4C6EA

Crystal structure of the dihydroorotase domain of human cad bound to substrate at ph 5.5
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
364
structure length
363
Chain Sequence
KLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROOROTASE
publication title Structure, Functional Characterization and Evolution of the Dihydroorotase Domain of Human Cad.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 119
structure length 363
sequence length 364
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4c6eA00
4AQLA 2Z26A 4GC3A 3S2NA 4IF2A 1PSCA 3A3WA 4ICMA 4C6IA 1FWEC 3GIQA 3NEHA 5FSDC 3CAKA 1YRRA 1J6PA 3ISIX 3A3XA 3R0DA 3V7PA 3MSRA 4IG2B 4LAKA 4EP8C 2OODA 4C6DA 1I0BA 3S2LA 1V51A 4NP7A 3TNBA 4QRNA 3ORWA 1J5SA 4D8LA 1EF2A 3WYZA 2HQAA 2UBPC 3LA4A 4AC7C 3OJGA 1FWHC 2QT3A 2Y1HA 4DO7A 2G3FA 3RCMA 1NDVA 2VC5A 3E0FA 3FDGA 3QY6A 4XAFA 1FWBC 1P1MA 1A5KC 4F0RA 4GY0A 4EPBC 2Z28A 1FKXA 4DLMA 4DIAA 3T8LA 3E38A 1HZYA 3GTIA 4H00A 4KQNA 1EJVC 1O12A 2E1WA 2GWNA 1EJUC 3URBA 2RAGA 3TN3A 2A3LA 4ERGA 3MVIA 3GTHA 4DI9A 3MDWA 1BF6A 2FVMA 1UMLA 1P6BA 4CNSA 3AU6A 3GUWA 3LS9A 1FWAC 4M51A 3GIPA 1KRCC 1A5OC 4GX9A 4C6LA 2AQOA 2ANUA 2YB1A 1GKRA 4NI8A 5HMEA 4C6QA 4RDVA 4CEUC 3T1GA 4ZSTA 3D6NA 3JZEA 3HTWA 1FWJC 2D2GA 1R9XA 4IFKA 4ERIA 4HK5A 1I0DA 2HBVA 3ID7A 1P6CA 2Q09A 2Q01A 4C6PA 2CZVA 3E0LA 4PE8A 1UBPC 4HA0A 4HJWA 4KEUA 3K5XA 1RJRA 3IARA 1RA0A 1VFLA 4QROA 2R1PA 1V4YA 4UB9A 1PO9A 2P50A 4WVXA 4XD3A 3OOQA 4R88A 4GBDA 4PCNA 3E74A 4BKNA 4R85A 2WJFA 4IGMA 4PBFA 2PUZA 4RDZA 1POJA 1EJRC 4C6EA 5G4HC 4MUPA 4LANA 4C6OA 4KEVA 3PNZA 1V77A 2Z29A 1A5LC 2GZXA 4C60A 1EJSC 3G77A 3RYSA 4B90A 1FWFC 4LCQA 4KETA 2D2JA 1EZ2A 2QPXA 1JGMA 3TN4A 3OU8A 4YIWA 1M68A 4L9XA 1M7JA 1XRFA 2Z25A 4G7EB 1YMYA 1K70A 4PCPA 4RDYA 4KF1A 2E25A 1A4MA 1RK6A 2EG8A 2VUNA 2YXOA 3GU2A 3T81A 3UF9A 3B40A 4LFYA 3EGJA 4CQBA 1GKPA 4UBPC 2R1MA 2Z27A 3KM8A 5CH9A 3F2BA 1NDZA 4C6BA 1FWCC 3K2GA 4C6MA 3TN5A 1V7AA 4DYKA 4LH8A 4TQTA 1PTAA 2Z4GA 2WJEA 4B92A 4IGNA 4GX8A 1EYWA 1RA5A 4G7EA 4DI8A 3S2JA 4XAYA 4H9ZA 1RJQA 4IG2A 2WJDA 2KAUC 1KRBC 2IMRA 2AMXA 1RAKA 1E9YB 3IGHX 1YBQB 4GZ7A 1S3TC 3E2VA 3GU1A 4EPKA 4GY1A 3S2MA 4F0LA 3O7UA 3A4JA 2BGNE 2HPMA 3TN6A 4BY3A 3F4DA 4GY7A 3PAOA 1WXYA 1J6OA 3FDKA 3FEQA 4C6KA 4GYFA 4XD6A 3CJPA 4C65A 2OGJA 2VHLA 3MJMA 2VR2A 3ICJA 1IE7C 2QVNA 2PLMA 1YBQA 3GRIA 1ZZMA 2P53A 4LAMA 2XIOA 2VM8A 4CEXC 1ADDA 3UBPC 2F6KA 2Z2AA 3PBMA 3LSBA 1XRTA 3F4CA 2AQVA 3IACA 4XD5A 2Z2BA 2I5GA 2WM1A 1EJTC 4J35A 3DCPA 3IPWA 1ONWA 4IFOA 4HK7A 3AU2A 2OQLA 2D2HA 4V1XA 2GWGA 3C86A 1POKA 4H9TA 2R1NA 2O4QA 2OOFA 3QY8A 3OODA 4INFA 4DZIA 4DNMA 1A5MC 1NDWA 3LNPA 4NG3A 4CNTA 4IFRA 3QGKC 4I6VA 4L6DA 4ZSUA 4KEZA 2Z00A 3F2DA 4R7WA 1V79A 4J5NA 5LXXA 2EG7A 1EJXC 3K4WA 4DZHA 2I9UA 4H01A 4H9VA 4QTGA 2YZ5A 2HNHA 2FTWA 2QS8A 3URNA 5A6TC 4GXWA 1A4LA 3GU9A 2Z7GA 3WZ0E 1J79A 2GSEA 3DUGA 2PGFA 2R1LA 5AKQA 2HBXA 1KRMA 3GTXA 3HPAA 4C5ZA 4RDWA 4IH3A 3EWCA 1FWGC 4EPEC 4H9XA 3GTFA 1DPMA 4KESA 4F0SA 3SO7A 1KCXA 4XAGA 3EWDA 3QGAC 3HM7A 1GKQA 1K6WA 1FWDC 3LY0A 4XAZA 1WXZA 3QY7A 3O0FA 4OFCA 2R1KA 2DVTA 3MVTA 1RK5A 3UR2A 3IV8A 4H9YA 4I6KA 3CS2A 5FSEC 4RZBA 2O4MA 4CQDA 4C6NA 4QS5A 2W9MA 4H9UA 2VC7A 1EJWC 4J2MA 3N2CA 4H9MA 4BJHA 4QSFA 2GOKA 1W1IE 4LAOA 4PBEA 3B0YA 2PAJA 2Z24A 4B3ZA 4E3TA 4IFKB 4HK6A 1XGEA 1YNYA 3LGGA 3BE7A 3LGDA 4RE0A 1R9YA 3GG7A 1A5NC 4JOMA 2UZ9A 4G2DA 4LEFA 4XD4A 3URAA 3MPGA 3AUOA 1QXLA 2YB4A 1NFGA 3SFWA 3ITCA 4LCSA 3MTWA 3LU2A 3RHGA 2FFIA 1E9ZB 3MDUA 3NQBA 3IRSA 2EG6A 4KERA 4ERAA 5HMDA 4EPDC 1O5RA 3DC8A 2ICSA 1ITQA 3NURA 4DLFA 4QS6A 4CQCA 1R9ZA 2FTYA 4LCRA 3UPMA 4B91A 4Z42C 4GOAA 4WHBA 3IJ6A 4GK8A 1K1DA 1QW7A 4C6FA 1M65A 4KIRA 1ITUA 1YIXA 3PANA 2ZC1A 2HPIA 3F2CA 1RJPA 2BB0A 3B0XA 3OQEA 1NDYA 4C6CA 2DVXA 3LSCA 2FVKA 1UIPA 2PGRA 4CNUA 1FKWA 3OVGA 4LALA 3UR5A 4V1YA 1FWIC 1ONXA 3E3HA 3WMLA 1UIOA 4IQJA 3URQA 3MKVA 1PB0A 4WGXA 3S4TA 2DVUA 5E5CA 5HMFA 2ADAA 1KRAC 4P5UA 2OB3A 1XWYA 3PNUA 3RN6A 4C5YA 4C6JA
chains in the Genus database with same CATH superfamily
4CN1A 1XBVA 4G9PA 3H4XA 4ASTA 4GC3A 1PSCA 3FYOA 3CWHA 3B06A 1F3XA 1B9BA 4H8NA 4Q32A 2V0TA 1DTUA 4FX7A 4IX0A 2VTFA 4HB7A 4LAKA 4W8LA 4L4MA 2Z7KA 1NF7A 2WOQA 1EX5A 4S3KA 1PTDA 2B31A 4YWIA 1O6IA 3AHYA 1J5SA 1TFVA 3QXBA 1EF2A 3XIMA 4DO7A 4CU8A 3C0LA 1FOBA 2QCCA 4NIRA 4DXXA 4PCSA 2V5BA 1H7PA 4WX2A 2SFPA 3MSDA 3KUMA 3EKZA 1FKXA 4DIAA 3C2OA 2J7CA 1J4EA 4W7WA 3URBA 4O10A 4QCFA 5CPSA 2X2YA 3U2ZA 3CK5A 3DH7A 2NXIA 2VGBA 3LZ3A 3MV01 3ZIZA 4HYVA 5AY7A 4PMDA 2DP3A 4ATLA 1DIOA 1W3IA 3USZA 1VC4A 2GSJA 1KNWA 3T1GA 3T2PA 4L4PA 7A3HA 3B9NA 3PUOA 1XBZA 3HGJA 4AY7A 4K8EA 4U4MA 1XLIA 4FOUA 5C9XA 2WBKA 2DORA 2VZOA 1UP3A 4GBDA 2DUXA 2F8QA 1XFCA 3YPIA 3GK0A 1DWAM 4JIIX 4ROQA 3BQ6A 1TVLA 3ARSA 3UZ5A 4AHQA 2VEMA 2QDGA 4GWEA 2AOSA 2AKZA 4XO6A 3M64A 3W1UA 1CB7B 1YMYA 3VD5A 3LM7A 3ABOA 3EA3A 2YXOA 1RD6A 4QR6A 4NZ3A 4GBUA 1DOSA 1UC5A 1VFUA 4HU3A 1UW9A 4YS1A 5HR7A 8TIMA 3PZVA 1UZDA 1SPQA 2PDWA 4TX9A 2A3BA 2FKPA 4U3CA 4Y8FA 1BPLB 3TNOA 1VYRA 5LA1A 1OCQA 3O8AA 4ZFMA 3DI0A 1UOZA 2WKLA 2PTYA 2KAUC 5A6SA 1TQXA 