4C6EA

Crystal structure of the dihydroorotase domain of human cad bound to substrate at ph 5.5
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
364
structure length
363
Chain Sequence
b'KLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROOROTASE
publication title Structure, Functional Characterization and Evolution of the Dihydroorotase Domain of Human Cad.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 119
structure length 363
sequence length 364
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4c6eA00
4C6BA 4INFA 1BF6A 4C6IA 1I0BA 4PCNA 4UBPC 1V77A 3LU2A 3O0FA 1E9ZB 3O7UA 2FTWA 4KEZA 2HPMA 3E38A 4ICMA 2P50A 1I0DA 4CEUC 2WM1A 3ISIX 4H9TA 4PE8A 5HMEA 4WVXA 1QW7A 2O4QA 1FWJC 3BE7A 3GU9A 3FDGA 4C6LA 2Q09A 4IFOA 4EPBC 4RDVA 4EPEC 4LFYA 4NI8A 1EJRC 2WJDA 1YBQB 1S3TC 3MPGA 1RA0A 2FTYA 4CEXC 3MJMA 1PB0A 3MKVA 3S4TA 1RJPA 1K70A 4HK5A 3MSRA 3URAA 1UBPC 2FFIA 3IGHX 4Z42C 1XGEA 4C6CA 4GXWA 2HBVA 4LCSA 3LSCA 4F0LA 3OVGA 3NEHA 2EG8A 1P1MA 1J5SA 2Q01A 4C5ZA 4J5NA 1V7AA 2QPXA 3UR2A 2Z00A 4OFCA 4IFKB 4XD5A 3DCPA 1EJVC 2OGJA 3MVIA 3SO7A 4LAMA 1QXLA 3QGKC 1M68A 1P6BA 2Z2AA 3GRIA 3LY0A 3GIQA 5A6TC 1A5KC 2W9MA 2AQVA 4TQTA 4IH3A 3ORWA 2ICSA 4ERGA 1A5MC 3HPAA 2Z2BA 1FWBC 4G2DA 3V7PA 4RDYA 4L9XA 2ANUA 2VC7A 4LALA 1KRMA 3EWDA 1FWHC 1FWFC 2Z26A 4AC7C 4DI9A 1R9YA 4H9UA 2P53A 1POKA 2R1NA 3GU1A 5AKQA 4EPKA 4RE0A 1UIOA 3K5XA 1ONXA 1FKXA 1VFLA 3PNUA 3MTWA 4IF2A 2GWGA 4KF1A 2R1MA 4RZBA 4GYFA 2FVMA 2VHLA 2ZC1A 1R9ZA 3LS9A 4R88A 3EWCA 3QGAC 4WHBA 4J2MA 4V1YA 4C6MA 3T1GA 4IFRA 4B91A 2G3FA 3OJGA 1EJSC 4XD3A 3DUGA 3IV8A 3MDWA 1RA5A 4E3TA 2E25A 3DC8A 4C6EA 1RJRA 1V51A 1GKPA 3LA4A 3E3HA 3F4DA 3K4WA 2Z25A 4KEUA 3KM8A 4PBEA 4F0RA 3GUWA 1UIPA 1V4YA 4C6QA 4XAYA 2F6KA 1K1DA 4LEFA 4ERIA 2HBXA 3A3XA 1FWAC 2VM8A 1EF2A 3NQBA 4C6DA 3T8LA 4B92A 4I6VA 1J6OA 2Z27A 4PBFA 3OODA 4BJHA 1RAKA 3FDKA 4IGMA 2D2JA 1KCXA 2KAUC 2OOFA 3LNPA 3S2LA 3TN3A 4G7EB 2BB0A 4LAKA 1PO9A 3AU6A 2FVKA 1HZYA 1YNYA 2WJEA 2IMRA 3S2JA 3URNA 1JGMA 1KRAC 3N2CA 3UF9A 1PSCA 3ICJA 3PAOA 1RK5A 4C6PA 3IACA 3A3WA 2ADAA 3NURA 3SFWA 4DNMA 2I5GA 3JZEA 1KRCC 4XAZA 4HK6A 5FSDC 4C6KA 2A3LA 3F2DA 2GWNA 4HA0A 4QRNA 3PBMA 3OOQA 3QY7A 1POJA 4QS5A 4C6OA 2OODA 2UZ9A 4EP8C 4BKNA 1W1IE 4KESA 1E9YB 3ITCA 3IRSA 4NP7A 1M65A 1EJTC 4QROA 3CJPA 2OB3A 1J79A 4IG2A 3CAKA 3QY6A 1GKQA 3UBPC 1O5RA 3LSBA 2D2HA 4M51A 2QS8A 4H9ZA 4CNTA 3TNBA 3URBA 3GU2A 2VR2A 2QVNA 4HK7A 4AQLA 4C6FA 2XIOA 3MDUA 2O4MA 3S2NA 1YMYA 4QSFA 1EJUC 4H9MA 1FWCC 4H00A 4CQCA 1WXZA 1ADDA 4MUPA 1O12A 1RK6A 4GZ7A 1NDZA 4GX8A 3A4JA 2PGFA 4XAFA 1EYWA 1ITQA 4GK8A 4GOAA 2R1PA 4H9XA 4GBDA 3F2BA 3GTFA 2R1LA 1EZ2A 3GIPA 3GG7A 3IJ6A 1J6PA 1XRFA 3GTHA 2E1WA 1XRTA 4NG3A 4CQDA 1RJQA 2VUNA 3WZ0E 4KIRA 4KETA 2HNHA 2QT3A 4RDWA 4LANA 3RN6A 5FSEC 3WYZA 2Z28A 4KERA 4C6NA 4C6JA 4GY1A 4DZIA 3AU2A 2Z4GA 4IGNA 3WMLA 4DLFA 2GOKA 1K6WA 4DIAA 5CH9A 1YIXA 3S2MA 2D2GA 3D6NA 3F2CA 4G7EA 4L6DA 5HMFA 4B3ZA 2I9UA 4EPDC 2YB1A 1UMLA 2DVUA 2EG7A 5E5CA 2PUZA 4DZHA 1FWEC 3E0LA 4IFKA 2Z24A 1A4LA 1NDVA 2PGRA 1M7JA 3ID7A 1ONWA 2YXOA 4LH8A 3B0XA 1EJWC 3LGGA 3K2GA 4XD4A 3RCMA 1DPMA 1XWYA 4CQBA 3G77A 3OU8A 4QS6A 4GY0A 4H9YA 4GX9A 3HTWA 4CNSA 1NDWA 4DI8A 3GTXA 2GZXA 1GKRA 3PANA 1V79A 3MVTA 2PLMA 4R7WA 3T81A 4XAGA 2VC5A 4J35A 2EG6A 1FWDC 4ZSTA 2Z29A 4JOMA 4WGXA 4H01A 4LAOA 4R85A 2PAJA 1A5LC 1FWGC 4DO7A 5LXXA 4KEVA 3E74A 3HM7A 1ZZMA 3QY8A 4V1XA 4D8LA 2GSEA 4C60A 2RAGA 4YIWA 4P5UA 2HPIA 4LCQA 1EJXC 4B90A 1NFGA 4PCPA 4C5YA 3CS2A 3RYSA 4F0SA 3OQEA 3R0DA 2DVXA 3E2VA 3GTIA 2AQOA 1A5NC 2UBPC 1FWIC 1NDYA 1ITUA 3FEQA 4UB9A 2BGNE 3C86A 4DLMA 3IARA 4GC3A 4DYKA 1PTAA 1A4MA 3LGDA 3E0FA 2YB4A 5HMDA 1YRRA 4IG2B 3TN5A 3AUOA 2CZVA 3URQA 1WXYA 4RDZA 4ZSUA 3TN4A 3F4CA 4BY3A 3IPWA 4GY7A 4LCRA 1IE7C 1KRBC 4KQNA 4QTGA 4ERAA 3B40A 5G4HC 4H9VA 1A5OC 1FKWA 2Y1HA 2AMXA 3PNZA 2Z7GA 2WJFA 4I6KA 3UR5A 1YBQA 4C65A 2OQLA 3TN6A 4XD6A 2YZ5A 4CNUA 2DVTA 1R9XA 4HJWA 4IQJA 2R1KA 3B0YA 1P6CA 3UPMA 3EGJA 2HQAA 3RHGA
chains in the Genus database with same CATH superfamily
4NILA 3GM8A 1FRBA 1XI3A 3O0FA 4XZIA 1VBHA 3VGDA 3STGA 4GUGA 5LIUX 2FTWA 5C0QA 5A5WA 3W7MA 3LCLA 1XDMA 2E9LA 1K8XA 3KBVA 5LIXX 1FFRA 3UG4A 3MUCA 2QV5A 3HGJA 3MW7A 1MW1A 4NI8A 3WEMA 5M1TA 5CEWA 3JUGA 4LRTA 1XYAA 5C71A 3KE0A 2Y70A 1R3QA 1V6WA 2V5DA 3HG3A 2NUYA 4G5DA 4YLWA 4UTFA 4J27A 1SO4A 3AMDA 5F1VA 3WQ8A 3KHDA 2EGZA 1W56A 1WOBA 1JZ2A 4NZFA 3PM6A 3UR2A 2GQ3A 2XWDA 1HXJA 1EJVC 3BLEA 4H19A 3KVJA 1M68A 1P6BA 2Q8LA 3LY0A 3W7NA 1OIMA 1TJ2A 2XIJA 3CWNA 3W1UA 2HK0A 3ZSTA 1DJGA 2CZDA 3M4HA 3DZ1A 1F5ZA 3KZSA 4GO9A 1CEOA 2IKJA 1D8CA 4RDYA 2DPEA 1C9DA 5CZTA 1OG0A 2QHAA 1D9EA 1Q45A 3HA1A 1FWHC 4A3YA 4NRRA 5A6JA 3T08A 5AYBA 5CG0A 3G1YA 2J77A 3CHDA 2YFOA 2B7PA 3UZJA 1OC6A 3GU1A 3VA8A 2OFJA 4HCHA 3QRHA 1UKOA 5SWUA 1IXOA 3B0VC 3B0PA 5AHFA 5CPQA 1XFBA 1A0CA 2B0MA 1LBMA 3HO8A 4Z1CA 3EWBX 4FR6A 3QV8A 4BHYA 4DAIA 5AC8A 4US6A 4FF5A 2J9XA 2QJJA 4XD3A 3DUGA 1TELA 1VFUA 4D6JA 4QDMA 3H2MA 4GI6A 1AODA 1GG0A 1XP3A 3GUWA 3AS3A 3B3DA 4AW7A 2QCEA 3U5UA 1IF2A 3FKRA 4NZ3A 3GQYA 4OT7A 1KBBA 2ZE3A 2Y89A 1FH8A 