZ5A 1E18A 4BO5A 4EJFA 2X6TA 5ED4A 3KO8A 3SC4A 2Q5IA 3L7AA 2FFAA 4D3DA 3P5SA 1RJGA 2FPGA 2JEZA 4O59O 2YV2A 3KB6A 5JYBA 2QHXA 3F6BX 4D96A 2FPIA 1YRWA 2GK6A 4H1TA 4KJXA 4KVFA 2P4QA 4FCTA 2EWVA 3Q3CA 4FE7A 3GEDA 3ZH2A 3E58A 4XI9A 5JBIA 4YFVA 4RSHA 1WJGA 3NOXA 5BSWA 5B3JC 4LZAA 4EKDA 1DXYA 3C3BA 1AKVA 2IOYA 4KMRA 4LHZA 5FH9A 2XKAA 4D98A 3N0XA 1Q3TA 4EA8A 3QIVA 4HV4A 5HFNA 3GPDG 5IT0A 1OLXA 1IM2A 3INNA 5KMGA 4JP5A 2OGSA 1UKZA 2KMLA 5I7OA 4IFTA 3KQQA 3A9SA 3ELYA 1WTCA 3A27A 4ZZ3A 3FVRA 3N0TA 2QTVA 3KLPX 1ZGGA 1OIVA 2IE0A 1N2CA 1E1QD 3FJYA 4GEKA 2G09A 4UBIA 5EN4A 1UEXC 4URXR 5JSHA 2GCNA 3ZD8A 4TMWA 3M6XA 3PXXA 5EQTA 1VGRA 5K8CA 2G6TA 1U2TA 4FFMA 5TGTA 3UHPA 1BQEA 2ZSIA 3HKDB 3OMWA 5IJ0A 1RQLA 3CRW1 1COWD 1V9LA 3BAZA 4UE2A 1FDVA 4BQIA 3C74A 4Q6WA 1JR3A 4PFJA 4YVFA 4F3KA 1TM2A 3A10A 1RHQA 1P77A 1E2HA 2F1IA 2P3QA 4KAXA 4EPXA 1P7YA 3TPCA 2I80A 4U2FA 4UW9A 2IPNA 3OCXA 4K6FA 2ORIA 3IQGX 5IF3A 2FWMX 1XUOA 3HRKA 4PZLA 5JCJA 5CNMA 2MSDB 3MJEA 1CYDA 4LDNA 3WWCA 5EJ7A 4I81A 5JAIA 1M5RA 1Q7EA 2FP4B 1XVIA 4IF4A 1KPHA 4OREX 4V2IA 5AW5A 4YUYA 4G1VA 5JEEA 1M8GA 4QUJA 4KN8A 1DAPA 4I4IA 1F2VA 4TXHA 4K2AA 1J33A 3EOAI 3JYHA 3Q11A 4FXPA 3SKYA 3W2HA 3ZC3A 1K89A 5LDGA 1MT0A 2C0QA 4CIDA 2NVUB 1EA7A 1GNPA 2Z2IA 4ISCA 3IDQA 1KMIY 4ALLA 1M0TA 3CVVA 2F7SA 4DM7A 4Y6GB 1CETA 2XI4A 3TFWA 1GQQA 4LWQA 3ZJUA 1FZTA 4NOKA 1V43A 3BN3A 3VZDA 4G81A 1TLFA 4DEXA 1BEZA 4DILA 5DM70 1CQIB 3C6QA 2WTBA 2O6LA 4AY6A 2VKTA 1UL1X 1L4NA 3TW4A 2QRNA 2ZULA 1HLGA 4RLSA 3WSWA 3B13B 2G25A 4M0KA 4OQ4A 4YGYA 3Q2KA 1M8JA 4FNGA 1JEEA 3OLZA 3R3VA 5THXA 4I1SA 1EDEA 4Z0NA 3TB6A 4DUGA 3KQNA 2D74A 2C3PA 4AO6A 1I6WA 2YC2C 2CB9A 5FNVB 5GM2A 1ZA1A 1S96A 5AW3A 2GOYA 2XNDD 4LYHA 4MVJE 1X7GA 2SCUA 3HLYA 3MTAA 4OOFA 4W9NA 5I48A 2I91A 3DT8A 2EQ5A 3KSDO 4XYBA 5JJLA 2QX8A 4YLGA 2NP6A 3R44A 2J7PA 1GPNA 1M1NB 1JKJB 3AF3A 1JBKA 3AYXB 3D64A 1R12A 1Y80A 1MOSA 2VH2A 3FCOA 3JX9A 4G01B 1T34A 1GRCA 1IDN1 1NUPA 2C83A 3ET5A 3PHBE 3EVBA 4HEQA 1RYHA 3M5DA 5HIIA 4C07A 2A30A 2CLMB 1QAOA 3D54D 3IQDB 4DT1A 1L5OA 1SEPA 3EARA 1EM8B 4JU9A 5G40A 1NOKA 4B40A 4TQGA 1XL0A 3SOZA 3C7TA 3R75A 4X00A 5AJWA 1RYZA 1FLAA 1IAVA 2JAQA 2XMZA 1TCAA 4E5SA 4YRBA 1LSUA 2HSEA 3NRJA 4BJ1A 1RXYA 4LHYA 4DL9A 3UF0A 3VPDA 1JIVA 3NBAA 4MV1A 4CV2A 4C3VA 1XCJA 2VK8A 1U6IA 2PUVA 4ENUA 2JI9A 5K2OA 3H1BA 1D04A 1KJYA 1L5SA 1ZKMA 1M1YB 3BWDD 1G5FA 2YH2A 4WFJA 1WB6A 3RUCA 1ELOA 3WGQA 3SYTA 4ZDJA 3WLRA 2ZWMA 1RTKA 3RTAA 2XHZA 3HVKA 4GYYA 5F2KA 1OROA 3I72A 2CUZA 2EOAA 1DAGA 5IMSA 3I5XA 5EWMA 2G9VA 2ZM5A 5IHPA 2EWMA 4ZCTA 3D8SA 1TK9A 2I62A 5BUQA 2BFAA 3ZGNA 5FOVA 5BXYA 4Y2JA 1TAUA 1JWBB 1DIAA 4EO9A 1MIOA 1I4DD 2OMEA 4QASA 4G0VA 4L5YA 5BN4A 5KWIA 3SC6A 2J4FA 3QVUA 2B1QA 3ROEA 5LQDA 5HDBB 3KFVA 3VA7A 4FJ1A 5A0TA 2BFFB 1A8QA 1R7RA 1K8XB 2JBWA 3I3OA 3PPVA 5B4VA 5F76A 1L7NA 4CV0A 3PXBA 5IABA 4DV6B 3WK6A 5IC4A 4AQYB 4MCIA 4MX8A 2VTEA 4QULA 5DHQA 4EVRA 2CZCA 1PNQA 4OJTA 4N8SA 1NVXQ 1P4SA 1Z0UA 3AYZB 5D7BA 3U7QB 3GOQA 3D6FA 3HL4A 3MFYA 3FLEA 3THWB 3EVTA 3ZNNA 3H5VA 5CNIA 4G4SP 2IY8A 2DF8A 4LXGA 4EENA 4B8WA 1PWEA 2QD3A 2AR0A 2QLBA 4KWIA 3OPVA 2H00A 4MGKR 1FOEB 2WWHA 2PJZA 3S0JA 1X92A 4QT4A 5KINB 4CL2A 3U44B 3K1ZA 1E2KA 1W6UA 3HSYA 3OZRA 3QEKA 2ZR0A 1CJBA 1RWQA 2VVTA 4GLJA 1O0SA 3BM5A 3ENVA 