3ARTA 4BI6A 4H8HA 5D02A 1RAKA 3NCOA 2WHKA 4PMQA 4X22A 4ENLA 2WNQA 3HMCA 3UCQA 4EF9A 1YPXA 1XC6A 1ICQA 1SFJA 1UD5A 3GVGA 1CEOA 1FH8A 2XVLA 3M0VA 4Q33A 5IBXC 2H8XA 1LBMA 1AJZA 3Q94A 4P7NA 2GJXB 4IPNB 5BXSA 3V5CA 1BVNP 2XSAA 4X3ZA 1T5AA 1XIDA 3USBA 4CEXC 3AIRA 2CLHA 3AMKA 3KFTA 2PGWA 1KCLA 2X7WA 3VK5A 3UNTA 3BG3A 3VNKA 4L1WA 3TYBA 3P8IA 3CQIA 2D2HA 4F79A 2GGJA 4JNYA 2NW0A 3F4NA 4UUIA 5CAHA 5I09A 3EWUA 3GYCA 2CU0A 3TC6A 5F4SA 3DHUA 1YXYA 1L6YA 1K77A 4CNTA 4O17A 4L6DA 5AOUA 2GVGA 3BGGA 4JYFA 4EAMA 1QUMA 4U31A 5U4NA 1V79A 4IICA 3B8WA 2PCQA 4DZHA 2I9UA 4BWLC 3SY1A 1JG9A 4Z1DA 2O9OA 4IIGA 7TAAA 3UWVA 1F2JA 1ZAIA 2YZ5A 3PM6A 3VNDA 1RBLA 3VIOA 3UG3A 3B0PA 2PP3A 1KRMA 1VJIA 3N04A 4CCEA 1RPKA 5ABGA 3O06A 3GTFA 1DPMA 2VFEA 3TXZA 1ZBWA 1KWGA 4IXXA 2EJAA 1V03A 1DJWA 4KS0A 3LHTA 3N18A 1D3GA 2H90A 3BAWA 1ZHAA 4JTIA 2DSZA 3DENA 2INZA 2AQWA 2J7FA 3MVTA 4LSBA 5IXEA 3L4UA 3TW7A 4Q8QA 4V27A 1EUAA 4J3XA 4HOZA 1NFPA 1LOQA 7PTDA 3MBDA 3QTPA 5FSEC 3ATZA 3C5QA 2D0FA 3VIPA 1REQB 4K68A 5IM51 2JEPA 4UXDA 1Y5WA 1GTEA 1KM2A 2HROA 3GVVA 3L4YA 1W1IE 4PSRA 1B9ZA 2DZPA 2NV2A 2ZXBA 3LGGA 1FVPA 1R9YA 3P82A 3WMSA 2AL1A 2CHRA 4UTIA 4AVFA 4JOMA 2P8CA 2DT2A 2W27A 3AYRA 3SURA 5CPOA 4LX4A 4QAWA 1QXLA 4IP4A 3ITCA 5JIWA 3MTWA 3UQNA 4WZHA 1IR1A 3NXLA 3TYZA 4TTGA 2X1SA 4H8UA 1S2TA 1O5RA 1NWTA 1LP6A 4XX6A 1KV8A 4DAIA 4MAVA 1JD7A 1Q65A 3QJAA 1K1DA 4MOZA 2ZC1A 2HPIA 1OEPA 2ZZ6A 2FQIA 3M4HA 2NUYA 3RAOA 1J0YA 4YWSA 3W25A 4ZE4A 3S46A 4BFAA 4FIQA 1JR1A 3J7HA 1FKWA 3OVGA 3VO0A 3RPDA 1X1OA 3DGBA 3SB0A 2R24A 5D37A 1TREA 1Y5XA 4N0RA 3IUIA 3QMTA 4WSJA 2I5IA 4QHRA 3DYPA 3RU8X 3W02A 2BOFX 3G3DA 4W5UA 3S2NA 2WCAA 3A4XA 1RHCA 1XYLA 2QUTA 4C6IA 1T7LA 3BARA 4IGSA 3SQLA 4GINA 2WZEA 3ISIX 2WWDA 3SGUA 3W1QA 3MUZ1 1I0BA 4OT7A 3VCCA 4HHLA 4CNPA 3C2VA 4HNUA 4NYYA 3WQDA 2B7PA 3QZEA 3P3BA 3GHTA 4UFIA 3TQPA 3LA4A 2YBUA 1EBGA 3LEPA 1NM9A 1GJPA 2YYUA 4AX7A 1WOAA 3LTSA 3QY6A 4UNLA 1JPDX 4PMUA 3CV1A 4FHAA 4IGHA 3ARXA 3W7JA 3WEOA 1S2CA 2XIBA 3GAYA 4GISA 3WG6A 3HJZA 4Y9OA 2BMBA 2OZTA 4D8ZA 2ISVA 3M0MA 4IMFA 4NRSA 1PX3A 1UZ4A 5LIKX 3W70A 4AZGA 3BICA 1SJAA 3A22A 3AU6A 3QOKA 4ICNA 5C6MA 1XH0A 1DWIM 4UC5A 1AQHA 1MEHA 3GH5A 3RX4A 1XYFA 5CPQA 2WNZA 2VR4A 2PE4A 1XC4A 4Q4QA 2GJRA 3N2MA 4B5SA 4HN4A 3UGVA 1HL2A 2DH2A 2DQWA 1JZ7A 1XLLA 3OG2A 2HVMA 1LLOA 1XCWA 1XKJA 2E4TA 4KRUA 4HSNA 2HMCA 2NQ5A 2EAWA 4REQB 1PAMA 4C1NA 1LOSA 4MY8A 3HURA 3MS8A 3WH9A 2D2JA 4N9EA 5DF0A 2BOGX 4Z2LA 4LU0A 2PP1A 2PWDA 2VC9A 2ZRYA 3GO2A 4CQAA 4GJ1A 4PCPA 3NQDA 4DHGA 1A4MA 1SZFA 3W3OA 4I7VA 3VD9A 4ADSA 3CZJA 3QSTA 1AL8A 4AVOA 5HNTA 4JTCA 1TWDA 1MXDA 3FN9A 4M6PA 1TV5A 4TMCA 1Z41A 1RQBA 3KBJA 2Z4GA 8XIAA 3VUSA 3ITVA 1VBRA 5CAKA 3OB8A 1YPIA 4IPLA 3SCOA 4DI8A 4GRSA 4H9ZA 3LBCA 3I6TA 4HZMA 2VZVA 2D22A 2GLKA 3MI3A 3EDJA 4RW5A 1MVYA 4GQGA 4F66A 3UWZA 4GZ7A 3P5YA 1S3TC 3T78A 3ABSA 1OFQA 3MY9A 4M8UA 5KINA 3WLRA 2R82A 1NU5A 2XSXA 4BF5A 1ZY9A 5JMUA 1PIIA 4GI6A 4AXNA 4ILSA 3ARQA 2VFGA 5LYRA 4JTGA 5G1MA 3W7HA 1SYTA 3I65A 3L4TA 3UWYA 3U6WA 3L2LA 4IIHA 3CUFA 3VFCA 1DQXA 2INFA 3OLIA 3RCYA 2VFDA 2G4JA 2NUXA 4JQAA 4JTKA 3KDNA 3T0BA 2GL5A 1O1HA 4HHPA 3GFZA 2J62A 1HKMA 2GVLA 3BLIA 2OFJA 5I78A 1G7UA 1XLGA 4K37A 2A3HA 2DIEA 1NIUA 4QJ4B 3QF0A 4RNHA 2PDPA 3AJ7A 5G4WA 2J7GA 2NVCA 4YTQA 2WZTA 4MWAE 1QK0A 4FR6A 4M81A 2E6AA 3C52A 4KEZA 2Z00A 1VPYA 4RNJA 5E1QA 5LXXA 1H1NA 1VFFA 1UWQA 1Q6LA 4GC4A 2IPGA 1H49A 3OBKA 4UQEA 3WQOA 2BSLA 2PF8A 2VENA 4UR9A 3IJQA 1UUMA 1F4AA 5JVLA 4B2DD 4IIDA 3C0JA 2OKTA 4Z2JA 3OPSA 3L68A 1S5TA 3LHYA 3H4GA 2XU2A 3SO7A 1EB3A 4MZ8A 3MO4A 3QHMA 1M9HA 1ZNNA 1I8JA 4O8RA 3V1HA 4OFCA 2DVTA 4AD4A 1IXOA 4H7ZA 3CH0A 3MW7A 4ZO6A 4JD4A 1M01A 5CZJA 2YBTA 3HG2A 2W9MA 1QAPA 2QJMA 4QG8A 1UQZA 1XDLA 1DXIA 3VNMA 4K39A 2A6NA 4J2MA 4QEHA 5HJXA 2OYLA 4L1XA 5AB3A 3GW0A 1BQGA 3CZEA 4HK6A 3QR3A 2V8ZA 2R91A 3WF4A 4PUWA 4RV8A 4IP5A 3PTMA 2NV9A 1CXFA 4XD4A 3URAA 1R7AA 2RUSA 3BSGA 3ZO9A 2VWTA 1BG9A 4LUTB 2XH4A 3P62A 3NURA 1W17A 2XIJA 1EJ7L 3LLDA 4B15A 1K9FA 5EMYA 4I9TA 2OSXA 3NPUA 2ZZ1A 1XQLA 3WCZA 2AMGA 3VDGA 3LX9A 1XBYA 2CBJA 1UWSA 3SY8A 4K8HA 7ODCA 1H11A 3G6LA 2GK1A 3EWYA 4M5PA 4PUDA 4A3RA 4L6HA 3ZT7A 2PRLA 3DFSA 2E8ZA 3VX0A 1TG7A 3DHFA 4E6MA 3KOYA 1YPFA 3NDOA 1T8XA 4B5VA 4M0XA 4QDMA 4Y6GA 1LUCA 1DXEA 1XG3A 1W1ZA 3KLLA 5DQPA 1RXOB 5FL0A 5J8LA 4ICMA 1H5YA 3WF2A 5FF3A 5FSDC 3POCA 4NILA 2C16A 3CPRA 4Z17A 8A3HA 1SW7A 1ZUAX 2VQUA 3VDCA 4A8NA 5JXQA 4C6DA 2YIHA 2FH8A 4W93A 4HPNA 4PMOA 1HJUA 1Q7MA 4H2CA 1KM4A 4AZCB 5BOFA 3OJGA 2HE8A 4GUHA 3LN3A 2G3FA 2C6QA 4WCJA 3SUVA 1A5BA 3VNJA 1X6NA 2PCEA 2IQ0A 4HNOA 2CBVA 4E0CA 4KWSA 3G1RA 4BZYA 1GJUA 3T8LA 1ONRA 4TVCA 2XSBA 3NSMA 1W3TA 4FEZA 5F1UA 3IGSA 1PZ3A 4C1KA 1P6BA 4CNSA 4S1FA 2O7SA 4XBSA 1CLVA 4LQ1A 2NT0A 1GYMA 2AQOA 2ANUA 1KD0A 1EHNA 3S8HA 5BRQA 3L5AA 3LI1A 4KGLA 2HBVA 3WLHA 3KP0A 4A21A 4LF2A 4HA0A 1R2SA 3BJFA 3WSUA 1X96A 1TWZA 1MQQA 2Q02A 9XIMA 2AGKA 3WDRA 4AD3A 2A79A 1NWUA 2ZUTA 4DF2A 3DYOA 4LGXA 3EWXA 1CNVA 2WJFA 3RR1A 4PBFA 5LGZA 4O54A 3NM1A 3LGEA 5D9PA 2Y0FA 2DQXA 1OB0A 4C60A 3V0TA 3NVDA 3K13A 1TMLA 3GUGA 2PB1A 2IW0A 2QCGA 3NVTA 3CB3A 