4C6EA

Crystal structure of the dihydroorotase domain of human cad bound to substrate at ph 5.5
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
364
structure length
363
Chain Sequence
KLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DIHYDROOROTASE
publication title Structure, Functional Characterization and Evolution of the Dihydroorotase Domain of Human Cad.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 119
structure length 363
sequence length 364
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4c6eA00
2OODA 1FWJC 1J6PA 4H9ZA 1ITUA 4KETA 3UR5A 1FKXA 4ICMA 1ITQA 1PO9A 4KESA 3IJ6A 3G77A 5E5CA 4GZ7A 1FWAC 4IG2B 1GKRA 4J2MA 4CQCA 1UBPC 4KEVA 1RA5A 4GOAA 4GK8A 4IGNA 3AU2A 1M65A 1FWDC 3E2VA 2UZ9A 1RAKA 2VHLA 3ICJA 4XD4A 4CNSA 4H9YA 2GWGA 2GWNA 1R9ZA 2Z25A 3DUGA 3SO7A 3TN5A 4C65A 4LAKA 3EWDA 4BKNA 1XWYA 3OU8A 1M68A 1RJRA 2P53A 2WM1A 4DI9A 3S2LA 2VC5A 1FWIC 1FWCC 4IFKA 2WJFA 2FVKA 2Z7GA 3HTWA 3RCMA 1A4LA 3NEHA 4C6CA 3GRIA 1UIPA 4LCQA 3E0FA 1POJA 4C6IA 3AUOA 3E74A 3MDWA 3RHGA 3FEQA 3B40A 3MVIA 2P50A 4INFA 4XAZA 1QW7A 3MJMA 1E9ZB 2VR2A 3LGGA 4C6EA 2HBXA 3NURA 1J6OA 3URQA 4GYFA 2AQOA 1KRCC 1PB0A 3QGAC 2Z28A 3A4JA 3MKVA 2UBPC 4WVXA 4H9TA 3LSCA 4C5ZA 3FDGA 4Z42C 4C6LA 3GTFA 3EWCA 4ZSTA 4WHBA 1J5SA 1FWBC 3ORWA 2PUZA 3HM7A 3RN6A 3F2DA 4HA0A 4HJWA 1A5MC 1UIOA 2RAGA 2FVMA 3LSBA 1A4MA 4C60A 1EJTC 2WJEA 1A5LC 3F2BA 2EG7A 3URBA 3LA4A 1I0DA 4GY7A 4H9XA 3FDKA 3GTIA 1FWHC 3A3XA 2E1WA 3GUWA 3PANA 2A3LA 4GY0A 4UB9A 3K5XA 4I6VA 4GY1A 3WZ0E 4DLFA 2OGJA 3GU1A 1PSCA 4LFYA 4PBEA 1K6WA 4EPBC 3E0LA 2ICSA 2ZC1A 3LU2A 1QXLA 4CNTA 1P1MA 2QT3A 4JOMA 4DI8A 3ID7A 3OQEA 2PGFA 4L9XA 3OODA 1E9YB 2QVNA 2WJDA 3GU2A 3LS9A 4IG2A 1R9XA 3B0XA 4ERGA 1RA0A 1NDYA 4C6KA 2EG8A 1R9YA 1YBQB 1YRRA 2HBVA 4V1YA 4B3ZA 3K2GA 2FTYA 3ISIX 3F4CA 2PLMA 1KRMA 4H9MA 2HNHA 1EJVC 1KCXA 3O7UA 4KIRA 1ZZMA 2I9UA 3S2MA 3K4WA 4I6KA 1NDVA 3UPMA 3F4DA 4B90A 1ADDA 2OQLA 4B91A 3IARA 5HMDA 2HPIA 4AC7C 4XAGA 1DPMA 2ANUA 4XD3A 4CEUC 1RK6A 3S2NA 4PBFA 1WXYA 1YIXA 4MUPA 3URAA 2Z27A 4DYKA 4KERA 5HMFA 3WYZA 4C6FA 2XIOA 1XRTA 3ITCA 2QS8A 2FTWA 1EZ2A 2AMXA 4L6DA 4P5UA 3RYSA 4C6JA 4C5YA 2R1KA 3CJPA 3T1GA 1ONXA 4DZIA 1BF6A 2OB3A 3KM8A 4NP7A 3AU6A 4C6PA 1YNYA 4IH3A 4DO7A 3QY8A 1FKWA 1EJXC 3CAKA 4ZSUA 4DLMA 4R88A 1VFLA 2F6KA 1FWGC 4G7EB 3TN3A 4E3TA 3TN6A 3C86A 4F0LA 4IFOA 4RZBA 3PNZA 2OOFA 1JGMA 4D8LA 1P6BA 4BJHA 4C6BA 5A6TC 1RJQA 3D6NA 3OOQA 3O0FA 2YZ5A 2R1NA 1V7AA 2IMRA 2Z2BA 4DZHA 3GTXA 4CQBA 3GIPA 5LXXA 3MVTA 4QRNA 1K1DA 3IPWA 4R85A 3MPGA 2HPMA 2DVTA 2YXOA 4LAMA 4IGMA 1RK5A 3GTHA 4LALA 2O4MA 3UF9A 4XD6A 4ERIA 1EJSC 2HQAA 1EJRC 4H9UA 2VC7A 3CS2A 1GKPA 4HK7A 4NG3A 3N2CA 4XAFA 2R1MA 4M51A 4OFCA 1V51A 4C6QA 2Z26A 2FFIA 4H01A 4KQNA 3PBMA 4PE8A 4GC3A 3GIQA 4BY3A 3MSRA 3MTWA 4QROA 4XAYA 4IQJA 3QY7A 1O5RA 4C6NA 4CEXC 3A3WA 4J5NA 2BB0A 1A5KC 3OVGA 3IV8A 3E38A 2YB4A 4NI8A 3V7PA 5CH9A 3LGDA 3QGKC 4WGXA 3B0YA 3HPAA 4C6OA 2PGRA 3GU9A 1NDZA 4YIWA 2G3FA 2GSEA 1J79A 1YBQA 3UR2A 5FSEC 2W9MA 4KF1A 4GX8A 4EP8C 2VUNA 1EJUC 4ERAA 3S2JA 2D2GA 1XGEA 4DNMA 1O12A 1PTAA 2PAJA 1I0BA 4LCSA 1M7JA 2ADAA 3DCPA 4C6DA 2R1PA 1NDWA 2I5GA 4IFKB 3F2CA 1P6CA 2VM8A 2EG6A 4H9VA 4RDWA 2E25A 2Z2AA 4LAOA 4LEFA 3LNPA 1EF2A 2AQVA 1W1IE 3BE7A 2Z00A 2Q09A 3PAOA 4C6MA 4F0SA 4PCNA 4AQLA 4HK6A 3S4TA 2Z29A 4LANA 5HMEA 3MDUA 3NQBA 4QSFA 3E3HA 4R7WA 4QTGA 4V1XA 4RE0A 2YB1A 3DC8A 4J35A 4TQTA 3UBPC 1S3TC 2Q01A 2CZVA 4KEUA 4KEZA 4GXWA 1UMLA 4EPEC 2DVUA 4EPDC 4IF2A 4HK5A 4G7EA 4CQDA 1IE7C 2D2JA 2DVXA 4QS6A 1HZYA 1EYWA 2R1LA 4LH8A 1NFGA 2Y1HA 4DIAA 1KRBC 1POKA 3SFWA 2QPXA 5G4HC 4PCPA 4LCRA 1RJPA 1XRFA 1V77A 2BGNE 3JZEA 4G2DA 1FWEC 1GKQA 3WMLA 4RDYA 1KRAC 2KAUC 1WXZA 3TNBA 5FSDC 2D2HA 5AKQA 4IFRA 3T81A 4B92A 3R0DA 1A5NC 4GX9A 2O4QA 1EJWC 3PNUA 1FWFC 2Z24A 3IRSA 4F0RA 2GOKA 3OJGA 3TN4A 3IACA 1ONWA 4QS5A 3T8LA 4CNUA 4EPKA 4UBPC 4RDZA 2GZXA 1V4YA 3QY6A 1YMYA 4H00A 1A5OC 3LY0A 2Z4GA 3EGJA 4XD5A 3GG7A 4RDVA 3URNA 4GBDA 3IGHX 1K70A 1V79A
chains in the Genus database with same CATH superfamily
4F66A 2VURA 1YPXA 4H9ZA 1ITUA 2V5KA 3KBVA 4RJEA 4Q3MA 4KESA 3TQKA 1GG0A 3BQ6A 2HSAA 3T2QA 4N4QA 4IQDA 3G6LA 4LC8A 1RVGA 3HGJA 1UC5A 2YJQA 3JS3A 2WO5A 2QCFA 2CHRA 1XLJA 1P0BA 5KZMA 3ICJA 2XHYA 1MYRA 3NQ8A 4URIA 5AC7A 3RAOA 4PH6A 3EB2A 3NCOA 4XIAA 3CUZA 1KFEA 5M17A 1R46A 4FR1A 2B4GA 4D1IA 3HTWA 1XXXA 4AC1X 1XLLA 2YA2A 3C0QA 1R30A 4B4HA 5CJNA 2HVOA 1XH0A 3KTSA 3LHTA 1HXJA 3FAWA 3H54A 4B9ZA 2RJHA 3EWYA 3AIQA 3VNIA 5HQEA 3F4NA 3GUGA 4GKTA 4UCGA 2CKRA 2OU4A 4C6EA 3FGCB 1KBIA 3BDKA 3PPFA 2X41A 1OF6A 3SB0A 1V3JA 4NL1A 3DGBA 3E2SA 4Z42C 2X0YA 2ZRUA 4JIEA 5G4EA 4HYRA 3RRXA 5JXQA 3ANVA 4K8HA 1Q6LA 3IVSA 4C60A 3AHXA 2CKSA 1UA7A 1JCJA 3PZOA 4QX4A 3QR0A 2DH3A 3HPFA 1XDMA 3WF3A 4XZHA 3DX5A 5ABTA 1AFSA 3F5LA 3M5YA 1Q6OA 4JHOA 3ITLA 5IBXC 4DWSB 1KC7A 1MWOA 3TU9A 3ZT5A 3VCCA 1QXLA 1MFVA 4DN1A 1CYGA 2B7OA 3AYVA 4BI6A 2WLZA 1X6UA 2WKJA 4NAEA 1FCUA 3OQEA 4I9AA 1KA9F 1XUUA 4HT3A 4AYGA 2ZBTA 1TTJA 2BX7A 3LS9A 1Z9AA 1NFBA 4DXKA 4D72A 3M7SA 1XH2A 4FXJA 3V18A 3HA1A 3A23A 5K3VA 3TVAA 3UY8A 1VCGA 