4C62A

Inhibitors of jak2 kinase domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
287
structure length
273
Chain Sequence
FEERHLKFLQQLGGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYRNLKLIMEYLPYGSLRDYLQAHAERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords TYROSINE-PROTEIN KINASE JAK2
publication title Discovery of 1-Methyl-1H-Imidazole Derivatives as Potent Jak2 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 273
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4c62A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4c62A01
4O84A 4PPBA 5HKMA 5EM7A 4DN5A 4GT5A 3C4FA 4GW8A 1DM2A 2C5OA 5EHLA 2RFDA 4U3ZA 3UIXA 2X1NA 4C0TA 3HMPA 2UVYA 3PRIA 3V8WA 1WBSA 4WRSA 4BGGA 5JGBA 4NJ3A 4D4VA 4QTAA 2RG5A 3CCNA 2IWIA 3R73A 1A06A 5BMMA 4D4SA 3QX2A 3ZRLA 3PRFA 4C61A 5M08A 1Y6BA 5HBEA 4J97A 4E1ZA 1MRVA 2YIWA 2G1TA 4F63A 5D11A 4FNZA 5CNNA 4BDKA 3MGYA 2RFEA 3VUKA 2JAVA 1FVTA 3PWYA 3QZHA 1H0WA 4RSSA 5LARA 3V8TA 2CGXA 1Q8WA 3VUMA 2PE1A 2VWUA 3R8UA 2PVNA 2FSTX 3QGYA 4EBVA 4KSPA 4AE9A 4RLLA 4U3YA 4G6OA 4OTGA 4P5ZA 4IAFA 3THBA 4ZP5A 5BYZA 2H96A 4FTCA 4GUEA 3E93A 3Q5ZA 4NKSA 2WU7A 4RIOA 4DH7A 3COIA 3UNKA 3I6WA 1OIRA 2C3IB 2XJ2A 4YTIA 5E9EA 3VBXA 2BUJA 3FZ1A 4A9TA 3VBQA 1GZOA 3FSKA 4FSUA 5M09A 2PMIA 4W9XA 1BL7A 3G2FA 4CXAA 4FOBA 3AGLA 2GNIA 3I7BA 4CVAA 2VTHA 3I4BA 5KMNA 1YI6A 3W1FA 5EDQA 3TNQB 5AADA 3ZC5A 4O1PA 4U8ZA 4QYEA 3LFDA 5CAVA 2BCJA 3QWJA 2XEYA 4YHJA 2UW0A 4WNMA 3C1XA 3WZKA 5BVDA 1F0QA 4EKKA 4IW0A 2X0GA 4C4HA 4WIHA 3FBVA 3ZO4A 4MK0A 3NNXA 4X3FA 4XBRA 3RINA 3TV4A 4F6UA 4FV8A 2EB3A 4O7TA 5E1EA 4JRVA 4KIPA 3DBEA 4X2GA 4KBAA 3UNZA 5J7BA 4IVCA 3PIZA 4EK3A 4C02A 3UP7A 2H8HA 4CTBA 4IANA 2BALA 3HP5A 3ZFYA 2JKOA 3ZBXA 1NW1A 4JG6A 2BMCA 3HP2A 2PZRA 3LJ0A 2PUIA 3D7TA 4CD0A 2VTIA 5CEKA 1KE8A 2C6OA 4C7TA 4ZTQA 2A2AA 2V5QA 2XBJA 4FZ7A 2WTKC 3WF9A 4U9AA 4IBMA 5T6KA 1PXOA 5EI8A 4I92A 2BZIB 5DT0A 3G0FA 5KKRC 1BI7A 3R7EA 4OTFA 5F9EA 2ETMA 3BU6A 3C5UA 3QRIA 4I41A 2FGIA 3LQ5A 3PVGA 4PWNA 3KCKA 5J9YA 4J1RA 3U9NA 3UYTA 2UZLA 4TYIA 1YXUA 2IVSA 3HZTA 2B0QA 4KKHA 4XG8A 5LMAA 2R0UA 3TG1A 5CAOA 4G5PA 4BWXA 4Q2AA 4DG3E 5HX8A 4JVGA 1BX6A 4BTJA 3HLLA 1UNGA 3R22A 3VS2A 4YR8A 3LMGA 3PVBA 4I5PA 4K77A 3BEGA 2YABA 5CSHA 4XP3A 4BDHA 2F7EE 4AT3A 4FICA 1VJYA 5IDNA 4RC4A 3CS9A 4IMYA 3BPRA 4F65A 2VD5A 3PSBA 4G5JA 2J6MA 4QMYA 4USDA 4GT4A 3V5LA 3BGQA 1FVVA 2H9VA 2WTJA 4TRLA 4E7WA 4F0GA 2BZHB 4J7BA 4BBFA 1LR4A 4N57A 3PVUA 4ZJIA 3A2CA 4RWLA 3B2WA 4E4NA 3S4QA 3KN5A 4IVAA 3KULB 3NNVA 2PUPA 3QBNA 3G33A 2JIIA 4D55A 4IEBA 5C03A 2RFSA 5TKDA 3TXOA 2HAKA 2XK7A 2VX1A 4G3FA 5JZNA 3V6RA 4ZY4A 3WZUA 2EXCX 5FM3A 4D28A 5DEYA 4B7TA 5AP3A 3TIYA 4WG4A 2Y4IB 2VTRA 4OBQA 2YAKA 4R7HA 3L9MA 1FGIA 2VTLA 3EFJA 5CWZA 5CZHA 2GSFA 3PY3A 2Z7QA 3LFAA 2BTSA 5CF8A 4IAKA 1ZOHA 4FTIA 1G8SA 3ULZA 2UW5A 3ZHPC 3E7OA 3GCSA 2B52A 4FTMA 3JS2A 3LCKA 3ZLWA 5CEIA 3EQGA 5E8ZA 1O6LA 3UIMA 1OKYA 4F7LA 4BR3A 2WMSA 4YJSA 1U5QA 2J2IB 2J0KA 3CQUA 3FUPA 3II5A 4M14A 1R78A 3ERKA 5CNOA 4C3FA 2W1FA 5T3QA 5IG1A 4AAAA 2VO6A 3HMNA 4FKSA 3RCDA 4KINA 3GC0A 4C4EA 4DT8A 2X9FA 3E92A 4FSYA 4BKZA 3U6HA 5FDXA 1FQ1B 4TW9A 3G15A 2SRCA 4GSBA 2ITPA 4BTFA 3U6IA 2F4JA 1G3NA 2WMXA 5TOZA 2GDOA 4CCBA 4NTSA 2XNNA 3QXPA 4O38A 3QUEA 1DS5A 1WBPA 2G15A 4UZDA 1GY3A 3F7ZA 4WD5A 1OPLA 2V55A 2W1EA 4YBKA 5DYJA 5GZ8A 5M4FA 5K4IA 4BKJA 1AQ1A 3ZO1A 4DEAA 4ENYA 1JBPE 2AUHA 3DY7A 2UZEA 5GINE 1R0EA 4AZEA 4TWNA 5CEQA 1UVRA 5F4NA 3K3IA 2R2PA 4M84A 4ZSEA 3RZBA 5LVPA 1WFCA 4GU9A 2XNGA 5HCXA 4BN1A 4F4PA 1DI9A 3SOCA 3A7FA 2YIRA 4PTCA 1KV2A 4ZTHA 3ZEPA 3FLYA 3EN7A 2C6IA 3VF8A 1YDSE 4S33A 2XBAA 5F94A 2J0MB 5EM5A 5EQEA 4QMPA 1JAMA 1PXKA 3NW6A 4XX9A 4Z55A 1FVRA 5CSVA 3DB6A 1V1KA 1YHWA 3PG3A 3HDMA 3TM0A 2WTVA 1H08A 4RLKA 5J9LA 3ENHA 2ZDTA 2BROA 2O0UA 3OWLA 5DR9A 3GU5A 3V5QA 1W82A 3POOA 4N0SA 2QG5A 4L42A 5TE0A 5CXHA 4ACHA 2R64A 4S2ZA 3LCSA 4FIHA 4A9RA 1WBVA 4KS7A 1TVOA 5E90A 4JQ8A 4PMTA 3DK7A 4DF3A 3QQJA 4UZHA 3ATTA 5AFVA 2B7AA 4F08A 4M15A 1J91A 3IGOA 2C6LA 5HG8A 4D2SA 4L68A 2ZVAA 4L45A 4IVDA 4UXQA 1S9JA 5ETFA 3PP0A 3TCPA 5HLWA 3HVCA 3MY5A 5ANDA 4IM3A 5BUJA 2BAKA 2WMBA 1R3CA 4K33A 5CSPA 4ITIA 3WF6A 2PK9A 1ZY4A 1HCLA 1KOBA 3F3WA 2ITQA 2X2LA 3DGKA 2W0JA 5B7VA 1FMKA 4CV8A 3GC8A 3QKKA 3OT8A 3PPJA 5JFSA 2VV9A 4EH7A 5M06A 2GNHA 3G6HA 4QYGA 4FV9A 4WG5A 3GUBA 4OGRA 5JGDA 3EFWA 4AN3A 2IG7A 3QRTA 4ZLOA 4B8LA 1OL5A 4BIDA 2PPQA 1MUOA 4BHZA 5H9BA 5HOAA 4F9BA 2WKMA 5I9YA 2E9VA 4DEDA 3VS1A 4XG2A 4WG3A 4C4FA 4UYAA 5CASA 3GGFA 2F57A 4LL0A 3FKNA 3L8VA 4P90A 1YXXA 4FTKA 2PTKA 4PL3A 3FHIA 5ANIA 4XV9A 4TN6A 2YERA 1Q5KA 1Z5MA 1OKVA 2VGPA 2X9EA 4G9CA 5L6WL 1BMKA 4I4EA 3QALE 3A7IA 2ZB0A 4V0GA 4I0SA 2R3NA 3EN5A 3QTQA 5IQBA 2ZV7A 3DQXA 3KXGA 3R7GA 2IVTA 3T9IA 4BWPA 2GTNA 3SA0A 5J5SA 2OICA 1WBOA 3RJCA 1IG1A 1REKA 4X2NA 3SW4A 3PJCA 3RKBA 2ITYA 2JBPA 1H0VA 4DLIA 3R1SA 2YM5A 5A4EA 4YNEA 5ANEA 4CYJA 3W55A 3LCDA 2BIYA 2OIBA 3BYUA 3KRXA 4JDKA 4AS0A 2YWVA 5HO8A 1K3AA 4W9WA 1M7NA 5A6OA 3QFVA 2X7GA 2KTYA 2W4OA 1OECA 4OT5A 4BCHA 4E93A 4EH3A 4L01A 1Z57A 3E3PA 4Y5QA 4FSMA 1W83A 4TKSA 3QLFA 2X7OA 3PXKA 