1SRRA 2HMSA 4G5OA 4YBZA 4L2IA 4WCVA 1MAHA 1EG7A 3FZQA 3I05A 3IOMA 5I7SA 4AF6A 1NZDA 3DG9A 7MHTA 4J0KA 1W36C 1XTZA 1Z5UA 2CWDA 4HAWA 4R1QA 3UGQA 1F6WA 2NZJA 4A8JC 1PQPA 4MQEB 2J31A 5JQGA 3T3OA 2BSXA 5JSFA 4EKGA 1UMBA 1ZXXA 3DWGA 1FX0B 4JEMA 4JP8A 4LTNA 2PX0A 3URKA 4BJ5A 5JU6A 1C30B 4MIYA 3W6ZA 4DCSA 3P9KA 2PKQO 4L5IA 5ISMA 4BY9E 4D4MA 3THXB 3VU1A 3H65A 3TMYA 1ZHFA 3SIRA 2O4UX 4L8GA 3RJ5A 3ZZTA 3OZAA 4DJEC 4D8VA 1HM5A 4H6XA 4QJ5A 2W58A 1OA1A 4GPTA 4QICA 2QN8A 1NAIA 3EA4A 4YHHB 1JYSA 4WMLA 1BCSA 3F3MA 1QXSA 3NBUA 4KQGA 5AQ1A 4FZ5A 2UAGA 5E6SB 3B20A 1IUOA 1J0DA 4OXQA 1YZLA 2R4QA 4E1AA 5LWHA 1ZNZA 3LW7A 4FEAA 1S9DA 2O7VA 2PUHA 2BM1A 5TV2A 3U2QA 3T8YA 4J0HA 2K7ZA 1VLLA 3HBJA 3I5UA 4NABA 2ZVDA 4MH0R 4X7RA 2BTEA 3G5MA 2I3ZA 4L6AA 4XGQA 2Q3EA 2AUNA 3IP7A 8AT1A 3CEJA 3AF6A 3JQAD 4UVEA 3VU9B 3DFZA 4DQDA 2GCIA 1G17A 5F35A 4K81B 1X7XA 3E9DA 1XGKA 3P5BA 4RZXA 3RREA 2FSPA 2VHUA 2OM6A 5D5HA 1FYFA 4A92A 5YASA 4Q02A 2BBSA 4A0FA 1AA9A 1WV1A 2X8WA 2VJMA 5ENZA 5ABPA 3M6MD 4FGLA 2BH9A 3SLGA 3G0HA 2J8ZA 1ZN8A 2VNHA 3RO7A 4XW2A 4IDEA 3WDMA 2WU0A 4KQMA 4X7MA 3N7TA 3I83A 4RA6B 1Q17A 4JLBA 4TVSA 1SCQA 1EI9A 1YU9A 3K9QO 4XCVA 3RNLA 4CPDA 3EF1A 5CB8A 4RBNA 4ALIA 4ITVA 3ZGYA 1ZD5A 4O4LB 3SLKA 2EC5A 3UT6A 1X7DA 2NXNA 3JV7A 5CYFA 4NK5A 1Z5OA 3O74A 3CJQA 3MIIA 2HD4A 1G3MA 3RSGA 2AFRA 2YV1A 4DXHA 4IDHA 3P8ZA 4XE5A 4DCVA 2G77B 5DW0A 3INYA 3SD7A 3WHPA 3LWNA 4HFNA 4RTLA 4L4YA 5E3HA 4HDKA 3HN6A 2BLNA 2I1VB 5F5LA 1GL3A 3GEGA 3G2IA 2DFPA 2W00A 3K9NA 1YB5A 3IMFA 4FEGA 1EVQA 2I6SA 4JR2A 5EEHA 2H9AA 4U00A 5JS7A 4UZEA 821PA 1XQYA 3F6YA 3LM8A 2OZVA 3GDWA 3KXPA 4MV7A 1QP7A 2YMPA 2QDKA 3K09C 4BFLA 4DAEA 621PA 3ZLTA 3FY4A 3DTVA 4TM8A 3FTPA 3QMVA 2I6GA 1PQWA 4W5HA 5LP1A 1YVUA 3JYLA 1UKVY 4C88A 3KQLA 1JT2A 3O84A 1XD2B 2C1EA 4CKXA 2OC4A 3F5MA 1D6NA 2IIVA 4OSPA 3N8DA 5ECYA 5P21A 4JJAA 5G4LA 3GQBA 3RASA 1MBZA 4JYAB 1II8B 4QM6A 4D9CA 1JHOA 3E3OA 4I36A 3QOYA 5JWRA 1GU7A 1G8KA 1ZESA 2E37A 4EZBA 1GRNA 5KNBA 3ZWWA 2JRCA 1GZ6A 3KV1A 3MT8A 4OL9A 5EXSA 1ZQ9A 1IWBB 1EP9A 1EHIA 1J07A 1WDWB 3BMNB 3HJNA 5F1YA 3RANA 1SUCA 4N3GA 1M2GA 1HDZA 2Z58A 4G1BA 3OPYB 3AEUA 2XXAB 4WVFA 5CITA 2VO1A 2AF4C 2NU6A 3CLTD 2EFJA 3OKFA 4V0RA 3MJSA 4ZHQB 5F7XA 4YRIA 3EYWA 5IJZA 3OZDA 5EIFA 4B82A 3FLBA 3WMGA 3SXUA 4N7RA 2WQ6A 1RRGA 1FE8A 4RHEA 5ALQA 3PLNA 3T3HA 3C2QA 1R4NB 4AVYA 4YR9A 3GO4A 3DVQX 3QOWA 1A9XA 4CKZA 3PL5A 4NG5A 5HHTA 2VLBA 1D03A 4AL4A 3RBVA 3N2LA 4H6WA 4R68A 4M7WA 3O21A 2HUPA 3UMGA 4ZK2A 2EP8A 2NQTA 3OC6A 3OX4A 1O08A 4ZICA 1XTVA 1ZIDA 2PBRA 2GDZA 4QUKA 2GXAA 4FSXA 1WL8A 5KOJA 1F20A 3C6BA 4P3PA 1E1RD 2QXYA 1RPZA 1VE1A 1HDGO 7ABPA 2XGJA 5EHIA 4ETNA 5LDDC 4FFBB 4GNRA 4EYOA 3CRVA 3TAUA 2F1KA 3I04M 3STUA 1MO3A 1M75A 1LH0A 2I8LA 4R84A 4E5KA 1TUGA 4PICA 1NIJA 1QVVA 1TFRA 1EP2B 4DWOA 1A82A 4TQAA 5TMEA 1E3WA 1XQVA 4D9MA 3MJFA 1U80A 5E1DA 1PZHA 2ILVA 5LM3A 1W35A 3HO6A 4UM7A 4EJSA 4ZAXA 2TS1A 2HYIC 2O59A 2I4IA 2X41A 3O2NA 2LKCA 3A14A 4JI4B 1GPMA 1E5XA 4YB8A 5SZHB 2QD1A 4KTVE 5HCNA 2D7JA 1U0NA 2D6FA 3WL6A 3ON5A 1U0JA 4ZV9A 2J9FB 4EG0A 4KPEC 4IHQA 5EJ5A 3T0GA 4JI8B 4ZOLA 3UWPA 1DKQA 1I6KA 1FDSA 1M2KA 1TT7A 4B3CA 3T5AA 3LVFO 1A9RA 4XB6B 4YJ3A 1BO6A 5LNK1 2ZBRA 2XLBA 1JG6A 5F3RA 4PNHA 3C5CA 1YA8A 3GGCA 4BVEA 1HSOA 5DTEA 1GQFA 2ZUEA 