4C55A

Crystal structure of serum-derived human igg4 fc
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords IG GAMMA-4 CHAIN C REGION
publication title Structural Determinants of Unique Properties of Human Igg4-Fc
pubmed doi rcsb
total genus 41
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4c55A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4c55A01
2J6EL 5FKPA 3RRQA 1Q0YH 2X1QA 3U0TB 3KXFD 5HYQA 5DJDB 1QQDB 4LSQL 5A40E 5C0CB 2KPNA 2ATKB 2XTJD 2LTQC 4WGWB 4DEPC 1SY6L 5EZOL 3PG2A 1F5WA 4U1SB 5EUOF 3TV3L 1MCIA 4ZTPL 4M61A 4OD1H 2OK0L 4S10A 1P9MC 2QSCL 2BY2A 3ZO0A 4O00A 4WJ5B 1C12A 1JGEB 2MMXA 5JQHC 2NZIA 3RL2B 1N64L 3TO2A 1T1XA 2Y4SA 5BCAA 2OR8A 1TJHH 2FGZA 5C2UB 3WNNA 1TXKA 4UTBH 1M71B 1FBIL 5T1LA 2CPCA 4JQVA 3IDMA 2M8XA 4HS6B 4XWOC 5I75B 5AD0B 1X5YA 4NQSB 1F8TH 1OGAA 1VFAA 3VMPA 1WWBX 4F7TB 5KS9A 1MLBB 2ZUVA 4JFFD 5J3HD 1HKLL 2CO7B 4LNVA 1WCBA 3QEHA 5JHDB 5I1LB 5ENWB 1ZTXL 1EEYA 4XHQA 4WTZA 3TJEL 5C0NC 3VFNA 2JCCF 4XI5C 4MQ7A 4CKVX 4AEIH 1RHHA 3S4SA 1FORL 2ID5A 3FO9A 1AFVH 4M6NH 5AUMA 3X14B 3MJ7A 1DUZB 4ONGH 1RJLA 2NY2B 2VDLH 1XIWC 2WP3T 5GRZA 2DLGA 5GS3A 1T20B 3SGJA 1AXIB 1BVLA 4U1KA 4O02L 4P4KA 1XZ0B 3VFUA 1C5CH 4B7IA 4A2LA 4OZ4B 2OLDA 5H2BB 4L8CB 1NFDA 2V17L 4H26A 2HWZH 1I3RB 2OR9H 3O45B 2CIIB 5GSVB 5ICZB 3T2NL 1UYWL 4AM0B 5GISL 5L2KA 1EAPB 4OQTA 4HS3B 4HF5L 4Y1AA 2W9EH 1DN0A 3MGOB 5D7JA 4LMQI 3D0LB 3RWIB 3S34H 4PJFA 1YMMA 2HT2C 3U83A 1DBKL 4P2OB 2EDHA 4X6DA 1OCWL 2VQ1A 1QSVA 3T0BA 4C56E 2EE6A 3MRCB 4J2XA 4R26H 5SWSE 4UIKH 5BOPA 1CFNA 1OTTC 4FNLL 4MJID 2ZUWA 1IGTA 1CDYA 3CFIC 4G5ZL 3O2VH 4R7DA 3ULUL 2YA2A 3HRZA 4BFBD 1FP5A 4KI5C 2ZOLA 5C0DB 3O11B 3ECBB 4ONFH 4NUGH 3T0ED 2KQNA 2E9BA 2ZCHH 5D1XD 3ARGA 2LABA 4EDWH 2BVOB 2EZ0D 1ORQB 5DD5H 1TJHL 3S96B 1R3JB 4TRPH 3GMOB 5IP4A 3EZJB 4XNQB 4PJDE 2HFGH 3MYJB 3C5ZC 2ESVA 3C6SA 4PGCA 3CDYA 2D7MA 4LCWB 4Y4KC 3BMVA 3QUMH 4V1DB 4XBPA 2R15A 2Z91A 2H2SD 4YZFF 2X70B 1FIEA 1YYML 2J12B 5LQBH 1OF2A 3MRIA 4RAVB 1HQ4B 3QDMA 5ETUA 2AJVH 4JQXC 1FO0H 2YA1A 1BQHA 1EIBA 1MQKH 4JY4B 4ONGL 5DMGD 1LEGA 5KVDH 3RWHA 2YZ1A 1DE4A 1AXTH 1W8NA 4G7YH 1FC2D 3T4AA 3S36L 4KTYA 3OJVC 4P2RB 4WUUD 5GRXG 3RTQA 2WK2A 1NDGB 4GRLB 4LLYA 3O6FD 3RX5A 1C5CL 4L3ED 4OAWA 4HKBA 4UQ3B 3O4LD 4KDTA 2HWZL 2OR9L 4XMKL 3VFOA 1YEFL 1HNGA 4HGMA 1SVZA 3OBAA 4PJEA 4UOJA 3IGAA 4HFUH 3ULUE 4P9HH 2BSSB 2EDDA 2W9EL 4MXVE 1HHKA 3C60D 5F1KC 1S5HB 5CSBA 3S34L 3UYRH 2HT3D 1CGUA 1RFDH 2B5IC 1JZ6A 4DGYH 5ADOH 4Z76A 3MRGA 1NGQL 5C6PB 5CCKL 4E41A 1IEAB 1G7QA 2I9LB 1ZK9A 3I2CH 4HJJH 5H8DA 4R26L 3O41A 4GH7B 4QY8A 4UIKL 4DK6A 2GYSA 5F8QC 1IFHH 1P7QD 1YPZB 3G6AB 3GIZH 2R4RL 4QCIA 1UXWB 1UXSA 1XGQA 3O2VL 4PD4J 3V79C 5C09E 1BAFH 3WHE1 1JTTA 2LVCA 4PJIB 1VKXB 3TT3L 3U4AA 3HR5A 4ODUB 4HWZB 3KXFB 4ONFL 2CRMA 2LVEA 4NQUA 4NUGL 2UY6A 5E99H 3UPRA 4X6FA 2ZCHL 4N0CC 2XTJB 5GGUB 3ZTJH 4EDWL 4WWKD 4JFZL 4XTRC 5HGHB 2HYMA 2HJLB 3EUUA 4PUBH 4TRPL 1SVCP 2G9HA 2X4UB 1ZLVH 2GCYA 5BRZD 1GGIH 5GGSY 3S36X 8CGTA 3SDAA 4OF8A 4Z0BH 4M93C 3WL9B 5E6ID 4KY1H 3TWCH 4L8SC 4LPWA 3QUML 1J0YA 2JJUA 3X3FH 5TGBB 2DM2A 3GSRA 5F7FA 1FAKT 3NZ8A 2GSIB 1KB5B 1FG2B 2B2XL 2MHAB 3PWUB 4YXHH 4JDTH 2W9DL 1JNHB 2WANA 4JFFB 3L6FB 1FO0L 3B5GA 4ZFOL 2AABH 1MQKL 1NH6A 1R3HA 5B8CA 4RIRA 1U2HA 3MV7E 1UM5L 5KVDL 4TPRH 1T1WA 3QPQC 3ZDXF 4XH2B 3FQUA 3I6KA 3VXOA 1VCAA 2AJSH 3QNXB 1AE6L 2ZUQB 4S1RH 5GIRA 3B6SA 4G43B 3ROLA 4Z7UF 3OX8B 4CN1A 3NIFE 4AIZA 5CZVH 1UZ8A 3L5WB 4H0HB 3GSOB 1MUJB 4JQVC 1U8IA 4N0YH 5L8JB 4OUUB 3D3VA 1HH6B 5GHWH 1YN6B 3BW9A 1D5ZA 5CILH 1KB9K 1NDMB 1GOHA 4HFUL 3MUGA 3SGEI 1CICD 4LCWE 2CKNA 3PGFH 4HH8A 1RFDL 1MWAB 4DGYL 1JBJA 3MRMA 3TVMA 4WIQA 3O2DH 3IFLH 3J7HA 1FVEA 1RUAL 1WC7A 4X6CE 2IANA 1KBGH 2V7HB 3I2CL 4HJJL 2R2BA 5HHQA 1KJ2B 3O3EB 3MFFA 2FDBP 4HUWB 1IFHL 5DMYA 3IJSA 1G1CA 2Q76A 3SGJC 4JGMA 4H1LB 4NO5B 1EEUA 1P1ZB 3U0PA 4P4KC 4PP1C 5EBLA 5A2KH 3I50H 3Q5OA 4KV5E 1RK1B 4UIMB 3MRJB 2AQ1A 2G5BA 2H8PA 2VWEC 1KPUB 4MJIB 4YE4H 5E99L 2F8OA 5H94B 2OTUB 4UT9H 1AIFA 3ARBA 2DQTL 1FZJB 4TSBH 4OLXH 5JOFB 3MV01 5I73B 5D7JC 5IESH 3VGAC 3BUYB 1GGIL 3T0EB 3VFVA 5D1XB 2BRRL 5I8CB 1JCKA 4NO3B 1IQWL 2FR4A 4PJBA 5C0FA 3NTCH 3TWCL 5IQ9A 3BQUD 4LSSH 1P2CB 5IMMB 2QKIA 2BOBB 2Z4QB 1NGXB 5L88H 3S6CA 1CS6A 1RK0A 1JNLH 4YXHL 2VABA 1F6LL 4NO0A 4J4PD 3OKEA 4N9GA 3E6FB 5BS0A 1G7HB 2AABL 2MQCA 5EC2A 5ITFB 4KK8C 3QWOB 1LILA 1MNUH 5F3BA 2IFFL 2Y7QB 4TUOB 5CSGA 1KTDB 2AJSL 3ARGC 2AK4D 3PXJA 4NRYB 4W68A 4S1RL 4BH8A 1E27B 4PRAA 2YPKA 3OZ9L 4FQIL 2XTJE 3HCVA 4Z7WE 4ETQB 5AZEH 5CZVL 3OKOB 3ARDA 2BSTA 3DMMA 3P0YH 1KJ2L 3OTTA 3F8UB 4JRXE 2YPVH 4N0YL 3SKOA 4WUUB 1IZJA 1YJDC 5CILL 4XMPL 1HSAA 4GO6B 4KK9C 2VDPH 3O6FB 2Y5TB 4L3EB 5EUKA 3O4LB 5GS2D 4JG1H 3OXRB 3FFDB 1R3KA 2BMKB 2CKBA 2KH2B 3IFLL 2E7CA 1CDHA 4WW2F 3RNQA 2APWA 4LGSB 4JFPA 5F7WC 1KBGL 1S8DB 3IAQA 3ALPA 3RUGF 3GKZA 4F7EB 2I5YL 3C60B 1QD0A 3CK0H 1YUHB 4XT1C 2Q6WA 2EDBA 1C16B 3RI5K 5EU3B 5I76B 3GJEB 4KWUA 3WS3B 1MVUA 5E08H 4FA8A 3RTQC 4C4KT 3CUPB 4ETYA 3I50L 5HSFA 1CQYA 3MNVA 3V2AR 4KDTC 5KSBF 1I8KB 1P7QB 4MB5A 4YE4L 5E8EA 5I66A 