5KETA 1BWLA 3P0WA 2VCCA 4LYPA 1EA0A 3T81A 3KE0A 4F0MA 3LCXA 2ZRXA 3RLGA 3W72A 4PMJA 1LORA 2R1MA 2Z27A 1WKEA 5ABFA 3DFHA 3TWBA 2ZE0A 3TTOA 3IJ8A 4N9BA 4S3EA 1XR2A 4KPLA 4E8CA 1WZLA 1FP8A 4HMNA 3GY1A 4DN1A 3ME3A 3GVQA 1VLIA 4OGZA 3IAQA 3NJ3A 4UNIA 3Q45A 2YPIA 3IANA 2BBFA 1A80A 1PKNA 2GOUA 4GI4A 3WL1A 3I7QA 4DWSD 1UKSA 1FWWA 2YLAA 5AYIA 4FS9A 4GY1A 4CUCA 4DAFA 1W5PA 4EAYA 1R5YA 4HNTA 2P10A 5ECVA 2X1IA 4DJEC 2V5KA 1ZJHA 5CG7A 2C19A 1G4PA 4EE9A 1THFD 3PBVA 3IIPA 3P60A 1WDRA 4GYPC 1UH4A 1GOQA 4J1OA 5CCZA 2QVNA 7TIMA 3GHUA 1WZKA 1RD5A 3OP2A 2XIOA 1D8CA 1LLWA 1PKYA 4JTSA 2YOCA 3F4CA 3AZTA 2ZZ7A 4XD5A 4E3VA 4HHHA 1TPVA 2WWCA 4O12A 1LDCA 3WUBA 1EGZA 4PCFA 1PZ2A 2ISFA 4L7ZA 1EDGA 2WMIB 4YHGA 2WMHA 3UG5A 4TVDA 1GVRA 1NQKA 4H04A 2WNWA 1DJIA 2BDQA 4OOUA 1I75A 4YN5A 1WPCA 1FUYA 1OD0A 3Q2DA 3QY8A 1VJZA 3W74A 5CLWA 4Q7BA 3KL5A 1PDYA 3WH8A 3TYDA 1R3VA 3KZSA 2VRQA 3VM7A 3EMZA 4P8WA 4I6VA 3FK4A 3WL0A 4LWWA 1B3YA 4FI4A 3HGSA 2RJHA 1EJXC 3K4WA 1J11A 4DZAA 4H01A 2CBUA 1M6JA 3PUGA 5CBIA 2CLMA 3GAKA 3NGFA 4NJGA 3WD4A 3FYPA 3DOPA 4DYEA 4HPHA 1WE5A 1BD0A 3HG4A 1GJWA 3ZWSA 4CN4A 4A6GA 4NL1A 4F0SA 3IJDA 2RH9A 3CQ0A 1KCXA 1EPVA 3H2OA 4JFTA 3EWDA 4Q8NA 4GCAA 1GKQA 1ISWA 1XYAA 3LY0A 3VX1A 4DJFA 2WJZA 3UVIA 3TTQA 4YL2A 4GXPA 2CEQA 1IT0A 1E6PA 3UVAA 3H53A 1HGYA 3WUGA 4C6NA 3SCPA 3WD2A 3L4XA 3PJUA 1EP3A 4NZFA 4M1RA 1KC7A 3LENA 2AAMA 3OLDA 4LS0A 2Z24A 1L6SA 3OLEA 4J3SA 3SEPA 1H09A 1JPHA 2QDHA 4ONVA 2UY2A 3W0KA 1XLAA 3RRXA 5BOEA 2UZ9A 2XUCA 4UTTC 5G1TA 3VE7A 4JN7A 1EPXA 1ISZA 5K4ZA 2E68A 3UESA 2ZUUA 1XG4A 4QISA 3P74A 3R7MA 5D2WA 2GJLA 4YLWA 4HJFA 1R9ZA 1K7EA 1UP2A 3UPMA 2PLKA 5C2XA 3CMJA 1ZS2A 3KVLA 4Z42C 2GJXA 3AO0A 3WLLA 2Y5JA 4WY0A 1PS9A 1JZ2A 5FJJA 1Y5VA 2YXXA 2CXEA 4KCTA 3WQWA 5EU9A 1RJPA 5HUOA 4ATWA 4C6CA 4UTKA 2BY1A 3M0ZA 2Q3RA 2PDQA 2PEVA 5LZLA 2NQ9A 1KQYA 1ISXA 3TZNA 4S39A 4RKAA 7REQB 3KS6A 1PX8A 3TCSA 3FGCB 3W07A 1UR2A 4FB7A 2H9AB 1TV7A 3WO8A 1OIMA 2OZ0A 3HB9A 3UWWA 1RCXB 3I6EA 1V0MA 3T08A 5KTLA 1Y8BA 1QMLA 5A94A 4IF2A 2G0WA 4A2RA 1S5NA 3GXMA 1DE5A 1TWIA 4JFUA 3AIBA 1R0MA 4EP8C 1J93A 4QDPA 1V51A 2YW3A 2X0YA 1QI2A 2QJIA 2IS7A 4N42A 2OEMA 3KVKA 3WEMA 1UASA 4LUJA 1LWIA 3II1A 1UPMB 4A8IA 4GZJA 4ATDA 1WDDA 4RX0A 2XVKA 1P1MA 4WLCA 2P0OA 4IPIA 5AYZA 2OO0A 4F0RA 1Q6OA 1CYGA 5I79A 3ERPA 3SM0A 3TC3A 1LQ2A 4KQNA 2E5CA 2YYTA 2DPEA 2A2IA 5A2AA 2PDGA 2XM2A 3V75A 2FVMA 2YLLA 1UMLA 1P0EA 3BAKA 4MDOA 1SR0A 1REQA 2TAAA 3G22A 4LC8A 4OZOA 1CT5A 4NQ1A 5K9XA 3G1HA 1V3LA 1C7SA 4F2TA 1JZ8A 1QASA 1I0DA 3HFYA 1K8YA 3M0YA 3QR0A 5FD0A 4NXKA 1O66A 3SN4A 4UB9A 4Q8TA 5I5RA 1YTEA 4XD3A 3GR8A 4KWOA 2NXGA 1R3SA 2A4AA 3BTNA 3E74A 4GNJA 2DFAA 2YDRA 3BCFA 3RX2A 3STPA 1MEWA 3PNZA 3OEXA 3EPNA 2GFTA 3N4AA 2ZX6A 2W79A 2DV0A 1R46A 1W1TA 4O0ZA 1VBGA 1O4UA 2OXNA 3R6IA 1KBJA 1EH9A 5CBJA 2G50A 2JF6A 3FEMA 3PPFA 2J25A 4A3YA 3KL3A 3WFAA 3UF9A 1LG1A 4F9JA 1WBHA 3FA4A 1AJ0A 4B3LA 4ZA0A 2QCHA 1K8XA 1X7FA 3GNNA 4AU0A 1NDZA 4FNRA 4C6MA 4KMQA 4JR5A 1V7AA 5E93A 2WC3A 4GHRA 2ZXDA 1GCYA 1UR0A 3DFTA 2F2HA 4PYSA 5K4XA 3UJEA 1UH2A 2UY3A 3SCVA 3ZJKA 3ARUA 2FB3A 3JS3A 5CSRA 2J47A 5C9ZA 3RCNA 1HJSA 4M6VA 1KXQA 3RMJA 5K3VA 4N7QA 4F0LA 1SM9A 3DBNA 2HPMA 1JI1A 4GY7A 4ZOCA 1S46A 1JAEA 4W88A 5G1YA 3W2MA 4DXVA 1WQ5A 1MNSA 4LVFA 4WOZA 1KFJA 1MRQA 3BC9A 3DYMA 1LZOA 3R43A 3ICJA 4WIWA 4ZB5A 1DHPA 3O16A 1XSJA 4CQ9A 1Q85A 3QEZA 1TWSA 2IKGA 5M2FX 1MXGA 5XINA 5A2CA 3N19B 5HA7A 3M43A 4H6RA 4XZBA 3CZLA 1ONWA 2E40A 1MRAA 1Q13A 1YXCA 2POTA 2PLJA 4RNFA 4RZ6A 2P1FA 1GGOA 3FOKA 2VELA 2OOFA 2Y61A 1VP5A 3GHSA 4DZ5A 4FSAA 4DPPA 1NSJA 5H8UA 8XIMA 2V5LA 4X2RA 3E0WA 4PTNA 2PDKA 3W1AA 3PG8A 1NTHA 3G6MA 3S1VA 4KWVA 1RALA 3T2QA 3UEQA 3ANYA 3O1NA 4ZSUA 1DQWA 4M80A 4NNAA 4CNOA 4JNMA 3TJ4A 4FOJA 4QNWA 3VI2A 2OT1A 1U22A 1VPXA 4US5A 3KTSA 4XSLA 4CD4A 3RJYA 4DYJA 1LBFA 2ON3A 3G1XA 3M44A 3P0XA 4REQA 3FJNA 1SZRA 2WHMA 4A35A 3HPAA 2ZXQA 1C8XA 1MFVA 3W7QA 2OLAA 4U28A 3NZPA 1XIGA 4DBWA 2FDSA 4XAGA 1LT7A 3TC7A 3AIUA 1HT6A 5EPDA 1K6AA 5FF7A 2PDIA 1V6XA 3DKJA 3QPEA 2J24A 4AEEA 1EC9A 1WUFA 2CLLA 1SFLA 5CC6A 3VDHA 1B2YA 3IV8A 4H9YA 2PDMA 3LXBA 3DXIA 3OLGA 4HU0A 4UFJA 3WFLA 3KRSA 4W86A 2OX1A 5E6ZA 3UXKA 4I8DA 3AHXA 5D32A 1Z89A 1QRQA 3TOPA 1J8VA 1VENA 4ROPA 4GQQA 3C2RA 4GABA 3OGVA 1OGBA 2BY2A 1OG6A 1UWUA 4OBRA 1HJWA 1CGTA 1V3KA 4B5UA 2JKAA 3V16A 4AWEA 4YVPA 3A24A 3IWPA 3QN3A 4K7VA 1QPQA 4DLFA 3AMGA 5ECUA 3UR8A 3VYLA 2FTYA 2PWGA 3DG6A 4XZHA 4P8XA 2OLSA 3H70A 2YDQA 1DEDA 4K1WA 4KCVA 4RUBA 4IPPA 3IGUA 1KCKA 1HL9A 2J7DA 2VYOA 3HPSA 3NZRA 1KLZA 1WUEA 3LPPA 1E1CB 3M1ZA 5DBTA 3T6CA 3LTYA 2E8YA 3WBWA 3MKVA 3G0XA 4G6CA 3BWWA 3ZQ9A 4JS3A 5CSSA 1KRAC 4P5UA 2WHLA 1HKVA 3DI1A 1XWYA 4LS1A 3OA3A 3M07A 1ELSA 3HPZA 1FWEC 1TMQA 4MJZA 1J6PA 1FTXA 4S2CA 3A3XA 1X38A 3V7PA 3B8IA 1R3QA 2Z1WA 3IUHA 2VD8A 4TR9A 2ZRZA 3UXDA 2VDHA 1GVQA 4XAPA 3H7VA 2WCGA 3GH4A 4OE7A 3WYZA 1NWSA 1VBUA 2IKJA 4NAEA 2VOTA 2C79A 3V36A 2E28A 1OYAA 3GNRA 4PODA 4JKMA 3EDDA 1MMFA 2PTZA 3VDAA 4HZ8A 3N3TA 5T8GA 4P7OA 3B9EA 1QK2A 4GO9A 1AZ1A 1HNYA 5FKYA 2WC4A 4DUVA 5A1AA 2DSVA 3GXFA 1UD2A 2GJNA 3CO8A 3BV4A 5CPTA 3RX3A 1O5QA 