4C6RA

Crystal structure of the tir domain from the arabidopsis thaliana disease resistance protein rps4
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
162
structure length
162
Chain Sequence
QHQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEAFNLIPNIMGIIIDKKSVESEKVNEIVKAVKTALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords DISEASE RESISTANCE PROTEIN RPS4
publication title Structural Basis for Assembly and Function of a Heterodimeric Plant Immune Receptor.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 61
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4c6rA00
5H3CA 4OM7A 2J67A 1O77A 4EO7A 2M1XA 3UB4A 4LQCA 3OZIA 4LQDA 4LZPA 4C6TA 3UB3A 3JRNA 4W8HA 5FORA 4C6SA 2Y92A 4C7MA 3H16A 4C6TB 1FYVA 4C6RA 1FYXA 3UB2A 5KU7A 4DOMA 4FZ5A 4W8GA 2Z5VA 1T3GA 2JS7A 1FYWA
chains in the Genus database with same CATH superfamily
3OE5A 1BS9A 1FL9A 5LQDA 5CXSA 2H2HA 4NMHA 3DWEX 1CETA 4GI3A 4E4TA 4ER7A 4P08A 5I4KA 3JRWA 4IKEA 3M6IA 3GA0A 4MQBA 1U0HC 2WYOA 3AERB 4B3MB 5E1OA 2FN3A 1GZ7A 4NBVA 1IFXA 3R6DA 4L5IA 4CDGA 4CKCB 4BY9E 1UKAA 2HK8A 3SS9X 3VU3A 1U0GA 3D5EA 1M6VA 3QEMB 1FK8A 2WMNB 2XITA 3QA9A 3TSOA 3AI7A 3PTAA 4Y2YA 1K4KA 3GLKA 1A4UA 4PYNA 3ONNA 4K9OA 2WZBA 1PQPA 2R4QA 1PT6A 4OAPA 3OQOA 2RARA 5REQB 2B8TA 2JLZA 4DV2B 3WA7A 3L4EA 3C7KA 3DPSA 1XAGA 1M1NA 2WUDA 3N1UA 2D2VA 5C18A 1ESCA 3DLTA 3C5WP 4N0MA 4H77A 4Y2HA 4HI0E 1CJTC 2WNIA 3UK0A 3QG1A 4XEHA 2X0RA 3BTSA 1RAHA 1G5PA 2IE8A 3A3OA 2NG1A 5BQFA 3LDAA 3TQCA 1SOAA 3HA7A 1Z6ZA 2AXPA 1CE8A 1HFWA 2OHJA 4BVBA 4EM6A 3RUPA 5A5VA 3U4CA 4JUBA 4Q03A 3KSRA 4EHLA 3TK1A 1R5BA 1MIHA 1PJ3A 1XELA 5CK4A 1V1MB 2HADA 2DUNA 2VUSA 1YBMA 3H8SA 3HM2A 5AUNB 5CDHA 5B3JA 1OASA 3DE6X 