4C4ZA

Crystal structure of human bifunctional epoxide hydroxylase 2 complexed with a8
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
318
structure length
318
Chain Sequence
TSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Combination of Spin Diffusion Methods for the Determination of Protein-Ligand Complex Structural Ensembles.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
total genus 108
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c4zA00
4X91A 3WL7A 1MU0A 1O6FA 3QMVA 4LXGA 1EB8A 4BDSA 1BEEA 2XMRA 1CUEA 5CXUA 4H77A 4FHZA 2CUTA 1TCCA 3I28A 4WJLA 4JNCA 4S0XA 4BRZA 4PF1A 3ESAA 3KSRA 3ZLUA 2XQGA 4G1FA 1R3DA 5HK8A 2RGUA 1YR2A 4A16A 4PSCA 2AXEA 1CV2A 4AXBA 3B3QA 1PFQA 1ZIXA 5AJHA 4MWSA 4AB1A 4CCWA 1Z68A 1FJ2A 4X85A 3D7RA 2XUJA 1BCRA 4KAJA 4WY5A 1AMNA 1QIJA 5CURA 5AM3A 3ZPXA 5AH0A 5T4FA 2XMGA 3CXUA 1XZAA 1F8UA 1QTIA 1WPRA 2QZPA 3CCCA 5ALLA 3QMMA 4HS9A 2QS9A 3F67A 3ESCA 1XQWA 1NX9A 4IQ4A 5ALGA 2JEYA 4C6HA 2QJWA 1A7UA 1EHYA 3C70A 2OAEA 2Z3WA 5F4ZA 5EHXA 1ZOIA 4DMKA 5A2GA 2JEZA 5H3HA 1LPSA 4H7DA 4KE6A 4Y9SA 3V1NA 5LZ5A 2Z8XA 4UPDA 1HKHA 2QT9A 1HPLA 5FPQA 3QYJA 4IHAA 1FFCA 1LPMA 2ONCA 3G8YA 4Y2SA 1VXOA 2FX5A 1W6RA 2XUHA 4UHBA 1XLUA 3O4JA 1SCKA 4WFKA 2HA7A 3D2BA 4AO8A 2O2HA 2K2QB 2PX6A 4K6HA 1PV1A 2IX9A 3DJYA 3IULA 3NUZA 4MJ3A 4DLNA 1CQWA 3S2ZA 4HVTA 4BZZA 3O0DA 4FKBA 3I2IA 2BGNA 1CUAA 1ODTC 5HKAA 1IVYA 1PJAA 2QTBA 3ESDA 1VA5A 1U4NA 3H2KA 1XZJA 1AC5A 1W76A 1YAJA 4U2CA 3M3DA 3BJRA 2QR5A 2O2GA 2YXPX 3C6BA 5T4BA 5AKEA 3GFFA 4QDTA 2XE4A 2HHAA 4QDZA 3GA7A 4H7IA 2QUBA 4Y2RA 3DNMA 4OUKX 4B84A 3LCRA 2FJPA 5E4TA 5DJ5A 4GHWA 2OAGA 1H22A 5CW2A 2QJRA 2X8BA 1I6WA 3R40A 2CBGA 4CFSA 5LLSA 4QLAA 3K9BA 5AI6A 2JGEA 1YASA 5JALA 1XQVA 1C7IA 4JH0A 1UK9A 4QDUA 4GXNA 4X92A 5T4HA 1G42A 1P0IA 2RI6A 1QO9A 3FLAA 5EIHA 4X6YA 3W04A 2WFLB 3DQZA 4YASA 4JYPA 1XRLA 3O95A 1XKTA 1BRTA 2C0QA 5A7HA 3NGMA 4UBJA 3WKAA 2GZRA 1UOQA 4J0HA 4LYEA 4HRYA 2XLCA 2VJBA 3DOIA 3RKSA 4TPKA 3ICWA 4KYVA 4M0EA 1HL7A 3M81A 4CI9A 2QM0A 3STUA 1QIFA 3HABA 4JEIA 1L7AA 1ZIYA 1TKRA 4E46A 3VJLA 5IKXA 1XRRA 3DD5A 2XMDA 1LLFA 5ALYA 2NW6A 3OPMA 4HZGA 1XKLA 1Y37A 5ALMA 5HF6A 5HFAA 4GWLA 2GYWA 3OOSA 1K8QA 3O9VA 1F0PA 2CZQA 2ZJFA 2GYVA 5D3KA 1THGA 2QRUA 4UHHA 5E4JA 4EZIA 3VVMA 1CUBA 3OTQA 5LZ2A 3QPCA 4P08A 2WFZA 3ZLTA 2PVSA 4X90A 4ZV7A 2WM2A 3G0GA 3DS8A 1GPKA 1BN6A 1TCBA 2XI4A 3I2FA 3EQ9A 4P92A 5A71A 5AI4A 4UHEA 3G0IA 5AKZA 4B0OA 4Q1VA 1E8NA 4BC1A 1MX9A 2VA9A 4W1RA 4UHFA 3B12A 2PUHA 4J0JA 2XLBA 1DT3A 4GECA 4ITVA 1L7RA 1GKLA 4WFIA 1FFBA 1LPPA 4DGQA 3WK9A 4G8BA 2VT7A 2PBLA 4PSDA 1UT6A 5CH8A 4G8DA 3EQ8A 4BP8A 2H7XA 3FBWA 4J7AA 3AILA 1WOMA 5HF8A 4IO0A 3IBTA 5ISMA 4PQEA 5DLPA 1UXOA 4W63A 2BGRA 2XB6A 2E3JA 1JJFA 1EINA 1T2NA 3OURA 4Q05A 5HQ3B 3A2NA 3WWCA 4I4CA 4CCYA 1W75A 2QKYA 1MAHA 5AI0A 3QM1A 4MWTA 2VJDA 3PF8A 3EQ7A 3FVRA 3V1LA 4B80A 1GQSA 1UKCA 3IURA 4KR0A 2WIGA 3R3VA 2XMZA 4PO3X 1E66A 4Y2UA 3STTA 3PF9A 5LKRA 5D7BA 1JMKC 4B7ZA 1BU8A 4NMWA 2WU3A 4GI1A 4KE9A 3I1YA 2WHQA 4RE6A 2ROQA 2I3ZA 3C5WP 1AZWA 2DFPA 4B85A 3I6MA 4FLEA 4J0IA 4L72A 5JAPA 1YCDA 1GQRA 5JADA 1YB6A 1TQHA 2Z3ZA 1LNSA 4OYLA 3WWDA 4W1SA 4K6GA 4N8EA 1U8EA 3DOHA 3AINA 5AIBA 1BCSA 3DKKA 4OCZA 1YA8A 4DTCA 1AQLA 3H18A 4EBBA 2VAVA 3C5VA 4FWBA 1WCYA 3D4LA 4MYSA 3FOBA 4CG3A 3LIPA 4G4IA 4BAGA 3WK4A 1ZD2P 5LZ8A 2I03A 4HRXA 2WHPA 3SWWA 3STWA 1E8DA 2Z5GA 2B20A 1JKMA 1SCQA 5JYCA 1EVQA 3GUUA 3V48A 3RK4A 3GBSA 4RE5A 1X70A 4K2AA 4C89A 2PKYX 1XZIA 1ISPA 1LBSA 2DCMA 2WUFA 4E14A 1USWA 1IZ7A 1DQZA 3F98A 1QZ3A 4PW0A 5AIAA 2WUDA 4X71A 4I3FA 4QNNA 5AOAA 1BN7A 2JGMA 3I2JA 5HF5A 3VVLA 3DYIA 4EB0A 5AM5A 3R41A 1J2EA 3ZWQA 4F0JA 3RLIA 1XZKA 3UUFA 3H19A 5BV7A 1LPNA 2JGLA 5C8VA 3NOXA 3VJKA 5FLKA 1B6GA 3LIIA 2Y6VA 4RNCA 2B4KA 4LKOA 3HI4A 4B9AA 3ESBA 5CRIA 2CEKA 3PICA 5JARA 4NZZA 1XROA 2ZYSA 3HRHA 5CTAA 1XLVA 2ZVDA 3BDVA 5HCUA 5FKJA 4WDRA 1RP1A 2XMCA 3I2GA 1IUNA 3ZI7A 2WHPB 5LP1A 1EK2A 4Q34A 1FFEA 4EY5A 5AKJA 1MNAA 1QIDA 2G63A 2VQ6A 4ZREA 3CCBA 1CUUA 1HLGA 2ZSHA 4KACA 1NU8A 4WY8A 3QH4A 3W05A 4BVJA 3WJ1A 1XQYA 1N5RA 3A6ZA 4FTWA 1VKHA 4W1QA 3IUMA 3D5EA 1X2EA 2HA4A 1WB5A 1VJ5A 5EHNA 4BBZA 1TIBA 4YPVA 3PI6A 1XQXA 3TEJA 1CUJA 2HA0A 2X5XA 1ZD4A 1KU0A 2AJDA 2WTNA 3R0VA 3WYDA 5T4EA 2DSNA 2WSLA 1ZICA 5DYYA 1W4LA 3R3UA 1CUZA 4EUSA 4EY4A 3FNBA 3FWHA 3G0BA 5DYWA 5CMLA 5EIEA 3QMWA 1XZLA 5ALRA 1EK1A 3FYUC 3KXPA 1K4YA 5JD6A 5BOVA 1BEZA 5CT9A 3R3ZA 2H7CA 2WILA 1YA4A 3ICVA 1QJ4A 4ZRDA 5AO9A 2WTMA 1A8UA 2DR0A 5C7YA 3CN7A 3AUKA 4K6KA 5AKIA 1XRPA 2OQVA 3QPAA 4BATA 3HYSA 4UBLA 3E0XA 4G4JA 3H17A 4DSZA 2VT6A 3T52A 5ALUA 5E4YA 3OM8A 4B6GA 4H0CA 1JMYA 4MEBA 5ESRA 4GDMA 1QIHA 1HDEA 4XX1A 1EH5A 2C5GA 5BWCA 1DWQA 4TGLA 1MX5A 4X7BA 4DNFA 3G9XA 3KWJA 3DYVA 4BVLA 1EB9A 5CH3A 4CIBA 3NWOA 5I8PA 5AHXA 3OG9A 4UUQA 4HAIA 3H1AA 3WZMA 1FFDA 2QVBA 3WK5A 2CB9A 3VXKA 3IA2A 3QBJA 2OPHA 2HDWA 3M83A 4J03A 4J0DA 1XZCA 2I3DA 5AK5A 2DHDA 1ZI9A 5FRDA 2DHCA 5K3EA 3FLEA 5AKYA 5EIAA 4KAFA 3H1BA 2VF2A 3WWOA 2WKWA 3I1IA 2XUFA 3V9AA 1DX4A 3I6ZA 4BDTA 2UZ0A 1XZEA 3F9CA 3YASA 3WKEA 2ACEA 3ZLVA 