4C6JA

Crystal structure of the dihydroorotase domain of human cad bound to substrate at ph 7.5
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
363
structure length
362
Chain Sequence
KLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure, Functional Characterization and Evolution of the Dihydroorotase Domain of Human Cad.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CAD PROTEIN
total genus 121
structure length 362
sequence length 363
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4c6jA00
3DUGA 2Z26A 4QROA 4H9UA 4GYFA 1UBPC 3PANA 3QY7A 3MTWA 1P1MA 1PTAA 2YXOA 2PGRA 1FWGC 2HBVA 4C6BA 1UIOA 2VR2A 1P6BA 1ADDA 1GKRA 4DIAA 2GWNA 4GY1A 4LH8A 4TQTA 1PSCA 4Z42C 1FWHC 1HZYA 2XIOA 5HMFA 1V77A 1FKXA 1YRRA 3WMLA 1S3TC 2BB0A 3LSBA 4H9YA 2ICSA 4V1YA 3MVTA 4XD3A 3GG7A 3OJGA 3LY0A 2WJFA 3K4WA 4IFKA 4WGXA 4H9VA 2W9MA 4UB9A 3TN6A 3GTXA 4C6PA 4DNMA 1V51A 4C6OA 3T1GA 3ISIX 4DO7A 3B0XA 3S4TA 3IACA 4WVXA 1EJTC 3GRIA 4JOMA 2DVTA 3HM7A 2Z00A 1XGEA 4C6LA 2O4QA 2ANUA 2VC7A 2Z2AA 4J35A 2FVMA 2WJDA 4XAGA 4F0RA 1R9XA 2AQOA 5FSDC 1K1DA 3UF9A 4DI9A 1PO9A 1O5RA 4QS6A 2D2HA 1XWYA 1UIPA 2PAJA 2QVNA 1ZZMA 3WYZA 3FEQA 2P50A 2PLMA 1O12A 3EGJA 2QPXA 2GOKA 3GTIA 2HPIA 3E74A 2FFIA 1E9ZB 2EG8A 2R1MA 1V4YA 4ICMA 1EJUC 3IJ6A 3ITCA 2OODA 3IRSA 4C6FA 4CNTA 3NURA 4LCQA 1M65A 1EJXC 5CH9A 3HPAA 3UR2A 4BJHA 1RJRA 5A6TC 2Z24A 1GKQA 3C86A 4OFCA 2AQVA 3T8LA 1POKA 2OOFA 3PNZA 4G7EA 2R1KA 4XAFA 4LALA 1RA5A 3E3HA 4L9XA 4C6MA 2Z25A 3O0FA 3LNPA 2BGNE 3O7UA 3NEHA 4R7WA 2D2GA 4IFOA 1A5OC 4C6KA 3JZEA 1XRTA 1M7JA 4R88A 3IGHX 4DLFA 1V7AA 4PBEA 5LXXA 4GY7A 2PGFA 3E0FA 3WZ0E 2Z4GA 4CEUC 1YNYA 1DPMA 3ID7A 1R9ZA 2UBPC 3IPWA 4C6NA 3AU6A 2VHLA 4CQBA 4DI8A 3T81A 3FDKA 2VM8A 4RDVA 1FWFC 1FWAC 2A3LA 4GX9A 4MUPA 4AC7C 3R0DA 4NG3A 4R85A 3E38A 3B0YA 4J5NA 2VC5A 1XRFA 4KF1A 4IQJA 2I5GA 1BF6A 1ONXA 2R1PA 3AUOA 2FTWA 1PB0A 1FWDC 3GU1A 1ITQA 3MDUA 2HBXA 2Z28A 3GIQA 1W1IE 1RJPA 4HA0A 3OU8A 1A5LC 4EPKA 3UBPC 4PE8A 3TNBA 1KRMA 4NI8A 4KETA 3GTFA 1RAKA 3F2CA 4C6DA 1NDVA 3BE7A 3E2VA 1A4MA 5FSEC 1R9YA 2Q09A 4RE0A 4G2DA 3V7PA 3TN3A 4C65A 4C60A 4H00A 2KAUC 2OB3A 4LCSA 4I6KA 1VFLA 4EPEC 1RJQA 3MKVA 4LFYA 1M68A 3GTHA 4WHBA 4KQNA 2DVUA 4H9XA 3A3XA 3OOQA 1A4LA 1EF2A 3MSRA 1KRBC 3EWCA 1GKPA 2R1LA 3MDWA 4DZHA 1I0BA 3LA4A 4D8LA 4F0LA 2HQAA 2OQLA 4LEFA 4GK8A 5AKQA 4ZSTA 3GU9A 3QY8A 2YB1A 3GU2A 4RZBA 4C6IA 4H9ZA 3RCMA 4ZSUA 3LS9A 4UBPC 1EZ2A 2GSEA 4L6DA 1NDWA 1NDYA 3F2DA 1YBQB 4HK6A 4DZIA 4IH3A 2VUNA 4CEXC 4HK7A 1A5MC 4H01A 3S2NA 3SO7A 2GWGA 3URQA 2AMXA 2IMRA 3F2BA 3LGDA 2E1WA 4C5ZA 3S2JA 3CJPA 4AQLA 4QRNA 3TN5A 4KEVA 4ERAA 1QW7A 1KCXA 4LANA 2O4MA 3GUWA 1EJWC 1ITUA 3URAA 1JGMA 3URBA 1RA0A 2DVXA 3A4JA 4CQDA 1ONWA 3QGAC 4GZ7A 3LGGA 4RDYA 4LAOA 3NQBA 2PUZA 4QSFA 1FWBC 3B40A 4ERGA 1P6CA 4NP7A 4C6EA 2HNHA 1J6OA 4EPDC 2UZ9A 4GY0A 1EJRC 4GC3A 3CAKA 5HMDA 3RHGA 2Z2BA 2F6KA 2QS8A 1I0DA 4KEZA 4KIRA 3UR5A 4PCPA 3ORWA 3LSCA 1EJSC 1FWCC 1NDZA 4C6QA 1E9YB 1YBQA 2HPMA 1YIXA 4C5YA 1UMLA 4IGMA 4B92A 2I9UA 4GOAA 3RYSA 3QGKC 1YMYA 4IGNA 1KRAC 3K2GA 1NFGA 4IF2A 4IFKB 4XAZA 3LU2A 4RDZA 4P5UA 1A5NC 2RAGA 3AU2A 3PAOA 4DYKA 3FDGA 4KERA 5E5CA 3S2LA 4XD6A 3HTWA 4V1XA 3N2CA 1FWIC 1J79A 2Z29A 2Q01A 4RDWA 1WXYA 4LCRA 4CNSA 2OGJA 1V79A 3GIPA 1FKWA 5G4HC 1FWEC 2YZ5A 2R1NA 1POJA 4CNUA 3RN6A 4LAMA 2ADAA 4QTGA 1RK5A 4INFA 3OQEA 3DC8A 1IE7C 4YIWA 4CQCA 3MJMA 3TN4A 2YB4A 1EJVC 4LAKA 4GXWA 4EP8C 3MVIA 1FWJC 2E25A 5HMEA 1WXZA 2P53A 3MPGA 3SFWA 4H9MA 2QT3A 3IARA 4ERIA 3CS2A 1RK6A 4C6JA 4G7EB 3ICJA 4E3TA 2FTYA 4HJWA 4QS5A 4M51A 3OVGA 3A3WA 4BKNA 4PBFA 3QY6A 1A5KC 4KEUA 4HK5A 4KESA 4I6VA 4B91A 2WJEA 3KM8A 4B90A 4BY3A 2CZVA 2Y1HA 3DCPA 2G3FA 3IV8A 2Z27A 3PNUA 3E0LA 3URNA 4C6CA 2GZXA 3F4CA 4PCNA 1J6PA 4F0SA 4XD4A 2WM1A 3OODA 4IFRA 4IG2A 2FVKA 1KRCC 4B3ZA 4GBDA 2EG7A 4XAYA 4DLMA 4J2MA 2D2JA 4EPBC 2ZC1A 2EG6A 3D6NA 1EYWA 3UPMA 1J5SA 2Z7GA 1K6WA 4GX8A 3F4DA 3G77A 4IG2B 1QXLA 4H9TA 3EWDA 3PBMA 3S2MA 3K5XA 1K70A 4XD5A
chains in the Genus database with same CATH superfamily
1GEHA 3VKAA 5CPMA 2W63A 2QCMA 5LSMA 1R7OA 2RUSA 5AHFA 1AJ2A 2PGRA 3QKZA 3WBXA 6A3HA 3W70A 4DIAA 3TTQA 2CBJA 3W38A 4IWWA 2PDFA 2QR6A 5A8MA 3LBOA 3UVAA 1C8YA 2DZPA 2AAMA 3CQHA 3D5HA 4US5D 3RLUA 1YDYA 3O15A 3LTSA 2Q71A 2OEMA 2WPBA 4GGBA 3DHPA 2PS2A 4C6LA 3MB9A 1O1HA 1L6YA 4QX4A 4J1OA 1HJQA 4RCXA 4AYSA 4BI7A 5LIYX 3TA9A 3T9PA 3LLDA 5HWNA 1O68A 1KQYA 2VDIA 2PSNA 1HL8A 4N6FA 3LXCA 3DESA 2GGGA 2WWDA 4JTLA 4IP7A 2WWCA 1UB3A 5L6UA 3GO2A 1RPXA 4OJYA 1KTNA 1RCQA 4RJEA 3WLMA 2ZYFA 2VDGA 3BJFA 3VKDA 4ICMA 1EDTA 1EIXA 3S1WA 2QCHA 2NUYA 1V0MA 3NQDA 1UZHA 2VO5A 2E6YA 4XZLX 2CLEA 3ZWSA 2GUBA 4L65A 5A6TC 1GKQA 3C86A 2YOCA 1POKA 3QZ6A 4DBDA 1RA5A 4L9XA 1E6PA 1DJHA 3ZR6A 3O7UA 4L6OA 1EEPA 2EAWA 5E93A 4R88A 1W31A 3W0KA 4LOCA 3SRKA 3T4CA 3OVPA 1EHNA 3W4RA 3FA5A 3DOPA 3N1AA 1J4EA 4UNLA 4J3UA 4CQBA 1UZDA 2OT1A 3EWXA 2GJXB 3QYQA 5IRPA 1OGGA 1UKOA 4XZIA 2ZUVA 5LZLA 3O63A 4B5SA 3UQNA 4EWND 1NP0A 1WDRA 3SQSA 1LBFA 4GGHA 3RU6A 3IIZA 1YE4A 3WELA 2FTWA 1PB0A 3MMUA 2QCGA 1ITQA 2GDQA 4XUGA 3WQ4A 4NYUA 1A3XA 1EOKA 1R3WA 