3UOHA 3QUPA 2OJIA 5HCYA 3HV5A 4YZBA 3REPA 3I79A 4C4GA 2QR8A 3KXMA 4KABA 5KMIA 3HMMA 3R6XA 5CX9A 3KCFA 4MXZA 1SMHA 4XS2A 3V5JA 4ACDA 5KUPA 3QWKA 4CKJA 5C01A 4NIFB 3R9OA 3UMXA 5A9UA 3DKCA 4HOKA 4CG8A 4RZWA 2OLCA 2PE0A 3ZONA 2WMTA 4ZZOA 1VZOA 4D2PA 2R3FA 4MQ1A 2BHEA 3SG8A 3PXYA 4CQEA 4O7WA 4IHPA 2PL0A 4MXOA 4JQ7A 5LVLA 1K9AA 3EL8A 3RHKA 5LQFA 1H00A 1ZRZA 3R63A 2B53A 3IS5A 5AUUA 4OBOA 3PPZA 3LFBA 3FEGA 3EN4A 1UKIA 1PMEA 4ANLA 4CGAA 2WMQA 4O1OA 1JSTA 2JIUA 4IX5A 4A9YA 2XIXA 4E4LA 5D41A 1M14A 4HGEA 3R7UA 4XCUA 2PZ5A 4IE9A 2H34A 4NM7A 3MVMA 3D0EA 2NNWB 3QTXA 4GFGA 3HV6A 2HZ0A 2OG8A 4MD8E 2YHVA 2C47A 3GU4A 4MF1A 3JUHA 5AP4A 4BB4A 2C30A 2HZNA 4ENXA 5M55A 4ALUA 3R7OA 4A7CA 3ZLYA 2QHMA 4FYNA 4LL5A 4NSTA 5L6PA 1BKXA 3C0IA 2G2IA 4NW6A 3ZM4A 4F9CA 3FMNA 4PQNA 4BCOA 4BYJA 4FTAA 3PJ3A 4IX6A 3V51A 4FSNA 3V5TA 5AA9A 2PUNA 2PZYA 4NCTA 3R0TA 5AUWA 5DLSA 5HIBA 4C3PA 1OUYA 2C0IA 1YXTA 1JQHA 1H1SA 4DEHA 2CGUA 3EQBA 3R2BA 1JKSA 1YXSA 1GNGA 3MH3A 3QTUA 3AT2A 1I44A 4RBLA 2GQGA 2LAVA 3RVGA 2Z60A 5CT7A 4LQMA 4OLIA 3ULIA 4D2WA 2ZM3A 5ITAA 1ZOGA 3PSDA 4RIYA 5DRBA 4GFOA 4UBAA 2VTOA 4X3FC 5H8EA 3DFAA 4KIQA 3TNIA 3IDCA 3R2YA 4FTTA 4ZY6A 2ZM1A 1LPUA 2ERZE 1YHVA 4F7NA 1HCKA 1PRYA 2XKEA 4WA9A 2OH4A 3HNGA 2IPXA 2VWWA 2HW7A 1E1XA 3VULA 5CF5A 4NJDA 3BYOA 4XOYA 4CZTA 3WF7A 1M2RA 1FMOE 3FQEA 3HECA 4G17A 3ODZX 4FX3A 4XNEA 3QA0A 2P0CA 2QOOA 2IW6A 3OW4A 4CLJA 2XJ1A 3SRVA 2XZSA 3A7JA 2ACXA 4U44A 1PY5A 2C6TA 4U80A 4X7QA 3P0MA 4LFIA 5TR6A 3KN6A 4IFCA 3EQRA 3GVUA 5DI1A 2OZAA 4FC0A 3VQUA 4Q9SA 2OSCA 5E8XA 5CU0A 5FTOA 4C4JA 3E64A 3I7CA 4F7SA 4AT4A 4FGBA 5CF6A 4E6CA 4ANNA 3MFTA 3UZTA 4O7NA 5KMLA 4CFUA 3MFUA 3K54A 2J0JA 4IB5A 2VTMA 1LP4A 4XRJA 2B4SB 4QYHA 5EW9A 1XH9A 2V22A 1ZARA 1ZYSA 5K3YA 4C2VA 2HZ4A 3VUDA 2PWLA 5IMEA 3VJNA 3ZXTA 3BHUA 2GU8A 4OAUC 1VYWA 2BHHA 3ORXA 4M66A 5HE2A 5I0BA 1U54B 1V0OA 4LRKA 4JR7A 4YJRA 3PWDA 4JAJA 4IWPA 4GKIA 3ZRKA 4OTDA 3FHRA 4UYNA 3R8PA 2ZV2A 1XR1A 3HV4A 5I4NA 3EQFA 4GS6A 3I60A 4DFZE 2E9PA 4UWYA 2Z7RA 4I6FA 3IOKA 4AGUA 4F6WA 2FUMA 4LGHA 2Y9QA 3V01A 4XEYA 4E3CA 3ROCA 2CLQA 4IAIA 2WO6A 3DNDA 3QYZA 4DGNA 4L3LA 1H24A 3ZZWA 4HCVA 4EZ5A 5F20A 3ROYA 1PXNA 4FV2A 4RC2A 4HVSA 2YEXA 4MNFA 4PMSA 3MA3A 1H27A 5JKGA 3DPKA 3MVHA 3OCGA 4PDOA 5J8IA 3VVHA 3ORLA 3A60A 5EQYA 2YLFA 2XM9A 4QMLA 1GOLA 2ITNA 3QCYA 3AC5A 3NYXA 2BFXA 2XK9A 1F3MC 2R4BA 4YURA 3NW5A 4J8NA 2V0DA 5CAPA 3CE3A 4QNYA 5KX8A 4C62A 5CENA 5B2LA 2XK4A 2OO8X 5CEOA 3DKOA 4XV2A 3I81A 3DU8A 2I0YA 3UO6A 1CMKE 3LFEA 3NAYA 4B6LA 1NVRA 2C3JA 4NW5A 4KB8A 4PRJA 1TKIA 3P08A 5CTPA 1XH5A 3F6XA 4YSMA 3UQCA 4JQEA 3Q6UA 1URCA 2X81A 1PYEA 3PYYA 3N4UA 4TWCA 4CKRA 4LMNA 3MH2A 3SOAA 4FL1A 2W99B 4JJRA 3K3JA 2RIOA 4FVQA 4YLLA 4F09A 2IVVA 4JBVA 3SVVA 4JOAA 4ASZA 2R3GA 4AA0A 3CD3A 1ZY5A 1W98A 3FZOA 2R3HA 1CM8A 4D4YA 4B99A 4EOQA 5M4UA 4QMNA 4YC6A 3W32A 2F9GA 3LMIA 3BLQA 5AJQA 2XIRA 4ASEA 2A19B 3VW6A 5IISA 3UPXA 4BCKA 3LFSA 3PE2A 5KCVA 3QQKA 2R3IA 3F88A 5J7HA 3LAUA 3NRMA 3E8DA 3KA0A 3U54A 4XLIA 2QKWB 4UXLA 3AOXA 3KXNA 4ZEGA 2VWYA 4ZSAA 5KMJA 4EWQA 4FIEA 5GZAA 4E6DA 3LXKA 3M42A 4CNHA 3U4UA 2JEDA 3KRRA 3QX4A 5LMKA 4ORKA 4JDJA 4EUTA 3CGFA 4M69A 4NU1A 4GJ3A 1UWJA 2QOBA 3NUUA 4L8MA 4RJ5A 3HEGA 5CYIA 4E5WA 4H05A 3QUDA 2CKPA 4Y83A 2C1BA 3ZUUA 5IEYA 3AGMA 4RQKA 3RK9A 3AMAA 4D2RA 4XRLA 5E91A 4UMRA 2HENA 5D12A 2CNUA 1R39A 3QKLA 3UIUA 2GNFA 2UW3A 3G0EA 1OI9A 4JX7A 4WKQA 5HEZA 4PDSA 3VNTA 4I1ZA 4KAOA 4AX8A 5CSWA 1A9UA 1OL2A 3JY9A 3CR0A 4H3QA 4IACA 3TZ7A 5IZFA 4JXFA 3E3BX 4K11A 3KF7A 4GG7A 4O91A 3A4PA 4IQ6A 1H28A 5A3XA 4PV0A 4UX9A 4DTBA 3C9WA 3TI1A 3OTVA 4FSRA 4PTEA 4BIEA 5JRSA 2C3KA 2IZTA 4O6LA 1KE5A 1YXVA 4P4CA 3FI8A 4D2VA 3RZFA 3UQGA 1Q3DA 3OHTA 1UU7A 1KOAA 1OKZA 1Y8YA 3QD0A 4NWMA 5FRIA 2XIYA 4ANBA 4F7JA 4R7BA 4GIHA 2QO7A 3GB2A 4K6ZA 4FTQA 2VX0A 1IEPA 3BHVA 4IZ7A 2P3GX 4PL4A 1ND4A 3BE9A 1Q8TA 1WVXA 5CQUA 5DPVA 5EHOA 1G5SA 5FM2A 3PZHA 2UZWE 2X8EA 4FG7A 2O63A 1W7HA 5EYDA 2WD1A 2Z02A 4RC3A 4BWKA 3CPCA 2OWBA 3MVJA 4TL0A 2C5YA 3QAME 5JH6A 1JPAA 5HE0A 2HYYA 3G5DA 4X2KA 4LYNA 4R1VA 4BYIA 4EK4A 3M2WA 2BKZA 3DS6A 4YP8A 4ACGA 1KSWA 3PP1A 4JAIA 4AGDA 4EK5A 4NFNA 5TT7A 2RSVA 3WZDA 4F99A 1H1PA 1PMNA 2PVRA 5BQ0A 2UZBA 2OXDA 4A4LA 4OW8A 4CZUA 4AA5A 3EL7A 2GNJA 4PY1A 2PMNX 2JBOA 2PSQA 4I93A 3OROA 3VS5A 4I6QA 5HTBA 5IPJA 1MQ4A 3RMFA 5IKWA 4BDBA 2BRGA 1YDTE 3EQCA 2F2CB 1GZ8A 4OTIA 4QQJA 4R3RA 5DT3A 2VWXA 5K0XA 4CLIA 3FMHA 4O96A 3EOCA 4CFMA 5C26A 3ZS5A 3FY0A 4ZSGA 3KMUA 3O8UA 4D9UA 1B6CB 3DXNA 4DAWA 4BBMA 3DZQA 4DEEA 2GHLA 2WEIA 2ZAZA 4IX3A 3PLSA 3DXQA 4JIAA 3ORMA 5GNKA 4QMXA 4QO9A 5DFPA 3W18A 3UMWA 4FKWA 1M52A 4EOSA 3MBLA 1YDRE 4FT5A 3DK3A 3CSVA 3IOPA 5FUTA 4KWPA 5FEEA 2YCRA 1KE7A 4OAVB 4GK2A 3OP5A 3OWJA 3MIYA 5BVKA 4C59A 2QQ7A 4DCAA 2QNJA 1V0PA 1SM2A 4K9YA 4YJNA 5HHWA 4XBUA 2XNOA 3TDVA 4YZ9A 4MXYA 4MH7A 3ODYX 3PVWA 5J1VA 4XJ0A 3L1SA 3OG7A 3OWKA 4N70A 2GS7A 4JX3A 2Y6OA 4ACCA 4G31A 4C33A 2W17A 4FVPA 4X0MA 3RM6A 3RALA 4BCGA 4GMYA 4QP6A 5CSXA 3PJ1A 2BFYA 4L52A 4L46A 3FZPA 4DH5A 5CI7A 2YM8A 1O6YA 1T45A 2VTJA 4M67A 3O51A 4E8AA 5L2WA 1YWRA 3UOKA 2JAMA 4OBPA 3KQ7A 2Z2WA 