1OXMA 4KJXA 4E11A 1CUGA 2J3DA 2OGTA 1WM1A 1CLEA 1CR6A 2OCLA 3W9BA 3BF8A 4AN1A 4FOLA 3FAKA 2CJPA 4C4ZA 4FLMA 1HQDA 1UFOA 1XRQA 2QUAA 2QMQA 2IITA 5AKLA 1LGYA 4FBLA 4O08A 5ALPA 1AUOA 5JATA 2GBFA 2BKLA 5AM1A 5ALHA 5A7GA 3BXPA 1AX9A 4BAZA 2XQIA 5LZ4A 3WIOA 4C87A 2Y2UA 2XUDA 3H0CA 2PU7A 4QDXA 5ALDA 3IUJA 4N5IX 1D07A 1L7QA 5KBYA 1R50A 3ED1A 3I2HA 3ZV7A 2XMSA 3HEAA 5EHQA 5ALIA 1WHSA 3C8DA 3BIWA 4AZ3A 3W06A 5ALJA 4GW3A 3G0DA 1SFRA 1YSCA 1XRNA 1CUXA 2Y2VA 1ODSA 4BAUA 4G9GA 3OC0A 5CH5A 1XRMA 1QFSA 1A8SA 2GYUA 3DLTA 3A70A 4AX4A 3A2LA 2WLSA 1P0PA 2HFKA 3KD2A 2AJBA 2ZYIA 3V1MA 4MXDA 4ARBA 2C5FA 4BYMA 2H1IA 3LP5A 3IUQA 1WHTA 4N8SA 3P2MA 2ZYRA 3PUIA 1GZ7A 1XZDA 4KRXA 4CG2A 1R1DA 2B9VA 3JWEA 5CT5A 4BTLA 4X3CA 1QO7A 2PSHA 2ACKA 1ZI8A 5CBKA 1CUHA 1Q0RA 1UOPA 4XWGA 3GROA 2D5LA 2WIFA 1FFAA 1A8QA 4Y2TA 1E3QA 4F21A 3FYUB 1TAHA 2VJCA 3UMJA 2YH2A 2Y1KA 4UBKA 4FLFA 5I7UA 4F5ZA 2HRRA 3O4IA 3M82A 1JU4A 2WFMA 1CUSA 4ARAA 5JAUA 4CIAA 4OPMA 5ALQA 1BE0A 5DNVA 4H18A 2WIDA 4QE3A 1SC9A 3BIXA 3GZJA 4ZXFA 1XFDA 1YS1X 4H7JA 5FP0A 2D0DA 3FSGD 1THTA 1W52X 1LPBB 4E15A 2WU4A 1ORWA 2WUEA 3AIOA 5IVIA 1IUPA 2DQZA 3IUNA 4OU4A 3DDUA 3HXKA 3AZOA 1LBTA 4WCVA 6YASA 4P93A 4DSAA 3BWXA 4L0CA 1AGYA 1IZ8A 1AKNA 1BS9A 2WG0A 2JGIA 3T4UA 2LIPA 2GBGA 2VAXA 3PDCA 4FMPA 2OQIA 2V96A 1JJBA 2PU5A 1MX1A 4DYHA 2ZJ6A 4Y2QA 5HKBA 1CUFA 4U2GA 1R88A 1ZJ4A 1VE7A 1QIEA 3EIOA 2PL5A 1N1MA 1CRLA 1LZKA 4MYDA 1CEXA 1UK8A 5AM0A 4ZV9A 3H2JA 2XUOA 4FFWA 5EI5A 5ALOA 4YX9A 3H04A 3N0TA 3BF7A 1SCIA 5EGNA 3X3HA 5D6OA 4ZGBA 4N8DA 1QGED 3TGLA 5AK3A 4DNPA 3AIKA 1GPLA 1XZMA 1N5MA 4HXGA 3H2IA 3L1HA 1DINA 4N5HX 5HF9A 5JAHA 1DWOA 1FSSA 1Y7HA 4U2FA 1IMJA 4J3JA 3JYHA 4BVKA 2Q0XA 4GBGA 1EI9A 3S8YA 1G4HA 3GELA 4LIPD 2G5TA 3WL8A 5A7FA 3BJMA 1MTZA 1JT2A 1EXWA 5IVDA 3DCNA 3H2HA 1XZBA 1VXRA 4BCDA 2O7VA 4ZWNA 5AOBA 1QIKA 5E2IA 5YASA 4C01A 1DQYA 4Q3KA 4B83A 4M0MA 4EHBA 3WKCA 5ALWA 2EDAA 4I19A 1K63A 4WDQA 4QA9A 5AOCA 3E3AA 3SX4A 1QIMA 5FUMA 5SYMA 4KE8A 4J0CA 3RARA 2C0PA 1QOZA 4JYMA 5IH7A 1CUVA 4Y2YA 3HZOA 7YASA 2PSFA 1CQZA 5EHZA 2BJHA 1IUOA 1CUDA 2YASA 2HADA 4KEAA 1BROA 4H7EA 4OSEA 1CPYA 3WYNA 1P0MA 3AZQA 2OCKA 3STYA 1CUWA 4B0PA 3RM3A 3FSGA 4U2BA 1UOOA 3MUOA 3WL5A 3SC2A 4X00A 2RAUA 5JD4A 1XZGA 3BE8A 2PSJA 3C6ZA 4Z49A 1MPXA 2HA3A 2WFLA 3A2MA 2HIHA 4PNZA 4B9EA 3IB3A 2GZSA 1YS2X 2ORYA 5DNWA 4Y2XA 5ALNA 4QWWA 2WIJA 1QLWA 1Q83A 2WG1A 3I6YA 3SK0A 4CCYB 5HK9A 2PSDA 3E4DA 4MEAA 2BCEA 4KE7A 4QLOA 4BRSA 1RYYA 1UWCA 3FCYA 5EFZA 5LIPA 1E5TA 2OXEA 2EDCA 3D2CA 1C4XA 4KRYA 1J07A 3DL4A 3K2IA 4U2DA 1MO2A 5K3FA 5KWIA 1GXSA 4INZA 1YAHA 5HQ3A 5ALFA 1KU6A 4XIIA 4DM7A 3IDAA 4K5QA 5AKGA 2XUKA 4X93A 2B61A 4LXHA 2FJ0A 1CVLA 2V9ZA 1WPXA 3G02A 1KEZA 2IIVA 4LYDA 2JF0A 4OB8A 4AQDA 5DYTA 3E1GA 4BE4A 3QPDA 5ALKA 4G8CA 3C87A 2JGFA 1QFMA 1QE3A 3AFIA 3D0KA 4W9RA 5DTJA 4GLBA 2WJ4A 4TVKA 5HZGA 4GEGA 4EY8A 3C6YA 4FDMA 2AJCA 5SYNA 2WJ6A 3IVMA 5A6VA 4DNOA 4IH1A 1P0QA 4ROTA 1UKAA 3UUEA 4X94A 4XJVA 1QTRA 4H7KA 3TRDA 3F8SA 2HFJA 1U2EA 3D2AA 5JIBA 5IVHA 3AZPA 5JZBA 3VISA 2XDWA 1MAAA 2BUBA 1A88A 1H2WA 3WJ2A 2DHEA 3VJMA 1GGVA 3U1TA 3WA7A 2P8SA 3LS2A 1CFJA 2ZJ7A 3N2ZB 4QEKA 4MQMA 1H2ZA 2HU8A 1ZD3A 4ZI5A 4Y2VA 3WK8A 2R8BA 2AJLI 2OCIA 3DL7A 1DX6A 4X95A 3B5EA 4OD0A 2CKMA 4U2EA 2JBWA 2O7RA 5K3DA 1R9MA 2G4LA 4EY6A 3F96A 1ZGCA 1CIJA 2VTVA 4H7HA 3KOOA 4DNQA 2ZYHA 5AKXA 5FDFA 5HFNA 2WQZA 2CMFA 4J0KA 1ORVA 2QXUA 2G5PA 1R4ZA 2PPLA 1GPNA 1TK3A 4UBOA 1U65A 1EX9A 5IVKA 1G66A 4Y2PA 1DTEA 1JU3A 1W1IA 4UHDA 2Z8ZA 3FLBA 3U0VA 4EA6A 1AURA 5A62A 2PUJA 4Q3OA 3DEAA 5K3CA 2RHTA 3FYUA 2GBIA 5CXXA 1GKKA 5LKAA 1RWQA 4H7FA 1CUYA 3DKRA 4H35A 3WQHA 1S8OA 5K3FB 4DMFA 2J3QA 1OILA 1QONA 3HC7A 3PFCA 3WK6A 2ZSIA 3STVA 5DTIA 4BE9A 3WLAA 1MT3A 2DQYA 4Y2JA 2RONA 3C8HA 4HXFB 4HXEB 2J4FA 3EBLA 3FCXA 1K6EA 3PFBA 3ILSA 4C4YA 5C81A 3C6XA 1C7JA 4BP9A 3R3XA 3CN9A 2OLEA 4BCCA 2AJ8A 4FFVA 1H2XA 1CUCA 5K3AA 4D9JA 4A23A 1SOMA 2QXTA 4MQLA 1MN6A 1ZD5A 5CT6A 4G9EA 5JZSA 1JI3A 3K6KA 1VZ2A 4JUIA 1CUIA 4Y7DA 1TRHA 5LYYA 1M33A 1VA4A 2JGKA 1ZJ5A 2I78A 5LZ7A 3R3WA 4XVCA 5CT4A 4LXIA 1ZGBA 3WWEA 3WA6A 3G9UA 5C8XA 3AIMA 1YB7A 3D59A 2EEPA 3JW8A 2WUGA 1MNQA 4QDOA 3WKDA 2OCGA 4OB6A 3ANSA 1Q0ZA 3WKBA 3WL6A 3V1KA 1G5FA 2C4HA 2C7BA 4V2IA 4F60A 2FUKA 4FNMA 1UKBA 1WB4A 3L1JA 2PSEA 3C45A 1XZFA 5KREA 5LZ9A 5AM4A 2GBCA 1Y7IA 3MVEA 5ALTA 3PUHA 5ALZA 3MUNA 4AMYA 2VJAA 5JZ9A 4AO6A 3ANTA 1EDDA 3G0CA 4CG1A 4Q3LA 3WK7A 5AP9A 1J06A 1B41A 5KWJA 4QZVA 1JJIA 5FOQA 1TCAA 1ETHA 4YK7A 5BWBA 3HLKA 1EA5A 3EF3A 4BCBA 1E8MA 5FPPA 2W6CX 4UFPA 2XUAA 1R9NA 4LHEA 2BUAA 4G5XA 1LPOA 2VATA 1N8SA 1WB6A 4L3WA 1T4MA 3Q8WA 1Q84A 1ACJA 3R3YA 2R11A 1ACLA 1LPAB 2ES4A 2HA6A 2RHWA 2VEOA 2XQJA 1NU6A 4EY7A 3O9MA 1X2BA 2XUGA 2W22A 5DWDA 3MGAA 3HSSA 4RPCA 4AN0A 5ALSA 1DT5A 4BB0A 2V97A 5FXMA 2OG1A 4OB7A 3W9UA 3H2GA 2HM7A 2HRQA 1F0NA 1F6WA 2V98A 4UBNA 4UFNA 5AKHA 1HBJA 2OGSA 4X6UA 4BZWA 5JASA 1OCEA 1UZAA 1VOTA 1VLQA 1ODCA 3LLCA 5K3BA 2PM8A 4IH9A 4C4XA 1XZHA 2WG2A 1H2YA 2Y6UA 3IIIA 4OU5A 4P9NA 2XUPA 4HTAA 4NS4A 3WI7A 5AM2A 5AICA 1H23A 5AI8A 1O6GA 4A5SA 4QWMA 2WHRA 3WIBA 