1DQUA 3R11A 4RR4A 2BTMA 3STEA 3W73A 1EKOA 1AQFA 1E4IA 2UY2A 1ODUA 1BWKA 3GW0A 4W87A 4D6FA 3CV1A 2CIPA 2R24A 1IXOA 4HHPA 3A6OA 3MU7A 4WJ8A 3GDKA 4RE0A 1M7OA 1R3YA 3ZO9A 1FHLA 4K36A 4GLEA 1TPC1 3TK7A 3QW3A 2KAUC 5FESA 2DZBA 4AIUA 4BHYA 3KRBA 3FOKA 1ENUA 1Q6FA 1MEIA 4LFYA 3REQB 3VZXA 4EXBA 3DAQA 3UWZA 1A4LA 4ZBCA 5AVHA 2WLYA 2IUZA 1WAWA 3EWCA 3DFTA 4MFDA 4UTLA 4MGGA 3SQLA 5DCEA 1J93A 1H5VA 3W37A 4QG8A 2J7GA 3ES8A 3QC3A 4K68A 3AHXA 3L0NA 3QZEA 1C3FA 4FIRA 1BYCA 4L1XA 2ZXAA 4IT1A 3VDBA 4EF9A 2NV1A 3RLVA 3PP7A 1JZ3A 3UG5A 2X1RA 3KZSA 2VYOA 3GFXA 2X2GA 3WMSA 4KS0A 4ADSA 2DIEA 3QTGA 2XN2A 3OA3A 1OWQA 1ISWA 1VRDA 3RG6A 1EZWA 4UIOA 2Q6ZA 1KXQA 3BL3A 1BRLB 2YLLA 4JFSA 1RA0A 2CLOA 4ZOCA 1WX0A 5A6BA 3NQ8A 4RZ6A 3ATYA 4HZ8A 1AH0A 3CAVA 1OT2A 4WXZA 2PI6A 3OLIA 1F3XA 3NFUA 3UR7A 2QF8A 3CUHA 3W6MA 4R27A 3RHGA 3UWVA 1G9HA 1VHCA 3CK5A 3IVUA 4YWIA 1LWIA 2CW6A 2PC4A 1WDPA 2CNCA 3O9NA 2WC7A 4TV5A 2NV9A 1ME8A 2KX9A 5A94A 4K6AA 1LP6A 3ZOAA 3FSUA 3ZVIA 4XAPA 3O6YX 5JBDA 2Q01A 3B8IA 3QW4B 3RU8X 4CNSA 2OGJA 5C2CA 1KTBA 4FP1A 3W23A 3C0LA 1OADA 1POJA 1T8XA 1XSJA 3ITTA 4ZB0A 3UXIA 4INFA 5AZ1A 3FLUA 1IE7C 1KGUA 3WJSA 1QU4A 2ACUA 2YB4A 2PODA 1SO6A 1EJVC 4XX6A 3W1NA 2XGIA 1P0EA 3TCEA 2X0YA 2F7FA 1FWNA 1WDQA 3VNJA 4E3TA 4Q4PA 1NH6A 4NYYA 3WDPP 5CC6A 4JQ2A 4Q7BA 3UR8A 1GTHA 2V5CA 2X41A 1R85A 2C1IA 1EH9A 1LRTA 1PX8A 5AHLA 3UCDA 1VP5A 3Q67A 3ANUA 3GR4A 4QEHA 2HE5A 1IWBA 2CWXA 4PMDA 3M7WA 2Y63A 3PNUA 2IW0A 1BAGA 1J6PA 4XD4A 4Y9PA 2GGJA 4RXGA 1KRCC 4KH2A 2VI0A 2TPSA 3NJ3A 5ABEA 2EG7A 4NZ4A 4DLMA 4LVBA 1E3XA 3U7VA 4FXRA 4EPBC 3RPTA 1CYGA 1DXFA 1EDQA 4WZHA 1ZBKA 4BQ2A 3AYRA 2J27A 1V6VA 2J7DA 1JPKA 3SBFA 4YXGA 2AAAA 2XDFA 2CZ5A 3N4AA 1U5VA 3FYYA 4IZGA 1SO4A 1TWSA 3CM4A 4K7VA 1GOMA 5LA0A 1K02A 1ALDA 1GKRA 2EKCA 1NM9A 2X8RA 4UTUA 4TQTA 4KMQA 1QCWA 4L6HA 1XLBA 2WZIA 1T7LA 3RGTA 4C1LA 4GI9A 4GE8A 1RP9A 3PTKA 3DZ1A 2Y7FA 3QR0A 2W9MA 3AIVA 2OO0A 3TN6A 4AHQA 4DNMA 3GDTA 3O6DA 4C6OA 4F2TA 2J74A 1OM0A 2GDUA 2AKZA 2JGYA 3ONCA 3ARQA 1EJTC 1XW8A 4OIFA 5EKYA 4O17A 2VC7A 1KM4A 2WJDA 4UQAA 1GVRA 5CBJA 2J66A 4GO9A 4NZ1A 4AX6A 1IR1A 2QULA 4ZO6A 1HP5A 4MZYA 3VX1A 1D7KA 1DJXA 1IEXA 2GJRA 3VIPA 2PAJA 3KX6A 3B03A 3DBPA 1C91A 1KD0A 5DANA 3N19B 4GQRA 1W1YA 1D3GA 4W88A 3VCRA 2EG8A 1P0DA 3F4WA 4IXHA 1Q63A 2SFPA 4XVEA 1QATA 1LQ2A 1EJXC 1U22A 3HPAA 2HS6A 3PNZA 2Q8ZA 4DB7A 4P2VA 2PWHA 4H4IA 3F7JA 3VIGA 2QDDA 1GQNA 3LDVA 4QDWA 3CZKA 3G2GA 4M56A 4AFYA 3GIYA 3H24A 3H23A 4JN8A 1V7YA 2DT0A 2ACSA 4GKLA 3M7SA 5I07A 2BFGA 3N12A 4OU1A 1J18A 3M0JA 5I5RA 3PUEA 2G3JA 4HKPA 4U2ZA 1ECQA 2YCIX 4HB7A 3GR7A 1LORA 1V0NA 3W75A 2C71A 5C9UA 3AIQA 1JDFA 1RD5A 3WDJA 4IMGA 1KGWA 1FWDC 1W1IE 1FWTA 2V5LA 3H70A 4Q32A 1JAKA 3MUAA 3WD0A 3HG2A 2C19A 1RAKA 3UETA 3C2EA 4NX0A 3BE7A 3VX0A 1GOKA 4LTSA 3VD9A 3KBWA 3CNYA 4HCLA 2NLYA 3SN0A 4DJEC 3VK5A 1ZJAA 5EMMA 4JFTA 4KWSA 4I6KA 1TZ9A 1YW1A 2ZRWA 4EXQA 4DQWA 2NQJA 3STPA 4C7FA 4ACYA 3UA4A 2O7SA 4EPEC 2VL4A 4C91A 1KFEA 4JNZA 3WF4A 4DN1A 1JR1A 8A3HA 3GE7A 2HXUA 3C0SA 5DMNA 1H11A 3O6AA 4DXXA 1GKPA 1CGTA 3GB6A 3M4HA 4D8LA 1EC7A 4HP5A 3EPOA 4E2DA 5C7VA 4PTWA 5BU9A 4E8GA 4S3GA 4M5PA 4H8HA 3W83A 1PVNA 1ICQA 4FNPA 1US2A 3QQ1A 3HZ3A 2J77A 1QO2A 4HN4A 4HU4A 1MQRA 3V16A 2V8ZA 3R89A 4MZ1A 2I5IA 4AF0B 3U2OA 4UTHA 5LGXA 1KO0A 3N14A 1IR2A 3SCVA 1EBHA 4GRSA 1TR1A 3W01A 5DN1A 4PUDA 2Y8KA 3A24A 1EJWC 1Z7AA 3AALA 4PB5A 4Q8PA 3V36A 4IJBA 5G1MA 1VIWA 2XHYA 3SSZA 3CEUA 1YPFA 1XC4A 2V68A 4LJ3A 1UKSA 2Z6JA 3MMWA 2ASHA 3TQKA 1QBBA 5LIXX 4MVAA 1WA3A 2UZ9A 4I5XA 4E5TA 3LMZA 1HG3A 1FFRA 2JBMA 4DHGA 1U1UA 3DI1A 3N3MA 4DAFA 3W88A 1UD6A 4DWSA 1NDZA 2YL9A 3BLKA 1UWIA 3CHFA 4AIOA 1UH4A 3EX1A 4M6VA 3U5YA 3CUZA 2JQXA 3DG6A 2G4FA 1VFSA 4BQ5A 3H53A 4H8VA 3G3DA 1X96A 5CLWA 1W32A 2OZ0A 2JEPA 4P5UA 3USBA 1G67A 1XBYA 4ZQOA 3NGFA 1SUXA 4GI6A 4TU1A 4DYEA 1EYEA 4RPPA 1DIKA 3DENA 2DT1A 3ZJKA 2WJZA 4QTGA 3RRXA 2E8ZA 5LNSA 4CD4A 5BRBA 3HGRA 3PZNA 1XXXA 3IIOA 1QK0A 2A3EA 4Z1AA 4D6JA 2WSQA 1VFTA 1GHRA 3ARXA 1JUBA 2WVVA 3NPVA 4GVHA 3R94A 4AXNA 3A3WA 1Q2RA 1KFKA 5J8LA 1SJDA 4IQEA 3MY9A 3VA8A 3VNIA 1UOZA 3RX2A 2GOUA 3G1XA 3L4XA 2ODOA 3N9KA 3QF0A 5H1WA 2V2DA 2OLHA 3I3BA 3LBCA 4S3FA 4N9EA 4DAIA 3GYEA 3OODA 2NWRA 3RX4A 3BXWA 4C1KA 3J7HA 2I1OA 1GVQA 3PVFA 3R7MA 1D3HA 2D2JA 1ISXA 3WD3A 1VYPX 3ITXA 4JKLA 4AHPA 3CT2A 1GYLA 3BO9A 2RDXA 4H2HA 4H7ZA 2PURA 3GG8A 3EDEA 3M0MA 1YYAA 1MQPA 1ZAHA 3TYDA 3ZLGA 3UY7A 1OZQA 1PTDA 3M0IA 4XV0A 3PPCA 1ONEA 3WLSA 4BQ4A 5HAOA 1P1MA 3W7JA 4W4QA 1GVYA 3P0XA 1CLXA 2D1ZA 4HYWA 4FB7A 1Z32X 5C70A 1NFPA 1E73M 3GY1A 1DBTA 5LA2A 3NG3A 3S5YA 2FLIA 4JIIX 3ARVA 1ZQ5A 1YRRA 2OKOA 4J7RA 3MVTA 2QF7A 5REQB 3EOSA 2O9TA 1V08A 2CLKA 4WIWA 4ONVA 1M01A 5HXMA 3HGOA 5D2WA 4AISA 2TMDA 1O5QA 3ERPA 2PGWA 3VGGA 1ZHAA 1E56A 3LCHA 1VPXA 4M3PA 4WY0B 5LHEA 3M0ZA 4JTUA 3FFSA 4Y96A 4U10A 5G2HA 3MJYA 5HWMA 1F76A 2AOSA 3TJIA 3KDNA 5XIMA 4XIAA 2R82A 3NSXA 3FA3A 2ONEA 5C9XA 4QR6A 3ARSA 2EXOA 4KWWA 1CLKA 4NRSA 1HF6A 1CXIA 1XIBA 1WZLA 1M6JA 4GH1A 1E9ZB 1DE6A 1C7TA 3BCDA 4XZNX 2WCSA 1B3YA 1KGXA 3B9OA 1S5NA 1Q6GA 4B2DA 5D9OA 3JR2A 3QVQA 2VFHA 2AQVA 4F8XA 