1HMPA 2YXEA 2W98A 1ABFA 2PSJA 2QMUA 2WP0A 1GUFA 3OF2A 1RFGE 3G23A 2P2NA 1K7FB 3K2QA 2H18A 4NBVA 4OXYA 1GV0A 1Q0LA 2ZG6A 3ZE8A 1G8GA 1NM5A 1FB5A 2ORYA 3I9NA 4OUDA 6REQA 3P9IA 2JFYA 3N2NA 1ECCA 1B0ZA 3D7LA 4C3ZA 4JXXA 5JTUA 1XG5A 2A0WA 2WJWA 3CFYA 1R9JA 1ULUA 3COSA 5U9CA 2I4RA 5KS2A 2VNAA 1COWA 4M60A 1IM5A 6LDHA 5KPDA 1J24A 1R5BA 1N3IA 2AFIA 2POQX 1ISPA 1ENZA 1TUEA 1J97A 2FPSA 3F98A 3SJCA 2A9OA 1GGMA 3T9EA 3BIOA 3I2HA 2PRIA 4BNFA 3CN7A 3N28A 1Z4NA 2ZSUA 4KDFA 4X8OA 3D4BA 4A0GA 5BV7A 4XQGA 2O8FA 5H82A 1Y89A 4HH1A 3C5EA 3JZFA 3QE2A 1ODCA 1PK7A 2HF7A 2UVPB 2X7XA 3SFZA 4RTMA 4RVGA 3UFXA 5BSVA 2D5BA 2ENUA 2IE8A 1L4MA 2RGXA 3K71B 3H87A 4QDUA 1FP7A 4LYGA 2Y0PA 4B6EA 4IIDA 1O8CA 4OHFA 3DAFA 1P4HA 3MMXA 3FPSA 3TLGA 5JROA 1PR9A 2JJ1D 4UVDA 2GEFA 5ESXA 4MITA 1JIKA 2O3TA 5AXDA 2MCFA 1JQAA 3W6UA 4QBIA 1H2RS 3VC3A 2FEMA 4OTZA 4I8IA 5LYJA 4XVRA 4D82A 4TV8B 4R2IA 1T3SA 3I30X 3PKJA 4J1SA 4NAVA 2FUG1 5HJ5A 4GRIA 5AM2A 1IBLB 3VR6H 2QXUA 1BG6A 2Q5HA 1ZEJA 1CEXA 1GGKA 3AEQB 3NHZA 2O23A 2WKWA 1C1HA 4IQ4A 3H5WA 1GARA 3A1SA 2ATVA 2G83A 1A5TA 4GD3Q 4NYJQ 2OYRA 4YT2A 2H1SA 1PJQA 4I1IA 3D3WA 1XTSA 4II7A 5JFTA 3STYA 1WZUA 4MCJA 3BFKA 3PXUA 4LVCA 4E13A 3SOPA 4ZI5A 1Y7IA 2HJGA 2PGDA 4G63A 5DGTA 5IAJA 3WLNA 2XNDA 1OBOA 2Q27A 3ENWA 2XRZA 1ZXBA 3L77A 5CB4F 1BS2A 2GXSA 3LOQA 1RM3A 2CLKB 2YZGA 3HUUA 1MCZA 5AKLA 2J5RA 2GH1A 2A2ZA 3KXDA 4CYMA 4MV4A 4MYHA 3M7IA 3BK7A 5DW3A 3GL9A 4C6SA 5BR4A 3I42A 5CM2Z 3R41A 2BFDB 4GOMD 3DM9B 4RKQA 1ECFA 1XDDA 2D1FA 2ZQZA 4LEIA 5LQMA 3WWEA 4CMKA 1JHZA 4B4WA 4PBTA 2PT7A 4A2PA 2YFKA 1PGQA 3KB8A 1ORHA 3NTVA 5HQJA 2VDLB 4AWAA 3HYRA 4EF4A 5HG0A 1I0IA 3SVZA 3L79A 4P83A 4LW8A 1CUAA 4HAVA 4U2EA 4F3CA 2GYWA 2YYYA 4P7GA 5A03A 2P40A 3SWWA 3BIJA 2CCGA 2VP6A 2CDBA 2H06A 4ZT6A 1SBTA 4HF7A 2AEMA 5NLLA 1L5LA 5DISB 3GUZA 4G65A 4XSHA 2ZJ6A 2IIPA 4YA6A 4H1WA 1Z2NX 4IIGA 1GPBA 9ATCA 2HXYA 3NKVA 3R6TA 1N77A 3LLCA 3PNOA 3MWDA 3UCFA 4FGKA 1PG5A 2WUEA 3ANYB 4M1SA 4X61A 3AW9A 4XIYA 4ZTZB 4KITB 4W9MC 2BISA 2FN8A 4GR4A 3UHFA 3HDTA 4BX0A 4OXRA 5F12A 1UFKA 3U9LA 1FVFA 3E2IA 2BN4A 4QJBA 3PDIA 5ALZA 3C5WP 1QH0A 4EEKA 1KYTA 1QMPA 3OX3A 4MV9A 3I01M 4RLFA 4AX8A 1XYVA 3RTGA 3G5TA 4GM4A 4WLFA 2YS6A 5HBGA 2J0QA 4FI3C 4M8KA 3OLCX 1QV7A 2HJWA 1SCAA 1GN8A 2GPJA 1LPOA 1SG6A 4Q34A 2XE4A 1N6PA 1XZGA 3W79A 2GCOA 3TF5A 2OBBA 1CC1S 3GWGA 1KHTA 4KN5A 2ONYA 4L08A 3IPCA 2D13A 1FYEA 1OWNA 2KLBA 2VYND 4NCNA 2WIDA 5CT5A 2YJNA 1LPSA 2MR6A 4JLVA 3E2MA 2FK8A 5KZMB 2IYLD 3LP8A 3L7OA 4JELA 5HTOA 4IWXA 2Y71A 1YTUA 5ALKA 3T4UA 3P9XA 1L5FA 4HNSA 3TPFA 5EJ6A 1X1SA 1QTIA 2C9MA 5AJVB 3GLVA 1VCHA 1VSVA 4E2ZA 2QP4A 3AVYA 1HV8A 4TN5A 1YA6A 2PX2A 3NYIA 1OB5A 2JH9A 1KK2A 2LBPA 1FDUA 1VL5A 2NNLD 3CA8A 2JHFA 1RCTE 3K1TA 1VIYA 3MMNA 3JRWA 4BE4A 1NJGA 5CJJA 3PTLA 1BMFD 3M9LA 3B7WA 2RHMA 4RWEA 4CMJA 2GM5A 4M46A 1IN7A 6ABPA 3DC2A 3REQA 2ODAA 3A31A 4C7XA 1R6AA 2HLHA 3OCWA 2B83A 1QHFA 4N9WA 4WEOA 5BQFA 2PSSA 2E87A 1P9LA 4ND5A 4L9AA 2VBIA 2IZZA 2LDBA 2QN7A 4JOCA 4N5NA 4K9MA 4CIVA 4DIUA 3CX3A 1KAOA 1GNQA 5JWOA 1LPAB 3KZOA 2DBQA 1B0UA 3GB9A 2F2TA 4LOKA 2CV0A 2OFOA 1C7RA 4MW4A 1CEYA 2J4CA 3DGFC 3JWEA 1L7MA 2GFQA 3K1YA 5HK8A 1O4WA 1T1EA 2Q1TA 3TG2A 4O2RA 3ORHA 1UJCA 3CCCA 5TNXA 1PVOA 2R25B 3S40A 2PJUA 1MOQA 5BYBA 2PZLA 1NXXA 5CGZA 