4Y2OA 3JZ7A 1KJVA 4UT9L 5CZKA 5J0BA 4R9HA 3ALWA 4TSBL 4OLXL 3MACH 3M1BB 1MRCH 1I9IL 2ITDB 3VXME 4KZDH 3BIAX 3IXAB 1W0YT 1ZGLP 2F58H 3U9UB 1NMAL 5CD3A 2D9CA 5JPMA 2GEEA 5DF0A 5I8EA 2DB8A 3BIBX 2JKXA 1L6ZA 4WWKB 5D70L 3BFOA 3MLUH 4OM1H 4FS0A 3RVWD 2CDGB 2Z9TA 3AS1A 5BRZB 2C3WA 2M26A 3D2UA 4LDEB 5JDJA 4N8VB 1NGWB 5E6IB 2XN9E 4NN7C 5FM5O 5JXEA 2VXSH 1N59A 2VZVA 3CD4A 4X5LA 5BZDA 2J6EA 2XI9A 5JPNA 3SKJH 1MNUL 3KPRE 5L8LB 3LD8C 4EI6B 1YEKH 3JV0A 3OR6A 1RJYA 3KNBA 1A7PL 5JMRA 5I30H 4UBDC 2XA8H 1SY6A 2NY6D 1EUUA 2ADGA 4KUZH 5DO2D 5AZEL 4FRWA 1QRNE 5EPMB 5L8KB 1EHLL 3OR7B 3CXHK 3UTQA 3R06B 2YPVL 4N90E 2ENYA 3SDAC 4KJWC 1H8OA 4HXBL 2IPKB 4C56A 2VDPL 1NEZA 2B4CH 4O2CA 1HSBB 4HDIA 5SWSA 1TDQA 3LEXB 1CLYH 4JG1L 1I1FB 2X5PA 3CPLA 5IEHB 4ALAH 1NCWL 2M2DA 5I1IH 3BJLA 4O5LH 1W72H 1TCRA 5HYSA 4KJQD 1CICB 1WF5A 5J89A 4FXKB 1DZBA 4JN1H 5B8CC 3CK0L 3CDCA 2XWBA 1C5BH 5T5NF 3W5NA 1CGWA 4HK3N 5E08L 4WW1A 2PTTA 5EULV 2FJHB 5AAMA 5T5NG 2P42B 5DQDL 1ZT4A 5CEYB 1JPSH 1N0XH 2FYYA 5TDPA 4FFVD 1G9MH 4PJDA 5FO8A 2ED7A 1MHPL 3TH3T 1ITCA 1FZKB 3PP3K 1KTKE 4XCFL 4AY0A 3ARED 3GB7A 3QXWA 4MNQE 3MACL 4YX2L 1MRCL 2CLZA 2IBBA 4WHYG 3OJDA 4R2GC 3IDJA 4WUUE 4KZDL 1Q9KA 2VLLA 5EFIA 5FYLD 1TVBA 2F58L 4MD0B 4L3EE 2V5RA 4U1MB 4UNVA 4WV1B 1CGTA 3TVMC 4JZOB 3O4LE 2CDEB 1U8PA 2X42A 4NO2A 3W9DA 4LARL 4NM4H 4W70A 5IMKB 4HSQA 5D9SB 3MLUL 4OM1L 2VUOA 1QSFE 5DFTA 4XCYB 1I1YB 4NC1E 4PJ5E 1FN4A 2GI7A 3HAEA 2OTWA 5GGTH 5L6YL 2AV7B 1CT8B 3MYZA 3HI5H 4KUCD 4XNMB 3BQUB 3VGBA 43C9B 3SO3B 2VXSL 4LDOB 5IJKA 3MJGX 3H42H 4YO0B 1MRFL 4NM8H 1C5DB 5F7KC 4Y8DC 1PKOA 3RL2A 1HXYB 3WFDH 4XNYL 3WUWB 3DI2B 5MEOB 2ZG3A 5TE6L 3SKJL 3AB0C 1M71A 4MJ4A 1YEKL 3ARBC 3V8CA 3M07A 4HS6A 4K3EH 5AD0A 1I3GH 4KUZL 1AGFA 5DQ9A 1GYAA 4F7TA 5D93C 1AY1H 3CH1B 3MR9A 4YEFA 4YQXH 5E1HB 5JR1H 2VDNH 2NPLX 1UG9A 1MHHB 1NMCC 2AK4B 2WINA 4Z7QF 1QFWL 2QQNH 1CGYA 3QIBD 2B4CL 4DKFL 4XZUA 5IQ7L 2RGSA 1CLYL 3BX7C 4PB9H 5IHLB 4X9HA 5F1NB 4LU5H 1M7IA 1DUZA 5D2LF 4ALAL 1E28B 3DUUA 5I74C 2FX8H 4O5LL 5BRZE 1S7XB 1W72L 5C09A 5BV7C 4YDLB 4JN1L 5IM7A 1T0NB 2NXYC 3BGMB 3P9MB 3TIDB 5I18L 1RZKH 4ZO8A 4NYLA 1CR9H 1C5BL 5EBWA 1UWXH 3L3OB 4ZUUA 2CIIA 1JPSL 1N0XL 4AM0A 3CDFA 1EAPA 3ARDC 3W5MA 3DMMC 5E8DH 4B41A 2ADJB 3JV6B 3DX6B 3D0LA 5EB9A 4ZO6A 1KELH 2Y5EA 5JO5A 5DK2B 1KEMH 4PRBA 2QQQA 5IVXB 4LVOB 4HH9B 5DD6A 4JKKA 1AGEA 4BKLA 4ELMF 4P5KB 2CR3A 1ERNA 4K55A 1XR8A 1OTSC 4PLJD 5KVFH 4NM4L 1CFTA 4D9QD 3GJFH 1D3CA 4P4RA 3VMNA 3QWRD 5E00B 2ERJC 1U8JB 4P3DB 4JY5H 2YHGA 3MV7A 1L9NA 4LCUA 2P8PA 4NUJB 5C0DA 1RQ5A 4TUJB 3QQ9C 4PJGB 2H45A 2W65A 2R0WH 4U6YA 4KKBD 3QPXH 4NGHH 4YFLI 4X5WA 2OQJB 4NM8L 3WFDL 4QRQA 1R24B 2UWEB 2HLAB 1MJ8H 3RVXD 5IG7A 2W92A 3MYJA 4K3EL 1IVLA 4AEFA 1I3GL 4LCWA 1DLHB 1OW0A 4G8FB 1S3KL 4QRRD 1NUNB 3LB6D 2RR3A 5JORB 4ENED 2BDNH 2JIXA 4YQXL 5JLZB 1R5IA 5JR1L 4PY8J 3L1OH 4XP9L 4X6CA 2XY2A 1OWRM 2ATPA 2NY6B 2HTLD 2Z92A 5DVOA 3HC0A 3KYOA 4YHYC 1RJZB 1IQDB 4LU5L 1QHOA 5IOPA 2D03H 4XVSH 4YC2C 3CFBB 3CX5K 2FX8L 3ARFD 1QA9B 4GG6E 5IBLC 2D0HA 4FP8H 5JXEC 3BKCH 3U30B 3M8OL 4HUUA 1U8QA 5C08E 1WITA 4JHAH 3QUMA 1VHPA 5ESVB 2D7QA 2OXGA 4GRLA 3NVQA 1RZKL 4CDGC 4G9DB 1CR9L 1QLFB 4UQ3A 3QNZA 2YK1H 4JANA 4KAQH 1NGZA 5DRWA 1MCWM 2RFXB 2HKFH 2BFVH 3QEQD 4ZFZA 4CJ1A 4L29B 3VXSD 2PETA 3FAWA 5E8DL 2BSSA 4XPGH 4NN5B 2HA1A 1RIVH 1S5HA 1KELL 3V7MA 5EO0A 1KEML 4WFHE 43CAB 5EORH 1YEDB 2VDMH 1EVTC 2AXFA 4NKMA 1FFPB 3MROB 3GKWH 4JCLA 5SX4I 4JFDD 3AREB 4P5MB 4KJYB 5JIKA 3VXPB 4NHUA 2A74B 4JY5L 1PY9A 1NUFA 4MXQD 4H25A 2YPLD 2DOCA 3ZKXB 1VKXA 4L8BB 4HWZA 3Q3GB 2YD5A 3AS2A 5FKAB 2R0WL 1M6OB 4HAFA 3QPXL 4L4VD 4NGHL 4Z7WA 1CDGA 2OI9C 4BJLA 4PJ7E 5FM5M 5HGHA 2PO6A 4JRXA 5EIIB 3V5HB 1LVEA 2HJLA 1QO3A 1U42A 4QXGH 3M17A 5FXCH 1JZ4A 2AXGB 1WK0A 2CQVA 2X4UA 1J0JA 5I17B 3FCTA 5EOQH 3UYOD 3JTTA 3MUZ1 3KPMA 2A73B 2BDNL 4ZAKD 3VXUE 1MLCB 3KYKH 4ONHB 3B83A 4CBPA 2APBA 4LLUB 3MRHB 1PEWA 3PWUA 2WBWB 3GNMH 4MCZA 5GS1B 3FZUD 1KGCD 1RHFA 4NN6B 4YXKH 3VGFA 5L0QB 3PDGA 4KROD 1NBQA 4D3CH 1NC4D 4QKXB 4XVSL 1XGYH 2DS4A 1T0MB 2MQ3A 3QIBB 4CVUA 4FP8L 3BKCL 3ES6A 3QFJE 5IJKC 4YJZL 4AMKH 4MMXC 3BXNA 1QEWA 4WFED 5ADPH 4OLUH 1Q9LA 4KC3B 4Y4HD 1TVHB 3KGRA 3QIUA 4YNYB 1PZUB 5J6HB 1OARH 2OL3L 1FV1B 4OUUA 5I75C 3QSKB 3ULUC 3VXMA 1HH6A 1SEBA 3GGWB 2BFVL 2VR4A 1ZWIB 4YDKH 3FMGL 5FYLL 3VW3H 4Y16D 4JHWL 4NPYB 3GI9H 4K07A 4XPGL 3G5YA 4N1EA 4OBSA 3BEVB 4ZPTA 1MWAA 4YFEA 4O51B 3RJDA 3RWDB 5EORL 2BRQA 5FGCE 2VDML 3EOAB 3B9KD 4HWEH 5E56A 1P4LB 3E3QE 1OGTA 4WU7A 4JM4L 2V7HA 5HI3D 4ZPVA 1KJ2A 1T7ZA 3LMJH 1ZA3A 2XN9A 3BHBA 4HUWA 3SPVA 2EKSA 2DM3A 3JWOH 4H1LA 2EKJA 1A9BA 1CQKA 3F5WA 4KHXH 3KPRA 1DBJL 1RK1A 2A77H 2QHLA 3C8HA 5DHVB 1IM3B 1KTLB 5H94A 1YY8B 1OM3H 1MELA 4HWNA 4L3CB 3IDGB 4XGZB 2J88L 4NHCH 5DJCA 1QRNA 2VLRD 2R2HA 2VXVH 1SYVB 4QRSA 2EDYA 3AMLA 4WFFD 3S35H 4U7MA 4PJAF 1IGFH 1KXTB 2MQ0A 4MJ6B 1I7TB 3X3GH 4TUKL 1HDMB 3TBTB 3EO1B 4Q2ZB 3LRGA 1DUYB 1J7VR 1NCAL 1NCDH 3ESVF 3KYKL 3MOQA 3RL1A 1ZLWH 1GRWA 5LGJB 5I15H 3GK8L 2GJJA 4XNZB 5MEQB 2Z4QA 3RDTA 3OGCB 4OD2B 2F53D 4RMVA 3GUTB 1SJXA 3BYTA 