1YQ2A 2YB1A 4N6EA 3K4AA 5F4XA 3VD7A 7ENLA 1GOXA 1LL6A 5TF0A 4O0KA 3P80A 1X7IA 2CZVA 3E0LA 1LWJA 1L6FA 3WH7A 2PWHA 1XP3A 5U7SA 5DO8A 4YHEA 1QO5A 1IZCA 3GLCA 5E0FA 2XGIA 1EL3A 4LUTA 3WJWA 3SECA 1MDRA 3PHAA 3STEA 3BLDA 4P7RA 5ABTA 2PUZA 1POJA 4C6EA 4UFMA 1GWJA 3W85A 1DWFM 1F3EA 3R10A 1HGWA 3OVQA 3TQ0A 1C9WA 3WQ4A 1BXNA 4B90A 1M7PA 1W9UA 2VMFA 2X7VA 4XIMA 3S2CA 3IJ7A 2QPXA 3PPHA 3TLQA 1HJQA 5DXYA 2VWSA 3DAQA 4W8BA 3TX9A 1RPXA 3NPVA 1E0XA 3KRZA 1Q4NX 5EFFA 3UW6A 5C8BB 4BR1A 3CUZA 2ZZ3A 2OQYA 3ARVA 1OFOA 3TH6A 4PA8A 3GVWA 3BSHA 1B1YA 4HA1A 2F9RA 2J79A 1D3HA 3EPOA 4NU7A 2FVLA 4LYRA 5AHLA 3ZM8A 1ECQA 2FB2A 4B9ZA 2E1DA 3E5BA 4H83A 1DKWA 3IK4A 2WJEA 1XRSA 4JAWA 4W4QA 1AJ2A 3AS2A 3HPXA 3EKLA 2PFHA 2HEJA 2QMJA 3BW4A 2FFCA 3N34A 4Z2GA 4O0QA 2NSXA 3EAUA 4JTAA 1HO1A 3E0VA 2EPKX 2J77A 2I5QA 1Q63A 1BAGA 1W5OA 4UTHA 2GUYA 3MKCA 2XISA 2IQDA 4XQ6A 1JNDA 3WQ5A 2Z1VA 3O9NA 4GIYA 4HBKA 3AZRA 3L4WA 5I3DA 3WD0A 1FDYA 1GW1A 1JQVA 1BYDA 4MKVA 1M03A 3RLUA 4S3JA 2VRJA 3KX6A 4LB4A 1MWOA 2OO6A 4J35A 5BOOA 2H3BA 3WNPA 3VGFA 3KS5A 3W84A 1LM1A 2QV4A 1YE6A 2XH0A 5LNWA 3WELA 3AU2A 1MZRA 1TPH1 2I17A 4V1XA 1QNSA 3GDBA 1EKOA 4Z0SA 3TXVA 3TYCA 3U48A 4KH2A 2ONEA 1G4EA 3GC4A 5FAGA 4IISA 1GONA 4NJHA 2ZRUA 3EX6A 4Q6JA 3SDOA 3QGKC 3QHNA 1ZJAA 1TTPA 1VCFA 1TJ2A 1MUMA 4RE2A 5G2WA 2ZTJA 3QMSA 3THUA 2QJHA 3E02A 3ABQA 3ITTA 1E0WA 1O5KA 2FTWA 1CIUA 4WKHA 3EMCA 4KWWA 2GGHA 3GDKA 4RW3A 2NX9A 1TJRA 4IH3A 1SJDA 4KESA 1F7BA 1KV5A 4S3BA 4MKSA 5D2XA 1FWDC 1TTIA 3WD1A 4OTKA 3PS7A 1WXZA 3D0CA 3C61A 5KZEA 2W6RA 1GEQA 1E6ZA 3C2EA 4RR4A 3W7CA 4EXQA 4U2ZA 4LBUA 3WDQA 2E3ZA 3S9YA 1XRVA 4XBKA 2ZC8A 1AH4A 3AS1A 3LDVA 3NDYA 1TE6A 4PZVA 1XINA 4B3ZA 3ABXA 2F2KA 1V3JA 1PYFA 4NJJA 2WB5A 4HMDA 5FF0A 1Z42A 1H62A 4ZEPA 3UERA 4ZODA 5AHFA 3UCDA 5PTDA 2VDIA 4JKKA 3CNYA 1RLDA 4EPDC 3SUUA 3MHGA 4CQCA 3U2OA 5C7HA 2CETA 3WIJA 1S3HA 5TAOA 1M65A 2ACUA 2J7EA 4JTRA 2TODA 2QKFA 1EFZA 3B0XA 1NDYA 2F84A 2DVXA 5FIPA 2X0HA 2CWXA 1VRDA 1Q6GA 1QWKA 3OTRA 2YFNA 4KBXA 3NFUA 2CERA 4UFKA 4F8XA 2O9RA 3VKDA 3LRLA 4IMCA 5EMMA 3P5ZA 4LJ3A 4BQ3A 3DG3A 3VXGA 4NZ1A 4KRZA 3PTQA 2WXDM 4AC1X 1ME7A 1PB0A 3BDKA 1JEZA 2NX1A 2WM0A 3VKAA 1SZGA 1JZ5A 1FCQA 1G4SA 1K02A 2FTPA 2Y4SA 1HKWA 4Y96A 5KZDA 3PBGA 4PRRA 3O63A 3CQHA 1MEIA 2WAGA 2IQTA 1A3HA 1PPIA 3NEHA 3WENA 2CITA 1YRRA 4GMEA 5HDRA 2VX7A 3H2MA 1KR0A 2X0SA 3T07A 2EPLX 4AG0A 5I3JA 5LA2A 2W66A 4E5TA 3DFOA 1WYIA 3AMCA 1XLMA 4KW2A 5LA0A 3WQ8A 1GG0A 4Z2HA 3T0DA 1IWBA 1B3WA 4C7GA 2QXWA 3ARRA 4H19A 3OZOA 1FWBC 1UR4A 3H8AA 2PDUA 4W89A 5EMJA 3TONA 2IUZA 1D2KA 3H7RA 4H00A 1HZYA 5KZ6A 4IIEA 3A9BA 2J27A 3FJ4A 3N2OA 4DELA 5AHIA 4ERGA 2C1GA 4JDYA 1M41A 4BQ5A 3G1FA 3W76A 3QC0A 1S2AA 3CGTA 4V15A 3VGDA 5IDIA 2OSYA 2DZUA 1EHAA 3WJSA 5AC5A 2VZSA 1QW9A 1UKQA 4GZIA 1E4LA 2GPTA 5I00A 3NTYA 2XGBA 1FWJC 2YA1A 1RY0A 2PZNA 3RG6A 3GXPA 4KEUA 1H1ZA 5B7YA 4FLSA 3KBVA 4FLOA 1GOMA 1FBAA 3OZYA 4UTUA 4NASA 3CUJA 1JI2A 4D2JA 3KBMA 2HV5A 3IV3A 4WDUA 4YTSA 3N12A 2DDXA 2PBOA 3N2TA 4Y9AA 4LANA 3LUTA 4JHMA 2R8WA 3W6YA 5A5WA 2C14A 4Q7IA 4XO7A 5HUPA 1EZ2A 4GFIA 3V5OA 1IEVA 5DLCA 3LOTA 3ES8A 1GPFA 1JF5A 3LXAA 5A8GA 2ZUNA 4IJRA 5DX7A 3KP1A 4RDYA 1RK6A 1Z44A 5K9DA 3FGCA 4HCDA 5IRPA 4GYKA 3MC5A 3W81A 1GZGA 1IR2A 2D2OA 2GVJA 4H1ZA 2V5JA 3EGJA 1R86A 1LROA 3M0LA 5ENLA 2ZQ0A 3NL5A 3EB4A 1A50A 4E2DA 3TN5A 1XI3A 4TQTA 1Y0EA 3ARPA 2P8BA 1RA5A 2ZUVA 3O6DA 4HCHA 3VKJA 2ZDRA 3VIMA 3ZVHA 1UH3A 1QDSA 2CLIA 3VCRA 4KT2A 3REQB 4MWAB 4C1LA 1ITCA 3RJXA 1KM6A 5I07A 1JPKA 1KTCA 2QCLA 3NXFA 4U10A 2V81A 3EB2A 1G01A 3W6MA 3AROA 4D6FA 3AOFA 5D38A 2ZX7A 3IIOA 4V28A 3LYEA 3ECQA 4D8AA 1VR6A 3SRFA 1VEPA 1RCOB 1H50A 3W7GA 4BY3A 5HPCA 1O95A 3O6CA 3BL3A 3E2QA 1N82A 1LRTA 3PPCA 3SCWA 4DY1A 3CBWA 2WHJA 2VR2A 2QCEA 4QBXA 4GVHA 1YBQA 3TA9A 4B2DA 3ZLFA 1W56A 2Z2AA 4Y2WA 2QEZA 2D23A 4HOXA 4IP7A 3UD6A 3DCPA 3FKKA 2DZBA 1TPUA 1ZLPA 5L6UA 3RF9A 3PZOA 1I1WA 2FZMA 3N14A 2G8ZA 3OZMA 1KO0A 3SFKA 3H7UA 4JX4A 4IIFA 4INFA 4ML4A 1E51A 4PN2A 4DRSA 3S5OA 2YXGA 3V5FA 4TV5A 3LB0A 4NZJA 3HGRA 3CO4A 1IIGA 1BYCA 3HFTA 2Z1KA 1JAKA 4MM1A 2VZUA 3B9OA 2A3AA 1NVMA 2O55A 5REQB 1DORA 5BU9A 2C0HA 1Z48A 4PUEA 3H2AA 3TSBA 3MWAA 4YCPA 2HE5A 3BAIA 2BP1A 2VGGA 3A6OA 3CHEA 4HQVA 4GXWA 2YJQA 3VGGA 4ZTXA 2JKEA 1J79A 1V6TA 2OU4A 3L7RA 3KHDA 3LI0A 1HF6A 1X1ZA 1W9XA 3GTXA 1ADSA 3CLMA 2XGZA 2IXVA 3LNMA 4IIBA 4MMWA 1R3RA 1TTJA 2QYGA 3HM7A 2QV5A 1K6WA 1XSKA 3G24A 2PDXA 3K1DA 1HX0A 1UR8A 1RK5A 3Q67A 3EWBX 3NQVA 3NNTA 2A0NA 2XWDA 5D2VA 3SADA 4CCCA 3VMNA 1JDCA 3WK0A 4JQ4A 2RGMA 2CLFA 3DN5A 5CKSA 1W32A 2WPGA 3A9IA 2E6YA 1IV8A 2Y5SA 4KEMA 1A5NC 5CJMA 1R2TA 3HPFA 3BGAA 4GGBA 1CZ1A 4JN8A 5GPRA 3HOJA 4D1IA 2DZWA 3E2SA 1F5ZA 4IL0A 2JGQA 3MDUA 3WQ6A 3DECA 3OO2A 1A3XA 1E0VA 2EXOA 1ITQA 1C93A 2XVPA 4HZ6A 3K8KA 3AJXA 3HQOA 5FOOA 4D6DA 2Y2WA 2TYSA 5IHRA 3QZ6A 4LCRA 4YPJA 1F3TA 2YCJA 1LRQA 1JDAA 1PDZA 4C6FA 1XPYA 4RV3A 1V3MA 3B97A 1H51A 4LAUA 3W1TA 1S2UA 2XN0A 1V3HA 2FVKA 5I02A 3QC3A 4OIFA 4XISA 3F03K 1Z8AA 2BXVA 4UFHA 4X9SA 1QI3A 3URQA 4JGDA 4D1JA 1K8CA 4WJXA 3S4TA 5EGRA 2PTDA 1OZMA 4GVIA 2QF7A 3GG0A 4UIOA 3TROA 4YTUA 4DO6A 1RBAA 