3RE1A 3FF1A 1CJUC 1KO4A 3ENZA 3KKOA 1RMQA 3IT3A 2BGMA 2HPZA 2OY0A 4K9NA 4P7KA 2GM4A 1N78A 1UR5A 2YINC 3W9UA 1D6SA 1U8UA 2VXYA 1KFEB 3DEYX 2X5XA 4N0MA 5KNCH 3G7NA 3K9FC 5IYZB 4RK0A 4EQZA 2RARA 2R62A 1OU4A 5HE9A 3VRHA 5LP6B 1IJFA 2YIMA 2O3SA 3HA3A 4RIFA 4XWYA 1FSPA 1U5CA 4C1BA 5C1DA 2PT6A 5DI3A 2PKWA 2R6DA 3GNSA 3TBKA 2C4VA 1W88A 3TTUA 3A70A 1L7XA 4OYHA 2PG3A 4A6PA 1TEVA 4C06A 1YO6A 4IUDS 3DXXA 3L82B 4HEA1 3H1EA 3C85A 3DOCA 2B3TA 1ZW6A 3GLKA 4RK7A 2NIPA 4LOHA 3RVBA 2SKDA 2G06A 4AJKA 1YFKA 5J2TB 1AXEA 3BK2A 4BNKA 4TYQA 4HX2A 1ZOLA 3G82C 1WQ1R 2V5VA 4UEOA 1DLJA 2NTYC 2D5AA 2YOFA 2H57A 2WYWA 1VYUA 3LLMA 3BXOA 5CYOA 4ZCMA 4TKZA 3LLUA 2WT8A 3H9EO 3DE2X 4JVLA 4RZQA 4PPNA 1U94A 1Q7TA 1V1JA 1I36A 3HKEA 4E1BA 3BUSA 2OCPA 4V0ME 5AKHA 2FUEA 2NYRA 4ZTBA 3L7LA 1I10A 3RFCA 3LC7O 2RE8A 4ZPJA 4KGZA 1TIBA 3U4QA 2DU8A 4DDVA 1QIKA 4JQYA 3TXAA 1AU9A 5BOVA 3H9JA 4LS3A 4R2JA 3KE8A 4KWTA 4IG4A 4YRJA 1RPJA 1ZM9A 3ORFA 4OD0A 4CM4B 1FLNA 1KK3A 2JIRA 1R6VA 3R7AA 3ZDRA 1F9EA 1NR7A 4OHVA 4BP8A 2DWPA 4S1VA 4F3YA 3TSYA 3RRZA 3Q40A 2OSBA 3UUFA 1JHYA 4P22A 4OHBA 2GRJA 1J22A 5DO9A 1P72A 3ZE7A 3HO1A 1YHZA 2ZETA 1L7RA 2EF0A 2A0UA 3R40A 5HJ7A 3CTMA 4NWIA 1FTGA 4Z49A 2XQFA 4DADA 4TTQA 4WNAB 3VNRA 5EPUA 2X42A 4RHYA 4BWYA 4NU0A 3F90A 3WGIA 5L3QB 5DRYA 2VBGA 3RRFA 5BYJA 4AZTA 5F64A 1RXUA 3N39C 3PGLA 4Z9FA 4MWGA 1U3TA 5AHKA 1CZHA 1IRIA 4HVCA 1ZSNA 4GWLA 1M2OA 1TD9A 2OCLA 1TEHA 1LBTA 3R0IA 5AJYA 3QX3A 1O9BA 4AJ2A 1RYFA 1UP7A 2VK4A 1EX1A 2YQ5A 4QAJA 1KETA 1JA0A 3ZY4A 4BNZA 2ZZNA 3M81A 1GSOA 4QGBA 2JASA 4V1CI 2QLMA 1ESDA 4OLAA 4CW7A 3NKFA 1B6RA 2HQBA 4HZUA 4LRUA 3S8YA 1IZZA 4LMPA 3OTOB 2X0DA 1W8IA 1Z5ZA 3DLHA 2QTWB 3QTBA 1SHUX 3PGJA 3ST7A 4A27A 4DJDC 1U0EA 2VDWB 3SN6A 2VJYA 4LX0A 1H42A 3WL4A 1PFVA 3HZRA 1J8FA 5CFZA 4JI3B 1C3XA 3WNQA 3EMVA 1S3SA 3NEJA 2VSFA 2PX3A 3LRXA 4W82A 2B69A 1MJ5A 1AKUA 5JXJA 3S68A 1ZNWA 2D2VA 1XVAA 2G36A 4M98A 3GBSA 9MHTA 3HABA 2EYUA 4FFSA 3EQZA 5EMKA 3VX4A 4J75A 3CPEA 1SKAA 2J0UB 2Z08A 2A5LA 2DQZA 5EVJA 5L3SB 2R7MA 4BO1A 1W30A 4N5HX 1QPZA 1FU4A 1S2MA 2BCJQ 1Q92A 3NIDB 2PVSA 4HBZA 1MTOA 4OH7A 2EKLA 4RXUA 3SC2B 4UTNA 2BWJA 2O2XA 3W3ZB 2G72A 2HA3A 3G2KA 4K88A 5JS6A 2XYPA 4B2IA 4YAWA 4BB9A 3GJXC 2HUNA 3AUXA 5THKA 1E7SA 1UXHA 1OD6A 1UXKA 2HBYA 2XV1A 3QTLA 3SNKA 3UAYA 1MV5A 2WA2A 4HB0A 3WB9A 4BX8A 5HQ3A 1I94B 3BXZA 4TLEA 5HZKA 3EGXA 1Z75A 3L8GA 3RAGA 4DJFC 1SB9A 5CX1B 3ZU3A 5KHLB 1QGED 1P7VA 4MS1A 5AM5A 4AY5A 1FCJA 1VMAA 3LY8A 3IBFA 4R2WA 3OLXA 3G2MA 4AM8A 2RBGA 3AI3A 4F6LA 5EKUA 2G1KA 2AOVA 4W1RA 4I9UA 4EDHA 2XBLA 3COYA 2BGLA 2QQFA 3RABA 3L07A 3LCMA 1GTJ1 3PUZA 1OGJA 4IMPA 2OBFA 3KIPA 4RVDA 4J0QA 1ZQ1A 3VR0A 4BWVA 2ZVPX 1KK0A 4QGSA 2W6JD 5KX5F 3NQ41 2PL5A 2H29A 2GF9A 2XUZA 2FQYA 3AJRA 2H7CA 5BVGB 2PSEA 4W5OA 3W8EA 1TECE 1K66A 1K8QA 3E27A 4RHXA 1I2AA 3DWFA 2RGNA 2RHBA 2W6QA 3LIIA 4JEHA 3SS7X 3VTZA 1XU9A 2GZSA 3EGWA 4HQ6A 4D0NA 1QIDA 5KSZA 4Q3KA 2NO6A 3O4IA 1XMJA 4KHPB 2NZ8A 1MEOA 4GMXA 4GICA 1T8UA 4K9KA 3PUJA 1U7PA 2BIFA 4N3BA 1IJEA 1IQPA 1PR3A 4WKNA 1G4UR 3R20A 1K5HA 7ADHA 5JIBA 1PD1A 1GLGA 4Z3OA 1O97C 2VF8A 3N58A 2FLWA 1Y4ZA 2QTLA 3FPFA 1QRUA 2ZRDA 3KDAA 4XUDA 1Q0SA 3A4VA 3IP6A 4MYUA 1GPLA 4OHZA 1E79D 3KBBA 1R6UA 4XVQA 1RWMA 1OASA 3EXHA 3KAQA 4TUYF 2FUKA 2ICAA 5FTNA 1AK2A 