3GNML 2GJ6D 4AIOA 4QRRB 1OWWA 4YXKL 1IBGH 2HT4C 2WMPA 4CU6A 3RGVD 1XGYL 1J1OH 5FYLE 4NWTH 3OKKB 5JDSA 3DNKA 4AEEA 5DLML 4Z77B 3Q48A 3D85D 5C9JA 3LKRA 3DRQA 4AMKL 4GKSB 4BFEA 4NRYA 3VD3A 1AJ7H 1MCKA 1LO5A 3MC0A 2EDWA 2HN7A 1CD8A 2VLKD 3ZYJA 3ZDYE 1OARL 5JMOC 3ARFB 3QO0B 5DJ0A 4MNQA 4X83A 4F2MB 5GGVH 1IKNA 1KCSL 4WUUA 4YHIA 3D0VB 1EPFA 1V7NL 4MQSB 4JPWL 2AQ2A 1JPTL 1OW0C 4DN4H 3O6FA 4L3EA 5IHZB 3VW3L 4FQPA 1WJ3A 5I9QC 4XB7A 1YC7A 3O4LA 4FQQA 1S9VB 3RWEA 3W9EB 1IT9L 2X1OA 1T5XA 2A2QT 4XPFL 1OVZA 3U6RA 3U7YL 1CLOL 3HMWH 3O3DB 1I8MB 1PKQB 4TOYL 1QSFA 3QEQB 5E1AA 3TLRA 3VXSB 2NX5E 4HWEL 5M95B 3L7EB 4PJXB 4PJ5A 5K33A 3ULVH 3C60A 3F7QA 4ZODA 3TBYA 3LMJL 3VG0L 3P4NB 5F21B 2KZ1B 2DLFH 4H88L 3O8XA 3GJEA 4X6BA 2NY3D 4OUOA 1TQCB 1FNEA 1BM3H 4GRLC 4J1UA 3F58L 2A77L 2BNUA 4TVSa 4JFDB 3SDXB 3QHFH 1XGUB 1P7QA 4HIJA 3FT4A 3LKOB 4NHCL 1HHJB 2YPLB 2VXVL 2ITDA 4U2YA 3S35L 1FSKC 4UT7H 1NPUA 3RPIA 3C08H 3IXAA 1IGFL 5I71C 1Y18A 1OAUH 4QTIH 3X3GL 2VNCA 4UI2A 3WEXA 4L4VB 3DV6A 2YRLA 1G6RB 4XX1E 1U8LB 3PL6D 1SJHA 2CDGA 5I15L 5BRZA 5I2IA 4N8VA 5HY9B 4PTTA 2IMMA 3ZLQC 3TN0A 5B38G 1S7WB 4ZAKB 5LJYH 1YMHB 4YDJA 1AD0B 1FFOB 3B43A 3R0NA 4I13B 3V6ZA 4CUCA 4NWTL 1M1SA 3PABB 5B3NA 5HI5D 3TCLA 3ZKSD 4CMHC 3SN6N 2XTJC 1K85A 3NGBC 2WW8A 1WUNT 3HG1E 4KROB 2MKWA 2E3VA 1UADC 4JRYD 5ERWB 2PO6C 5EN2B 1NC4B 2NNAA 1FYHB 1LP9B 4JY6A 3MXWH 3SCMA 5GGVL 3MBXL 3PGDB 3R06A 4R97B 5MHSD 2VOTA 4MB3A 1LEKB 4Y4HB 4DN4L 3UEZA 4LFHD 3MV8B 3QDAA 3GI8H 3UTTB 4L4TD 1I1FA 3WNKA 2P7TA 3S3JA 5TE4L 5DZLA 3HMWL 1NGPH 3MCKB 4XNXH 4YIQA 3T1FB 3R0MA 5IW6A 4Z7NF 5DR5L 4Y16B 5J3HC 4N5UA 1S7UB 1U91B 4MDIB 2Y06H 4NBXB 2DLFL 2C3GA 3ULVF 4XAKE 3B9KB 1S9YB 4GUPA 4NT6B 5E4EC 2EIEA 3O4OB 1BM3L 3WLBA 2FWOA 1Q9WB 3QIUC 3EGSB 5LAXA 4S1QH 1W72A 3FOLB 1G7IA 2F8VA 2Q7YA 3T2QA 4HAGA 4UT7L 1CU4L 2R23B 3C08L 4QHUB 4DGVL 5GRYA 4U6HA 4OZFH 2Z31D 1OAUL 2FH6A 4QTIL 4U1MA 3UMTA 3FHQA 1WAAF 3DYPA 4RGNE 2Y9RT 1K3IA 3NFPA 2VLRB 5FFLA 5JW4R 2E6PA 1RULH 4K9EH 3HPLB 3HE7A 4FQJH 5CGYD 2DD8H 3ZKMD 1P6FA 5B21A 4KKAD 2GTZB 1FL3B 5GGSB 5E0QA 1KPVB 4GG6A 4X7TB 4QXTA 5C08A 4N0FA 1CT8A 3TNMB 43C9A 3M45A 2BNQA 4YO0A 4LPYA 5T3XD 1C5DA 1VPOH 4XVJL 5HVWA 1KIQB 2PTUA 1RZFH 3WUWA 4EN3A 2GUOB 2F53B 1PFCA 3KWWB 1DDHB 4UT6L 5SX5H 1CD9B 2GJ6B 5HPOA 3LEVH 4OLZL 1LEIB 1INQB 1A5FH 5DYOA 3BRFA 3MXVL 2I07A 4I9WE 2DQCH 3CH1A 3D85B 1FNSH 1EO7A 2IPTH 1BWWA 1T0PB 5DRZA 1T22A 2GTWA 4PGZA 4ZSOE 2VLKB 3DBXA 4KTEH 2Z35A 1G0XA 3GI8L 3UPAA 2FSEB 1Q8MA 3P4LA 3RDTC 3LSOB 1NGPL 5F7HA 5DEFB 1BJ1J 3GHBL 4Y5VA 1XGTB 4C55A 3LKNA 4D9LH 1S5IH 4GAYB 4MYWB 4PLKC 1L0QA 3P9MA 1JN6B 4YK4C 3WDHA 5IIEA 3IU4H 1ZA6B 4JZJA 4B50A 4UQ2B 4PJ7A 4FQXD 3H9HA 2E7HA 4JDZB 3TA3D 2WBJD 1KGCE 2BC4B 1WV7T 1I9JH 1L7TH 2W0KA 2QADC 3H9ZA 3FTGA 5DD1L 1IKNC 3DX6A 3JV4B 3P4OA 4S1QL 2NY3B 1TNMA 4D0DA 5DK2A 1RZ8A 2O5YH 3K8LA 3VXUA 3D69A 5JW4Q 1IGJB 5IK3A 5IF0B 1EHXA 3T2PA 1NAMH 1KSRA 4P5KA 1CWVA 4Z5RA 2C3XA 4UUJA 1KCKA 1EMTH 2SEBB 4GW5B 2QR0A 4ZS6D 2ZKHL 5FGRA 4J3XA 1RULL 4NC1C 4J7RA 1TLKA 4FQJL 2DD8L 4OZFG 4BH7B 4R7NA 4HHAB 4GKNA 4K7PH 3QFJA 1WTGT 2EC9T 3O8XC 3WHE0 4KMTH 1BHGA 4WDIA 3E6HA 2X1WL 3V0VB 4KHTH 1YNLH 3PL6B 3ARUA 3QA3A 1TJIH 4F3FA 1RZFL 1S78D 1YPZF 2YD4A 3VRJA 4BYHA 3QXDB 4IMLA 3GSUA 4TVPH 5KVEH 3LEVL 3GJFA 5ALBH 4ZOCA 5J1AA 2VISA 3ETBF 4Q9QH 4PJIF 1KCUH 4JFOB 2VR5A 1MCRA 5HHPB 4IBLT 2NQCA 4YBQD 4I18B 2P5EE 1DLHA 1FL6A 3MRBB 3MV11 4LGPB 1A9EB 2XKUA 5F7DA 2DQCL 1CFVH 3TPUB 3W11C 1WIUA 3DGGB 4EZMA 3TBSA 3S5LA 4WTXA 4O4YH 3WFHB 1FYTE 5K9QG 2IPTL 2C3HA 4JR9H 1K8DB 2VSDA 4G3YH 3OKDA 4MSWB 3T8XB 3WKNA 4JRYB 1K9TA 1F4AA 3LDBC 1ZLVK 4EI5D 1T1ZA 4CMMB 2GFBA 2VLRE 4M43H 3CFBA 4IOIA 1FFRA 1Z5LB 4CL7A 2EH8H 3TN0C 2PTVA 1GXEA 3SHSA 3FT3B 4L4TB 4OZHB 1S5IL 4KJPC 1CGVA 1RUMH 3IU4L 2MTPA 2VSCA 2Y6SD 4RFOL 2AI0H 5E9DE 4LCIH 5D72H 2F53E 1IARB 3NPSB 4RISH 3UC0H 5F7YC 2FHBA 1FJ1B 3RIAF 3BPOB 1A6UH 1CIUA 3SCMC 5IB1B 2Y72A 4HPOH 1LMKA 2MKLC 2WWKO 1BIHA 1PG7W 2AJ3B 2MPAH 2AEQH 3HZVA 3UTPD 2RQ8A 3HZKB 3PQYD 3LPWA 1UCBH 1GZPB 2YC1B 1JF6A 4APQD 5D7LE 1NAML 4DVRH 1PZ5B 3RY5A 4I3SH 3DO3A 2IPUG 3G5XB 1A8JH 2P5WE 4IRJA 5C0AD 5L2JA 2OL3A 3ZHKA 2CIKA 2A6KA 5L9DH 2PXYA 4PPTA 1B88A 3BT2H 4MNGB 3QDJD 1OY3B 1RPQA 4OCWH 1KIUA 2Z31B 3OKYA 5HYJE 4JFXB 3C8DA 3GMLB 1KNOA 4K7PL 5IVZB 1DEEA 4NZJA 3HLAB 2Q20A 4HG4J 1KXQE 3EFFB 4POZD 3U79A 2B4CC 4KHTL 2XWTA 2C1PA 1YNLL 3NA9H 4F9PA 4JFQB 4LPCA 4LL9A 2CRIA 4X4YB 3IFPB 4HUXB 1MI5D 5J13C 1AO7E 4TVPL 3T65B 2H26B 4LLDA 5ALBL 4LSDA 4R0LA 4Q9QL 1BFSA 1J0KA 3CVHH 5HBBA 1KCUL 1QYGH 2D4DA 5EA0L 5F7UA 4QYOB 3Q6GH 4G8EA 3F7YB 5LG1A 4P57B 5I19H 2ZZUT 2A73A 4F7PB 4YGVA 3MA7B 1BJ8A 3KPQA 1A6WH 4JR9L 5KOVC 2NX5A 2X9YA 3DSFL 4HK0B 4DCQA 4M9PA 5ACZB 1X5IA 4P5TA 3HE7C 5HDBE 2NTFA 4HWUA 4M43L 1Y6MR 3BP4A 3EW3B 1BD2D 2EH8L 1A3LH 3PDOB 3ZSSA 1PYWB 4YFDB 2DTMH 1QFWM 4TYUA 1CD1B 3T3MF 1T80A 4KPHH 3FB5A 1OAYH 2F8XC 2JJTA 4EN3C 5T3ZD 1RU9H 2MNUA 3FFCD 4RNRA 5DI8A 4GLRI 2AI0L 4ZOBA 2FJFB 4LCIL 1TETL 5I6XC 4GKZB 4RISL 4YR6A 3UC0L 4XWOD 5C0IA 3WO4B 1L0XA 4JO3H 3GBNH 4U1LA 1I9RH 3VFTB 5F6IB 