4GYPC 5AVNA 3HGOA 4EACA 4P8WA 3MBDA 4HN4A 2CYGA 1MRQA 4MKNA 3L21A 1QRQA 2FVKA 4R34A 4PTDA 4DELA 1H1ZA 2AGTA 2FVLA 3I3DA 3K8MA 4RCXA 4BI6A 4JIPA 5AC5A 4GIAA 4MOZA 4HA1A 3HQ1A 1RQBA 4HK6A 2YDSA 1ISWA 2A3LA 3F2DA 4PULA 1POJA 3NIYA 2F84A 3B8VA 1W2PA 3MHFA 3QQ1A 4PMXA 1BWVA 2XM1A 6A3HA 4G8TA 1TUXA 3WLRA 3SRFA 5H8UA 4WY0A 2GQ9A 4FNRA 3CAKA 3KL0A 3OP2A 1LJYA 2FPYA 1IIGA 1Q13A 4Y9PA 4CNTA 3PC0A 3SFKA 1I75A 3GWQA 1TV3A 4Q8PA 4WOZA 4BQ5A 3GBDA 2AL2A 3NPUA 4H9MA 3QPZA 1U5VA 3MZ2A 3UZWA 4NVTA 5HK4A 4I90A 4BF7A 4GBDA 1T5AA 2WJZA 1J6PA 2B31A 4Q4PA 2CLFA 4KPLA 3AALA 5BXSA 2VX6A 1CCWB 2ALDA 2QCMA 1PWLA 3ZYZA 5H91A 2PDHA 2XIIA 3H53A 4JTIA 5JVLA 4C6NA 2E9BA 6PTDA 3XINA 4IPIA 1YEYA 4E0CA 5D9OA 1YIXA 3D6NA 2QF8A 1NM9A 1XSKA 2ZOXA 4W9TA 1GPWA 1G69A 1KGWA 4RZ4A 2WAGA 4JKMA 3TJ4A 1YPIA 1G9HA 1EEPA 4K8EA 4OOZA 1H2JA 5DXYA 2QUTA 1V0MA 2FGBA 2VQTA 3OZOA 4ZO8A 3VO0A 1RD5A 4Q8TA 3ME3A 1D7FA 2QULA 4MDPA 3GXFA 1GHSA 3GG8A 4Q4RA 5DXXA 5I78A 1UWIA 4IMGA 3EDJA 1CWYA 5TD4A 3M0KA 3N15A 2IPGA 4W85A 3N14A 2QUMA 2FKPA 5D9PA 2C6QA 3BAIA 4KKXA 1BXBA 3L4XA 4M1BA 5EPDA 4LU0A 1ECEA 2UV8G 4KEVA 1N8IA 5C2GA 3F4VA 2C13A 3VC5A 3WNKA 5AYXA 3GC2A 1HTIA 4F0MA 1TPWA 4OE7A 4GWEA 3SN0A 4KWWA 3GH4A 1A80A 1J11A 1CW2A 3OA5A 2PD9A 5EBAA 3FX4A 3GR8A 4I9MA 1FWIC 2Z0IA 1ZAHA 4UTKA 3FEQA 1JZ4A 4LV4A 4HMNA 3OHIA 1CYGA 4LW7A 3EA1A 3SGGA 4FX6M 4NSBA 4IJRA 3TTYA 4HNLA 3E9AA 3W37A 4FEZA 3LCXA 1HVXA 3SIMA 5GNZA 1VENA 4NZ4A 4DBDA 3UU0A 1XKYA 3IEBA 5EMUA 2VEMA 1VF8A 4N42A 1NH6A 2V5LA 2PMQA 2GDUA 1P6CA 4D72A 4KS0A 4INFA 3UWUA 1CLXA 3E5BA 3G3DA 1JPMA 1ZHAA 3OYXA 5M03A 1S39A 2EXOA 4LTSA 5PTDA 1RXOB 1E73M 1GOIA 3WH8A 2ONEA 3S83A 4R3UA 2XHYA 3OBAA 4PYSA 1QI4A 1FDZA 4G7FA 4O1EA 3UG8A 1EHAA 2JQXA 4HPNA 4JN8A 4A05A 2AMGA 1PWMA 1A5CA 3DIPA 3MPGA 1CLKA 1EGZA 4CN1A 5KZMA 3CAVA 1VPXA 1OYCA 1K8ZA 4B9YA 1BVNP 3MSRA 5JIWA 2XPKA 4RXGA 1R3RA 3AZTA 2WSPA 1V8EA 3AUJA 3IIPA 1JYVA 4JTAA 4CVUA 4OUEA 2ZXBA 5G1MA 4DPPA 3LYEA 3EDEA 4CLMA 3CHCA 2QKFA 4RPQA 3DI1A 4J3VA 3WQWA 5JQ9A 2OX4A 1JZ3A 1R6WA 3BLKA 3ZT6A 1R5YA 3M5VA 3L68A 3O63A 4DNHA 4G2DA 4L9XA 2BY1A 3G1HA 4DWDA 1SFTA 4YHGA 2VC9A 3MKCA 3VM5A 4K68A 3WNLA 3E96A 1GK8A 4S38A 4JTGA 4H9UA 5BYWA 3N1AA 3WD3A 1EBGA 1XKJA 3G1SA 1F61A 1WQ5A 4K7YA 1AW5A 3LERA 3QC0A 2EPOA 4ZOAA 4HVXA 5F4XA 2PTDA 4XB3A 4L5ZA 4BK9A 5B7ZA 3EWCA 4RW3A 2V6AA 1AJZA 1Z41A 3AHTA 1PVNA 3IVTA 2YGYA 3FY1A 1HUVA 3GDRA 3ZM8A 1CXFA 2GUUA 1EDTA 4MDOA 3A47A 2E40A 3M0JA 4LB4A 5C9UA 1WKEA 1JJKA 2Z25A 1J10A 2J47A 3W6MA 2RHGA 2BWGA 2X42A 1FWAC 3T8LA 4I6VA 2C0HA 3EMCA 3QKZA 3H7UA 3FJLA 1WE5A 3JZUA 5CC7A 5D2TA 4FB7A 1TMLA 1L2QA 1UD5A 2VZSA 3S2LA 3S47A 1PO9A 1TR9A 5BOFA 5AHMA 1LBFA 5LHFA 3JRKA 4M8UA 1TTJA 3U3HA 3DFTA 3O8AA 1FWSA 2A7NA 5FJUA 3P14A 2NT1A 2HJPA 4V27A 2DV0A 2J4GA 1TJRA 3MUXA 4X63A 3T44A 4CGTA 3CLWA 5D2VA 1OFEA 4WRHA 4H3DA 4ADSA 2XSAA 3UXAA 1R46A 2PF8A 1N8WA 3S1VA 5KETA 3ITCA 5DBUA 2RGMA 3PZQA 4CVWA 4FI4A 5ECVA 4IG2A 1LLOA 3CV1A 1XPYA 4XUYA 1CGYA 4JL2A 4XO7A 4OZOA 1XGZA 2REQA 1ENUA 4D8AA 2E8YA 3BOLA 2NQ5A 4AQLA 1XPGA 2EPNA 4OKDA 3R89A 1FP8A 3B8TA 1R7AA 3PZMA 4W88A 2WNWA 3VIMA 1J0JA 4V15A 1ME8A 2HXUA 2D24A 2VWTA 1R3VA 5EMMA 1EEXA 4XAFA 1SZEA 4GK8A 3HG5A 4ORMA 3LCHA 4IISA 3E0IA 2X8RA 4Z2LA 3AROA 3GXTA 3AIVA 2Q8ZA 1MFUA 1V6UA 4PB3A 1GJPA 4O0KA 4YTSA 1AA1B 4E4PA 2VUNA 4HU8A 1VS1A 3BW4A 3RX2A 1UWSA 3WBWA 2QT3A 3U4AA 3GHSA 1HGWA 2VX7A 2VI0A 2WCAA 4QAWA 1XYFA 2Z4GA 4I7VA 5T91A 2FH8A 3WLQA 2PU1A 3LZ5A 2YYTA 4PMVA 4BEQA 1QNVA 1DVJA 3FA4A 1UD4A 1NDVA 1XS2A 3FIGA 4JQAA 1CXHA 3UD6A 4O12A 5REQA 3IIVA 1XF0A 2VD9A 1ZNNA 3RCMA 3G77A 4EF8A 3W01A 3W27A 3WL0A 3NQ8A 2ZA1A 3VZZA 3SJ3A 2EPHA 1GKRA 1X6LA 4DJDA 1G01A 4GE8A 3KBNA 5HATA 3AI0A 2VRQA 1UR1A 1W1YA 2ZICA 2C15A 4HU4A 4TMBA 4MLJA 3L4VA 3IK4A 1KB3A 1G5AA 3NQDA 3QW4B 1EUAA 2FQIA 2Y24A 2V38A 3E74A 3M07A 4JTCA 3KL5A 1Z44A 1TPEA 1TPDA 1UMYA 5GPRA 3G0SA 4JQ2A 3F7JA 4P5UA 1MEIA 3HJEA 5FKYA 3L4UA 2G97A 1KM0A 2NXIA 4UB9A 2JK2A 3KOXA 5DMYA 4DLMA 1K8YA 2FZBA 2PDWA 2IW0A 5HWJA 3TN5A 3AXHA 1JI2A 1FY6A 3M43A 3H21A 3PWGA 5D37A 4H6QA 4GACA 4HPJA 4Q8QA 2Y5JA 2YZ5A 1KFEA 1QI3A 5ECUA 5CJ5A 2E0PA 2X1RA 4MGGA 3ITYA 4C6IA 4P7QA 4HOZA 1Q2SA 1UWTA 5DRIA 4MJ4A 4AF0B 1G7UA 1R85A 4AUBA 3B4YA 4KEZA 4ICMA 4NXKA 5HDRA 2YLAA 1P43A 2XINA 5HMEA 4WVXA 3GU9A 3VX1A 1J0YA 2GYIA 3U0HA 4UUIA 4AEFA 1W5PA 1G4SA 4GPNA 1CT5A 3MKVA 4CEXC 1O5XA 3ARZA 3V0UA 2BOEX 3QMSA 5MHBA 3VKCA 1K8CA 2WMFA 3AOFA 1BLIA 2FJKA 3PF3A 1JZ5A 4TVDA 3SECA 4WK9A 2PTZA 2OGJA 3KBMA 1EJ7L 5DT7A 3N2XA 4JNMA 1HW6A 1NSJA 1GOOA 4IOTA 4UQDA 3I3EA 3ORWA 2ICSA 1KR1A 4Y9MA 1A5MC 1AH3A 1GT8A 1DIDA 2OXNA 4IIGA 1OEPA 3O3RA 3N6HA 3LZ3A 3CB8A 4JCLA 2ZIDA 3VGFA 2BLEA 5IFTA 1VFFA 2Y5EA 2DJXA 3EA3A 1JYNA 3VE7A 1JCLA 1DL3A 4LVBA 4BFAA 2PB1A 2A3EA 3U7BA 4PR4A 3VNDA 1TMQA 5FAGA 2XSBA 2BY2A 3R79A 3U2EA 1ITCA 1SW0A 1K3UA 3IGXA 1TFVA 4L4MA 2PDJA 4YPJA 3WSUA 3WQVA 3ALGA 5A2AA 3QJAA 2AL1A 2E8ZA 3EOOA 4AD2A 1J0IA 4PRTA 5E6YA 3VKDA 1EIXA 4IP5A 1PTDA 3NO5A 1VCVA 1OFPA 4PTXA 3DFYA 1A5SA 2J79A 4KWVA 6XIAA 1H11A 4Z2GA 5A6AA 1L8PA 4DJDC 2PDBA 4JFWA 1YE4A 3KCOA 3OB8A 2JALA 2GL5A 