2HL6A 2C58A 4DIUA 1UK6A 2JGJA 5AK6A 2J4CA 2JIDA 2XUQA 1EDEA 1E89A 5J3JA 3Q0TA 3HACA 5AK4A 3BDIA 4PV7A 5AI5A 2VSQA 5ALXA 2WJ3A 2X76A 2WIKA 3O4GA 1J1IA 5FV4A 5AKKA 2BFNA 5JD5A 3STXA 3W2TA 2XMQA 2XQKA 4W1PA 4B82A 3G7NA 4AO7A 5DNUA 1VE6A 4RGYA 1MJ5A 3VKFA 1VZ3A 4C88A 1QIGA 5D3ZA 4DMHA 3WMRA 5C8ZA 1UK7A 4J0GA 3VDXA 3BL8A 2XQFA 4AZ0A 3WWPA 2HA2A 3PE6A 1XLWA 5K5EA 1EVEA 2OGZA 4BC0A 3KWFA 2XUIA 3TJMA 1LZLA 3L1IA 3QVMA 2HU7A 2XMBA 5AI9A 2H7YA 4IH4A 5ALEA 4PSUA 2HA5A 4UFOA 4X97A 3WZLA 4DMCA 3KDAA 3I2KA 5CT8A 3FVTA 1QIIA 3F97A 2HU5A 3G9TA 4X6XA 4B81A 2BUCA 2XT0A 5JAOA 1DU4A 5ALVA 3FYTA 3G9ZA 1EDBA 4AMZA 4G4GA 2YYSA 2QOEA 2BAGA 2RIPA 4KAAA 3C43A 3QZUA 1K5PA 4ETWA 5JANA 4WFJA 3HJUA 1JFRA 3O4HA 3AJAA 4UHCA 2H9YA 1ZI6A 1DWPA 5I9IA 2ECFA 4L9AA 4BTVA 4Q82A 4UBMA 3D3NA 4OYYA 4FBMA 4NVRA 4UBIA 2O2IA 1GT6A 4M0FA 4FNGA 3QITA
chains in the Genus database with same CATH superfamily
4X91A 1SVOA 4JLOA 2WZQA 1FYXA 2PXCA 1MVNA 3D3EA 1YB5A 1QG6A 3OEHA 2IPAB 2X8LA 3B13B 3FZQA 1PR2A 5LOVA 1GM5A 1F2TA 5DYNA 3J7AC 4GPZA 1BEEA 1I9CA 1T0UA 2WSSD 2MSLA 4ILKA 1Q6YA 2I8AA 4LJ4A 4FHZA 1HLDA 3MTDA 4LGVA 3PC6A 4MQUA 5P21A 3RJ5A 4BE7B 4CKBB 1Z73A 1AQIA 5L53A 1TCCA 1O4WA 3KTOA 4JNCA 5CYGA 1KRHA 4IGEA 1SEVA 3CNNA 2YX1A 4DPKA 5EQDA 1CD5A 5JS7A 4R2KA 5EE9A 2CJFA 3L7KA 3BSYA 4N7BA 3M3PA 1XJ5A 4NENB 4FIZA 2IEIA 2CE2X 2C2OA 1DNPA 3OWOA 4HQOA 2XQVA 4QPDA 3TSZA 4BASA 4KFRA 3ENKA 5KTPA 2FSVA 1R3DA 1JHXA 5M3BA 1ZW6A 2W7TA 5FOSA 3E81A 4C4PA 4NONA 2AE2A 3B2NA 3KNZA 4B6FA 1VBMA 1PCXA 2YS6A 3BWVA 3LHIA 2OCXA 1PLKA 1H4SA 4KX5A 1CV2A 4JQSA 3IELA 3CNHA 1QNLA 1BX3A 1E2NA 1H0SA 1IBMB 2QORA 2KM1A 1PFQA 1UJ4A 3HJCA 2I8CA 2UYGA 3MELA 3Q3CA 4IEEA 1B8UA 5AJHA 4D8YA 2JKYA 3OZRA 1DJMA 3T7RA 3JZMA 5I7AA 2I7DA 4AB1A 4TMTA 2XVMA 3MAAC 2PZAA 1PI3A 4K40A 4QAJA 4POOA 4X85A 4L8FA 3D7RA 4V0ME 4UZSA 3SHQA 3V8VA 1YZQA 4DG8A 3FLMA 2JEOA 1W36C 1IAVA 4JLDA 4KAJA 3RK0A 1Q17A 1WVIA 4IDNA 1JJ7A 4MKRA 2BEUB 2XYVA 4WLNA 5BN3A 1E3LA 4PG4A 2ZP1A 1KOGA 4F3TA 3CRZA 1VCHA 4YJFA 2HCTA 3ZPXA 3OO1A 5AM3A 2J8ZA 1ZAYA 1V8FA 2IYXA 1P45A 3VU9B 1A82A 1U1DA 1DKOA 2BMJA 3EK2A 3AJEA 3M9XA 4ISBA 4C0LA 3ONEA 3L6UA 3PUJA 4YJ3A 5CDUA 2DERA 2CMGA 2ZBGA 2ZIEA 3A6JA 1YFKA 2HZBA 2HRZA 2J32A 2X3YA 4KODA 4WERA 3LBYA 5J59A 4ZKEA 1M1UA 1EFDN 1U5BA 2OWEA 4GOKA 5L4NA 2R6FA 3QMMA 3HJGA 3BGVA 2O06A 3VR5D 3DBLA 4R8RA 5I3ZA 2RD2A 3F67A 2HPHA 1R8XA 1VDMA 1P0FA 2AW5A 4GT1A 2GXUA 4D9JA 4ZQIA 5B36A 4PINA 4MUNA 2HWWA 1XQWA 1NX9A 3NONA 3FXAA 1HUQA 5CVUA 2ON6A 3VTAA 3KQHA 2HAEA 5JOQA 1V4BA 3RS4A 2PLRA 2H1WA 3FFTA 4KJZA 1W85A 1JGTA 1KXJA 4N01A 4HLQB 5FJJA 4EH1A 4WBNF 4X65B 3KQPA 2YINC 4GF5A 2QJWA 1A7UA 2F62A 2FE1A 1C0PA 2XB4A 1D5WA 3CHYA 3CLTC 4J3FA 4O0MA 4MI3A 1G8MA 5F4ZA 4FXOA 3JPYA 4YACA 5LOVB 1ZOIA 1R6AA 3JALA 4U7FA 1Q14A 3VNRA 1WKBA 4B6QA 3U9SA 4CR6A 5A2GA 2ECOA 5H3HA 3GQVA 1GP2A 1Z0ZA 3GIWA 1L2TA 1T6NA 4H7DA 3WRVA 1Z8NA 4TQUS 1R6BX 1DO0A 3T7TA 1EHCA 3QYJA 2IS1A 2GK3A 2WM9B 2HW8A 1I3KA 1ZRHA 1XRSB 3MTGA 1KZ9A 4IHAA 5H9WA 5GJVC 3ZE9A 5JLJA 1JFLA 3NDJA 2VDNB 3NDIA 1KOLA 2VR1A 1MJGM 3KZMA 2O1WA 1K8XB 2ODAA 2A9VA 1YRYE 5GP1A 2PCJA 4ZJPA 4GZ5A 2AF4C 3USZA 2XF8A 4UAGA 4QYMA 4P4SB 3JVUA 5IP5A 2CNDA 5BV1A 3L2OB 2Q9CA 1NUHA 4QUAA 5BWMA 1SCKA 3PS9A 4RZQA 1HQYE 2P6PA 4WFKA 4B4OA 4AYTA 4AKHA 1QAQA 1X6VA 3CEJA 4AO8A 2O2HA 4K6HA 1A9YA 1E2KA 1IOVA 1PV1A 4A3SA 5L6LB 3DJYA 3HGTA 2Z95A 4X1YA 1E0AA 4LDQA 2YC2C 2DWUA 3MLEA 4A73A 5CHYA 2R8OA 1YZ3A 3L8DA 1CQWA 1W94A 2WLTA 2YVAA 3RKUA 2RHGB 4DDKA 3KWLA 1NR7A 4PTZA 5ITZA 1MP0A 2CXNA 1EPUA 1ODTC 1LNZA 2RGGA 5HKAA 1KPIA 1EVZA 5IDYA 1EFVB 3Q10A 4FGWA 1UMDB 2PLNA 4BLSA 1KK1A 1N2ZA 1PJAA 2X86A 3EGDB 3FF4A 1OV4A 1RJ9A 2VP3A 2CD7A 4ZOAA 4V0QA 5JW6A 1U7WA 4TT8A 1OLSB 4FGJA 3WDLA 2OHJA 1XZJA 4D25A 4WAUA 1JNXX 2V8OA 4ZQGA 1HZZC 2YKGA 3GX1A 1VM6A 4BNXA 3TNFA 2QZZA 4IIGA 4BEWA 2ZYAA 3GJ5A 4TL8A 4P4SA 3TD2A 4U2CA 2AG5A 3FOCA 3TIVA 4CU5A 1NP6A 2YXPX 3C6BA 2HZ7A 3UC5A 3W5HA 5AKEA 3GFFA 2XE4A 5L3VA 1EZ4A 3PHLA 2BFEB 4B4VA 4XGKA 3SNKA 1QTQA 3GA7A 3H5OA 5TPWB 3ZJ5A 2YVQA 3DNMA 3QOXA 3MGCA 1AQYA 4MIYA 3RYFB 3U44B 1E3DA 1CZRA 1VJCA 3VTFA 2ZPAA 1ADGA 1NW5A 3I39X 4I36A 3P27A 4MUIA 4B84A 5E4TA 3NAQA 1CWUA 1OI4A 1NUUA 2OAGA 2OLJA 4R0NA 1IN1A 3Q15C 4DCNA 2VSXA 1NNUA 4OI2A 2CBGA 2QYSA 1LFDB 1R4NA 2W6PA 1JEDA 1RI1A 2ENWA 4MI6A 3BQMB 2HJRA 5CNMA 5LLSA 1YASA 1HETA 1GXSB 4GX0A 3IBGA 1SUDA 1J39A 1D2NA 1KP2A 1XRJA 2QX4A 4KIWA 1B74A 1YZUA 4FHEA 3SQOA 3JQ8B 3UMRA 4QDUA 4GXNA 4A27A 4MWZA 5JJLA 4L7VA 1QHIA 3KK0A 1YRAA 3EVBA 3W7AA 3ZXSA 1JHAA 5T4HA 3X1MA 1A5SB 4MW4A 1UT5A 1VSQA 2Y1WA 2JJ8A 3OPYB 4S2EA 5EIHA 2WJVA 4J29A 3FTNA 4PLHA 3K8QA 3UJ8A 2O5RA 1TYAE 1WDMA 3C3MA 3GPIA 2ZJ3A 2WJPA 4GBED 4JYPA 5LB4A 4CLRA 3O95A 4DWOA 5CIYA 3HL0A 2W6ID 2C0QA 5A7HA 4YJHA 3G79A 2HLNA 1TU4A 4XWYA 1DAGA 4RH1A 4QTXA 5EKDA 2IV3A 3KLPX 4J0QA 2O19A 3DCIA 2F55A 2GZRA 2GK4A 5E7IA 2YBDA 3ON5A 2IL1A 2HMTA 5BSRA 2XNDA 3JVIA 1FPQA 4MQFB 2YRFA 4LBYA 4RK5A 1ZH2A 4I5EA 3N76A 5EE1A 2QM3A 1OIXA 2FX2A 3IBYA 3NHPA 3P71T 5F1PA 4KYVA 5K0CA 4OL0A 1I2MA 2HT1A 5B1HA 1YS4A 3BL6A 3WX0A 4IDDA 