5HJ3B 5FAAA 4HPOL 3P4MB 3BZEB 4N0RA 3RWDA 4FQXB 1NCBH 5F6HI 4NZTH 1G9EA 2MPAL 2AEQL 5C0ND 4XI5D 3DUSA 5TFSH 3TA3B 2WBJB 1MF2H 4I77L 1NEUA 4U6TA 3RA7H 1K5NA 4I3SL 3ZE2E 1DCLA 2RB8A 4LLWB 1XIWD 3CFDA 4TVPE 3BIKA 5L9DL 3I02A 3BT2L 4QT5B 5IV2A 2YEZB 4Y5VC 1MJJB 2YBRB 3PGCB 4LCYB 4OFKA 3NOIA 1ES0B 1V5JA 2HKHH 4OF6A 2MSPA 3OG6B 3HG1A 3MV9D 4JVPA 4JZJC 4XCEB 5ACMA 4WI3A 3D39D 3R1GH 3NA9L 4LHUD 1AHWA 5SWZE 4HULB 4PTUB 1NUDA 4KDVA 1V7MH 3KPPB 4MA7H 4OV6F 1BGXH 2J8UE 1ZSDA 3PWLA 2G2RB 1F11A 1JMXA 3GMRA 3PHQB 3HZMA 3CVHL 5JOEA 2HT2D 1HDMA 5FK9B 3EO1A 3Q6GL 4Q2ZA 4NRXB 1M7DB 4Y4FA 1KB9J 5I19L 1RZKC 1PSKH 3BKML 3LN4A 5ID1A 3S8WA 3QISA 5IMLB 4U6XB 3N1FC 3G6JF 5LGJA 2EEBA 1NFIB 1A6WL 2EYSB 5IR1A 1U8OA 5HVHC 1G0DA 1BZ9A 1OTTD 1MCWW 1YC8A 4M6AA 4PREB 4LEXH 3U1SH 4TQEH 5HHME 2VMFA 1I7ZB 1M05A 4X8JB 4MNHB 2ZJSL 4KI5D 3UJJL 4KGJA 5DK0B 1A3LL 1ACYL 4UDTA 4PGBA 3V4PH 4EI5B 4KPHL 1KPRB 2Q8BH 4OGXL 4PIRF 2UVEA 1UQSB 3O3BA 1U3ZA 1RU9L 3FO2B 1LO0H 1A6AB 4JPVL 2CXKA 4GG8A 2H9GA 5H37H 2FZ3B 5MP6H 4F2MA 1UJ3B 5EBGA 4Z7OE 5EDXA 4C59B 3OB0K 4IIQB 2D2OA 4RWYH 5DDHA 1NQBA 1OOAA 1S9XB 5E2VL 3C5ZD 4JO3L 5DJ2A 1MFBH 1I9RL 5J56B 3WV0A 1EVUA 1FLRH 1HHGB 5HGBB 4AENB 2DI7A 1MAKA 5TQ2H 5C6TH 3E3QC 5J11C 5TFSL 4WO4A 2Q3AA 4JPIA 1EEZA 2R0LH 4H5SB 5DO2C 3VFWB 3AFLA 2IG2H 4KZEH 2PYEE 3RA7L 2FIRT 1EHNA 3DTXB 2DM7A 5T33H 4G42A 4M9OA 5KSAD 4XPAH 3EAKA 4FTVE 1AGDA 3TESA 1ODAA 5C1MB 3PQYB 3BI9X 1A14H 1NGYB 1ZHBB 4APQB 2BSRB 1QVOA 2X6MA 5AZ2H 2HRPH 2HKHL 4U1HB 5C0AB 1YNKH 1A7RH 5JOPE 2MOVA 1E4WH 2C26A 4FQHA 2FEEI 4X7SL 3QCUH 4LMQE 3QDJB 2O5ZH 4GW4A 1V7ML 3QRGH 1U8NB 1JNNH 4MA7L 1MCSA 2XT1B 3HUJF 5ID0B 1BGXL 3IRZA 4QRUA 2DIJA 3NFNB 5FV1L 3B9DA 3QYCA 4M6OL 5F93C 3WIIH 3PWNB 2AK1H 4ZSOA 5FEBA 1IAIH 2BX5A 4BQ6A 5DUBB 1MI5B 1PSKL 1U8LA 1JHKL 1JPFA 1R3LB 3SGEH 3QZWB 5AEAA 4HJ0C 4IRJC 1OD9A 4LEOB 5F9WB 2PXYC 2NYYC 1KIRA 3K1KC 2X89A 3EO9L 4YAQA 1UEYA 2JJWA 3NN8B 1DQMH 2DL2A 2DQDH 4LEXL 4NQXA 1XGRA 1S7WA 4TQEL 4XCCH 3U1SL 1YMHA 5I1AA 3MRPB 1N5AA 2VR9A 1KEGL 3OXSA 4R4BB 4OIIL 3V4PL 3DX7A 4KKCC 4LKCB 4F9PC 4N0CD 2VXUH 2LTQB 3DXAD 4DEPB 1AR1C 3GFUA 5ERWA 1QFPA 4XTRD 5EN2A 4JAMB 4LF3A 3MRLA 1ETZB 1UCTA 1BD2B 5MP6L 5IT2H 4R0LC 2ZP0T 1LE9B 3GMMB 1RJCA 2BVQA 2X4NB 5TDNA 1T2QH 4CNIB 4F33A 3X12B 1MFBL 1DN2A 4Y4HA 1FVCB 2VZOA 3FFCB 4RX4D 1FLRL 5DJZB 5H37G 4N8PA 5TQ2L 5A2FA 3C5JB 4RSVA 5C6TL 3DOSA 4PGJA 1N2RB 3MCKA 3L3KB 3LKQA 3BKJL 3T1FA 3T1WA 2R0LL 1CDJA 4P5TC 3TCXA 1T7WA 2IG2L 4KZEL 4Y16A 2XG5A 3V4VH 5DT1H 5C2BH 5T33L 1SYSB 4XPAL 3QULA 4MQXC 3QUXC 2JK5B 3UPCA 1VFMA 5E5MA 3QPQD 5BQ7B 1A14L 4S2SB 1JPST 4D0CA 1H3TA 5AZ2L 3L3JA 2HRPL 2JJTC 4C58B 1Q9WA 2WUCH 4YDVA 3HPJA 1YNKL 1A7RL 1XIWB 4LPTA 4Y2DD 1S7RB 2OSLB 2D9QB 3BOVA 4LP4A 3D18B 5T1LD 3VFMB 3RWGA 3LRSB 1ND0A 3QCUL 2P8LB 2O5ZL 3MZTA 2P5EA 1FGVH 3K46A 3QRGL 3KDMA 3FN0H 3VFSB 1OGAD 2ZSWA 2VE6A 1T3FA 2VL5A 4HUVA 1FYTA 1I4FB 1OP9A 1QLRB 3MV9B 3SO5A 3D39B 2AK1L 4LHUB 4B53A 4M5YH 1OAKL 2VLRA 1A21A 1BLNB 1MIEL 2IADA 1CBVH 3I6GA 4JJ5B 3D87B 4I5BB 2QSTA 4Z95H 5IW1A 5IVXF 3BZ4A 2EE2A 3STZB 4ODWB 4JVWA 1GVIA 1UZ6E 4D94A 1DQML 3WCYA 2DQDL 4XCCL 5FYKD 3PQYE 4K8RH 3T0DA 2A83B 5T3ZL 4P4KD 5BVJA 4OZFA 1Y0LB 1G7JB 4DAGH 5E9DA 4PLJC 2COQA 1ITBB 3MPCA 3NCJL 1N3NB 4XP4H 2F5AL 2I60L 3UZVB 5KG9B 1WBYB 2EE9A 1OLLA 4OM0H 4Z0XA 5C0AE 3L5XL 1CN4A 1AHWC 1AXSA 1CXFA 1LEIA 2VXUL 1S7SB 4RDQG 2FIKB 4PJGF 2H3NB 1A4KB 2EYRA 4Q9CA 3RGVA 3SKMA 1T4KB 5BJTA 3OWEA 4Y1AD 4DUXA 5D7JD 3D85A 1YMMD 1T2QL 1EO5A 3VI3F 3MRDA 2ILLA 5CBEB 2FBOJ 5SV4A 4Y4FC 3BSZH 5D7LA 2UWEF 1AQDA 4HX1B 3H9SE 5ESQB 4K2UL 4OB5H 2P5WA 5MEND 3LN9A 4CVZA 2YOCA 4GRWB 5E24E 2EEDA 3QQ4B 4O2EA 4QXUH 5HHVH 5CMAB 5HHXL 3C5ZB 5JW5B 4R4NC 4UDUB 4Y4KB 5HYJA 2YUZA 4ZQKB 4ENEC 3SDYL 5KVMC 3V4VL 4H0GA 5DT1L 5SV3A 2R1YB 3UZEA 4U1GB 4X80L 5CLTA 3VD9A 2E6JA 2F74B 1HILB 2GW5A 2C9AA 1FDLL 3ARGD 4UQ2A 2GAZB 3AAZA 3WN5A 4LP5A 1AO7A 2BC4A 2WUCL 5KSAB 5DFVC 4ZUTB 4XAWL 2DQEH 4PJCE 4OCYH 5DJ6B 5T1MA 3PHOB 3QO1B 4I2XB 1CFBA 2VN4A 4PB0H 3TYFA 2ESVD 3FN0L 1MAMH 4KK9D 3BMWA 5IF0A 4RGNC 2EDKA 5T3ZE 2R9HD 3FFCE 4OZGE 4KKNA 4WO4C 1VDGA 3N50A 2YMXH 1D6EB 2HH0H 1XF1A 3EYSH 3QDMD 3EYQC 2D31A 3KHQA 1KC5L 3BPNB 4HCRL 3DWTA 4OD3L 1B0GA 1CE6B 2B5IB 4KTDL 2DQUH 3R4DA 2BVEA 1Q1JH 4L1DA 1ORSB 5HPMB 1ZHLB 3NABH 3GSNH 4YHZH 4BQ9A 4QHNA 3V0VA 4RWHA 3RTQD 4K8RL 3BH9B 4TULH 1NAMA 1XCQB 4DAGL 4XWGH 1WFNA 4XP4L 1GOFA 1HQRB 4N0UE 3CFEB 4OM0L 1NANH 3ZYOA 2IF7A 5CWSA 5TQ0H 1NCUA 1E6OH 4NBZB 2W0FB 4TSCH 1NUGA 4WI9A 1AGBA 3HI1B 4HGKC 3PNWB 3WFHA 3N1QC 2CDFA 3V7AE 3QH3A 3VU2A 3DXAB 3CJJA 3BSZL 4E41D 4LASH 1A1MA 3DI3B 5AWNL 4ZUVB 5F70A 1P7KA 4R8WH 5BXFA 1GGBL 4LSTL 3IYLW 1S9WA 4M93B 3VD4A 3MREB 2Y07H 4I4WA 4RA0C 5DZNA 1CTNA 4L8SB 4PV9B 5HHNB 4HIEB 4P46A 1WZ1H 1BBDH 2DYPA 3LHPH 3IDXH 1LK2A 2VITB 3VRIA 5HYQB 3V4UL 1S7QB 5SWZA 3DO7A 2WQRA 2WWKT 3QWQB 3V8OA 4J3SA 5B22A 2E5EA 2N1KA 3ZT7A 2J8UA 4PYGA 4F8QA 1IAOA 3MTRA 3HC4H 2CMRH 4CADA 3IJYA 4UBDD 5JHLH 2ADFH 2JJSA 1A1OA 3CU7A 2DQEL 1G1YA 2B7DT 2NW2B 4A6YH 1AR2A 4NQCE 2WLYA 4KMLB 4KJWD 4PB0L 5DS8A 4Y4HC 