2I14A 2Q71A 1J2WA 4DJED 4GQ0A 3D5HA 1JDFA 3TP4A 1ODZA 5I24A 1I60A 1XBXA 4XZNX 3S1WA 1GW9A 5AVHA 5H2ZA 1T99A 5T9BG 3IUDA 1ME9A 2ABAA 2VC5A 4I5UA 2Y63A 2POZA 4YXGA 3T09A 1R85A 1A5KC 3LCGA 5EA9A 1U5VA 1HP5A 4EPBC 3TR2A 4WDTA 2GQAA 4PL1A 4Z0JA 4QLJA 3H26A 2CLEA 1V02A 2VFIA 1EJUC 4U5IA 3IS4A 2RAGA 5CPLA 3PZGA 2PRHA 4O50A 1VFOA 5EBUA 2QMKA 2OPJA 1TV3A 2V2DA 1SMAA 3CV6A 3DIPA 3GXTA 1XLHA 2HWGA 1A5OC 3AISA 2XN1A 5HMEA 4FXFA 4L56A 2V82A 3PJXA 4JFWA 3JZEA 5CGQA 4N6FA 4ZTYA 3GB6A 4HK5A 3ABRA 3ONBA 4FF7A 2Q09A 2Q01A 5BXRA 4JTFA 2PDFA 2WBGA 1WZMA 5I06A 3L9CA 2I7GA 3DU0A 1VFLA 3VCNA 1EZWA 1XUZA 5AC6A 2OEKA 2R1PA 2VL4A 5HR6A 4XKYB 2VCAA 4H7VA 4LBRA 4QXIA 1U83A 1CXKA 2QIWA 1FXPA 3TV8A 4PCNA 1L2UA 4DWSA 1Q6FA 4EANA 4AW7A 1W1PA 3O07A 1IHIA 4LUIA 3TQVA 3STCA 2ZRWA 4JIPA 2P3EA 2Z29A 2J7BA 2ZYFA 4PC8A 3LXCA 1FY6A 3PJWA 2A3CA 5JBDA 1HTIA 3QW4B 5HWJA 4MFEA 3TN4A 4WSHA 1WA3A 4ZFCA 3ITLA 3R58A 3CWOX 1E1CA 3CIVA 4KF1A 4I5RA 2XVGA 2Z1SA 1AW1A 1XS2A 2VVSA 1PL9A 2EEXA 3NPWA 3B40A 3L21A 1YNPA 3RR4A 4AZIA 1XLFA 5JH2A 5FJPA 3FVMA 4C6BA 4XK2A 3W83A 4DYKA 4LH8A 3GC2A 1PTAA 1XW8A 1VRXA 4DF1A 3W7IA 1EX1A 1NOWA 4XAYA 3HQPA 2BWGA 3PN8A 1OFPA 3UR7A 4IX2A 3CUIA 2TPSA 2REQA 3RNDA 1FH9A 4Q8VA 3VZXA 1KRBC 1VLWA 2WMJA 1YYAA 1YE4A 2JEQA 3ZWTA 4R7JA 1WDPA 4PEKA 2CZDA 2CKSA 2OZ3A 3VA8A 4QEEA 1SMDA 4UQCA 3BW2A 1KTBA 4MTVA 3NDZA 2VDGA 4AEOA 3W73A 2QHAA 5RUBA 2FZ9A 2NLIA 2XPKA 2O0TA 4C65A 2WCSA 1XYZA 3UZYA 2GGIA 3VD4A 1TPFA 2QUVA 1NQ6A 1OC5A 3BOFA 1N7KA 4ZQPA 3NQ6A 1XLEA 3WEZA 4F40A 1F74A 3XISA 2BG5A 4P8UA 4OV4A 4YMZA 2CIPA 2UY5A 1K7XA 4AY8A 2ZZ5A 3WF0A 3K30A 5DRCA 4PBGA 3FAWA 5MHBA 1KM0A 3SRDA 1TJ1A 3D46A 2Z2UA 3CV7A 3PJTA 4FXJA 4LBSA 3WJXA 1ZU8A 1XPGA 1MDLA 5MKGB 2W92A 3M0IA 1AQMA 1VJSA 4H9TA 5BZAA 2O4QA 2QCNA 4ZB0A 3VIHA 4FAMA 2Y88A 3A4AA 3GG8A 4GNKB 1US2A 2XZ9A 4G1NA 1JD9A 3IIZA 3G18A 2RJGA 1ZBKA 4NG3A 3R11A 3NYDA 4MPKA 3FFSA 4AZ5A 3UJRA 3T7VA 3MB9A 3W88A 4L6OA 1OY0A 1ONEA 2CKRA 2BY3A 4CU6A 3LZ5A 2FZ8A 1FWNA 4Q4KA 4UR8A 4UQDA 4QIUA 3P2VA 2NQZA 3MU7A 2Q3OA 3THCA 3L2IA 2YZRA 3TR9A 1QATA 3MO7A 1EDTA 4B5XA 4YJ5A 1U1JA 1KCZA 1F76A 3EWCA 1OGGA 3G5EA 3NL6A 1PE1A 5J04A 2I56A 1W3LA 2NUWA 4X60A 3GD6A 3GDMA 1MXSA 1L6WA 3H24A 3L12A 3L0KA 4EK7A 3TE9A 2HVNA 3O0FA 1B5TA 5HAOA 5BWAA 2E9MA 2R1KA 2CZFA 2BFGA 4FLQA 2CW6A 5HATA 5HOSA 1P48A 4JQ1A 2ALRA 4H9UA 2WVVB 3BGJA 3SUSA 3ARYA 3WLKX 2C0AA 2YDSA 1FHVA 4IFKB 1GOWA 3Q37A 3BE7A 3WDPP 5ABEA 3LLXA 4GIAA 2ZA3A 3SQMA 2ISDA 1DBTA 1E15A 4MNLA 1JRBA 3U9IA 3WBEA 4LCSA 2TMDA 5C9UA 3P81A 4DQWA 2XDFA 1A0CA 1AH0A 2G4FA 5HMDA 5FI8A 1IT7A 5A3HA 5CG0A 3ARWA 3I7RA 3M6YA 3I3DA 1UUOA 3W7OA 1GZ1A 2OR2A 2QR6A 4BK9A 1OF6A 1QOXA 2QF8A 1YIXA 4LV9A 5D09A 3N4FA 2BB0A 4OU1A 1EEPA 3TTSA 3NZGA 1ODUA 1AMKA 2FMOA 3EWWA 4ZO9A 2RDWA 4WJEA 4IQEA 1TX0A 1NH6A 1UIOA 1JYXA 2B0MA 4DBEA 4FOKA 5BXTA 3GBDA 1XYBA 3O6YX 4JTJA 4MADA 1S5WA 4WR3A 1DIEA 1E3XA 5I23A 1VEMA 2PD9A 3T0TA 1QW8A 5CJNA 1RSCA 4YYCA 3BMVA 1Q2SA 1M53A 3WMCA 2JQXA 4BEQA 2FGZA 1OFBA 1GQNA 3W1MA 2ZIDA 3SSJA 3GIQA 2ZICA 3CH9A 3GQYA 3WNMA 1A3WA 1W2VA 3TKFA 4Q8WA 4ADUA 3WQEA 4QRNA 3UY8A 1XIFA 3VIGA 4D8LA 3GH7A 1UJQA 2Y1HA 1R87A 3CL8A 3C0QA 3E0FA 4ZXLA 1W3JA 3VE9A 2X2GA 4LRTA 3W9ZA 3FX4A 3MI2A 4XIAA 5DFAA 4UTJA 2ESCA 4GIRA 4LT9A 5IDZA 3GTIA 3L65A 4IMEA 4MWAC 2NQLA 3PZIA 1EGVA 2Y8KA 3WH6A 1V7YA 2A5HA 1EF3A 5BMWA 4P61A 4LUSB 3W75A 3MDWA 3RDKA 4J28A 4O52A 5LIUX 3TEVA 3WLQA 6ALDA 1MFUA 1J0HA 3PY2A 2B4GA 1G69A 2BS9A 1FWAC 3BAYA 3ZSTA 3LRMA 3S5ZA 1XQKA 5C5YA 2ZX9A 1XH1A 3MMDA 4HNVA 3O6AA 2CNCA 2QCDA 2PDHA 3BLFA 2QW5A 1CI1A 2GDVA 2D2GA 2PRMA 4FALA 2GQ9A 3CZKA 3RXZA 4QP0A 3RK8A 4AFYA 2BVDA 4ZQOA 1SSGA 2ZOXA 3KHJA 2QQ6A 2QNEA 1LL4A 1X6UA 3QGVA 5EL1A 4QE1A 3S0CA 1UZ1A 3KLKA 2OG9A 1K4GA 3HU7A 4LUYA 3WK2A 4IXHA 4AWSA 1JFHA 2DT1A 4HVXA 2W62A 5BXPA 4P2VA 2PSNA 4LCQA 2A3EA 1WKDA 3NL2A 4C90A 2D20A 1KBLA 3N2BA 3LHVA 2Z25A 1BSIA 1AMYA 2P5NA 2VUNA 1OK6A 3WLJA 3QQ0A 3GU2A 4TX8A 3GIYA 1ITXA 4I9MA 2ISWA 4EX4A 1B31A 1GKPA 2VVNA 2WV8A 3I4EA 4UBPC 1JZ3A 4JFSA 2J78A 4AD0A 4G7EA 3BOXA 2BHZA 3AXMA 3MZ2A 1NOFA 3TUUA 3CWNA 1MO0A 2J75A 3LLFA 4J3ZA 2J13A 3ITGA 6ENLA 3U4AA 3TAOA 4KFOA 1CENA 1LOLA 3G1VA 3KVMA 3QYSA 1XSIA 3E49A 4H3DA 1HN1A 5G4EA 3TJLA 1WDSA 1RV8A 1QR7A 1H7XA 4YU1A 3MUIA 2WK2A 3FEQA 1FA2A 3M6DA 2CPUA 4NYUA 4DF0A 1K9TA 2CZ5A 4TTUA 2Y62A 3CEUA 3VNIA 5C0QA 1XJBA 2FHFA 1B57A 1W2PA 1KM3A 4K6AA 1MI3A 3W86A 1O94A 2WM1A 1EJTC 3O15A 3ENLA 4IUOA 2RDTA 5G2IA 4UTWC 3NZQA 2B81A 4S3AA 2OQLA 4D6GA 4LYKA 2GWGA 2R1NA 3AHTA 4PUNA 3UZJA 4ZOAA 2ZRVA 3ITYA 3U0HA 3ITXA 4GH1A 1ZBCA 1VS1A 1LL7A 3HQ1A 3TA6A 1VCVA 4BI5A 3PWAA 4RCXA 3W27A 1QNPA 1R30A 3EDEA 2FJKA 5CZSA 2BXYA 1J0KA 5FEXA 4HIBA 3N4EA 3CQKA 3FS2A 1Q66A 2EKCA 4CLMA 2XINA 1TO3A 1KGXA 1P0BA 2Y89A 1NWRA 4IL2A 4AIOA 1TUXA 4BHYA 3G0SA 3VKCA 1YHTA 2OVLA 3A47A 3NIYA 4V2XA 1QI0A 3QKEA 4MDPA 3GTNA 4NRRA 4R7OA 4RDWA 4IMDA 1DJZA 5T26A 3WLSA 5D8WA 3HV8A 4JCMA 2X09A 3SIMA 1RQEA 4QX4A 4XZMX 1YX1A 2V3DA 4O1FA 4M6UA 1LF1A 3UXAA 2G37A 2C8NA 1CW2A 1JPIA 1OWQA 3SCNA 3PSVA 1WDWA 3CS2A 4RZBA 3GHRA 3OGRA 2Y85A 1CB2A 3AUJA 2PU1A 3AXXA 