2OMKA 1A1SA 2W37A 3FKSA 4CWAA 3N6RA 1P2DA 1P9LA 1KVQA 1ZGGA 3EGCA 2OKCA 3HABA 3HRKA 4NY1A 1NNEA 5LQDA 2G88A 1QFXA 4O2BF 4YMVA 3HVJA 2Q4RA 3KSDO 4KN5A 4URZR 5DEIA 3CURA 3PGA1 3VJLA 4E46A 5KWEA 4GKVA 4D9KA 1T8WA 5C5EA 3LVQE 3F5FA 4R2IA 3DE5X 4XWKA 3IFSA 5LQJA 3AFGA 4M1KA 1Q15A 2NW6A 4A5OA 1R8SA 2IYAA 2VDQB 3L79A 3I6QA 5L95A 1Y4UA 3CUYA 2OZKA 5JRDS 3K92A 2H29A 1BDBA 4HZGA 1N25A 1XKLA 3OQHA 1NW3A 3L7IA 4X84A 3GLGE 5C4MA 1NN5A 2AIRA 3UW1A 2ZIXB 3F5SA 1T5BA 3RO7A 5DGHA 5BQ3A 3ASYA 2G9VA 2V3VA 2BZGA 4K9LA 2XVZA 4MUBA 2GYWA 3SR3A 1VPDA 5KAPA 3OOSA 1BKDR 5BV8A 1E2GA 1M75A 4IIUA 4UCWA 3RYHA 2CZQA 1THZA 1UC4B 1W47A 2X7JA 3O94A 1JKFA 2V65A 1NKSA 1NW7A 2V7PA 3E9QA 3T5PA 4P0QB 4R8KA 1MAUA 1LSSA 5BSVA 1PSWA 1U9IA 2PDAA 3E0QA 5DGXA 4C3OB 1QNFA 2QPOA 4DIMA 4E22A 5BRJA 3GGGA 1SD1A 5ANRB 4MV0A 1N9ZA 5K0EA 2IF0A 3ZE2B 1Z0IA 2H2IA 3EBOA 4J1QA 1J00A 4YJ2B 1M2FA 4ZC8A 3MAJA 4KIGA 5F3WB 4F97A 3BRCA 3AR3A 5A4AA 2IHZA 2ZIGA 1CR4A 1NBMA 1S7CA 1JG7A 1FP4B 4OQMA 1JIQA 1NE2A 4RJLA 1QQAA 2WM2A 2YR0A 3EGVA 4OJTA 4QELA 1OTHA 4JVNA 5IKEA 4EBFA 1K9SA 4K9QA 4TLEA 2PJZA 4ZHQA 3B6MA 4GVPA 1F6DA 3E15A 3E9CA 3LRPA 1KMQA 2XI4A 3JYQA 3I2FA 1IG0A 3RC7A 4FILA 1B6TA 1EWQA 2HSGA 4UDYX 1UBFA 2WP0A 1HDYA 2VYFA 1YFLA 1KPHA 1T2AA 2ZVPX 3CRRA 4UKDA 5AI4A 1IUKA 1KEWA 4O2AF 1ZISA 2Y1LA 2KQUA 1YFJA 4XR4A 1DRJA 2D0OB 3CBGA 3GDFA 3VRHA 4BC1A 4U9HS 4AY4A 4OFXA 3HWX1 4LRTB 4Z1MA 1AK9A 4N5DA 1EM6A 1VHJA 2SCUA 4R2JA 1ZJWA 2Q4OA 3B12A 4B8YA 2GZDA 2Q27A 4ITVA 4GX5A 3WXMA 1ZM4A 2PRIA 3D3WB 4B34A 1QVWA 2V4UA 3ZG6A 5BO5A 2D5BA 1TAGA 1LPPA 3RVSA 1GPAA 3OZSA 2XCTB 2R7NA 4G8BA 4YYEA 4DSUA 1EVJA 4PSDA 5FUXA 3ZD8A 2XNHA 3SJUA 5I6DA 2QX6A 1Z7BA 4CCSA 3WQQA 1CCWA 1DDIA 1ZMOA 1ECBA 1QXSA 4LE1A 4W4TA 1D4AA 1E1LA 1NBAA 3GW8A 1GNQA 3JS5A 4TLMB 2CLMB 3ICOA 1GZ5A 3SDZA 3SFTA 4DVGA 2J4DA 3EIUA 1KY5A 3I30X 4J7AA 3JAWA 4EYKA 4XVUA 2WF5A 1HLFA 3AM1A 3R3SA 3DE1X 3W2GA 5AW0A 3ZBUA 4IIJF 3EXEA 1KI9A 2EP5A 2BGLA 4G65A 1RHJA 4OMCA 5ISMA 4YT5A 1RRMA 1AMUA 4PQEA 1UXOA 2YICA 1VBKA 3O1HB 1F2VA 2KS6A 1IYZA 1X38A 1C29B 3NHUA 3VC3A 2E3JA 2X0NA 2ODEA 5CP8A 4N5MA 4NYJR 4Q05A 3WGLA 4EL0A 2O2SA 4IO1A 4V0SA 5HQ3B 2FQ1A 4A2WA 3OLQA 1C1XA 1X1SA 2E87A 3TUZC 2O8DA 3D6HA 4DC0A 3IQGX 4LNHA 3NT4A 3FWPA 2C2XA 1QGYA 1P5ZB 4HAZA 3RS8A 1NHGA 1YE3A 2QKYA 4PR3A 2J9ZB 2GN4A 1JXQA 1LNQA 3QM1A 3MWFA 4GD3Q 1DUVG 1NXVA 2R85A 3HJHA 4HNAB 4MWTA 2IS2A 2NUBA 3EH2A 4HNGA 5EKXA 3EQ7A 3V1LA 3ZWPA 3TSOA 1C8BA 2AR7A 1U6IA 3GD7A 3ISJA 3JV7A 4ZAVA 4G5QA 1LCIA 2XCLA 3WIEA 1A98A 1QBGA 4NTZA 5IABA 1PWXA 1QRDA 2R86A 4AIRA 1NQTA 2XMZA 4B4UA 1N1GA 4PO3X 4D97A 4A26A 3PEUA 1YBMA 3FHJA 4G9BA 5M29A 4ECEA 2JGRA 1VPVA 3AHGA 2IEZA 1WXFA 3LPAA 3EXFA 4GGOA 1ECPA 4Q37A 4B7ZA 2YNMA 2CUKA 2QTVA 4ZTBA 1P2SA 2BW0A 2WWHA 3QY0A 3TH5A 2J3HA 3KU4A 1KFJB 2WU3A 3K1YA 3RBAA 5HIKA 1R0ZA 4GI1A 4JQOA 3U7HB 3U81A 4GS5A 5F9HA 1TF2A 1E5XA 3HA5A 1YBHA 2ROQA 4HDKA 5F21A 5E6RA 4UTRA 2W2KA 4CV3A 1DTSA 1U7OA 1JQKA 5FADA 4BN0A 1LV7A 3KRTA 1JHQA 1AZWA 3C5WP 1PEYA 4TS3A 1NN0A 2PLWA 3I6MA 5TQ2B 4J0IA 3SBEA 4L72A 1WQ3A 3GZNA 3MCWA 3PWKA 1XTQA 1YQQA 4WY2A 4BO2A 2GO7A 3ZXYA 1SKYE 1QZUA 3I12A 5KKCA 1HE2A 3C2QA 3LZCA 1JFVA 3ZCQA 1C5KA 4JGBA 5FUQA 4Q0MA 1JIVA 3I6IA 4DT1B 1D1PA 2WSYB 3K1JA 5BUZA 4CQNA 3HUEA 1ESCA 1Z47A 3OU7A 3PUKA 1YB6A 2CLHB 1ULSA 5JSKA 2QN6A 3SHWA 4C4OA 1Q5PA 1LNSA 3SQDA 1SWVA 5LA6A 1USKA 4OYLA 4EUFA 4LXTA 4LRWA 1M6NA 3WWDA 3U40A 3G13A 2VQEB 1QPZA 3VU3A 4D9HA 5BY2A 4C7MA 4EM6A 3COZA 4DQ0A 3IIEA 3U26A 3DOHA 3GPBA 4OP1A 4O4JA 2EJVA 1KZHA 4NRDA 1T8SA 1XMSA 4RQTA 4JKYA 2XNCA 5AIBA 5B58C 1QV9A 3LAWA 3PJRA 3K5WA 2LRHA 4AY2A 3DKKA 4OCZA 3LECA 3LC1O 3HS3A 4DTCA 1FBTA 4X64B 4E07A 4YCNA 2ZE6A 2JIPA 1AQLA 1SG6A 3GT4A 3PXEA 3UZUA 4D8UA 5LP6A 1P1IA 5E0OA 3D02A 2XWSA 4MYSA 4EF5A 3PP8A 2XNJA 3IP1A 4PNPA 4CG3A 4D4MA 2R62A 5LU9A 1QH1A 2AD5A 3TJRA 2FPKA 3M33A 5I7RA 1ZN2A 3WADA 2GI4A 5GONB 1IXYA 3S0JA 1X8KA 3JQBA 1O95D 1GYRA 4PG7A 5L7TA 3L9WA 3OZDA 4X66B 3TCKA 1ZD2P 5IVPA 3N9IA 3TI7A 4R9VA 4BO6A 1SBCA 2JFWA 4CEIA 5AHWA 3QEAZ 2YMPA 3STWA 2OK7A 2BJVA 1E8DA 3Q8LA 2XNSA 3R74A 3WQSB 2C83A 3RBZA 3NHRA 3OEYA 4UUOA 4M0UA 1EFTA 2WICA 3P94A 4RORA 3VU0A 4ZV4A 1CNEA 3N1UA 3Q3EA 2Q2NA 4V0RA 3VU9A 1KARA 1YJ5A 4ER6A 2LCQA 4EVQA 1E1KA 4NULA 3WGVA 2RE8A 4GR5A 4JI2B 3V48A 1ZK0A 5CFLA 2HMSA 1X70A 3CIFA 3VR6D 4K2AA 4BZPA 3I1FA 1CE8A 1JSXA 1N5DA 5BSGA 4WHMA 1LQTA 1F0YA 5FH9A 1OKKD 2A33A 3BGSA 3IEKA 3ICEA 3OESA 4Q1EA 3VR5A 1USWA 2X4DA 3ROZA 3PEFA 3OLVA 4IINA 4IXNA 3U4AA 2FFBA 1BXGB 2Q3LA 1OASA 3N2GA 3L3BA 3OC6A 1QZ3A 3KSUA 4KI7A 3ITNA 3OIFA 1CJTC 3OUUA 3BXZA 3KM0A 4MWBA 1BWRA 2OZVA 1G3RA 4K1LA 3OTGA 5EXPA 4EUHA 1BJRE 2CYCA 4LX0A 1DBIA 4C3UA 3V2IA 1WBDA 4QNNA 1F2UB 4YRTA 5AOAA 4C6SA 5HW0A 2IXGA 2E89A 1FTNA 5DNEA 1EFAA 3MTQA 1HDGO 1E1QD 2G8NA 2AG8A 3A3OA 3K0KA 3DYIA 2VHYA 1JR6A 2N1MA 3EGXB 1AA9A 4R9RA 2XKAA 4EB0A 1JHDA 3QFRA 3INGA 5AM5A 4TX1A 4HGNA 3OTWA 3TM5A 1E7YA 1PFWA 4RVHA 5IU6A 2BR4A 2NVUA 5NLLA 3EC7A 3JQPA 3QKRA 2BBSA 3C7TA 5DE3A 3KZ1E 5KOJA 2R4QA 2ZWAA 2QTNA 1P8AA 5C8VA 1QYRA 4DLBA 2H4ZA 3D0QA 1LI7A 1QYCA 