1C12B 3HZKA 3TO2B 1T1XB 2DI8A 1HI6A 1JI2A 3H2WA 2X1PA 3TH4T 4Y2DB 1A7BA 5T1LB 1KLUA 2HLFC 2OJEB 3G5XA 3IDMB 4QO1A 3S3SA 1PX3A 2JB6A 4WHDA 1AKJA 1OGAB 2YMXL 2HH0L 3EYSL 3QQ3A 4G6KH 4KDWA 4QXWA 4Y16C 4Q6YA 4CVXA 5KS9B 1A7OH 4W81A 5T5FL 1WCBB 3B2VL 3QEHB 2DQUL 3EOTH 4HBQA 1EEYB 3VFNB 2DN7A 4MQ7B 1BQUA 3Q1SH 3GSNL 4YHZL 1JTPA 1RHHB 3S4SB 1GGYA 4NQTA 1LO4H 3FO9B 3K8MA 1Q9OA 3O4OC 1I1AA 5AUMB 4TULL 3MJ7B 3KR3H 4X4YA 1RJLB 3IFPA 4XWGL 3A6BH 1U3HA 3MLTB 1H0DB 2WNGA 4JREC 3T65A 1KOAA 1U9KA 1Z9OA 2YSSA 3D3VD 4OZIF 1BVLB 3PP3H 4U1KB 4P4KB 3SQBA 4TSCL 3VFUB 3BZFA 4CW1A 1MOEA 1MEXH 4R2GD 3BE1H 3F7YA 1MFCH 4P57A 3VDCA 3RKPA 3QG7H 1NFDB 2VKWA 5CGTA 4H26B 4ZD3H 4U6VL 2PYEA 5D2NE 5KTEL 2IAND 4O58L 5GSRA 4Y1AB 1HZHH 4FTVA 1DN0B 5D7JB 3U2SA 3VGAB 1YMMB 2FX9H 2IEPA 1UT9A 3UJTL 3CVHA 3KPSE 4FQLL 4X6DB 2Y07L 4NOFA 1V3LA 1YEGH 2NY0D 1BX2A 4OTXH 2FHFA 5MENB 1CD1A 5J1SC 3LHPL 4GW1A 4FHBD 1IGTB 2FJFA 1FZOA 4Y19D 3RNKA 3HRZB 2YS4A 3ZHDA 4GKZA 5CEXB 3HC4L 2JLLA 4G8IA 5JHLL 4YWGH 2W60A 2ADFL 3RGVC 1UEMA 2ZOLB 3T4YA 3UTSD 3HN3A 4A6YL 3BZEA 4YHKL 3ARGB 2R0KH 4JB9H 3ME0A 3ZE1F 3TA3A 3DXAE 3ILQC 4Y7MA 1KN2H 3K74B 2X4TB 4LLWA 3B2UC 3G08A 2ESVB 4PGCB 2EIZA 4NO0D 4KRPC 4N5EC 4G6KL 4XBPB 5BS0D 2Z91B 1E4XH 1ZLSH 3EFDH 3L3DA 2J4WH 3EOTL 2NXYD 4Z7VB 1EFXA 3ZZ1A 2HJKA 2IAMA 1B4JL 4PJXF 1FGNH 1OF2B 3MRIB 1HINH 3QDMB 5ETUB 5CKGA 4EBQH 3WN5C 2R29H 3KR3L 3ARXA 2A0LD 1BQHB 4P23A 3A6BL 1KCVH 3F7RA 4F15C 3EJZC 4PGDA 3ARDD 3RWHB 1DE4B 5DC0A 3T4AB 4FFYH 4U1IA 3RTQB 5DD3H 3L5JA 1I3UA 3OV6A 2OJZL 2IH1A 4I3GA 4LLYB 3SDXF 5HDQH 1MEXL 1M7DA 1JWUA 3BE1L 3SEPA 2R2EA 1MFCL 1SMOA 4OAWB 4HKBB 2DWDA 1BVKA 3PXHA 1X5XA 4ZD3L 4QHKI 1NFIA 3VFOB 1Z6JT 4PGEB 2BCKA 2D7PA 4RMSA 4PV8A 4PJEB 3IGAB 1X5HA 3SJVE 1YEHH 3LS5H 2XYCA 5ABDE 1HZHL 1HHKB 3K4AA 1MQ8A 4Z76B 4NZUH 3VXNA 3MRGB 4JM2A 5SX4H 3QQ9D 4E41B 1G7QB 4OTXL 4JDVA 3ESUF 5FCSH 3O41B 4QY8B 1UVQA 4WNQA 1AQKH 1JK8A 4X7FC 4DUVA 4ELKA 3CAFA 2FZ3A 1UXSB 1XGQB 1UJ3A 4NN7B 5FCUL 1IC7H 1FNLA 5GQBA 4YWGL 1XF3A 4HW6A 1P84K 3HR5B 3FONA 3LD8B 5CHNA 1HHGA 3UPRB 1XF4A 4X6FB 2R0KL 2AJZA 2X41A 1XT5A 1OHQA 2XXMB 1LP9F 3N9GH 2IH3A 3CCHA 4N1HB 4URTB 3MBEA 4H5SA 1ONQA 4I0PA 4U0RB 1KCLA 5B39A 4ZFGH 5FIEA 2GCYB 4HLZH 1FCCA 4OKDA 3D2UD 3HS0A 3K2MC 4OI9A 1B9ZA 3PQYA 3EJYC 5IBLD 1I8LA 4K3DH 5JXED 4P46C 3JBG7 3GSRB 4R3SA 1ZLSL 3EFDL 4M7JL 5E6ZA 5MENE 2X4QA 2A38A 1SBSH 2VDQH 4LLQA 5C0AA 5M7QA 1FGNL 1HINL 3BWUC 3SY0A 1IGCL 1HCVA 1WBZA 2R29L 1U8NA 3UROR 1R3HB 3MRFA 4RIRB 2JJSC 3QIWD 1T1WB 3NFNA 3HKFA 4JO4L 3I6KB 1QSEE 3FO0H 1VFUA 3QXVA 3H9SA 5DD3L 3H3BC 5GIRB 5HDQL 1D5MA 3B6SB 3ROLB 1BBJA 3WDJA 5SWSD 4AIZB 1UZ8B 1X5FA 3FQNA 1WEJH 2I27N 2F54E 1U8IB 2VJXA 1R3IH 2V5TA 3D3VB 3CZFA 2P47B 5K9KA 2A1WH 2EDQA 1QTYT 4NFCA 3MUGB 4R2GB 5HHOD 1YEHL 3LS5L 3EDJA 3VCLA 3WS6C 4J3WA 4NQDE 1F42A 2XY1A 4NZUL 4U05A 3MRMB 3TVMB 1WBXA 3VFGH 1ULVA 4Z7VE 1WC7B 2IANB 4J12A 1I1AC 5HHQB 5J1TC 4PJCA 1AQKL 3MRKA 1U3HC 1AC6A 4JAMA 3MLVH 3IJSB 2Q76B 2NY0B 1CG9A 3GMMA 1IC7L 4TN9A 3BVNA 5EBLB 1FZMB 1VFBB 3X12A 4QWWC 2LAAA 3S97C 4R96A 5SX5K 3P2TA 5L7XH 3FFCA 4LAQH 2Y23A 2G5BB 3AB0B 4OZGA 2H8PB 4LPXA 4UV7H 4Y19B 5TJWK 3MCLH 1AIFB 3EO0B 1CL7I 4C57C 1IGYB 3DV4A 1CFSA 1BFTA 3L3HA 4NIKB 5D93B 4ZFGL 1AC0A 5F88A 3NIGF 3VFVB 3BH8A 1NMCB 3L3GA 3VFPA 2AQ3A 5BQ7A 2FR4B 4PJBB 3E8UH 1ZS8A 3L5HA 4UINH 2QKIB 1IEHA 2FL5A 2AJUH 4HLZG 4N0UA 1EXUA 1RK0B 4ZXBA 5I74B 2VABB 3PP4H 1MHEB 3BP6A 4NO0B 4X99A 5BV7B 1INDH 1A1NA 3UDWA 3OKEB 2Z8WC 3QDHA 4N9GB 4JRWA 5BS0B 2KDGA 3ULUD 3IETB 3HNSH 4YHOL 1HK6A 4TTDC 1J05A 1ZLUH 5EC2B 3RIAK 2NXYB 4CRPA 2CD0A 5F3BB 1VEPA 1UKTA 2BVPA 3FO0L 1QKZH 2QJDA 4NOBA 3F12A 1FG9C 4BH8B 3TA3C 4PRAB 2YPKB 4WEBL 3HCVB 3STLA 1BLNA 2YUVA 3ARDB 1BZQK 2BSTB 5H35A 1A64A 1WEJL 1HWHB 2XA3A 3SKOB 1RIHL 2WLZA 4Y5XA 5C09D 2CLRA 4W6XB 5EUKB 4LIQH 5MI0C 4NJAH 3GSVB 1KFAH 2CKBB 2IAMC 3INUH 4JFPB 4M4PA 3B9AA 4YBLC 4ZS6C 5KG9A 2WIIA 1J8KA 1MRDL 2ERJB 4RBPK 2N7BA 3L5IA 5DMJB 4DKEH 1GGTA 1VSCA 2G60H 4P23C 5CBAA 5J9PA 1C8PA 1K6QH 1N26A 2ARJA 3LIZH 4HCRA 4YUEL 3MLVL 1PG7X 2Q6WB 4NQCA 2OM5A 5K9QI 3EDEA 1FNGA 1MVUB 4OFVA 4B7LA 1BVZA 3AROA 3WFCL 3MNVB 5JNYA 4YDIH 1S78C 1ZAGA 4AEHL 4ZOEA 3O6MH 1XMWA 4OGAC 1KJVB 4UV7L 3MLSL 3P9LB 5C92A 1EO8H 4EIGB 1Z3GL 1URLA 3VWKD 4J3OC 4WHTA 1PY4A 5T1KA 5FA3A 2ZG1A 1WWCA 2RJMA 3MV7D 4Q7DA 3L95A 2X7LA 3CLEH 2HT4D 5CD3B 2R1YA 4DGIH 5JPMB 5I8EB 1H8NA 4JM2C 4PG2C 5FB8A 4NP4H 1RZIB 4UINL 4YHYB 5J4MA 1OB1A 2AJUL 4RCAA 4MA3A 5KSAA 3D2UB 3QXTA 4YC2B 5E2UL 2VUYA 1JZ5A 3V5DA 1INDL 2LQRA 5KSUA 4OZHF 1UH4A 1DJSA 1G7LB 3MZGB 2ADIA 2AV1A 1YQVL 4NZRL 3HNSL 1N59B 4DKDC 2Q3ZA 1P4IH 5BZDB 5IB3A 2JE8A 5JPNB 4I3RL 2V2TA 2V6HA 5F72S 2JIXD 1J8HE 4GXUN 3OR6B 1L7IH 5D2NA 5B3JF 1RJYB 5EUOB 4ZOAA 3MLZH 2VZSA 5GPRA 1N7ML 4Q6IB 4Y19E 1F2QA 2ADGB 2C5DC 2VZTA 3MBEC 4I0PC 3QIWB 5CP7A 3UTQB 3KPSA 1YEIH 2Q86B 3SE9H 1D9KA 3UTSE 4NWUH 1J0IA 1OSPH 2G75A 4NNYA 4C56B 4MD4A 1IAKA 4HQQH 1NEZB 4O2CB 4M7LH 1I8LC 1GCFA 2CK0L 5SWSB 4LQ1A 4IHOB 5E5UB 4LIQL 3MNZB 3QUKA 4IMKA 1A2YA 2ZCLH 4NJAL 5D7IF 3CPLB 1KFAL 1LWRA 2BVTA 