3D5UA 3D9VA 5E8WA 2C0OA 2XJ0A 4R6VA 5HZNA 3VQHA 4ZS4A 5C8MA 3CKWA 3FY2A 4U6RA 5J1WA 3PXFA 4C36A 5DHJA 5JZJA 2WTKB 5DNRA 3E62A 4AXAA 3AC1A 1Y6AA 4O7VA 4HGLA 4IJPA 4BTMA 2W1GA 4YJQA 1DI8A 2C68A 4J99A 4P2KA 4XG9A 3S1HA 3QRKA 4EK6A 3OY3A 3LQ3A 4BFMA 4NIFA 4DGMA 1FBNA 2ZV9A 4QMTA 4PDYA 1OL7A 5LCJA 4F0FA 4WUAA 2GFCA 2A27A 1H1RA 2UW9A 4FYOA 3PA3A 4JI9A 4TY1A 4M97A 5HVYA 1L8TA 3UQFA 3G90X 4KIKB 4Z9LA 4EZ3A 5HIEA 1H1WA 5DN3A 2JDTA 4AW2A 4D5HA 3AC2A 3FZRA 4YBJA 3ZU7A 4NCTC 3BBTB 2CNVA 4H58A 4GVJA 2E9NA 4DEIA 3FL4A 3R71A 3P4KA 3H10A 4FZAB 4MHAA 3VS6A 4F1MA 4GFMA 3I0QA 3R28A 3JY0A 2HOGA 3LQ8A 4EH2A 3R01A 5AP7A 2YIQA 4HYHA 1CKIA 1EH4A 1WAKA 4USEA 5IQDA 4FBXA 2R3KA 4TWOA 2HWOA 3EFKA 4HGSA 3CY2A 5EOBA 4ZK5A 3TNPC 2ITZA 2C0TA 4C2WA 4HZSA 3V8SA 4CRSA 1YWNA 3GCVA 2QKRA 3CTHA 4GEOA 4QTCA 3UVRA 4YJTA 1IR3A 4L53A 3IG7A 4LRMA 5AR4A 3P7CA 2J7TA 4X2FA 3R9RA 2YACA 1JLUE 4EOKA 1XH8A 4YHFA 3S2PA 5L2IA 3LHJA 4GYGA 3S0OA 1IASA 4O2ZA 4EWHA 1Z9XA 2O3PA 1XHAA 3NYOA 4HNIA 4BI0A 4PDPA 5E1SA 3F5GA 1TQIA 2Q0BA 3BEAA 3O0GA 4C37A 2IVUA 4P7EA 3DQWA 4G3GA 3ORPA 2VAGA 3OXTA 2R5TA 3E8NA 3Q4ZA 1ZZ2A 2I6LA 4TYHA 4EQUA 3EKNA 4L7SA 3ZOSA 4IZYA 2YDKA 4NM3A 1PXIA 3OMVA 3QQLA 4QMOA 2JLDA 4DCEA 5HX6A 1ZYDA 1URWA 3LLAA 3EMGA 1UU3A 3SAYA 4EQCA 5JMSA 5C8KA 3KRLA 4MCVA 2VWIA 3CEKA 4FIGA 4JR3A 4AG8A 1H8FA 3QZIA 2VTNA 5FEDA 5HE3A 3TL8A 3KKVA 3KRJA 3UTOA 4EH4A 4EORA 3G6GA 3WYYA 2C5XA 5ETAA 1OL1A 3DKFA 4LI5A 1Q8ZA 5C27A 2W1IA 2PYWA 3R7YA 4BKYA 5BX0A 3R1QA 1IAJA 1OPKA 2HY0A 3K5UA 5EG3A 2FVDA 3NS9A 5AR5A 5CT0A 4CT1A 3D4QA 3Q32A 4IZAA 5DR6A 3R30A 3FL5A 3Q9XA 3W2OA 4IFGA 4KBKA 3S00A 4E5AX 2XF0A 5BVOA 3ET7A 3QLGA 4BL1A 1Y8GA 4GH2A 5DT4A 2YZAA 5J9ZA 4EKLA 5EM6A 2X2MA 5D10A 4II5A 3FXXA 2WTWA 4PL5A 4RJ7A 3SC1A 3ZMMA 3D2IA 2ESMA 1XH7A 2X8DA 4O6EA 3C5IA 4GIIA 3TKUA 5EK7A 4NUSA 3QZFA 3IPHA 3MTLA 2QHNA 3A8XA 3P5KA 5FGKA 4O0SA 2WQBA 5B2MA 1XH6A 3F2RA 4M3QA 4NFMA 2C6MA 1WVWA 4V05A 5C9CA 2C69A 1R1WA 3EN9A 2GNLA 3M1SA 2I0HA 4F9YA 1WCCA 4AP7A 1JKKA 4AOIA 1UU9A 4F0IA 3UE4A 5AP1A 3FJQE 2HY81 2W5AA 1S9IA 3Q2JA 5BVWA 4LOOA 3NSZA 5KE0A 4EJNA 2GQSA 4O2PA 5DH3A 3ZO3A 5ICPA 1AD5A 2QOLA 3GENA 3H4JA 3CY3A 3HV7A 3T3UA 3W16A 2FH9A 2J51A 3MS9A 4XH6A 4GKHA 5CVGA 4YPDA 3KU2A 3L8XA 5ANKA 3KREA 5AP6A 5AM6A 3DOGA 3ZFMA 5D9HA 4ANMA 4NKAA 3EHAA 3Q4UA 4CMOA 4FZ6A 3BZ3A 3CBLA 2XKFA 2QU6A 1B39A 4G3CA 5JQ5A 4S31A 5JRQA 2PY3A 2VO3A 4UWBA 3RAIA 2XS0A 5KMKA 2EVAA 4CTCA 2G2HA 2Y4IC 5FG8A 3ZYAA 4M0YA 2IZSA 5GZ9A 1UU8A 2R9SA 2W4KA 4I0TA 3MV5A 3DA6A 4BDIA 3NUSA 3K5VA 1SNUA 5M44A 3POZA 4MNEB 2WPAA 4G6LA 3O7LD 5HQ0A 3ORNA 4QPMA 3ZUTA 5JSMA 4HYIA 5FP6A 5DG5A 4DE4A 4L43A 3HAVA 3BE2A 2W5HA 3ZXZA 4J53A 4FGRA 5HNIX 3CGOA 5HTCA 4BGHA 4E4XA 2WIPA 4QRCA 4GRBA 4UMUA 3Q4CA 5AR7A 5JEBA 2GMXA 4R77A 3NUNA 1UKHA 4PP9A 5AP0A 3OCSA 4G34A 5LMKC 1YHSA 4D4RA 1IAHA 4YO4A 3H9OA 3KVXA 2QOKA 1RJBA 2I40A 5J87A 4XOZA 4E6AA 3BYVA 3MESA 3QQHA 4UV0A 4IB1A 5HESA 2YWPA 4FV5A 4HVIA 5E8VA 3H0ZA 4OTPA 3UO4A 4M7IA 4ZSLA 3R9NA 2QOFA 4MD9E 1PHKA 4Y95A 1FPUA 4O7YA 3VBWA 2J4ZA 4EZ7A 2BAJA 4WRGA 5L4QA 2BILB 5KMOA 4V04A 2BDFA 3QF9A 1W8CA 3FZTA 3LJ2A 4H1MA 3EYHA 3KGAA 2B9IA 4ZAUA 4AA4A 2EXEA 4IXPA 2VWVA 2XKCA 3GQIA 1J3HA 3HV3A 2Y6MA 3MPTA 4I0RA 4UWCA 5E7RA 4WSQA 2X4ZA 5L2SA 3MYGA 3LCOA 4JDIA 4X3JA 5M56A 3LLTA 2P2IA 4FSZA 5JT2A 5CVFA 2PVLA 4A06A 3KXXA 4O0XA 5DBXA 3L9NA 4MD7E 2CHLA 3V04A 3PIYA 3VUTA 2JDSA 5AUXA 5CAUA 2PULA 3O96A 5AR3A 4RIXA 3CC6A 2ONLA 2WTIA 3TDWA 2WOUA 2BZJA 4MVFA 1RE8A 4WOVA 3A7HA 5B0XA 1XO2B 2NRUA 4KS8A 4I24A 4FK6A 4N6ZA 4WBBB 3CKXA 3F3UA 3O7LB 5KHWA 2QO2A 5AP2A 3W10A 2WTDA 5AV3A 4L9IA 1LUFA 4QQTA 3PXRA 3TV7A 3W2RA 3AC8A 2YA9A 3UPZA 4RVLA 4LGGA 3FWQA 2YDIA 3A4OX 3BV2A 4QP8A 2VWBA 2R3MA 4AGWA 3RI1A 4K2RA 4AN2A 4RFMA 4HVHA 3L8SA 1M2PA 3OW3A 2X7FA 3KMMA 3PIXA 4MWHA 4ANQA 3Q60A 1H1QA 3CQEA 5M07A 4XUFA 4TWPA 2OH0E 4QQCA 4ZMFA 3GXLA 5HI2A 3PXZA 3GI3A 3ENMA 2XK8A 3QKMA 5A54A 2BR1A 3GP0A 4UMTA 1J7UA 2XIKA 3RK5A 3P9JA 3DCVA 4BCJA 1OZ1A 4KKEA 4FNYA 3PFQA 4EI4A 4FL3A 4J95A 4A07A 3EJ1A 2G01A 4IM0A 2FYSA 3DDQA 3W2CA 2ITXA 5AV0A 4HVGA 4FV0A 4WBOA 3QGWA 3OFMA 3QQGA 4AF3A 4CYIA 5L8KA 2YM4A 3UOJA 5EFQA 3EQIA 3QTWA 2WTCA 5IF1A 3ZLSA 2ZMDA 4YMJA 5JN2A 3KRWA 1Y91A 4MAOA 4YSJA 1REJA 4I6BA 4KRDA 3UG1A 1OIYA 2W1ZA 4DEBA 2JC6A 4W4WA 1DAWA 1IA9A 2VNWA 2WAJA 2WMWA 4O0VA 1NXKA 5EHYA 3CP9A 5HG7A 4HYSA 4EOPA 3MW1A 3QCSA 3LXNA 4YNOA 2QG7A 4O0UA 2W1DA 3E7VA 3R8MA 4EH8A 3AMBA 4BCPA 3OCTA 4U45A 1SZMA 2BPMA 2E9UA 2PHKA 4S34A 5EDRA 2GCDA 5I3OA 3MSSA 2OJGA 4HZRA 1BL6A 1P4OA 4ARKA 3GNIB 4YU2A 4U79A 3UGCA 4O21A 4NL0A 2QU5A 5IA3A 5J5TA 5KO1A 4A4XA 3IW7A 1BYGA 3ZLXA 4YHTA 4OTQA 3UJGA 3W33A 2DWBA 2QOQA 2QD9A 5AA8A 4L00A 4J71A 5IQEA 1ZXEA 2PVHA 3HKOA 3OWPA 3PTGA 4ZTNA 1HOWA 4PP7A 3PE1A 4ZTSA 2P2HA 2P33A 1NA7A 2CKEA 1VR2A 1ZYJA 3RPSA 3VBYA 4RA4A 1PF8A 3RWQA 4UMPA 5HD4A 1OGUA 3ZSIA 4DFXE 3TKHA 3SXFA 3GU6A 4IWOA 3D7TB 4YZCA 5L2QA 3PDTA 2Z7SA 4TTHB 5HO6A 1ATPE 2OK1A 5I9VA 2DUVA 3ANRA 3BWJA 3FXZA 5C4LA 3ZO2A 3VS4A 5A4QA 4DBNA 4E5BA 3NVMB 4Q5HA 1QPDA 3VS7A 3R21A 4CFNA 5LOHA 3UZRA 4Z3VA 3BLRA 2VRXA 2HXLA 3KB7A 3UO5A 