4LB4A 1V3IA 1ZZMA 1AODA 3DG3A 4I6KA 4GVFA 1XG3A 3W1MA 3MV01 2ISVA 2OELA 5CSSA 5CC3A 1Z32X 1OT1A 2WSKA 3OBAA 3WL0A 4XZLX 3B8IA 4D71A 1GUVA 3WH8A 1O1ZA 2XISA 4DY1A 2FKPA 2H90A 4MUPA 4JTGA 2POTA 4JTLA 3W07A 1EC8A 3FXGA 1O5KA 3QBUA 4C6JA 4C5YA 3A13A 3TH6A 4WGHA 1TMLA 5TBOA 2JIEA 3W22A 4NNBA 5DBTA 3T4WA 4W7UA 1HP4A 2CESA 1U5VA 4D6CA 1NF0A 1XIGA 4QAWA 4AEEA 1TR1A 1Y5VA 3S1XA 1EXPA 3NFUA 1HVXA 1JYVA 5CGMA 2GQAA 2FLIA 3AJXA 2X30A 1Q45A 2A0NA 3CWNA 3TQ0A 4L80A 4ENLA 5DEZA 4CQBA 3MVTA 2DVTA 3PZGA 2B7NA 3C0SA 1US2A 1XYBA 2GJXB 4XAFA 3OBEA 2C16A 4P2VA 1E70M 5DCBA 1EX1A 2FFIA 3AYRA 4S2BA 1ZP3A 4H83A 1OD8A 4AZ6A 2ZADA 2VEKA 3KOXA 4J1OA 1UR2A 2PWEA 3DFHA 3VIKA 5AC8A 5U4NA 1HJWA 1E6SM 2ABBA 3K8LA 2XVPA 1JCLA 2W62A 1ICQA 1JFHA 3H55A 4M6PA 1O4UA 3P0WA 4DZAA 1IT7A 3DHDA 3ZQ9A 4JTSA 1XJBA 4FLRA 1EC9A 3PWAA 4GX8A 4OVXA 3DYOA 4DUOA 1EXBA 3S2JA 4ROQA 1I9CB 4GVGA 1RY8A 1VEMA 2C0HA 1IF2A 1I0BA 1SGJA 1UR1A 2ADAA 3QR3A 4GUJA 3AUJA 4MWAA 5EMJA 1M03A 4OV9A 1UD8A 1RBOB 3VGGA 3HQPA 4W93A 2OGYA 2JGYA 5IOBA 4B4FA 3UERA 3CAQA 2OJPA 3OP2A 4PUWA 2HISA 1HJUA 3QHMA 4PB5A 3ZT7A 1ZPTA 3S9ZA 4FMVA 2ZZ4A 3GM8A 5ABFB 1GOWA 4GGHA 4NI3A 1E3XA 2QLYA 1UKTA 1MNZA 4TVCA 3CWHA 1ZJAA 2KX9A 3NQBA 3KRBA 4DJFD 5FA5A 1GQNA 1Z6KA 2VEPA 2CLEA 2CZVA 4FIQA 4CCCA 4GUGA 4F9JA 3PUOA 2D3NA 4H2HA 3R1ZA 5CBJA 4IJBA 4PUNA 5EMUA 1MVYA 3THQA 1N8WA 2XGIA 5LIKX 4QS6A 2QXWA 5I03A 4J3XA 4O54A 4D6HA 4H7VA 2WZTA 4LNYA 2C7FA 4BI7A 5C2GA 3R12A 1FWEC 9RUBA 4FNQA 4Y7EA 2VOTA 3AXHA 2A3HA 1GOOA 4J2PA 4B92A 3NL3A 3O6YX 1XIEA 3R10A 2NX9A 1QBAA 3S83A 3OO2A 1F4HA 5CSRA 4F2UA 1VC4A 1UWRA 1RZMA 1KGXA 3AXIA 2J7BA 5CSUA 3U4AA 4PSRA 4AH7A 4JKKA 4RDZA 1S2VA 1WUEA 1DWJM 4GBDA 2YL9A 3CHEA 1FWJC 3OGVA 3EX1A 5FJPA 2E28A 1TR9A 1XLHA 1MEWA 5E5CA 3TYBA 5BCAA 3UWYA 4GGBA 1PHQA 2PB1A 1A5BA 4P7OA 3OYZA 4POCA 2ZA3A 1SJCA 4CVUA 1R3VA 1S46A 1W3KA 2TSYA 1GQJA 3N2OA 3RK8A 4I9MA 4ZOCA 1EHNA 4NZCA 4Q4OA 3BGAA 5FJOA 3CEPA 4GVHA 5A8MA 1R9ZA 4Q7IA 3AALA 3DUGA 3P8IA 4CD8A 5D37A 3EDJA 5HQMA 2GVEA 3O06A 3P81A 4Q4QA 3UESA 4DI9A 4AD3A 4XO7A 2E5DA 4K6AA 3CC1A 5BXRA 1QU4A 4JIPA 1SVDA 5I09A 3M43A 4JTIA 2F8QA 1KD0A 3GW0A 5A6AA 4C6IA 3TYEA 4DB7A 4PRTA 4UTTC 3H6OA 1CEOA 2J8GA 3M16A 2QQ6A 2IKHA 1KXVA 3LGGA 3NQCA 1J6OA 4GYFA 3BW4A 4A3HA 1YXDA 4BR1A 5HXMA 3H12A 4Q8OA 3ONCA 2QYGA 4XVDA 4C5ZA 4A8RA 1LWHA 3RJYA 3SBFA 4TMCA 4KBXA 2DSKA 4ACZB 1P6WA 1ZBVA 4MDOA 1RP9A 1A4MA 3E0IA 2YFOA 2WVUA 2P8CA 3CU2A 4JYDA 4JNMA 1A5LC 3F2BA 2PE4A 4GY7A 4IUGA 4C7GA 3HFTA 4ADSA 3GDRA 3K5XA 4I6VA 5C8BB 3QVQA 4FOUA 1EO5A 1J12A 3R6IA 4QLJA 1ZU8A 2WSQA 1S5NA 2FGBA 2DZBA 1Z48A 4G56A 7REQB 5GNYA 1DIOA 2PDJA 3MT1A 3DI0A 5IFPA 2VZTA 1UWAA 3EKGA 3SCVA 1MUCA 3KCLA 3ES8A 3LLXA 4AZIA 2J47A 4OHQA 1FXPA 4GWEA 4GE8A 2E3ZA 4MB1A 3BLFA 4YXGA 1FOBA 3P0XA 1YE6A 2G5WA 2OLAA 3EMZA 1F3WA 3CASA 5DMMA 4LAZA 2XM2A 3GH5A 5BXSA 3UZXA 2Y88A 1H09A 1I2QA 2ZZ3A 3F4CA 3B3DA 4AFYA 4O8AA 4GISA 3W71A 2VZOA 3LXCA 3Q94A 3UPMA 2ZE3A 3M0VA 1DVJA 4CU6A 4PTWA 1HNYA 3VDBA 3IARA 1DE5A 3CHFA 4WIWA 1E6PA 1GTEA 4GQ0A 3G1HA 4XAGA 1U5HA 1K7FA 4S3GA 2BLEA 1VKFA 4O50A 1BQGA 3W7NA 2ZYFA 1WAUA 4FPSA 1KFJA 3UG5A 1JR1A 2Y89A 2YGYA 3EKLA 1TX0A 5A6KA 1RQHA 1ZB5A 3QY8A 1XFBA 3M9YA 3L23A 3MI2A 1NOFA 3FJLA 4JY8A 3FAXA 2B7QA 3CH9A 5D2TA 4LS1A 4BJHA 4RNFA 1HJQA 2P0OA 3GNDA 3TAOA 1RJQA 2FGLA 1HW6A 1A50A 1X8FA 2G0WA 4X22A 1F73A 3HV8A 2Q02A 4QXIA 1DJXA 3KEHA 4R85A 3MMDA 3RM9A 4J3VA 2PDNA 5TIMA 4G5DA 4HK7A 1TWZA 1UR8A 3PK7A 3G1FA 5DLCA 1NWRA 3S46A 1CECA 1K7XA 2PDUA 4E3VA 3A3WA 2G37A 4KH2A 4S2CA 1DJQA 2EPOA 3V7PA 1BXBA 3WNLA 1ODUA 4C6OA 4TXEA 4LV9A 3UGVA 2YCIX 1YBQA 3V35A 4GQQA 2QZRA 1NFPA 1PX3A 1CGWA 1MQQA 2YW3A 3BOXA 4J3TA 4R9OA 4C6DA 4AHQA 1E9LA 4IP4A 1D3GA 1US3A 2E8YA 1TKKA 1UP3A 4RDWA 1ZL1A 3CUXA 2BY3A 3EMQA 4RLIA 1JJKA 3P93A 3W28A 3N11A 1N82A 3MSYA 5KZEA 2GDUA 2FJUB 3EXSA 3E96A 4E4UA 1H60A 3KHDA 4QDMA 4OGZA 2OCZA 2GJNA 5DBUA 5EGRA 2XH4A 3RUBL 3BLOA 3LQGA 4MYXA 3SY8A 4PMDA 3QPEA 3DOPA 4JQ3A 1R3TA 3AIEA 1J0JA 3APYA 3M5ZA 5A6JA 3WELA 2TODA 5HR6A 3GNOA 1HIZA 4YTQA 2XSAA 3EX2A 1OINA 3CZEA 4LVAA 2OXNA 2PP0A 1KB3A 4N9DA 1OQFA 4XSLA 3R5EA 2W66A 1WXZA 1X38A 4Z2GA 3LPOA 4YNGA 3V5FA 4YCOA 2Q3OA 1F3EA 3QN3A 4UTKA 2VJXA 1EIXA 1ONWA 3S1VA 5AHNA 1I1XA 2W4XA 4PL2A 3PZ9A 3LPPA 1CNVA 1YXCA 4H00A 2Z4GA 2Y7EA 7ENLA 3SGZA 2VZSA 2V5BA 3LBMA 2FHCA 4HIBA 1BHGA 1O95A 3LV6A 1GQLA 4MY1A 1WZAA 4NAEB 1ITQA 1V0MA 1PO9A 3G77A 4LUSA 1ME9A 1GKRA 1GZ1A 4KEVA 3NDYA 4IL0A 1GYMA 1B5TA 5FF4A 2OEMA 1FWDC 3O2LA 3NQDA 4AISA 4MY8A 3SUTA 4A29A 4PB3A 5AHFA 2GWNA 4XBKA 5KSWA 5GPRA 5HNRA 3FCPA 1OFQA 1PCKA 4IPIA 3NGFA 3WUGA 1GOKA 1FWCC 2BVWA 5D2VA 5CPLA 3UP8A 3THCA 2XIBA 1OWQA 3GRIA 1UIPA 4PUEA 2W91A 1POJA 4IIEA 5GNZA 3EXTA 3MC5A 2OG9A 4MF4A 1ME8A 5EMLA 3V0TA 4L64A 1X98A 2BBFA 1H7RA 1ZCCA 2C79A 3WDRA 3A22A 3GSMA 2NQ9A 5GVJA 2UBPC 4QJ3B 3I4KA 3PBWA 3PP7A 4TIMA 4PUDA 1RCXB 4E0CA 2NWSA 4GH3A 1B0IA 2V81A 1I2PA 4O1DA 2INZA 2TAAA 5CZSA 3BLKA 3IUDA 4Y8FA 3EKZA 3MZNA 1E4MM 4N9BA 4F3HA 1BXCA 5M5DA 1IXNA 3VZYA 1AW5A 4GIRA 1I0DA 4PMVA 3W2LA 3UYIA 3WEMA 2D0GA 1XIIA 3ABQA 3GFYA 1C90A 3O6DA 3TYZA 4PUJA 