3T1TA 2YUIA 4MJLA 3KSAC 3RS5A 1DO8A 4EABA 2BEUA 4JCCA 2FR1A 1X7WA 4BNVA 4RZXA 4D92A 1KI7A 8AT1A 4BFVA 1DXYA 3GT3A 1SBTA 1J70A 3M9WA 4K6CA 1PJLA 2Y6VA 3TN7A 3FMIA 2AUMA 2XE8A 1FLVA 4KYUA 3V8EA 1AGNA 1HTBA 1KKLA 4X6UA 5EE3A 3HI4A 3OKAA 4QYWA 4E5UA 2ANBA 5DMXA 1IQRA 2WE8A 3CLSC 1XTIA 4NZZA 3ROXA 1BFUA 4HSEA 1LLDA 4O2BA 2NXNA 3LUHA 2A14A 2KX7A 3OHPA 3MMZA 2V7UA 2G1UA 3T41A 3JQAA 3L06A 5HCUA 4AY5A 3EFEA 2H2GA 2ONKA 1PEDA 4RCYA 5SY4A 3LKBA 3EPJA 1FE8A 3FNIA 3I0NA 821PA 1PFUA 3WV4A 3GEDA 5JY1A 1ZA2A 2BP7A 2YYYA 3I2GA 4Q1FA 1U3VA 5JSUA 3C4JA 4ETIA 1W0KA 5KOIA 4LDJA 5LP1A 3GQBB 1EK2A 4GL4A 3DOUA 3N58A 3WGJA 5GZ3A 2PX8A 3SM9A 1B42A 1V1RB 2HV9A 2G63A 2QTLA 2VQ3A 2VQ6A 4JJKA 1DDGA 4ZREA 5ES4B 3GLGB 4MINA 4OQEA 5C32A 1WV0A 1ZNXA 3U16A 4L1KA 3AJDA 3UWPA 1XTTA 1CIPA 1E60A 2IZ1A 1I2CA 3FYDA 3KVVA 1KGSA 1T8RA 3DONA 2BR5A 4J16C 4KACA 5FI5A 1NU8A 2ID9A 3QH4A 3IAS6 5EYPB 2WKRA 3FVWA 2GM4A 3BXXA 4N7JA 1DBRA 1SUAA 1XQYA 1NRXA 1BW9B 3ZXUB 4IIVA 1RC1A 3RW9A 3G7UA 4FTWA 3ED5A 1XOIA 3EHDA 4W1QA 3IUMA 2I2WA 2O7NA 5T6BA 2QRLA 2IH5A 4K9NA 1IE3A 2RARA 1X2EA 2ZB4A 1QC5B 2IYZA 3HBNA 1YQUA 1R0LA 3H9GA 3VDRA 3GMDA 4A7PA 5L40A 1LVUA 4AF8A 3FDZA 4EGQA 3K0EA 3Q7TA 1U31A 1R18A 3PFKA 2X5XA 5F2OA 3WHLA 4XD7A 4RDHA 4LZLA 4MZXA 5FF9A 1JAYA 1F2UA 1KU0A 5IRCD 5CDGA 5WRFA 5IM4A 3FOAA 4BLWA 4RPJA 2WTNA 3R0VA 4CM6A 3T3EA 3W5CA 3CSUA 1GTJ1 2QHXA 3CF4A 4O25A 5G02A 3MXTA 1E2JA 2CNWA 1IHYA 1DJPA 1W4LA 3IAAA 3R3UA 1HI9A 1OX6A 1X7GA 3R5TA 2QYOA 1X77A 3L8CA 2Z2IA 5A3RA 4P7GA 1PNOA 3HXLA 4HFRA 2QGFA 2YY7A 3QMWA 4O0LA 3ZGOA 1Z7EA 2UUCB 3OM1A 4BX8A 1O0SA 1EK1A 2G08A 1ECGA 1PDWA 2QRPA 1TO6A 2PZLA 3DAYA 5D3MA 2XCQA 2M98A 5JXJA 3ANMA 5AQEA 4ZARA 2C5EA 4C9BA 1N75A 4ZEMA 2QV0A 3CKYA 3C24A 4ZIRB 3RJZA 2YN2A 1PVDA 2BR3A 4JDUA 1BEZA 1J2RA 5EE0A 1T13A 2Q9AA 3VKHA 3A1SA 4LJRA 2ECPA 2X22A 4Q19A 2H7CA 4PN7A 4OJYA 2OFOA 3IUBA 1FTSA 1XNJA 2GJAA 3LUFA 5F1KA 1QJ4A 1YI8A 2VL7A 3CONA 2Z2KA 3WLRA 4LOKA 2YOGA 3QKSA 5BUQA 1A8UA 4DUGA 4GO1A 2WYHA 4FN4A 4YUVA 1WVMA 3H4MA 1JQDA 1FK8A 1FXWA 1OZHA 2NWQA 3F46A 2O8EB 1TADA 1GUFA 3C3CA 3KE9A 4TKVB 1SQ6A 4P82A 2YJ3A 3GH3A 1ZQ9A 2HDOA 3IB6A 3OQPA 5THXA 1ZLXA 2DC1A 2WMOB 3MCAA 5KINB 1H6BA 3TFWA 2REQB 4CKCB 1HG1A 2VJYA 2CDBA 3BIJA 1KDYA 3KJGA 2F3RA 4IZIA 4N40A 4UBLA 2PXHA 4K03A 2WKQA 3H17A 3P2IA 4DSZA 4NJEA 4LRXA 3T52A 1BNCA 4ME6A 1FMFA 5E4YA 3REQA 3R0QA 3GRVA 1U0NA 1MQ9A 4Z2AA 3OM8A 1GEGA 4B40A 4ZDKA 4H0CA 4S35A 3FPAA 1JMYA 1UCFA 2ZVQX 3ZNPA 2RAVA 1YVDA 1RYNA 2LZ0A 2OZEA 1HZZA 3TL6A 2C2YA 3T0GA 1A7AA 1O5TA 4O2RA 3T1YB 1QIHA 1H8EA 2XWQA 3ANNA 1MC1A 4I1PA 1HDEA 1RT9A 4TV8A 1I0ZA 3S2GA 2W93A 3VR5H 3N2EA 1EH5A 1RBQA 1YZKA 3WQRA 3MWKA 4DLTA 4LK2A 1QV6A 1ZC4A 1KH2A 3QLTA 2F43B 1NC1A 3OQ6A 1D4FA 5FTNA 4G0YA 1XE3A 4B4WA 2R84A 1WETA 5A1TA 4MIKA 3HM2A 4RFVA 1YR3A 2V9PA 1S02A 1I9GA 3RR2A 1IM2A 2VBCA 4M2LA 4JU9A 1K0UA 1SVNA 2FCRA 3BZBA 3HLTA 3NWOA 5IJAA 2ONJA 4JLBA 2GLUA 3T34A 3DVRX 3U0BA 1NVBA 3ACDA 4UUQA 5AR1A 4AW9A 4F1KA 4ZZ0A 4GZLA 3EY9A 3MWDB 3SC3A 3OI7A 1FFDA 3TTWA 3WLEA 1GAXA 3WK5A 1BD3A 5CX1A 3SG0A 4J8PA 5KJ1A 4C2BA 1KYXA 1TT5B 1AN0A 4P80A 4QUBA 1YA6A 3QBJA 3LKDA 4AXXA 4NCIA 2BEWA 3QFHA 4GMGA 1OFVA 3AM4A 2J09A 4RVCA 1OFUA 3Q7SA 2OPHA 3UJ7A 1SELA 2HSEA 4J03A 1JLHA 2QENA 2YHIA 2DHDA 1T2FA 2VDOB 1S2DA 1U9JA 2VAMA 4MO9A 1T6ZA 4Q24A 4O4LF 4M99A 3T3GA 4DEYA 2G1PA 5UKDA 3D8HA 3Q41A 1FUIA 4QQNA 3VAYA 5LFAA 1TKBA 4I1SA 4JJAA 2EL9A 4LY9A 3EGEA 1JT9A 4LGYA 1NHWA 2XSZA 1OWNA 2QL9A 4C6TB 2UUBB 3ER6A 4ZVNA 1V96A 2WP8J 2ZIXA 2WAMA 5L3SA 3KOMA 1QM5A 3BBPA 3QKUA 1N7IA 3K9NA 1GUZA 1RI4A 4ED9A 5IJ0A 2D7DA 3U09A 3U4QA 3I1IA 1NMSA 4JC0A 1RM4A 1HTTA 3TNDA 4BEVA 2ZUVA 3F3YA 1P8JA 5EL0A 4D9EA 6REQB 5F2KA 2X13A 4RQBA 4MDEA 4HQ0A 3KAQA 4QTTB 2NU8A 2PT9A 3K1AA 4RJIA 3ZLVA 1A2BA 4E11A 1RWWA 1D7AA 1W59A 1WCIB 4H16A 4OFBA 2EOAA 4YDSA 1N2CE 2OGTA 2WWXA 4H1UA 1H2HA 4YP0A 2AFHA 4ISCA 2Q3EA 4JFRA 5DSZA 5A5FA 3GYBA 1U2DC 1CRWG 1PG2A 4I9NA 1RKXA 1U8FO 1CR6A 3IRUA 2EX0A 1R5JA 2B36A 4INOA 3W9BA 3D9QX 3N0RA 3IKLA 4R1NA 1KDRA 5D01A 4QFBA 5CEEA 3I0ZA 1YH3A 2HSJA 2JHFA 3W7VA 2GT1A 2VDVE 3D3WA 3IDQA 4PX5A 1SKUA 4I4IA 2YQZA 5BPFA 2V6FA 1RBMA 2P11A 4G1EB 1T4CA 2UUPA 3BMNA 2P9HA 2LBPA 4CODB 3PA6A 4QBKA 3MPOA 4FC7A 1WUIS 1HQDA 5IG2A 4CV0A 3OU6A 2PYDA 4MUEA 3LWNA 2FEAA 5TV2A 3LBHA 1KETA 1XRQA 2ZWVA 3A6KA 3E7XA 2YJNA 3P5BA 2WJAA 2V6JA 3UY4A 3FR7A 5FA6A 1LEHA 3T9AA 4LYAA 1KS9A 2O6LA 1Y3CE 2IOHA 3DHVA 4I5DA 3D8RA 4X61A 4KWCA 2PKQO 5AKLA 4EKDA 5BOSA 5MN6A 1LGYA 3UAGA 4ARVA 4AKEA 3A10A 1E9AA 2PS0A 1EFHA 4TWJA 4CNQA 2QTWB 3CXRA 1J7JA 1P2FA 4W8HA 1W8DA 1H05A 5JVDF 2AEJA 3Q40A 5BT9A 4ILEA 4R83A 1HSZA 1OLUA 5AM1A 3KB8A 2Y1XA 1AX9A 4HB4A 4I9HA 4MUXA 4XB1A 4DCJA 5G1PA 2GMWA 2P6UA 2W4MA 4FJ1A 5KNCH 5BW5A 3EMDA 2QX7A 5LZ4A 1EWRA 1PVVA 1NJSA 2VZ9A 4F56A 4I55A 2RK6A 1E63A 1RQPA 2RHBA 3UBTA 2NO9A 1P9WA 1U9CA 3H0CA 4YDHB 5ALDA 5ABPA 2IT1A 1JDUA 5DOVA 3IUJA 2JFUA 9LDBA 2FZ4A 3DUFB 2F3PA 3IAFA 1ZVKA 2KLHA 4B6SA 4J43A 4JROA 4IX9A 2DLNA 1PT8A 5KQGA 4YRAA 3T4EA 2XMSA 5KX5B 5EHQA 4IQ0A 1NVTA 1RWVA 2OUKA 5B4UA 4UNRA 3QVUA 2BTOA 