3SD0A 5DIAA 3MFRA 5EW8A 2IW8A 4NT4A 4XG6A 4YTFA 3H9FA 2GHGA 2XM8A 4EYMA 3ETAA 4ONAA 3FSFA 3LW0A 2ZM4A 5TF9A 2QO9A 4H3PA 4FKQA 4TXCA 1JWHA 3NUAA 4ID7A 3IW4A 4J8MA 4FNXA 3EH9A 2XK3A 3EQDA 1NVQA 5DGZA 3U51A 3UVPA 3F5PA 3F7WA 3HMOA 5KZ0A 2OJJA 5IH4A 2XIZA 1F5QA 4FKLA 1ZWSA 5FXRA 2UZUE 5C1QB 2GQRA 3TUDA 2NPQA 1YOJA 3RGFA 1OIUA 3NZ0A 3RTPA 3W2SA 3GCUA 2QLUA 3HL7A 2UZOA 3ORTA 3W2QA 4A9SA 3OF0A 4MBJA 2F7ZE 3I1AA 2XYUA 5E92A 1X8BA 3R8VA 3IQ7A 4CG9A 4TYEA 1WMKA 2JFMA 3ZBFA 3DB8A 4CZYB 2OFVA 3WE4A 2XVDA 1ZMWA 4ZIMA 5E8UA 5BVEA 4EL9A 1FOTA 4GUBA 2PVKA 4RWJA 3A8WA 3ZDUA 4GJ2A 5GJGA 3BHHA 3NUPA 4YZNA 4DHFA 4ALVA 4C34A 3WYXA 3PJ8A 3LFNA 3QTZA 4R5YA 5AV1A 1P4FA 4QP1A 2UZVA 3F3VA 4L7FA 5CQWA 4BI2A 3UC3A 2FA2A 4C57A 3DAJA 3Q04A 1CKPA 5HICA 3QD2B 1H01A 4FTOA 4FEQA 4O7ZA 4W4YA 3CXWA 4FV4A 4C38A 1XJDA 3EKKA 4YLJA 4QPAA 5IQGA 5KBRA 1SNXA 4YJPA 4UN0C 2AC3A 5AUZA 5E8YA 3QCQA 2NRYA 4EEVA 4CT2A 3QCXA 4P5QA 2YITA 4AZWA 2REIA 3RAKA 4N4SA 2XRWA 1SYKA 3Q96A 3IK3A 2R3QA 4AZVA 2B9JA 4WNKA 5K5XA 1YOMA 3VW8A 4IVBA 4E26A 2EXMA 3BGZA 2PU8A 4YPSA 2DYLA 3D14A 1MP8A 2PUUA 3AD6A 3SGCA 3JPVA 3U8WA 3OBGA 4B4LA 3HA6A 5GHVA 4H3BA 2RG6A 3TNWA 4W8EA 5FLFA 4FKJA 3P1AA 5IQAA 4NM5A 4G9RA 3CIKA 4GK4A 4D1XA 3KULA 3UODA 1Q3WA 3DAKA 2HZIA 3CPBA 3MB6A 5IA4A 3FLWA 3IKAA 3H0YA 4FKRA 5KMMA 5EI6A 3OXZA 5M4IA 4DTAA 2XRUA 4HYUA 3SKCA 3HRCA 1I09A 2X8IA 4NK9A 5FBNC 4BDCA 2CGVA 4Z7GA 4RVTA 4DFLA 4L6QA 4C8BA 2VGOA 2JKKA 3BX5A 3D5WA 4FR4A 5J95A 4DINA 4IAAA 2KULA 3SW7A 3OOMA 5HLNA 1NT2A 3DLZA 4EUUA 3R04A 4K0YA 3UIBA 4MF0A 4Y85A 3SLSA 4I22A 3UNJA 4CV9A 4AOTA 3IECA 3EFLA 5DWRA 3BGPA 2PVFA 2QVSE 4YTCA 3LXPA 4YJOA 4BBEA 4PNIA 5AIRA 4I6HA 5AX9A 2CCIA 3FLQA 4LV5A 3TZMA 1Q97A 2V7AA 4ZTMA 3VC4A 4EOIA 5DRDA 2QI8A 3CTQA 3PY1A 4EHGA 4RJ4A 3ELJA 4FEWA 4MKCA 2I1MA 3MH1A 3R9DA 5JK3A 3C0GA 5ACBC 2HIWA 3U6JA 4QTDA 4BI1A 4FTRA 4EC8A 3AMYA 3TJDA 3EN6A 3R02A 2XB7A 3NNUA 4LGDA 4QD6A 5HVKA 2WU6A 4MQ2A 1GZKA 2BDWA 1H26A 4E6QA 3UVQA 5AWMA 5L8JA 4RX7A 2FSOX 3QRJA 3IONA 4QP2A 2GHMA 4WNPA 2YM3A 1KV1A 2QURA 2WXVA 4FKIA 2QLQA 2ETKA 3NX8A 3OC1A 4X6QC 3EIDA 3NAXA 3KY2A 3W8LA 4G3DA 2PMOX 4ASXA 2YIXA 3VAPA 4AE6A 3ITZA 4CCUA 3OT3A 4MXXA 4FIJA 1SVHA 1H25A 5J79A 3Q53A 4IM2A 5D7AA 4MBLA 2O65A 4JDHA 3MFSA 4MNEA 3OS3A 5CF4A 2CJMA 4IWQA 5GIOE 4KNBA 4Y5HA 3TZ8A 3Q52A 5A4TA 1JVPP 4ERKA 2XH5A 4ZLYA 2WMAA 1P2AA 5ANOA 5EQPA 4XYFA 3UBDA 5FTGA 1JKTA 1FINA 3MDYA 1ZZLA 3GU7A 3WILA 1PKGA 2W9ZB 5AP5A 3GOKA 2XP2A 4FEUA 2YM7A 4JL9A 3H3CA 4NEUA 5AUYA 3WIGA 4AW5A 2OF2A 3ORIA 4FUXA 1ZAOA 5B2KA 3NEWA 3QA8A 4GVAA 4C4IA 3QC9A 2WNTA 3HMIA 1ZMUA 2UW6A 2ONLC 3JYAA 3RNYA 4FL2A 1GIHA 5AM7A 2J9MA 3MI9A 4BZNA 3AD4A 4RX5A 2OXYA 2OI4X 3G51A 3RP9A 4HCUA 3HAMA 3SXSA 3F82A 4AWIA 3RPVA 4DH3A 4FE2A 5HLPA 2R3PA 3FI2A 3FKOA 1OM1A 3ANQA 4GCJA 3UZPA 4DYMA 5HNGA 2F7XE 4G2FA 3FC1X 1Q24A 3BHTA 3OOGA 3PJ2A 4G3EA 4IJ9A 5CU4A 2WELA 3Q4TA 3P23A 1WVYA 3WE8A 3AXWA 3NDMA 3NUXA 5EYCA 4FSWA 4DH1A 4FZFB 3VO3A 3F2NA 4BCQA 3EYGA 3F3TA 3LXLA 5AMNA 4YZDA 3TTIA 4YUQA 4BCMA 5IUHA 3WI6A 3NLBA 2UZNA 3QTIA 5JFWA 3W8QA 3U4WA 2QOHA 5AAGA 5CALA 5DR2A 5BUEA 5GIPE 4AW1A 3N51A 4Y46A 1J7LA 4M13A 4K1BA 3T3VA 4QPSA 4FKGA 2ZB1A 4XG4A 2WZJA 4ZXTA 3QQFA 3LCTA 4TYGA 5DMZA 4RX9A 4U5JA 4A4OA 4O0TA 4LRJA 3D2KA 3QU0A 1KE6A 3F69A 4PTGA 2OIDA 3NYNA 4AW0A 4ANOA 2C1AA 1W84A 2GNGA 5CU2A 5CXZA 2EWAA 2UZDA 3AT3A 5FXQA 3K2LA 2VTTA 4H39A 1P14A 3IDBA 3BWFA 3QZGA 2J50A 2P4IA 3DTWA 3LFFA 1XQZA 2AYPA 2J0IA 3D5VA 3KK8A 3MN3A 4WT6A 3RPOA 4I23A 3LFQA 2CNQA 5AR8A 3SQQA 4U7ZA 2WEVA 2UVZA 1IRKA 3ALNA 5CI6A 4RQVA 4QMMA 4JRNA 1Q99A 1M7QA 2I0VA 2X4FA 4RJ6A 1Q8UA 4FV7A 4Q5EA 1YI3A 4FT7A 5LXMA 4LUDA 3A99A 4HPUE 4PUZA 2VTAA 3F3ZA 3ORKA 4RWIA 4RWKA 1PMVA 4O0RA 3PXQA 1RW8A 2BRHA 3HRBA 3LPBA 2QOIA 4XP0A 4FV6A 3HYHA 5AUVA 5EKOA 4QMWA 4ZZMA 4FG8A 4KD1A 2O64A 4MXCA 2VZ6A 4RIYB 5KKRB 1MRYA 1PKDA 4XLVA 5HVJA 1JSUA 3F5UA 2OXXA 3EQHA 4F9AA 3SDJA 4YLKA 2HWPA 3KXZA 2BRBA 3HA8A 4XV1A 3FI4A 3NIEA 3FMLA 3VHKA 5JQ8A 2JITA 5C8NA 2FSMX 3H30A 3C0HA 3O8PA 3MY1A 2W05A 4QMQA 2VTQA 3UDBA 3WARA 3HGKA 3F61A 2RF9A 4UY9A 4BF2A 1JOWB 3SRVB 4DGLC 1Q8YA 2VN9A 1YQJA 3CJFA 3NCZA 3E63A 1SVGA 3VN9A 4AT5A 4LUEA 5BPYA 3WF5A 2OZAB 2Y0AA 4W4XA 2CGWA 2VX3A 3SX9A 3CTJA 3UYSA 3EWHA 4IC8A 2XNPA 3WBLA 3GFWA 3FV8A 4I4FA 2VTSA 3R9HA 5HBJA 4IC7A 3C13A 2OKRA 3FXWA 4L3PA 3C4WA 3AQVA 1VEBA 4NTTA 1UNLA 5A6NA 4GU6A 4NZWB 3D5XA 3FMDA 4F1TA 2J90A 5LCKA 3FLSA 2WFYA 1OKWA 4AZTA 4EONA 4IB3A 5IUIA 5AV4A 3Q5IA 3RAHA 3OXIA 3HX4A 5ANJA 2OJ9A 5FQDC 2Y7JA 2Q83A 4HCTA 4DEGA 3NR9A 2JFLA 2C6EA 5AV2A 4ERWA 2W1HA 3ALOA 3F66A 2BKKA 1ZLTA 3IW8A 1ERKA 4O27B 4EJ7A 1E1VA 4DC2A 4FUYA 4GL9A 4B0GA 4CFFA 4O0WA 2O5KA 2WMRA 1AGWA 2RL5A 4JIKA 4KUJA 4R3CA 2VWZA 4RIWB 3OD6X 4BCIA 3AC4A 2CPKE 4EHVA 4IIRA 5IEVA 3I6UA 3IDPA 1OIQA 5E8TA 1V0BA 3L9LA 5FWKK 1PXJA 2PVYA 4EK8A 4DFNA 5IUGA 1XWSA 3MY0A 4BTKA 3WOWA 4D0WA 4AN9A 4FF8A 5A4LA 4M68A 2BAQA 4HGTA 2QODA 5A14A 2ZMCA 5HU3A 4Q9ZA 2R0IA 1IA8A 3DXPA 4B9DA 5DVRA 5F95A 4PMPA 4G16A 4D5KA 4NYEA 4D58A 4IX4A 3O71A 2EB2A 3O2MA 5CAQA 3RPYA 4L44A 3ZUVA 4FMQA 2ERKA 3EQPA 1O6KA 2RFNA 