4RVCA 1BW9B 4G1BA 3KZ1E 1BG6A 1C9EA 3ZWWA 3DV0A 2ATCA 2O2SA 3E3AA 4HXFB 4G8CA 2IV7A 2B4QA 1XT6A 2B37A 1Z2AA 2R3SA 1U8ZA 2ZI5A 3HYTA 3ICOA 2C1EA 1TXGA 2C78A 4MWGA 4PHGA 3ZV7A 4LBZA 1H3FA 5DHQA 3STYA 4KLRA 3TIVA 1PR1A 2UVPA 2VPPA 3WLJA 3C8ZA 4URWR 3KS9A 4JVLA 4MVJH 2L2QA 3JRNA 3ODPA 5H3HA 4DIMA 3WL7A 3HGTA 3NNSA 3L8ZA 4F9EA 5BVGA 3KQKA 3IBYA 3V7WA 2TRSB 3CZMA 2YZ2A 1JLKA 3OF5A 1P9OA 1J2JA 2XTZA 1NU6A 1D1PA 3AHJA 1TT7A 3SZ3A 3KJFA 2W4QA 2FN8A 4CNQA 2OY0A 4XWKA 1YZNA 1ZNWA 2F7SA 5HKLA 4RFSB 1Z7WA 3ROGA 2ZOSA 3DE4X 3PE3A 4ND6A 4DIEA 3A1NA 4P5EA 1CG6A 1N2BA 3KJZA 2EDAA 3N6VA 3ZBUA 2BFEB 5BQOA 5IH7A 3SC2B 5KYKA 3ME5A 1DBRA 1LWNA 1R10A 3IOYA 4GC5A 4LF9B 3N75A 3R3JA 4YT5A 4MO9A 5TEVA 4AICA 3MWGA 1RBQA 4BLRA 4EKIA 1XAHA 3VI3B 5B37A 4H3SA 1QH1A 1L8XA 1UH5A 1Z2EA 2ZQZA 1A2OA 3C98A 3G2IA 3ZD7A 4DNXA 1OC4A 4FOPA 4O2AF 1FE8A 3HV0A 4KSBA 3GH3A 2KHZA 2I4RA 4RVHA 2RGWA 3KLNA 1EFLA 2X9LA 4ZK6A 1OD6A 3EZFA 3FRHA 3P9XA 1TVCA 4LK3A 3ISJA 4WBNA 5LP6A 4HB0A 4KR2A 1FTYA 4UEJA 4YRBA 1AKNA 3ONDA 4LHEA 1QB8A 4FC6A 3TI7A 5JQWA 1G9XA 1PI3A 2D1RA 1NXWA 1PFQA 2FX5A 2GK6A 3KUKA 2H4JA 4L7VA 2PUAA 4N6OA 5GM2A 4RTLA 1KRWA 2A33A 1OU0A 3ZWCA 5DGIA 3KCQA 5T8KA 3OX4A 2ZIEA 4TMYA 2BGWA 2BHSA 4I3GA 1YVPA 4KXWA 4NJOA 3DZJA 3DHVA 3GW8A 9MHTA 1NXPA 2PBFA 1BTOA 3I2JA 4IMPA 1HNWB 4QT4A 5JD6A 4YAFA 3T9CA 2OOKA 3GBVA 3EY4A 1UKCA 3LY5A 3OA0A 1VPEA 4M1WA 4MRNA 3TZBA 1Q0ZA 2XODA 1LPMA 3BB4A 3NBQA 2RBKA 2Z2KA 5TQ0B 1CUZA 1GQRA 4G1FA 4IDOA 4IS3A 4J7UA 2FMIA 3DFIA 3NP7A 2HA6A 2MDTA 4F97A 1RAFA 4BNGA 1SVOA 2Q99A 2D5AA 2QN3A 4V0QA 4Y0AA 4QASA 1IXKA 1QHSA 3LP8A 2C42A 2PSHA 4N01A 5LQNA 1TEHA 4EK9A 1MZPA 2W6MA 1GSAA 3M3DA 1AQYA 1TK9A 1PGJA 1JHOA 1ZM9A 2VDMB 5EJGA 4OMUA 4TMFA 