2X1UA 3MYPA 1OFEA 3T2OA 4O4VA 1A5OC 2AQWA 8XIAA 2J47A 3VFCA 2PGFA 3VDCA 4UTFA 2Z4GA 3PUDA 3DI0A 3BMWA 5C2GA 2ZUSA 4Y9OA 1K9TA 1P5BA 1XLDA 2E40A 3KW3A 1LWJA 2CETA 1V6TA 3GH7A 3W7GA 3S9ZA 1BTMA 3ANYA 3IIXA 1FH7A 2J62A 4NJGA 4FOJA 3WD4A 2VELA 4FR6A 3QN3A 1VRXA 5JXQA 1C8XA 5EMUA 3UZZA 4FXJA 5C6MA 2IPWA 5F1UA 4D9PA 2YFOA 2B4GA 4BI6A 2OEKA 1CTNA 1NDVA 2A0NA 2WZEA 4LY4A 3TN3A 3OZOA 3DIPA 4C60A 4LUYA 3BW4A 1IZKA 1KM1A 2IQTA 2BVDA 3SCUA 1XYCA 1PDYA 2P76A 3H2MA 4D6GA 1XC6A 2DVUA 3MP4A 4GACA 2EF9A 2WQDA 4ZR8A 3I4KA 4FLOA 3CLMA 3UZ5A 5ABHA 3U48A 2P8CA 1RH9A 2DV0A 4P7OA 3UGRA 2GSEA 1AQMA 1FP8A 4NRRA 1DWGM 1JCXA 3W00A 5FL1A 1KM3A 1REQB 1TMQA 4CQ9A 4HK7A 2J25A 2EJ1A 4IPNB 4QNWA 1DIDA 1VHNA 2J24A 3AMCA 2PFHA 1ZBVA 4QQ3A 1DQWA 3T0DA 1ZB5A 1KBJA 2Q3RA 2DQWA 3GUWA 5MHBA 4TMCA 4NSBA 2FZ9A 1GQLA 1SGJA 4HNUA 4ZQRA 2WQPA 1UWSA 2ZVIA 3A4JA 3UVIA 4HZ7A 1QNOA 1XH1A 4N6EA 1H7PA 3WLHA 2PUZA 5CZ0A 1QPQA 4MZ8A 5E9AA 2OQYA 1JDDA 5E6YA 4HPXA 1I0DA 1Y5WA 1FXPA 1GG0A 1A5AA 1YIXA 3SCRA 1IT7A 3ZZ1A 4O1DA 3QGKC 4ADTA 4YMZA 1NFGA 3NQEA 1XBXA 3RIKA 5EMJA 1FHVA 1HQTA 3M46A 1CXEA 4Q33A 5T9BG 2QUNA 1WNOA 2W5FA 1JJKA 3G18A 4DUWA 2VD8A 1TWWA 4YU1A 1L0PA 2BV9A 5CXPA 4FMVA 1LDCA 2VEFA 5A6JA 3FCPA 1LG1A 3CXOA 3W86A 1NWUA 2F9RA 3BWWA 1E0XA 2FH8A 3NM3A 3VCCA 1DWIM 3IK2A 2E77A 4I3GA 5LXEA 2XIQA 3T4WA 4EAYA 5EY5A 3S1GA 1W91A 3WJZA 4U31A 2E25A 1WXZA 3OBAA 4ICCX 4F2UA 3IARA 4ERIA 4FOKA 2XM2A 4Q6XA 4DJDD 2O0TA 1OFAA 1QI2A 2E4TA 1JRBA 3PB0A 4AWEA 1A53A 5CZKA 4YTQA 3MMTA 4HCHA 1F07A 3KM8A 4O28A 1YTDA 2PRMA 3FY1A 1JULA 3UESA 3GC2A 5EA9A 3W1LA 5I3DA 3C3UA 1QOXA 1WKEA 2BY2A 3EZ4A 4L56A 2CBUA 2A6NA 3I3EA 1XINA 3VD4A 4O0ZA 2C0HA 3G0SA 3WIJA 1W6TA 1KFJA 4KRUA 1KLYA 3W7OA 3NYZA 5CJNA 3W53A 1J0IA 1M04A 1M1BA 3LTPA 4WSKA 1OEPA 1EA0A 5FEZA 3BAYA 4XD5A 4BZYA 4PUWA 1KCKA 4DF2A 1HFBA 3B0UX 1VFUA 4GYFA 3BLFA 3G3MA 5HQMA 1ZAIA 3L66A 4GIRA 2GQ9A 1PTAA 5GVJA 3TYCA 1PZ0A 2YFNA 3VYLA 3MUY1 5HPCA 4QJ5B 4PSRA 1AMYA 1JZ5A 1PIFA 2O9PA 5HMFA 2WKJA 4CKQA 2ICSA 2BB0A 3LSBA 3RLGA 4KFNA 3TYZA 4R53A 3FEMA 3OJGA 2WMIB 1XKYA 2QIIA 1ZFJA 1P1XA 2DZUA 2Y5SA 3ISIX 4AWSA 1XKJA 1ZP4A 3HFTA 1R47A 2W6RA 2OO6A 3P2VA 3NVTA 3VIMA 3WK3A 4RZ5A 3FK4A 1LF1A 3M0YA 1MDRA 3KLKA 1QTWA 2QLYA 5I3HA 3ARPA 3NWRA 4JGDA 4JFUA 1LT8A 3XINA 4I7WA 5DLCA 3OIHA 3EEZA 4O19A 4FZIA 2GOKA 5M17A 1SR9A 8XIMA 3GTIA 2FVLA 3MQTA 5AC5A 2VUYA 3WF0A 4JCMA 3PSVA 3THQA 2VOTA 1XIFA 3W1UA 1GQIA 1XF0A 1E5JA 1O4UA 3P67A 3WX7A 6TIMA 3CZGA 2EPMX 3PS7A 3WQVA 3B9DA 5BZAA 3TAOA 3AMDA 2GPTA 3GK0A 3GZAA 3PJXA 7A3HA 1P7TA 2HK0A 3OYZA 1TVPA 2G5WA 1TE6A 1GOXA 4XBKA 4K39A 3KFTA 4BS0A 1B5TA 3O07A 3W7QA 3WMBA 2Y70A 2TAAA 3PR2A 4XTIA 3IGUA 1LL6A 4ZB5A 2FZMA 2HVNA 2B7QA 1HKVA 4X2RA 3QSTA 3BOLA 3LLFA 1OC7A 1W9DM 3BZJA 4FO4A 1KKRA 4FX7A 3VNDA 4UMAA 2ISDA 2W67A 5LNUA 1TG7A 2A2IA 2AL2A 3K30A 3NA8A 5MKGB 4Z2GA 1JPDX 4LAZA 4LYQA 4ZMGA 1PYFA 2JGQA 4H04A 1J12A 1RALA 3EYPA 9XIMA 3H21A 1KCZA 2QJJA 4QQUA 4O16A 3PTMA 1AH3A 4JTFA 3GVVA 4UCFA 1HO1A 2XVPA 4UFJA 1EP2A 2I9EA 1K9FA 4LB4A 4MB4A 3SI9A 5FSEC 3W1AA 2PEVA 2YCEA 1KFWA 3RK8A 3HGSA 5CSYA 1J0HA 3S83A 5BNKA 4DXVA 3MP3A 7REQB 4MF4A 3UZWA 4NZFA 3GTHA 3DYMA 4QLLA 3WLTA 1EF2A 4S2CA 3PJWA 1QVBA 1YEYA 4RUBA 3N2BA 3LA4A 3WK2A 2G3NA 4FNRA 2ZC8A 4GK8A 5D2XA 3TIMA 5HATA 4G1KA 2YA2A 1OG6A 1H1YA 3P60A 1MW0A 2DT2A 1V03A 1AJZA 1NDYA 3F2DA 1GYMA 4S3CA 1ISVA 2E6FA 3HJZA 4YTTA 3M6YA 3LOTA 2IMRA 1VPQA 3KRSA 2J9YA 3CJPA 2WC3A 5FD0A 5FJTA 3ITYA 5CGTA 1AVAA 1Y5VA 3VGFA 3PWAA 2WSRA 3I6EA 1Z69A 1H5YA 4NIRA 3LGGA 1VBRA 4EXAA 1NQ6A 4DJFD 3RM9A 4XBJA 1WZKA 1WKFA 1FWBC 3E5BA 2VRJA 1ZPTA 1DJYA 4C6EA 4B3LA 2W92A 4UMCA 4QM1A 2R9RA 2QAPA 2VFGA 4FNQA 4LBUA 1TMHA 1I2NA 1E0WA 4W93A 1EJSC 2W79A 3BLPX 4C6QA 3IAPA 1WXJA 1S1PA 1SJAA 2OELA 4MKSA 3RYSA 1XDLA 2FKPA 2B31A 2GL5A 4HYVA 2QUMA 1UR1A 4IPJA 3PG8A 1HKMA 4XO7A 4DXKA 1BQCA 4HTYA 3GXMA 5FJIA 3ANVA 2R6OA 3PBYA 2QDEA 3SY1A 2XSAA 4Z2KA 3T0AA 4ORIA 4AH7A 1FKWA 4QE5A 3AC0A 3CH9A 1YE6A 3PULA 3DG7A 1DJNA 4A6GA 4KCVA 5DBTA 2TYSA 1XPYA 3CL6A 1Q65A 3AO0A 3EMCA 4IIHA 5BOOA 1GQKA 2V67A 3NSMA 4D2JA 3UWEA 2R94A 3H12A 5GPRA 3VE9A 2HXTA 1V6YA 2AMGA 3NL3A 3WUEA 4QS5A 4CU7A 2WNQA 3HF3A 4IMDA 1E72M 3EXRA 2WMFA 5U4NA 3FGCB 3NVDA 4E2OA 3APGA 2PF0A 4KESA 4QG9A 2IPFA 5BRQA 1IGSA 1EXPA 3DCPA 3L2MA 1VAHA 5IBXA 1R46A 2CBIA 1LQ0A 5AYBA 2YSWA 3WLKX 3H4WA 4FS9A 3LV6A 3JVAA 3IEBA 3B0PA 1OYCA 1F8IA 3DH7A 4GVFA 3PSWA 3O8AA 1WYIA 1EYWA 3UPMA 3W2UA 4JFWA 3CZ8A 2Z1KA 3BW3A 1C29A 1S2UA 2I5QA 2YXGA 3K5XA 3VKCA 3WDQA 2DT3A 1RCXB 4M1BA 2OFJA 4NZ3A 2EKGA 4YTRA 4US6A 1X1NA 1XIDA 3B8WA 5I2UA 4DF0A 3RO6A 3PANA 3DYPA 3GVGA 4CNOA 2FDMA 2R8WA 2WKLA 1TX2A 4QAWA 4HNTA 4UC5A 5EYWA 1AJ0A 1ITCA 5TAOA 3WL0A 3VZZA 1ISZA 3M0VA 3WMLA 4E6MA 1VH7A 1CI1A 4PEEA 5DCDA 2XN1A 2NQZA 4A2RA 4IFKA 4WGXA 2JKAA 1MYRA 2HEJA 2J6VA 3M43A 2Y89A 4BEQA 1BTCA 2PD5A 4DO7A 3IIPA 4AZBA 2BDQA 3QH2A 1CZ1A 4DRSA 4MB1A 3ATZA 3T07A 2PTZA 3V1PA 4S39A 4XB3A 1RY8A 2WSKA 3WUGA 4GPNA 2FDSA 4WLCA 1TV3A 4WY0A 4N02A 1BWLA 3G5EA 1C90A 3UF9A 3ABXA 3P3BA 1O5RA 1R86A 3DKLA 3H4GA 4IIEA 3R2GA 1ZZMA 4NAEA 4DUVA 1B54A 2F6XA 