1CE8A 3G68A 1HE2A 2O19A 3WA6A 5A5EA 2ZBQA 1IQUA 1VJCA 3OE7D 4JXKA 3P32A 4QNMA 3TJRA 5JH7B 3W06A 2JGMA 1O1YA 3IAS6 1ECGA 1SCBA 1ZC4A 5D3QA 5D6OA 5G0VA 1M5UA 3LDFA 2ZWIA 3V1YA 3A4YA 1ZGBA 5KVCA 4CKBB 4EUKA 5E2IA 4P58A 3ZH9B 2F43B 4JI5B 4EJ2A 5BQXA 5DCWA 3AESA 1M83A 1SCIA 1X77A 3L8FA 4KEAA 4MUGA 3UWOA 2UUCB 3BGDA 3G0BA 4B5KA 5KJFA 5DP1A 4GMGA 13PKA 2QR5A 1HRDA 2IYWA 4TRJA 1TVCA 3EZXA 5BV1A 2BE9A 4GPAA 3IMGA 4YQYA 5ECGC 3EXAA 5KTNA 2ANBA 2RB5A 2BZ1A 2ZB8A 1XB2A 3ITDA 1C3LA 3QA3E 3NGLA 4MI9A 2AJBA 1ZG3A 3IOYA 1VKOA 1Q21A 4NCJA 3HI4A 2QM3A 4HO1X 2QV7A 3CJTA 3A25A 1M5TA 5CVJA 3SM9A 3T9CA 1KS9A 1ECJA 2ON6A 2SHKA 4M88A 2Z4SA 3L7NA 4OFXA 3VKFA 1JFRA 3HJCA 3LIPA 3KRTA 1OUMA 2I76A 4FOSA 1NW5A 1U2SA 1DJPA 2HU8A 1LNZA 3P4UA 5DNDA 3OT1B 5FNZA 3MBOA 5TEWA 4DA4A 4MR8B 2WVHA 1UBRS 4P0QB 2IDZA 1YGPA 3OICA 5J59A 3ZXYA 4EPVA 2AYXA 4LFAB 1EBFA 1XEAA 2DLCX 3NXKA 2O6HA 1K7YA 2V3CC 5C5IA 1DFIA 1QUFA 4KN9S 1HFEL 1L3IA 2EIXA 1O94C 2IPOA 2PS0A 4RXTA 1NX6A 4FMCB 3U0VA 1JYFA 4GPBA 2Q7DA 2ZSDA 2XZTA 2EF1A 5BWNA 3ANNA 3U7FB 4EUNA 1OB2A 2RKOA 3AKDA 1CUSA 8LDHA 1NM5C 4EOGA 3W8RA 1D2HA 3LX4A 2H8KA 2VA9A 3ZOZA 1W94A 4JX8A 3SX0A 4RTNA 4ZCRA 4V02A 1E3DA 1DKMA 5G1PA 4LMAA 5K3CA 2AQHA 2R11A 2TRSB 2WIKA 3I04A 1E0DA 3N6RA 5A0FA 3U62A 3U48A 5HUQA 1PNOA 2GZDA 4BJHB 2ZI4A 1W1IA 4HLQB 2GEJA 2ZQYA 1HYEA 4M6WA 2AN3A 3LKZA 3TE7A 1QS0B 2A67A 3UAWA 5JJ5A 3GPLA 1QBKC 2Z9DA 3VVCA 3UWKA 1IXYA 2ZUTA 1NN0A 1SXJA 1SO8A 3ZDAA 4TX1A 2XKJE 1IN4A 4IUCS 2JVIA 2P9CA 3DE3X 3FNQA 3LI2A 4Y6QA 5ARDA 3R5XA 4KE8A 1GQRA 3NVDA 2YHUA 1LC0A 2PL9A 1TUIA 2BEUB 2WE7A 3BB4A 5D2CA 3WGKA 1N2ZA 2O3QA 4GYJA 2PN1A 4LYYA 3L6DA 1FK8A 2R6CA 1RAEA 2CLHB 2HTEA 2EDAA 4BGIA 4BO8A 1C1YA 2AX3A 4B4DA 2I4LA 3I2JA 1FNMA 1SVOA 3V4VB 2QXTA 5H9VA 3HFJA 3T52A 2OVFA 4C2UA 4CZ2A 3VZBA 4GLFA 2X0KA 1YAHA 3N3AC 1Z0IA 1T5OA 2GM9A 2VYNA 5SY9A 4AN0A 4C0SA 5IKXA 4MKIA 5JI2E 4YP7A 4NNPA 1LU9A 4ND8B 3V3TA 4D9FA 3HDVA 3L6CA 3HS3A 3MGCA 1BXRB 1QVRA 5JLAA 2I4TA 4R54A 1A7AA 1BH2A 5GVRA 5KHOC 1N2EA 1D2EA 1DC7A 3C4QA 3O3OB 1QFSA 3DMTA 1U9ZA 5BWMA 2V1XA 3EVGA 3RKSA 2FPPB 3E9ZA 2H7YA 5DDIP 2FUCA 1AUPA 1NVVR 1ONOA 3GFVA 3GU3A 4Q39A 3NOOA 4PN3A 3BRCA 3KTFA 2Q6IA 4IXWA 5IJAA 4P1ZA 1YDWA 1P4AA 3VKWA 5HKOA 2C07A 2NLOA 3I8XA 5H3HA 2RD2A 3CJRA 1TTQB 1BMFA 1Z4PX 3K8OE 4GF5A 2QVCA 3VZSA 1VP3A 1XEXB 2Y1OA 2Y1KA 2O57A 1DVRA 4JJ8A 3P9ZA 5E6UB 1VCMA 1U2GA 3QNUA 2W2QA 1EQUA 2ZJFA 3S5UA 3RSFA 5IM4F 4N5IX 3EPKA 1A1VA 1SUFA 4LF6B 1CULC 1YONA 2Q5EA 5L45A 3PWTA 3VFDA 4INZA 4TTTS 1HE5A 1NUTA 1T0UA 2B5VA 4FS3A 4K1LA 4U2GA 5DULA 3SEAA 1X7WB 4ARIA 3PF9A 3VPXA 4U39A 4DMGA 4CTMA 3RAEC 1D4ZA 2WF6A 5ALGA 4GPIB 4Q9HA 4DKXA 2KS6A 4OQNA 4PZPA 4RPKA 2CFIA 2QBYB 5IKMA 4ZOCA 3M89A 2KYRA 3A7EA 3VBEA 4CIXA 3M4XA 4MR9A 3OCUA 4HXFB 1ZD4A 4RJ2A 1ZIXA 2IP2A 1KA9H 5FRDA 2AR7A 2P90A 3FUVA 3DQQA 4IGFA 4R81A 4DQLA 2G08A 1UC8A 3JZIA 4KBYA 3FRHA 4CQNA 5CP8A 5LQRA 3WBBA 4D79A 5K8UA 4RFVA 1W36B 4G0YA 1DXQA 3QFSA 2J3JA 3GLRA 3ONVA 4QYIA 4XQCA 2DGDA 1MX1A 3BHMA 4H0CA 4NEGA 2ZJZA 2ZUVA 3HJUA 1LBSA 1R27A 5TQJA 3DEHA 1RWWA 5TEVA 2VHXA 4KFUA 3B1XA 2CJXA 2J9YB 1NP6A 1U1CA 3IQXA 2XZLA 1DKLA 2FVXA 2JJ2A 5CLQA 3N1UA 4DNXA 4P5PA 3LUPA 3SBEA 4M9ZA 4AJHA 5LQJA 3E05A 4MKFA 2OENG 3DLAA 4EA7A 3ROMA 4K9DA 3R8CA 3CU5A 