3VXQA 4XB8A 1ADQH 3IDYC 2R1WA 3INUL 2FO4A 3MRRA 5E8OB 1TCRB 3CFEA 3B9EA 5HYSB 3NPZB 5DTFA 4ODBD 2PW2A 4DKEL 2CO6B 5KN5A 2G60L 2DL9A 1XGPA 3LIZL 3T2OA 3DHJA 2XWBB 4GAJH 5CJ8A 3TBWA 4WW1B 2PTTB 4Q9BA 3CLFH 3GSNA 1IC4H 3DXAA 1ZT4B 3DX8A 1CYGA 2OI9B 2FYYB 3NIDF 4YDIL 5CSZB 5TDPB 5ICYB 5EO9A 4PJDB 1CGSL 5A16A 4MVBD 5C0BE 1HEZA 3KPNA 4H20H 3OAUH 4PD4K 3I85A 3GB7B 2C1OA 1R5VA 1UKQA 3S37H 5FOBB 1EO8L 5K9JH 2CLZB 3KLSA 2MFNA 3OJDB 3IDJB 5F96H 1V3MA 1Q9KB 2VLLB 1P7HL 1TVBB 4HIEA 5ESAB 4OGYH 3CLEL 5C70A 2RIKA 4DGIL 2VQUA 4IEFB 2VITA 1U8PB 4NO2B 3W9DB 2ZUTA 2FBJH 1S7QA 1S7TA 4NP4L 2FB4L 3SOBH 4K7FA 4M1GH 4PJHE 1CLZL 1UM6H 4HIXH 5F7EH 2PO6D 1FN4B 3HAEB 2OTWB 4JRXD 5K59E 1RI8A 2NW2A 2UUDK 3BRDA 2B39A 3C2SA 4PBVC 2ICES 5D7IE 2FO1A 3HMXH 1P4IL 3DVGA 4AH2A 1MH5A 3S3PA 2HJFA 4LIQE 1H5BA 1H9VA 3V5KA 4KGLA 4Y2DA 4YXLL 3GO1H 3Q6FA 2OJEA 5LWYH 1L7IL 1EDQA 1A6ZA 3MLZL 3SJVA 3VJ6A 1XR9A 2L7UA 1SQ2N 1AGFB 5DQ9B 5BW7A 2QL1A 3ZL4H 5FUOH 25C8H 3QHTC 5IB4A 4OCRH 1GGCH 3MR9B 4KQ3H 3RVUC 3UBXG 2OMBA 4OIBA 4PRPD 2EO1A 2J5LC 3SE9L 4A6YA 4NWUL 1OSPL 2WINB 3WJJA 4WU5A 1HHHA 4HQQL 4M7LL 3I3BA 4XZUB 1VA9A 1KIPA 2ZCLL 3X11A 1M7IB 5DJ8A 2HFFA 1RSFA 4DVBA 3QIUD 1MVFA 1ADQL 4ZXBC 2EC9U 3DUUB 3MLTA 1H0DA 1T2JA 2CRZA 5C09B 1OAZH 4J6RH 3UDWC 4K3HA 2GJZA 3VXMD 5EOTA 1QLEL 5LXGL 4HUNB 5IM7B 4BFIA 4ISVA 1B6DA 2Z0BA 2F15A 4NYLB 4ONOA 4GAJL 3QXAA 3NCFB 3BP7A 2DJUA 5EBWB 4ZUUB 4U7KA 1IC4L 4ODVH 1LK3H 2GSGA 5EUOE 1X7QB 1ZT1A 2BNRE 4NCDA 3NCYP 5AYUH 3MA9H 2VLME 5GZOC 4AL8H 3X13A 2K7PA 3UAJC 5GGVY 5JO5B 3OAUL 2XN9D 4MXWL 4PS4H 4Y5XC 5K9JL 3IS1X 4MA1B 4PRBB 3S37L 5I0DA 2RCSL 5IFJA 4KMQA 2H6PA 3WBDA 2VTFA 3CFKB 1MCNA 3DIFB 5MENA 4OGYL 5DD6B 4BKLB 1AGEB 3KPRD 1IKFH 3VA2C 1Q0YL 1KUMA 1XR8B 1WLHA 1A6PA 1CFTB 3MX0A 4CJ0A 2DQIH 4P4RB 3VWKB 1F02I 3WXVH 3K8KA 1NC2A 3VXRE 3MV7B 1QRND 4LCUB 5CEXA 1UM6L 5HHOE 2P8PB 4HIXL 4N90D 4S1DD 2V5MA 1QSEA 1HCFX 2JCCE 4OD1L 2CGRH 4LLMA 2W65B 2ICWI 3VWJA 4U6YB 5C8JA 4IJ3C 4M02A 4X5WB 4K8RC 3O6KH 4QRQB 2F54A 3HR6A 2MWCA 3GO1L 4UTBL 2X4TA 2W9LA 3ARWA 5BOZG 5IG7B 3RDTD 2XICA 4QOKE 3W82A 4G7VH 4P2YA 2V5YA 1F8TL 3FRPA 1ZT7A 2PW1A 3ZL4L 4NQDA 5FUOL 1UWGH 25C8L 1E0OB 1GGCL 4W4OA 5I9QB 2JIXB 2AXJA 1R5IB 2UYLA 4Y0GA 4YPGA 4RGOH 4LSPH 4PLKD 4Z7VA 4U1GC 4X6CB 4G80A 2DQFA 5I8OH 1UWEH 4AEIL 2ATPB 2Z92B 3HC0B 3KYOB 1AFVL 3N06B 4M6NL 3CDGA 5GGRA 3CIQA 1SHMA 5IOPB 2ITCA 5KSAC 3NH7H 1K4DA 2VDLL 1H3PH 3CXDH 2QADD 2GY7B 4MNQD 3DHMA 1ED3A 1TTGA 1O7SA 3EYOB 4J6RL 4DW2H 4HUUB 1U8QB 4DWHA 3D9AH 1M4KA 3WFEH 1D5XA 1PJ9A 3QUMB 3TFKD 4XBGA 5DWUH 4N1CA 2B0SH 2E7MA 1BIIA 1EJOH 4LVHC 5KSVA 4GS7C 5A2JH 3QNZB 4P49A 4JANB 4JFHE 4QNPF 5D2NC 1IC5H 1NGZB 5F9OH 5DRWB 5TF1H 4PGEA 3F6IA 4ODVL 1LK3L 1QSFD 4ZFZB 4U1JB 1FO0B 4ZFOB 3BWAB 5FF6B 1FSKB 4PJ5D 5AYUL 3MA9L 1UA6H 3BPNC 5I71B 4AL8L 2UZIH 2W0LA 1D9KC 5EO0B 4PS4L 7CGTA 1EA9C 3N0PB 3O8XD 2AXFB 3GSXA 4IMKC 4LQFH 1F4YH 1AD9A 2DLTA 3MGAA 4G8GE 4NNPH 4HIHA 4NKMB 1FAIH 1MFDH 3QZWG 4WI5A 1K2DA 3BISA 5C07E 3RX7A 2DQIL 4RAUA 1Q0XH 4WCYH 2H1PH 4NHUB 3EBAA 4H25B 4YZFE 1U3JA 5F89A 3WFZA 1TPXC 2DQGH 4LNRA 2CGRL 5IVOA 1KF9B 3VH8A 3W11D 1FQ9C 1VB9A 5FYJH 4CMHB 1MCPH 4WI2A 3NGBB 5D1ZA 3DUHA 4Z7WB 5I1DB 4KVCH 2CLVA 3P9WB 4AQOA 2PO6B 5DD5L 4E0RA 4JRXB 2DQHH 3EYFA 1FE8H 1QO3B 3DSNA 4KKLD 3M17B 3P30H 2BY0A 5TH2A 4X4XA 4J23A 2HFGL 3FCTB 3FQXA 3A6CH 4Z6AT 1KXVC 4HIIA 3TN0D 3JTTB 1U6AH 4MDJA 3FO1A 3VG9C 1IEBA 3KPMB 2O61A 1BFOA 1YDPB 4Q58C 1UH2A 4KJPD 3RVTC 3Q0HA 4PBXA 1MREH 1OSZA 5I8OL 1YY9C 1I7UA 5LQBL 4MCZB 3WXWH 1JZ3A 3OAYK 4LLAA 2AJVL 4XP1H 5CIPH 5D1QC 5IKCA 3CXDL 1AXTL 3SCMD 4G7YL 3QCVH 5DHXB 4DW2L 2AJXH 3ES6B 5BZWB 4GLRH 3RIFF 5CS7A 1CZ8H 1KYOJ 3D9AL 3WFEL 3BXNB 1QEWB 5E4EB 3EKCA 1HN1A 1Q9LB 2PN5A 3QXUA 5DWUL 3QIUB 3G6DH 1H5BC 1LQSR 4P9MH 4Y2DC 5E2WH 1EAJA 1EJOL 4XC1H 3GZKA 2GY5A 4B5EA 5F9OL 1IC5L 3DETC 3GSQA 1IAII 3VXMB 1SEBB 5K9OA 3P11H 2X9XA 5BW7C 5I1HH 4LPVA 4LK4A 3RHWF 1SJEA 4P9HL 3LS4H 1GSMA 2A6JA 3G5YB 1UA6L 3H8NA 3UYRL 2UZIL 4Y89A 4MWFA 4ZPTB 5ADOL 4LKXB 4BM7A 1SBBA 5D5MF 3WJJC 4MA8H 3RJQB 4LHUG 3JWDH 1OGTB 3HE6A 4NNPL 4WU7B 3L7FA 1FAIL 5D6CB 4ZPVB 1MFDL 5CJ5A 3V9FA 1ZA3B 2XN9B 3BHBB 2KQMA 3SPVB 2EKSB 4WCYL 3GIZL 2H1PL 4L4JA 3TZVA 2C7UA 1EFQA 5MERA 5EOCH 3DGCR 3VGDA 4XVUC 1A9BB 2OZ4H 3F5WB 3LQZA 1BAFL 1FZMA 1VFBA 4KVNH 3KPRB 5IBUB 3WIFA 1J8HA 1XF2A 1CI5A 1V3JA 2XKNA 3BDYH 2IALA 1X5GA 1QFOA 4Y19A 1UC6A 3U9PH 1MCPL 3EO0A 4Y5YA 1IGYA 5DJCB 1QRNB 4KI5F 3WFBH 4D9RE 2R2HB 4QRSB 2DQHL 3HE7D 4K94H 1FE8L 4PUBL 3ZDXE 3UTSA 1P69B 3FB8A 3LVEA 4I1NB 3UP1A 2XZQH 4Z0BL 3A6CL 1K4CA 5C08D 5MEPA 3TH2T 3TP4A 4Z7UE 4GRWF 1U6AL 4KY1L 4U31A 1JE6A 3ZE0F 3X3FL 4OLYH 1NKRA 2BNQD 3RWFA 3RL1B 5DRXA 12E8H 3KG5A 5F44A 4EN3D 3RDTB 3W81A 3FRUB 3BKYH 2DRUA 4JDTL 2FD6H 3WXWL 1MHEA 5INDB 3GBMH 4AQ1B 5JA9A 4XP1L 1DSFH 3IETA 3IDIA 1IJ9A 2F5BH 5JDSB 4YK4B 4TPRL 4K7PY 3VWJC 5C9JB 3LKRB 2J1KA 3QCVL 4WFHD 2AJXL 1T6WA 3DRQB 1CZ8L 1JWSA 3MRNA 1LO5B 1JWMA 2HN7B 3P40A 3G6DL 4P9ML 5C0BA 1Q94A 1HXMA 2QADB 4JJHA 5DJ0B 4MNQB 2NLJA 1KACB 2CUMA 1QSZA 5INCA 4YHIB 2AERT 3P11L 5EU5A 