1EA9C 2A21A 2YIHA 4QBXA 4AY8A 4Z1YA 1GTEA 5C2CA 4ZQOA 4XAYA 3MC5A 4N02A 4MB3A 4KMQA 1K1DA 2VDGA 3DBNA 2XUCA 4DJFA 2QQ6A 5K2ZA 3FYYA 5K3VA 1SU5A 2WPBA 3STFA 2GVJA 3OIXA 4QJ5B 3DHPA 1LOLA 1WB0A 3TQPA 3VK5A 1OK6A 1WAWA 4AZGA 3CGTA 2BSLA 3WBXA 2UY4A 2EQDA 4O52A 3ARWA 1M5WA 3QOKA 2IMRA 1OT1A 4H8VA 3GAKA 1GGOA 4H6KA 3S8HA 3BLDA 4WGHA 1AQMA 1TG7A 3SFWA 2HEJA 3VIHA 3KOFA 1KRCC 2JKAA 3G18A 5I7GA 4FLOA 3DERA 5ABTA 1ODZA 2PDFA 1UWQA 4QS5A 5AYIA 5I3HA 2P10A 1D3GA 4XTIA 4Q33A 3DENA 1PUDA 3ITLA 4TX8A 2AOSA 1EJTC 2CWNA 1JF6A 1UQZA 3CJPA 4MY9A 3K4AA 1WBJA 1V02A 3LHUA 2FHCA 4DBWA 3TQ0A 3TV8A 2OZ8A 4JZ5A 1H7PA 3SQSA 3M5XA 3SSJA 1FWNA 3NJ3A 1EO5A 2V9DA 3AIUA 3HU7A 2CETA 3WUFA 4OBTA 1G4TA 1XLGA 2VRKA 3W1MA 4MG4A 2PDYA 4REQB 4ZXLA 3R8RA 2QEZA 5JBDA 1EYWA 1C9WA 3VUPA 3KTSA 3MO4A 4PMYA 1GEHA 3W7GA 2BHUA 3LHWA 1HVQA 3HV8A 2PRLA 3R7MA 2BY3A 1K9DA 3GTHA 1W3JA 1W0MA 1Y7VA 4RNFA 3O6DA 4CCZA 1EZWA 3HFTA 1EX5A 4WSJA 1K77A 5DRCA 3SADA 2ZXDA 3M0LA 4MFEA 3S42A 3GNNA 4NJHA 1H61A 1K02A 3AU2A 3P5YA 4GC4A 2D2GA 2RDUA 1CB7B 2WCGA 4H04A 2Y62A 2P1FA 3W86A 1FWEC 3CPUA 3EOLA 3TROA 5GJPA 3U2CA 1XXXA 3TLLA 1NAL1 3BCJA 3CQIA 1S2AA 1ZAIA 2JKPA 3HF3A 1GQKA 3LG3A 3T2PA 3B9NA 3TC3A 3MP5A 1EJWC 3AXMA 3Q58A 3KOZA 3UVAA 3WQ6A 3NR0A 1UKQA 2JF7A 1DE6A 3T0CA 4S3BA 2GVEA 1DJNA 1PCKA 2O55A 5G2WA 5GQBA 1V79A 3TP4A 2B7NA 1XC4A 3CH9A 1PXGA 2QCFA 4M56A 4WJEA 3W23A 1KWGA 1PKMA 2ON3A 1A5LC 4LOCA 3T2OA 4UWMA 3DFNA 4JQ4A 4I5RA 3PTDA 2GSEA 4GZIA 3NXLA 2PODA 2XM2A 3QHNA 2DH2A 2XFYA 3O15A 4RR4A 3PZNA 1CXLA 4UFJA 4ZEPA 4JAWA 3GC4A 3GDLA 1B3XA 1JIBA 3GS6A 2GSHA 1UYQA 4OV9A 1UZ4A 5DEZA 4AWSA 5A6KA 1RBAA 4PTWA 1NARA 2ASHA 1JCTA 2WCSA 1A4MA 3VFCA 1IXPA 1PS9A 2QMKA 3ZFHA 1JQVA 3NZQA 3TN4A 4PUUA 2FZNA 3UCCA 2EPLX 4H9VA 3AHZA 1SO5A 1Z48A 1LORA 4HZMA 3UR5A 3PZ9A 3WLJA 3DEQA 3TN6A 4MPKA 4WLCA 8RUCA 3I6EA 2QV4A 3WLSA 1OZQA 4Z0SA 1UPPA 5XIAA 3MKKA 5F4WA 5D2XA 3TMQA 3IK2A 4HD5A 2WZHA 2D2OA 3F03K 3E0WA 3OW1A 1I60A 4O17A 1ELSA 1JG9A 1JDEA 1BXNA 4KGLA 3AISA 3URAA 1EC9A 2FFIA 2OZ0A 2PF0A 1XGEA 3S3GA 4GIRA 4YCOA 3CUJA 3O6CA 3PP7A 1NQKA 4PUEA 2Q01A 4AZCB 1O7AA 2D22A 2XZ7A 3EXRA 1V3JA 4UTHA 2POZA 3QSTA 3NYZA 1YDYA 4S2CA 4QHRA 4EVZA 4KIEA 3TU9A 1QXLA 3RM9A 1JZ7A 3RRXA 2ISDA 3MV11 4E5TA 1TV4A 4TQTA 2XVPA 4AD5A 2G3MA 1U33A 3NQVA 2ACQA 1YADA 2YLLA 3JW7A 1CGUA 3L5MA 2ZRZA 4XBSA 2WOQA 3WLLA 2P8CA 2WZIA 4HYRA 5JXQA 2J7EA 4HNVA 3A9IA 3BGJA 4UQAA 4B5XA 3ZWTA 4M80A 3M46A 1B3OA 3FJNA 1RCOB 1W9UA 4IPLA 4FX8A 3N9SA 2O7SA 3WLPA 4YTRA 4JPGA 5LIYX 4RZBA 4RV3A 2ISSA 3F4WA 3R25A 1E6SM 3TH6A 5LGXA 4J2MA 2PWVA 5EKYA 2W27A 1SPQA 2WVSA 2VZOA 1D7KA 1HG3A 1ISZA 3MDWA 4HT3A 5CJMA 1GKPA 3M64A 1HO1A 1V5XA 3K4WA 4QR6A 4U2ZA 4DWSB 2XIMA 2A2IA 5LNUA 3S5OA 2F6KA 7TAAA 1NF0A 4W7VA 4NJJA 4MB1A 3AJXA 3QTGA 4B92A 1PKYA 4HBKA 4JL1A 1J01A 2Q3RA 2Y7GA 4MIMA 4ZFMA 1XSIA 2DIEA 3UWZA 4GNKB 3H7VA 2NQZA 5C9RA 2BB0A 3WF1A 4C1NA 3SR7A 4QG6A 4DBSA 3II1A 4D6HA 2I9EA 2HXTA 3UNTA 3S2JA 3URNA 2ZZ2A 2PFHA 3VMPA 1VHCA 1VIWA 4PB5A 1FHLA 2CFFA 3A6OA 3NPWA 1Y5VA 1RH9A 4KFOA 3W71A 5DCDA 4GI4A 4BS0A 2GWNA 2RDWA 2OODA 4IWWA 1OC7A 1O1HA 1VB9A 4LAZA 4ZQPA 5IBXA 4YL2A 3HZ3A 9CGTA 1ADSA 3ERPA 5DBTA 1WUFA 3NWRA 3A4XA 1O5KA 4QNEA 3LSBA 4FNSA 3PPFA 4BR1A 4HK7A 4JCMA 2WWCA 2DZAA 2FFCA 2O4MA 1AD1A 1YMYA 4O1FA 1US2A 1TR1A 2VO5A 4GX8A 1X38A 5D2YA 3N17A 4Q6JA 3LRKA 1SZRA 4ZQRA 4DEFA 1QNSA 2GGIA 4A3HA 3BL3A 2JGYA 1V93A 1U5HA 4W8BA 1XRFA 3K1DA 3BDKA 2W61A 3TVAA 3VC6A 5FCZA 4ZXOA 5A8NA 3W85A 4CU7A 2NVAA 1B30A 2E9MA 4ML9A 4IT1A 3VDAA 1M1BA 4QLLA 1C91A 5EL1A 2G95A 2DSZA 2Z1WA 3H2CA 4LBRA 4C6JA 1W91A 3RM4A 3LCWA 1UC5A 3DFOA 5HPOA 1K6WA 3N19B 1CLVA 3T4WA 1QNPA 2VWSA 3NL2A 1QDSA 4L80A 4F2BA 5HMFA 4MKSA 3PJTA 4B3ZA 4EE9A 2D1ZA 1W3NA 3T0BA 5E5CA 3VNIA 5JMUA 5E93A 3AS0A 2ZX7A 2QDGA 1FX6A 2Y7FA 1EGMA 3EAUA 1YXYA 4R33A 1R2RA 5LA2A 4F48A 6ALDA 1Q63A 4K37A 3PZGA 1JAEA 4C7FA 2Y2WA 1LZOA 3TA9A 1OB0A 1C8XA 3FSUA 3NL5A 5D32A 3C56A 3ONBA 1I45A 3TMLA 4Z0JA 4I7UA 4JHZA 4J35A 4IHCA 2PBOA 3CIXA 3NSNA 1UHVA 2V0TA 1JZ8A 1L9WA 4WGXA 3M7WA 7REQA 3WMCA 1T99A 4O0QA 3VKAA 2PWHA 3TSDA 3QY8A 4I9TA 1W3HA 1KBIA 2I5QA 4LCQA 3R0KA 3DBPA 4HSHA 7ENLA 4J3UA 4YTQA 5G2HA 3UZZA 3P0XA 3W2LA 5AY7A 3R0DA 3NOYA 4FA3A 2ZX6A 4N4QA 1NDYA 1OT2A 2Q71A 3W72A 3T05A 1XC6A 1YDOA 1DIEA 4AF0A 3E0FA 2CIPA 1E4NA 3TEVA 4R27A 5EB8A 3A22A 3F4CA 3TW7A 2Y6ZA 4UFLA 4K39A 5C7VA 4WCJA 1FKWA 1VC4A 5FF4A 1EHNA 1JXJA 3WQOA 2OQLA 4MFDA 3TXZA 4P2VA 4Q3MA 1HL9A 1EKOA 2E5BA 3EA2A 2GUBA 3ITTA 1KFJA 4IMAA 2BOGX 4DB7A 2G5WA 3O7UA 2QJIA 5IBXC 3W2MA 1SW7A 1HKJA 2Q09A 1LWIA 3G6LA 3V1HA 5CSRA 1EXBA 1EJRC 1XL9A 4PFMA 1MW3A 3R4IA 4L61A 4XAPA 3BPWA 4LWWA 2CZ5A 3CZLA 4LYPA 3UCQA 4UMBA 4FK9A 1VHNA 4FALA 3S9ZA 1MMFA 5IHRA 3FA3A 4WXYA 2CLPA 3NZRA 2YXXA 1DBTA 3OVGA 3NEHA 4GA8A 1F07A 2DT2A 3WK0A 2OLHA 2PDLA 1D3CA 1W9DM 5GVJA 3T42A 4FR1A 1PDZA 5JBEA 2FB2A 2J6VA 4FHAA 5HANA 9XIMA 4M1RA 3W75A 3W7QA 3VINA 1QK0A 1LT7A 1V3HA 1B3VA 3ZWSA 1XYLA 3AXXA 2OLSA 3MYPA 3WH7A 4PSPA 5HNRA 1FWBC 3ZJ8A 2FGLA 3QN3A 4Q4KA 1IT8A 4KW2A 4B15A 1YPFA 3PFMA 3F5KA 4B5SA 1B90A 2Z26A 4DI9A 1XM3A 3HV9A 4LBUA 