3WK2A 4CD6A 5I00A 4IMGA 4FF5A 1PSCA 3P84A 2ICSA 3ANUA 3LU2A 4ML9A 3R7MA 3BAIA 2YBVA 1P1MA 5CZ0A 3BICA 1YEYA 1IIGA 1V0LA 4WJ8A 2V67A 1FCBA 4UTWA 4J3WA 3OODA 4MAVA 2C6QA 2ZZ7A 4IPLA 3KCJA 3S3GA 3VNZA 3NO5A 3KBJA 1SW0A 3DI1A 3RCYA 1YRRA 2XZ7A 3C6CA 1HTIA 4NSBA 3O9NA 2NZLA 1BXNA 4D6EA 4E38A 3N17A 3AROA 4UQ9A 3AWOA 5BOEA 4MWAB 2WZIA 3H2NA 1K4GA 3SCPA 1C8VA 5EMYA 2CWXA 4IISA 1B30A 2INEA 3GXMA 1A53A 2PTXA 2BY1A 4CNOA 1YIXA 2WNQA 1HKKA 1OCNA 1R86A 4WKFA 4FA3A 2YSWA 1T99A 1H7NA 2CIPA 3BAJA 5CG7A 3VMPA 4JDYA 3WNOA 1HVQA 4J3SA 1CLXA 5J5DA 3MYPA 4KCTA 2DDXA 1N2VA 4AWSA 5EPDA 4AUBA 3NVDA 1IT0A 3QH2A 1FQ0A 1TB3A 5HUPA 4AB4A 3T8QA 3LCXA 4E3TA 4H8VA 2Y5EA 3VKBA 1JXKA 4NJGA 4BQ3A 1KV8A 3ALGA 3OOQA 3DXIA 3RCNA 2QJMA 3GXFA 2PTDA 3GTXA 5AECA 2DSVA 2V2HA 2YCLA 1DJNA 3SQMA 1Z44A 4JY9A 1MO0A 4GHRA 3CZJA 3SSJA 2L5HA 4MNLA 1TELA 5G5IA 4ZB5A 3N2CA 1PIGA 2QJIA 4P8UA 5DRCA 3L5LA 1CXLA 2JF7A 4KQNA 1IR1A 4R9XA 4YU1A 1WA3A 2VXNA 3L7RA 2PF8A 4U31A 4YS1A 4ZO8A 4HU4A 2UY2A 1BSIA 4C7FA 1EX5A 4W5UA 2PDFA 5M3WA 4H41A 3IV8A 5H1WA 4PFMA 4U10A 2IW0A 1EDQA 2FHFA 3W2UA 1UMYA 3BAKA 4BF9A 1K7EA 4KCVA 3GG8A 4ERAA 1TUXA 4BFAA 5BMXA 1XGEA 4F8XA 4PTNA 2ALDA 2X1SA 3KWSA 1VR6A 2VDHA 1EQCA 1W9DM 3W7EA 2UY4A 3QMSA 2R1PA 2IS7A 5GNXA 5C5YA 2IXUA 4H9VA 4WXZA 1UD5A 2PDXA 3MMUA 2ZXBA 1IZJA 3BE7A 4JFVA 2W27A 1P5BA 3ABRA 1J8VA 2D0FA 3Q58A 4AZBA 3KP0A 4DWDA 1Q13A 1UPMB 3DHUA 4QSFA 5D05A 1HO1A 2CEQA 4P8WA 2A21A 2PEVA 1E0VA 5CC7A 2J88A 2QR6A 1SO6A 4PTMA 1OYBA 1I6NA 1GPFA 2H3BA 1FTXA 1JUBA 4LY8A 2NSXA 2XGBA 1UD2A 1PX8A 4LEQA 1POKA 2JFEX 2QPXA 3CQHA 4UWMA 4M24A 4WOQA 1UR3M 1E0TA 1DJIA 1RJPA 3PBUA 1KRAC 4O10A 2Z1VA 1CTNA 2AAAA 3TNBA 2XIJA 5AKQA 3QW4B 3ARTA 4MJZA 4A3QA 1HKWA 3SRDA 4ZOAA 4Z08A 1FWFC 3GBEA 2EBNA 4JD4A 4UQBA 4YJ5A 5CLWA 5B7ZA 1PV8A 2Y2WA 4MPKA 4JQ1A 2F2HA 1V4YA 1DXIA 2HXUA 3RMJA 4RDVA 4IHCA 2OZ8A 1J6PA 4LAUA 2GYIA 5CAHA 3INPA 4MB3A 3WQVA 3FX4A 5E0CA 3W29A 3W84A 1KCZA 2OFJA 6CGTA 1FH9A 4QAIA 4AZGA 4J2MA 4G1NA 4Z1YA 1PS9A 4U3AA 3WN6A 5JBFA 3W53A 4A05A 3BOLA 1M7OA 3CZKA 3HGSA 4IQEA 5D2YA 5F2GA 1VFOA 3U8GA 1ZBWA 5ABEA 3VKJA 1LG1A 1XLGA 3O0KA 4C6CA 5JBEA 1RBLA 4JEQA 4JN8A 1XR2A 3NXLA 1AD1A 3OTRA 1F6KA 4UNKA 2Q8ZA 3V1PA 3VAVA 2OT0A 4PMXA 3GFZA 4XB3A 3WQPA 2WLYA 3MKVA 4N4PA 3FEMA 4GO8A 2PWDA 4K7YA 3ZLHA 1Z7AA 4AD0A 4PSPA 3PC0A 3W0KA 3G1RA 2NV1A 3EOOA 5CGTA 5LGZA 2C15A 5IXEA 4NZ5A 3AIRA 4GIEA 3RF9A 4H6QA 1MDRA 2VUYA 3MU7A 4QCEA 4KIEA 3VE7A 4NHVA 3G18A 2D73A 1W5PA 4GYPC 2QUVA 4GY0A 2OOGA 4FHAA 1JVNA 1KR1A 1HKIA 3UWUA 4LFYA 4DHGA 5AYXA 3W00A 1GYNA 3VILA 1GVEA 5H91A 4DWSD 4G9PA 2NWRA 1Q4NX 2WMIA 3LCWA 4JN6A 2OKOA 4XO6A 1VP5A 4R3UA 1F05A 2FZDA 2PD5A 4O4VA 3W74A 2PDQA 3LPFA 1UH3A 2GGIA 1CBGA 3U2EA 4LV4A 1OVDA 4B9YA 4B15A 2J7FA 3MUXA 4I9JA 1YBQB 3MO4A 1JFXA 2A1YA 1DIEA 3WNKA 4DQWA 1NF7A 3EOSA 1PCWA 3LTPA 4IJCA 3AYSA 2XGZA 4XZ9A 2OMAA 1FCQA 4NIRA 3T4CA 2ALRA 2EPKX 2VCAA 3V16A 1ZTVA 3GFXA 4GINA 5CPMA 1RR2A 1H3GA 2OQLA 4RPPA 3WQEA 4UR7A 2FZNA 3B06A 1EA0A 3CYJA 3VA8A 5FACA 1HFBA 3RLHA 4LSBA 1YYAA 4PTDA 1XRTA 3ZFHA 3OHIA 1ZHAA 4H4IA 2TYSA 4H2CA 4ZB2A 3WK0A 1FBAA 2XFYA 4U2YA 3ES7A 2A6NA 2Z1WA 1LL7A 1PXGA 3T2OA 1ZSXA 5BWFA 2RFGA 1DHPA 1XYFA 1QT1A 2CU0A 1JDCA 3UG3A 1NQ6A 1FWGC 3GXNA 4JTCA 1D9EA 3TN6A 3E0WA 3BLEA 4MLRA 3LHYA 2QNEA 1XG4A 4GZIA 2J13A 5JIPA 1GJWA 3ITOA 2D0HA 3AXKA 2DJXA 4C7DA 1L2UA 4FX8A 1R38A 3P8JA 1JD7A 5C9XA 1NEYA 4ZO9A 3L67A 2GUYA 4F0MA 4FLQA 2MANA 1GKPA 4JAWA 3PS7A 3S5OA 4N6FA 3P74A 1VFUA 2QPUA 2C13A 2BXVA 2VQTA 1EZWA 1XD1A 5I3FA 1DXFA 3DECA 3PBMA 3QHOA 3UR7A 1GHSA 1DJWA 4UTIA 1O66A 2X0SA 3BG5A 3KL0A 3WFAA 4M1BA 3FK4A 4RE4A 4AIOA 2DZPA 4LVBA 1QUMA 3VOCA 1MW3A 4LRTA 2Y4SA 3QKZA 2VEFA 4EF9A 3EPNA 4DRSA 2V69A 1OFRA 4L4PA 3Q2DA 3BQ5A 3VM7A 1CB7B 3WKZA 1WP6A 3CAWA 2VGGA 1QOPA 1R8LA 3WG6A 4E8CA 3CZLA 1AD4A 3HOJA 3UWEA 5JH1A 4PBGA 3SCUA 1UA3A 4JFWA 1E0WA 2PP3A 2PPGA 2NLIA 2OWWA 5K4XA 3CMGA 1I8JA 1CGXA 4AVFA 1Q6DA 3L65A 4HNTA 3UU0A 5E6ZA 4A8IA 4O52A 5AYYA 4QGCA 2CCRA 1PKNA 4Z2IA 4D9PA 2VFDA 4NX5A 3E02A 2YB1A 3VCRA 4TQTA 4IIGA 3HPXA 4KEUA 5ABHA 2OSWA 3FS2A 4HK5A 4R33A 2PDPA 3NDZA 4AHOA 1DJGA 2D2JA 4GH1A 4XKMA 3MUZ1 3OPSA 4XIMA 5D2XA 4GABA 3NL2A 2D1ZA 2PDHA 3BC9A 2XJ7A 3W1RA 1V77A 3CXOA 3T05A 1W31A 1UZHA 3S8HA 2X1UA 2ONEA 5CBBA 3RG6A 5C9WA 1BYDA 2R6OA 5I07A 3DFYA 3PNUA 3DFNA 4ZQCA 4Q8TA 4S3DA 2OZ0A 3CQJA 1QR7A 1VPXA 1WBJA 3U0HA 1NY1A 1IHIA 4QS5A 3T8LA 4CNUA 2V3DA 1VHNA 4HSOA 3LY0A 4XZMX 1QATA 4J9JA 1HQTA 3W6MA 2O9PA 3IGHX 3M6DA 2DZVA 5HUOA 1SFTA 4B3KA 3W82A 4W7VA 1MSSA 3SCWA 3WEZA 4JIRA 1V6YA 2PDMA 3CL6A 1RA5A 4AIBA 3Q67A 3AU2A 1GCYA 4FOJA 2YL5A 3UA4A 2G3IA 2PDLA 5LA1A 3GXIA 3LEPA 1YHTA 2WXDM 1B1YA 5I79A 4K8EA 4BKNA 4EXBA 4FALA 3H70A 2EQDA 2XN0A 3KP1A 1CB2A 4HCDA 2DV0A 9CGTA 3SCOA 3GYEA 4M19A 4B5XA 3GD6A 2HROA 3HGOA 4BCEA 1JZ5A 2YZRA 1PAMA 3M6YA 4Y9OA 1H7PA 1PBGA 2WMFA 2OTDA 1XKYA 1YPIA 1KW1A 1B3XA 2RDUA 3W1XA 2GGHA 4J4KA 4LY4A 2OVLA 1HO4A 1CDGA 1R47A 4WSKA 1R2TA 1S39A 3VIMA 3USBA 4B5UA 1OC5A 3WLSA 3K4DA 1NJJA 5LXEA 2JBMA 1DIDA 1RALA 2QCNA 3AZSA 4HA0A 2W61A 3T07A 5DRIA 1MZHA 1EJTC 1UBSA 3LXAA 3UG4A 