3V5WA 4YC3A 3KF4A 4PF4A 1XH4A 4ZSJA 2YCFA 4F64A 4FV3A 4KBCA 4LOPA 3R8LA 1QPEA 3OBJA 3O23A 4FSTA 5CZIA 3NPCA 2C5VA 3ZEWA 4E20A 5EW3A 2XCHA 3VBTA 4DG2E 2JDRA 3SG9A 2XKDA 4BIBA 1Q62A 4RJ3A 4S32A 4JBOA 2VNYA 2QONA 3QHWA 2E2BA 2IZRA 5DA3A 3COHA 4F9WA 4PPCA 5I9UA 3U9CA 3NUYA 3PPKA 5M53A 4R78A 1STCE 4JNWA 2XNBA 4LOQA 2G2FA 4RG0A 4U42A 4ZJJA 1U59A 3PG1A 2HK5A 3FPMA 4XP2A 1U54A 4HVDA 3R1NA 3NMUF 1WBNA 4WUNA 1APME 2OW3A 4FV1A 2YCQA 1UV5A 5L2TA 3RK7A 2XYNA 3GC7A 3ACKA 3QD4A 4FKOA 5GJFA 2X39A 3GQLA 5LWNA 2OFUA 3HDNA 4APPA 4EQMA 5HORA 1U46A 2PMLX 1JKLA 2VUWA 4IDVA 4CFWA 3OTUA 2YJSA 3VS0A 3RWPA 3JR1A 5EYKA 4OTHA 3RM7A 4QT1A 5CU6A 4M69B 1XBBA 3FMJA 3QL8A 4FT3A 5E4HA 1PW2A 5BYYA 4FVRA 1JSVA 2QC6A 4FEVA 2OBJA 5AX3A 4TZRA 4Y72A 2P55A 4NH1A 2IN6A 4TT7A 2UW4A 3RAWA 3JVRA 4EOLA 3TJCA 3S3IA 5BMSA 4KRCA 1NY3A 3DTCA 3FLNC 3DK6A 4FOCA 4HJOA 4ZMEA 4YZMA 3B8RA 3PUPA 4IAYA 4JS8A 4W4VA 5ETIA 4EC9A 5DE2A 5H8BA 3A62A 1PXPA 4S30A 1ZYCA 2XNEA 3UG2A 1OUKA 3AC3A 4QMUA 4QYFA 5AIKA 5ANGA 4CEGA 4ITHA 3VBVA 4LV8A 3VUIA 2XK6A 2BRMA 2YZLA 2Z7LA 3OUKA 5IU2A 1YI4A 2YCSA 1OVEA 1KWPA 4D9TA 4BY9E 4LG4A 1PJKA 4LM5A 3T8OA 4PNKA 3G9NA 3D7ZA 1UWHA 3DJ6A 5HU9A 5HG9A 1ZOEA 2RKUA 1UA2A 1OMWA 3C51A 4E73A 3TNHA 4ZJVA 5CEPA 5IEXA 3TKIA 2W9FB 3DJ5A 5EI2A 4XV3A 1W0XC 2A4LA 3P7AA 5I5ZA 3ORZA 2X6DA 3I5NA 3FMEA 4CRLA 1Q4LA 1QMZA 2XA4A 3FPQA 3ZM9A 3P78A 5FBOA 5EDPA 4M12A 3S95A 3CLYA 1OBDA 2J5FA 2W1CA 2ZOQA 4ALWA 5CANA 3O17A 3BYSA 3DV3A 3MIAA 3ZSGA 5M57A 4ZTLA 1QL6A 3R83A 3GT8A 3FI3A 4BDEA 4RFZA 4ACMA 4FIIA 5LVNA 4CMTA 3VWAA 2NO3A 5I9XA 5JFXA 4OTWA 4QTBA 3MB7A 3FLZA 1GAGA 3AD5A 3E8EA 2C5NA 2R3LA 3R7IA 4Y73A 1PXLA 3Q9ZA 3E5AA 3RPRA 3VUHA 5M51A 3BKBA 4OR5A 4JLCA 4O7LA 3NNWA 4RT7A 4OT6A 5BVFA 4ZS0A 3PA4A 2WQMA 4NM0A 3BCEA 4YJVA 3F2AA 3WIKA 5IA2A 3P79A 3BQRA 4XG7A 4AQCA 4DFUA 2GTMA 4Y8DA 1K2PA 1GIJA 5CEMA 4GT3A 4HPTE 5EOLA 4QMVA 3DLSA 4EOJA 4ASDA 3SHEA 4BHNA 4EH5A 2IZUA 2YFXA 4XMOA 2BIKB 3O50A 1H07A 4QTEA 1WZYA 4MYGA 4GG5A 5CVHA 4BZDA 2R3RA 3LOKA 2FO0A 3DKGA 4RFYA 4RMZA 5FXSA 4DT9A 4UALA 3TV6A 4GV1A 3EZVA 4CFXA 4USFA 5AUTA 2B9FA 4RGJA 4RJ8A 4AFEA 4DITA 5IDPA 4QP4A 4QMZA 2B55A 2E9OA 3FQSA 1L3RE 1LEWA 4HW7A 4QP3A 5I9ZA 4RX8A 4O7SA 4EH6A 4YO6A 2I7QA 2FSLX 3HUCA 3P7BA 2CKQA 2X2KA 3LMHA 4F70A 4FKVA 1G8AA 3ZRMA 4C3RA 3PLAE 4EHZA 2V62A 2HELA 2UV2A 4QNAA 4HNFA 3V3VA 3JXWA 4E4MA 4IH8A 4BZOA 1M17A 2DQ7X 5T68A 4BC6A 4UEUA 2VTPA 2QR7A 3R8ZA 3VRZA 4DFBA 3BBWA 5BNJA 4N6YA 2Z8CA 2WQEA 2B1PA 5LVMA 2XCKA 4PPAA 3DAEA 4QP7A 4ZTRA 3ZC6A 4PX6A 5IQCA 3FAAA 4RPVA 3TIZA 4XG3A 4U0IA 2H6DA 3W2PA 4DFYA 3OVVA 3VS3A 4BVUA 5DOSA 4JG8A 4X2JA 3DJ7A 5BVNA 1CKJA 4JT3A 2W7XA 1U5RA 4M0ZA 3R7VA 5HBHA 2WQOA 4C58A 5EKNA 1B38A 4U97A 3SXRA 4X3FB 4C35A 3FYKX 2F2UA 4BDAA 2O8YA 4AU8A 3TN8A 4DGOA 4FTLA 3PZEA 3QC4A 1OBGA 1Y57A 2ITOA 1E9HA 3TT0A 5K0KA 5KBQA 5L8LA 2BTRA 3KK9A 2ITWA 5FP5A 5L3AA 2R7IA 2JKQA 3E8CA 2XUUA 2R7BA 4YTHA 5IA0A 3DNEA 3L9PA 4WNOA 3VRYA 3F5XA 4IDTA 1T46A 1ZYLA 2EUFB 4X21A 5H8GA 4CQGA 4CSVA 5IA5A 4DG0E 4ZOGA 2VO7A 2IW9A 3DBFA 4G6NA 4XHKB 5FDPA 2UW7A 2A0CX 3ACJA 4R1YA 3RCJA 3OEFX 2XNMA 4I3ZA 4MX9A 3LJ1A 4WHZA 3FYJX 3VUGA 1XBAA 4D1SA 5EH0A 3IO7A 2JD5A 4TNDA 4FKPA 1P5EA 2B54A 3GBZA 3QYWA 5D7VA 4AZSA 3CD8A 1KUTA 4L67A 3MWUA 2CN8A 2FB8A 3OEZA 2HXQA 4AOJA 4DTKA 4O82A 2PZPA 3A61A 5HG5A 1QPJA 3BI6A 3COKA 2WHBA 5CY3A 3ZCLA 4JBQA 2CMWA 3MA6A 1H4LA 2GS6A 5G6VA 3ZDIA 2ITTA 2XMYA 5M4CA 4I94A 3Q9WA 4UB7A 3MPMA 4I5HA 3BYMA 3COMA 4TYHB 4D1ZA 5HIDA 1LEZA 2C4GA 3LKMA 3R00A 5IQFA 4OTRA 4R7IA 4ZY5A 2ZV8A 5LMBA 4IWDA 3HRFA 4TPTA 1QPCA 2ZJWA 3BIZA 2CN5A 2RGPA 3EZRA 4D2TA 2OZOA 2YIYA 2C6DA 3AT4A 3AG9A 3FDNA 5BUIA 1M2QA 1Q41A 4KKGA 3MH0A 4Z7HA 2PZIA 4IAZA 5DEWA 2CKOA 3B2TA 3TEIA 1RQQA 2ITUA 3TZ9A 3CJGA 5HO7A 5JGAA 3QTRA 4WSYA 4RVKA 3Q6WA 4EYJA 3FQHA 4KIKA 5C4KA 3ZH8A 3QXOA 2JGZA 2OF4A 2UW8A 3DBDA 2PVMA 3UC4A 2F49A 1Q61A 3QTSA 1A48A 5A4CA 3KVWA 4O7RA 1CSNA 4FSQA 3BV3A 3NIZA 3PSCA 4IZ5A 5IMXA 4FIFA 3P86A 3PY0A 3GU8A 3Q2MA 3GCQA 4DLJA 4F6SA 1OPJA 3MJ2A 2AC5A 2GS2A 5ACKA 2ETRA 4KIOA 4O83A 1MQBA 2YAAA 3N9XA 5I3RA 3GOPA 3OY1A 5D1JA 2YJRA 5K4JA 4BDFA 3U55A 1RDQE 2CDZA 3G9LX 4FG9A 1NVSA 4L3JA 4CKIA 3DDPA 3KFAA 2CCHA 4CFVA 4FKTA 4AACA 3WF8A 3BHYA 3QHRA 1YW2A 5CS6A 4FI1A 3D15A 5CU3A 4BCNA 2WOTA 3KC3A 4FZDB 4W8DA 4EOMA 2I0EA 3BU5A 4GYIA 3C4EA 3NVKI 2YN8A 5HCZA 5AR2A 3UOLA 1GIIA 4V01A 4FNWA 4J96A 4K8AA 4APCA 2PVJA 4LMUA 4I5MA 4BGQA 1J7IA 3C4CA 5H3QA 1ZMVA 1BI8A 1QCFA 2EU9A 4RIWA 2G9XA 2BZKB 2ITVA 3MJ1A 4DBXA 4GK3A 4A9UA 3OUNB 3C4XA 3DBQA 4TYJA 5E8SA 4YGAA 4FKUA 3FC2A 1R0PA 1TQMA 2XEZA 4RZVA 4R8QA 4FODA 2BVAA 2UZTA 2JIVA 4WO5A 4MEDA 4OUCA 5IA1A 3D83A 1J1BA 3IGGA 4EHEA 1OL6A 3Q3BA 1PXMA 4M8TA 3ZZEA 4FTJA 5A46A 3FMMA 2R3OA 3N4TA 4YJUA 2YM6A 5AAEA 3BQCA 2WMVA 3LM0A 3IW5A 1CTPE 4O0YA 3UP2A 1YOLA 3T9TA 5IH6A 5LVOA 4X6RA 2IJMA 3RNIA 2B9HA 3TUCA 2J0LA 5FD2A 4O86A 5L6OA 5IQHA 4RA5A 3JVSA 4FK3A 1GJOA 4JG7A 4BDDA 4EBWA 4Z16A 1U4DA 2YDJA 3DT1A 4AUAA 3LVPA 3TWJA 5HNBA 2OJFE 4ZLZA 3RBWA 2V7OA 2QOCA 1YRPA 3ZSHA 1WBTA 1BLXA 4AZFA 3C4ZA 1JNKA 5EYMA 3U87A 4YC8A 3ZFXA 4MBIA 5AEPA 4MTAA 