4WW0A 3CW2A 2ZR8A 3G7SA 2A0UA 1WCXA 3ESCA 4KAAA 3QE2A 4PC1A 5KJ6A 3QF7A 2F64A 2PTHA 3T3EA 2GBFA 1G8HA 2VUUA 3ADDA 5D3KA 3TRDA 4OSPA 3LLCA 5J47A 4EVRA 5EIBC 4LA4A 4OCZA 1SCAA 2VR1A 4OXKA 3RUHA 4OLJA 1V6CA 2EWMA 3WXMA 3EMVA 1CEEA 3VO1A 1QMPA 1W0JA 3BE4A 3ZQ6A 4MQ4A 4MSUA 2FRVA 7ABPA 1MX3A 1HZZA 5HVNA 1S96A 1NI4B 4BJ6A 1A9ZA 1C5KA 3ISVA 4G56A 3LA6A 3MWLA 5IVPA 5JYEA 5I45A 1FLDA 2GLXA 2O19A 1CUBA 1MJ5A 2EQBA 2AH5A 4DA0A 4Q3KA 4FN4A 1JDBC 1NP6A 3LWZA 1DZ3A 1QIMA 5KDOA 2J5RA 2JFGA 2PKQO 4IXNA 1KOJA 1WHSA 2G1UA 4WA8A 2R00A 2VDVE 1Z5WA 2J7PA 3D9QX 3QUBA 5IARA 1TYAE 3OHSX 1J33A 3LOQA 3GGDA 3UW1A 3S5JA 2Y4NA 3PGXA 1US8B 2IYSA 1W48A 4INAA 4C88A 2AOUB 1HG1A 4Q34A 1Y8RB 1QBGA 2E4ZA 1XD2A 2J67A 1PEKE 2X2EA 2YVUA 2I7TA 3A58B 2WFZA 1RMQA 4YRKA 4KNYA 3OZIA 4LJKA 5A5EA 3FSRA 4ID3A 4G24A 1AUOA 3EHDA 4CIXA 1VL0A 1NL3A 1PZGA 3KZMA 3NHWA 3UF0A 1Z0UA 4OYLA 3TBFA 5HRCA 3SBEA 4LFBB 1T5HX 4GVLA 4Q39A 4NLLA 4ARCA 1E9VA 2JKVA 3TLBA 5DOZA 3UBMA 1CU1A 3HCDA 1DCTA 1DLJA 1WHTB 4X54A 3AOEC 3QXJA 2WICA 3OCCA 1QH8B 3OJWA 4MW4A 3JQPA 2BDTA 3ACDA 5LQMA 3KKEA 1OZAA 1T2EA 1Z06A 1GL7A 1Q0LA 1YQ9A 3EHEA 4ICIA 4JC4A 4KYTA 4BN4A 2V7GA 4XGNA 3IAM1 5E0KB 4OMDA 2CKDA 4P6VF 1G0NA 4WE3A 2XA2A 2H52A 4RMJA 4M0EA 3HL0A 5BYBA 1Y33E 4D4GA 2QP9X 4PFQA 4C3UA 2OKCA 3KDSE 1MC8A 2I4MA 1D4ZA 2C4KA 2ODNA 3GQBB 5L51A 3HWWA 4O4HB 3T7TA 5B6JA 5ESWA 4E51A 5EQTA 3VPGA 2EIHA 3BIWA 4Y1RA 1QVAA 5EINA 2BMEA 1AKEA 3VJKA 4BQSA 4JI5B 1FRZA 2VYVD 3ZWVA 4B3DA 1A4IA 2Y6VA 4Z0TA 3A6HA 3BZWA 1QFMA 3D7NA 4MGYR 1OB5A 5DHAA 1E92A 3ZWBA 2FHPA 3ITKA 4DG8A 1W4RA 1XZQA 1PJTA 1MJNA 3AHIA 3WK9A 4AY2A 1NX9A 2E18A 2YN0A 3ETGA 1QG2A 4BQFA 4OU5A 3CRNA 1Q77A 4NG4A 4WK6A 3EGVA 1SD1A 3E7DA 4F3NA 4B6FA 5DSXA 4PE5B 