1P43A 2DUAA 3E02A 1XLCA 3IJLA 3G0XA 3T7VA 2FFIA 3OZYA 3OA5A 4ZQPA 4Q8WA 4QE1A 2EBNA 3AS2A 3MT1A 1M7XA 2QCDA 1E51A 1Z89A 3NURA 4OGZA 3BAKA 5K4XA 4BJHA 3AXIA 4OBRA 3WLOA 5AYZA 1S2TA 2Z24A 5FF7A 3L65A 1MXSA 2R91A 2NXHA 4WRHA 3P8IA 4DPPA 1TREA 4F48A 3DFYA 1XSIA 3CAWA 3NDYA 3AICA 3R4IA 3WFZA 1RVGA 4IL0A 4H6EA 3LNMA 1TB3A 3DXIA 3IPWA 4TVCA 1EWDA 3TTYA 2CZEA 3TW6A 1W1ZA 1FWAC 2A3LA 4FA3A 4R7JA 1BLIA 3TR9A 2OQHA 2Y8VA 2WCAA 3R0UA 4FALA 1CB7B 4O8RA 2VR5A 5A8NA 2BOGX 5HJLA 3S0CA 4KWUA 1W1B1 1VB9A 1LWHA 5A6LA 1UR3M 1R3TA 3EA1A 2BHUA 1E1FA 1L6WA 4N2YA 4XKYB 1DWAM 3PBVA 4K38A 5GQBA 1B31A 2VFFA 3GNRA 1RLCL 2FGZA 2IKIA 4FAMA 3VI2A 4PZVA 4NAEB 2VENA 3NM1A 1H4PA 2GQ8A 4N4QA 1EXBA 4Q7NA 3C2FA 7ODCA 4CN4A 2F6UA 4AZ6A 1XYMA 4PUKA 5FCZA 3ZR4A 1UJPA 4XO6A 3DECA 4J4KA 5D30A 3C56A 4RE2A 4MWAE 2FGLA 3WK1A 1RJQA 5D9MA 1FCVA 3MKVA 4W9TA 3P14A 2YIHA 3V1HA 1XLMA 3NO5A 4R9XA 2R1LA 1FH8A 3HOJA 2Y7EA 3GXFA 3QHOA 4RW5A 2J78A 4IPPA 4F2BA 1MVYA 3QFEA 2UY4A 2YZRA 1UROA 3VGBA 3FYPA 1KFBA 5C5YA 1W3KA 3QV9A 4DZIA 4NZCA 1ML1A 4HNVA 3EKZA 2WZMA 2WANA 5AC7A 4WX2A 4FSAA 3B4UA 4QRNA 3AMGA 1OFOA 1QPOA 3NSNA 2J9XA 1QW8A 3W6LA 4AMCA 1XHGA 1MFUA 3ZVHB 5IHRA 2D0GA 3TXZA 3WSUA 4LBRA 3TXVA 2ZADA 2NW0A 2O9OA 1GK8A 3CUGA 3U2CA 4JTKA 4PCTA 5CZTA 5E0KA 1R6WA 4O11A 1E6NA 3K8KA 1WUEA 1HXJA 1HNYA 4P8VA 3EXSA 5ECVA 1XCXA 3I3DA 1XIHA 2VR4A 2QS8A 1K03A 1B3WA 3UR5A 4DO5A 1BEUA 4J3ZA 2GYIA 3W76A 1C9DA 4D1JA 3N2TA 3QEZA 4JTCA 4NKCA 1OFBA 3S1VA 4GCXA 2I9UA 5A8QA 1W9UA 2NVDA 4FNTA 1PHQA 2HVOA 1B4EA 2QEZA 2YYUA 3NPWA 4S3BA 5DRIA 4ZTYA 2INZA 4HYRA 3AU2A 4DYKA 4IGSA 1H63A 3ELFA 1UP0A 3EAUA 3KOZA 1ZUAX 2WKGA 4LCRA 4ZFMA 3RR4A 2PWEA 2RJHA 3A13A 3PB2A 4YTUA 3UXLA 3NQ6A 3TW9A 1RP8A 4RV8A 2H3DA 3DC8A 3TN4A 3SJNA 4LUSA 5DT7A 2ZZ4A 2ALRA 1QHOA 1QI3A 1DIEA 1ZJIA 5HMEA 4N0RA 3COTA 4KW2A 3BDKA 2Q8LA 1EWEA 2V2HA 5KZMA 3ENLA 3U7BA 5FJOA 1ONRA 4DEFA 5I3FA 3LBMA 4H6RA 4PMUA 2VMFA 3S5ZA 5BRPA 2VZSA 1JI2A 2G96A 2WMJA 2P5NA 4LUTA 4G6CA 4WF7A 4U2YA 3CHEA 3OG2A 2GZXA 3KVLA 1PWLA 3G6MA 4V15A 2WM1A 4NUWA 1GTEA 3TE9A 1E5NA 1KQZA 1NFBA 3LGEA 4GBDA 4U28A 4H19A 1OX5A 4J2MA 3WLLA 5E9XA 4LVGA 3TMQA 2J8TA 3P0WA 1F73A 3ZIZA 4L80A 4XZMX 3RXZA 3R79A 3A12A 3TSBA 3FSTA 1WO2A 3OHMB 1W17A 3RMJA 1OBAA 3SUWA 1DV7A 3EX6A 4H9UA 4PBGA 2F2KA 4DYJA 3GW3A 1YNQA 4QDPA 2ZZ5A 5I77A 3G1VA 3W22A 3PZOA 1V3HA 1KM2A 3ZWTA 4MJZA 2X40A 2PDMA 2FZ8A 3VABA 3BH4A 1V77A 3M5ZA 2ZUNA 5H2ZA 5CAKA 3BICA 2ZXBA 3STGA 2J7HA 3TJXA 1TIMA 3BAWA 1UR8A 1SW3A 4J3VA 2BS9A 1KBLA 2PP1A 4RE3A 4UTTA 1BD0A 2YL5A 4IIFA 2XYLA 4NILA 3PJTA 1MRQA 4ZOAA 2D0HA 2Z00A 2OSXA 5AOUA 1ME7A 1MQQA 2Z2AA 1OK4A 3AHYA 1BVNP 2FVMA 3LHVA 1E15A 3HPSA 1OIMA 3VM5A 1PO9A 5BYWA 4EX4A 4N9BA 1GW1A 1XWYA 2X0HA 3EDJA 3STFA 3UFYA 1LLWA 2DDXA 2GVYA 1UZ4A 1YPIA 2OT0A 2PLMA 1GORA 4ZOBA 2WLZA 1FHUA 3WO8A 4L5ZA 1W9PA 4R34A 3G1SA 1VPYA 2I14A 1V4YA 3KBMA 5DFAA 3H7RA 1K7FA 3P93A 1RHCA 2BHZA 3I6TA 1PAMA 3WQDA 5FL0A 2PC8A 5F2MA 3UR2A 3GM8A 4JDBA 1H1ZA 4ZB2A 2OOFA 2VNCA 6REQB 4G7EA 3N6JA 4Q8VA 4RW3A 3W7RA 3DX5A 5ABGA 4JTGA 4DLFA 4H7CA 4WR3A 3UZJA 2WAGA 2G37A 3AHZA 4UFIA 2PCQA 1CXKA 4PUMA 4C6NA 2BMBA 5CGMA 4PMNA 4IMAA 1Q6QA 1JZ8A 3BMVA 1J5TA 3EA3A 2PTDA 4IX2A 3CB8A 4Z0SA 4UZSA 4J3TA 3WH5A 4XISA 1FVPA 1XLKA 4Y8EA 4UFLA 5TBOA 4GYJA 1VFMA 1TTQA 5BROA 4AZ5A 3UYIA 4GQ0A 1O95A 4LVDA 3MDUA 2V5JA 2IXUA 1ICSA 4JICA 5M5DA 2DORA 3MBFA 1OCJA 3HMCA 4MIMA 4PE8A 1GHSA 5A6BD 4JIQA 4AIBA 1PKNA 4WK9A 1PZ1A 2FJKA 3TOPA 2V3GA 3RM4A 1R9YA 2GK1A 3HV8A 3HQOA 2PGEA 3D46A 3V7PA 1JZ6A 1E1CA 4LUTB 2Y7GA 4H00A 4LF2A 2Y88A 5T91A 2DEPA 4FX8A 4DO6A 2BX7A 2VZTA 4AZCB 3EB4A 1B9ZA 3ZXWA 3KP1A 1ZU8A 3E2QA 3BOXA 7PTDA 4A3UA 3P8JA 4KGLA 3MDWA 3T09A 2PTWA 3WNOA 2VVNA 3CIVA 2PLKA 1KR0A 1KM6A 3NXLA 4YL2A 3MW7A 2BVWA 4OKDA 1EQPA 3LB0A 2FQIA 2G3MA 4ZSUA 3T0TA 4TIMA 1NDWA 3VGEA 1XG4A 4XZBA 4CD6A 5E6ZA 3PBUA 4B15A 1D9EA 5HNTA 4Q4OA 4O14A 2D3NA 1LLOA 2CU0A 2OTDA 4K3ZA 5HBFA 2QJHA 3SGGA 4M0XA 1ZAJA 1RSCA 4F79A 3FVMA 1G7VA 1DWFM 4HOWA 1NWSA 4CQDA 4UTIA 3RNDA 2BP1A 1B3ZA 1L6FA 3KDOA 1V6XA 3LI1A 1A5BA 3NQBA 3C2VA 1KXTA 1OX4A 3EPNA 4ENLA 4OT7A 4NP7A 3L5LA 3M47A 1PKLA 3A9IA 3H7VA 1ZJHA 2OYKA 2PDPA 4PCPA 4AG0A 2JF6A 3W7HA 1YBQA 3P74A 5ENLA 3W7PA 3NPXA 3R25A 3AHTA 4AUBA 4XKMA 4HD5A 1CX9A 3MP5A 1H50A 1K9EA 3KZPA 2Z29A 1J0KA 2PPGA 1X6LA 3TTEA 2O92A 2OOGA 5I78A 2PLJA 4U5IA 2VGFA 2NXGA 5G2IA 1EF3A 2V3EA 1YTEA 4Q4MA 3V5CA 4Z2HA 3M41A 5C8BB 2H90A 3CYVA 1G6CA 3T2QA 2CLLA 4C6JA 1VKFA 1QNRA 1EGVA 2E5DA 2VRKA 2MNRA 5MF5A 3KWXA 4Z2JA 1OFQA 4JZ5A 5G4EA 3QY6A 2WHKA 4B91A 3LYEA 3GX9A 3S1UA 4NJJA 3A22A 1W5PA 4MWAD 3ZT5A 3UP8A 1RPKA 3URNA 1XV8A 4CQAA 4DELA 2INFA 3N25A 1JIBA 4MAVA 5TD4A 1RQEA 2YCLB 3EBVA 3PM6A 1EL3A 3LHWA 4GX8A 3TONA 3UY8A 3FJLA 1KWKA 4GNKB 4OTKA 4QJ4B 3S2MA 3UNTA 1BPLB 4XIMA 1W1TA 4Z08A 1VJZA 1R3SA 4DJDA 3DUGA 4GZEA 4QROA 3TC7A 3VM7A 4UOQA 4MAZA 3W82A 3AZRA 1D7FA 1SU5A 2DIKA 2NX9A 3IJ7A 3K8LA 1X97A 3QQ0A 3BPWA 3KEHA 4NI3A 3BSGA 5AYYA 4I9TA 1W9VA 4HJFA 4HN8A 4WDUA 4V1YA 1H7NA 3C2YA 1K9DA 5DQPA 5FAJA 1VENA 3K4WA 4DM1A 3AQUA 5IBXC 1HGWA 1V51A 5D8WA 5DY2A 1ISYA 5HNUA 1M53A 