1XP3A 1AZ2A 3BCFA 1TV3A 5TAOA 4A8NA 2YW4A 1I2NA 3AOFA 1EP1A 4PMQA 3GUWA 2I1OA 2YCLB 3BURA 3LMZA 3WLPA 4PBEA 4DUXA 3CTLA 4PRRA 1IGWA 2QUUA 4TX6A 2P10A 4E6MA 2WCSA 3BARA 4CNTA 3W87A 4OBSA 3BK0A 1IQ8A 5FF2A 3U2ZA 2ZRXA 3GNNA 2FJKA 3NPXA 1HF6A 3C8NA 3KRZA 2ZCGA 3QFEA 3VOFA 3B4YA 1ZFJA 2RUSA 3L4YA 4DF1A 1X1ZA 2FTYA 1S5WA 1KRMA 1MUWA 4H9MA 2OEKA 3FLUA 3VCNA 1WQ5A 1V08A 3G3MA 2I17A 2I9EA 1KBBA 3U48A 1IWBA 3H8AA 5I06A 1H11A 2VWSA 2I56A 3KE0A 1E4NA 4KRTA 1JCYA 1P4CA 3R94A 3B8VA 4K3ZA 3DEQA 1UHVA 4B2DD 2BZNA 3GAKA 3C2RA 3WYZA 2XIOA 4LYRA 4LUIA 1HUVA 2J7DA 5FL1A 4GBUA 1T96A 1V6VA 4Z2KA 1B3YA 3M64A 1GVSA 4LF2A 4OZOA 2VD9A 3WNNA 3N29A 4C6PA 2X2YA 4IH3A 4OUEA 3WDHA 1HGYA 2Y5JA 4R88A 3SJNA 5FKYA 3M0MA 3ECQA 2ON3A 2HXTA 1A3XA 1JAEA 3CT2A 4M6QA 4RZBA 1TWSA 1EOKA 2VEGA 1UWUA 1VHCA 5F4XA 4DAFA 2G3MA 3GG1A 3STEA 4V28A 2A79A 3BJTA 3EOLA 1V7AA 1AJ0A 3FA3A 1BG9A 3RU6A 4NU7A 3WLNA 1K1DA 5TD4A 1VQTA 1GVFA 3B05A 2HPMA 3TZNA 4GJIA 2YLLA 1RK5A 5I02A 1EJSC 5XIAA 2FDSA 1XLMA 2OYLA 3L12A 1D3CA 4M82A 4XQ6A 4UTFA 3WD1A 1TO3A 3GIQA 2OLSA 4LPCA 4IQJA 1O5RA 3VYLA 5IHSA 1GVOA 2DZAA 4S1FA 4XWUA 1V93A 3T09A 5G4WA 3M5VA 3JUGA 4YIWA 1VS1A 3TLLA 1FFQA 2AL1A 3TDFA 4MJMA 2VUNA 3UJSA 2Z6JA 1BTMA 3T0DA 2QMKA 2VCCA 1MXSA 4NJJA 4O57A 3DCPA 4XZWA 4DPQA 4G1KA 2YL8A 3W1PA 1P6CA 2AOSA 1W91A 4BEQA 3GVRA 3NPUA 3UZYA 3QQ0A 1W3TA 4RZ4A 1SSDA 3ZWTA 4M80A 3LNPA 4H7CA 3SIZA 3NZRA 5G2HA 5FF3A 3CZGA 3OHMB 3ZVIA 4HK6A 1UOKA 3QOKA 3TJ4A 1D8WA 2I16A 5CPTA 1VLIA 1ESWA 4P8VA 3SQLA 4E4PA 1KBLA 4JFTA 3W7MA 4DJEA 4LYKA 2DVUA 3TSDA 4IF2A 4WDUA 3TMLA 2QV5A 1L2QA 1GOMA 4P61A 1OG6A 1KO0A 4O15A 3CV1A 3O3RA 3T78A 1XLEA 3IGSA 4QEEA 3ZS4A 2FB3A 2WK2A 2BGNE 4G2DA 4HN4A 1GKQA 3SGGA 1YE4A 4ZEPA 4RDYA 4IGSA 3UT0A 4IFRA 4JX4A 4O0KA 3OYXA 4GQGA 5JMUA 4MADA 4Y9PA 3AMDA 1ZBCA 3PN8A 3AI0A 4CNNA 3OW1A 1EDGA 2FPTA 2OQHA 1GTHA 1A5OC 3FJ6A 3OEXA 3LCFA 4O19A 5D32A 2WMIB 2PP1A 1TRDA 1LWIA 2OODA 2ZX5A 1VCVA 3SAZA 2KZHA 2DW6A 3T08A 3R0KA 3BMWA 1WYIA 1JF6A 3TJIA 4HPHA 4PMUA 1VJZA 4UR8A 4AIEA 4CQCA 1B9ZA 1O6IA 3E2VA 2UZ9A 1MXGA 3R58A 4J28A 3UWZA 2YX0A 1JCMP 1TE1A 3HIJA 1QRQA 1RJRA 2E6DA 2VQUA 1PDZA 1V6UA 1XBXA 3QYSA 4E8GA 4DJDA 3RCMA 4LBUA 1A4LA 4XSMA 5REQA 4LS0A 1IGSA 2BV9A 2DQXA 1JPHA 1AH3A 3C56A 4NX0A 2NT0A 4IMFA 1W56A 1GOQA 1Z41A 2WM0A 4K1WA 1DWAM 4R53A 4UTMA 4MKVA 2C1HA 3URQA 4W9TA 1DWGM 1PB0A 1W5NA 4FB7A 3W86A 4ZODA 3IIVA 2VP8A 3UZJA 4B3LA 2J27A 3FDGA 3WUBA 3U5UA 1E1FA 2R8WA 5XIMA 3GLCA 2V5DA 1JEZA 2J66A 3RITA 2I5QA 3H2OA 3ORWA 1OIMA 3EEZA 4P7LA 3OA3A 4JQ2A 4GI8A 1JUKA 5ECVA 1JPKA 3QKEA 2NQ5A 2ZVIA 4TOQA 5LIUX 2XH7A 3QR1A 1IEWA 3KXQA 5FEWA 3CYVA 1SJBA 3WF4A 2WC7A 2E4TA 1P0KA 3WZ0E 6A3HA 4EXQA 1UPPA 2EGZA 1EIBA 3EPMA 2E5CA 1EH9A 4LOCA 1OX6A 3T0TA 3VUPA 3WLRA 1I2RA 2QT3A 2ZUNA 1IR2A 3POCA 3Q4DA 1OM0A 2J6XA 3QPYA 3DYMA 2WW5A 1GORA 3W7IA 3W7LA 1AJZA 1IXQA 3UJ2A 3CHCA 1OK6A 1R9XA 3B0XA 2AQWA 4DAIA 1RA0A 3P14A 4DO5A 1M53A 1ZAHA 1IWPA 2OPJA 1TA3A 3H7UA 3XINA 3ZT6A 4MAZA 2PODA 4B5TA 5DO8A 1ICPA 5FEXA 4KIRA 4I5UA 1DQUA 2LLEA 1IEXA 4B90A 2HTMA 3E2QA 4JGDA 4MWAD 5EKYA 1XCWA 1LDCA 2WSRA 4IJRA 3A24A 1P48A 4FEZA 4ASTA 2QS8A 4LF1A 2J8FA 2FTWA 1VFSA 1GGOA 4P5UA 1GQKA 1XIBA 2DT0A 3F5KA 3DYPA 1XYMA 4GA8A 2QAPA 4YTTA 2J4GA 1KM6A 2XFFA 3NQ7A 4JKMA 4W5ZA 4AD1A 1MXDA 2IPWA 3CAKA 3G2GA 4I5XA 1MRQA 4O11A 1X1NA 3FOKA 2OT1A 2RDXA 3NR0A 5DXYA 2WVVA 1IEIA 3CUJA 4KT2A 4M56A 1L6WA 1JZ3A 3BW2A 4O8RA 2QPSA 3LRLA 3D5HA 3U6WA 2GVGA 3G1YA 1OCBA 3LBCA 2J9ZA 4HZ7A 5E6YA 2PRHA 3PAJA 3W83A 1ML1A 1JRBA 3VX0A 1BYBA 2HQAA 1W1PA 4TMBA 3NEVA 5HPCA 4GD0A 1UP0A 2HRWA 4QEHA 2DY3A 4D6DA 1M5WA 1TJPA 2WQDA 2GJXA 2Z7KA 5BU9A 5LNUA 4YTSA 4H01A 4PE8A 4QQUA 1VB9A 3QOMA 4PTVA 1ZJBA 2OSYA 1RPXA 1LRNA 3A4AA 1UB3A 5AC5A 3V0SA 2Y62A 3GYCA 2IPGA 3IJLA 4HMNA 2O92A 1DTNA 1IZCA 5HPOA 3F1QA 3B0YA 2PGRA 3TYDA 5D09A 1SZNA 3G0SA 1JL8A 5ENLA 3UR2A 3LV5A 1E43A 4LTSA 1MNSA 1EJUC 2PDBA 4DJFC 2CETA 1SR9A 4G7FA 1CW2A 3WD0A 1RXOB 4HNOA 3WMCA 2BG5A 2PU1A 3F5JA 3WSUA 3D3AA 4O1EA 3N15A 1LYXA 3SUUA 4AWEA 1A0CA 1C8YA 4HD5A 3VOGA 4GNJA 1KBKA 3RLVA 2A3BA 1BRLA 4LAOA 3TTEA 2DUZA 1S1RA 4H6EA 1MW2A 2DZXA 5BXPA 1OBAA 2VKZG 1XISA 3DFPA 5TQLA 3THUA 1K9TA 3G8EA 3CLMA 1GZGA 4AQLA 3S4TA 2Z29A 1VFFA 2EXOA 4FXFA 4V1XA 4YLWA 5DQPA 1S3TC 1EP2A 1E1CA 1K8YA 4CD4A 1D2KA 2XVLA 1XHGA 2QVHA 3VIHA 9XIMA 3WQDA 4LH8A 5L9FA 1SUXA 3SFWA 3H24A 2V2DA 3JZEA 1REQA 3WF2A 1BVWA 1O5XA 4UFIA 1M9HA 3MW7A 2CNCA 1Y7VA 2RDTA 2D2HA 4YYCA 3OIHA 3R0DA 3LX9A 1KFWA 4GX9A 3HJEA 3W25A 1U1HA 2A3CA 2GVJA 2WVTA 6ENLA 2BS9A 2FZ8A 5E93A 1A0DA 1V3KA 1H2JA 2JALA 4U3CA 5A8QA 2X09A 4WY0F 1EUNA 4L4MA 4ORIA 1BVNP 3MBFA 3KRUA 3NZPA 3WJWA 1W6TA 1LL6A 3SCNA 3SY1A 3DBPA 4PEEA 5LA2A 1VFHA 3RX4A 3FJ4A 3TQVA 1V6XA 1GWJA 2RHGA 3P82A 5CC5A 5C71A 4F0KA 4GZ7A 3N34A 2PFHA 1FWAC 2PWFA 3DFTA 1YNQA 2E0PA 4K37A 3NM1A 3S5SA 3EEGA 5IHRA 4DZ5A 4MTVA 5EMKA 3QQWA 3ARVA 1K4HA 2ZRYA 5C70A 1Q3NA 3S2LA 2VNCA 2FMOA 2PBOA 3N3MA 5HDRA 3VPLA 3AS0A 5CPNA 3NEHA 3LCHA 2CLKA 1RSCA 4QSHA 3PUGA 1A3WA 3GXTA 2REQA 3ABXA 4PGLA 4C1KA 2HEJA 2GK1A 3F4WA 1A80A 1YDYA 2P50A 2UWFA 4DX3A 3AIVA 1CX9A 