3ZTXA 4JBPA 2J5EA 3VIDA 5IQIA 1GZNA 4FEXA 4U81A 3NCGA 3PA5A 1OITA 5K9IA 2Q0NA 3A7GA 3E87A 2OU7A 2WIHA 3IW6A 3OZ6A 2GFSA 5K5NA 1BUHA 3N4VA 3KEXA 4ANSA 4BRXA 4F1OA 2BDJA 3Q9YA 5FTQA 1PMUA 3O8TA 4H1JA 3FKLA 3V5PA 3KMWA 4MXAA 1CDKA 2JDOA 2O2UA 3BU3A 4G1WA 3H9RA 4O81A 3DZOA 2Y4PA 3MTFA 2VU3A 2C6KA 3KXHA 3M11A 2CLXA 2WMUA 3MVLA 1MRUA 4DGGA 2UUEA 5CLPA 2BRNA 3ATSA 2X6EA 3NW7A 3V6SA 4BDJA 3TACA 4QYYA 1DAYA 4QQ5A 5I9WA 4FT0A 5KHXA 2WGJA 4O22A 4FTNA 4RIXB 5F1ZA 2VO0A 5H2UA 2WB8A 1VYZA 2HW6A 3QRUA 4FT9A 4U41A 3WZJA 1XKKA 3CQWA 2C3LA 3QD3A 2UVXA 1TQPA 2W96B 4AGCA 3EB0A 4EOOA 5HTIA 5IH5A 2W5BA 2GPHA 4R5SA 1PYXA 4PMMA 4B8MA 2Y8OA 4KSQA 3FMKA 5GJDA 4EH9A 4V0GB 4K18A 5HGIA 4ZZNA 4FTUA 3TUBA 3BELA 4H36A 2JDVA 4QOXA 5HE1A 3TTJA 4RVMA 5KNJA 3ID6C 3OCBA 5FEQA 3KL8A 5KZIA 2QCSA 3LE6A 3I0OA 3C7QA 2OIQA 3GC9A 3LZBA 3SV0A 3FZSA 3WZEA 1FGKA 2A1AB 4I20A 4QP9A 3LFCA 2R3JA 3RHXA 3VJOA 3HUBA 4DA5A 5HD7A 1KE9A 2ZDUA 3GCPA 4RRVA 1J1CA 3LIJA 3DBCA 1YVJA 3B8QA 5LWMA 3GEQA 3D94A 4I21A 2CSNA 4D0XA 3E88A 4IB0A 4TNBA 2W4JA 2YISA 3BLHA 4R3PA 2ZYBA 3QQUA 5ETCA 1UNHA 4CMUA 3BRBA 2LGCA 5BYLA 5AAFA 2HCKA 4ITJA 3NWWA 3GFEA 1XBCA 4AFJA 3F9NA 4I5CA 5TO8A 2DS1A 3FE3A 4QMSA 4J52A 3I5ZA 4BCFA 4DH8A 3DFCB 2NP8A 2YLEA 1WBWA 3NGAA 4KA3A 4BDGA 4J98A 3MPAA 2JKMA 2PE2A 3VF9A 1O9UA 2WQNA 5JFVA 5G1XA 2W06A 4UMQA 2IO6A 3R1YA 4IADA 4MWIA 1YKRA 2OGVA 3L8PA 3C50A 3LM5A 1YWVA 3NYVA 4U40A 4BICA 5LJJA 4FA2A 1OB3A 5EM8A 3VHEA 1SVEA 4U43A
chains in the Genus database with same CATH superfamily
4O84A 4PPBA 5HKMA 5EM7A 4DN5A 4GT5A 3C4FA 4GW8A 1DM2A 2C5OA 5EHLA 2RFDA 4U3ZA 3UIXA 2X1NA 4C0TA 3HMPA 2UVYA 3PRIA 3V8WA 1WBSA 4WRSA 4BGGA 5JGBA 4NJ3A 1ST4A 4D4VA 4QTAA 2RG5A 3CCNA 2IWIA 3R73A 1A06A 5BMMA 4D4SA 3QX2A 3ZRLA 3PRFA 4C61A 5M08A 1Y6BA 5HBEA 4J97A 4E1ZA 1MRVA 2YIWA 2G1TA 4F63A 5D11A 4FNZA 5CNNA 4BDKA 3MGYA 2RFEA 3VUKA 2JAVA 1FVTA 3PWYA 3QZHA 1H0WA 4RSSA 5LARA 3V8TA 2CGXA 1Q8WA 3VUMA 2PE1A 2VWUA 3R8UA 2PVNA 2FSTX 3QGYA 4EBVA 4KSPA 4AE9A 4RLLA 4U3YA 4G6OA 4OTGA 4P5ZA 4IAFA 3THBA 4ZP5A 5BYZA 2H96A 4FTCA 4GUEA 3E93A 3Q5ZA 4NKSA 2WU7A 4RIOA 4DH7A 3COIA 3UNKA 3I6WA 1OIRA 2C3IB 2XJ2A 4YTIA 5E9EA 3VBXA 4DHIB 2BUJA 3FZ1A 4A9TA 3VBQA 1GZOA 3FSKA 4FSUA 5M09A 2PMIA 2IF8A 4W9XA 1BL7A 3G2FA 4CXAA 4FOBA 3AGLA 2GNIA 3I7BA 4CVAA 2VTHA 3I4BA 5KMNA 1YI6A 3W1FA 5EDQA 3TNQB 5AADA 3ZC5A 4O1PA 4U8ZA 4QYEA 3LFDA 5CAVA 2BCJA 3QWJA 2XEYA 4YHJA 2UW0A 4WNMA 3C1XA 3WZKA 5BVDA 1F0QA 4EKKA 4IW0A 2X0GA 4C4HA 4WIHA 3FBVA 3ZO4A 4MK0A 3NNXA 4X3FA 4XBRA 3RINA 3TV4A 4F6UA 4FV8A 2EB3A 3BL7A 4O7TA 5E1EA 4JRVA 4KIPA 3DBEA 4X2GA 4KBAA 3UNZA 5J7BA 4IVCA 3PIZA 4EK3A 4C02A 3UP7A 2H8HA 4CTBA 4IANA 2BALA 3HP5A 3ZFYA 2JKOA 3ZBXA 1NW1A 4JG6A 2BMCA 3HP2A 2PZRA 3LJ0A 2PUIA 3D7TA 4CD0A 2A98A 2VTIA 5CEKA 1KE8A 2C6OA 4C7TA 4ZTQA 2A2AA 2V5QA 2XBJA 4FZ7A 2WTKC 3WF9A 4U9AA 4IBMA 5T6KA 1PXOA 4AXDA 5EI8A 4I92A 2BZIB 5DT0A 3G0FA 5KKRC 1BI7A 3R7EA 4OTFA 5F9EA 2ETMA 3BU6A 3C5UA 3QRIA 4I41A 2FGIA 3LQ5A 3PVGA 4PWNA 3KCKA 5J9YA 4J1RA 3U9NA 3UYTA 2UZLA 4TYIA 1YXUA 2IVSA 3HZTA 2B0QA 4KKHA 4XG8A 5LMAA 2R0UA 3TG1A 5CAOA 4G5PA 4BWXA 4Q2AA 4DG3E 5HX8A 4JVGA 1BX6A 4BTJA 3HLLA 1UNGA 3R22A 3VS2A 4YR8A 3LMGA 3PVBA 4I5PA 4K77A 3BEGA 2YABA 5CSHA 4XP3A 4BDHA 2F7EE 4AT3A 4FICA 1VJYA 5IDNA 4RC4A 3CS9A 4IMYA 3BPRA 4F65A 2VD5A 3PSBA 4G5JA 2J6MA 4QMYA 4USDA 4GT4A 3V5LA 3BGQA 1FVVA 2H9VA 2WTJA 4TRLA 4E7WA 4F0GA 2BZHB 4J7BA 4BBFA 1LR4A 4N57A 3PVUA 4ZJIA 3A2CA 4RWLA 3B2WA 4E4NA 3S4QA 3KN5A 4IVAA 3KULB 3NNVA 2PUPA 3QBNA 3G33A 2JIIA 4D55A 4IEBA 5C03A 2RFSA 5TKDA 3TXOA 2HAKA 2XK7A 2VX1A 4G3FA 5JZNA 3V6RA 4ZY4A 3WZUA 2EXCX 5FM3A 4D28A 5DEYA 4B7TA 5AP3A 3TIYA 4WG4A 2Y4IB 2VTRA 4OBQA 2YAKA 4R7HA 3L9MA 1FGIA 2VTLA 3EFJA 5CWZA 5CZHA 2GSFA 3PY3A 2Z7QA 3LFAA 2BTSA 5CF8A 4IAKA 1ZOHA 4FTIA 1G8SA 3ULZA 2UW5A 3ZHPC 3E7OA 3GCSA 2B52A 4FTMA 3JS2A 3LCKA 3ZLWA 5CEIA 3EQGA 5E8ZA 1O6LA 3UIMA 1OKYA 4F7LA 4BR3A 2WMSA 4YJSA 1U5QA 3KIOC 2J2IB 2J0KA 3CQUA 3FUPA 3II5A 4M14A 1R78A 3ERKA 5CNOA 4C3FA 2W1FA 5T3QA 5IG1A 4AAAA 2VO6A 3HMNA 4FKSA 3RCDA 4KINA 3GC0A 4C4EA 4DT8A 2X9FA 3E92A 4FSYA 4BKZA 3U6HA 5FDXA 1FQ1B 4TW9A 3G15A 2SRCA 4GSBA 2ITPA 4BTFA 3U6IA 2F4JA 1G3NA 2WMXA 5TOZA 2GDOA 4CCBA 4NTSA 2XNNA 3QXPA 4O38A 3QUEA 1DS5A 1WBPA 2G15A 4UZDA 1GY3A 1ST0A 3F7ZA 4WD5A 1OPLA 2V55A 2W1EA 4YBKA 5DYJA 5GZ8A 5M4FA 5K4IA 4BKJA 1AQ1A 3ZO1A 4DEAA 4ENYA 1VLRA 1JBPE 2AUHA 3DY7A 2UZEA 5GINE 1R0EA 4AZEA 4TWNA 5CEQA 1UVRA 5F4NA 3K3IA 2R2PA 4M84A 4ZSEA 3RZBA 5LVPA 1WFCA 4GU9A 2XNGA 5HCXA 4BN1A 4F4PA 1DI9A 3SOCA 3A7FA 2YIRA 4PTCA 1KV2A 4ZTHA 3ZEPA 3FLYA 3UDTA 3EN7A 2C6IA 3VF8A 1YDSE 4S33A 2XBAA 5F94A 2J0MB 1OGYA 5EM5A 5EQEA 4QMPA 1JAMA 1PXKA 3NW6A 4XX9A 4Z55A 1FVRA 5CSVA 3DB6A 1V1KA 1YHWA 3PG3A 3HDMA 3TM0A 2WTVA 1H08A 4RLKA 5J9LA 3ENHA 2ZDTA 2BROA 2O0UA 3OWLA 5DR9A 3GU5A 3V5QA 1W82A 3POOA 4N0SA 2QG5A 4L42A 5TE0A 5CXHA 4ACHA 2R64A 4S2ZA 3LCSA 4FIHA 4A9RA 1WBVA 4KS7A 1TVOA 5E90A 4JQ8A 4PMTA 3DK7A 4DF3A 3QQJA 4UZHA 3ATTA 5AFVA 2B7AA 4F08A 4M15A 1J91A 3IGOA 2C6LA 5HG8A 4D2SA 4L68A 2ZVAA 4L45A 4IVDA 4UXQA 1S9JA 5ETFA 3PP0A 3TCPA 5HLWA 