3P80A 1V6UA 3EOUA 2CKSA 2QW5A 3C6CA 2WMHA 2ANUA 3V0UA 1Z6KA 4XAGA 3V5OA 4GD0A 1XICA 4HNLA 3W7LA 2V30A 2CXEA 5LNRA 4JIPA 4PH6A 4QS6A 4BQ3A 1CGVA 2ZRVA 3UA3A 3GVQA 3W2NA 4X3ZA 3S47A 7TAAA 3FEQA 2WHMA 1UWUA 2QPXA 3BGAA 2ZRYA 3E74A 3HB9A 2ZQ0A 4N9DA 1FY6A 5GJNA 1MNZA 1UYQA 3STCA 2OODA 3C8FA 4P7RA 1GUVA 3GXDA 1EX5A 3QQWA 2LLEA 3WBEA 2E9MA 4GIEA 1G7UA 4B4FA 1J96A 4XAFA 4I9AA 3PPHA 4AVNA 3SEPA 3WQFA 1IXPA 1TJ0A 5TIMA 3CQKA 4L4LA 1GCYA 2G97A 3GHTA 1XRTA 3AIBA 4O54A 3FV9A 2PTXA 5D32A 4HA3A 3MUIA 3EXTA 1MO0A 3EWWA 1TZZA 2F2HA 3GD6A 3WH7A 3CPUA 1I2OA 4RDVA 3TC3A 3QPYA 1R2SA 1P48A 3NZ1A 4IUGA 1UWQA 4C1NA 3WF3A 3P61A 1PCWA 1R2RA 2V2CA 3KHDA 2PZ0A 1H0IA 2OR2A 1EHAA 1DWJM 1R7AA 5D03A 1BXNA 5I06A 1JCTA 2Y61A 4W8AA 1FP9A 7REQA 3WLRA 3EWZA 3ARTA 1QWGA 3FHAA 5GNYA 2XN0A 4IMEA 1F8MA 3SIZA 2QGHA 1D8WA 5F2IA 2QJIA 2QQ6A 1VYSX 2UV8G 1HN1A 3L67A 2Y7DA 3E5PA 4A3HA 4ZFCA 1DTUA 2QVHA 2Z2UA 3BZGA 4FLSA 1XD0A 1E0TA 3EB2A 2EPHA 4C65A 2XIJA 3HGJA 1OSEA 1VBUA 3ME3A 3OVRA 3LHTA 1RV8A 1YXCA 3GDLA 3DFPA 2REQA 4OOZA 2RDTA 4QGCA 3AS1A 2VURA 1B3VA 1CGXA 3RUBL 1R3RA 1XRSA 1TQJA 3G1YA 3I10A 4ZQMA 2E0PA 4JN6A 2X30A 1OD8A 3E9AA 4WGHA 1DWHM 4FLRA 3CWOX 3UT0A 1NY1A 2QNEA 3CTLA 3RCMA 3OB8A 3SIMA 1G0CA 3KBSA 3VDHA 1H49A 2CHOA 2BWGA 2WMKA 1LOQA 1PKMA 3F2BA 3WN6A 3TQVA 4AZGA 1NELA 1GG1A 3TA6A 6XIAA 4KEVA 4MLRA 4LX4A 5EMKA 1I2QA 1TZ7A 4BF5A 2O4MA 1VQTA 1ZCCA 2C7FA 4HHMA 4DM2A 1B1YA 1XRVA 3SRFA 3KWSA 4O8AA 2IPGA 2D22A 4WDWA 2OZ8A 4LAOA 5F4XA 4WJEA 3Q37A 1SYTA 1EGMA 3S1XA 3H55A 4JX4A 1EC8A 3CAKA 4Q8QA 3U57A 3LPFA 1Q45A 4PTMA 3LM3A 5C9RA 2E28A 4GXMA 3NQAA 3PZMA 4P8UA 4BR1A 4HT3A 1ADOA 1M9HA 3PZIA 3WLPA 3SY8A 5HOSA 3W1PA 4IJCA 4AD3A 1BYAA 1V3MA 3ES7A 2QJMA 2Z1VA 5A1AA 3TAKA 3FDGA 5E5CA 1XD1A 1L6SA 3CV7A 4GJJA 1FDYA 3TJLA 3Q94A 4PRTA 3BLLA 3BTNA 4M81A 2YZ5A 3ARYA 5IFPA 4JTJA 2OGYA 4MY9A 4DNHA 5H6HA 3NDOA 2HZGA 3FAWA 2VZUA 5G2WA 5I23A 4M29A 2Y85A 4GXWA 3NGJA 1CXHA 4HGXA 1XBVA 1Q5MA 1W5QA 4ALDA 1TIWA 1H0GA 4TMBA 2DH3A 4LUSB 3PZUA 1YHTA 1HKJA 4JTQA 4QLKA 1XUUA 2G41A 3QV8A 1LROA 4I9MA 4IIBA 3U0HA 4BI5A 1O1ZA 1UD3A 4KEUA 1S5TA 1E4LA 1X7IA 1JCMP 1F6KA 4DVOA 1NWTA 4OV9A 2G3FA 4NNAA 3SCPA 3RCYA 1LLZA 1K4GA 2CPUA 2WHLA 2WNWA 3CPRA 2FVKA 4RNHA 5IXEA 4CD7A 1FDJA 3QR3A 2PDUA 5DMMA 4H6KA 5FOOA 5FJPA 3GDRA 1VF8A 4AIEA 3B8VA 3V0TA 1Z41A 1QHZA 4H8UA 1QHPA 3I6RA 3TH6A 3LK6A 3U8GA 3HQNA 1US0A 1EDGA 1ZGDA 3MBDA 3W02A 2Z26A 2BY1A 5FIPA 2DUZA 4WUIA 2ZZ2A 1XIEA 3A5FA 4UTWC 4JTHA 1FWGC 2HBVA 3IIVA 4WSJA 3EDDA 3VTRA 1UIOA 3QFWA 1R87A 1A80A 4QAIA 1Q66A 1YX1A 5D33A 4UZUA 2GWNA 2F84A 3LCWA 5D8ZA 2Q02A 3KL3A 4NNCA 1JCJA 2ZX6A 2PDLA 3MI3A 4C6PA 2ZUTA 5D05A 3T1GA 4LB3A 1I4NA 3B0XA 4LVAA 5HQLA 5CPQA 4GUIA 3M9YA 3L2IA 2FHBA 3IJ9A 4X0VA 3RX3A 3Q45A 2ZICA 3B8DA 1SZGA 4UOJA 1R9XA 3R5EA 5FSDC 1P0BA 1PZ2A 2B81A 3M1ZA 3EWBX 4LYRA 2VZVA 2D2HA 2PDNA 1UIPA 2AKMA 4RE4A 3EDFA 4MNJA 2P50A 4DJDC 2XSBA 3T05A 5DXXA 4IHCA 3CMJA 1TPH1 1V5XA 1FWSA 3A4WA 3MI2A 2R1MA 1JFHA 3GXNA 4YCOA 1LM1A 2QCLA 4YPJA 5F2LA 1IWPA 1A5CA 4D6EA 1KKOA 3OQ8A 4LCQA 4Q8OA 2IQ0A 1BGAA 4GUGA 1M5WA 4CCDA 1VCFA 1J2WA 2XG9A 4UR8A 1QUMA 4C6MA 1UD2A 2E7FA 4S3AA 5REQA 4FPSA 3T55A 3JZEA 3I7QA 1RD6A 4AW7A 1RR2A 1UUMA 1ECEA 5IDZA 4IMFA 3MHUA 5DO8A 1W1A1 3AHVA 3QRHA 1QDSA 1B57A 3FDKA 1JF6A 4KRZA 1MMFA 3ITGA 3GAYA 2DGAA 1KNWA 4PFHA 3H7UA 4JN7A 4NHVA 4AC7C 4OE7A 4J5NA 1W3JA 1VIZA 1CIUA 3TUUA 4IQJA 3ARWA 5CC7A 4M7SA 4PGLA 4RNJA 2R1PA 1W56A 3V18A 2OZTA 4BWLA 1TPDA 4LYKA 2Z28A 4IP5A 3GIQA 4OQVA 3N2XA 3LPGA 1RJPA 2ON3A 5I6SA 2DJXA 3OU8A 3U5UA 4RX0A 3V5FA 3KOFA 2AL2B 2RFGA 1OINA 3AYTA 4OHQA 5GNXA 3I7RA 3P82A 1N7KA 1W3IA 2CLMA 4LUJA 1S2VA 4FR1A 1A4MA 1F6PA 1GJPA 3UU0A 3GNXA 2ZWYA 4E3VA 1LL4A 3W7IA 1TJRA 3FW6A 2GK1B 3E6EA 3DYOA 4LCSA 3L12A 3LV5A 4GYPA 1MZRA 2QUTA 3WLJA 3N29A 3E0VA 5I09A 3NZPA 2V3DA 5CEWA 5BMWA 2OEJA 1F6YA 5FJRA 3S42A 3SCTA 3SZ8A 4UCGA 4J9JA 1DYSA 3BCFA 2DH2A 3USZA 1XPGA 4JTSA 4L4MA 4ZSTA 4MDPA 2Z1SA 4V33A 3VE7A 1XBZA 3L2LA 4GYKA 1EUNA 3H2EA 3THCA 3QYSA 1EFZA 4HK6A 1V02A 3GNOA 4UQCA 2REQB 3DERA 3LGDA 3IJQA 4HHHA 3HPFA 5I7GA 9RUBA 3IVTA 4D6DA 1HJWA 4M82A 2VQTA 4QISA 3K13A 3OZPA 4PR4A 1KLZA 2HISA 1B9BA 2FMOA 4MLJA 1O94A 3D3FA 1XLJA 1XIMA 2RDWA 1MUWA 4PN2A 4NZJA 4BA0A 4DWSB 4ZENA 1XLEA 2WXDM 2OWCA 1UR2A 3VIHA 4E8CA 2A4AA 1TV7A 1EJRC 3Q58A 5HMDA 3PZGA 1OX4B 1O7AA 2WPGA 4KIRA 3LX9A 5FJUA 2I7GA 5F4SA 2YDSA 1IYXA 1UMLA 5FI8A 3UG4A 3K4DA 2XM1A 1J10A 1XYLA 3U4AA 2XZ9A 4PUNA 2WB5A 3L21A 2XH4A 4A3QA 2HK1A 2HV5A 4N4PA 3LU2A 3F5LA 5KMYA 5H8MA 2BNJA 4B5VA 4WDTA 2PDKA 1Y8BA 1E55A 4RDWA 4OOUA 1JQVA 1HW6A 2QYGA 5HQEA 3AWNA 2DW6A 1UG6A 3TZNA 3H6OA 3UCQA 4J2PA 3N9SA 4GZJA 3N17A 3MJMA 3SCQA 2ISSA 1SO3A 4WXYA 1T5AA 1UC4A 3CWHA 2HE8A 1XCWA 3ARZA 4BFAA 3SFWA 1BYBA 1IIGA 1LTDA 1VBGA 1PYMA 1MNSA 4PUJA 3P5YA 4REQB 4AVFA 3AXMA 3ICJA 4UTJA 2FTYA 3M64A 3CV2A 1V0KA 4P7QA 4K8HA 1A5KC 2JIEA 3P62A 4MHBA 3B9AA 2Y2WA 2A5HA 1S46A 3BG3A 3SRHA 4IIDA 4KWVA 4QIUA 3DG3A 3WNKA 5IOBA 3N4FA 3KBVA 1IQ8A 3H2FA 1WPCA 1I1WA 3SURA 3L5AA 4X60A 1UHVA 4PCNA 1QPRA 4GUFA 2NX3A 4QXIA 3LUTA 4EE9A 3RFAA 4ZTXA 2PDYA 3JW7A 