4BBPA 3DD5A 1RXWA 1YQDA 1YB6A 2X15A 3HUDA 3TE6A 3BWBA 3NFRA 2NZVG 1E2QA 1YS9A 1JEQB 2V7PA 3EZ2A 3I9V1 2NU8B 2UUAB 1ABBA 1GGHA 4Q3LA 1F7VA 1JMYA 4IIJF 4HNQA 5JVDF 3MCVA 3VPAA 4LZNA 3TTYA 4M9CA 2CVOA 1H69A 4YUVA 4XTCS 2G5CA 4F5EA 4KOEC 2QVZX 3ID6C 3IERA 3R4VA 2D0PB 2P9QA 3O8CA 1CLUA 3HEAA 2DH6A 3QJ5A 3HN2A 3WJ2A 2PXXA 3C7AA 2FMUA 2O1WA 2ZI7A 3TQOA 4IOKA 4ED9A 3G5UA 5JANA 2D4AA 3R0QA 1N9ZA 2FOLA 1MH1A 3SBDA 2D62A 2IBMA 4FZ3A 4H3HB 3D2AA 1AQNA 1I3MA 3IIIA 5ILOA 2QRPA 1BXKA 1DKNA 4NG4A 3O8QA 4ZALA 1I3NA 1SIOA 2GM3A 3JW8A 1J2EA 2P62A 3DQZA 2V03A 3IR7A 4MS3B 3DEZA 1R8YA 4P4TA 5H68A 1XQWA 3ODGA 1O6CA 1I4LD 2WF9A 3Q0EA 4AXXA 3HB9A 1K08A 3LOPA 2XITA 4IDFA 2FF7A 1YS7A 3DBHA 4B76A 4C4ZA 2OGZA 2GFHA 2ZRIA 5I9LA 2C04A 2ZJ8A 3V7YA 1MB3A 3R0ZA 1YULA 3QVXA 4IQGA 1SEVA 4B80A 3JATB 3QE9Y 4CKYA 1GFWA 2QVBA 3I12A 4ARZB 2QK4A 4CF3A 2REQB 3B7PA 3I01A 4W5WA 1H0SA 1P2BA 3P45A 3HA7A 2ZE5A 2WJ6A 3WHKA 1J2UA 1RPNA 1OWMA 2BHTA 3NASA 4LX8A 4MR7A 2BKEA 1H8EA 2ZYSA 4A3SA 4N49A 5D87A 4R7ZA 2WJGA 3C70A 4EG3A 5M29A 3BWCA 4LUCA 3FOAA 1Y1TA 3ZU2A 4EFLA 2IHZA 1BD4A 2CVQA 4B32A 5GQSA 5CBKA 2R2GA 3C3CA 2AN1A 3JD0A 3LUGA 3GLFA 4GDFA 1P3Y1 4DWJA 5JDCC 4D0RA 4WKGA 4CT4B 4MPRA 3NT2A 3PQFA 2GD6A 4EFNA 1KR5A 3FDZA 5JWHA 1V26A 3F67A 1FYVA 2YVQA 4S1WA 1YQTA 3VHLB 1QYCA 4AUMA 4GECA 1MU0A 3E7XA 1L9KA 1REQB 2QSUA 2SKEA 1LI4A 4G5XA 1KE1A 3R7NA 2VRCA 3WBKA 3MAJA 4CU5A 4C21A 4PZDA 5KNDH 1YVPA 3HCPA 4IDQA 4N3CA 5LN1A 5JCPA 5TY0A 2PV7A 1BWSA 5I7WA 1IMOA 1CP3A 4Q3BA 2A0XA 4L50A 4EI7A 2R7AA 3NRCA 3VDNB 4BVBA 3OX2A 2AHOA 2IHUA 5HBRA 1IQRA 2XEDA 5DHSA 4MVJG 1PR1A 1QYIA 3IFSA 1WR8A 3Q3EA 4JL6A 4RF2A 1T8TA 2CNBA 3TIVA 1XL1A 3HWX1 3HHPA 5GONF 1Z39A 2BM0A 2FK7A 3G6WA 3C5HA 3HNRA 1P1RA 3UJ3X 2F55A 1H8HD 2QAGA 4BRWA 2ECOA 4ZEVA 1R6TA 2K4MA 3VVBA 4YR7A 1BE1A 2ZJ3A 2IKQA 4WDRA 3PUKA 3RU3A 4BN0A 1EHYA 3H84A 3OIWA 4YMUA 5ANRB 3WMXA 3VI3B 4NPAA 3GI1A 3V7NA 2EFHB 4L0MA 4GM1A 2JJ8A 4G5FA 4J0FA 1WXIA 2Q3LA 3DOFA 3REOA 4CLRA 3UMFA 4B8ZA 2B99A 3RLIA 1ISRA 2QNIA 3K31A 3EDQA 1C9JA 1QLHA 1VKHA 3TGPA 1PUXA 4IQFA 3IUMA 4LZPA 4DDWA 5E0KB 2WIBA 4DLPA 3RYCB 2ZIFA 4UM5A 4J0DA 5SZJA 3FR8A 1L7VC 5DNAA 4YCSA 3EE6A 3GRRA 4CDRA 2Y9PB 1LSSA 2ZYHA 4D9NA 3AEXA 2HMVA 2Z4RA 2WYVA 4E30A 2PX4A 4X20A 5K4AA 1DPFA 4EKYA 4CLOA 3I2KA 1MNAA 4AJ9A 1CUFA 3GIWA 1T6BY 2PL3A 1WUJS 2D54A 4C43A 1ISHA 3R6LA 2I3AA 3Q72A 5CB0A 5C0OE 4BCCA 1US8A 1Z8FA 4JI0B 2VBCA 2Z3WA 1E96A 1YR8A 3D5TA 2HLDA 4WUTA 3S81A 4LVNA 2Q29A 1VPDA 3ZDEA 1ZGJA 4YCLA 5AKXA 2JI4A 3PDWA 1PJ3A 4GQAA 3MM4A 2WBLC 2WMDA 3IX7A 3MTGA 2BD0A 5EERA 2IHJA 2ORVA 3HGTA 3WGUA 2WINI 4EA6A 4BE9A 2H2FA 3DCYA 3FCYA 4GOLD 4RDXA 1T9AA 1AUOA 2PZMA 1U98A 1NN5A 3UJPA 1YDEA 2B6NA 2GK4A 4AG5A 4O1MA 2ZR8A 4MIKA 1V4VA 3RS8A 4XASA 3T5MA 2Q3CA 2QTFA 4O4HA 5BW4A 2Z8XA 2EZ9A 2YR0A 1RC1A 2OHGA 2DKOA 1Q95A 1E79A 2YJGA 3PQ2A 3LFTA 3TEMA 1SCDA 3GCWA 1ZRSA 3ITNA 5JEDA 4HRXA 3C4VA 5JV5A 4ZVNA 4JUDX 4YY3B 1GUBA 3PQDA 3E70C 1HOTA 2FVYA 3OE7A 4WHMA 1HYQA 5JTTA 3A6PC 2Y2VA 2PKEA 1YWGO 3NDIA 1QOZA 3J7TA 2LIVA 3PIDA 1JFVA 4PAMA 4BJ6A 3K4HA 3K8ZA 4OPMA 1WHSB 1HFJA 2RG1A 5FPPA 2NO1A 3BRWD 1OYYA 4BNWA 3E18A 2RAFA 4JJZA 4XTRA 3VQTA 1J8MF 1AC5A 1KY3A 3EBPA 3I1IA 3JARA 4G89A 4KMSA 4LV6A 4UMVA 4W9RA 4CQMB 1F0PA 3FMOB 2I7CA 2O50A 2F62A 