4WX2B 5FBKA 3FYSA 3UMCA 4AZ3A 5A9RA 1KYYA 1S2LA 4ESHA 2GBLC 4G86A 3ELYA 4HWGA 5DM2A 3ZW8A 4F04A 4KI0A 4MW2A 4S1WA 4MV6A 4J2HA 4GPD1 1U7DA 2WKPA 1PSDA 2WNSA 4A0FA 3HE3A 1ZNQO 3LQ1A 4ENRA 1QQTA 3U7FB 4I3HA 2OXTA 1T5TA 3MCVA 1IB0A 1ISFA 2ZYWX 2GYUA 2PHZA 3M70A 4RSHA 3ESQA 3PTAA 2EF0A 1VMDA 2Q5EA 4ER5A 3D6UA 1H4QA 3MOGA 3V8RA 1WNFA 3JYOA 1E1RD 2A78A 4CFYA 1UBGA 2J5BA 3HJTA 1P0PA 2BGJA 2IYQA 3BA6A 5SYAA 4CLOB 2E5LB 4WRRA 5CPBA 1FTQA 5J5VA 4YMTA 1DV2A 1LB1B 2DF8A 5DB4A 3VH1A 2NSLA 2DBVO 1XD2B 4PZCA 1E3MA 3JQGA 2Q5JA 3KB6A 4WZ6A 5MGBA 2AJBA 1IN5A 1GVHA 3R8CA 3AB8A 1LLUA 2BE9A 1M10A 3AUJB 2QLBA 5IC5A 4BYMA 3WYEA 3AP1A 3FX2A 4TT3A 5BYJA 4AUMA 4REQA 5BYAA 2BRUA 5JJIA 3IUQA 3LFTA 3MJRA 4N8SA 3UMYA 1DEAA 3OD5A 3P2MA 4LMAA 1HWYA 4HTFB 5GAJA 4QICA 1XZDA 1YCGA 3E7PA 2ZOSA 4CG2A 1YVPA 1WD7A 3R44A 4TTSA 2PL3A 4X6LA 2HPVA 1QUEA 1X13A 2IYFA 1F2DA 1VHWA 2C94A 1P2UA 2HLDA 4I0WB 4MITA 4NBSA 4RVFA 2MR5A 4BFLA 3LKZA 2GEUA 1RJFA 4DV1B 4OI0A 4BTLA 3EDQA 1A4UA 1QO7A 1JYSA 3SMQA 2C2GA 1ANKA 1CUHA 3COYA 4HH3C 1OMOA 3C7AA 3LUAA 1BYIA 1G17A 3HVUA 5HIIA 1A8QA 1T4GA 2JGDA 3GAFA 3TOSA 4M9XA 4Q9KA 1E3QA 1Y63A 4Y2TA 4ETNA 3LO8A 5K6AA 4RH3A 1YZGA 3ONDA 2EG5A 1Q19A 4GKKB 4HNHA 4JUAA 1Z5VA 3K20A 4F21A 2HNBA 3PGVA 3AB7A 4QSMA 1FP4A 2EZ8A 2H5JA 3S7ZA 4S04A 1NVAA 4GLFA 3ZHTA 1RJEA 4QGHA 1GL3A 4FLFA 1FA9A 1G98A 2CLKB 3S70A 2DHQA 1P1JA 2DUWA 1T8PA 1XALA 4OQNA 4XJSA 1AGPA 2RB4A 3KTFA 4XGIA 5JT1A 1R2QA 4YRBA 3H1TA 3LKVA 2NV2B 4CIAA 1M1YA 4OPMA 1X7HA 1Z2OX 3KELA 3LCMA 3BEOA 4H18A 1SC9A 2W2VA 2Z4TA 3GZJA 5CD9A 2INGX 1H2RS 3E1SA 4DA9A 1YS1X 2XUZA 1LLQA 1VYVA 2F59A 3N8GA 4GOMD 4WOCA 1QV7A 2C9ZA 3CF4G 3K1TA 3JZFA 1KI1A 1NT2A 5A06A 2BGWA 1ZN9A 4OHWA 4OATA 4BFWA 1VE3A 2RDMA 1VSVA 3LUKA 4M3NA 4EPWA 5HIJA 4LJSA 5J4VA 4QX6A 3GGSA 2ZATA 4NKRA 1ORWA 4YMGA 4Z0TA 4JUCA 3ZDEA 2H4HA 2IQ5A 2WUEA 2UZIR 1UEJA 4JOQA 3THWA 5BUSA 1O0BA 1UMBA 1E6LA 1EWVA 1UKYA 1ZCZA 4POAA 5IVIA 4B5LA 3VZPA 2IIPA 2IYRA 3GEMA 3Q7PA 3DDUA 4M1ZA 4CXMA 1X7WB 4HFJA 5EZQA 1N5LA 3PQ7A 3H9UA 4P36A 3PDHA 4EI7A 4G0PA 2VJLA 4WCVA 2NO0A 2LE0A 1STOA 2VT2A 1G21E 2FPSA 3O0TA 4YNBA 2OTCA 4P93A 5E6SA 3W2HA 2O4CA 4BMOB 4DSAA 1C9KA 1HY3A 3NWPA 4L0CA 4IJMA 2CWDA 4U00A 2NPIA 3QPWA 3MHPA 5LBTA 1E4VA 1ONSA 2QQ0A 2CFSA 3OQBA 2H07A 1AGYA 1RDFA 4HQFA 4EKNB 2VXBA 1C1HA 4OHKA 2WG0A 1V6AA 3REOA 3SC4A 2JGIA 3A9VA 3IMKA 1LBQA 2LIPA 5FBLB 5FL7A 2UVPB 3D6AA 3UAVA 4BMNA 1Z6TA 4DBLE 2PNFA 2NX2A 121PA 2OQIA 2GVNA 4ZMSA 2R8YA 4RWZA 3UFBA 5JO0A 4AFNA 4OAPA 4E31A 1W6UA 1YULA 2PU5A 3GVIA 4EW2A 3ZCUA 2ZJ6A 1DXHA 4Y2QA 3S2SA 3SM3A 5LLDA 3KYDA 1IK4A 1M6VA 2IV7A 5I7HA 1JV2B 3P7MA 2BI8A 2AL7A 1G1MA 1LV8A 1HMYA 1M6WA 2A5FA 2V59A 1VJTA 4HRVA 3RVBA 3EIOA 5AJUA 3PX7A 4JKIA 1Q0UA 5ITVA 2PUAA 4HO1X 4U02A 3RAJA 3W77A 4OHXA 1RQRA 2WAAA 4M0LA 4ENWA 4X5OA 3BFKA 3KKMA 5EP4A 2O5EA 3ROGA 2J30A 1XXHA 1L7XA 2D3TA 4YXFA 2GRUA 1KZ4A 5EFOA 2AFRA 4MYDA 4TLLB 3O2JA 4UVHA 1KZYC 1GZDA 4MIEA 4BLRA 5A3SA 1GV0A 2QRHA 3LLVA 3O74A 5LXTF 1L5KA 3AEQB 2BZ1A 4M88A 5H3CA 1FUKA 4ZV9A 4ZYXA 2JLUA 3KTAB 3A9UA 5TT0A 4KQGA 3AVXA 4TXMA 2OQ2A 1EKXA 3IQFA 4J07A 4EG5A 5JBIA 4BTEA 4ERNA 3CPSA 3IUSA 3P4UA 4RHTA 4EEKA 2ZE5A 2P75A 4CDGA 4NHEA 4NL4H 3KQTA 2FN7A 2DT8A 4MA0A 5EI5A 1DKMA 1IY2A 1T36A 4GWGA 2AG6A 4X20B 1GITA 1I3CA 3PT5A 1DRKA 2ZI9A 3E48A 3EVZA 3N5CA 5ALOA 3W7BA 3OP4A 1CULC 4CIXA 2H92A 1RQXA 1XTSA 2R6CA 3BF7A 2VCYA 3ONFA 4AUEA 5EGNA 4D3XA 4D6YA 3BH0A 4RM3A 2J41A 3X3HA 4FU0A 5D6OA 4Q9DA 4F5WA 4PXYA 1NDHA 3AC0A 5CA0F 1ZIPA 3X1YA 2Z9BA 3JYPA 4RZSA 4ECAA 5M7EA 1ZCBA 3V4SA 1Z4MA 2W2PA 1N5MA 2JRCA 4OJQA 2J9FB 3HFGA 1CDDA 3NDPA 4Y0VA 3H2IA 2QUJA 1RWMA 1E18A 1U5BB 1DINA 2G7MC 1OVMA 4M53A 3T7EA 2LTAA 1NURA 4N5HX 4L74A 5CCBA 2DFTA 4BRUA 4ZYUA 2NV6A 1RAEA 5HF9A 1T5LA 1ZL2A 1GPYA 4JLPA 2DOKA 1V3QE 3TIIA 3NJ4A 4J4TA 4O4JB 1G6KA 2IEDA 4K9DA 5IM4F 3HDQA 5TGZA 1PJSA 3JYHA 1HNXB 2Q0XA 4GBGA 2JW5A 5ICCA 5LN1A 2J3EA 1CJBA 3VKVA 3GELA 2IH2A 3JSAA 2HK9A 4LIPD 4F85A 1WWKA 4QHSA 4A1OA 3E58A 5GWXA 1EXWA 4YS6A 4LCEA 3V5NA 3DCNA 2BM0A 4TKZA 4NZ9A 1IN6A 2E4YA 1Z6ZA 4GXQA 4A15A 2QP3A 4RQUA 1VXRA 4I2NA 2DFKB 4HGZA 3USCS 3A0UA 5KSPA 3GUZA 3RPEA 5AOBA 1ZX1A 2K5UA 4GZ3A 3R7DA 1ZEMA 3FIUA 3PJFA 2BCGY 4RD3A 3O1LA 4GC5A 1S1MA 3ZS9A 3AL3A 1T1JA 3WDSA 3HR8A 1DQYA 2JIQA 3O21A 4GL2A 2FX3A 2LDBA 4DLRA 2BFMA 1B14A 1DKQA 4D0LB 5A4JA 5J2TF 4I19A 3UJCA 5LDDC 1IJKA 2PMWB 3BL5A 4Z3DA 2ZXFA 1HT3A 5FOVA 2I7XA 2VH2A 2J6CA 4XYGA 4UE2A 5K0JA 1VLJA 3A37A 1QQ5A 3R2JA 5KMGA 4PYNA 4XRGA 1REQB 3EIWA 5CHEA 3R1IA 4GSKA 5SYMA 4CMIB 4MICA 1Z4JA 3O84A 1N2JA 1F8FA 4D5EA 3A58B 5T8KC 4ARZB 3I04A 2F1JA 3AQ4A 3IMFA 3RARA 3GHYA 5MN5A 1PR1A 2QW0X 1SZCA 3M9LA 4JIGA 1QOZA 3DDNA 1MLDA 1JLSA 4IXDA 3BKWA 1YJ8A 5IH7A 3AMVA 3H2YA 3K05A 1EG7A 1WXEA 5CFRA 1JN0A 3EYAA 3A6EA 4MB0A 2O2DA 3KAKA 4KH1A 5BQ5A 1NXOA 5LQNA 1AOXA 3AF4A 4HDSA 1X7DA 3PX3A 5H8WA 4WASA 4CYMA 3ECAA 1I4OA 1TKCA 4INAA 4KEAA 4H7EA 4PO8A 1CPYA 1F4VA 2MYPA 1NF8A 1Q0QA 1Z36A 4F6RA 1IQPA 1E5LA 1M74A 2ID8A 3RC8A 4RLHA 4M7PA 2BMEA 1NLUA 3BCHA 3NXKA 4WN3A 5DRTA 5FHRA 3RRYA 5A2QA 1JDJA 2R00A 5KYWB 4IIXA 