3HVCA 3MY5A 5ANDA 4IM3A 5BUJA 2BAKA 2WMBA 1R3CA 4K33A 5CSPA 4ITIA 3WF6A 2PK9A 1ZY4A 1HCLA 1KOBA 3F3WA 2ITQA 2X2LA 3DGKA 2W0JA 5B7VA 1FMKA 4CV8A 3GC8A 3QKKA 3OT8A 3PPJA 5JFSA 2VV9A 4EH7A 5M06A 2GNHA 3G6HA 4QYGA 4FV9A 4WG5A 3GUBA 4OGRA 5JGDA 3EFWA 4AN3A 2IG7A 3QRTA 4ZLOA 4B8LA 1OL5A 4BIDA 2PPQA 1MUOA 4BHZA 5H9BA 5HOAA 4F9BA 2WKMA 5I9YA 2E9VA 4DEDA 3VS1A 4XG2A 4WG3A 4C4FA 4UYAA 5CASA 3GGFA 2F57A 4LL0A 3FKNA 3L8VA 4P90A 1YXXA 4FTKA 2PTKA 4PL3A 3FHIA 5ANIA 4XV9A 4TN6A 2YERA 1Q5KA 1Z5MA 1OKVA 2VGPA 2X9EA 4G9CA 5L6WL 1BMKA 4I4EA 3QALE 3A7IA 2ZB0A 4V0GA 4I0SA 2R3NA 3EN5A 3QTQA 5IQBA 2ZV7A 3DQXA 3KXGA 3R7GA 2IVTA 3T9IA 4BWPA 2GTNA 3SA0A 5J5SA 2OICA 1WBOA 3RJCA 1IG1A 1REKA 4X2NA 3SW4A 3PJCA 3RKBA 2ITYA 2JBPA 1H0VA 4DLIA 3R1SA 2YM5A 5A4EA 4YNEA 5ANEA 4CYJA 3W55A 3LCDA 2BIYA 2OIBA 3BYUA 3KRXA 4JDKA 4AS0A 2YWVA 5HO8A 1K3AA 4W9WA 1M7NA 5A6OA 3QFVA 2X7GA 2KTYA 2W4OA 1OECA 4OT5A 4BCHA 4E93A 4EH3A 4L01A 1Z57A 3E3PA 4Y5QA 4FSMA 1W83A 4TKSA 3QLFA 2X7OA 3PXKA 3UOHA 3QUPA 2OJIA 5HCYA 3HV5A 4YZBA 3REPA 3I79A 4C4GA 2QR8A 3KXMA 4KABA 5KMIA 3HMMA 3R6XA 5CX9A 3KCFA 4MXZA 1SMHA 4XS2A 3V5JA 4ACDA 5KUPA 4LV7A 3QWKA 4CKJA 5C01A 4NIFB 3R9OA 3UMXA 5A9UA 3DKCA 4HOKA 4CG8A 4RZWA 2OLCA 2PE0A 3ZONA 2WMTA 4ZZOA 1VZOA 4D2PA 2R3FA 4MQ1A 2BHEA 3SG8A 3PXYA 4CQEA 4O7WA 4IHPA 2PL0A 4MXOA 4JQ7A 5LVLA 1K9AA 3EL8A 3RHKA 5LQFA 1H00A 1ZRZA 3R63A 2B53A 3IS5A 5AUUA 4OBOA 3PPZA 3LFBA 3FEGA 3EN4A 1UKIA 1PMEA 4ANLA 4CGAA 2WMQA 4O1OA 4AXCA 1JSTA 2JIUA 4IX5A 4A9YA 2XIXA 4E4LA 5D41A 1M14A 4HGEA 3R7UA 4XCUA 2PZ5A 4IE9A 4BJJB 2H34A 4NM7A 3MVMA 3D0EA 2NNWB 3QTXA 4GFGA 3HV6A 2HZ0A 2OG8A 4MD8E 2YHVA 2C47A 3GU4A 4MF1A 3JUHA 5AP4A 4BB4A 2C30A 2HZNA 4ENXA 5M55A 4ALUA 3R7OA 4A7CA 3ZLYA 2QHMA 4FYNA 4LL5A 4NSTA 5L6PA 1BKXA 3C0IA 2G2IA 4NW6A 3ZM4A 4F9CA 3FMNA 4PQNA 4BCOA 4BYJA 4FTAA 3PJ3A 4IX6A 3V51A 4FSNA 3V5TA 5AA9A 2PUNA 2PZYA 4NCTA 3R0TA 5AUWA 5DLSA 5HIBA 4C3PA 1OUYA 2C0IA 1YXTA 1JQHA 1H1SA 4DEHA 2CGUA 3EQBA 3R2BA 1JKSA 1YXSA 1GNGA 3MH3A 3QTUA 3AT2A 1I44A 4RBLA 2GQGA 2LAVA 3RVGA 2Z60A 5CT7A 4LQMA 4OLIA 3ULIA 4D2WA 2ZM3A 5ITAA 1ZOGA 3PSDA 4RIYA 5DRBA 4GFOA 4UBAA 2VTOA 4X3FC 5H8EA 3DFAA 4KIQA 3TNIA 3IDCA 3R2YA 4FTTA 4ZY6A 2ZM1A 1LPUA 2ERZE 1YHVA 4F7NA 1HCKA 1PRYA 2XKEA 4WA9A 2OH4A 3HNGA 2IPXA 2VWWA 2HW7A 1E1XA 3VULA 5CF5A 4NJDA 3BYOA 4XOYA 4CZTA 3WF7A 1M2RA 1FMOE 3FQEA 3HECA 4G17A 3ODZX 4FX3A 4XNEA 3QA0A 2P0CA 2QOOA 2IW6A 3OW4A 4CLJA 2XJ1A 3SRVA 2XZSA 3A7JA 2ACXA 4U44A 1PY5A 2C6TA 4U80A 4X7QA 3P0MA 4LFIA 5TR6A 3KN6A 4IFCA 4I6LA 3EQRA 3GVUA 5DI1A 2OZAA 4FC0A 3VQUA 4Q9SA 2OSCA 5E8XA 5CU0A 5FTOA 4C4JA 3E64A 3I7CA 4F7SA 4AT4A 4FGBA 5CF6A 4E6CA 4ANNA 3MFTA 3UZTA 4O7NA 5KMLA 4CFUA 3MFUA 3K54A 2J0JA 4IB5A 3UDZA 2VTMA 1LP4A 4XRJA 2B4SB 4QYHA 5EW9A 1XH9A 2V22A 1ZARA 1ZYSA 5K3YA 4C2VA 2HZ4A 3VUDA 2PWLA 5IMEA 3VJNA 3ZXTA 3BHUA 2GU8A 4OAUC 1VYWA 2BHHA 3ORXA 4M66A 5HE2A 5I0BA 1U54B 1V0OA 4LRKA 4JR7A 4YJRA 3PWDA 4JAJA 4IWPA 4GKIA 3ZRKA 4OTDA 3FHRA 4UYNA 3R8PA 2ZV2A 1XR1A 3HV4A 5I4NA 3EQFA 4GS6A 3I60A 4DFZE 2E9PA 4UWYA 2Z7RA 4I6FA 3IOKA 4AGUA 4F6WA 2FUMA 4LGHA 2Y9QA 3V01A 4XEYA 4E3CA 3ROCA 2CLQA 4IAIA 2WO6A 3DNDA 3QYZA 4DGNA 4L3LA 1H24A 3ZZWA 4HCVA 4EZ5A 5F20A 3ROYA 1PXNA 4FV2A 4RC2A 4HVSA 2YEXA 4MNFA 4PMSA 3MA3A 1H27A 5JKGA 3DPKA 3MVHA 3OCGA 4PDOA 5J8IA 3VVHA 3ORLA 3A60A 5EQYA 2YLFA 2XM9A 4QMLA 1GOLA 2ITNA 3QCYA 3AC5A 3NYXA 2BFXA 2XK9A 1F3MC 2R4BA 4YURA 3NW5A 4J8NA 2V0DA 5CAPA 3CE3A 4QNYA 5KX8A 4C62A 5CENA 5B2LA 2XK4A 2OO8X 5CEOA 3DKOA 4XV2A 3I81A 3DU8A 2I0YA 3UO6A 1CMKE 3LFEA 3NAYA 4B6LA 1NVRA 2C3JA 4NW5A 4KB8A 4PRJA 1TKIA 3P08A 5CTPA 1XH5A 3F6XA 4YSMA 3UQCA 4JQEA 3Q6UA 1URCA 2X81A 1PYEA 3PYYA 3N4UA 4TWCA 4CKRA 4LMNA 3MH2A 3SOAA 4FL1A 2W99B 4JJRA 3K3JA 2RIOA 4FVQA 4YLLA 4F09A 2IVVA 4JBVA 3SVVA 4JOAA 4ASZA 2R3GA 4AA0A 3CD3A 1ZY5A 1W98A 3FZOA 2R3HA 1CM8A 4D4YA 4B99A 4EOQA 5M4UA 4QMNA 4YC6A 3W32A 2F9GA 3LMIA 3BLQA 5AJQA 2XIRA 4ASEA 2A19B 3VW6A 5IISA 3UPXA 4BCKA 3LFSA 3PE2A 5KCVA 3QQKA 2R3IA 3F88A 5J7HA 3LAUA 3NRMA 3E8DA 3KA0A 3U54A 4XLIA 2QKWB 4UXLA 3AOXA 3KXNA 4O4DA 2VWYA 4ZEGA 4ZSAA 5KMJA 4EWQA 4FIEA 5GZAA 4E6DA 3LXKA 3M42A 4CNHA 3U4UA 2JEDA 3KRRA 3QX4A 5LMKA 4ORKA 4JDJA 4EUTA 3CGFA 4M69A 4NU1A 4GJ3A 1UWJA 2QOBA 3NUUA 4L8MA 4RJ5A 3HEGA 5CYIA 4E5WA 4H05A 3QUDA 2CKPA 4Y83A 2C1BA 3ZUUA 5IEYA 3AGMA 4RQKA 3RK9A 3AMAA 4D2RA 4XRLA 5E91A 4UMRA 2HENA 5D12A 2CNUA 1R39A 3QKLA 3UIUA 2GNFA 2UW3A 3G0EA 1OI9A 4JX7A 4WKQA 5HEZA 4PDSA 3VNTA 4I1ZA 4KAOA 4AX8A 3NFGB 5CSWA 1A9UA 1OL2A 3JY9A 3CR0A 4H3QA 4IACA 3TZ7A 5IZFA 4JXFA 3E3BX 4K11A 3KF7A 4GG7A 4O91A 3A4PA 4IQ6A 1H28A 5A3XA 4PV0A 4UX9A 4DTBA 3C9WA 3TI1A 3OTVA 4FSRA 4PTEA 4BIEA 5JRSA 2C3KA 2IZTA 4O6LA 1KE5A 1YXVA 4P4CA 3FI8A 4D2VA 3RZFA 3UQGA 1Q3DA 3OHTA 1UU7A 1KOAA 1OKZA 1Y8YA 3QD0A 4NWMA 5FRIA 2XIYA 4ANBA 4F7JA 4R7BA 4GIHA 2QO7A 3GB2A 4K6ZA 4FTQA 2VX0A 1IEPA 3BHVA 4IZ7A 2P3GX 4PL4A 1ND4A 3BE9A 1Q8TA 1WVXA 5CQUA 5DPVA 5EHOA 1G5SA 5FM2A 3PZHA 2UZWE 2X8EA 4FG7A 2O63A 1W7HA 5EYDA 2WD1A 2Z02A 4RC3A 4BWKA 3CPCA 2OWBA 3MVJA 4TL0A 2C5YA 3QAME 5JH6A 1JPAA 5HE0A 2HYYA 3G5DA 4X2KA 3VONA 