4Q7KA 4X1IA 3LY7A 4R7TA 1FSGA 2DTDA 4XRGA 5IH7A 4U0KA 2DBZA 4TGLA 1T29A 3S1SA 3ZKWA 5IT4A 1V71A 3FBGA 1XHEA 4R8SA 1V35A 4J9VA 3V00A 3EGEA 4GKBA 1F2UB 1L5QA 2ST1A 2IV3A 4D4GA 3JRNA 4TWRA 2EP5A 4L5AA 1GPYA 2B78A 3U39A 3ETLA 2K87A 4BYMA 2DFNA 4YUXA 4US2R 3AF2A 2W8ZA 4KR9A 1CUHA 1WBJB 3W4IA 2C1XA 1O9GA 2W90A 1FSFA 1GJRA 2H8GA 3C8MA 3HEBA 4M2LA 4MQFB 4PXAA 4W6QA 2ZBUA 2C2KA 3BSSA 4NBTA 5CTAA 4HPXB 3IXMA 4E5MA 1E1KA 1UK6A 3EQ7A 4FHDA 2BONA 3LK7A 1HG1A 4WINA 3V1LA 3EIOA 3MLEA 3UJ8A 4P4LA 1FXUA 2RHWA 3JQPA 1E9CA 2A5FA 1GVNB 3FFAA 4BLOA 3A3YA 3IAM6 1NKVA 3ME5A 3ZYZA 3WL7A 4Q1AA 4DMHA 2F3SA 4A1OA 1L3BA 2GFIA 4WXYB 1IEXA 3WLFA 3K0FB 3NM5A 1KQNA 2OHFA 1UK9A 3SMVA 4YV7A 4MKRA 3KJHA 5K2MA 4FW8A 4M7OA 1MIOB 3BXHA 1OLUB 2ATXA 3MJ4A 4P3NA 1VI6A 2QZ9A 5E9AA 2RGNC 5IT9A 2OO7A 1ZMXA 2ZYVX 3RVQA 4B7CA 4B34A 2G0NA 5AW8A 4GI3A 2QPTA 4MZXA 2J3LA 1M7HA 2VXBA 1WTAA 1OPRA 3AY6A 3AJ9A 3DCIA 5K8VA 1Q77A 2WFLA 2PMCA 2YCLA 4JKIA 2NQ8A 4BFWA 1H5QA 3FJOA 2FZWA 1L5WA 5LVAA 2DLNA 2OAGA 3G9UA 3IA2A 2YWHA 2ZIUB 4HGRA 4Z4IA 2BFCA 4YAGA 1MFPA 4IIXA 2VSNA 5CHEA 1X9HA 1ZYUA 3GAZA 3TQIA 4JT4A 4LNUA 2JAXA 1XEWX 4INJA 4I5DA 1AE1A 4BB5A 2G28A 3NALA 5JFGA 3EXHC 3FCXA 4DUZB 1VSQA 1L5HB 4URYR 3L0SA 1PR5A 3RC8A 1AA6A 1V25A 2GN1A 2P9HA 1V8FA 5BYAA 1FJXA 5TSDA 1BJKA 1P91A 1CVRA 2IF2A 3CZ5A 4RV5A 3CWZA 1CUJA 3Q8MA 3QW2A 2JG3A 2XB2A 3N07A 3EYAA 4WY2A 3D8NA 4FPXA 4HBGA 3ZY2A 1CUBA 1MEJA 1A5BB 1XTPA 3DMNA 5AH0A 2AFHA 5CR9A 1C7ZA 2F8MA 2XCIA 5CBPA 3ZHBA 1H2EA 5HRUA 3NIWA 1UMBB 3RTDA 3GLGE 2B8JA 4YP1A 4F8JA 1NFRA 4MGZR 4NENB 4YQEA 4ACBA 3CVUA 2G4LA 4LYAA 1RXVA 4DIOA 4Z53A 1X94A 4XWKA 5FBLB 2QDXA 3HK2A 1MAUA 3TIGA 2NVBA 5CFMA 4V1CA 1KAHA 4V0QA 4NYMR 3GD5A 1AUQA 5I5EA 3EXEA 3WE7A 2V3WA 5BSUA 3C6XA 1E7RA 2RHJA 3JY6A 4LK2A 2PBLA 5L8VA 1PZEA 5DEIA 1KWKA 3E9NA 1AK9A 3CIFA 3WIOA 4DDUA 5K3OA 2QWXA 1KNXA 1TCCA 5JQWA 3PC2A 4CCYA 2HZ7A 2IXBA 2A0FA 5DEOA 4ZQBA 4EABA 1YQ9A 2HT6A 2O8CB 4ZQCB 4BP3A 4OP2A 4AQ7A 1SJ9A 1JHPA 5DHUA 4RD4A 4I8DA 3EZFA 4BHTA 4F6RB 2JVJA 2JFBA 1J4AA 4BMDA 1C3OA 3CNLA 4DCGA 1JDTA 1NC3A 3TDKA 1U2DA 1ZM3A 1F2TA 4ZEXA 1ORRA 2ESRA 2A1TR 3GH3A 4MRMA 4Q3NA 1ZXLA 4FNMA 1LQTA 4IZIA 5FWAA 4ECAA 4HGOA 4UXJA 3MB5A 2D2XA 2BM8A 2E4ZA 3AP2A 2DSNA 3ZHSA 2PH3A 4PLPA 1UADA 5KYUA 1LUAA 1GDDA 3QX7A 3W7BA 3NHMA 5IVIA 2E6UX 2INGX 3P9CA 3KYIB 1ZD2P 1RM5A 2OHHA 2LE0A 4YJHB 4GIBA 4C0BA 2BTQA 1NW3A 3EUFA 5BT9A 2FSVA 2XAAA 1K6XA 1V1MA 2XTMA 4R3NA 3TAXA 4OIFA 3ESRA 4A5SA 2Y3IA 1Z2AA 1QC5A 1SXJC 2X8BA 4HDNB 3ETJA 2D7CA 1V1RA 2PGJA 3O2SB 4L6IA 5FULA 3CVYA 1Y82A 2Q4OA 4RA9B 1O95D 1T2DA 3DVLA 2XAUA 1MLDA 4B3DA 5GGYA 2QIPA 5K1ZA 1TCBA 1N1GA 1TRKA 3H1GA 2WUVA 3IO3A 4KQ2A 5DX0A 2GCPA 2HPAA 3GXBA 4IX9A 1W85A 4DIEA 1T5BA 1TCVA 3BPSA 3LYUA 3NNDA 1Y7PA 3F5DA 3ZCPA 6PFKA 1PT8A 1LPMA 3ABSB 4UPDA 2RCNA 3TKLA 4Z7NB 5KYKA 4MPPA 1W5FA 3EBOA 1QHYA 4B3MB 5KX5A 3SQWA 4Y2SA 1OTXA 3IUJA 1SY7A 3U3ZA 2WHPA 3WOHA 1TRHA 5CVDA 1E99A 2WF7A 3I6IA 4RE6A 4FD2A 1CHNA 2PYZA 1VHWA 4JB2A 1DKPA 2FWRA 4QTXA 4L3WA 2X4GA 5LL6P 2VWHA 1XP8A 3DMTC 3E8SA 1JDNA 2RAVA 1CXZA 5AM0A 5KB3A 4IFBA 3UQYS 2FW7A 1S7GA 3JAWB 2H54A 3SF8A 4RPGA 1Y8RB 2CL7X 4G1MB 4MV0A 3RS3A 3E7WA 2QROA 2P41A 1Z6AA 2GN9A 2Q9BA 1OSNA 1R3DA 4X8HA 4YUAA 3O8OB 1RXCA 3L9XA 2I29A 4DN6A 4L16A 4G84A 