3SXUA 3THSA 4AKSA 4PYLA 3FW1A 1Z16A 4B0PA 2VO1A 4M1YA 4XWAA 1MAWA 1YONA 3L0BA 1IRXA 3WL5A 4E21A 3HYRA 3LYAA 2RAUA 4JQCA 1YO6A 4TSFD 4CTJA 2GWHA 3DD1A 3GNLA 5TPWA 2DVMA 5EGSA 4ZODA 3PDUA 3RRFA 2IKSA 2AMLA 1FU7A 1MPXA 2ETVA 3DEJA 3PD1A 3VYVA 5TF4A 3A1FA 4JL5A 3RH0A 3ML1A 4L5AA 1PZHA 2ZB8A 1DIHA 2FLKA 4R1SA 1JZQA 1VMEA 2NQTA 3H99A 1ZUIA 3BCUA 4EW3A 4EENA 1HT2E 3IQXA 4RLFA 2WTUA 4Y2XA 1D03A 2B9EA 5ALNA 2C59A 1P3JA 4URYR 3OX4A 4H15A 3I6BA 2AWOA 2ST1A 4KC0A 4QOFA 4L3OA 3IVGA 2Q1WA 3VO1A 4W5QA 3FNGA 3Q7EA 4QWWA 5H1YA 5HJ7A 1I94B 2I91A 1GGEA 2XB8A 2Q4EA 4LY3A 4C2AA 4E88A 3ASZA 4LTDA 1E92A 1DBPA 2WJGA 5EIFA 4AS3A 4YUXA 5F2NA 2OCAA 1I7DA 2ZSJA 3QLVC 1RXYA 4AMBA 3PEWA 3MS2A 3TLEA 3LP8A 1FRZA 4FVTA 2C9DA 2C0CA 4BMSA 1AE1A 1A2OA 3A3YA 2IY8A 2MYTA 3FCYA 1YBVA 4S1NA 1LSJA 1GNRA 2EDCA 4J7XA 2COUA 2IOYA 1J07A 1II8B 4ZVLA 3ZY3A 2R8EA 4AIIA 5TX7A 5KDDA 5BXQC 4GOOD 2XGSA 5DK4A 2C4TA 1GA1A 1GXSA 2IFTA 1W5BA 3EGOA 4PYRA 5D2CA 2WYVA 1YAHA 4MQFA 3ADDA 5ILOA 3T1HB 1NM5C 2XCRB 1W7AA 1XJWA 3FHOA 4BZXA 4G67A 5AKGA 3R9XA 3QU9A 4C0WA 4HSGA 4GOXA 3F90A 4N0PA 1DFGA 1JF8A 4BV9A 4LI0A 3S8EA 3U37A 4CKZA 4BNDA 1AKQA 1MGPA 1GNTA 4DYDA 3RRXA 3IE1A 3TQOA 1WPXA 4UAJA 4GI7A 2D5AA 2IIVA 3L0ZA 5G0UA 1LRLA 2PSSA 3EULA 3OOJA 5IAKA 4BTVA 5JNLA 2HWUA 1K4MA 3H42B 1PQWA 2X5OA 3MTEA 3QKRB 1YZTA 2I0FA 1HQCA 2QL5A 3NNNA 3M5WA 5DO9A 1SCUB 2H8KA 5JSQA 2BKVA 4W82A 2EWWA 3GHHA 5ALKA 4FSDA 5TB5A 2V1XA 1Z07A 4G8CA 1RM3A 1NXTA 1IBRA 4PE5B 3I9MA 4IIFA 5EJ7A 5LWQA 2HYIC 4FBGA 3COVA 4EK9A 3C87A 4PEVA 5KYWA 2GHIA 1E0KA 1G8AA 4L9WA 1QE3A 1J8YF 4BMCA 3ZDCA 1N2EA 4IY1A 3G23A 2AT1A 4K28A 3NLLA 5JEDA 2HJHA 3JQFC 4W9RA 4DJ5X 3UPUA 1JBQA 2QU8A 3K1AB 3PXBA 1JHVA 3CSDA 1G7SA 1SOUA 2FPPA 1GSHA 3FNEA 2EKZA 1FMLA 2QAGB 3U13A 1E3IA 1E1DA 1G9TA 2WWGA 2PX5A 2YJ4A 1JHOA 4EY8A 1KJQA 5H68A 3PEEA 4FDMA 3B1JA 3K0HA 2IU3A 3DV0B 4HYTA 1OWLA 3O31A 4JUFA 3HZHA 5F2EA 4C3ZA 3IVMA 3MCTA 2EWMA 3IV6A 4YWHA 1CR0A 1KYTA 4XQGA 4DNOA 1TYEB 4IH1A 1EK5A 1P0QA 3EXHA 4PICA 3K3PA 4ROTA 4W99A 4CM7A 4PG5A 3FHTA 1UKAA 4UUMA 1DUSA 2IXBA 2OZPA 3KUKA 2SCUB 4X94A 4CM8B 2DZDA 1I8TA 2XWPA 2B30A 2P35A 3QQ5A 2C31A 1QPBA 3UK1A 3OQMA 1NRIA 1M8PA 2GZ1A 3LZ6A 4H6PA 4RTMA 4CEJB 3L82B 4NV1A 4EW6A 1N5JA 2PGJA 3A4TA 4Q39A 3CG0A 3FNRA 3ANXA 1KAGA 3GJZA 3K30A 3N0XA 4RPIA 3P0RA 1CNFA 3TYXA 2QF7A 5CW1A 1L7VC 1EIZA 1TU0A 2EQ5A 3CZQA 2AB0A 4I81A 4WD3A 1U2EA 2PTGA 1EJ6A 1M2OB 3T3HA 5JIBA 1AS0A 2J67A 1IPHA 1U3GA 2O20A 4V2UA 5C8YA 1JDPA 2ZYGA 4ZP1A 4BRWA 3D8NA 5DTMA 3TLZA 1WZEA 3AZPA 5IK2D 1IEWA 4BY9E 3EA4A 4M1MA 5KX5A 1XG5A 3LRXA 3R7NA 1Z6QA 4F96A 3IEIA 2PGXA 3IJ5A 1AKYA 5CVTA 1A88A 1PS9A 5FTJA 4DZTA 3TOCA 5LU8A 4QASA 1A8IA 2X0DA 2FZ5A 1E7QA 3D4BA 1D6NA 3NETA 2XA1A 3ZH9B 5IAAA 4RTOA 1T3TA 2HBZA 3Q2KA 4JP8A 1PJ3A 4LOIA 2TS1A 4TT3D 3WA7A 2QBYB 2FK8A 3NHKA 1T15A 3LS2A 4ZQCB 4J6EA 1SXJD 2GCPA 4L0DA 5A4FS 2POQX 4GPIB 4MQMA 1F7UA 1Q12A 4Z4EA 1JECA 1H2ZA 4LY0A 521PA 1H2BA 1G6Q1 4ZI5A 3C14C 4PAOA 1ZM2A 3WK8A 5FTLA 5DM60 1Z9BA 2HC9A 2R8BA 5TC4A 4CZ2A 1Z7GA 4D3YA 5KTNA 2X0IA 1E69A 3WWZA 4CQJA 2P9BA 3MT8A 2O2XA 3PHCA 4AVYA 2PN1A 5CEFA 3QXCA 2FPOA 1A95A 1TEXA 3O2NA 3CR8A 1YL5A 3B1FA 2X9QA 3ASUA 3OEWA 5ADUS 5LR6A 3GRKA 5JQGB 2J5KA 2JJ1D 5EXDA 3RGWS 3WMGA 2WVHA 2G83A 1IK6A 4JVMA 1ITZA 2JGNA 3JX9A 4JUDX 3T9CA 3GJ4A 4LWZA 4QDJA 3W5JA 1Y6JA 2G36A 1C1YA 4E5MA 4GP6A 1JALA 2I2DA 3EVDA 4YAUA 2ZU0C 1FQOA 3AVTA 2PMBA 2VYQA 3G5AA 3B36A 1GUAA 4YXWD 3HKDA 4WZBB 5K01A 3GBPA 4EY6A 4HC4A 4BLUA 3U7JA 3W78A 1ZUWA 2ZPTX 2HGZA 5CD1A 2JK1A 3MTAA 4KV9A 4H7HA 2VTVA 3LMKA 4WESA 5IHPA 5KYYB 3QA9A 2PKXA 2EJCA 1S2GA 1U2DA 4LYFA 3ZX5A 1VCOA 1GCUA 1IG3A 1ZUNB 4AP6A 1NOKA 4C6RA 3JQGB 2VRNA 2OM2A 5F5XA 3MK31 5EJMA 2JLZA 1F12A 1ORVA 3U4MA 1O08A 2VXYA 2G5PA 1NNSA 4JBGA 3DZ8A 1R4ZA 1VIMA 1I0LA 4ZT6A 2C9BA 3D4PA 4RZUA 4YIKA 2XT9A 4OJKA 4AF6A 2E6UX 2X5JO 2VKTA 3E22B 2XIQA 4GPBA 3I5XA 1W5EA 4BKOA 4HQKA 3GZNB 1OXUA 3SI7A 1Y5RA 4LF7B 5FOTA 4YCBA 4JXJA 3WB2A 2XB9A 4YCDA 4YFYA 4PSKA 3WGKA 2BEKA 1M6HA 3T7SA 3AOGA 3BWEA 2OUIA 1YJAA 1UBEA 4Y2HA 1N6RA 4B44A 2PAFA 2Z8ZA 9MHTA 3UTDA 3ID6C 4LQDA 4BHTA 1T9AA 2M1ZA 2WY2D 1ILWA 3WLLA 5MFPA 2CL6X 4X9XA 4C21A 1TEHA 4F7DA 4YDQA 2A0UA 3EUEA 3ZU4A 5KNDD 5A6SA 2OBMA 4CQMB 1C81A 1FL9A 2YV4A 5KNDH 5LIRA 1J97A 2HPAA 2V7VA 4Q4DA 5I51A 1SHZA 2QAGC 4EA6A 3GLSA 4ZMRA 2SECE 3NRCA 3KLOA 4D96A 2C2WA 1TM3E 4KRFA 3FYUA 5IAGA 3TCNA 1K2VN 1VFPA 3SZLA 1DCMA 2MSCB 3B3AA 4H7FA 4LJLA 1SVMA 4QYXA 3L6BA 5JR3A 4H35A 3IP3A 3B52X 3WQHA 4DMRA 4HQ6A 1RW4A 3OZGA 1OAAA 3KSZO 4CUJA 3BWDD 4NU6A 2NXJA 3VNAA 4CF4A 3KPUA 5LMZA 1PGQA 3BAFA 2XAAA 3ZWWA 2ZSIA 5LDGA 3KUCA 2KW5A 4P22A 4WKPA 3BRWD 4TQGA 2IUEA 1RU3A 4C0BA 5DCWA 2ETXA 3C8HA 1XTBA 3MJVA 1Y8ZA 5IFKA 1PX0A 5IAOA 2W6OA 3AP3A 2WJIA 1G8FA 5B37A 3AGQA 3EBLA 3N8DA 3LPLA 4MR8A 5AXCA 4C2UA 3FPCA 3TL3A 3BWCA 3D5QA 5JMPA 1Z17A 2X0FA 3ZHBA 2OHOA 2Y8EA 3A05A 2P79A 4FKMA 1EUDA 3PFWO 3ZWVA 2IXFA 3W3ZB 1YUNA 4DIBA 1JIIA 1F20A 2RMKA 2D1QA 3ELDA 4I5FA 1WSAA 3KB2A 4KDEA 1T1EA 3MFYA 3NHJA 2DTEA 2ZS8A 1GGHA 3SF0A 1JDTA 3Q7RA 5LA6F 1ZITA 4A10A 2BMVA 2VDUE 