3I6RA 1RUSA 3M0VA 2E1DA 1KR0A 2TODA 1R86A 2ZDSA 1KCKA 2VVNA 2NSXA 4AH7A 5I00A 1R9ZA 3GVQA 1KQZA 4HMDA 3UJRA 4LVAA 4FNTA 5C2XA 3WD1A 3VCNA 4UTJA 2OWWA 2XN2A 3W9ZA 3IV8A 2A6NA 1GVYA 1PBGA 3U9IA 1ZS2A 1XCFA 4Y9AA 8A3HA 2VR5A 4WKFA 4YWSA 2KZHA 2JEQA 2P0IA 4J3XA 1ISXA 4KEUA 1YPXA 2GSJA 4MWAB 1X7IA 4LEFA 3VIJA 3ABRA 3ZJ7A 2YBTA 1JEZA 2PTWA 1VLWA 2YCJA 3PBGA 2XH4A 1CGVA 3VIOA 2O9OA 3MCOA 3TUUA 2H6RA 4WEVX 4CD4A 2D2JA 1OJXA 1GJWA 4PCFA 3TWAA 2EPKX 4ATLA 3MHUA 3C5QA 4RNJA 1ZY9A 5F2MA 1MXGA 2GVGA 4AZIA 1OC5A 2DIJA 1PJ9A 3M1ZA 3QSRA 3N2CA 3UF9A 3MWAA 1RK5A 4C6PA 1ZALA 3S9YA 2BVWA 3VVGA 3EB4A 2PDKA 3BG3A 2I5GA 2O9PA 2IXVA 2F38A 3GVVA 5A6SA 4AVNA 1OK4A 2O56A 4FNQA 4PMDA 1P7TA 4AY7A 3U57A 2OO6A 4REQA 1TMHA 3NCOA 1BHGA 3MV01 5M3WA 3G8RA 3GDTA 4L56A 1BF2A 1MVYA 2R6OA 4QROA 5HQLA 4E2DA 3WK2A 3GIYA 3FAWA 4Y7EA 3WUEA 1WKFA 4WDXA 1TPFA 4X9YA 3IIOA 3AYVA 3O16A 1F6KA 3CQ0A 3S2NA 3BSMA 2DSUA 1B4KA 1GOWA 1DTNA 1YTKA 3WDIA 1V08A 4N6FA 3NGJA 2OQYA 3LX9A 1IWBA 3B9DA 4AWEA 3ECQA 2R1PA 1AZ2A 3CZGA 2Q3OA 4AVFA 3RLHA 3PBWA 2ABBA 2XYLA 2DT1A 2GVYA 3ZQ9A 4I5XA 1RJQA 2QAFA 5DT5A 4M0XA 2ISFA 3QPEA 2G4FA 1W3LA 5C7HA 3QW3A 6ENLA 3SCPA 5FSEC 1S2CA 1N7KA 2B4GA 3TYEA 2VFFA 3S2MA 2VL4A 3FJ6A 5CPSA 4A3UA 1SMAA 1FUYA 3SW6A 3ELFA 3RCYA 3NVDA 1WKDA 2ZE0A 4S3EA 4CD5A 3C0QA 4A2SA 4S2BA 3GC5A 1M7JA 2VKZG 5DY3A 3RFAA 4EKJA 1PZ1A 8XIAA 4U3CA 3B0XA 5BZAA 5FJJA 3UYIA 5EGRA 3QV9A 3LTYA 3L4YA 4GVFA 4JY8A 4R9OA 3N6QA 3RU8X 3UJ2A 3BWWA 1WDSA 3HTWA 3BOFA 4KFPA 3GTXA 3UA3A 2GZXA 1NF7A 3CASA 3MVTA 4ZBCA 1GW1A 1A5AA 2ZADA 3LQLA 5DF0A 4AWTA 3O1NA 5LA1A 1MDLA 2UY5A 3R8GA 3IIXA 2PGEA 2FZDA 3EXSA 1O94A 4IIEA 2VTFA 2VZUA 1FVPA 2CWXA 4FF7A 4C60A 4LAUA 4ZOEA 3NXFA 1ZQ5A 4PN2A 3WD4A 2VVSA 4C5YA 3LV6A 4TVUA 1DWIM 2ZZ3A 3EX6A 4DN1A 2WKLA 1AVAA 1RLCL 3P2VA 2VELA 2QJNA 1QPKA 3MUY1 3CZKA 1JUEA 5LA0A 2BVYA 1C92A 3IUDA 3WUGA 4PC8A 4BZYA 5IOBA 1C3FA 1X7FA 4RDZA 4I3GA 3IPWA 2IKIA 1LQAA 4PUWA 1RZMA 4X61A 2WZTA 1FA2A 4D71A 3D3FA 3K46A 1EDGA 2Y8KA 3W7HA 4B5VA 2ZTKA 2E68A 2VGBA 3NTYA 1TWSA 2D69A 2CCRA 1K7XA 1E0TA 2WQDA 1BF6A 3C0JA 4PCNA 2BGSA 2VZVA 3W1TA 2CW6A 4PEEA 2V81A 3SRDA 1LCOA 1BXCA 3RLUA 2AKZA 3A24A 2MUCA 3FYOA 3TTQA 3I4EA 5RUBA 4PE8A 3QV6A 1MXDA 3BE7A 4HCLA 4UQ9A 3P67A 3G6MA 2A7RA 2H9AB 1E4LA 1DWJM 3WJSA 4O50A 1SO3A 3ITXA 1E5NA 4LS0A 2A6LA 3WLMA 1S2UA 3WDPP 2IS7A 3STEA 5AB3A 1CGWA 4O18A 1AG1O 1IXNA 4Z42C 1O6IA 3P93A 1B4EA 2VDIA 3OGRA 1XINA 2DGAA 2DZXA 2QGHA 3KDOA 4C5ZA 5AFDA 2G41A 2OZTA 4LPCA 2ZZ4A 1VJZA 3SUVA 2Z2AA 1QBBA 3GVWA 3GIQA 3QC3A 1ESWA 1WDRA 5B80A 4KFNA 3LBCA 1R47A 1OFAA 3B8UA 2WO5A 3LNMA 3PAJA 5IM51 1NVMA 2HZGA 2JGQA 3EDKA 5D2WA 4XKYB 5HWMA 2HK1A 3W0KA 4YNGA 1QOXA 4Q8VA 1T41A 4R5EA 4RJEA 1QASA 4DWSA 5TQLA 2QUNA 3EMZA 3V75A 5J8LA 1JUKA 2R1MA 4TV5A 1Z6KA 3R8HA 3EYPA 1Y5WA 3H23A 2YCLB 4IIFA 3S5SA 1JD9A 3ZR4A 4XZWA 2NLIA 1RA5A 3FV9A 2WVVB 4GYKA 1J4EA 3WO8A 3ZT5A 2WMJA 4JTTA 2V3GA 2BODX 1JRCA 1UWAA 3CM4A 5LKYA 5I24A 2BNJA 4NL1A 4PTNA 2FDMA 3W1LA 1S2TA 2HVOA 4JFSA 4XBJA 3PTQA 2J74A 2HS8A 4NI3A 4XZNX 3IAQA 1NWSA 1LTDA 3PVFA 3B8IA 4GCAA 5K4ZA 3VILA 3GR4A 4PL2A 4L6HA 4PRWA 3W25A 3FDKA 4S3JA 3L4ZA 3I65A 4W5UA 4H41A 1DWHM 1PZ2A 3K1GA 3ARXA 2EEXA 2V5KA 4NYUA 5AYYA 3P82A 3QEZA 2WVUA 4HPGA 4ZCWA 3ICJA 2WHKA 4AMAA 4L65A 2PDIA 3UWEA 3NZPA 3G1AA 4Z2JA 1XFCA 2AKMA 4LXFA 2BBFA 3G8EA 1W3TA 3EWUA 1BVWA 1KM3A 2VCBA 3L12A 3QMRA 3PY2A 1VFMA 4AZ7A 1ZLPA 3W7OA 3VTRA 3HOJA 1K6AA 1M65A 1MQQA 3EKZA 4O4WA 2OB3A 3COTA 4M6PA 3BAWA 4G1KA 2F6XA 4NZ5A 3MI6A 3VPLA 2PP3A 1PAMA 2QS8A 5GNYA 4ATDA 2VGGA 1E9LA 1JDDA 1RY8A 2X0HA 2ZUVA 2ZXQA 4L4OA 2VURA 1KM2A 3LM7A 4GZ7A 1ML1A 3NO1A 1H7NA 2FDSA 4YHEA 1DWFM 2PGFA 2VEPA 4MMWA 3FA5A 1J0HA 3FGCB 1MI3A 1WV2A 4JNYA 4POCA 3UNDA 3IJ6A 1AD4A 2IPWA 1TRDA 5FD0A 3EZ4A 3AHYA 2DU2A 1F7BA 1UD8A 3DYPA 3G0XA 3M5ZA 4AC1X 2G3JA 2J66A 2NXHA 2I14A 1BYBA 3TTEA 3OVPA 5I3DA 4S3AA 3AWNA 4DM2A 3GW3A 1QFEA 3DFSA 2VEFA 5DMMA 1S38A 1F8IA 4UTLA 1IEQA 1T40A 2XFRA 4RNIA 1B3ZA 4QEEA 2OEJA 2J7FA 2VMFA 3MU7A 5BXTA 4Y9NA 4CN6A 4LUTB 4A4AA 4IXHA 2F7FA 4IQDA 3LLXA 4MJZA 2RJGA 4J3WA 3VNYA 3ARVA 3CPRA 4QCFA 4A3QA 4JEJA 4N7QA 1W54A 3GLCA 4H8HA 4KEMA 4JHMA 3WUBA 4XSLA 2BV9A 4Q7BA 2HDJA 3IJ7A 3RLVA 3M47A 2OSXA 4QSHA 3W4RA 3PANA 3GH5A 4XAGA 1J5TA 3FHAA 3AMGA 3ZVHA 4NNCA 2XZ9A 2EG6A 2MNRA 3LBMA 1B54A 4JOMA 3W74A 1K9EA 2C1GA 3PG8A 1W1PA 4WSKA 2J24A 4DQWA 3UPBA 4D8LA 3CL6A 3MP3A 5E9AA 1M3UA 2TYSA 3EKLA 4B90A 5KMYA 2QZRA 4MWAE 3P0WA 2QNEA 2DDXA 4W84A 3RYSA 2DIKA 5E9XA 4OQVA 1KNWA 1O66A 2FGZA 1LOSA 5AVHA 3TZNA 3C86A 3VE9A 3BJFA 3QM3A 2GJPA 1ADOA 3WKZA 2ATMA 3VXGA 1FFQA 3ZR5A 5FAJA 2VX5A 4F4RA 3PNZA 4OUIA 1WX0A 2F8QA 4LNCA 1CXEA 3UW6A 2OSWA 1HX0A 3A5VA 1BD0A 4H2CA 2O92A 3BJTA 2ZVRA 3WG6A 1EGVA 4IMDA 1H4PA 2CKSA 3IJDA 3E12A 2J7BA 4FO4A 3NSXA 1M6JA 3M0HA 1GEQA 1WO2A 3EX4A 3W2JA 1FWJC 2GJRA 1R2SA 3N73A 4JYEA 4LFYA 3TWBA 4D2JA 2C1IA 1DKWA 1HKMA 3BAJA 1CTNA 4UZUA 1KLYA 5CAHA 1QW8A 1SZNA 3ABSA 1M7XA 3TYDA 2BG5A 2J7DA 1J12A 4UFKA 4AD4A 2XN1A 1TZ9A 3C6CA 3CWHA 1DV7A 2GVLA 3PUEA 4OFCA 4NF7A 5H2ZA 3GKAA 2ACRA 4UMAA 4FP1A 3ZZ1A 3QGKC 1F05A 3T40A 3V3WA 