1U2GC 1TJ4A 4PM4A 2NPOA 2QUKA 1S2GA 1M6HA 1Z15A 3QWBA 4TUYA 4PQFA 4G1EB 3H75A 1CKEA 3ESQA 4EKEA 2UZAA 4BFYA 1BC5A 4AFNA 3BB3A 2B4RO 4V24A 1JPUA 1MT3A 2QY9A 3E23A 4JD5A 3SXUB 5BN3A 1E2IA 3ABOB 2MT9A 5FHQA 4EFMA 3ZUGA 1UJ2A 3T3NA 2H31A 2AG5A 3COZA 1LRJA 1P74A 3ZZMA 1ZJJA 1FYXA 1WUTA 4Z9YA 4XQEA 1I13A 4Z3DA 4UPEA 4CTNA 5AVZA 5D00A 4MUMA 5J2UB 1M2EA 3VKVA 4QPJC 2B37A 3OKCA 3V4PB 3A6FA 4YBRA 3E1SA 2I71A 4RH3A 2DUWA 5IDWA 3T1NA 2MSEB 2UYQA 3HJGA 2WIFA 3H99A 3H3JA 1YIAA 3DL0A 4GPZA 3NBXX 1F9AA 4KQXA 3ZW8A 3A11A 3OKPA 1QZ3A 2CJFA 2N1MA 4R1OA 4DIDA 2WV7A 2VATA 1W93A 2ZDGA 3RU9A 4P82A 4RYDA 5FNVF 2ETXA 2QTZA 2WHXA 2BGNA 4N0QA 4Y2PA 5CIQA 4G0MA 1W0JD 3JWGA 1HPLA 4CMEA 3OJLA 2HIGA 3G8BA 3OZUA 1CY6A 2WB2A 1LC3A 1Y9EA 4M0MA 1ZMBA 5CH3A 3ICPA 2YN4A 4MRPA 3LBYA 3V7UA 4P8RA 1O7JA 3QSGA 2B35A 5BSTA 2O5VA 5FXMA 1PR6A 3IUQA 4HH3C 3QF7A 2JGRA 1H6BA 4FGZA 1IHPA 1V8ZA 3S2YA 1YD7A 1QLJA 2B0CA 3Q15C 3F6PA 4PAOA 3F5FA 2ZBGA 3OU7A 1B16A 3QI2A 3EDYA 3L41A 1PQYA 3IKVA 3LC1O 3ZGLA 1H8HA 4LDQA 3PR2B 1ZM2A 1I7LA 2Z04A 3BMOB 1E94E 4F5YA 1JB1A 3AKYA 3D1VA 3NHKA 3L8YA 3GA0A 4RESA 4WLUA 2LWIA 5HUJA 1AKWA 4F04A 2DZDA 1DI0A 1YTLA 4KIJA 4XPIB 3OEHD 1H4VB 1EUCB 2XHEA 4XEUA 1HE4A 3CV3A 4YAOA 4RHFA 4ZQGA 4EY3A 2IYPA 4XYLA 1EVKA 2OFPA 3LKDA 4R16A 1HYHA 1PRYA 1YBAA 4PZZA 1VJGA 2PMWB 2C82A 1QRSA 1UBSB 5BSMA 4GPEA 3BGIA 4MJ3A 2CLIB 5DKFA 1CY8A 2H4XA 4QJ3A 3MIZA 2BMFA 1KVUA 3EULA 3OBBA 4DV5B 1QO7A 3T41A 3T94A 5CFOA 1S2OA 3G1WA 4D80A 3FNFA 3ERCA 1F4VA 3E7FA 1U1FA 2QTCA 1FW6A 5K3FA 1V5EA 3U4GA 4CG1A 5IWAB 5LSAA 5HP4A 1GTL1 3DE0X 4XOUA 1X1DA 2BGRA 5EPOA 3RRMA 3LF2A 4K8RB 3UAZA 3TFOA 2ODBA 1O0BA 3D31A 3WZ2A 2OO5A 5A6SB 1RRKA 2H08A 2BUBA 2KB0A 5T5QA 2OG1A 4B9AA 1RI2A 2X6RA 2H1RA 1Z4KA 3GRYA 1Z7BA 3M3PA 3HR4A 3WR5A 3UFXB 4FC6A 5FTJA 5AM3A 4ZMRA 1Z6TA 3CS3A 5EMMA 2XVYA 4P53A 2X1LA 4HC4A 4A8PA 1L2TA 4NOLA 3PG5A 4EY8A 2BLLA 5FWYA 3IP5A 5DXJA 3W1EA 4BFZA 2E85A 3QKWA 1NBIA 5T64A 5A9RA 1P2FA 1J70A 2CLOB 3EEFA 3L0CA 1TD1A 4NC9A 4EBFA 2VDKB 1WXQA 1Z5WA 1OBFO 2GBIA 2Y0BA 3IT2A 4DFDA 5K7SA 1YJ5A 2G70A 2QV0A 1QO0D 1YSCA 1QVZA 1MAAA 1Z17A 4PYQA 2O1EA 4TT8A 3W78A 4F7DA 5HCUA 1GM5A 1FPQA 1LTHR 3GJ0A 4OI1A 4NOMA 4MRNA 1KI6B 2ZDQA 1P1HA 4KXNA 4C9BA 2W9XA 3KXIA 1AQLA 1ULAA 2HXGA 1KVSA 1NW7A 1UOOA 3A0UA 4MWTA 4KPFC 4AKTA 2P5SA 2ERCA 3ONWA 4YRSA 3DW3X 3KJEA 4FBLA 3L93A 1DEOA 4IJVA 2A7QA 1D5CA 3K32A 1RYDA 3MWKA 2P8SA 3NAQA 4JOSA 4TPKA 3BRWA 3ZI0A 4BWFB 2GARA 1QYWA 3IHKA 3OPNA 4UD6A 3H0EA 1JEAA 2AKEA 1E3EA 3CPSA 3BXXA 5A6VA 1Z0JA 4MRSA 3W7AA 1FP4B 4ZGWA 4EW1A 1RLOA 4TXNA 1MEEA 4C22A 5AW1A 1YQGA 4WFKA 2K2QB 1Z2DA 2J41A 3V8QA 3N70A 3WNBA 1A9PA 2QAGC 4LECA 4S0XA 2G17A 3UOWA 1F17A 3VR6D 2C9YA 5K6AA 1YL6A 4KREA 4DRXA 5I9BA 4OHUA 1XE3A 1CY0A 4DLKA 1LBEA 1V9CA 2DWUA 1WHTA 1DXHA 3EH1A 3DFFA 3ICWA 4FB4A 5H3CA 2HSDA 1TDJA 6Q21A 1VRWA 1WSBA 1ZOPA 2PMFA 3QG1A 4Q3CA 4Q9LA 4LJRA 3EPRA 2ZW9A 3GRCA 3HCAA 4OJMX 1S9HA 4Q3AA 5F5XA 3S7TA 4JX9A 2QMQA 5SY4A 3JVEA 3TBHA 2IS1A 1K1EA 2MMGA 2C4UA 1TCUA 4TKMA 4C0XA 4CGYA 4BPBA 5LMUB 2DCMA 2JCGA 2JZOA 1UT8A 2HO4A 2HA7A 3GHYA 3WHIA 3ER9A 4Z5XA 3O4JA 3Q3GE 4V2UA 2IOFA 4S0ZA 4D4KA 1FF9A 3MC1A 1GPAA 3HU1A 1WD7A 3ZNPA 2VXOA 4QQFA 4J2TA 1E1MA 2A9KA 4NH0A 5A7GA 4NF2A 5TRTA 3VSDA 3NAZA 2SECE 4UOZA 3AIIA