1CPUA 4XUYA 4L4OA 4PEKA 3G1SA 1TFVA 3SRKA 1PZ1A 2FPVA 3EWCA 1V8EA 3VABA 3D47A 4JEJA 4ONVA 2YXGA 4K1GA 4OWGA 2WSYA 3C5QA 1ECQA 2VI0A 3VFCA 3UFYA 3VKAA 5I3IA 3PZQA 5BYWA 1MRAA 1F6PA 1F8MA 3TUUA 1GVQA 1MW1A 1DORA 4B5SA 4H9XA 4Z1CA 1CI1A 3GTIA 4M7TA 2A3LA 4RNHA 3L5AA 3I3EA 1WCGA 5FIPA 5D30A 1HGWA 5AB3A 1OZQA 4X2RA 4A4AA 1W9VA 3U3HA 1F61A 3W01A 2GFTA 2ASHA 7REQA 2DP3A 5TF0A 4DEFA 1RP8A 4JIIX 1OX4A 3N9KA 1SJAA 2VD8A 3LZ5A 3NUKA 4GXMA 2X7WA 3WQ5A 2GVLA 3B9NA 1CZ1A 1DEDA 2QIIA 2DT1A 3FIGA 1W8GA 4EE9A 3NWRA 4XTDA 4B3ZA 3AAMA 3N18A 1TPWA 1RD5A 4MVAA 2BODX 4MJ2A 2Y7GA 1ISVA 1XYZA 4EWJA 4HPJA 3PHAA 1YTDA 2W6RA 3O7UA 3S2MA 1DJYA 5C55A 5I77A 1LBLA 2R14A 1AH4A 1A5SA 1L6YA 2OWXA 2YBUA 4FZIA 1AQMA 3F4DA 5H8PA 1ZAJA 1J11A 7CGTA 2F9RA 4W85A 5JVLA 4QJ1A 3S6DA 1EB3A 1YADA 2Y6ZA 3TA9A 3REQA 5XINA 3M0LA 2DT2A 1KM1A 4PBFA 4I5RA 4AD2A 5G1TA 4QG9A 2QJJA 4I8DA 2Q71A 3ARSA 3MUY1 3H21A 3A4XA 3AHTA 3ABOA 1T0OA 5A69A 1OCQA 3CJPA 3S5NA 4CQ8A 3AU6A 3MHFA 1XYCA 3YPIA 3TOYA 3VC6A 1A5UA 1VFLA 2XZ9A 3XIMA 3LN3A 1Z89A 2WV8A 2ESCA 3C8FA 4A8LA 4J3UA 3TN3A 3PBVA 2HE5A 3NAVA 3UPWA 4LUTA 1ZNNA 4LU0A 2CZDA 1UR0A 2Y8VA 2YZ5A 2R1NA 5J04A 2Z2BA 3MCMA 1E73M 3TE9A 3VDAA 2VCBA 3IPWA 1FCVA 4HTYA 2DZWA 3N14A 2NXIA 3IJDA 2PURA 3GTHA 3WNPA 4FAMA 3PVFA 1BGAA 2E9MA 1QPRA 3CIXA 3NQVA 5D03A 4DO6A 1PIIA 4IPJA 4OFCA 1G9HA 2G3NA 3RGTA 1BLIA 4PUKA 3PZMA 1K9DA 1AQHA 5KINA 3AS2A 5BWAA 1TPFA 2CLMA 4J5NA 1ISZA 2BY2A 4Q4KA 3VZZA 4NXSA 1Q66A 3VGBA 3W7QA 1QI0A 4GZEA 4WGXA 2D69A 1NDZA 1J79A 2WCGA 3AIWA 1N8IA 3TZFA 2VX6A 4IPPA 1M41A 2W9MA 1L9WA 4GCXA 2V2CA 3PZUA 5IBXA 3WLLA 3V75A 4KWWA 2J7HA 3VFLA 3CUHA 2PAJA 2X16A 4MKNA 3STPA 2VFEA 3G1DA 3UQNA 3PTDA 2XH0A 1T7LA 3V0UA 1SU5A 4JTFA 1TPDA 3WL1A 5REQB 3ARXA 4I9TA 5MHBA 3W1TA 2ISWA 5HNNA 5E09A 1EF2A 3KBMA 5E9XA 1J9YA 4PCNA 2PZ0A 4UQDA 4XV0A 5F1VA 4LANA 3PR2A 1UH2A 2VC9A 1VRDA 3EWXA 2FHBA 1UWSA 3DC8A 1UKPA 3QYQA 4GXWA 4R7JA 5J5RA 2J24A 1W32A 3HV9A 2CLFA 4N6EA 2W3ZA 5LNVA 1ITXA 3M0JA 1PKMA 4CQDA 3MA8A 4CLMA 3ARQA 1ENUA 1ZCOA 1BVZA 1NU5A 3ATYA 1PX4A 1E4LA 4PULA 1M1BA 1SMAA 1W2PA 4HNLA 4TO8A 3M47A 4ZFCA 2O4QA 4NYYA 4JTDA 1EJWC 3AMLA 3TN4A 1QFEA 2ZZ6A 3WQCA 4EPKA 4ZFMA 2A3EA 1K03A 1H1ZA 2BHUA 3EXRA 2A5HA 4FNPA 1UP2A 3GHSA 2EHHA 4AHPA 1V02A 1WE5A 3R13A 4I7WA 3UR5A 3C0JA 3QRHA 3QSRA 1UASA 3AHYA 1UH4A 1XUZA 2YDRA 1C7TA 1XICA 1UBPC 4GK8A 3CV6A 4IGNA 4Q8WA 4YN5A 5AHIA 4BF7A 1TA3B 2VEMA 1HG3A 2ACQA 2ZUSA 4C91A 2CZ5A 4EXAA 2Z25A 3EPOA 5AFDA 1FWRA 1C93A 3S9YA 2DW7A 3AYTA 3MKKA 2P53A 2Q8XA 2NUXA 3DN5A 4U4MA 3BV4A 1XM3A 1YKWA 1PTGA 7TIMA 2WJZA 4I7VA 1CCWB 4KKXA 3SFKA 1ONRA 1GJPA 2G4FA 1OYAA 3WENA 3IGXA 3CMJA 4JQ4A 3NURA 3R89A 5K4ZA 3H4XA 4MFEA 4Z17A 2ZKMX 4Y9AA 3A4JA 3MS8A 2WAGA 3GTFA 1J0KA 4ZMGA 3I6EA 3WJYA 2EF9A 2E5BA 1XBZA 2WVVB 1H51A 1R3SA 2EKCA 2WJEA 2E40A 3UEQA 4FXRA 2J75A 1TPEA 2NLYA 3L4ZA 3VMNA 4PN2A 4HOWA 4JQAA 2IPFA 5HJXA 4H6KA 3A3XA 4BF5A 4MB5A 3W7PA 1JCNA 4MNKA 4ICNA 1GJUA 4MLJA 2X2GA 4CQAA 3TYCA 1KKRA 5I3GA 2CLPA 3FY1A 2IUZA 3T42A 8XIAA 3UXKA 3MSDA 3H2CA 2PRLA 1L0PA 5A8PA 2ACUA 1E56A 3QV7A 2UY3A 2PS2A 1QI2A 3TXVA 3N73A 3HF3A 2BVYA 1E71M 4K36A 3VKCA 3UXDA 1NDYA 2HBVA 3T2PA 3ZM8A 2ZVRA 1K3UA 3P7YA 1CXIA 5IFTA 3W76A 3OGSA 3ISIX 4WLCA 2R94A 4AZCA 1AW1A 1U1JA 4HU3A 4MNMA 3O63A 3GDBA 3HB9A 3GQYA 3ITYA 4LBRA 4EWND 2BOGX 2G96A 2GJRA 4UTLA 3MBDA 4NNCA 3NPWA 3VMOA 4TUFA 2CYGA 3M0XA 3CTTA 1DPMA 4XD3A 3NNTA 5HJYA 1BRLB 3TMQA 3AICA 2OO6A 2I5IA 3S2NA 3URAA 5KITA 1EWEA 1SSGA 1R3RA 5PTDA 2HK1A 2XWEA 3ITCA 3L66A 2J9YA 3VI2A 1BKHA 1E5JA 3M0ZA 1U83A 3GC2A 1UQZA 4L65A 3RM4A 2IPJA 1YNYA 3VGEA 3FW6A 1A0EA 3WUEA 1E1CB 1JGIA 3EOUA 1XI3A 4DLMA 5H8MA 4GUHA 4L6OA 1BEUA 3IEBA 1XIMA 4TTUA 1KCKA 3C86A 1TJRA 3LDVA 3LTYA 1IIHA 4IZGA 4UTTA 4GUFA 4C6BA 4E2BA 4Q8UA 4DYJA 1B54A 1REQB 4U28A 5D9MA 5A6SA 1E55A 4W88A 3FA5A 4XISA 3WLTA 1R2RA 4FNRA 4TU1A 4UFHA 3VVGA 3GNXA 2NXHA 3LTSA 3PJTA 3W24A 3P6LA 1LLZA 1IWAA 4D6FA 4KFOA 4ACYA 4LAMA 4IGMA 4JDBA 4ERIA 4KEMA 3C61A 4O1CA 1Q4WA 3R8RA 3ERPA 1T8QA 3WJZA 4C6QA 2DPEA 1XX1A 6REQA 1KV5A 3MSRA 4E2VA 4QE1A 5A6BA 1VYRA 1U22A 5LHEA 3PG9A 1E6XM 3G1VA 4TTGA 2CLOA 3KL3A 6TIMA 2GDVA 3HG2A 1Q8JA 2B0MA 2O7QA 5D02A 3HG5A 3GHTA 1LF1A 3LI0A 3NIYA 4JXCA 2NUWA 1Y5XA 1EPVA 2ZUWA 6ALDA 2D2GA 3TEVA 4GACA 2BP1A 1TVNA 4DO4A 4B5NA 2GPTA 3S0CA 4RR4A 3W72A 6XIMA 4CQ9A 2FVLA 1OGGA 2WMKA 4G6CA 3LHZA 3F2CA 1ZS2A 1DWFM 1OB0A 3QM3A 3LRKA 4DF0A 2REQB 5A8GA 3PF3A 1CXHA 2GK1B 3WLJA 4JNZA 1SW7A 3S47A 4FF7A 3RU8X 4NZJA 4QNWA 3LGEA 3GWQA 1S5VA 3IVUA 4CCDA 3AWNA 4R7OA 3CGTA 4PC8A 1MMFA 3KFTA 1KQZA 1S3HA 4F2TA 1TTQA 4PCPA 1XF0A 4Q6XA 3SN1A 3PFRA 3WMLA 1BGGA 1XLFA 3R0UA 4IXHA 2OZTA 2XINA 2PSNA 1X97A 5AN7A 4ATLA 2C1IA 4RX0A 5I23A 1SZFA 2VR4A 3LHVA 3TYAA 3DKJA 3EGJA 3BJFA 4XD5A 3ATZA 4HHLA 2WHKA 4X61A 3M44A 1OX4B 1O60A 4TX9A 1IXPA 5FAJA 4W89A 4KETA 3RM8A 2EPHA 4ICMA 1FFRA 3WQWA 3NO3A 5FD0A 1DJZA 3L4UA 1BTCA 3CHVA 3LHUA 3RNDA 2HCVA 3BWWA 3I10A 5M2FX 2V38A 3RILA 1PUDA 1N8FA 3IIPA 3L2MA 4FXSA 2ABAA 4LAKA 1SR0A 1Q7MA 1XIDA 4OTKA 4V15A 1OG0A 2GLKA 3II1A 2HVNA 1FWIC 1QASA 3P5ZA 4NZ1A 1JG9A 2G95A 1J0YA 2W5FA 