1G4EA 3BH4A 3CHFA 3C4UA 1DEDA 2J9ZA 2XH2A 3GE7A 5A8GA 2AQVA 2AQWA 7CGTA 2I16A 5A6MA 5E1QA 1Q6GA 4ZE4A 2ATSA 3SB0A 2WXDM 4ZR8A 3E49A 2Z2BA 1NOFA 2D3LA 3TONA 4YU1A 2Y5SA 1VEMA 1W1ZA 1X8FA 4DM1A 4KT2A 2H3DA 2R94A 3CC1A 5AZ1A 1RVKA 3MSYA 1ZL1A 4ZO6A 4RE0A 2PDCA 4CU8A 3VDGA 3WBYA 2GJLA 3BANA 2NXGA 4XISA 2WK2A 1F4HA 4XVEA 3C0LA 4AB4A 2Y7DA 5I2UA 5I03A 2XIQA 2EJ1A 4XG1A 1J8VA 3UR7A 4WD0A 4JHOA 1LDCA 2VXNA 2WWDA 4FLSA 1XH1A 1A50A 5J04A 1QMLA 1OQFA 1S5NA 1IGSA 1F76A 3EWWA 5DO8A 1C8VA 1PIIA 1V4YA 5DCBA 3SGZA 5IXEA 5FF2A 2ZUUA 2HTMA 2X0SA 3GG0A 1QR7A 4W86A 4EXQA 3UCDA 1F73A 3N04A 3TNOA 3N2MA 2Z6IA 1TCDA 4F8XA 4GVHA 4IQLA 7XIMA 4JEQA 3H2OA 3AS2A 3WCZA 3W2NA 1YDVA 1F6PA 1LUCA 2C3ZA 4LAKA 3IV3A 1BPLB 1O4UA 5MKGB 1Q65A 1MW2A 2WNNA 3PZUA 3KTXA 4DJFD 5BRQA 3PAOA 4HCDA 1XIMA 4LY8A 1UR9A 4E38A 3B06A 5KEZA 4JXCA 1JDCA 1LBLA 2EPMX 1SUXA 3IJIA 3LI1A 2QCNA 4NT0A 2C79A 5LIWX 1CGXA 2J25A 2YXGA 1RLDA 4G56A 3L2IA 1KTCA 1EP1A 1KCZA 5AZ0A 3EDDA 1J79A 1TWWA 3W73A 1UUOA 4GJJA 4BEUA 4F3HA 1JPHA 1JRBA 2XIOA 1S46A 3BO9A 1XIGA 5E70A 3GTNA 1EJUC 3ARYA 4DO4A 3QFEA 4X3ZA 3RPMA 1BRLA 4Q7NA 2V67A 4W7WA 1J2WA 3TYZA 3ARTA 4U33A 5FF0A 2Q6ZA 3S1WA 4GXPA 3A13A 3W70A 1ZB5A 4PFHA 1W1VA 2A3AA 5K9DA 1ITXA 3O07A 2R1LA 3AIBA 4ZO9A 3TDFA 4C90A 4S23A 2WMIB 2PLKA 1JPIA 3S6DA 5FIPA 2GLKA 2E1WA 4HNNA 1GOKA 1Q8AA 3WQPA 3OPSA 1FXQA 4GI9A 4KETA 5D9NA 2QR6A 1SJDA 2PGWA 3GH7A 1XYBA 3VGGA 5A8QA 5F2GA 1PPIA 2Z28A 1DJHA 1KXTA 1UZHA 5BU6A 4FMVA 3WMLA 4E3VA 4B4HA 3CL8A 3VD4A 4JNZA 3UZXA 4I7WA 3DU0A 1QPRA 2VZTA 3P62A 2PWFA 2J7HA 1KGUA 3RCNA 4DZHA 2CLKA 1AQFA 4GGHA 4IFKA 4K7VA 3A21A 4DAFA 1BG9A 3BURA 1GNXA 1ONWA 4KWUA 3DHUA 3YPIA 3I68A 1LRNA 2PC4A 1QU4A 1DXIA 5FF7A 1L2UA 1OFBA 2ABAA 4HNOA 3IJ9A 1OVDA 2ZUTA 1P1XA 5LIKX 3W7EA 4Y8FA 3LV5A 1F3EA 3T6CA 1IT0A 4O4VA 1JYWA 1JGIA 4UFIA 2H8XA 3WQEA 1ODUA 1VPQA 1SZGA 4CN4A 1XIEA 1RPKA 5LXXA 2BXVA 5HQMA 2GGGA 1MWOA 4V1XA 4ML4A 2RAGA 2HPIA 2XVLA 4BF5A 5I07A 1TQXA 3MJYA 1JF5A 5CGMA 2Z1KA 3VD7A 4NAFB 1FCBA 3U4FA 4MTVA 4DBUA 2UBPC 1ZBKA 2CITA 4Z1AA 1X39A 4GIYA 5DMLA 3CMGA 1IR2A 1PYMA 2YB4A 4AZ5A 5FOOA 5HMSA 1UH3A 3WEZA 4ZOBA 1V0NA 3FVMA 3C2OA 3F5LA 4F9JA 4JIRA 2WPGA 3SN1A 4GZEA 4ZVJA 1BVZA 4K38A 5FL0A 4DVOA 1UD3A 2VFEA 1SVDA 4G7EA 2FJUB 3B4UA 3EOUA 4NKCA 1UP2A 4ACYA 3BV4A 2H90A 3UESA 1JAKA 4Q4QA 3UZYA 3TW6A 3EBVA 3VOIA 2WM1A 2R8WA 3U2ZA 2CPUA 2XTKA 3NM1A 4C6LA 4WX2A 4IL2A 4RDVA 4J4KA 2OGYA 3AWOA 1JXKA 1W37A 4X60A 1OFQA 4Q7IA 1Y8BA 3MCMA 4O16A 6TIMA 1ZENA 2FMOA 4J2PA 4XKYA 3BG9A 3KW3A 2DZTA 3DI0A 2EG8A 2CC0A 4CD8A 2ZZ1A 2PRMA 4F2TA 2D0FA 3QOMA 2QAPA 1H1NA 2G0WA 2X7VA 3INPA 4CD6A 1DJZA 3L5LA 1G7VA 1KFKA 2Y88A 3NQ7A 6XIMA 1KV8A 1ZBWA 2POTA 3Q94A 2YCLA 2WMKA 1B9BA 1C7TA 4MYXA 2XVNA 5KTLA 3CYVA 4GFSA 4G1NA 2WANA 1DOSA 2BP1A 3PPHA 2OYLA 2C7FA 1NELA 4XK2A 4CQ8A 1KLZA 3W3OA 3RJXA 1OY0A 3CQHA 5BWAA 1EIBA 3GXNA 4HSNA 4UTIA 5LNSA 2X1IA 3K5XA 1T8XA 2XGBA 4U4MA 4P7RA 2MANA 1E6XM 1KFBA 1GVOA 3AXKA 4XX6A 2PI6A 2VHLA 3LS9A 3WF3A 3S9IA 3ES8A 4K1WA 3W1QA 3SZ8A 4Q8OA 4HMEA 3OJGA 5D03A 4IUGA 1NP2A 1I2PA 5GJMA 1TYGA 1TTQA 3O9NA 4XSMA 4DYEA 1XQKA 2GK1A 3LXBA 1YKWA 3CQJA 4J7RA 1ICQA 3NQBA 1EF2A 1CXKA 3V5OA 3UYCA 5CPNA 1Q4NX 3ITVA 2X40A 3AZRA 3BGGA 4LQ1A 4JIIX 3ATZA 2PS2A 4I8YA 5M2FX 1U30A 4QJ4B 2OCZA 3RGTA 2TAAA 2QCCA 3TA6A 3BLPX 4J40A 3WFLA 1KBJA 4JYFA 4YVPA 2CHNA 2NZLA 1KRAC 4YJ5A 1V3KA 3O6YX 2Y63A 3L66A 4LB3A 3A3WA 1U22A 2V2HA 3NG3A 3AXIA 5AN7A 3LHVA 1WZLA 1LL7A 4TR9A 1VBUA 2ZUMA 4O15A 1GYNA 3RMJA 3SCQA 4HMCA 5FACA 1DWGM 5B7YA 3BARA 5CJNA 5CLTA 1XGDA 4NP7A 3VKJA 3N34A 1XBVA 5D4YA 2QCLA 3DECA 1E6ZA 1S5WA 1GKQA 2J75A 4JTJA 4LF2A 3MSGA 4HTYA 1F6YA 5ENLA 1WYIA 3WH5A 1MYRA 3VYLA 2I1OA 1Z9AA 2I7GA 5C54A 3P60A 1EO7A 2VFGA 1NDZA 2E6AA 1ZJIA 3P80A 3N25A 3VD3A 4N2YA 1XLKA 2ZZ6A 1T7LA 4LUTA 1MNSA 4Q8NA 4OU1A 3LB0A 2QCGA 5DELA 1UROA 3WZ0E 2OPJA 3KAOA 2VFHA 3ZOAA 6TAAA 3SIZA 3N13A 4O14A 3CMJA 3NPXA 2YBVA 3CUFA 3ANYA 2RDXA 3GX9A 4GY1A 5D05A 3CIVA 5CBJA 4UTWA 2YDAA 5CAKA 3M0IA 3BMVA 4TXEA 2DVUA 1CZ1A 1PX8A 3E0LA 3THDA 1XLLA 5BWFA 4RKAA 4IIBA 1F3TA 3MMWA 1GZ1A 3GUGA 4LH8A 3EDFA 2V82A 3R12A 1W32A 3OU8A 2DW7A 1W8GA 4PH6A 5L9FA 1XUUA 2YL9A 4LS1A 5DY2A 1EC7A 2HSAA 4A8RA 5C8BB 5E0KA 2VC5A 1EQCA 2DJLA 3CIWA 3WJXA 1Q6OA 4PZVA 5E0FA 1LROA 4LY4A 2QVHA 1GVRA 2OOGA 2AGKA 2TMDA 2NT0A 5CPTA 5C70A 1XLBA 1AL8A 2WV8A 4ZQCA 2PDXA 2D73A 2Y0FA 3UXKA 8TIMA 3SM0A 2BS9A 5EMJA 4O19A 1OINA 4ZMGA 4GUFA 3PS7A 3UA4A 2W79A 1IIHA 4GUJA 1JD7A 1ZSXA 3RX4A 4K2SA 3R1ZA 3SY8A 2DVXA 2GGEA 1R30A 5XIMA 1H41A 3G3MA 4F0HA 1QNOA 2R82A 2ZWYA 4JICA 2WZEA 1GQIA 1DP0A 3OTRA 4GY7A 5AOUA 1GYMA 4GQRA 4DY1A 3OO2A 3DX5A 4Z08A 3UP8A 1V6TA 1FH7A 3WDQA 1XBZA 2IQTA 4LUSB 1NY1A 1ZCCA 5DMNA 4TU1A 1OZMA 4JYDA 1J0KA 3B0YA 1GQLA 2HQAA 1DIOA 4QP0A 1P0NA 1XICA 3UWVA 4TVCA 4Z17A 3TQKA 1JYXA 4WKHA 4NASA 6REQA 3BGAA 1K9FA 4B5UA 5CSYA 2BZNA 2GJNA 2P50A 3R2GA 5A95A 3WJZA 2O4QA 3FDGA 2E6YA 3REQB 1I1XA 1A47A 2XISA 1BKHA 1WA3A 3QZEA 1YBQB 1RA0A 3MJMA 2VEIA 2F6UA 2C14A 3CTLA 5CCZA 2ZC8A 2Y8VA 4HK5A 2BOFX 2JFEX 4N4PA 5GJNA 3IGHX 2HNEA 2B7QA 4L1WA 5IFPA 1VYRA 4EAMA 1MDRA 