3S28A 4CMEC 5EMKA 2X0NA 3IVGA 3ZVNA 3NR2A 3B2EA 3RWBA 4BCCA 1XNHA 1CJUC 2VHZA 1HQDA 5AVRA 3HXLA 1XPOA 4A5OA 2MR5A 4UMVA 4TKVB 4PEVA 2C7QA 3T1HB 3RU2A 3VQTA 2CLFB 3OM9A 1A9SA 1DHRA 4BNWA 3OQPA 1FNNA 1V2GA 2GPWA 3F7MA 3FBGA 4FS3A 4NS1A 3WQQA 5KIAA 4MV6A 2BMJA 1EGHA 1QGYA 3AFIA 4RPIA 3CIOA 3NG1A 2J5KA 4AN4A 1XHEA 2ZJ8A 3TIGA 1VGVA 1T5DX 4BKUA 3W5VA 2XYVA 1XNJA 4Z0NA 2AEFA 4F11A 4GHWA 4DCNA 5JPDA 2DXIA 1RYHA 1GEGA 2QAGC 4YRRA 3IT1A 3CC8A 4YEDA 4ZVVA 3PXCX 4PXSA 2B94A 4OQLA 2CLDX 3FZNA 3EXHC 4QQFA 4BAGA 4JKIA 3N87A 4GYWA 4QWWA 3I5UA 3L18A 3UT5B 4ZFNA 2ZJOA 4D6PA 5LLTA 1YC5A 2QV7A 3ER9A 4L6CA 5TT0A 3PXUA 3EVTA 2JJ2D 4FGWA 1YJAA 1TAGA 2XR1A 1C1HA 1PVDA 2B2XA 2WOJA 2WF7A 4GXTA 4OYRA 2B36A 2ZSKA 3BX1A 2Q45A 2YXDA 4AKGA 4MGIR 3C0KA 4FX5A 5JUWA 3ESYA 3DZGA 1FTNA 3NRCA 1KMNA 4K9MA 2D0DA 3ZX5A 5PGMA 1PSDA 5EYPB 2O8BA 5I8ZA 2RHRA 3HBAA 3I4LA 4LHXA 5SZIA 4JSYA 1ZN8A 4L8WB 4R1OA 3AH8A 5ESRA 3EC2A 1BEZA 3GP8A 4MIEA 3F1KA 2EFJA 1KKMA 1UKVY 1CVLA 3B20A 1U7OA 3IQZA 2ZRAA 4MIYA 1WW8A 4ZAWA 3U39A 4BRZA 4Z54A 4URYR 5HHTA 5KOJA 3HXOA 4LYHA 3UN1A 1OI4A 5ERGB 2Q4EA 1FFWA 3RT9A 3CGGA 1E3DA 4M1QA 3IEXA 2C98A 3KSDO 3WLEA 1QYWA 1P5ZB 2ATXA 3E3NA 3IPXA 4JLUA 2QN9A 4V0ME 4EY6A 2QD2A 5AOCA 1FPQA 1Z6GA 2LDBA 2Q5LA 3LPMA 4QGAA 4YRSA 2BE7A 1XTUA 3BT7A 2H5EA 5AICA 2WPDD 2CLKB 2MSCB 3FUUA 1FYWA 3D6VA 4BMYA 1XXHE 5EEGA 4CNBA 2DPYA 4Y1FA 4RKYA 2QGNA 4GZ6A 2GFQA 3R5FA 2W2OA 5K3DA 3SVZA 1T3LA 3P7MA 2XV1A 1WLSA 1ESZA 2FI1A 3CVYA 4ZOLF 1J8FA 1R4MB 1UEIA 1ECBA 2AR7A 1AKUA 3NIDB 4RD2A 3RT1A 5LIRA 1AUVA 1QRTA 2QM8A 1XQVA 1LVHA 3IB6A 2JL1A 2VP5A 4TMTA 3BHIA 3PL5A 3RRZA 4DMGA 4EENA 5BR1A 2ZIWB 3URMA 5ICGA 5KS2A 4PX5A 3ZK7A 2BBWA 2LRHA 3MT9A 2NU9B 2AFVA 1K8XB 1F6BA 