5AC8A 3UZYA 2NT0A 1MWOA 5DELA 2PDIA 3CC1A 3MHGA 4X61A 2GJLA 3W1TA 2X09A 3NTYA 3AYVA 1Q6OA 4S3DA 3UD6A 2X2YA 3TZFA 1K6WA 5JBFA 1RQHA 1VC4A 3TX9A 3UWYA 1IEIA 2FZNA 1X8CA 2VEIA 2Y5EA 3EOOA 1P0NA 3DGRA 3W72A 3WF2A 3PG9A 3MO7A 1JQXA 3W74A 4OBTA 1P6BA 2NWSA 3QLDA 3RRAA 5A6AA 3PTQA 3VIJA 3CL8A 4GY1A 1JEZA 1XLIA 4WKFA 2XIOA 3CEPA 3ZSSA 1G69A 1TJPA 3P5ZA 4LAUA 3LM7A 1H7XA 1IEWA 1DKWA 4PMQA 3LY0A 4AMAA 3AROA 2XGZA 1PJ9A 3GTXA 1CT5A 5CGQA 3VUPA 1K8CA 1Q2SA 1B30A 3FS2A 1S5WA 2VCCA 4JOMA 4NXSA 4NVTA 1B3OA 1XGEA 2RH9A 5MKGA 2WO5A 3EEGA 2J4GA 4M7TA 1MSSA 1U5JA 1KW1A 3KOWA 5F2GA 2IKHA 3WD2A 3ZSTA 1ZENA 1JG9A 3MZNA 3ABRA 2W91A 1W9XA 4PRRA 1KFCA 3DHFA 2QVNA 1AODA 3BJTA 3WYZA 3N9RA 1S2CA 2GVGA 3R8RA 1FCBA 5BOEA 1JYWA 4I8DA 4M80A 4O1AA 2HPIA 4E2VA 2XFWA 2WBGA 3NOYA 4HCDA 3RPMA 5K9DA 3S3GA 5KETA 1ZY9A 3W9ZA 1W0MA 1O66A 3ZM8A 5CH9A 1K8YA 3UWQA 3A5VA 1HJSA 3W7NA 2H9AB 5A95A 2OKTA 1OF8A 2OU4A 1WP6A 1R38A 4JBRA 4LALA 4MMWA 3BV7A 1S38A 3O0FA 3WKZA 4H3DA 1AZ1A 2Y4SA 4R7WA 1LRQA 4O52A 1M7JA 3GFYA 2D24A 3CQJA 2YKKA 3AMKA 5GNZA 2J88A 1UWTA 3AZTA 1GNXA 3L4VA 2UBPC 2BSLA 2FFCA 2VQUA 3IRDA 2E5BA 2YR1A 2X7VA 3UGVA 3KOYA 2D20A 2YDAA 1NSJA 2FHCA 3APYA 1XH0A 4LNYA 4CU6A 1OCBA 2FZBA 3AJXA 2AGTA 3KL5A 1V3IA 3DKJA 3SB0A 2I5GA 1F2JA 1BF6A 2WM0A 4RK8A 1S5MA 1H09A 2E5CA 1CXLA 1C92A 2PDWA 4OUIA 4Y8FA 2DIJA 4GYPC 1H7RA 1PS9A 1CPUA 3WL1A 4YLWA 1CENA 4ZGYA 3KRUA 3F2CA 4C6DA 1CNVA 4YVXA 1TA3B 2PRHA 2E3ZA 4G2DA 3GNDA 1XJBA 4GI4A 4PL2A 2WSPA 3SUTA 1RUSA 2ZUWA 4EAMA 1US3A 4JFVA 3S5OA 3BANA 5CSSA 2DPEA 2X05A 2GFTA 3CBWA 1PIGA 2IXVA 2WNNA 3VDAA 1XYBA 4NU7A 3LQLA 3N04A 3TKFA 4LBSA 4GINA 2QAFA 2FZDA 3M0HA 2ZX7A 1HJVA 3QY8A 4Y9MA 4J3SA 2BOFX 4RZBA 4C6IA 2XFYA 2Y6ZA 2NVAA 3KBNA 2BHYA 4UTWA 2HROA 5C9WA 1G4PA 4O53A 1C9WA 1GOOA 3UXKA 2QUUA 2Y62A 1A5MC 3S2NA 2GWGA 3A47A 1DXEA 4JTEA 2E1WA 5BMXA 4QHRA 3MC5A 4UFKA 3BQ6A 5CJ5A 2E8YA 4JAWA 2BBFA 4MB3A 1PX3A 5E70A 3HG4A 2V5KA 1B3XA 2CESA 1I60A 4HQVA 4NJHA 3TSDA 1ONWA 4GZ7A 4AC1X 1QR7A 3OTRA 4AVOA 2H8ZA 4LF1A 3HPZA 2VCAA 1FUYA 2BVYA 1NIUA 4DJEA 3G6LA 2ZCGA 3I65A 4CVUA 3AI0A 5EB8A 3O0KA 3POCA 1IF2A 2QCFA 4GC3A 2J7BA 3AYSA 4DJFC 2HPMA 1WOAA 1AH4A 3WQEA 5D02A 2X1SA 1N8WA 3AFBA 3F1QA 2CLIA 4DZ5A 4GOAA 3F4NA 5E0FA 4IF2A 4J27A 4O1BA 1DHPA 1GWJA 4EF8A 4YYCA 4Q22A 4GXPA 2RAGA 4MNLA 5A6MA 3PAOA 5K4ZA 3HTWA 4V1XA 3WQGA 1EJ7L 1GJUA 2X1TA 1WXYA 3W6YA 3MANA 2WMGA 1IEVA 3WH6A 3DFOA 1OABA 5SWUA 4LAMA 2PRLA 2PD9A 3HMJG 3AIRA 1V6WA 1U2YA 1W2VA 4ZO9A 3G1RA 3LHUA 4Q3MA 3W1QA 1AD4A 4WDXA 3GXTA 2WZTA 1LT7A 4D6IA 1ZL1A 3MPGA 5D09A 5LIWX 1UJQA 3HO8A 2NQ5A 3CS2A 1RK6A 4FOUA 4WKHA 1WAUA 3RCNA 2C1GA 1UP3A 3V35A 4G7FA 3M0XA 3P84A 1BWVA 4PBFA 4O10A 5AFDA 3SQMA 3LMYA 2P0IA 3ABQA 4YCPA 3W1MA 1V3JA 3S8HA 3MSDA 1E43A 2P3ZA 1VGAA 3L4ZA 3TW7A 4C6CA 1U5HA 1JPMA 3F4CA 4Q4SA 4IFRA 4F0HA 4HIBA 4B3ZA 1OCNA 3MSYA 2PDGA 1OF6A 2VJXA 2Z1WA 1J8VA 4O50A 2OPJA 1K70A 1OG0A 3ZLFA 4NASA 4TOQA 1BXBA 4H2CA 4WOZA 3EX2A 6PTDA 3PZQA 4QSHA 1A0DA 3T08A 1F3TA 3V0SA 4NJKA 4NY2A 5CZSA 5ECUA 4MADA 4RKAA 1X39A 1IGWA 3VUSA 2PU0A 1DE5A 4IQLA 1PSCA 3CPGA 1HZYA 4AAJA 1S3TC 2FMNA 5I00A 2XZ7A 1X6UA 1AK5A 4H9VA 3KAOA 3H2CA 1UR0A 1W3LA 4I90A 3CU2A 1BSIA 4EANA 3TEVA 4NXKA 3W7KA 3WF1A 2XVNA 1XR2A 2I16A 2XH2A 1L8PA 4WVXA 4REQA 2BZNA 2BLEA 2C91A 4Z0JA 4TXEA 1GJWA 4J35A 3B0VC 1OGSA 5AC6A 4FNSA 1JYVA 4NX5A 4F0RA 2DP3A 2P3EA 3THUA 1K1DA 3C52A 3W87A 1NAL1 8CGTA 3W85A 1EEXA 3ALFA 4KIEA 3MMDA 5CC3A 2PA6A 2INEA 1BG4A 1TTIA 3QV7A 4Q8NA 1EC9A 3FVDA 1B0IA 2DU2A 1XLGA 3H54A 1GVEA 3TQ0A 4C6FA 4B5XA 4AX7A 3WBWA 1RJRA 3VGHA 3W81A 3VD5A 2A1YA 1E3ZA 4QDMA 4IM4A 4GA8A 4M19A 1QW9A 1JDEA 1KTCA 1CW2A 1SZFA 1YPXA 2E68A 3FKKA 3HFYA 2V5BA 5FA5A 3NEHA 4Q4KA 4FF5A 1VS1A 3QMRA 3IGHX 4PBEA 5LXXA 1E0UA 3WZ0E 4GKTA 2CITA 1GGOA 5G1YA 1JI1A 1V3LA 4ZE5A 2OWXA 2FTPA 4E8DA 2E6DA 2YBUA 3VC5A 1UMYA 5LYRA 2B0MA 5DF0A 4PC8A 4Q6JA 3NEVA 3E38A 3OW1A 2HVMA 2PWFA 1E6ZA 1OQFA 3W84A 3A4AA 2XISA 4EKJA 3UXAA 2D0FA 2ATMA 1WKDA 4M6PA 3AUOA 2QV5A 5FF3A 3BVJA 4DZAA 1XFCA 4JQAA 2NQHA 4H7VA 5I3KA 5A6SA 5D04C 2IQDA 4NI8A 5JH2A 1T96A 3NL5A 4CNPA 2XJ7A 4N7QA 2HRWA 3R12A 5BXPA 2VTFA 4XSLA 3KL0A 3E2VA 3EB3A 4L9YA 1G94A 3MO4A 4D6CA 4Q7IA 3CHCA 1SVDA 6XIMA 2HMCA 2V3FA 3B05A 1K8XA 4G8TA 2XGBA 1Z44A 5CPLA 3UNDA 3WBAA 2CLFA 5IHSA 3C61A 4H9XA 2BOEX 1V02E 1C8QA 2VGGA 3K4AA 4F0LA 4LEFA 5DY3A 1CWYA 4IUOA 4S38A 1LOSA 4QFUA 4H1ZA 2H9AA 4L6DA 1HVQA 2JFEX 4L4PA 4DBUA 2ZXQA 4FEZA 1YBQB 5T26A 3CHVA 2JEQA 2V81A 3URQA 4D71A 2GSJA 2X1IA 1MI3A 3WQ8A 3ITVA 1AQ0A 1QW7A 3GYCA 1GPWA 1M7PA 4FXSA 3NQCA 3O16A 3CGTA 3VIOA 1FDZA 4JR5A 4MOZA 1JGMA 4I7VA 4GJ1A 3IS4A 1CEOA 3QGAC 4Y7EA 2C0AA 3C4UA 3N13A 2QGYA 3NL2A 3VDGA 3M5VA 3MYOA 2A79A 3SSJA 1X38A 4JKMA 4ZA0A 1NJJA 3O2LA 3WQOA 1KR1A 1JD7A 3CHDA 4U4MA 3ARRA 5J04A 3NCOA 3WEZA 1A49A 2EQDA 3W1XA 6TAAA 4F0MA 1E9YB 1ZBWA 3LCFA 1D2KA 4A8LA 1UQZA 3LTYA 3W7CA 1XX1A 2RKXA 3TYBA 4AZ7A 1RXOB 4RDZA 1AZ2A 1WE5A 4C1NB 1T0OA 3DDMA 4Z2LA 4HNNA 5KZ6A 3T2PA 3WLQA 2DSZA 4MFEA 4JHZA 3WDIA 1KV5A 3OGSA 3KBJA 1FWEC 2ZFAA 3HG5A 3RN6A 2KZHA 4CD8A 4L64A 4UNKA 1R0MA 2HNEA 1UR9A 4MSSA 