1PIFA 3SSZA 1X96A 1KA9F 1THFD 2GQ8A 1SSDA 2XFWA 1P1MA 2D23A 4I9AA 1KFLA 4UTTA 4G6CA 3IUHA 3H2AA 3N2BA 2Z00A 3QH2A 3DCPA 2E5DA 4LC6A 4EOUA 4UQCA 1UOKA 3P3BA 3SCNA 1W31A 4AYGA 2W9MA 3AIEA 3RM8A 2ZTJA 1NWUA 3WENA 3LD5A 1KBLA 2PA6A 1V6XA 3KBJA 3SJNA 1O1ZA 4R7OA 1BGAA 1TIWA 2O0TA 3EWYA 4CNPA 4B5WA 3E2QA 3HG2A 4RPPA 3W7PA 1E51A 3HQNA 1V3IA 3B97A 1NWTA 3PBYA 4UTWC 4WDUA 4UQEA 2VC7A 3BUVA 4LALA 3EPMA 4LVDA 1ISYA 3NYDA 2JEPA 2JE8A 3PG9A 1Q7ZA 3EX2A 5DFAA 1CDGA 1EC8A 5AKQA 2J6XA 3BLOA 3IS4A 2E28A 1OX5A 2VNCA 1HT6A 4RXFA 1GUVA 1ECQA 1N2VA 3VIFA 2GWGA 3CUGA 3VU2A 3WLNA 2V5CA 3SUWA 2PP1A 2VCCA 1EUNA 2ZUSA 4Q32A 9XIAA 4V1YA 5FI8A 3D3AA 4QEHA 3LTPA 3LPGA 5LZLA 4KRUA 1DJQA 1IZCA 4E3TA 2E25A 3N2OA 1RD6A 4QLKA 1UJPA 3DN5A 3F4DA 1CECA 4DUVA 4F2UA 4F0RA 1FWRA 5F2LA 3KCJA 3THCA 2PEVA 1VJSA 4LGXA 3UGVA 3QBUA 1FP9A 4L6OA 1A5BA 2EO7A 2WHLA 1BQGA 1PYFA 4HGXA 3MUZ1 4QITA 4AZHA 1S2VA 1AQHA 3FN9A 1AMYA 2NUWA 2P3ZA 1WP6A 3BQ5A 1ICSA 4QLJA 3UR8A 4D6FA 2O9TA 2PCQA 5C9WA 4CD7A 1ZBCA 4LVGA 4NHVA 3B03A 1VLIA 3N4AA 1Z8AA 3SQMA 4F79A 4JX6A 4HA0A 7A3HA 3VX0A 3QVQA 1EF3A 1E1CB 1PE1A 4GVGA 4HJFA 4P7LA 5CLWA 5IDIA 3G1DA 4MM1A 4BQ3A 4P7OA 2WLZA 3AQUA 1GZGA 3V18A 1DWAM 3S5YA 3GZ3A 4DF2A 2VOMA 2P76A 3UBPC 2Q8XA 4A3RA 1PKLA 4AFYA 2DSWA 4GHRA 3W22A 4H9ZA 2PTYA 1GZJA 3N18A 4IX2A 3FEMA 1M41A 1GW9A 1S3HA 3S5NA 1KO0A 1C8YA 1QT1A 3HQOA 4H00A 3OIHA 3C3NA 4HPHA 4GH1A 2Q02A 2IQ0A 4IICA 3MMUA 1PDYA 1QOPA 2A4AA 1P0KA 3LHYA 3NM3A 1I6NA 3WFAA 1TPH1 2EHHA 3W7CA 4ZFCA 3IUIA 2OWXA 3WEOA 1XYZA 2QIWA 3I3BA 5AC7A 1Q6CA 2D0HA 1QPNA 1XRTA 4CQDA 5I02A 4UTTC 3DYMA 1M01A 3L2LA 4E8DA 2VENA 3ZIZA 4IP4A 1UC4A 4FOUA 4GMEA 2WBKA 4IGNA 3R13A 1QVBA 2CHOA 1WOAA 3R10A 1UMLA 3T4CA 3CXOA 3WD0A 4AVOA 1PIGA 8XIMA 4LBSA 5AHNA 2C91A 3S5ZA 3M0XA 1MZHA 1GVIA 1TVPA 3LGGA 4LYRA 4PRRA 1V0KA 4QS6A 2DZPA 4H9YA 2VEKA 4E2VA 3THUA 3UQNA 2V3DA 3H24A 2DT0A 1JDAA 2Z2UA 4DJED 1FXPA 3LCGA 4X0VA 3ABQA 4DXKA 5CSUA 4NAEB 4B2DD 4M6QA 3VFLA 4QG9A 1ONEA 3ZO9A 5A8MA 3MSDA 1H3GA 1HKVA 3TFCA 2G50A 2WLYA 4Q8WA 4NX5A 4M81A 1Q6DA 3H2NA 4DF1A 2F2HA 1ZZMA 7ODCA 5I79A 4S39A 2ZWZA 3LENA 2WMGA 1ICPA 3LPPA 1FHVA 1AUSL 3KRSA 4S3FA 5A94A 1WNOA 1LRTA 3VGHA 3VNJA 3QHOA 4F0SA 1PL9A 1KGXA 3TZFA 4JX5A 3CV2A 2OG9A 4B5NA 1D3HA 3VNLA 4LT9A 1HQTA 1JNEA 2RGLA 2ZZ7A 3IARA 1OFRA 3LGDA 4GD0A 1QPQA 4KCUA 4AIUA 2Y7EA 1YRRA 4IG2B 2CZVA 1QCWA 1VFTA 5ABGA 2REQB 1W2VA 1WZMA 3KXQA 3B40A 1L6YA 3GVGA 4OECA 3KCLA 3E02A 4FX7A 1HKKA 4XZMX 1DIKA 3W53A 1TWDA 1Q4WA 2J8FA 4GINA 3TSMA 1R9XA 1R38A 5EMKA 2E09A 2Y61A 3BZJA 4W87A 4CKQA 5I3KA 1JPKA 3RX3A 3DHFA 1E43A 4GQGA 3W2UA 1OGSA 1F8MA 2G96A 5A6BD 1G4PA 4AYSA 3PB0A 3TXVA 1P0EA 4HZ6A 4L64A 2FLIA 4IFOA 4EPBC 5CZ0A 2NVDA 3O6AA 4CQAA 1YQ2A 5E6ZA 5CKSA 1TV5A 1T96A 1QTWA 1J93A 1EP2A 1Q66A 1MRAA 3VDHA 1RJPA 3W1PA 2V5BA 3GFYA 4QISA 5L6UA 4LCSA 1FCUA 2J13A 4JR5A 2IKHA 1UR2A 2PURA 4NJKA 1RQEA 1YNPA 4WJXA 5G4EA 3U2OA 1UOZA 1Y0EA 3CO4A 2XDFA 2C8NA 4FXSA 4M29A 1LM1A 2WNZA 4A29A 4UNIA 4LAMA 1DJXA 5DX7A 4O10A 1UQYA 3W07A 4UC5A 5REQB 1HN1A 5A6TC 1MQRA 4PA8A 1YW1A 4AIBA 4M19A 1I2NA 1AH4A 4AIEA 2ZRYA 1XIHA 1TPB1 4ERGA 3AICA 4JD4A 5EFDA 3HPAA 4TX6A 3W7KA 3K30A 1GHRA 3QYSA 2A3BA 5BMWA 3MP4A 2RFGA 4MPQA 1R8LA 5BOOA 5JUVA 4QDPA 3R6IA 4K6AA 2W92A 4N0RA 1KRMA 3MY9A 1QNRA 3N4EA 1SFSA 2ZDRA 1TX0A 1TIMA 3FAXA 3TSBA 5EYWA 5LSMA 2YJQA 3KLLA 1ONXA 1DE5A 1FKXA 2W3ZA 4HTBA 2QXWA 1CENA 1OD0A 2V5JA 3VIKA 2FVMA 4R88A 4PTVA 1XQLA 4GISA 1M53A 3GNRA 2A7PA 2E77A 3T1GA 4UR7A 3BZGA 1W5OA 1SM9A 3BSGA 4OV4A 4GKTA 3OVQA 5I23A 1KBKA 3HBLA 4DWSD 4DX3A 1U1UA 1Z89A 2TRSA 3P7YA 1GVFA 4ZA0A 3VGEA 4KCVA 3EX3A 4C6QA 5HJYA 3I4KA 3LDVA 2OJPA 1OX6A 1PEZA 1DJYA 3H12A 2OU4A 5T26A 3RXZA 4MJMA 1QO5A 5AHLA 2PZNA 5TIMA 2KAUC 3LNPA 2VYOA 3TN3A 3UG5A 1YNQA 3S2CA 4J28A 3RMEA 3E1F1 2XFFA 1KW1A 3OHMB 4IMEA 2HROA 2OVLA 4B9ZA 2BDQA 4HOXA 5CBIA 1PSCA 2PWUA 4IQEA 3EX1A 1PHWA 4LSBA 2O9RA 1MNZA 4GQ0A 4Y9OA 2INEA 4DNMA 4KGJA 5C55A 2PWDA 3E2SA 4PMQA 1V6VA 2WKJA 2QJMA 4PMJA 3EKGA 1N55A 3PBMA 1ZBVA 3WNOA 1C7SA 3TC7A 3P8JA 1FCVA 1HJSA 1RQHA 3CUZA 3DG3A 4BKNA 1US3A 1VFSA 4C7GA 1FBAA 1HJQA 1HF6A 4QX4A 2DZWA 1K7FA 5BOEA 4X2PA 1O5RA 3RLGA 1JL8A 4PMOA 5BROA 4IGSA 3TKFA 1E0UA 1CXIA 4DUWA 3TE9A 4ROQA 2VR2A 2QVNA 1NFPA 1ONRA 3VIGA 1E15A 1JCJA 2JF6A 4ROPA 4QGCA 4DJFC 3TYBA 4JN6A 1GVEA 3TOYA 3THQA 1IEWA 2VT0A 3ZLGA 4JTEA 2YSWA 1R0MA 3NQCA 3SY5A 4Q8MA 2NUXA 1VEPA 1EZ2A 4EWND 1EH9A 4RE4A 2PU0A 3T07A 2ZQ0A 1NOWA 3OQ8A 4TX9A 1Q6QA 3NGFA 5BMXA 1WCGA 3PTMA 4KIRA 4S3CA 3KTCA 1H50A 4MJ2A 1S2WA 4HNTA 2YL8A 1ME9A 2HNHA 3CHVA 1BWLA 2CBVA 3GHTA 5D9MA 2HV5A 2CLLA 1O95A 4HHMA 1JFHA 4DIAA 3M0MA 4GIEA 2GPTA 1QNQA 3PN8A 3NQFA 3FNDA 3QZAA 5HBFA 2BVDA 4PUNA 3FXGA 4WF7A 3AHXA 3PPGA 3DDMA 4JBRA 3W24A 3NQMA 3GY1A 2JIWA 1DPMA 4MADA 3AMCA 1R7OA 3A9BA 1B31A 4EX4A 3GKFA 4AXNA 3KHJA 2ZUNA 4AEEA 4QQUA 1P0BA 1FDJA 3F4NA 3UWYA 3RJYA 4WKAA 1TWZA 3DXIA 4V33A 5GNXA 3WF0A 2PAJA 2TSYA 3UY7A 1JCYA 1LWJA 4LV9A 3PJWA 1YE6A 2VUYA 4ONVA 4IXXA 3H7RA 3BW3A 4PUMA 3CNYA 3UXLA 1XHGA 4YIWA 4GLEA 2FB3A 4LUSA 3VMOA 2XU2A 3ENLA 1MSSA 1ZP3A 1BSIA 1ZRQA 3GFZA 2X05A 