1H62A 2H8XA 4UFLA 4DBSA 1UZDA 2WKLA 1QNVA 1QPNA 3REQB 3LLFA 1LUCA 1A5AA 4OIFA 3AUOA 4GCAA 3QQ1A 3T9PA 1WZKA 1TV8A 4M81A 2BASA 4KGJA 1LT8A 3RMEA 4Z2JA 2EPLX 5F7UA 1LM1A 2OEJA 2C14A 2Z28A 1EHAA 3U7VA 2FQIA 2V5CA 1Q7ZA 1OHLA 1F07A 2IQTA 1TVPA 2WANA 4Q8VA 5AC4A 4O18A 4DWSC 1TV5A 2PF0A 3QJAA 3ZSSA 3BLPX 3EA2A 4LUTB 1FHLA 1RCQA 4KGLA 4LB3A 3NPVA 4XVEA 1H0IA 1HT6A 1KM3A 3SRHA 1EEPA 2IKJA 2PDKA 3E0VA 4RV3A 4UB9A 3UETA 1GHRA 1C8XA 3IWPA 3BAWA 1TTPA 1VF8A 1Q63A 3WK3A 2P3EA 1TZ7A 2VX7A 4DBWA 3P60A 3WDIA 3KTXA 4M5PA 2Z1SA 4YVPA 4ATDA 4JICA 2YDAA 2F38A 4HMDA 4WXYA 3ZO9A 3ID7A 4O14A 3GXPA 4CU7A 4A6GA 4Y8EA 4GO9A 4M29A 1GOXA 5CZKA 3M46A 2QVNA 3IANA 3W02A 3AISA 1LBMA 3CBWA 3EOEA 3HQNA 4CN1A 1R9YA 3SR7A 3VE9A 4Q22A 4HCHA 1M01A 4WSHA 3B03A 1XLAA 1R5YA 3CHDA 4UFKA 2VVSA 3T0CA 2GDQA 2PU0A 1GVRA 3WQFA 1PDYA 1ZQ5A 4KCWA 2DIKA 5G2IA 4PCFA 3L9CA 3M0IA 3VNDA 2H3DA 2A4AA 4L6DA 4FP1A 4XZIA 5F2LA 3L4TA 1G01A 1EGZA 1NAL1 1O68A 2Y8UA 5FI8A 4DO7A 3HPZA 3KS5A 4AU0A 2O55A 1SMDA 2F6KA 4AEOA 3KBWA 5CGQA 4FK9A 1QVBA 4HNNA 3VK5A 3V4BA 1MFUA 2ZUUA 3MKCA 1QWGA 4N0RA 3KZSA 4HMCA 3O0FA 2WPGA 4X9YA 3TWAA 3N2TA 1J01A 1ZENA 4K2SA 5LXXA 4EAMA 4KWOA 2J62A 1OC6A 2NQZA 1LQ2A 4HMEA 1TCDA 4IP5A 2ZTJA 4JL1A 3GHUA 2A3AA 1KGUA 2VC7A 1OF8A 1P7TA 4MY9A 1KCLA 4FLOA 2H9AA 1B4EA 5I7GA 1E6NA 2Z26A 1ZAIA 4TV6A 4O16A 3H26A 1JZ8A 4AX7A 3O1NA 1OFOA 5LA0A 2P8BA 1LP6A 1GYLA 2V0TA 1ITCA 1Y65A 5HMSA 3P3BA 4F0HA 4S23A 4NZFA 4AY8A 1C7SA 3HPSA 2ISFA 4EIVA 1VBRA 3CMFA 4LS2A 3APGA 1E3ZA 3EX3A 1JPDX 3QLLA 4ZB0A 1L6SA 3M5XA 4D6GA 5AHEA 3L0KA 2HVMA 2PWVA 2WNWA 5A6MA 1TZZA 1FWNA 3JW7A 4RV8A 2CBIA 4FX7A 1UW9A 5A6LA 2D24A 1XLIA 4YHEA 2ZTKA 1DKWA 5CPOA 1JYXA 2Z2AA 5ECUA 5FJIA 2V3GA 4JN7A 2BOEX 3ZZ1A 3U4FA 4XG1A 5AVHA 4PODA 4P7QA 3B9DA 1KTNA 1W1IE 2Q09A 1P43A 4I7UA 2DORA 3DBNA 5EFDA 5HMEA 5FESA 4ZA0A 4JCMA 1XBYA 5HR7A 5FJJA 4GIAA 1NIUA 4UQEA 2WWDA 3AHVA 3EYPA 3LM7A 2Q6ZA 4KEZA 3C3NA 1XDJA 5AZ1A 4EPDC 4GIYA 4OQVA 4DELA 4GPNA 1WNOA 1EYWA 3GB6A 1Q5MA 3VC5A 1PWMA 2Y1HA 1RHCA 4NXKA 4DIAA 4BQ2A 2C0AA 1XRFA 2BMBA 5KZDA 1NWTA 4MKSA 2WKGA 3PG8A 1EDTA 2POZA 3DZ1A 5A8NA 4CUCA 3H7RA 2IXVA 1A5NC 5DXXA 2Z0IA 4NJKA 3TR2A 2BNJA 3SY5A 5DMYA 4HSNA 3LCGA 4IUOA 2YYTA 3QFWA 3LHWA 4X0NA 3NZ1A 3ZJ8A 3QY6A 1UKSA 1KGWA 4KW2A 5FL0A 3GG7A 2VC6A 4IMEA 4E8DA 3VGDA 1V79A 1XSJA 2F84A 3EDDA 3BZGA 4TX8A 2E1DA 3MP3A 3BANA 2H8ZA 3ARPA 1QI4A 1BWKA 5DFAA 3IAQA 1I60A 3RPMA 5RUBA 2NX1A 3C2YA 1EYEA 2V5JA 4F40A 4AZCB 3SCTA 4ZBCA 1YTKA 3KVMA 4ZXLA 2ZC8A 2DJLA 1G1YA 1M68A 3BSHA 3MWCA 4GI6A 1JDDA 3LCLA 7PTDA 2EAWA 2WWCA 3TJXA 3TTOA 3ZJ6A 4JFUA 1US0A 4AVOA 3NGJA 2ZX6A 1WO2A 2JF6A 5MF5A 5E70A 3AO0A 3KAOA 1TSIA 4ZE5A 4HA1A 4BK9A 3B9OA 4GXPA 1BYCA 1KRCC 1WZMA 2CFFA 1K9EA 1G7VA 4Y9MA 2V82A 4ZCWA 2ZZ1A 4WVXA 4N9EA 1Z3NA 4LUJA 4HA4A 3VNJA 2VDIA 4ZSTA 2ZZ5A 3WJXA 2YOCA 1FWBC 5CEWA 4RKAA 1BFNA 1CLVA 3F2DA 4JHZA 3ZWSA 4HJWA 4O0ZA 2RAGA 1AMYA 4QCFA 3DKLA 3PPCA 4IL2A 4H19A 3BSMA 1RH9A 3URBA 3LA4A 1TPUA 4QITA 3AIBA 3HFYA 2YA0A 4AX6A 2E1WA 2G3JA 1GK8A 3QLDA 1DWHM 4ICCX 4GJ1A 1ALDA 2V63A 4UZSA 3HMJG 1FY6A 1EEXA 4FS9A 3K13A 2WMJA 6REQB 3PJWA 1SW3A 5HNUA 1W1TA 1G67A 3W7RA 4NKCA 4UTJA 3SM0A 2PGFA 3KRSA 1B90A 1TUFA 2J74A 5CLTA 1YXYA 3OLDA 3U2OA 3LLDA 4IQLA 3STGA 1DWIM 1IV8A 1VPQA 5DF0A 1EJ7L 3UXLA 1XYAA 5HA7A 3TTYA 2VTFA 3GVQA 1LTDA 1KNWA 3EAUA 5BOOA 1QNSA 3UPBA 2ZX9A 3GTNA 3VNMA 1QK2A 3M0KA 1KCXA 1OIFA 3NSNA 1PKYA 4Z1AA 1LQ0A 4R34A 5LSMA 3E12A 2XIQA 1P1XA 4AF0A 1YDNA 5HJLA 1XQKA 1BQCA 3GR4A 2J78A 3NQGA 2VT0A 1BF2A 3UJRA 2EPMX 1AZ1A 1JZ4A 1R87A 4CEUC 1YLVA 3D0CA 4JS3A 4ZZ9A 5E0KA 1GEQA 5JQ9A 3NXFA 2V3EA 1Y5WA 2CBJA 2PZNA 2AKZA 1HN1A 1B9BA 1UR9A 4IMDA 2P76A 3KM8A 1J10A 3NL6A 4IGHA 1SYTA 4JX5A 3ITXA 1FKWA 4UMAA 4GI4A 4OOZA 3W2MA 5IM51 4HNVA 1V02E 1WX0A 1GVIA 4DJED 3PBGA 2A2IA 3RFAA 3WH5A 3WMSA 2F6UA 4IXXA 1G5AA 2FZBA 4IFOA 3M1ZA 1Q6CA 4D8LA 1P6BA 2YYUA 1HJVA 1PHWA 4GKLA 3TWBA 5KEZA 4K8GA 1JDAA 3COTA 1T8XA 2DQWA 1KM4A 3VKDA 3B0VC 1RVKA 4O28A 1W17A 4PYSA 3UF9A 5I3HA 4XD6A 1EJRC 3N12A 3UZ5A 5CAKA 3CL7A 2JKAA 1TQXA 4F79A 2HS6A 5E1QA 4OJYA 4GC3A 1I2OA 2A85A 3OB8A 4XAYA 1XLCA 4AZ7A 4CEXC 1E9IA 1SO5A 3S6OA 5HULA 3JU2A 4WSJA 3QC3A 2ZQ0A 4GYPA 4HA3A 2X42A 3CV2A 3DDMA 4E4FA 2G3FA 3GKAA 3C2EA 4V2XA 1JYWA 3BG3A 3C2OA 4L7ZA 1L8PA 1QW9A 2FMNA 1PPIA 4ALDA 1R0MA 4EP8C 4KPLA 2TMDA 5HINA 3FA4A 1Y0EA 3NJ3A 3B9AA 4IIFA 3KOYA 2PDIA 2CLIA 1JULA 4PR4A 4RNIA 4O17A 1NDWA 2QCCA 1VCFA 1A3HA 2VM8A 4WOZA 3PZVA 2ZE0A 1ISXA 4L56A 4DJDD 1VBUA 3ITTA 5HBFA 2FZ9A 1XDLA 2PDGA 1LUCB 1TV2A 4X2PA 3I3DA 2AQVA 4XZNX 2QDDA 4LRSA 3N9RA 4MFDA 2QHAA 3NYDA 3BO9A 4Y9NA 5B7YA 1TG7A 2FZMA 4ZL1A 5FJTA 1ISYA 2G41A 2A7PA 1ZUAX 1QJWA 2J77A 3E3HA 4QTGA 4DPPA 1VFTA 4DXVA 3GR7A 3UBPC 4W84A 1X1OA 3BLIA 3KL5A 1XCXA 3G24A 3HJZA 5I78A 2QMJA 4DUWA 4HNUA 1E15A 5M1TA 2DVXA 1EA9C 2R1LA 4UMBA 3T6CA 2NQHA 5G4HC 1W5QA 1HL2A 4GI9A 4N2YA 2QDGA 2NXGA 2CHOA 3UWVA 3RX3A 2J7GA 1WAWA 1KQYA 1PWLA 3CT7A 3NQFA 5I3DA 1LQAA 1CGVA 3CO4A 3SQSA 1CXEA 2I7GA 2GOKA 4F0RA 5MKGB 1UCWA 1FWSA 3OZOA 4M8UA 1UR4A 3JZUA 1FXQA 4ZVJA 4E5TA 4ZXOA 4MWAE 1JUEA 3KBSA 2XPKA 