2XFRA 1XH2A 4FNUA 4DUXA 5FEWA 6ALDA 3G24A 1FWJC 4WOQA 2ISFA 4X2PA 5KTLA 4D72A 3WUFA 1R8LA 1XIGA 1UKQA 3WH9A 2POTA 1QFEA 2PDQA 1DP0A 1PHWA 1YDNA 3QPEA 1WOBA 4PMZA 3VOJA 3SGZA 3CMFA 1FRBA 1ZJBA 4EACA 2ZRXA 1BKSA 3TMLA 1JAEA 4ZO8A 3SDOA 3VKKA 3KUMA 4UMBA 2BODX 2C3ZA 4S3JA 1JF5A 2G4JA 1KM5A 2Y8UA 1TJ1A 1IXNA 4XZ9A 2ZZ3A 3EMZA 1TSIA 3OZMA 3LCLA 4AD1A 3GAKA 3QMTA 4ZEPA 2Q8XA 1EB3A 4HU0A 3RR1A 2X16A 1BFNA 4LEQA 1VCVA 3N2OA 4JQ1A 3M0KA 5H8UA 3VPLA 1GW9A 3KVMA 3CO4A 3WUBA 3VIFA 3KXQA 4IQDA 4GUHA 4PMYA 2TODA 3NDZA 2YL8A 2CLPA 2EGZA 1JRCA 1OFRA 1UBPC 2D69A 2QCCA 3B04A 3XISA 4DBSA 1DQXA 4CU8A 3VNYA 2EPLX 2YXOA 3N2MA 5C55A 3FGCA 1JNDA 1TPUA 1H41A 3CASA 5DCBA 3G22A 2BXZA 4Z42C 4ML4A 2VFEA 1RCOB 4B9ZA 5BWFA 5KZDA 4I5UA 1GQJA 3WMCA 2XVKA 3CO8A 4JYDA 4B5WA 5XIAA 1VLWA 4LWWA 1I45A 3FHQA 4W84A 1SQ7A 3FX4A 1M3UA 1RY0A 4BK9A 4XZHA 3S4TA 1XCFA 4I7UA 1DTNA 4JEQA 1Q13A 5EL1A 4ZXLA 1N8IA 4JY9A 2W66A 3BQ5A 4O0KA 5D2TA 2ZUMA 3SUVA 3NQ2A 2P10A 4MYXA 1ZS2A 2WYSA 3TVAA 3EGJA 3K46A 4MDOA 1AL7A 3F5JA 1XGZA 4UXDA 4A4AA 1EO5A 2GGEA 3K1GA 3RM8A 4RL3A 3TDFA 2QCNA 3RJXA 4IIGA 3N73A 1TPWA 1DIOA 3I68A 1KFLA 3WG6A 1VEPA 3CAQA 1SPQA 2HCVA 2PBGA 3TNOA 4CQ8A 5B7YA 4MJMA 2E9BA 1J01A 4Z1YA 1BYDA 3S6DA 2V0TA 3W2JA 2DZAA 3WLNA 3MI6A 4ZE4A 3WFAA 3TJ4A 1K77A 3AU6A 3T81A 4RV3A 1AD1A 5ABFB 1ZCOA 3JS3A 5XINA 3UERA 1XYFA 4GX9A 1AFSA 1PCKA 5M1TA 1SZRA 3JZUA 1JZ4A 2CLHA 3ZJ7A 1XRFA 2WVVB 3FJNA 5A69A 1E1CB 4MNKA 2OMAA 4HTBA 1WDSA 8TIMA 3CQ0A 2HBXA 3WFLA 4P61A 4ATWA 1XL9A 1CGWA 3GWQA 5KZEA 1HO4A 3MV01 4U3CA 4LV4A 3GTFA 2ACQA 1PTGA 5FEPA 5JVLA 4F40A 3E96A 2ZX5A 3FJ4A 1Q7QA 3GNPA 2G95A 2YDQA 1UH2A 3PPFA 2J7EA 4PRWA 3IK4A 4A22A 3YPIA 1ICPA 1QBAA 3G8RA 5A2CA 2ZVRA 4PTNA 3C2OA 4GVGA 3UZXA 2YLAA 4BEUA 2J79A 2G8ZA 2YB1A 3IWPA 1O5XA 4O13A 4GH3A 3E0IA 3I7SA 5LNVA 2QPUA 2OSWA 1EUAA 3PJUA 3BLDA 4IH3A 3HQ1A 4I9JA 3L4UA 3CL7A 4H01A 2FPYA 4JIRA 1WZAA 1JXJA 3AZSA 2ESCA 3A3HA 4ERAA 4CN6A 2EO7A 3W71A 1PX4A 1TPFA 2OCZA 4TX9A 4PULA 1DXIA 2VFDA 1MW3A 3M5YA 9XIAA 4G56A 3URAA 2P88A 2NUXA 1I9CB 3HIJA 2MUCA 3BLEA 5A2AA 3HQPA 2G0WA 1UWAA 1YLVA 2OZ3A 4S3EA 1JCYA 5D4YA 5E0CA 3G1AA 3D3AA 5HWJA 1W9BM 2DFAA 4POCA 3W24A 4ERGA 1P6CA 4CLMA 2BY0A 1A50A 2TRSA 1P6WA 5GJPA 5CBBA 1WKYA 3B9NA 4GNJA 3WEOA 3VMNA 1Q8AA 3BAIA 4LPCA 2NSXA 3P7YA 4F4RA 2F61A 2ZZ7A 3ZT6A 5C0QA 4MPQA 4HMDA 1LYXA 3SJ3A 2V63A 4ZQCA 1XLLA 1XDMA 1K7XA 3RPDA 3B06A 2ABAA 3UWWA 3R1ZA 1E70M 3LCGA 4UQEA 3NQFA 1W5MA 1QOQA 5EMYA 1NTHA 2BGQA 1WB0A 4Q8MA 1I8JA 2ZOXA 4CNUA 2ADAA 5HJXA 1TRDA 3E2RA 1A3WA 1GT8A 1X7FA 2Z6IA 3LRLA 3QM3A 1IHIA 2VX7A 2GGIA 3VOHA 2EJAA 4TV6A 4MG4A 4GIAA 3BSMA 3SM0A 1XQLA 3GFZA 3QHMA 4B4HA 3C0QA 2P53A 5JQ9A 4JKKA 2MANA 1ZSXA 1W8SA 5CG0A 1J11A 5CPTA 3CYJA 4M24A 3R0KA 1F9CA 3QR1A 4HK5A 1NF7A 4IXXA 2J8FA 1QMLA 4B90A 2CZVA 3ZQ9A 1MEWA 1ZBCA 4UNIA 1N82A 2RDUA 3BC9A 1O5KA 3E0LA 4J28A 4EVZA 2A85A 3NZQA 1F61A 5J5RA 3GKFA 1Q8JA 4E0CA 4XAYA 1KCLA 1QWKA 1XSKA 5B7ZA 4PMJA 1LBLA 3NXFA 4X22A 4LNCA 1HKKA 4JYFA 4K2SA 5I79A 3SGUA 1JPHA 2QPSA 1MXDA 2DUXA 1MW1A 2L5HA 1LG2A 1E6QM 5C71A 1GVSA 6ENLA 1WZMA 1YTKA 1J0ZA 3GHUA 4GIYA 4JEJA 1M03A 2DSKA 4YVVA 5HR6A 4KGJA 3M44A 2UWFA 2EPOA 3BV4A 4HSNA 1B90A 1Q7MA 1E6RA 1TE1A 2ZE3A 4HPNA 4H9YA 3TYEA 2V9DA 4XD3A 3TTOA 2VEGA 4GNVA 4NJIA 1EQCA 5DMLA 4YN5A 1J2BA 1REQA 4UB9A 3MCMA 4R7OA 1AUSL 3PK7A 2ZA1A 5G5IA 1QNPA 1YADA 2ZWZA 3GVWA 3VNMA 4BF7A 5EFFA 3LLXA 1PZ3A 4J3XA 3SW6A 5M3WA 1PDZA 3HPXA 3GHSA 2XH0A 3CTTA 4H41A 1QK2A 4ZCWA 3SCSA 4E4FA 4QBXA 1SMDA 2IKJA 3GQYA 4DBWA 5GJMA 3V3WA 1UQYA 1XGDA 1NF0A 1EX1A 3CUIA 1PUDA 2AGKA 4S2BA 5K9XA 1F7BA 1X1OA 5F1VA 2QHAA 2C18A 2H3BA 1XI3A 3OLEA 2NQLA 3IJ6A 4L7ZA 4LV9A 1MUCA 3L5MA 2ISVA 3CUXA 1KB3A 3T8QA 4A21A 4HPHA 2XIMA 1A47A 4C90A 1KM0A 3WD1A 3P81A 3T8LA 2D3LA 1B4KA 2DZVA 1R3VA 2YA0A 5I3JA 3E3HA 4JIHA 5HULA 1H1NA 2ABBA 2GVJA 4L9ZA 3GDBA 1RBOB 1ODZA 5U7SA 4AD0A 4GY7A 5FAGA 3WNLA 3LCXA 1W2PA 4W5ZA 1UBSA 1YNYA 4MM1A 3MKKA 1F3WA 4DI8A 3QXBA 1XYZA 3TTSA 3APTA 4RNIA 4V28A 2WK2A 2BXVA 5D9NA 4GISA 3JUGA 1B2YA 3B0YA 4M6UA 1S1RA 2VX6A 5FF4A 3NQGA 4JHMA 1LUCB 3WDHA 4UUIA 1LQAA 2FGBA 2YBVA 3A4XA 3OO2A 3E12A 1WQ5A 1G4SA 4G1NA 2FPVA 5I0DA 4HA0A 1FHDA 4AWTA 1G01A 1KRMA 4KBXA 3WNPA 4ORMA 3CUFA 4HSOA 4NZ5A 2G50A 1BRLA 3ZS4A 4NQ1A 2GUUA 1G1YA 4AY7A 3PBGA 1CLVA 3RMEA 3M16A 3IUHA 4AWUA 4PMVA 2OWWA 4Y9NA 3ABOA 1RZMA 5HNNA 3LERA 1W5OA 4DF1A 2NXIA 3BK0A 1VFLA 2VP8A 1LL7A 1PBGA 4X63A 2P1FA 2QCEA 4H83A 4UQBA 5TQLA 1X8FA 4WHBA 2B7PA 2ZX8A 2H8XA 3LPOA 3UJSA 1KRBC 2DZXA 3WNNA 1TELA 4UR9A 4GCAA 3VILA 1SW0A 4OZOA 1P7TB 2HQAA 3VIKA 4O18A 2A3BA 3NIYA 4NT0A 4D8ZA 4UTKA 1SW7A 5AKQA 2HSAA 3GU2A 4H9ZA 2ZE0A 4PB4A 1LBMA 4F9JA 1JXKA 1CGYA 1EZ2A 1K8ZA 1OCQA 4YWSA 1YKWA 1VR6A 1HKWA 2ZZ1A 1BG9A 1E40A 5H8PA 1GYNA 1HKIA 4LGXA 1QT1A 1RBLA 1U83A 4C5ZA 4PTXA 2YXXA 5F7UA 2BVTA 4DWSD 4NNBA 4MB5A 2CFFA 2IKGA 4HMNA 4JL2A 1HT6A 1EP3A 3MV11 4HPJA 1A0EA 1ITUA 4GVIA 3VOIA 1AQHA 1OYAA 2YCJA 4PTVA 4RXFA 1MEHA 1TQXA 5AYXA 5A3HA 2OXNA 1T41A 2V82A 1E6XM 2PDJA 3WLIA 4X9YA 1HX0A 1E4NA 1QI5A 2NUWA 3UPBA 4QSFA 3H22A 1HUVA 2FPTA 4K8EA 1J6OA 5EFDA 2PP0A 3EPMA 