2KX9A 4BJHA 3BLOA 2GOKA 5IOBA 4WRHA 1WP6A 5JH1A 5AYXA 4DBUA 1V3IA 4CCDA 4HYWA 2E0PA 3A64A 2VJXA 3W6LA 5IBXA 2I1OA 2DJLA 4DXKA 4QM1A 3W28A 1B3XA 1BHGA 2BZNA 2ZZ4A 4KFNA 2YCIX 1AZ2A 1FXQA 3PULA 2FZNA 4WJ8A 3UETA 4GK8A 1E4NA 1H2JA 2V5CA 2IPFA 4R9XA 3NL3A 4PTWA 4IJCA 4TV6A 3BLLA 1QNRA 3UG8A 5JBFA 2CXGA 5DCEA 1KM1A 2HS8A 1UKPA 3GNPA 2DGAA 1FWIC 4N4QA 3E3HA 2BXZA 1UROA 3NWRA 4Q22A 5HMFA 1V8EA 4JZ5A 5FEWA 3B03A 5DANA 1MQPA 6XIAA 3S9ZA 2BX7A 1TR9A 1TCDA 4L61A 5TBOA 3A3WA 4ZQMA 4X63A 3QPYA 4BWLA 1TZ7A 5F2LA 1T8QA 3S6TA 3W87A 5HQLA 1E6RA 5BWFA 3WD3A 4WKAA 5LGXA 1EYEA 4MAZA 2IXUA 3EXRA 3LV5A 1RQHA 1FWHC 4X61A 1DJNA 4HNNA 3U7BA 1PXGA 2CFFA 4X9YA 2ZX5A 5A6LA 1PKLA 2EGZA 1PZ1A 3MA8A 1U33A 4E4UA 1EJVC 4GVGA 2ZFAA 4J3UA 2OLHA 1VHNA 2V30A 2WZIA 4DJDC 1NARA 3QV8A 3N6QA 1P6WA 3GE7A 2QUUA 2ZE3A 1SW3A 4S23A 4M51A 1MUCA 3BLEA 3IVUA 3K4DA 2QJNA 4C6LA 1OX6A 1GKRA 1IWPA 4NI8A 3BH4A 1XIHA 1UHVA 2V69A 1TA3B 5D9OA 1GK8A 5E09A 3AMDA 3CAVA 5K7JA 1KLYA 3SRHA 1FH7A 5K9CA 2NLYA 3IARA 1S2WA 1D8WA 1ISYA 1B90A 4TUFA 2E67A 1HIZA 1UWTA 4LXFA 1FHDA 5LXEA 3A23A 2WYSA 4RDZA 3M16A 3T2OA 3VTRA 1MW3A 4C6OA 3W7RA 1KA9F 2IPWA 5A6KA 1TR1A 1A5LC 2J9XA 1L9WA 4JIEA 5LSMA 3GSMA 1WO2A 2FJUB 1QNQA 2G3MA 5LHEA 5LNUA 4AWUA 4D71A 1E43A 2YCLA 1IGSA 2QULA 1F8IA 3GXNA 3TSDA 4ACYA 4R3UA 3P6LA 1VEOA 4WY0F 3ELFA 3WFZA 3G8EA 3PTKA 1QWGA 1V5XA 5AHNA 1G4TA 4PULA 3VGHA 4NNCA 3TMLA 4A3HA 3I68A 1Q5MA 2BNJA 3FYYA 3IVTA 3KOZA 2AL2B 2VD9A 3CLWA 2YX0A 1T6MA 3PZTA 2R6OA 5EBAA 3KOXA 2XG9A 1W9VA 3B0UX 4EIVA 3ARZA 2AMXA 1ZL1A 1X98A 4M82A 3EX3A 3ZYZA 3P61A 4XV0A 4UTFA 2AAAA 1UB3A 5F7UA 2J7HA 1YADA 1QNOA 3DERA 4O53A 4MF4A 1VAHA 1WXYA 3PK7A 3N13A 1C8YA 1B3OA 4CD6A 3PVFA 4ZOEA 4J3VA 3PSWA 1OK4A 1TPEA 3FCPA 5G2HA 3QBUA 2OELA 3NEVA 1ZZMA 4FMVA 2QJJA 5C71A 5GJPA 1LT8A 1TZ9A 3CU2A 1XRTA 3LSBA 4AXKA 4WDWA 1XHGA 3MMWA 2EQDA 3EX2A 2QPUA 2PDCA 1UYQA 3WK3A 5HULA 2WZHA 1Q6RA 3VOJA 1UMYA 3W01A 4UQBA 3F4WA 3MSGA 4QJ5B 1W8GA 2VCBA 4HK7A 4JFVA 1POKA 1TPDA 4GCXA 3H21A 3WF3A 3CHVA 1O68A 4JY9A 2OJPA 3UP8A 1ZGDA 1CX9A 1QPRA 2RDXA 3VINA 2FZDA 3CIXA 4IFRA 5D4YA 5A6AA 4XKYA 1J0JA 3OHMB 1TRDA 3E96A 4Q4PA 4W5ZA 3I7SA 3HN3A 4YVXA 1JCYA 2EJ1A 4OBSA 3PUEA 5A6TC 2A85A 1V6WA 3GU9A 1AW5A 1SZEA 2D0GA 1Y65A 2ALDA 3V0SA 1YDVA 2VGIA 4B5WA 2F6UA 2Z1BA 1FWGC 2VEGA 2VOMA 4ZO7A 3PAJA 1K03A 3L23A 4MY9A 3VC5A 5A8PA 3DBPA 4DNHA 1O5XA 5H91A 4PL2A 4IOTA 1UR3M 3H23A 2NVDA 2PTWA 7XIMA 4UWMA 3W2NA 5BNKA 1JYNA 4IPJA 1PV8A 4DBSA 4S3CA 1KBKA 2XN2A 1FWSA 2Z0IA 3DFNA 3WJYA 3I4KA 1X39A 2XIIA 4OWGA 4AD1A 2OSWA 3UA4A 3UZWA 2HK0A 4B5NA 1JUKA 2QGYA 3LCHA 1EWEA 1L8PA 1E0TA 1F73A 1JNEA 3TFXA 2ZTKA 1J5TA 1NFBA 3N3MA 3HBLA 4JXCA 3ZR4A 4KERA 4LY4A 1X97A 2YGYA 5LNVA 1FHLA 3DG7A 4B5TA 1IEWA 1W37A 3W1XA 4B91A 4PB4A 5E9XA 1QHZA 5D30A 5H1WA 3W71A 4KIRA 1VBJA 5C2CA 3W1LA 1N8WA 2G3JA 3LSCA 4MB3A 2VX4A 1UIPA 2WSKA 4GQRA 4WSKA 4F0KA 3P67A 2BLEA 4LALA 4RLIA 1B54A 3FHQA 4NHVA 1JYVA 5MKGA 3MZNA 3WLTA 5E5CA 3MCNA 3C3NA 4FNTA 4EOUA 4HPXA 2E5DA 3PNUA 1XICA 2F38A 1VYSX 4XBJA 4AQLA 4ZQNA 2PBGA 1DJQA 3HZ3A 2X30A 1E9LA 5M1TA 5AHEA 1KFCA 3ALFA 3U5UA 4FP1A 4IG2B 6REQA 3TW9A 3WJZA 1BXBA 1JYWA 5GVJA 1EP2A 4ZQCA 3FXYA 3ORWA 3DX5A 4M6QA 4UQAA 2UBPC 1X8CA 2VFFA 3QSRA 4TVUA 3TVAA 5A69A 3RCMA 4LNYA 1RCQA 1Q6QA 4JTDA 3AHZA 2FGBA 3CUGA 1TV2A 3R0KA 1KBBA 4RE3A 4MYXA 3CTLA 4YVVA 3E38A 3R1ZA 2GWNA 4A29A 3RLVA 1Q7ZA 4FX6M 1YXDA 5FCZA 2GSHA 3UG4A 1E4IA 5KMYA 3R5EA 3XINA 1P1XA 1MZHA 4HU4A 5CC7A 1MW1A 1KRCC 5FJUA 3S1GA 3M0XA 2D73A 4QAIA 1FCBA 3BXWA 6TIMA 1A0DA 2MANA 2D69A 5M3WA 5GNXA 3HTWA 4IFKA 2ZCGA 3FXGA 5E0CA 1G67A 4GNVA 4C6PA 1F6YA 1UBPC 3G8RA 1ZP4A 1ALDA 4L9ZA 3P14A 1I1XA 1RA0A 1JCXA 1UKTA 1V4YA 3KOWA 5FJRA 1B30A 3WN6A 2VZTA 1K7FA 4N2YA 3UFYA 3OBAA 1V02E 4Z2KA 4BKNA 2G41A 3EX4A 3IIVA 1SO6A 5DCBA 3EB3A 3LG3A 3WBAA 2ZWZA 1XCXA 1CXIA 1YDYA 1EXPA 3EEZA 4WKFA 4DUWA 2FHBA 3C8FA 1M5WA 1K8ZA 2C3ZA 3N1AA 1CGWA 1AVAA 3S47A 1P0NA 1X6LA 4WDXA 4UTLA 4D6IA 3STGA 1WV2A 1ZP3A 3AAMA 4Z1AA 3DFYA 3CASA 2QDEA 5C55A 3NO3A 1OCJA 5CH9A 3EOEA 3NSNA 2QAFA 4IGNA 3UJFA 5J5RA 2NZLA 4E8GA 2V3EA 3S2JA 1XISA 3WQCA 1RVGA 4E4PA 3NQAA 5IFTA 1GQIA 5CZTA 1KXTA 2WJDA 4PMYA 3ZR6A 3E2RA 3LPOA 3QYQA 1A49A 1SO4A 3ZJ7A 1C9DA 3CQJA 1KFWA 2EF9A 1JZ6A 3UJ2A 4Q4RA 3IGHX 3FNDA 3E2VA 3F5LA 1JZ4A 4MZYA 3RMEA 1K9DA 3L2MA 4MFDA 3O7UA 3IAPA 3L67A 3E1F1 4RK8A 4LPCA 4N9CA 1J6OA 2ASHA 4GYFA 4HCLA 4XD6A 3CJPA 2OGJA 3E9AA 1GQKA 1F61A 1ENUA 1XUUA 4JY8A 2VM8A 1SFSA 2E5BA 4LUSA 2QCMA 3IACA 2G3IA 2Z2BA 4RJEA 3VD3A 2BV9A 2Z1XA 2E7FA 4EKJA 3UXLA 4IFOA 2JE8A 3SGGA 4UOJA 4PR4A 3QM3A 1B3VA 1HKIA 1S1PA 1E55A 1JJKA 3OODA 2QDDA 5CSYA 5BRPA 2ACQA 1QNVA 5LHFA 2XH7A 4I90A 4XVDA 4GFSA 3E5PA 1JDEA 4FNSA 2DZXA 4S38A 3SGZA 5HWMA 4TOQA 3TWAA 1ML1A 3JRKA 1EUNA 1OSEA 5DXXA 4HD5A 4G1KA 4MB1A 3P7YA 1XFBA 3SUTA 4PUJA 5MF5A 2W5FA 3BSMA 3B8TA 4EPEC 5DEZA 1WAWA 3P93A 3QGAC 3MUCA 2J9YA 4ZO8A 2ABBA 2FPYA 4US6A 4MUZA 2DU2A 3GFYA 4IZGA 1E0UA 1Q4WA 3B4YA 4I5XA 3VIFA 3QVQA 4HTYA 2J4GA 3LK6A 4FNQA 3S6OA 4ECLA 5C9RA 3G1DA 3H2NA 2NV1A 3GBEA 4S2BA 3MSYA 4EVZA 2V9DA 4PBEA 1TCMA 5A8MA 3SZ8A 5A6BA 