3CHEA 4CNNA 3OVRA 3ZVIA 2QDHA 2PDNA 4GC3A 4K8HA 3GXDA 3TLQA 1E40A 1QHOA 4GBUA 3AUOA 3URQA 3RAOA 3M16A 2YA0A 3ONCA 4TUFA 1AL7A 1TX2A 3B8WA 4DYJA 4QTGA 3DFQA 4HYVA 2J9YA 3REQA 1ZJHA 2AMXA 2FZ9A 1TSIA 4JTRA 1YBQA 3GR7A 4L9ZA 3LXAA 4XTDA 2J62A 1UKTA 2R1KA 1V3LA 1OFDA 3UG3A 4I5UA 1DJIA 3TOPA 3RDKA 4ILSA 1E4MM 1YTDA 2R24A 2YYUA 1EYEA 3E38A 1FHDA 4IIDA 1YX1A 5F2IA 4CEUC 4MHBA 2GDQA 1UH2A 3KRZA 3MWCA 5FESA 1OYAA 3T0DA 1A53A 4FOKA 4PGLA 3TTOA 3I10A 3RO6A 3HB9A 3HG4A 3S4TA 1F9CA 5I0DA 3NDZA 3WBAA 3K8KA 3UT0A 3LI0A 5BXRA 2PE4A 4F0LA 1FWTA 2CBIA 4FOJA 5EFFA 3H22A 1ZU8A 1J5SA 1BEUA 3ANVA 3JS3A 4V28A 3DGRA 1DJWA 3KLKA 3OZPA 3AMLA 3L7RA 2OEKA 4QE1A 4J3TA 4W89A 1QI5A 1EFZA 2CKRA 4H6EA 3GRIA 2CLMA 2XVKA 1KM6A 3NVTA 3MUIA 2YW3A 4H6RA 3VIPA 2YR1A 1KWKA 3KRUA 1UZDA 4MY8A 1US0A 1XLDA 3CK5A 1MEWA 4PCSA 2BHYA 3MB9A 3WMSA 5BRBA 1NP0A 4FIQA 5C6MA 2Z7KA 3HFYA 1PKNA 3HPXA 3QR0A 3VD5A 2V30A 4IPPA 3T78A 3FVDA 3UY8A 1OGGA 1HP5A 1L6GA 3U7VA 4ACZB 7PTDA 3T09A 2ISWA 5A8OA 2GJXB 4JX4A 4JIQA 1UIOA 2E67A 3WELA 2G3NA 4MAZA 3PNUA 1RR2A 4YS1A 4UXDA 1XH0A 2E6DA 3MQTA 1HKIA 4O28A 5E0CA 3AHVA 5JIPA 2XIBA 1QHZA 1JVNA 3MCNA 2G3FA 4V2XA 4Y6GA 3R11A 4PUDA 2ZXAA 4H2HA 1QWGA 4MWAD 4OHQA 4A6GA 4BF9A 3BCFA 3SBFA 2DZUA 3RIKA 4A22A 1GQNA 5LNVA 1R3YA 3AZSA 4QDWA 1CI1A 3NDYA 4KH2A 5HPCA 2VD8A 3A3XA 4AX6A 3MT1A 2J27A 5TF0A 1J0ZA 4AD3A 3RR1A 3M41A 3W81A 1TKKA 5CZKA 5FEXA 4CCDA 5D33A 2PWGA 3MI2A 4IGMA 2CXEA 1E1CA 4S3KA 1TA3B 2CLHA 3EB3A 3AU6A 5I3GA 4ZO7A 1EX1A 1VBJA 2VFIA 4JTLA 3TTSA 2DZBA 3KOYA 1JGMA 1KKOA 3FXYA 3LBOA 3T0TA 3UERA 4LF1A 5I77A 4H4IA 3W87A 2DFAA 3W7LA 5FSDC 3PWAA 1E0WA 2BGQA 4QRNA 3BOXA 2G3IA 3SGUA 1IWAA 2IUZA 4GVIA 4D9PA 2UZ9A 4EP8C 4JTUA 3VGBA 2OR2A 2YCEA 2WSRA 4YVXA 1L6SA 3PB2A 2WHMA 3RITA 3N3TA 5TAOA 1LLZA 3EWZA 3LOTA 4ZTXA 1UA3A 1R3TA 1LG1A 4RLIA 4HHPA 3UZ5A 2QUUA 3CWOX 3G22A 1W9XA 2ZA3A 4TV6A 3KS6A 2HCVA 1EQPA 2FYMA 5BRPA 8CGTA 1FWCC 3RO8A 1TVNA 2X2YA 1OCQA 3CLMA 1VKFA 1RK6A 1HL8A 4NRSA 2AAAA 5A2BA 1JZ6A 4E2OA 1ITQA 5BU9A 3MYOA 2OX1A 2D20A 3RG6A 3GTFA 4MZYA 3WQGA 5C9ZA 2B81A 1UJQA 5FJTA 1NOUA 2WQPA 4GQQA 2NWRA 3O2LA 4EWJA 4ZB2A 2OO0A 5C5YA 1SR0A 1LOQA 1Q2RA 1MZRA 4JIEA 1RHCA 1IV8A 2OELA 3WYZA 1VCGA 3G0UA 3SDOA 4BWLA 3CAQA 1B5TA 3FCPA 1K4GA 1W9BM 2OTDA 3CEPA 4GNVA 4S3DA 5JBFA 1TV8A 2V2DA 1PZ3A 2PUZA 1WDWA 1H7WA 4NAEA 2X09A 4XIMA 5KITA 2D3NA 4DRSA 3USZA 5H8PA 1OX4B 4LYKA 1VFOA 4CQBA 3IJQA 1W17A 4GY0A 4K8GA 2YCIX 3WLHA 4AAJA 1ZPTA 2V68A 1NDWA 1F2JA 3TYCA 4Z2HA 4JS3A 1ME7A 2WM0A 4R7WA 2L5HA 3GG1A 3VDCA 5DCEA 1LT8A 3BCDA 3NQAA 1W1A1 3VOFA 1FWDC 4W8AA 2RJHA 4LAOA 4K36A 3EOSA 3GHUA 3M0ZA 4C1NB 3EPOA 2VEGA 4MNMA 4LYQA 4DO7A 4NIRA 1LWHA 1EBHA 2C0AA 3BXWA 4EF9A 3LCFA 1EJXC 3LHTA 5G1TA 1ZUAX 3RILA 2DY3A 1ZGDA 4GABA 4D6GA 3NA8A 3TAOA 4GJ1A 1OCJA 4UZSA 1BAGA 1EXPA 3OQEA 4M24A 1TPUA 3GTIA 2AQOA 1EDQA 1DQXA 4AWUA 4UTMA 3T2QA 3WNMA 5HR7A 3HURA 2EKCA 2BGNE 3I7QA 1XUZA 3NQ2A 1PTAA 3P8IA 3TJXA 3SN4A 3PUDA 2EJAA 5U7SA 2GFTA 1KXQA 1WXYA 5EA9A 1QWKA 5A2CA 1KRBC 3ZT7A 2DSVA 1YXCA 4XBKA 4LUYA 3WN6A 4FS9A 4MZ8A 4F9DA 4XUGA 3ITOA 1XYMA 4C65A 2DH3A 1EWEA 4ALDA 3KX6A 3W1NA 3W1XA 1XDJA 4ZTYA 1RBLA 4IQJA 1X6UA 1GORA 4IJBA 4E8GA 1Q3NA 4IPJA 3BJSA 4L1GA 3A5FA 3NZ1A 1Z69A 2FHFA 5CPOA 3LU2A 3KOWA 1E9ZB 1DXFA 4URIA 3TCEA 3XIMA 3WQDA 4IX0A 3PWIA 1UKSA 1WAUA 3OG3A 3DG6A 1E0XA 3ISIX 1RCQA 4H9TA 5G2IA 4HA4A 4NZJA 3WK1A 4RNHA 4WQ6A 2VDHA 1EB3A 1KCLA 3A4AA 5K7JA 2WJDA 1S3TC 2WZMA 1PB0A 3AIWA 1X1OA 1K9TA 1TZZA 2WB5A 1K70A 1VYSX 5FEWA 1UBPC 4US5A 5T9CE 3WF4A 1M7PA 5CBBA 3O0KA 5I09A 3HMCA 1V7AA 3D47A 3VOHA 4N6EA 1AW2A 1LL4A 1UD2A 3MVIA 4WXZA 3H8AA 1A5KC 5LNRA 2QDDA 4Y2WA 5A3HA 3J7HA 3C8FA 3T0AA 1REQB 2GGHA 1NU5A 2IQDA 2TPSA 4A8NA 2PC8A 5HJLA 4N9CA 2NSOA 1DTUA 2E7FA 3G1VA 4BWLC 2ANUA 2HISA 1IZKA 1E71M 2ZRVA 3BLLA 4H8NA 3UWQA 3PSVA 1OADA 4O1DA 3GDBA 1MFVA 1DHPA 7REQB 2NQJA 2R1NA 2PTXA 5F4SA 4X0NA 4B4FA 4JFUA 4MF4A 2W5FA 1VFLA 4IF2A 3HIJA 1UA7A 1U1HA 4O0ZA 2ZC1A 3A12A 1L6FA 4EK7A 1EJSC 3HN3A 4GFIA 2FMNA 3CMFA 5BCAA 1B57A 1K4HA 1EOMA 3M9YA 3FK4A 3Q67A 4O13A 4DO5A 3IVSA 5ABEA 4PMZA 1Q7QA 4WY0F 1IWPA 1J9YA 1EL3A 3RK8A 1WZAA 5G1YA 1QK2A 2RKXA 2EKGA 4TOQA 4DZAA 3GDMA 2OT1A 4R9XA 2A85A 4PUKA 5EU9A 2PWEA 3FJ4A 3KBSA 3N11A 4Z1BA 2IPFA 4DJEA 2V63A 1KCXA 2OOFA 1FWWA 1WDDA 3WQCA 4Y8EA 1V7YA 5KZDA 1J18A 5ABFB 4B2DA 4MUZA 1AJ2A 1Y65A 4LUIA 2XGIA 3ALFA 3FSTA 3PR2A 3IACA 1MO0A 4FNPA 2VP8A 2P3EA 3SEPA 2Y4SA 3W1RA 4YYFA 3VD9A 5H1WA 1XLMA 1S1RA 1WUEA 1D8WA 1V02E 3CO8A 4JTQA 4C6OA 1H7OA 3SI9A 3HJZA 3BVJA 2OEMA 2OQHA 2G8ZA 3IRSA 4UOZA 1VGAA 5HNUA 1H0GA 3QMTA 3APYA 2D2HA 3BAKA 4M51A 2QCDB 3SURA 4IPNB 2QMJA 3GU2A 2RDTA 1XH2A 3DOPA 4QSFA 1YYAA 1WDQA 2V3EA 1PZ0A 2UY3A 4MUPA 1O12A 5AECA 3CZJA 1TREA 3W28A 4P8XA 1W1B1 3VNZA 4C91A 2BY0A 1SW3A 1SGJA 2PBGA 3F2BA 4E2BA 1RCXB 4I9JA 1RVGA 2NQHA 1HGYA 1TE6A 1XSJA 2QUVA 1H5VA 3W29A 5A6BA 4XZBA 3QTPA 1HIZA 5DLCA 3IVUA 1DYSA 3C2YA 3MS8A 2DT3A 3AO0A 1E70M 1HP4A 2HRWA 2W63A 1JQXA 3GW0A 4ZODA 1AQ0A 5JH1A 3B9OA 4S3GA 4LC8A 2PLJA 4DLFA 2QPSA 3LMYA 4AMCA 1ZCOA 3DAQA 4C7DA 3WJWA 1SJBA 4AZCA 3FYPA 3TX9A 4QE5A 3PJUA 