4LYNA 4R1VA 4BYIA 4EK4A 3M2WA 2BKZA 3DS6A 4YP8A 4ACGA 1KSWA 3PP1A 4JAIA 4AGDA 4EK5A 4NFNA 5TT7A 2RSVA 3WZDA 4F99A 1H1PA 1PMNA 2PVRA 5BQ0A 2UZBA 2OXDA 4A4LA 4OW8A 4CZUA 4AA5A 3EL7A 2GNJA 4PY1A 2PMNX 2JBOA 2PSQA 4I93A 3OROA 3VS5A 4I6QA 5HTBA 5IPJA 1MQ4A 3RMFA 5IKWA 4BDBA 2BRGA 1YDTE 3EQCA 2F2CB 1GZ8A 4OTIA 4QQJA 4R3RA 5DT3A 2VWXA 5K0XA 4CLIA 3FMHA 4O96A 3EOCA 4CFMA 5C26A 3ZS5A 3FY0A 4ZSGA 3KMUA 3O8UA 4D9UA 1B6CB 3DXNA 4DAWA 4BBMA 3DZQA 4DEEA 2GHLA 2WEIA 2ZAZA 4IX3A 3PLSA 3DXQA 4JIAA 3ORMA 5GNKA 4QMXA 4QO9A 5DFPA 3W18A 3UMWA 4FKWA 1M52A 4EOSA 3MBLA 1YDRE 4FT5A 3DK3A 3CSVA 3IOPA 5FUTA 4KWPA 5FEEA 2YCRA 1KE7A 4OAVB 4GK2A 3OP5A 3OWJA 3MIYA 5BVKA 4C59A 2QQ7A 4DCAA 2QNJA 1V0PA 1SM2A 4K9YA 4YJNA 5HHWA 4XBUA 2XNOA 3TDVA 4YZ9A 4MXYA 4MH7A 3ODYX 3PVWA 5J1VA 4XJ0A 3L1SA 3OG7A 3OWKA 4N70A 2GS7A 4JX3A 2Y6OA 4ACCA 4G31A 4C33A 2W17A 4FVPA 4X0MA 3RM6A 3RALA 4BCGA 4GMYA 4QP6A 5CSXA 3PJ1A 2BFYA 4L52A 4L46A 3FZPA 4DH5A 5CI7A 2YM8A 1O6YA 1T45A 2VTJA 4M67A 3O51A 4E8AA 5L2WA 1YWRA 3UOKA 2JAMA 4OBPA 3KQ7A 2Z2WA 3D5UA 3D9VA 5E8WA 2C0OA 2XJ0A 4R6VA 5HZNA 3VQHA 4AQKA 4ZS4A 5C8MA 3CKWA 3FY2A 4U6RA 5J1WA 3PXFA 4C36A 4QDEA 5DHJA 5JZJA 2WTKB 5DNRA 3E62A 4AXAA 3AC1A 1Y6AA 4O7VA 4HGLA 4IJPA 4BTMA 2W1GA 4YJQA 1DI8A 4AXEA 2C68A 4J99A 4P2KA 4XG9A 3S1HA 1TFFA 3QRKA 4EK6A 3OY3A 3LQ3A 4BFMA 4NIFA 4DGMA 1FBNA 2ZV9A 4QMTA 4PDYA 1OL7A 5LCJA 4F0FA 4WUAA 2GFCA 2A27A 1H1RA 2UW9A 4FYOA 3PA3A 4JI9A 4TY1A 4M97A 5HVYA 1L8TA 3UQFA 3G90X 4KIKB 4Z9LA 4EZ3A 5HIEA 3W0NA 1H1WA 5DN3A 2JDTA 4AW2A 4D5HA 3AC2A 3FZRA 4YBJA 3ZU7A 4NCTC 3BBTB 2CNVA 4H58A 4GVJA 2E9NA 4DEIA 1XMMA 3FL4A 3R71A 3P4KA 3H10A 4FZAB 4MHAA 3VS6A 4F1MA 4GFMA 3I0QA 3R28A 3JY0A 2HOGA 3LQ8A 4EH2A 3R01A 5AP7A 2X0QA 2YIQA 1CKIA 1EH4A 1WAKA 4HYHA 4USEA 5IQDA 4FBXA 2R3KA 4TWOA 4DHJA 2HWOA 3EFKA 4HGSA 3CY2A 5EOBA 4ZK5A 3TNPC 2ITZA 3BL9A 2C0TA 4C2WA 4HZSA 3V8SA 4CRSA 1YWNA 3GCVA 2QKRA 3CTHA 4GEOA 4QTCA 3UVRA 4YJTA 1IR3A 4L53A 3IG7A 4LRMA 5AR4A 3P7CA 2J7TA 4X2FA 3R9RA 2YACA 1JLUE 4EOKA 1XH8A 3TMOA 4YHFA 3S2PA 5L2IA 3LHJA 4GYGA 3S0OA 1IASA 4O2ZA 4EWHA 1Z9XA 2O3PA 1XHAA 3NYOA 4HNIA 4BI0A 4PDPA 5E1SA 3F5GA 1TQIA 2Q0BA 3BEAA 3O0GA 4C37A 2IVUA 4P7EA 3DQWA 4G3GA 3ORPA 2VAGA 3OXTA 2R5TA 3E8NA 3Q4ZA 1ZZ2A 2I6LA 4TYHA 4EQUA 3EKNA 4L7SA 3ZOSA 4IZYA 2YDKA 4NM3A 1PXIA 3OMVA 3QQLA 4QMOA 2JLDA 4DCEA 5HX6A 1ZYDA 1URWA 3LLAA 3EMGA 1UU3A 3SAYA 4EQCA 5JMSA 5C8KA 3KRLA 4MCVA 2VWIA 3CEKA 4FIGA 4JR3A 4AG8A 1H8FA 3QZIA 2VTNA 5FEDA 5HE3A 3TL8A 3KKVA 3KRJA 3UTOA 4EH4A 4EORA 3G6GA 3WYYA 2C5XA 5ETAA 1OL1A 3DKFA 4LI5A 1Q8ZA 5C27A 2W1IA 3TYKA 2PYWA 3R7YA 4BKYA 5BX0A 3R1QA 1IAJA 1OPKA 2HY0A 3K5UA 5EG3A 2FVDA 3NS9A 5AR5A 5CT0A 4CT1A 3D4QA 3Q32A 4IZAA 5DR6A 3R30A 3FL5A 3Q9XA 3W2OA 4IFGA 4KBKA 3S00A 4E5AX 2XF0A 5BVOA 3ET7A 3QLGA 4BL1A 1Y8GA 4GH2A 5DT4A 2YZAA 5J9ZA 4EKLA 5EM6A 2X2MA 5D10A 4II5A 3FXXA 2WTWA 4PL5A 4RJ7A 3SC1A 3ZMMA 3D2IA 2ESMA 1XH7A 2X8DA 4O6EA 3C5IA 4GIIA 3TKUA 5EK7A 4NUSA 3QZFA 4FRFA 3IPHA 3MTLA 2QHNA 3A8XA 3P5KA 5FGKA 4O0SA 2WQBA 5B2MA 1XH6A 3F2RA 4M3QA 4NFMA 2C6MA 1WVWA 4V05A 5C9CA 2C69A 1R1WA 3EN9A 2GNLA 3M1SA 2I0HA 4F9YA 3W0QA 1WCCA 4AP7A 4AXFA 1JKKA 4AOIA 1UU9A 4F0IA 3UE4A 5AP1A 3FJQE 2HY81 2W5AA 1S9IA 3Q2JA 5BVWA 4LOOA 3NSZA 5KE0A 4EJNA 2GQSA 4O2PA 5DH3A 3ZO3A 5ICPA 1AD5A 2QOLA 3GENA 3H4JA 3CY3A 3HV7A 3T3UA 3W16A 2FH9A 2J51A 3MS9A 4XH6A 4GKHA 5CVGA 4YPDA 3KU2A 3L8XA 5ANKA 2X0OA 5AP6A 3KREA 5AM6A 3DOGA 3ZFMA 5D9HA 4ANMA 4NKAA 3EHAA 3Q4UA 4CMOA 4FZ6A 3BZ3A 3CBLA 2XKFA 2QU6A 1B39A 4G3CA 5JQ5A 4S31A 5JRQA 2PY3A 2VO3A 4UWBA 3RAIA 2XS0A 5KMKA 2EVAA 4CTCA 2G2HA 2Y4IC 5FG8A 3ZYAA 4M0YA 2IZSA 5GZ9A 1UU8A 2R9SA 2W4KA 4I0TA 3MV5A 3DA6A 4BDIA 3NUSA 3K5VA 1SNUA 5M44A 3POZA 4MNEB 2WPAA 4G6LA 3O7LD 5HQ0A 3ORNA 4QPMA 3ZUTA 5JSMA 4HYIA 5FP6A 5DG5A 4DE4A 4L43A 3HAVA 3BE2A 2W5HA 3ZXZA 4J53A 4FGRA 5HNIX 3CGOA 5HTCA 4BGHA 4E4XA 2WIPA 4QRCA 4GRBA 4UMUA 3Q4CA 5AR7A 5JEBA 2GMXA 4R77A 3NUNA 1UKHA 4PP9A 5AP0A 3OCSA 4G34A 5LMKC 1YHSA 4D4RA 1IAHA 4YO4A 3H9OA 3KVXA 2QOKA 1RJBA 2I40A 5J87A 4XOZA 4E6AA 3BYVA 3MESA 3QQHA 4UV0A 4IB1A 5HESA 5BV3A 2YWPA 4FV5A 4HVIA 5E8VA 3H0ZA 4OTPA 3UO4A 4M7IA 4ZSLA 3R9NA 2QOFA 3PFYA 4MD9E 1PHKA 4Y95A 1FPUA 4O7YA 3VBWA 2J4ZA 4EZ7A 2BAJA 4WRGA 5L4QA 2BILB 5KMOA 4V04A 2BDFA 3QF9A 1W8CA 3FZTA 3LJ2A 4H1MA 3EYHA 3KGAA 2B9IA 4ZAUA 4AA4A 2EXEA 4IXPA 2VWVA 2XKCA 3GQIA 1J3HA 3HV3A 2Y6MA 3MPTA 4I0RA 4UWCA 5E7RA 4WSQA 2X4ZA 5L2SA 3MYGA 3LCOA 4JDIA 4X3JA 5M56A 3LLTA 2P2IA 4FSZA 5JT2A 5CVFA 2PVLA 4A06A 3KXXA 4O0XA 5DBXA 3L9NA 4MD7E 2CHLA 3V04A 3PIYA 3VUTA 2JDSA 5AUXA 5CAUA 2PULA 3O96A 5AR3A 4RIXA 3CC6A 2ONLA 2WTIA 3TDWA 2WOUA 2BZJA 4MVFA 1RE8A 4WOVA 3A7HA 5B0XA 1XO2B 4MUQA 3ML1A 2NRUA 4KS8A 4I24A 4FK6A 4N6ZA 4WBBB 3CKXA 3F3UA 3O7LB 5KHWA 2QO2A 5AP2A 3W10A 2WTDA 5AV3A 4L9IA 1LUFA 4QQTA 3PXRA 3TV7A 3W2RA 3AC8A 2YA9A 3UPZA 4RVLA 4LGGA 3FWQA 2YDIA 3A4OX 3BV2A 4QP8A 2VWBA 2R3MA 4AGWA 3RI1A 4K2RA 4AN2A 4RFMA 4HVHA 3L8SA 1M2PA 3OW3A 2X7FA 3KMMA 3PIXA 4MWHA 4ANQA 3Q60A 1H1QA 3CQEA 5M07A 4XUFA 4TWPA 2OH0E 4QQCA 4ZMFA 3GXLA 5HI2A 3PXZA 3GI3A 3ENMA 2XK8A 3QKMA 5A54A 2BR1