3IVSA 5AC4A 1ICPA 1RUSA 4WY0B 1JL8A 4QNEA 1H4PA 1BEUA 4IT1A 3PZMA 4KGJA 2EBNA 3RO8A 3AUOA 3IGXA 4DJEA 2YSWA 3W7NA 1SZNA 3SFWA 1T0OA 1H60A 4NJKA 9RUBA 3FVDA 3LCLA 3I10A 4GYPA 1SO3A 3G3MA 5EB8A 3DC8A 3GDRA 3TOYA 4AVNA 1C7TA 1TVPA 4GACA 1H63A 1P7TB 3CUHA 2CLOA 1ZCCA 5FESA 4UCGA 4O57A 3WQFA 4AY1A 4H4IA 3AIVA 4P7QA 2JIWA 1J0ZA 2PZ0A 1WKFA 4IM4A 4AD5A 4QDWA 3KTXA 2O92A 3WMLA 3CAWA 1OIFA 4XG1A 4HU8A 3QLDA 2JFEX 1SJBA 4O4WA 3ZJ8A 4WEVX 4D6CA 4HPJA 4C91A 4DUXA 5AC8A 3RN6A 1J18A 2GUBA 3THQA 3CMFA 3OYXA 2Z26A 1IYXA 4DB7A 1TRIA 1H1YA 1SUXA 5FACA 3W2LA 1VKFA 5KITA 4RZ4A 3APGA 1E9IA 1EP1A 1Z32X 1KR1A 3TK7A 2WVSA 1YDOA 4U33A 1CLKA 4Q8UA 1E72M 1G7VA 3A13A 3L4VA 1VIWA 4GUJA 2VRKA 4PFHA 5CQ1A 6TAAA 4X0VA 4JTEA 3DEQA 1A47A 3AMLA 2WVUA 3FDGA 3QRHA 1GPWA 3IJLA 3N29A 4AIBA 3PF3A 3ALGA 4OUEA 1LQ0A 2CLPA 3DKLA 5LIXX 2QUMA 1F6KA 1HFBA 4ORMA 1VF8A 1WBJA 3BUVA 3PG9A 4ZL1A 3NQCA 2HDJA 3G1YA 4TX6A 3N9SA 2ZVIA 3KXQA 3BURA 3B8DA 3T05A 3OVPA 3F5KA 1V0KA 4D6JA 4O1DA 1TUFA 1E71M 3PFMA 1WKYA 3QOMA 3L0NA 4UTTA 2QCFA 3I3BA 2OGYA 4CEUC 5KSWA 3MUAA 3RM9A 5H6HA 1BLIA 3H2CA 3KBSA 2PC4A 4AB4A 3ID7A 1P6CA 1BWKA 3RPTA 1SR9A 4HMCA 3DESA 1M7XA 4YTTA 1QHPA 4JHOA 4IMGA 1PO9A 3GR4A 4WD0A 1JFXA 4Q3MA 3F7JA 2YCKX 4QLKA 3OOQA 1TYGA 3EZ4A 3W00A 2E09A 4M29A 3MMTA 4AZ6A 4H41A 5HXMA 1TPB1 1L8NA 3V35A 4HOWA 4NT0A 4A3QA 5HNRA 3NQMA 3DHDA 3MHFA 3RM8A 1TZZA 1DIKA 3CZ8A 1XRFA 1FCVA 3SCUA 2EG8A 3TW6A 4D72A 3VM5A 3N15A 4HPGA 3WBYA 1QI4A 5FJTA 3QTGA 3B4UA 4ZOBA 3WLMA 1EO7A 5JQ9A 1XV8A 3WKZA 2V67A 1GEHA 1X1NA 5I6SA 1YEYA 4BQ4A 1HO4A 1HQTA 2PODA 3PTDA 1V0LA 3VFLA 4MKNA 1TIWA 4PSPA 3ES7A 3G0UA 3GWQA 5CC3A 3OIHA 4EWJA 1E40A 3O0KA 1O1ZA 3GNDA 1K9EA 1S39A 1UOKA 2VO5A 1OINA 3HO8A 3CT2A 1J96A 1MUWA 2YBVA 3LPGA 3CHFA 1E6SM 2HK1A 4N9DA 3BO9A 5FF2A 2HXUA 4XZLX 3L5LA 3CT7A 4LY8A 5I3HA 1T96A 5T9CE 4M24A 2PTXA 1DHKA 3NAVA 1ZRQA 3EOSA 2P53A 1IXPA 2XWEA 3CM4A 2JBMA 3UA3A 1JPMA 3QFWA 3CC1A 3UBPC 3D3AA 2I5GA 3FHAA 3WQGA 4LVGA 4GE8A 1B4EA 1BFNA 2DZAA 2J88A 4K36A 4G7FA 1TA3A 4Q8PA 1W1B1 3AYSA 4R9OA 3STFA 4QJ3B 1V6YA 1W3NA 3MKKA 1RBOB 3KRBA 5A8QA 3VOGA 4ZB2A 1A5MC 4W87A 1CECA 4O28A 3SJNA 1PHWA 2XM1A 3RIKA 2RKXA 3S6DA 3HF3A 2EG7A 2Z6JA 3NQEA 3VU2A 3EX1A 4H9VA 4GZEA 3H2FA 3ITOA 4MWAD 3ZLGA 1E6QM 8RUCA 4ALDA 5CPMA 1OF8A 2Z7GA 4DEFA 2GSEA 2P88A 3BG9A 5AKQA 3KCOA 1MW2A 4H9XA 4BS0A 5C9WA 3GDLA 1UWAA 4PB3A 2BHUA 3DDMA 1GZJA 1OX4B 3T4CA 2I57A 1JCTA 3TTEA 1C8QA 3U2EA 2JGYA 3W29A 2WSRA 2OOGA 1JCMP 3IJIA 1G6CA 3F4VA 1ZQ5A 3TYEA 5AYYA 2J6VA 5G5IA 4LVAA 1AA1B 4B4FA 3KZPA 3SUWA 2AL2A 2VC7A 1NAL1 3N2CA 1PUDA 3RU6A 2Y7GA 3ZT5A 1ADOA 2UY4A 1EIXA 2G96A 2PI6A 2GDQA 3WDJA 1I2PA 3V18A 4J4KA 4WXZA 4AEFA 4LEFA 1E70M 3U7VA 2WC7A 1ICSA 1NFGA 2YB4A 1W9BM 1UC4A 3LU2A 1E9ZB 1Q6DA 5AECA 1VFSA 2XZ7A 3L66A 1KFEA 3JU2A 1UBSA 3SCSA 2D3LA 3UY7A 4MB5A 2A1YA 5AFDA 1DXFA 3UXIA 1PVNA 4Y8EA 2UV8G 1CGVA 1QPKA 3FLUA 1CXLA 2QZRA 2VC6A 3M0KA 4IUGA 4EF8A 1AD1A 1H7WA 1FDZA 1OHLA 1C90A 3WMBA 3NQ8A 2FYMA 1IEXA 1GVYA 2E6FA 1WX0A 1OJXA 3KAOA 1JVNA 2ADAA 3RLHA 4C7DA 2BVYA 4E38A 1EXBA 1B0IA 4C6JA 1XM3A 3WLIA 4NAEB 3V3WA 2QPSA 2ATMA 4FF5A 1GVFA 4RXGA 2ZX8A 2VT0A 1EOMA 1T40A 2D0HA 1DIDA 3AI0A 3T0CA 4DVOA 3MSRA 4YNGA 4JX5A 4MY1A 3PBYA 4Y9MA 3HMJG 3VGEA 4R33A 1S1RA 2XFWA 1BQCA 1H7RA 1BKHA 4DM1A 3EDKA 3NSXA 1FHUA 3BW3A 3U2CA 4XTDA 2DEPA 4Q8OA 3MYOA 3KWSA 4O19A 5JU6A 4JQ2A 1P43A 1WNOA 3KDOA 2E1WA 3SSZA 3OGSA 3TTYA 4AZCA 5EMLA 5FJIA 2C1HA 1IEIA 4HP5A 1RVKA 3ONCA 3SJ3A 3EPMA 1E4MM 1OX5A 3S42A 6A3HA 6CGTA 4GUGA 2NWRA 1W6TA 1VD6A 1FQ0A 5CSUA 4A4AA 5BCAA 4RDVA 2CYGA 4O15A 3IIXA 4I7WA 2C91A 3VNLA 4A3UA 1HXJA 1EWDA 3T4WA 1G9HA 3LHWA 3S1XA 3S83A 4BF9A 1OZQA 2Y5EA 3TIMA 3K5XA 3GM8A 5AZ1A 1YDNA 3M47A 4UZSA 3UT0A 2HISA 3KTCA 1EC8A 1WDQA 1F3WA 5F2IA 2A21A 1TB3A 2WSYA 4KWUA 3RILA 2P50A 1OBAA 3BJTA 4PB5A 4H6KA 2LLEA 3WNOA 4H2HA 3N73A 3PC0A 4CCZA 1S5VA 1MSSA 1Z69A 5F2GA 3N9KA 4M1BA 1Q2RA 4JEQA 1IF2A 4JQ3A 4KEVA 4O18A 4X2PA 3WLNA 1LJYA 3G77A 4MJ4A 1R6WA 2JF7A 3S3GA 2ZUMA 1MNZA 4NZ4A 1S38A 3BLPX 4YIWA 1M7JA 4OV9A 2PWVA 5BYWA 5I03A 2I9EA 3VMOA 1K70A 2X42A 6XIMA 1NEYA 4LFYA 4O4VA 2DW7A 3VABA 4ORIA 3S5YA 3KM8A 4F2UA 3VILA 1O60A 3GZ3A 3AC0A 3NQ2A 4IQDA 4TIMA 4DJFC 1EYWA 2YR1A 4R53A 4QGCA 1I4NA 3A5FA 1RJQA 3QQWA 4IG2A 3B9DA 3W38A 3BQ5A 1E9YB 2PC8A 2HRWA 3QW3A 4BCEA 4LV4A 5TD4A 4MZ1A 5AZ0A 3TJXA 1XIEA 1VGAA 3S2MA 5HMSA 4QLLA 3PAOA 5HJLA 4W84A 2FHCA 3R94A 3FDKA 4RNIA 2HVOA 4BF7A 1VH7A 1TE1A 3NM3A 3B9AA 4V33A 3VNYA 5CBBA 1X8FA 3AFBA 1XDJA 4DPQA 4ZGYA 2PLMA 1R47A 5GQBA 4HT3A 3VOFA 4PMNA 5HQMA 3L4ZA 4K8GA 3CIWA 1TV8A 3AXKA 3VZYA 4GYJA 3P84A 2NQHA 4ML9A 4XSMA 3WUEA 3BZGA 1PTGA 1TQJA 3V1PA 3WX7A 4JNZA 1NOUA 1XIIA 1ZFJA 2J74A 3K8MA 3C6CA 3UPBA 3W37A 3PR2A 1GUVA 2FMNA 3ZXWA 2W4XA 3NO1A 1PCKA 1I2NA 4F2BA 4O11A 3NGJA 4PTXA 5FF4A 2YDAA 1UR9A 1VHCA 2PDNA 2XFYA 3WLOA 3EWZA 3F2DA 2WMIA 4CVUA 3TDFA 2WMKA 5DN1A 3T9PA 2V6AA 2HNHA 2PDYA 3ANVA 1RH9A 2XTKA 3FKRA 4DJDD 3WZ0E 5EY5A 3PZ9A 2PGFA 4LRSA 1Z6KA 2RGLA 3RUBL 4ZMGA 3KCJA 1VYPX 1LWHA 4OBTA 2X1RA 4JTHA 2OQHA 1NJJA 2A7PA 3UWUA 2BHYA 4OKDA 3QV6A 3T8QA 3RITA 3BANA 4HSHA 