4DLLA 4M7RA 1A5BB 1CE8B 4DQVA 4OVKA 3MD0A 1CTQA 4A8TA 1NXPA 1U99A 2FW6A 3HB4X 4QGFA 4N1AA 2DBYA 1C14A 1MA0A 2QXTA 3DDCA 4MQLA 3BMOB 4PYOA 4XIJA 1ZD5A 5ECYA 4DM3A 2GPYA 2R66A 4RY2A 4EY3A 1YDFA 3BIFA 1A5AB 1F1BA 2PJRA 5JZSA 2FPRA 1JI3A 1COWA 2BSAA 2D0IA 4DV5B 4TKUA 4B3GA 2AOWA 2EFDB 3T7IA 5K0TA 4Y7DA 4II3A 3CVVA 4QM6A 4ZPJA 3WIUA 1GRRA 4AS1A 1EFLA 2QWXA 4G23A 1VL5A 4DL9A 5GJBA 1E64A 4ZVQA 4M55A 2GCIA 1YS9A 2EYUA 1LTQA 5AQ1A 4KO1S 4IF4A 4F84A 5JVDA 2NYRA 2JH3A 3G9UA 1TO2E 3GJSA 3WA6A 5ICEA 4XW2A 3Q1LA 1XA4A 2EEPA 4PZ9A 2HMAA 2CWWA 5DNYB 4IDOA 2HJWA 2WUGA 4K2HA 5ER9A 1EX7A 1NYRA 1ZOSA 1PNTA 2Q3HA 1NUAA 3M0EA 3FFBA 4OB6A 4FYPA 1OREA 1RQLA 3UA4A 4MV5A 3L5OA 4EFNA 3SQWA 1I7NA 1OU0A 4B6JA 1G5FA 3JZIA 1A4XA 4Q4LA 2CKDA 4EB6B 2C7BA 3AB3A 5JWOA 3QGMA 4MUYA 3DOFA 2B8EA 4TXLA 4TV8F 5CVDA 1ECFA 2D2XA 3E5RA 5JC1A 3E2MA 3FCAA 5EVJA 3SEZA 3KKLA 4XM0A 1XU4A 2QM8A 3PCRB 4EY4A 1TTPB 1BKSB 1Q1NA 2EU8A 2I5PO 3GAAA 1YVEI 3GVXA 3BXFA 1Y8RA 1JDSA 4LJ7A 4PQYA 2YFKA 2JLAA 3E1KA 4RCVA 4QUDA 5AJZA 2YS7A 4NESA 3GMTA 5LJLA 4TV9A 4UVIA 4EGCB 3GFBA 4OLHA 2IZZA 3MVEA 1ZWKA 4IFTA 4L02A 5ALTA 3QVTA 4ZYWA 1AV6A 1N4DA 5T6MA 3INYA 3IS3A 1M1ZA 4RTJA 3ZW7A 1MG0A 4CLHA 2Q5IA 4B3JA 1E9CA 2ZYUX 3OIDA 4XEHA 2FEMA 5BV2P 5JNWA 5ITWA 2FXIA 4UULA 4OK3A 2XGMA 3ISTA 1RS0A 5HHTA 3I0MA 4W9MC 5FV7A 1X14A 3DCYA 4Q3LA 1R0RE 1H8HA 3FZGA 3I58A 1T8TA 5GGYA 2VQDA 5I9MA 4ARZA 4EQ6A 4ZK2A 3PR3A 3DCJA 4GP9A 3E61A 4Y6OA 3T9EA 2QTCA 4F93B 4UTNA 3HL4A 5F7JA 5C52B 2CV2A 3CKLA 2RKOA 1TZJA 3KUDA 2H2FA 5FOQA 1KYWA 4LK3A 4CU2A 3LHDA 4H1VA 2IF2A 1EA5A 2VRBA 5C1BA 1GKIA 3WYBA 3ZS8A 1SHKA 3QWHA 4URFA 1HYEA 5A4IS 3DEKA 4KQ9A 3TZBA 2XITA 1MHTA 1E9VA 1Y3FE 4JQYA 4E5NA 1XMVA 3MJEA 3K15A 4XYEA 2C95A 5K0ZA 1PFKA 4WXMA 1Y1SA 3EUFA 1YV9A 3O4RA 4CLOA 2HV8A 2C20A 3RUFA 2RGCA 2YW9A 2PZ8A 3GYGA 3N70A 5HXAA 2OXIA 3IXLA 3CJQA 2ZI5A 4I1UA 2ORVA 4LBZA 4JX8A 4S12A 2O1XA 2XWJI 4X8OA 4LHEA 2CDAA 4P32A 1ZK1A 2O2JA 1QG4A 2H4XA 2QMZA 2ZBRA 5EQJB 4G5XA 3HMKA 1XP8A 3U6KA 1WB6A 2K4MA 3SQNA 2R68A 1T4MA 4L3WA 2ASEA 1Q84A 3N5KA 1NP3A 4RHXA 1G20E 3KKKA 3HCCA 3RS2A 4EECA 4TYMA 5ED4A 2AKYA 4JYZA 2ES4A 1L8OA 3B1KA 3FNHA 2C57A 4HTFA 4UTVA 2DCUA 4HX5A 1JB9A 4E2FA 3OJXA 4E6PA 5EIBD 2VEOA 5CB4A 2XQJA 1G38A 3Q7IA 1YD7A 5EMKA 1OUMA 2OSBA 1X2BA 4MHOA 1X7ZA 1ML4A 3T7AA 4DJAA 2Q21A 4WJZA 1J9ZA 3ZCXA 2EBUA 2R48A 2VJOA 2Q5OA 2D8MA 1VRCA 1X1TA 5DWDA 1JG3A 1K86A 4ZVPA 3MGAA 1BGVA 5AW9A 3HSSA 2J3JA 1W1UA 3NORA 4RS4A 4EJSA 4JR2A 3WBJA 5M2QA 2HQBA 1JDBB 2V03A 4NOJA 1N3YA 1JWLA 5ALSA 2LNDA 4TTVA 5IW8A 2OHHA 1G63A 4QFDA 3RS0A 3VPFA 3BORA 1QC5A 3B1YA 3UXMA 1UJ5A 1Y7TA 3HKCB 2RBGA 2KWIA 2ZS7A 2C1EA 3G1WA 1U2GA 3H2GA 4Q4HA 3W9UA 2XVYA 4D5GA 1GDHA 3AETA 5KVVA 4N41A 2AF3C 4PTLA 3KEQA 4D80A 1IY0A 1Q2XA 3IAS1 1XWFA 1F0NA 1TFRA 2GWRA 2V98A 1HBJA 2P6NA 2H54A 3NV9A 2JCBA 3LRTA 3TRJA 2RKBA 1B43A 2VCEA 5JASA 1E1QA 2TMYA 2GBLA 1G2PA 1MC5A 2P4QA 2Z4RA 4I6GA 4PS0A 4RGBA 4E70A 2XZLA 2E9SA 1UDBA 3LLCA 3AVVA 4UU8A 2PM8A 5JMTA 1KORA 1DC3A 3IUPA 4C4XA 1GARA 1TX4B 4BV8A 4JOCA 1H2YA 1N8TA 1YQTA 1M8FA 4DMMA 1ISHA 1KI6A 2B98A 2CL5A 4NS4A 2FMKA 2FLVA 3O93A 1C30A 2RG7A 2OP0A 4M60A 2D06A 3RSCA 3UWOA 1JBKA 1Z45A 2I2AA 1U7XA 2BISA 2OVBA 3TI9A 1HDXA 4C78A 4Z3KA 3WIBA 1U04A 2WHRA 4B32A 3AJ8A 4KTVE 1N8NA 2O0MA 2YXLA 3GG2A 3MLBA 1U0RA 1IZZA 4WLVA 1V9CA 5JXGA 4DQXA 1PR9A 4IIYA 3SPXA 3EZ6A 1OX4A 1EDEA 4I8DA 4NBVA 3AWIA 4MPRA 3KUXA 4PC7A 3U5ZB 1ZVVA 3OY2A 1KDZA 4ZHQF 1DC4A 1QYDA 1Z3CA 1ENYA 3BDIA 2P2ZA 2Y4NA 1IBCA 3AJRA 5AI5A 2X3UA 2ZUBA 2X76A 5IN5A 4NBLA 1KSJA 2I33A 3L4KA 3CNLA 4WUVA 4ZO4A 1HE3A 3FDIA 4C22A 5AKKA 1ZRSA 2NZ2A 1D2MA 4HYEA 4IJQA 4A8JC 4C0HA 3IPYA 3I42A 3NBMA 1GNVA 2AGVA 3II6X 3VI3B 3OQOA 4EPVA 5JFTA 5DI9A 1C30B 3C3YA 3AL0C 1YMUA 1CY7A 3KFLA 4RV5A 2R6ZA 2I4RA 1MJ5A 2VP6A 3VKFA 5B30A 3OZAA 3VVBA 2O2CA 4YIHA 2O07A 4DJFC 2HB6A 2Z6QA 1XD8A 5IF9A 3AR8A 3REQB 4CT0A 4ENTA 2CVPA 4U9UA 1DFHA 4JJGA 3ABSB 3FIJA 5FQOA 4C6TA 4D4JA 5BQXA 3SVTA 2N9UA 3TQCA 2FEKA 2O50A 3HNRA 1UK7A 4JC8A 1D6MA 2HF9A 3PRYA 4OXXA 1CRZA 4J0GA 3VDXA 5FPSA 1OLXB 4DMUB 1M2HA 4MV4A 3HBLA 1E2UA 3CBQA 2WWIA 3I9NA 2VQFB 1WUTA 4UVEA 1W30A 3GJXC 1JEOA 3GWGA 4QARA 3DFFA 5IUKC 1U8TA 4NBKA 4X8HA 2H18A 5CLHA 2EX4A 1YU6A 4DTIA 1R6VA 1WPGA 3RYCA 3AGPA 3PE6A 3OOWA 4RANA 3A4NA 1EGHA 5K5EA 3IT2A 4L5BA 5U1PA 2ZTMA 2GSWA 5CG2A 2JAHA 2WVGA 1CW2B 3TB4A 7AT1A 4HXYA 1JH9A 1QSGA 1SQFA 2QSYA 2VOEA 4PYJA 2ZJ2A 4XVHA 1DJOA 2BTQB 1U7TA 2PX2A 3TJMA 2C82A 3NBYC 5ILGA 3K7EA 4NE9A 3HN6A 4AJ2A 4RDCA 2RAPA 1LXCA 4IH4A 3WGYA 5LPNA 1WMSA 3O47A 3T5MA 2UYHA 2W2LD 3D8BA 2ZM5A 4LZZA 2FRVA 1CJMA 3HR7A 2GA9A 1BYUA 3DAOA 3OE4A 1M5TA 4J2TA 1ZM3A 1PG0A 1FBNA 3PR1A 5JCOA 2O3JA 2V7TA 3OLCX 4AZTA 1XZQA 2CGEA 3H3JA 4R5HA 3I2KA 4MARA 5CT8A 2YHAA 1L6RA 3FVTA 1ZYUA 2YHBA 3SS9X 3QFSA 1G3UA 3A1UA 4DR1B 4V1CA 2BGMA 4YCAA 2F17A 1ORIA 1QIIA 3DJFA 3F97A 3T0IA 2GBPA 3QOYA 4OXQA 4NCXA 1D1QA 1LDYA 1U3WA 3H0EA 4OMUA 1LK5A 2FEPA 3CLUC 2BJWA 1V16A 3AIIA 3ZLJA 3D6MA 3NC1C 2IYLD 3IVAA 3LLUA 4UEWA 5G1NA 4MKGA 4RELA 4YI5A 3PBKA 5SICE 1UBMS 1QP0A 3ZGZA 3G9ZA 2C1XA