3TROA 2PD9A 1TCMA 2ZIDA 4FOKA 1F76A 4PMRA 1KTBA 2F2KA 2XVNA 4TVUA 3UCDA 3IJ6A 3BSGA 1XC4A 4XAPA 2QCGA 5C9RA 3KVLA 3KOFA 4DNHA 4DBDA 4NF7A 1FHUA 1T5AA 3L4XA 4NZ3A 1R85A 3FXYA 5E0FA 4YWSA 4HZ8A 1NARA 2PGEA 3RR1A 1QBBA 3M07A 5EU9A 2GGEA 1H1NA 4Q8QA 2P1FA 4AY1A 2WM1A 1QOQA 3ELFA 1B3OA 2X05A 4PMOA 4IM4A 1W0MA 1OEPA 1QNPA 1EC7A 4MM1A 1OC7A 3H2EA 4LCQA 4NT0A 4AY7A 3TW9A 5DMNA 3RHGA 3NQ6A 3B40A 3GC5A 3FKRA 4L9ZA 4QLLA 4X0VA 1QW7A 4UOJA 5D9NA 4UQAA 1J5TA 3CV7A 1VBGA 1JI1A 1TV7A 4OU1A 1QK0A 3U2CA 4H9TA 1JAKA 3GKFA 3TCEA 3IS4A 8TIMA 1MQRA 5C9ZA 3CWOX 3HM7A 3OQ8A 3QV6A 1W1A1 1XLDA 1EOMA 1F7BA 4X9SA 3QPZA 1E6QM 3H53A 4BS0A 2PC4A 3RJXA 3CZ8A 4DM2A 4PCTA 1FWHC 3D3FA 1W9UA 2VOMA 4RUBA 4BHYA 4MZ1A 1VFMA 4LVGA 3DU0A 3TXZA 3NSXA 2V8ZA 3CH0A 4NUWA 3CIVA 3UR8A 1P7TB 3WBEA 2H9AB 4WX2A 3WIJA 3TTSA 1TV4A 3SEPA 4M3PA 2OLHA 4XX6A 4ML4A 4R27A 4MWAC 2PLJA 3N4FA 1B2YA 4EX4A 3LI1A 5ABGA 4QJ4B 3KDNA 4IOTA 3MUCA 2IKGA 2O9RA 3PTQA 2J8TA 3WBWA 5T26A 3GU2A 4EACA 4ERGA 1ZLPA 3CUIA 3TW6A 1GW1A 4HZMA 4V1YA 4JYFA 4M6UA 3LD5A 5DT7A 3MUIA 3GBDA 3B8UA 4JR5A 4Q4SA 1ISWA 4XUGA 3S5ZA 5DCEA 3WLHA 2YDSA 1OK4A 3WBYA 3BCDA 1VYSX 4LXFA 4KRZA 3HMCA 4QR6A 2E6FA 3W1LA 5KETA 1XS2A 4KWSA 4WKHA 1R7AA 3AC0A 4RPQA 1G7UA 2SFPA 1SFLA 1RK6A 4MDPA 2Z27A 4DYKA 1IEVA 3QGVA 1UUOA 1W8SA 3BAYA 4ZO6A 5T91A 2AMXA 1AVAA 5CCZA 4M1RA 3W3OA 4QQ3A 1GONA 4WR3A 4XBSA 1OSEA 5JBDA 2VRKA 4MSSA 3AZRA 2IQDA 4I8YA 4ZSUA 1GT8A 4CGTA 3L0NA 5HANA 1GG1A 3XISA 3R25A 1QI5A 3CNYA 3GNPA 2PGWA 3E49A 5T8GA 3SCSA 2QGYA 4MNJA 1C8QA 1LOQA 5D8ZA 2E8ZA 4FO4A 1JXJA 4QBXA 1HKMA 3TTQA 1BPLB 3NQMA 4P8XA 3A21A 3MPGA 2ZUVA 3B97A 4WD0A 3PZTA 4EF8A 1DJHA 4AXKA 1MW0A 3L0GA 3ARYA 3K46A 1R3QA 2Y63A 4LUYA 4P7NA 4Z0JA 1FRBA 3TC3A 3TAKA 5DN1A 1X6LA 2HV5A 1E1EA 2GSHA 5J8LA 4ZOEA 2JKPA 3RRAA 2G50A 2F6XA 3WLOA 2DU2A 3PSVA 4O53A 1JZ6A 3WD2A 3QY7A 4O12A 4E2OA 3G6MA 2BB0A 3DIPA 3VD5A 3SN4A 3E38A 3WCZA 1S2UA 3LGDA 3W1NA 3MJYA 1GNXA 2GSEA 1VD6A 2CLHA 4RXFA 1CXFA 5C0QA 3WLMA 4D8AA 1I75A 2J6VA 1H0GA 3MQTA 2GQ3A 1PTAA 1G94A 4A2SA 1M7JA 1K9FA 3PPHA 3W6YA 3VINA 3LB0A 7ODCA 2MNRA 3E5PA 3C0LA 1WDRA 4GRSA 3UGRA 5HQLA 4AAJA 4S3EA 3ZR6A 4WJEA 2E25A 1B3ZA 1RY0A 1XCFA 4PFHA 1LZOA 1M3UA 2QF8A 2DZSA 1GZJA 1KLZA 3CPRA 3H22A 3PAOA 2TRSA 1RQEA 1TWDA 3KLKA 4XKYA 3E5BA 3OZPA 4IPNB 1WDDA 4Y6GA 2PWHA 4WK9A 1HJXA 2W67A 4N7QA 3VIOA 3SUVA 2X1RA 3DENA 2WC4A 1V0NA 1TPB1 3QMRA 3IUIA 1EP3A 3U7BA 2JEPA 1SPQA 1NFGA 1VBJA 4B5WA 2PC8A 2IKIA 1WKDA 2BY0A 3B8TA 1B3WA 1ADOA 1ELSA 1M6JA 3H2AA 1P0DA 3T81A 1H7OA 2ZX7A 2VR5A 2VENA 1KM0A 3BV7A 1NWSA 2Z6IA 4C90A 1FHDA 4HP5A 3AS1A 4L1WA 2NT1A 2NVCA 4US5D 2RGLA 2UV8G 3N6JA 9XIAA 3E6EA 3FSTA 3EX6A 3TQPA 4GVIA 4S38A 3BTNA 3GG0A 2OQYA 1EGMA 1QHOA 4GFSA 3VTRA 2FIQA 1M04A 2FFCA 3VO0A 5GJNA 3N9SA 3RO8A 4JYEA 5AOUA 3WBAA 4Y2WA 1H7WA 3BL3A 2GWGA 4XTIA 1UQYA 3SECA 4RE2A 3VKKA 1S5MA 3VNLA 1WUFA 3PZIA 3JRKA 2VX4A 2WHJA 3T0BA 3NQEA 1FP9A 1MEIA 2FPYA 1Q6EA 4AF0B 3SSZA 2QV4A 5F4SA 4IFKA 3WDQA 2YL6A 4IT1A 3C4UA 3CUGA 1G0CA 1JPMA 4A3RA 2WMGA 4LBSA 2WOQA 1D7KA 3A64A 3ONBA 3PB2A 1KXQA 3R8HA 3KTCA 4ZQRA 1LOLA 3LYEA 5KTLA 3T7VA 1DOSA 2VR2A 3DG6A 2VFHA 5JUVA 1JDEA 3CIWA 4U5IA 4V27A 1UKOA 1IZKA 1ME7A 1KXTA 3H23A 4ORMA 1PYFA 2RH9A 3UYCA 3TC7A 1UWQA 2CBUA 1KKOA 3ZVHA 1C9WA 4RW5A 4CD7A 4O4WA 2TPSA 3PULA 4IIBA 3L4WA 1EBHA 2CERA 1GVYA 3LSBA 1RBAA 1Q2SA 2OYMA 2AGTA 4U5KA 3S1UA 4HU8A 3EB4A 3USZA 1IEQA 4XBJA 2B81A 3FDKA 3TX9A 3MB9A 2VFIA 2ZRVA 1UYQA 3MO7A 2C71A 2ZRZA 2BHZA 4GY1A 4DLFA 3O15A 4BWLA 1XLKA 3A12A 1ZALA 1JCTA 3G3DA 2CZEA 4GUIA 3K4AA 3MANA 1K6WA 2G4JA 2VWTA 4PCSA 3KZPA 2FGZA 3CQKA 3N25A 2A7NA 3ZXWA 3K8MA 1H5VA 1N7KA 1Q6RA 3WDJA 5GJPA 2AGKA 1XPGA 4C1LA 3QV9A 4UC5A 5HOSA 4IX2A 3WFLA 3BOFA 3W85A 3W38A 1BAGA 4LYPA 1TIMA 1FA2A 2VZVA 1E6ZA 1YX1A 4C6KA 1Z8AA 2EG8A 2JQXA 1TPH1 2DSZA 3TFXA 1HL9A 1LRTA 4MMWA 4LWWA 4HPNA 1EJVC 3VIGA 3EA1A 5LNSA 4JCLA 2E7FA 1MEHA 1V7YA 3VNYA 2XU2A 4ZTXA 3U5YA 5HAOA 5AYBA 1L8NA 4UCFA 3LCIA 1A5CA 2PDYA 3G1XA 1QDSA 4RZ5A 3O8AA 3V5CA 4JTJA 4FI4A 1PZ0A 4C6FA 3N2MA 1UUQA 4RL3A 3CPGA 3QTPA 1QAPA 3W4RA 1BF6A 1KFCA 1OFEA 3N6QA 4NP7A 4YL2A 4OKDA 2Y70A 3VUSA 2BHYA 8XIMA 4QISA 1EJXC 3CQIA 4E2DA 3SRFA 4GJJA 2RDWA 1G4EA 1H63A 1FUYA 4X63A 2YLAA 4M7SA 3IJIA 3ZLFA 2OOFA 1VRXA 2WB5A 5A6TC 1SM9A 2XG9A 3ALFA 4H3DA 1H7XA 4K68A 5A1AA 3GIPA 3ZR4A 2XVKA 4UNLA 4F4RA 1AMKA 2R82A 4LALA 1FH8A 2Y85A 5D33A 2ACRA 1J4EA 3EA3A 4NG3A 4M51A 5C2XA 2BVDA 3AXXA 4WDXA 4ZTYA 4ROPA 3UWWA 1LRQA 3AMKA 3I65A 3PTKA 1RUSA 4BY3A 4QROA 1QNOA 2P0IA 4MOZA 1K77A 1Q6QA 4UTHA 5DMLA 4C6NA 2NSOA 3FHQA 1UUMA 4R5EA 2D3LA 3QGKC 2JK2A 3AIUA 3HPAA 3W1UA 4HKPA 4RXGA 1ZBKA 1LOSA 2YKKA 5FSEC 3FSUA 5HK4A 3IJ9A 2WYSA 1F5ZA 3W75A 1F3XA 4DBUA 4DNMA 3BAXA 3F03K 4DBEA 1NTHA 1SFJA 1YPFA 2GSJA 2RJGA 4WRHA 2GJLA 3LXBA 2PBGA 3NSMA 4Y96A 3R79A 1JQVA 2ODOA 2AMGA 1AJ2A 2Y61A 3UCCA 1TTIA 5CPQA 2E9BA 2OX4A 4AD5A 1PZ3A 4LEFA 4ADUA 4JTUA 4IIDA 5G2WA 4CCEA 2CHNA 1A47A 3KOWA 5LGXA 4C6MA 4J7RA 4GNVA 2EJAA 1SQ7A 3J7HA 2PRMA 4L5ZA 1SJDA 3MDUA 3TJLA 2VGIA 2DFAA 1HX0A 1VGAA 4J35A 1QPOA 5EB8A 1LL4A 2Q01A 3BH4A 2NVAA 1LBFA 1UMLA 