3U8GA 3PFRA 1HUVA 2WSPA 1PEZA 3VDBA 1FRBA 4DX3A 4I6KA 3APTA 1D3CA 1OQFA 2NT1A 4BEUA 4JKLA 3EYPA 1BTCA 1H41A 1G5AA 3INPA 2VP8A 4MNMA 2DSUA 2H3DA 4NZ5A 1BRLB 3EBVA 2PAJA 1KFBA 2W61A 4RE0A 3GG7A 3C4UA 1L2QA 3WK1A 2YL8A 1NF0A 2R9RA 4QITA 1TKKA 4WF7A 1ZBVA 5XIAA 1UR1A 1OYCA 1Q8JA 3B8UA 1HG3A 3RHGA 1VFHA 1M3UA 2EG6A 2QAPA 2HCVA 1VB9A 4R27A 4FXSA 3A3HA 4WUIA 4QS6A 4XZWA 5J5DA 4MLJA 2Q8LA 3B8SA 3GZAA 1GVIA 3THDA 4Q8MA 3IJ6A 1US3A 1W31A 2V5DA 2VFHA 3PANA 2XFFA 4E8DA 3OQEA 3WQPA 5I3FA 2TRSA 5DMYA 3NPXA 1UQYA 4P7LA 4CGTA 2HTMA 1F9CA 2Y70A 1TJPA 4PMVA 3SBFA 4V1YA 2Q8ZA 4HNCA 1EIBA 1ZCOA 3PB0A 1U1HA 2DVUA 5A95A 4XVEA 3M5ZA 2OB3A 3CB8A 4PUUA 3MUXA 4NJIA 2E9LA 4X0NA 3POHA 2Y7DA 3EA2A 3S5NA 3VIKA 3TQKA 3ZT6A 3W1RA 1P0KA 3CHDA 5BMXA 3H12A 3LERA 7REQA 2HXTA 4U2YA 4NNBA 2FPVA 4K3ZA 3W7EA 1SQ7A 2RFGA 4L4LA 2DW6A 2H9AA 5D9MA 3BK0A 4NP7A 4D9PA 3TNBA 2ZVRA 1JCJA 3BMWA 3ATYA 3RGTA 1A5CA 3EA1A 1JUEA 4FO4A 1T41A 4UOZA 4XAFA 3C2FA 2ODOA 2EPHA 4I9AA 3K1GA 3ZS4A 1XLCA 3C0SA 1U5JA 5BW6A 4OJYA 3KOFA 4JDBA 1MYRA 4ZQRA 1IXQA 1FX6A 5F4WA 3WNNA 3IEBA 3TYUA 1O7AA 5B7ZA 1E1FA 3VAVA 1BYAA 3EOLA 3MHUA 4B4HA 3OQ8A 4C6QA 4B16A 4Y9PA 1FFQA 4IHCA 3PPGA 2F7FA 5EYWA 3R0UA 1YLVA 2G5WA 4W9TA 1DJGA 3UZXA 4ES4A 1GORA 4XTIA 3W7LA 4ZENA 3WQVA 3VC6A 2OCZA 1I6NA 4QROA 1QHOA 4GJJA 4NVTA 2VQTA 5HQEA 4UQ9A 2VXNA 3W82A 3DFQA 4IGMA 1BVZA 3UZZA 5G4HC 3R25A 1P7TA 2DT3A 4BA0A 1PKMA 2CZEA 3AZSA 4O16A 2V3FA 2OX4A 4FR1A 1FWFC 1OD8A 4KETA 4AIEA 3R79A 2Y7EA 4A05A 4XWUA 3OU8A 1GYNA 1V93A 4XZ9A 3K8LA 4N4PA 3ZVHB 2E25A 4PUMA 5IFPA 3AIQA 1TIMA 1MW0A 1H7NA 2V68A 1W1YA 1ZSXA 2VX6A 3OG3A 1CWYA 4CQBA 2B7OA 2F61A 3LQLA 3F2BA 4NZCA 4OVXA 1FWCC 3BCJA 4NKCA 3W24A 3QV9A 1V08A 4YTRA 3SCTA 1GOKA 2V2HA 1KB3A 4H6QA 3AICA 2ZZ2A 3TAKA 4IWWA 3S5SA 3B0VC 4OUIA 3G1SA 1CTNA 2CWNA 5D04C 5H8MA 4URIA 3QLLA 3M46A 4DM2A 5JUVA 4HHMA 1XLDA 4JN6A 1YBQB 3VOIA 4Q4OA 4GO8A 4DBDA 1G1YA 2ZKMX 3F1QA 4WOQA 1AODA 4ADTA 1FCUA 4JL2A 2BGNE 3FIGA 3TN6A 4E4FA 2X41A 1W0MA 3VKBA 5DRIA 2NWSA 4AZ7A 3M0HA 1SVDA 2MNRA 3SRKA 2VHLA 3CZGA 3MJMA 4CD5A 1DWHM 5D03A 1IE7C 3W2JA 3IRDA 2OKOA 3WF1A 4F4RA 2TSYA 4J2PA 1E6NA 1GHRA 3DC0A 3QFEA 3EMQA 1GT8A 2V2CA 3MYPA 4WGHA 5H8PA 1E1EA 3T44A 2P76A 2PURA 1PJ9A 4PMZA 2PF0A 3GKFA 4LB3A 1ZPTA 5E9AA 3KVJA 2YL6A 3M41A 3C86A 4GI9A 3M7SA 4XUYA 3BCDA 1W5NA 2G3NA 3M9YA 2PMQA 1B3ZA 2GGEA 1IXNA 1F6PA 2EPMX 3KEHA 1SU5A 1VFMA 5CZKA 1NDWA 2EPOA 4G56A 1LYXA 3HA1A 3AIWA 4R7WA 5TQLA 1PIGA 1TPC1 5M17A 2PU0A 2PS2A 5DMNA 4Q4MA 1I45A 1R7OA 3UCCA 1JGIA 3KW3A 1N8FA 2XFRA 3KCLA 4LF1A 2QJGA 2DY3A 3I6RA 2C13A 5A6BD 1E6XM 5AN7A 1QBBA 3VKKA 3A21A 4UCFA 2R1LA 4ZVJA 2HBXA 4C5ZA 1GYLA 4Z08A 2XJ7A 1CXEA 3D3FA 4MJMA 3DGRA 2PWUA 4FX8A 1J10A 3LQGA 1AG1O 3APYA 4JTTA 9CGTA 3NG3A 4J3TA 3GKAA 2X05A 3RM4A 3VOHA 5LNSA 1KKRA 3E6EA 1FWTA 4EXAA 3FSTA 3GNOA 1J0IA 1JXJA 3H4WA 3SCRA 1R3YA 1Q8AA 4CQDA 4QS5A 4JX6A 5CGMA 3AHVA 1AD4A 1TMHA 2R14A 3LHZA 4R5EA 1EJWC 1DTNA 1NELA 4H9MA 3NOYA 1VCGA 5C54A 3W53A 3MUY1 3B0YA 2FGLA 1XGEA 4AZBA 1DWJM 4H8VA 3L5MA 3H55A 3DFPA 3MV11 3N2XA 4OHQA 5A6MA 1XF0A 1AQFA 1H3GA 1GQLA 1XLBA 1YTKA 4RPPA 2PLCA 4H7CA 3NQBA 2BTMA 3CUXA 1H0IA 5C7VA 1KGWA 4M56A 4AX6A 3EXSA 1U30A 2PDBA 1SJCA 2G97A 1KFKA 2C15A 3B04A 4PRTA 4Y90A 5CZ0A 1KXHA 2KZHA 1XL9A 4NAFB 2ZUWA 3MMUA 4GVFA 4WK9A 3CAQA 4ACZB 3T55A 5F2MA 4H6EA 3UJSA 4MYAA 2ZA1A 4GGHA 2DT0A 2GJPA 4IQJA 1K3UA 4ZBCA 4W7UA 3ZVIA 3Q65A 1J9YA 3W1PA 3B3DA 1ZAJA 4WGXA 2XIQA 4WQ6A 3W7DA 4JICA 1JRCA 4NF7A 4NXSA 3JW7A 2QVHA 3N6JA 5CXPA 4PEEA 4AHPA 3KBWA 4GKTA 3LCIA 4Z2IA 2C1IA 4JTLA 5AC7A 3B05A 4NUWA 3M7WA 1LCOA 3CAKA 4FXRA 4PGLA 2WVTA 3R8HA 1L6GA 1DVJA 4FLRA 3GW3A 5TIMA 3S2LA 3JUGA 4ZZ9A 3LD5A 2WKGA 3N11A 1XD0A 4A2SA 4W85A 2HJPA 1HW6A 1KBIA 3D47A 5E6YA 2HQAA 4QG9A 4AC7C 3OA5A 3PBWA 2QT3A 2GVYA 3GVRA 2PGEA 3LBOA 1LRNA 1G94A 3RO6A 4Y9NA 5A8NA 3R8RA 1OX4A 2NQJA 5L9FA 1DWGM 3N25A 3R2GA 5CGTA 3VUPA 3TN3A 2A3LA 1UWIA 3UYCA 3MVIA 4DI9A 4QSHA 4FNUA 4Y7EA 2BVTA 1W3KA 3EXTA 1UG6A 3BAJA 2HSAA 2YFOA 3UPWA 3GUWA 1QPNA 3GG1A 5DCDA 1ESWA 3O2LA 1E5NA 5F1VA 1FWRA 4DWSB 2CHNA 1AW2A 2HS6A 4ERIA 1JULA 1IEQA 2R94A 1KQZA 2Y8VA 4HJWA 5I7GA 5M03A 1UUQA 1QO2A 3EEGA 5K2ZA 2Y8UA 1UPPA 1H0GA 1A5UA 3AALA 4WVXA 3GS6A 2OZ8A 3SIZA 2GVEA 3OIXA 3HGOA 3QHOA 4J9JA 4JPGA 3WY1A 1EJRC 2QIIA 1IWAA 4LVDA 5KZMA 5TNVA 2JIEA 4HSOA 4Q6XA 1BGAA 4O1CA 4HA4A 4L5ZA 3RYSA 4B3KA 2DUZA 2WSQA 1RLCL 1QU4A 4POCA 3TU9A 1TJ0A 3TZFA 2X8RA 1M68A 4L9XA 4B9YA 3NQGA 1N8IA 1ZJIA 4Z1BA 1W9DM 1UKOA 5FEPA 1PWMA 1PHQA 1JCLA 5D9NA 5JIPA 2H6RA 3BG5A 4L64A 3CMGA 2REQB 2J66A 3W4RA 1J2BA 1OFDA 2YCEA 4UMAA 1R2RA 1P4CA 3HQNA 3Q4DA 3W7KA 5HNNA 5I77A 3R13A 1BKSA 3CYVA 4GIEA 3W26A 2OT0A 1XLKA 2VUYA 1LG2A 4KCWA 3CXOA 1H5VA 1C91A 2XYLA 1ECEA 3BVJA 4AF0B 4MJ2A 4XZIA 2ISSA 1Q6EA 5D05A 1P5BA 7CGTA 4D6HA 3M5VA 1YTDA 2EKGA 2H8ZA 4NY2A 3T40A 3WDIA 4JIQA 3PZQA 3A4JA 5LIYX 4S3GA 2VGFA 3VIJA 3T0AA 2D1ZA 3SCQA 4CQ8A 3MP4A 4CNNA 2CESA 4JL1A 4Z1YA 3SN0A 1BWVA 3R12A 2O56A 4MPQA 4XKMA 2EHHA 2QLYA 1QCWA 3U4FA 4LYQA 4KCUA 4MLRA 5DT7A 1EGMA 2PD5A 2NXHA 1TV4A 4E2VA 2WKJA 4K1GA 3LCWA 4PTMA 1D9EA 1R38A