5GHWL 5ANMB 1X6LA 1YZZA 4W4OC 4FQQB 3RWEB 3PGFL 2R9HC 3GSVA 1T5XB 3U6RB 1TENA 1X5KA 4UILH 3O2DL 4KH2A 4MA8L 1QSFB 1TQBC 5E1AB 3JWDL 4PJHA 1NCCH 4PJ5B 4KRNA 1MFEH 2H32H 3TBYB 1G7PA 4O2FA 1WICA 2G5RA 1PLGH 1H3XA 1HNFA 3PWVA 4PRPE 1L6XA 3O8XB 5D7IA 3WD5H 4NC0B 4X6BB 3V6BR 5EOCL 1MPAH 3FB6B 4U1NA 4L9LA 2OZ4L 4NKIH 1FNEB 4J1UB 5GJTH 4UAOC 4WHYH 3VXUD 2A6DA 2BNUB 2IGFH 2DBLH 3BDYL 1F4XH 4JFYA 4HIJB 3FT4B 2XWJA 3P9LA 4XPHH 3U9PL 2X40A 3WFBL 3FQRB 2VAJA 3HB3C 3T04D 3RPIB 4YLQT 3ZYIA 1OAXH 4OQTH 5IESL 1Y18B 2I9TA 1PAMA 1VACA 3ET9F 5LKNA 1D6VH 3WEXB 2EDXA 3QFJD 4AIXA 3DV6B 4MB4A 3U0WH 3CC5A 3NTCL 3TBVA 1J9CT 4LSSL 1RZIA 4BSVA 3RKDC 3LDBB 1SJHB 3SGDI 3CSYB 1EJ6A 12E8L 5L88L 3BKYL 4AJ0A 5I2IB 1JNLL 3IB4A 3C5SA 2FD6L 4PTTB 4MMZC 4JFEE 3TN0B 5LBSH 1G7LA 1DSFL 4ZTOH 2ARJQ 1JGLH 4YDJB 3V6ZB 3OB0H 2F5BL 1L4IA 1VGEH 2H41A 2R1XA 3TCLB 4PG9A 2V5SA 5D1ZC 3RUGE 5EUOA 1RAMA 3I3EA 2BNRA 1ZANH 4Q6IA 3R8QA 1JYVA 3C09C 2NNAB 3B5TA 4U0RC 1KG0A 3QIWA 4JY6B 3P0YL 1N0LA 2X4PB 3SCMB 5CUSH 1T2XA 1HYSC 2Q86A 1I8IA 2V9QA 3ZDZF 4LDLB 1F00I 4IHOA 5KSBE 3MNZA 4PP2A 2P7TB 5IFAH 2RHEA 1BF8A 4UILL 5CJOH 1U41A 1EEQA 5KS9F 3QG6A 4YIQB 3VXRA 5E8OA 3N85H 5IW6B 5HHOA 3O81A 3NFSH 3TJHC 3OKLA 4X7CC 3T3PF 2JCCA 4PJ9A 1NANI 5EH1A 4WTZG 3I9GH 1DVFA 4GUPB 1MPAL 2FEEL 3S4SG 4NKIL 1T1YA 5GJTL 3WLBB 2FWOB 3TNNA 1F4HA 5CSZA 2IGFL 5ICYA 5LAXB 8FABA 3EIFA 1F4XL 4AG4H 5J13B 1ADQA 4QOKA 3FN3A 2VIRA 4E5XB 5CZXC 1MSPA 2GQHA 4HJ0D 1W72B 4IRJD 3JWNC 5FOBA 1G7IB 2Q7YB 2PXYD 2NYYD 4C54A 2Z93A 1NFDF 2VXTH 4LVNC 4OQTL 4U6HB 5ESAA 4EUPH 2LE9A 5ANME 3UO1H 3SGKA 1CE1H 4FXLA 3REWA 3CSGA 3ARTA 3NFPB 4KXZH 3HE6C 4KKCD 3VD7A 4PJFF 4WENB 3HE7B 3SDDA 1BP3B 1X6NA 1AR1D 1H15B 5GS0H 4X6DF 4GG6B 4ZO7A 4QXTB 4PY8I 5C08B 3TZVC 1ZMYA 4N0FB 2NY0C 1BECA 1W2KT 3BD4A 5LBSL 4ZTOL 1U93A 2BNQB 4JN2A 1QBAA 1VGEL 4EN3B 1DQJA 3TO4D 5DURD 4DZ8B 2D0GA 1OP5K 3AXLB 4BUHA 2NX5D 1F3JA 4Y5YC 5I6XB 5DYOB 4OLVH 5DQJA 5I30L 3NZHH 2XA8L 3FOMA 2VAAB 2I07B 4P5TD 3V6OE 5FV2A 1IGIH 5HYIA 4CGTA 5CUSL 4UOW1 2J8OA 4JZNA 5DRZB 3HNVH 2NW3A 1T22B 5CEZH 1RURH 4PY7A 4MQXD 3QUXD 2GTWB 4G8GA 3HTLX 3DBXB 5JIPA 2Z35B 1QR1A 1GH7A 4XCNA 1BQLH 5C07A 5IFAL 3DX9A 5IB5A 3GMNB 5I1IL 4BFGA 4UB0H 3DURA 5HI4C 4NKOB 3T0WA 2QTEA 4Y5VB 3LKNB 1ZXQA 1DL7H 3H6JA 5IIEB 1ZOXA 4DFHA 4M8VA 5JQ6H 4G6JH 3I9GL 4JZJB 4FMKA 3ORJA 4PJ7B 2B1AH 2MCPH 3H9HB 4HV8A 2A0LC 3FT2A 4CU8A 3CU1A 1DFBH 3O2WH 2XKSA 2N7AA 1X7QA 2ED8A 1BQHG 2X4RA 1G9ML 3G9AB 3FTGB 4AG4L 3P4OB 5IMOB 4MX7A 2YWYA 4D0DB 1AP2A 2P49B 1RZ8B 3VXUB 3D69B 2ZG2A 3CFKA 5IK3B 5F7MC 3DIFA 5B4MC 4L5FH 4M8QA 1KCRH 3IFOB 4YHNA 4Z5RB 4X0KA 2H2PC 3QJFA 1VEOA 1CE1L 1IILE 4PJEF 2EDRA 4UUJB 1M7XA 5HVHB 2QR0B 3HG1D 3UJIH 3VRLF 3VWKA 5C0EA 1MCEA 3PWPE 5GS0L 1UH3A 4R7NB 4EUPG 1CXKA 4GKNB 5GGTL 3QFJB 4Z7QE 4GJTB 1NMBH 4F7CA 4WDIB 3E6HB 3HI5L 4JQIH 2X44D 2DIAA 4L9LC 3H42L 2YD7A 3QA3B 4F3FB 3GHEH 1TITA 4Y4FD 5D2LE 4BSWA 2K3TA 3VFRB 3VRJB 4NDMA 1DANT 4IMLB 4G9FD 3GSUB 4ZUSA 3GJFB 1B0RA 5J1AB 2VISB 2ZCKH 4OLVL 1P4BH 5J7CC 4R4ND 1FL6B 2D4FA 1QUNA 2KKQA 1QR4A 3ARQA 5F7DB 3MLPA 1AY1L 3Q5YA 4IRSC 5IB2A 3TBSB 3S5LB 2VDNL 5FGCB 5CEZL 1CXIA 4XAKD 1EV2E 2WSKA 3OKDB 2QQNL 5J11B 3UX9B 2Z8RA 4ZUWA 1E4XI 1T1ZB 2NZ9D 2GFBB 4QHMB 4PB9L 1JYNA 4JKWA 3SDCA 2BY1A 4IOIB 5DFVD 1WQVT 4NQVA 4UB0L 4WTWA 3EYOA 4BELD 3OF6A 3BO8A 5J57B 5BV7H 4ELME 4QGYA 5FGSA 2WM0A 5DJYA 4FFZH 4MZ3A 2BNQE 2P24A 4KQ4H 4RGND 4G6JL 3NCBB 2B1AL 2VC2H 4I8DA 4Q6IC 4WO4D 1DFBL 3O2WL 2XG4A 3QUZA 4U1JA 1FO0A 4ZFOA 2XPGA 3BWAA 3QP3A 5FF6A 3QIWC 4RZCB 3EYQD 1ZHKA 4AZ8A 3LV3A 1JRHH 5DSCA 4Z7UA 3HZVB 3MLYH 3O3UN 4QRPE 4FOMA 5F71A 1F3DH 1YEEH 4L5FL 1CCZA 3WSQH 3WDIA 4IRJB 5IBTH 5L2JB 2OL3B 3KJ4C 2CIKB 2A6KB 4GRMA 5KVFL 1EGJH 3PWJA 2PXYB 3H0TB 3HI6H 5EWIH 4I9WD 5EO1A 4HBCH 4PJ9C 4B0MM 1KNOB 3KPOA 2P48B 1DEEB 1J1PH 1NMBL 1RZJH 1DVFC 5GXBB 2XWTB 4ZYKA 2C1PB 5J12C 1J10A 5CEZE 4Q9RH 5EZIH 5I1DA 3GHEL 2DBJA 2OX5A 3IDNA 3VI4F 1UFUA 4RFNC 2AGJH 5HGAB 1PVHA 1MCCA 4LLDB 3OAZH 1MJ8L 1T04A 3W39A 4R0LB 2ZCKL 4L9DA 3F7PC 3PE9A 2XFXA 2X89D 4G8EB 2B20A 5DURB 3L9RB 4HLJA 3ZTNH 4YGVB 3BGFC 3KPQB 1YDPA 3DLQR 3SGKC 3U7WH 3L1OL 4NZDA 2NX5B 1T66C 5FO7A 5D7SH 4DCQB 5E95B 4P5TB 3SDDC 1VESA 2NTFB 1W8OA 3MOBH 5F8RC 5KVGH 4PRPA 2D03L 2YRPA 4PJBF 3BP4B 3QUXB 2IQAA 5C9KA 3PDDA 4PRNA 5BZWA 4EIZC 1MJUH 4JHAL 1TZIA 3FB5B 4FFZL 2PR4H 4RNRB 2J6EH 1BZ7A 4KQ4L 5DI8B 1CTOA 1JUFA 5C7XH 3BYYA 2HLFD 2YK1L 1B3JA 4KAQL 4OKVA 2VC2L 4FFWD 4LSQH 4YR6B 1ZLUK 5C0IB 2HKFL 4OF5A 4U1LB 5K93A 3K0WA 5CIPA 1SY6H 3I6LE 3KYNA 4DOHE 1A6TA 1RIVL 1DEDA 3QHZH 5EG6C 4F8TA 4LKXA 3MLYL 1O0VA 2EIDA 3DUSB 1RY7B 3NACH 2J3SA 3U82B 3S9DB 4OCMC 3OKNA 4OCLC 2D3VA 5D8JH 1K5NB 4AT6A 5D6CA 3GKWL 3HC3H 5IBTL 4JFEA 1XCTA 5ITBH 3CFDB 4OCSH 1EGJL 4NKQB 3BIKB 1V3KA 3RVVD 3I02B 3HI6L 5IV2B 4OFDA 4UV4H 5EWIL 3LQMA 2P5ED 3QNYA 4HBCL 3FQWB 4OI7A 4WW2A 1T7VA 1HWGB 1FYTD 4J3UA 3KVQA 1RZJL 3O2DA 3RUGA 3HG1B 1DR9A 1ZTXH 3TJEH 4Y8AA 1AHWB 2DAVA 4Q9RL 5EZIL 4LLVA 2XOTA 1GAFH 1FORH 3E1F1 2AGJL 2R56H 1ZSDB 3D6GA 4QXGL 3PWLB 4RA3A 1F11B 3GMRB 5JW4M 3HZMB 2X9WA 