2AXQA 2J6IA 3IPCA 3R0IA 4PBRA 2EYQA 4BMXA 3KP1A 1RCFA 1RXSA 3HU5A 4GUAA 3CT4A 5FH9A 1SUSA 3PE6A 3L4JA 1SKAA 2LDXA 2FOLA 3HGMA 4DIBA 1JA0A 2PSDA 2VXBA 3EOBI 3OJOA 3SYNA 4R9UC 4DCOA 1W9HA 4HATA 2BZ1A 1SWVA 5CLIA 4XD7D 5THXA 3QU2A 2W83A 4UFOA 2BE9A 3KRTA 3ROFA 3HXMA 1GN9A 1G20E 3ENZA 4ZOBA 4BFSA 3QPUA 3ETHA 2EL9A 5AW0A 1O96A 2QTAA 5DZSA 3NVMB 4TL9A 5HMMA 5KNLA 2W8ZA 5JJBA 5THQA 1NNUA 3VNVA 3LPCA 5CPFA 5JCJD 4WNCA 4A91A 1NVVQ 4J1SA 4PCUA 1SQ6A 1RJFA 2WKRA 3AHHA 3NM5A 3V1UA 3VR6A 3N9IA 4AYTA 2K2QB 2GPSA 4GSKA 5BQXA 5KJCA 3D0KA 3JATB 4TMXA 5FPTA 1FFSA 4GPD1 5IF3A 1TCUA 1QG4A 1XJQA 3S27A 3UM9A 2XA9A 2FWPA 4I6GA 4Q6WA 3O8RA 5JDCA 5DSTA 1FSGA 1ZONA 1U7HA 3H9CA 3RSFA 2G71A 4F1KA 1ACLA 1AUPA 1Z2NX 4RVDA 2A0WA 4FSHA 4ND5A 4ISCA 4WADA 2XUDA 5D2CA 5D7BA 2WHQA 4C6HA 1IQPA 3DZIA 1X1QA 5JY1A 1YJ5A 1HNXB 1SBNE 3D8RA 4OA8A 4UMEA 3NDBB 4BNFA 4D9KA 3GGJA 3IR7A 5I47A 1XRPA 3VPSA 2JCVA 1UPAA 3DHYA 5CA1A 4IIEA 4WVFA 3O1LA 4I5IA 4IXDA 4AJ2A 5IVIA 3CVXA 4WOPA 2GCIA 1ZH2A 2Y1WA 3FUWA 2Q1TA 4GYYA 3GH1A 3VV2A 1CZRA 4ZDIA 4IXTA 3U09A 4NBNA 2PUWA 3HJFA 1MAWA 4UUMA 1BN7A 2JDIA 3ZLBA 1T8YA 721PA 1JYEA 1PR5A 1U3FA 3IP6A 3ZGXA 4EEKA 3JQRA 1A82A 1XKTA 1QIGA 3L1HA 1CUSA 4QELA 1W0KD 3AP1A 3VFDA 3T1VA 2XTAA 4Q7QA 1WSWA 4IZHA 1Y89A 2FEOA 4EW6A 5F7OA 4J0FA 1VGQA 1ODFA 4GPBA 5F2EA 1Z4LA 3GG2A 5FA6A 1GGKA 3UWMA 2MINB 1H2HA 2Y1LA 3CX6A 3MAAC 5G3ZA 1PR6A 1EVKA 2WU8A 4FZVA 4RKEA 3QA3E 1QTNA 4BFLA 4KLZA 4ZJUA 4G0MA 1YTUA 2Q2VA 3U6KA 2VK8A 1J07A 2J59A 2PLNA 3PEFA 5DWQA 2G1KA 4JEMA 2CFTA 2NO5A 1GJRA 4RDCA 4EFMA 4BNXA 2HT1A 3ND7A 2I91A 3L49A 3BWCA 1D5WA 1ZH0A 4Q3LA 2OBMA 1ZGGA 4S0ZA 3HKDA 1Q7CA 3HV2A 5FYQA 4IDPA 1BCSB 2GI4A 2ZRLA 3D7SA 3SF8A 1JQJC 1UPTA 4W82A 4K88A 4IEEA 