3KP0A 2Z24A 3UJFA 3ABXA 3IJLA 2A1YA 3C2RA 3UFYA 4AG0A 1UUMA 2YA2A 3O06A 2DUZA 4ES4A 1BTMA 2V3FA 2XJ7A 3LLFA 3LEPA 4TTUA 4YTUA 2J7CA 4GX9A 1K03A 1VYPX 1UASA 1BFNA 3WBEA 4FLRA 2PLMA 1XRSA 3FW6A 3T55A 4FSAA 1QO2A 1S1PA 2DUAA 4P8UA 2QPUA 3W6YA 4P7NA 4ZGYA 2LLEA 1U83A 2PDMA 5LXEA 3QLDA 3M7SA 1SYTA 2FHBA 1N8FA 3P5ZA 3GK0A 1UP3A 3AS1A 3BV7A 4OWGA 2YOCA 2ACSA 5C9XA 1BKSA 2C19A 1BYCA 3NFUA 2BX7A 3TC6A 2JIEA 4MZ1A 1V3MA 4PCPA 1X1NA 1CGTA 1UUQA 4JIHA 3STCA 2YPIA 3GVRA 1FTXA 1XDLA 4IP7A 3E2VA 4PMNA 1P7TB 3M0YA 2NQ9A 4DXVA 4ENLA 1JPDX 4OJYA 3QQWA 3GAYA 4M7SA 4DJEC 3S1GA 3GYCA 5HMDA 1PTGA 3VAVA 1A3HA 3G24A 4HPXA 5CZJA 1ZTVA 4BY3A 1E6RA 5LYRA 4ERAA 1QW9A 2Y1HA 2V69A 4AZBA 2Z7GA 3NQGA 1BWKA 4NUWA 3DG7A 3V1PA 3GB6A 5H8MA 3QPYA 1KM4A 1TPVA 4XIAA 2W91A 2AAMA 3SCVA 1WXJA 4UNKA 3XISA 4BQ2A 3SUTA 1QATA 1Z42A 3M44A 1I9CB 2YL6A 1AZ1A 4ZOCA 4QAIA 1TE1A 3GYEA 3W26A 3LUTA 3VCRA 1E6PA 2WC3A 1VRDA 4RK8A 1HJXA 3W7DA 1XX1A 3APTA 5CG7A 1TO3A 3NUKA 2X1SA 3TAKA 1MQPA 1AW1A 4JQ1A 1OSEA 3GXIA 4FZIA 3TIMA 4H7ZA 1DQUA 4WZHA 1WPCA 2BVTA 3BQ6A 1O68A 1Q5MA 2HBVA 2OWCA 1XBXA 1DORA 2NX1A 4UOJA 2E3ZA 1RPXA 1B2YA 3P81A 5HNTA 3GSMA 3UXIA 4XD5A 2W67A 3W7IA 4MB4A 4ACZA 3K13A 1E56A 4EANA 3SO7A 2GJXA 2NLYA 2PDQA 3K8LA 4U5KA 1U5JA 4Q4SA 2J7GA 5FJIA 1E3ZA 3IJ8A 1ALDA 2WYSA 5FJPA 1XYCA 4X9SA 3NDOA 2ISVA 3FS2A 4AZ6A 1B0IA 1V0LA 1XIIA 5ABHA 1FHUA 3HMJG 1XIBA 2BMBA 1JCXA 4TMCA 3UPWA 4HOWA 1WZKA 3A23A 3PFRA 2NVCA 3MUAA 3QXBA 3M5YA 4IMFA 4Q4MA 1P0DA 1V6YA 3SCWA 1IYXA 1AMKA 3NAVA 3MTWA 4KRTA 4C1KA 3PZIA 1JULA 2OLAA 3CBWA 4EAYA 2XH0A 1OF8A 1GJUA 1Q8JA 1TA3A 3C61A 1TJ0A 3UXDA 5HXMA 1V51A 3LA4A 3USBA 4IGHA 4QNWA 3KWXA 3N3MA 3WDHA 2VFDA 3PSWA 5I3JA 4GJIA 1IT7A 1CX9A 2HVNA 4GQBA 2HBXA 1B3WA 4GCXA 1XLEA 1OF6A 4JTKA 1VP5A 3OYZA 4Z2KA 2Z27A 1XLIA 1HKWA 1CNVA 4M6VA 4QJ3B 3T9PA 4BJHA 1IXQA 5AHIA 1RP9A 2PPGA 4MNJA 3PBVA 5FJRA 1TJ1A 2R91A 3PK7A 1HZYA 1XRVA 1KKRA 4XO6A 2P5NA 4PEKA 4B5TA 4DWSC 3NURA 1XIDA 4R7JA 3ANUA 3CT7A 4KRZA 1X97A 1RP8A 3QF0A 1E72M 1Q6LA 1Q7MA 3OOQA 1YLVA 2WW5A 1WKYA 5A1AA 1VBRA 4HP5A 4HNCA 3ARUA 4KESA 1A0EA 1UG6A 3WIJA 4P61A 1BQCA 2CLEA 5LNWA 4PTMA 4RZ6A 4AY1A 2DZSA 3NO3A 1UWUA 3KVKA 4IZGA 3QFWA 3URBA 3E2RA 2WHJA 1JI1A 2CBUA 1EP3A 5F1UA 3KUMA 4C6FA 3STPA 4MNLA 4JQ3A 3VUSA 2Z1VA 5FJOA 3UETA 5CZSA 4UFHA 2H8ZA 4UR9A 4LEQA 4TIMA 3Q4DA 5K9CA 3WX7A 3F1QA 3CQKA 4CCEA 1M04A 3W76A 3NL3A 3IIZA 3UVIA 4GH3A 3C8NA 3GG7A 4W4QA 3NNTA 1EA0A 5DQPA 3ABOA 1E3XA 4PODA 1OX4A 3Q37A 2QLYA 1PX3A 1GVSA 4LANA 1OG6A 1ZP4A 4HHHA 2QDEA 2G37A 3WDRA 3L67A 4FXRA 2XN0A 3SRHA 3CUHA 4L6DA 1C8QA 1FCQA 3W82A 4EPDC 4YYCA 3H2FA 4GUHA 1UZ1A 4KWSA 1F74A 1MXSA 1UBSA 3TYAA 3ID7A 4E6MA 5HQEA 5D8WA 2YXOA 4OGZA 2HVMA 1B1YA 3MHGA 2OKOA 1P48A 4IUOA 4CNSA 2YKKA 1D2KA 3WLKX 4W7UA 2Z6JA 3CYJA 2CZFA 4D8ZA 3W7RA 3TJLA 1NFBA 4K1GA 1E6QM 3BTNA 1GCYA 3EMQA 5J5RA 1R3WA 3GNXA 1OWQA 4R85A 3SY1A 4AD1A 4FLQA 5FA5A 2X1UA 3S6TA 3VKKA 5IDZA 4XZ9A 3IGSA 4XVDA 4K3ZA 1C93A 5JH2A 2J88A 3ZSSA 3QR1A 4DZ5A 1B9ZA 3WLTA 1T8QA 1EWDA 4KWOA 4RE3A 1A5NC 1R3SA 1PCWA 4U10A 1QUMA 1RV8A 1ITUA 3ZS4A 4WJ8A 3VNMA 2I17A 4O57A 3OG2A 4PCTA 4ICNA 2E6FA 4MWAA 1TTPA 5DN1A 4H8UA 1A3WA 4F0KA 4LCRA 5T8GA 4GRSA 3GZAA 1OGBA 2WJFA 3VOCA 4FAMA 2I56A 4CNUA 2PDPA 1Q85A 3L9CA 1GOMA 2PZ0A 2WMHA 2ZYFA 1A3XA 4AX7A 3RU6A 4HIBA 1IZJA 3LCIA 2VCAA 1W9VA 2NV1A 3LRMA 3AYTA 4QCEA 2PDUA 3N9RA 2ZRXA 2WSYA 1LQ2A 1I0DA 2X1TA 3B04A 3SCSA 5EBUA 4DPQA 4UCGA 3AIRA 1MUMA 2WKGA 2ZBTA 3ZMRA 4AXKA 2FTYA 1UP0A 4PSRA 1REQA 3C52A 3V5FA 4EXAA 4HB7A 4O1BA 3N12A 3OGSA 3CV7A 3H2EA 4OBRA 5LHEA 3GXPA 1TUFA 1H0IA 2Z1XA 4YN5A 2QPXA 4KCWA 3PULA 1JCMP 4N9BA 4GGBA 3W00A 3MBFA 2ZCGA 3H70A 2WSKA 3AJ7A 1E6NA 4PMRA 1U2YA 4NNAA 3N29A 3H4GA 3CAWA 4D6IA 1M03A 2QGYA 2R14A 3EEGA 1E55A 4M82A 3W6LA 3R5EA 4M5PA 3ZVHB 4IM4A 3EWDA 3V0SA 1RBOB 3O05A 2P53A 1POKA 3WQ4A 3DFHA 1P6WA 3VKBA 3QKEA 3WD2A 3AYSA 1CB2A 4C1LA 2Y8UA 3IAPA 3D46A 2YDQA 1RSCA 3I7SA 4W93A 2Z1SA 2X16A 1X98A 3Q2DA 1JDFA 3HPFA 4WHBA 3LPOA 2NV9A 4WDWA 4B91A 3TW9A 2QJGA 3EXTA 4DUOA 1H7RA 1GOQA 3G1XA 4C6EA 1G0CA 3BK0A 4MY1A 3GNPA 1QAPA 3HGRA 5ABFA 4HSOA 2O7QA 2WBGA 3JVAA 5CPMA 4UNLA 3KM8A 4PBEA 4DUXA 1UIPA 1M7OA 3FOKA 3IWPA 4HN8A 3GDKA 3S6OA 4NZ1A 1W5QA 5FF3A 2B7OA 3RPDA 1KTNA 1J6OA 5EY5A 5CGQA 1Z32X 1AK5A 3DH7A 4AHQA 5HWNA 3WH6A 4CU6A 1EPXA 1KXVA 4GZJA 2A79A 3DGBA 3SUSA 2BXYA 2JKEA 3S46A 1GG1A 3L4TA 5EMLA 2QCDA 1W8SA 4J1OA 4OIFA 4RZ5A 1L8NA 2ACUA 4BI7A 4MWAC 3DYOA 1SSGA 3LK6A 1HFBA 1C90A 4LJ3A 4C6KA 1IHIA 3C2FA 4Z2IA 1UWRA 3QY7A 2HWGA 4O8AA 4UR8A 3HGSA 5AYZA 2IPJA 5FEZA 4LS2A 1UR3M 4L9YA 1H49A 3W7JA 4UOQA 3THAA 1SO6A 2ZKMX 1OABA 3SQLA 1F3XA 1XBYA 3KRBA 1DHKA 3MDUA 1FOBA 4FIRA 1SMDA 3ABZA 4AISA 5D38A 2C71A 3RRAA 1KD0A 3VNKA 2DEPA 2DORA 1WXZA 4AEOA 3AYRA 1LG2A 3PHAA 1NWRA 1TQJA 3KS5A 3GD6A 4GOAA 3LRLA 1X6NA 2WSQA 4M7TA 1SZFA 3IRDA 4MVAA 1LQ0A 4GNJA 3A4WA 2QW5A 4NX0A 5TBOA 5BXPA 2ODOA 2YL5A 1MUWA 2W62A 3U6WA 3LQGA 1G6CA 3BAXA 4NG3A 4U3AA 3QLLA 3T7VA 2H9AA 1KQYA 5A69A 3L23A 3WF2A 4AHOA 4W8LA 4WOQA 4YTTA 1PHQA 4ZB0A 1VFHA 3KZPA 3NZGA 2ZRWA 2IXUA 3DC0A 5M5DA 3DFPA 1K7EA 3GNOA