3CH0A 2Z2BA 1NARA 5JIWA 3VXGA 4FHAA 3OVQA 3AISA 2H6RA 1TTJA 3KVJA 4O57A 5K3VA 4U33A 1WUFA 3MUCA 4DX3A 1YMYA 3IAQA 4IFKB 3WQPA 3T40A 3SN1A 3O3RA 2E9LA 1L9WA 2ZTJA 1A5NC 2YBTA 3H8AA 4KERA 3S2LA 4XD6A 2Z1XA 1IZCA 3GG0A 1OFPA 3GIPA 3IJ8A 7ENLA 1VCGA 2PCEA 2YDRA 5HUOA 2R1NA 4CD5A 2HS8A 4UOZA 4TTGA 2VX4A 4KRTA 1OHLA 3OQEA 3CIXA 2J7CA 4W7UA 1S39A 2C13A 2DQXA 3N18A 4AD4A 2QJGA 4FX6M 1IV8A 1JCLA 3PZ9A 3QOMA 4HA4A 4BWLC 1WCGA 2VGBA 2PWDA 4B16A 3VC6A 5KSWA 2PP3A 4L61A 3AXHA 1CXFA 4GG9A 4S1FA 2WW5A 4H9MA 1PWMA 3FAXA 2RGMA 4AZHA 1HJUA 3S9IA 3BUVA 4WD0A 1S2WA 2DZWA 2CCRA 2NLIA 2WJEA 5HR7A 1SFLA 2V38A 4BY3A 4IX0A 3R43A 1TUXA 5LIUX 2C8NA 4UTTC 4TUFA 1Y5XA 3M6DA 1UA3A 2WHJA 4XVDA 1BKHA 3W7DA 4ML9A 5RUBA 4F9DA 1FXQA 1GVFA 1NOUA 1DJQA 3HV9A 2JK2A 2RHGA 3SFKA 1OZMA 1P4CA 1Q6RA 3LPPA 4AY1A 3E2SA 3M07A 2QJNA 3SCOA 4XG1A 3TLQA 1UUOA 3QHNA 3QY7A 2HTMA 1JVNA 4GQGA 2XU2A 2Z7KA 5T9CE 3LZ3A 4XKYA 1RBAA 4HZ6A 3GC4A 1UD8A 2VRQA 2QZRA 4LT9A 3RILA 1FKXA 1TKKA 1BHGA 3PZTA 4HMEA 2JF7A 3POHA 3UJRA 3O06A 3GXIA 3S46A 4FK9A 1I6NA 4ADUA 2YCKX 1L8NA 3VAVA 3WJYA 4K1WA 4B9YA 3FXYA 1QNVA 1H60A 4DPQA 4OBSA 3AMLA 1S5VA 4HHLA 1PKYA 1PEZA 4WQ6A 2O4QA 3L23A 3FJ6A 4F66A 3IV3A 1JZ7A 1XS2A 3HJEA 4P8XA 2XVGA 1GOIA 4ZL1A 5JUVA 4JCLA 4A2SA 2YW3A 4EIVA 3QZAA 3S9YA 2D2OA 5FF0A 4A29A 3UPWA 3H2AA 3IUIA 5LA1A 2CXGA 3O6CA 4JX6A 4HOXA 4QITA 1Q6EA 1KBIA 4Z1BA 2WMIA 1UCWA 2WNZA 2O55A 3PPGA 1TCDA 3WBYA 3NQVA 4DJFA 5J5DA 1XFBA 2NZLA 1A5UA 4W86A 2WZHA 4QLJA 1EJUC 4XZWA 1FQ0A 4ILSA 1QI0A 1UD5A 3BOFA 4HNOA 1OIFA 1L6GA 3WH8A 3GC5A 4IPIA 4NF7A 3FKRA 1UOKA 1Q3NA 3SUUA 2WVTA 4NAFA 1XG3A 1EPVA 1QPKA 1E0VA 2NT1A 5HANA 4IJRA 3QLLA 1XDJA 4GQBA 1TWIA 4CEUC 3S5SA 2XUCA 5PTDA 4O1FA 4NAFB 3TROA 2VT0A 3E1F1 2A6LA 3GDMA 4LC8A 2XINA 2IPJA 1J9YA 4KT2A 4LC6A 4XBSA 1E9IA 1SSGA 2A7RA 2I56A 1AW5A 1ADSA 1E4MM 1W1PA 4XTDA 3TYAA 4AYGA 1Y7VA 3BMXA 3N4EA 2J6XA 2CBVA 5HMSA 3VO0A 2Y0FA 3P6LA 4AB4A 2PWGA 1MZHA 3PFRA 2J8GA 4Z1DA 4PUUA 3WK0A 1T6MA 4LRTA 4W7WA 4CVWA 3LN3A 1UR4A 3ZFHA 1BSLA 4S3KA 1LRNA 3ONBA 4O1CA 1TPB1 1QASA 5CG7A 3SECA 3FYOA 1SR0A 1BXCA 1OFDA 4V27A 4GO8A 1Q4WA 4MYAA 3MCNA 4BF9A 4QJ1A 1UWRA 3W7MA 3HA1A 3TFCA 1TCMA 4O12A 5KEZA 3QMSA 2D73A 1U30A 4TO8A 4O15A 3TOYA 1CCWB 3BLIA 1WBHA 5HDRA 1C7SA 4CEXC 1SFTA 3R8GA 1TRIA 1Q6LA 1TTPA 3TQPA 3S2JA 4CUCA 5BXSA 3ZMRA 5D2VA 3C5QA 1DL3A 5FKYA 1OB0A 2NQ9A 2TSYA 2PZNA 4EOUA 1UD4A 1VFOA 3URBA 5D2YA 1EPXA 4MKNA 2ZTKA 4A3YA 3VCNA 1JNEA 4JHOA 3QPZA 5A8OA 4TVDA 2HNHA 4P7NA 4R5EA 1DJZA 1R5YA 2UY5A 2QKFA 3ZR5A 2GVEA 4HA1A 3LD5A 1TO3A 4PMOA 3W26A 2A7NA 3VU2A 4IGNA 1KRAC 5AYIA 3CMGA 4W5UA 4DUOA 4XQ6A 2DW7A 3GZ3A 2DSWA 5JH1A 3TCSA 4MJ2A 2V6AA 4WSHA 4A8NA 3ALGA 3N2CA 4AHOA 1FWIC 1VZWA 1ZLPA 2ZBTA 3VZYA 2ZDSA 1VD6A 3H4XA 1WBJA 2QMJA 3CQIA 1RK5A 4QNEA 4ACZB 1WV2A 4CQCA 3KS5A 4MY1A 4ICNA 5TF0A 4LAKA 3QSRA 4IP4A 3MVIA 4YJ5A 3OGVA 3T42A 4FF7A 2NSOA 5C54A 2ATSA 3N15A 3N6QA 1AW2A 3WQWA 1CGUA 1TV4A 3AIUA 1GZ1A 4N42A 4HU3A 2CKRA 5HJYA 1SFSA 3PY2A 2B7NA 3CB3A 3S6OA 2GGHA 1CB2A 4AEFA 5K9CA 4H6QA 2Y1HA 3LHZA 4RPQA 5JU6A 2ALDA 1UPPA 3AS3A 1E9LA 3IGSA 4LSBA 4F0SA 3C3NA 2F38A 3PC0A 2IS7A 3DBNA 5BOFA 3NQ7A 3HN3A 4JTAA 3ZJ8A 2GDVA 2ZX9A 4IGHA 4PODA 4W85A 5D9PA 3KCJA 4KCWA 2NVCA 1KBBA 1J5SA 3AIWA 1FOBA 3F4DA 1SM9A 3GG1A 4H9TA 3L4YA 3NYDA 3PBMA 1UKTA 1XQKA 1BVZA 1D8CA 3ABSA 2XPKA 4EWJA 1F4HA 1GEQA 4N9CA 3G1HA 3NZRA 3M0LA 3CUJA 3RF9A 3WJWA 1YNPA 4K1GA 2R14A 1KBKA 4B2DD 1DOSA 4TR9A 1AA1B 1N2VA 3G1FA 5AHNA 1X98A 1G4TA 1GPFA 3KCLA 5FJJA 2CZDA 3WDRA 3R8HA 5CJMA 4E4PA 1ESWA 4G9PA 5ABTA 4WCJA 4PCSA 5EPDA 1G4EA 3QTPA 1OYBA 3IACA 5H91A 5G4WA 1JDAA 3AWOA 1W37A 4OVXA 1QRQA 1XYAA 4JQ4A 5EMLA 3GKAA 3C8NA 2AQOA 3VIIA 3BCJA 1ZP3A 3U2ZA 4YS1A 3SY5A 3LRKA 3B9EA 3DFNA 3C2RA 4GMEA 1YQ2A 1QAPA 7CGTA 3VD3A 4AY8A 2AL1A 2YPIA 1O12A 1L2UA 1SJBA 4XWUA 1TWZA 5A5WA 1H61A 1MDLA 1FCQA 3DHDA 2OSYA 3EOLA 4UWMA 2XTKA 3ITCA 2PF8A 5AY7A 3GBDA 3TC6A 3QKEA 3R6IA 5ABFA 3THAA 4QJ3B 4UTMA 1T8QA 2PDHA 3IANA 2VXNA 2A21A 2Z0IA 3AIEA 4WY0F 4DWDA 3T0CA 1Q6CA 2OG9A 4PYSA 4PA8A 2XIBA 3PFMA 4KPLA 2OX4A 3LG3A 2C15A 2BGNE 1TYGA 4C6KA 4FXFA 4V2XA 1PXGA 3L4WA 3E0FA 4PL1A 2CHRA 2J75A 1F3EA 1R9ZA 2XH7A 3VINA 2ZDRA 3MHFA 3R0DA 5M03A 4R85A 3ITOA 1MRAA 4JPGA 2PDCA 4KF1A 3OEXA 3CZEA 3H2NA 1UC5A 4HNCA 3PN8A 4MWAC 3GU1A 3RO8A 5LGZA 3LI0A 1LUCA 3DFQA 1NOFA 3NUKA 2W61A 4LQ1A 4MWAB 3TYUA 1R3QA 1SZEA 3UBPC 3TNBA 3WJXA 1OX6A 4KETA 3VOGA 1DORA 1KXVA 4S23A 2QDGA 3A21A 2O56A 3PWIA 1H3GA 5BXTA 3EX4A 1QJWA 1KA9F 1NP2A 4WKAA 3FXGA 5CSRA 3R13A 3QGVA 1AG1O 5DBUA 4HMCA 1XLFA 1CBGA 1DJIA 3KTXA 3LHYA 4TTUA 1OJXA 1R2TA 1EOMA 2GJNA 3KOXA 4JL1A 3TLLA 2BGSA 4CN1A 2VOMA 5BW6A 1FCUA 2C16A 1M68A 9CGTA 1GVOA 2X7WA 3MSRA 4GBUA 4QE4A 1J0JA 2OQLA 5I03A 3F03K 1IIHA 1GZJA 3WQ6A 4LVFA 1YDVA 3EDKA 3W27A 3EX3A 3MSGA 3GTNA 3REQA 3BW2A 4M8UA 5CPOA 3SO7A 2PMQA 4HBKA 2AMXA 2I17A 1AW1A 4CNNA 1FH9A 5IDIA 1KV8A 1EA9C 3L68A 3TN5A 1KCXA 2BASA 2VDHA 1JFXA 2ZUUA 4LANA 3UG8A 6REQA 1F5ZA 4QCEA 3W28A 4GFIA 2QXWA 5LIKX 1G5AA 4KCUA 1JUKA 3GSMA 1KXHA 1SFJA 2EEXA 3QJAA 4Q4RA 5I24A 1H7WA 4L4OA 5CSUA 2CHNA 3EWYA 1TV8A