3FDJA 5ICCA 2RGAA 1FU7A 3K3PA 2V98A 1NW9B 4HDAA 2Q4DA 4PM4A 5KB3A 1TMKA 1ZP6A 4MV9A 4LHYA 5AJTA 1WMSA 2WILA 3L0ZA 1XU7A 3LUFA 5KYWA 3DVAA 2FB9A 1V11A 3EG9B 2NUAB 1W25A 4FHDA 1TQ4A 4R81A 4XVRA 2VRCA 1CC1S 3PVZA 4D2IA 1OIWA 3HE3A 2MYNA 3E3LA 3H9QA 3KPWA 4F38A 4MWZA 5JC1A 3RC8A 3SDZA 5K8CA 5DSZA 2QGZA 2V5UA 1HOXA 5EZQA 1UJNA 3MWFA 2YBEA 3C3CA 4IUDS 2P6NA 3DP7A 5ALGA 2IXFA 3LBNA 4Q21A 4WLFA 4GE0A 4E7PA 5HP4A 5JJLA 4KITB 5P8WA 3LDUA 3T3DA 3DEJA 4J4HA 2W0MA 3K6SA 1QH0A 1U65A 4MS4A 1N3LA 1E2PA 3K4QA 4CE6A 4TN1A 3H0CA 3V4RA 2OC9A 4DBLE 2FR8C 3WLFA 2PQMA 1SZPA 3VXKA 1WCIA 3PNLA 5FJJA 5JCXA 1RYNA 5DYNA 4FDUA 1F17A 1PFYA 1LI5A 4NZ9A 1TGYA 2BM0A 4AMUA 3VR5A 3CNHA 4EYGA 2JFPA 1QTQA 1DG9A 2D1SA 2XI4A 3OY7A 1HQYE 1BX0A 1Q0PA 3AK4A 3ZU3A 3UK6A 5FA5A 1L1QA 1PFWA 1JG1A 3BMQB 5J2TB 3W2EA 1RKQA 2AKAB 4MICA 4B6SA 1E2IA 4HUQB 1JKIA 1UPFA 1CR4A 1KSJA 3CMMA 4GI7A 3WFIA 2IPXA 1OXTA 3ZHXA 3QW2A 4FPXA 4HZUA 3AEUB 2ZBFA 4Y1GA 1U2TA 2FR0A 4ARUA 2IYYA 2XGOA 5I4BA 3THOA 1IXRC 1TIKA 3JARB 2XMCA 4JN6B 4NJEB 1BE6A 1Z08A 4TROA 3RS2A 1LPNA 1DDGA 4S04A 2FDRA 2B1RA 4KOEC 4QTYA 1OVMA 4RHYA 4L9WA 1XNGA 3ILVA 3OU6A 1DAFA 2ACWA 1XQXA 4DQ0A 1NN3A 3PDHA 4DBVO 1A76A 1V4NA 4L8VA 1R0RE 1EI9A 3PQCA 1AD2A 3QFFA 3LUDA 4IMJB 3QW4B 2C7VA 1UBGA 1NF9A 2GAAA 3SFZA 1H9CA 2SHKA 3O91A 3V3TA 1CYEA 3VDNB 1BEEA 4ZAYA 2DFVA 4JP3A 2RAPA 4M0LA 4AZTA 4L4XA 1E2MA 4EDFA 3FWHA 4BRUA 1S3SA 2UVDA 2OWDA 1ARZA 3OKFA 5GJWC 2HYIC 2VDOB 5DBFA 4EMUA 4F5WA 4PO1A 2BEKA 4EFLA 3SYTA 3ZD6A 2EZUA 4JLPA 3QKSA 4JYAB 1TA4A 2Q41A 3NONA 1U1EA 4C7VA 5ALJA 1HE3A 1YNOA 4XIFA 2G83A 3K73O 2ZVDA 3ZUPA 5UKDA 3B1KA 1M8PA 4Z51A 4D3FA 2AD5A 4DIUA 1F9AA 2CXUA 3B7GA 5L3ZA 4XWTA 1PO7A 3KVYA 4P3PA 1RMYA 2ZRHA 2ZRQA 