4MA1C 5EOQL 5KSBA 3AU1A 2OZ4A 4Y4FB 3PIQA 1CDIA 3C8KA 3W0WD 4BUGA 3ABZA 3D25A 4O02H 3T0XA 3LN4B 4G9FB 5ID1B 2EH7H 1WWAX 4F37F 4FQ2H 5IR1B 5E9DD 3FRUA 1F2XK 1U8OB 2V17H 1BZ9B 3VWKC 3ILPA 3LPFA 5INDA 3MOBL 3MODH 3T2NH 4X6EA 4P2QE 1QBMH 5GISH 5KVGL 4QGTA 3WHXA 4D3CL 5HYEA 4KRLB 1M05B 3IVKA 1BPVA 4DQOH 2YD8A 4NSKA 5F9JA 3SE3A 5C0GA 5LVEA 2DQJH 4UDTB 4PGBB 1DBKH 2E9JA 1MJUL 3BGAA 5ADPL 2D7TH 1OCWH 4OLUL 5D7LD 2QSVA 1GJIA 3O3BB 2P5WD 2PR4L 4GG8B 3ILQD 2H9GB 5C7XL 1TVDA 4XPBH 4HPYH 1H3GA 5LCVH 4FNLH 3B2UD 5DDHB 3OMZA 2IFGA 5DJ2B 4G5ZH 3LPGA 5DGRA 3ULUH 1RD6A 4KRPD 4N5ED 4YDKL 5HYJD 4RRPG 5ANMA 3GI9L 4RGNB 3QHZL 2BOCA 4M5ZH 1YN7B 5GZNC 5FO9A 3NACL 5GRVK 1YNTA 4WO4B 4JPIB 1EEZB 5J6GB 4PJAE 5D8JL 3RPKA 1AO7D 3HC3L 4G42B 3SDCC 5ITBL 1AGDB 3OSKA 4HKJA 3EJZD 3ISWA 4OCSL 1J86A 4XC3H 3MNWA 3QJHA 2UY7A 2VZUA 1QBLH 3JWOL 4UV4L 1NEZG 3FB6A 3SBWC 1QVOB 4KHXL 2K7QA 3F6LA 3L3IA 4L3AA 4QHLA 1YYLH 4FQHB 4PRDA 1YYMH 1OM3L 4GW4B 4HK3J 3MLRH 3V6OA 1KTRL 5HYSG 1GAFL 3FQRA 3QUZC 2H32A 2R56L 3CFJA 4QRUB 3RWJA 1VADB 4NKDB 4OIAA 3OPZH 5EZJA 1LDPH 3RFZC 4R4FH 3WNLA 4ZSOB 1X4ZA 2YR3A 3NMEA 3S36H 4HZAA 4PJDF 4A2MA 1NCDL 4I48A 1JPFB 2EH7L 3QI9D 4MVBC 3CSYA 4K71C 4FQ2L 1F6AB 2ZPKH 5E2TH 4E42A 2PUQT 2EDLA 4XMKH 1UB6A 3DPBA 1KIRB 4YAQB 1EZVY 2BVYA 1YEFH 4ORGA 3MODL 4NQXB 1XGRB 4P9HC 1IBGL 1QBML 1SJVA 1XH3A 1PD6A 5I1AB 1KT2A 5ELIA 5E8NA 1N5AB 1J1OL 4DQOL 1U8MA 1IE5A 1NBYA 3OXSB 4Z78A 2DQJL 2DMCA 1TZHA 1NL0H 3DX7B 1KLFA 4RFEB 1NGQH 3C9NB 2D7TL 1OD7A 4JKMA 5CCKH 1AJ7L 4F58H 4OF3A 4EVNA 4DZBA 3KLAA 1PEZA 3NAAH 4XRCB 4LF3B 2GIYA 3UBXI 4UMGA 4JE4B 3MRLB 3HAEG 2X4PA 4XPBL 4HPYL 4TVPD 5LCVL 3UXFA 2X2YA 2BVQB 5TDNB 4V2BA 5DHYA 4M7LT 4F33B 2R4RH 4S1SH 1CL7H 3BDBA 3PHSA 3EJYD 1R0AH 1NBZB 3KPLA 1DBAH 4P46D 2R0ZH 3TT3H 2DYPD 3ULUF 3EYVA 5FOJA 4M5ZL 4G9FE 4MXVF 4GBXA 3LKQB 5SWZD 3QDGE 3PWPA 4HFWA 3S35X 4JFZH 3ULVL 5D7KD 5HGDA 5DC4B 5EU6E 3QULB 3K4DA 2YD1A 5DRNB 5GJSH 4FG6C 5E5MB 3C2AH 4XC3L 4HD9A 1QBLL 3IU3B 5FDWA 1MHCA 5D2LA 3O6LH 4D0CB 3L3JB 5DVNA 1WIPA 4UTAH 4YDVB 3HPJB 3ZMRA 1U3YA 1BJMA 1OP3H 3QHFL 1JGDA 1YYLL 4JREB 3A6OA 2BXYA 3RWGB 1ND0B 4E5XA 2F19H 3MMEB 2B2XH 2P5EB 1IM9A 2ZOKA 3MLRL 2EYTA 2W9DH 3KDMB 1AKJD 2ZSWB 2VE6B 1T3FB 2VL5B 3O9WA 5HHMD 2VL4A 4HUVB 1FYTB 3OPZL 5C0CE 4HG4K 1LDPL 2GITA 3F7VA 4R4FL 1UM5H 1MIMH 4M1CC 4XXCA 4PYHA 4M62H 1AE6H 3UTOA 2IADB 1I1AD 3KS0H 3I6GB 5GGRY 1BQSA 1H15A 2ZPKL 3RU8H 5E2TL 5IW1B 3U36A 1U3HD 3BZ4B 2ZSVA 3LKSB 4PR5A 4ELMA 3BDXA 3W0WB 4HS8H 4ORZC 4WW2C 3ARZA 4OZFB 1U58A 5BVJB 4QWWD 5E9DB 2WUBH 4EUPA 4HJGA 1OPGH 4DZ8A 3FQTB 4HZLA 1PBYA 1WISA 1NL0L 4Z7NE 4Z0XB 1AXSB 2A6IB 4X5XA 3AXLA 5D4QA 3JWDC 3E0GA 5JHDE 3DROB 4IRZH 4F58L 1RUAH 2PYED 3JTSA 1IAMA 1T89A 1D5BA 2VAAA 2EYRB 3NAAL 3GEWB 3RGVB 4S1DC 3SKMB 5BJTB 4D8PA 3MXWL 4FTVD 5GGTA 3ULVE 2P1YA 5EBMA 3E2HC 3NIFF 2FEDC 5BVPH 3MRDB 4QRPA 4S1SL 3JVGA 5D7LB 1CL7L 2I25N 1AQDB 2P4AB 1R0AL 2P5WB 4KK5C 1DBAL 4CVZB 2PNDA 2XQYG 1BOGA 2R0ZL 4O2EB 5JOPD 1N5YH 2DICA 3GMNA 1KB5H 4XNXL 3WUZA 3GDBA 2DQTH 4NKOA 4KRPB 5HYJB 2E8ZA 2ICEA 4QF1A 1RZ7H 4K94C 1CF8H 3MJ8A 4X6CF 1UB5A 2BXZA 4TTDD 3U46A 1WAAE 5ECJE 5GJSL 3QCTH 4KRMB 2Y06L 2P8MA 4OSUH 4BQBA 3SE3C 3C2AL 3AVEA 4JPKH 4FXGB 2BRRH 3O6LL 3RIFK 4ODTH 1IQWH 1X5JA 3AAZB 3WN5B 4UTAL 1AO7B 5F9AC 2GK0A 2DLEA 3ARYA 2APFA 3THMH 4F15B 5T1MB 1LNUB 4KV5F 2CH8A 1T6VN 3BP5A 2F19L 3BEWA 2ICWJ 2YD6A 5IMOA 2PYFA 4PRHD 3TYFB 2OCFD 3TFKC 1HOCA 4U33A 1GHFH 3QR2A 5FM8A 3RHWK 5A43C 3IFOA 1MIML 1EFXD 1MWAH 5CP3H 2IFFH 4PLOB 2IAMD 3OHXB 4LRIA 2HVJA 4M62L 5DEZA 1T21A 4ZNCD 4K9EL 3IXTA 3OKMA 2D31B 3OZ9H 4FQIH 4P23D 1B0GB 4RBPH 3RU8L 1KJ2H 4NJ9H 2FECI 1IL1B 4XMLH 2R69H 5ALCH 4QHNB 4TSAH 4XMPH 2EDFA 3IRPX 1AGCA 4H1LH 4HS8L 1VGKB 3QI9B 1FNFA 1NAMB 1VPOL 4WRLA 2WUBL 3VFRA 1OPGL 3MGTA 4V1DE 4OGAD 4X98B 3V6OC 4IRZL 5CWSB 1A5FL 2BY3A 4WFGD 4RQQA 1B90A 2X4OA 1BF2A 4HWBH 3I75A 1AGBB 2I5YH 2IBZY 1N8ZA 1KLGB 3OG4B 1MFNA 1FNSL 5E7BA 4Z7WF 5IVNA 5BVPL 1NFKA 2CDFB 3AY4A 3QH3B 4QRTA 4JM2D 3WNOA 1FFNA 3EZ8A 4KTEL 3WJLA 3TIEA 2OS7A 2ZNWA 1A1MB 3MJ6A 4P2RE 4KKLC 4QHMA 4W6YB 1N5YL 1J0ZA 2V7NB 1P7KB 5BXFB 1S9WB 3DJ9A 5GGQH 1KB5L 4I4WB 4EXPX 1D7FA 1I9IH 1RZ7L 1CF8L 4P46B 4FZEH 4BZYA 2DYPB 3W0WE 4D9LL 1LK2B 3VRIB 3QCTL 1R5WA 4OSUL 4L8DA 2HG5A 2QQKH 4J8RA 3RQ3A 1NMAH 4JPKL 5SWZB 3DO7B 1MCJA 1U8HA 2QHRH 3ZTJG 3JV5A 1U8KA 4ODTL 2J8UB 5D70H 3ZSTA 5ICXA 1IAOB 1C7TA 4UU9A 3IJYB 4WWID 4CADB 4BZ1H 4PJ8A 3MBED 1I9JL 1O7VA 2O5XH 1A1OB 1L7TL 1TJGH 4I0PD 5EU4A 3THML 4RZCA 3K4ZA 5JW3H 3LN5A 1JTOA 2GT9A 3PJSA 4DUWA 5DS8B 2O5YL 1GHFL 1HI6B 1EK3A 1YPZE 1T5WA 4XXDA 2Q87A 1KLUB 4PJIE 1MWAL 4GBXC 3MRQB 2JB6B 4I0KA 1EMTL 3KXFE 3REVA 1AKJB 4JHZA 5I0ZA 3H0TA 4P2QA 1A7PH 3QQ3B 5HHMB 4CVXB 1JFQH 1LD9A 2K1MA 1BREA 4ZO9A 1EHLH 4NJ9L 4XMLL 2E6QA 2R69L 5ALCL 2AXHA 4KMTL 4HXBH 4ZMAT 4TSAL 1EH9A 3H9SD 1OT1A 1Q9OB 1I1AB 3UTZA 1TJIL 2BJMH 4JLRB 4D0BA 3ROOA 1U3HB 3KLHC 5HGAA 5KVEL 1DQQB 1NCWH 1EGJA 4NNXA 5DUPH 2YSSB 4EJ1C 4H1LG 1HH9B 1U92A 1MCDA 3BZFB 4HWBL 4CW1B 3O9WC 3B3IB 1C08B 3TO4A 5IBUG 2C3VA 2CR6A 3L9RA 5E4IA 1CFVL