1TWWA 5I6SA 4A35A 4UOQA 3LPGA 3ZYZA 2P3ZA 4MB4A 2ZICA 4G7EA 4EANA 4MPQA 3RPDA 4ZGYA 3R8GA 2WZMA 4W4QA 2WBGA 1OY0A 2WVSA 2YIHA 4UTWC 3NG3A 4H6RA 1XYLA 1EPXA 2NW0A 1EFZA 5I3KA 5A95A 3JR2A 3W73A 4Z1BA 3IRSA 1E6RA 3VIPA 3OJGA 2PMQA 3PSWA 4CN4A 3S6TA 2YFNA 3LZ3A 3V5OA 4A21A 1EO7A 3NVTA 3NZQA 4EKJA 3GH7A 1N55A 4UFJA 1FX6A 1TJ0A 3ENLA 4AZHA 5LHFA 1C29A 4J27A 3FHAA 5CQ1A 3V3WA 3PZNA 4JIQA 1FKXA 2X40A 3VD4A 3CPUA 2VX5A 3LMYA 3OLGA 3RLUA 1U2YA 1QPKA 2NV9A 2ZXAA 2HE8A 4GG9A 4GOAA 3SGUA 4PUUA 4HB7A 1H41A 4TV5A 5AHMA 4WY0A 3A9IA 4AW7A 1CGUA 5LYRA 2HMCA 2CW6A 2QDHA 4C65A 3W1AA 3L4VA 3IIOA 1XWYA 3OU8A 2E67A 1U30A 3KDOA 4MYAA 1KFBA 1QO2A 3N1AA 4KFNA 5IRPA 2Q8LA 3W26A 3VOJA 3MV11 2FVKA 5D9PA 3FVDA 3HO8A 1W1B1 2Z1KA 2OYKA 1TYGA 3I7RA 1HKVA 1LJYA 3R11A 1Q7QA 4NILA 4YCPA 3FEQA 4JTRA 1QHPA 1UG6A 2JEQA 3HG3A 3LM3A 3IGUA 4O0QA 4IIHA 1YTEA 2RGMA 2Y5SA 2WMHA 4DJFA 5EBUA 5CBIA 1K8CA 5AHLA 3C2VA 2BWGA 4WJXA 1EGVA 3C2FA 1WOBA 5EY5A 2JGQA 2WC3A 1FDJA 1XW8A 1RLCL 3LSCA 4JZ5A 1JZ2A 3ZJKA 2E77A 4JNYA 4QM1A 1UZ4A 2R9RA 3SI9A 1UKQA 2HS8A 1JF5A 3G0XA 3IJQA 2GVYA 3VGFA 1F3TA 1S1PA 5GQBA 3WH7A 1T41A 1UD6A 2BVTA 1K8XA 2Y7DA 1VIZA 3WLQA 3OG3A 3S42A 3W70A 3MYOA 4JTTA 2GUBA 2OGJA 3W37A 1KM5A 2EPNA 3GU1A 4OUIA 3CAVA 5K2ZA 3QZ6A 4Z2HA 1FH7A 3ZOAA 1EQPA 1XSIA 1KTCA 1X96A 1YNPA 2GL5A 4JOMA 3TP4A 3RXZA 5CJ5A 4IX0A 4GFIA 4QJ5B 3EWWA 4L9XA 5A6BD 4UR9A 3BUVA 2PWGA 3CB3A 1E9YB 3C52A 3RLGA 3BMXA 2V3FA 5C7HA 3ZSTA 4S3KA 1XD0A 1XIJA 3DFSA 3QV8A 3UCQA 4IWWA 2PLMA 1RCOB 2VRJA 3TYUA 3VDCA 3LQLA 3ANYA 4GYKA 5K9DA 3THDA 3P5YA 3KLLA 3MUAA 4W8BA 3WQ6A 4CN6A 2ZDRA 4REQA 1W9XA 4UUIA 4HSHA 4Q7BA 2VYOA 3GAYA 5EFFA 3Q45A 5B80A 2X1IA 4WF7A 1E5NA 2HPIA 2YCEA 5BRPA 2ANUA 3PJUA 1ZGDA 1RD6A 2V6AA 1X6NA 1PVNA 2E6YA 4N42A 5HMFA 2PWUA 4B16A 3BMVA 2BDQA 3RR4A 2NV2A 3ARUA 3QMTA 4XKYB 3ABZA 3HURA 3UW6A 2R1KA 4EOUA 1KLYA 4YMZA 2QJGA 3RDKA 3BLLA 3WQ8A 2D22A 1WKYA 2WPBA 2OO0A 4W86A 1AW2A 2PDWA 1TMQA 1HL8A 4WKAA 1U5JA 1OFPA 8A3HA 3G22A 3A47A 2FDMA 1VPYA 1KWKA 3NDOA 2FH6A 4QE5A 3BW3A 5GJMA 4F0LA 1OFBA 3HGRA 1JGMA 1BYAA 3NL5A 2XIMA 4A22A 4JTEA 1J2WA 4A2RA 4Q8NA 3D6NA 3W7DA 3I7QA 3HZ3A 3WK1A 4ZQNA 1K6AA 1W3HA 2NUYA 3QF0A 1DTUA 3GHRA 3NOEA 4MIMA 1VENA 3GY1A 2MUCA 5I2UA 2D20A 1ZY9A 1CLKA 4UOZA 1QI3A 4MJ4A 3G0UA 3IK2A 4HNCA 1L6GA 1YDVA 1PKLA 4QDPA 2QW5A 2VGFA 2WCAA 3WD4A 2CWNA 3P67A 2AKMA 2VGBA 2ZWYA 3LUTA 2AL2A 3RPTA 4AWTA 2WHLA 1OZMA 1JNEA 1V3HA 1R2SA 3APTA 2WNZA 4ZE4A 1DL3A 1O7AA 2CBVA 8CGTA 2D2OA 3QTGA 4HVXA 3G5EA 1S2WA 1V3LA 1LCOA 4S3AA 3I4EA 5T9CE 2PLCA 1NQKA 4QIUA 2QCHA 1XRVA 4F48A 4K38A 1ECEA 4ZQOA 3B8WA 4IFKB 5F2IA 2BTMA 2IQ0A 1B4KA 4EVZA 3TC6A 3MCOA 5A5WA 4KCUA 2O7SA 3MCNA 2PTZA 3VDGA 4DF2A 1OD0A 4LX4A 4S39A 4QP0A 5DX7A 3S5YA 3IIXA 1C9DA 4HZ6A 4PRWA 3A9BA 3OVRA 1BD0A 4R7WA 2NQLA 1EWDA 3GNRA 3KCOA 3KW3A 4L6HA 2ZX8A 2E09A 3FYYA 1C92A 3ZVHB 4OBTA 3NQAA 5A2AA 2ZXDA 3B9EA 3WJSA 4ATWA 1IE7C 1XH1A 3SCQA 3MMWA 3EWZA 4ZR8A 2WBKA 3DGRA 3ME3A 2QGHA 2DGAA 3NQ2A 2RKXA 3N2XA 1QCWA 3TNOA 3V36A 1ONEA 1G4PA 1UC4A 5I0DA 4AZ5A 3W7KA 3AS3A 5SWUA 4WDWA 1W9PA 3NZGA 3UZZA 3GO2A 2Z2UA 1F6YA 4UBPC 1SFSA 1G6CA 2EKGA 4HJFA 2GZXA 3KS6A 4US5A 1YMYA 1FP8A 3WX7A 1QPQA 5AVNA 4ILSA 3W88A 4HHPA 5D4YA 1OCJA 4K7VA 4X3ZA 4AMAA 4JFSA 1ZJIA 3TSBA 4GNKB 4LUSB 2W0UA 2HK0A 1J0HA 4JHMA 2W63A 2XSXA 1HJSA 3IVTA 3SURA 4AYSA 3B0PA 4WDTA 4TVDA 3A6OA 1CGTA 3CB8A 5FOOA 1M65A 2EO7A 3OVQA 1RAKA 3E1F1 4O1BA 4CNSA 1KR0A 2P88A 3WUFA 3SO7A 1AQ0A 4PZVA 2VO5A 3MI3A 5DELA 2WJFA 1QNQA 5M03A 1F74A 2ZXQA 1JPIA 2Y8KA 4LW7A 1TJ2A 1TZ9A 4AMCA 4W8AA 4IP7A 2ZWZA 2ATMA 2CZFA 1LLWA 1XRSA 4YHGA 1EKOA 1WZLA 1GEHA 2A6LA 4HOZA 2AQOA 4DM1A 3B0UX 3SW6A 3G8RA 1XLBA 1V6WA 3R43A 3L5MA 1PZ2A 4C1NA 1OYCA 4C6LA 4Q32A 4IMCA 4HPGA 4NAFA 1FWWA 4ES4A 4BEUA 1MDLA 1C91A 2PUZA 3W2KA 3VGHA 1A5MC 4Z1DA 1X8CA 1QW8A 1W5OA 2QCMA 3VIFA 1EUAA 3TSMA 4G8TA 1OT2A 3CLWA 1V03A 4Q8MA 6TAAA 1EF3A 3S1GA 4DUVA 2VZUA 2GGJA 3PANA 1ZRQA 2WSPA 1J0ZA 1XGDA 2QCLA 4LT9A 4AEFA 1W3NA 4RE3A 2H6RA 3SUWA 1DIKA 1A49A 1YDOA 3BLDA 2ZC1A 1O94A 4QFUA 3WF1A 5D38A 2J79A 5HWNA 1VLWA 1LORA 5IDIA 1DXEA 3PWGA 4DI8A 3L68A 3FKKA 4GQRA 3KWXA 2JIWA 3DERA 4MG4A 1NH6A 1J96A 2WJDA 4IG2A 2BFGA 3WEOA 4NASA 3GK0A 5CG0A 2I57A 4HQVA 1X39A 2Y0FA 5C2CA 4QNEA 2V30A 2YDQA 3BG9A 3PM6A 4LVDA 4K39A 4YVXA 3THAA 3DG7A 3OIXA 3WDPP 3UY7A 4KFPA 2PCQA 3K4WA 2Y7FA 3BXWA 2FB2A 2QEZA 1NDVA 1TJ1A 2OR2A 4WCJA 3DAQA 1GOIA 1ADDA 1GW9A 2XN2A 4GQBA 3TLQA 1J2BA 3UA3A 1H49A 1Q65A 2X0HA 2QULA 1WXJA 4O1AA 4HU0A 2ACSA 3T44A 5LIYX 4RNJA 4ZQPA 1S2AA 3ARZA 3I6RA 3VXGA 1VYPX 3MY9A 3UJFA 3PTMA 1S5TA 2XTKA 4FNSA 3O16A 4DZIA 5BW6A 2PCEA 4PTXA 1F4AA 3GZAA 3GS6A 3I6TA 1RV8A 1SZGA 2OSXA 4D1JA 5BMWA 1YW1A 3ARWA 4OECA 4G7EB 4W8LA 3AJ7A 2FH8A 3HBLA 2XYLA 5FJUA 1FWTA 2OKTA 4OE7A 2QUTA 5F2MA 4UNIA 3UVIA 3N04A 5H8UA 3SJ3A 1BG4A 5AYIA 2X7VA 3O07A 4HN8A 1XL9A 4OV4A 3KVJA 3BZJA 2IMRA 1FDZA 5FEPA 4L4LA 3RIKA 4I90A 3W6LA 2YBTA 3LERA 1RPKA 2CPUA 2C19A 1EL3A 3P2VA 5HATA 4FNUA 2O4MA 1K02A 1UROA 4JX6A 2V68A 4UXDA 2J7EA 3ABSA 2XIIA 3PUEA 4BQ5A 1NM9A 1WBHA 5AY7A 1O1HA 5LNRA 1PE1A 2J7CA 1B57A 1DQXA 2YA1A