2BGJA 4CT4B 4E5SA 4E32A 1VI6A 2JZOA 3DLIA 2RHHA 4XRGA 2DHRA 3H2JA 3S40A 2X22A 4DJJA 1NBHA 4R8RA 2W2PA 1U0LA 1GGMA 2XUJA 2V6GA 3AGPA 1Z34A 1PJ2A 2VOJA 1O95D 4DDTA 5FBLB 5AVWA 2X8WA 1G5IA 4JBWA 5CB4B 2VQFB 1SC6A 4AI6A 2JFQA 2N0SA 3HDTA 4BKPA 4X61A 1WIWA 4B6QA 4BKRA 5GMOA 1ONOA 1J00A 4OIMA 2ZSFA 2DQ4A 3UYKA 2CL5A 3RUIA 3UMMA 2QLJA 3I2HA 3D8BA 4RABA 3WGVA 4HP8A 2PN1A 5KC9A 1QHHB 2QLLA 4EUHA 3U19A 4RQBA 4I19A 4B8ZA 2O6LA 3WIVA 3B9QA 1F4VA 3IMCA 3U37A 1WP9A 2P1ZA 4OSOA 4R6WA 5DCUA 2NO6A 5HZGA 3OQIB 5KWSA 1HMYA 2N3ZA 4N65A 4MHOA 4K2AA 2IQ5A 5I7WA 5DM70 4D25A 1O94D 2ZGVA 1Z0SA 4WCVA 3VA7A 4CT5A 1J42A 3G0CA 3NHZA 5HE8A 2O8CA 2XADA 1X7XB 4JV5B 5LUAA 1AF7A 1GPH1 1WMAA 2FSHA 2VDJA 3DM5A 3IPYA 1XP8A 3LV8A 4IIYA 3KYCA 5CT6A 3RVSA 3WRYC 2POCA 2RE8A 2G70A 2YZGA 1AMOA 3PV0A 1JEEA 2XD9A 4KTVE 4JZYA 5M04A 5KJFA 1KJIA 2O2CA 2Q5QA 3L5KA 5ICFA 7ADHA 5DI3A 4E30A 2IYNA 4WTOA 1I7SB 3PDJA 2P8JA 4Y9UA 3D0OA 1D2MA 2C5LA 2I3DA 1F7VA 5JQGF 2FDXA 3LCJA 5BNIA 1W581 3GXBA 1H1DA 1Y3HA 5FUXA 3CNQS 1Z56C 3ORRA 4U2GA 4FWBA 4BX8A 1RYEA 4QBKA 3C85A 4GICA 4B79A 1WSAA 4JY7A 3U0VA 2BGRA 3ZKAA 2YOFA 3SP1A 1AGYA 1R8SA 2NP6A 3Q98A 3IDQA 3BSFA 3DKRA 3ESQA 3WBJA 3GUCA 3NVAA 2DBZA 3E9ZA 4HX2A 3FWNA 5L3SB 4TZ6A 2OO5A 2OKGA 1U99A 5TDHA 2JA2A 1NDHA 1GL3A 3HK2A 5I7HA 4UHEA 1NBME 2M98A 2JCYA 4RF3A 2DMRA 1FRNA 4EFNA 3EDCA 5C3MA 4E1VA 4LF7B 3VV3A 1T36B 4PAMA 1TK3A 3H3FA 3L4BA 1C3XA 3TSYA 2HLPA 3HM9A 1RS0A 2EP7A 3D02A 1AQIA 4B3GA 2RH5A 2ERYA 2ZUWA 3PQ3A 1XK6A 1MOSA 1C80A 2D2IA 4GQBA 3WX0A 2C2WA 1ISIA 2B4RO 3U6BA 1DCFA 1KXZA 4N1AA 2WP8J 4I3HA 4I4IA 4LJSA 2EJTA 1DCKA 1HLPA 2WJJA 3SIRA 2NTNA 3MTQA 4YQYA 1XMOB 5IDYA 4P7JA 1IE3A 4L8YA 4MYRA 3F4KA 1MTZA 5LKRA 4RXMA 1NBEA 4F96A 4F4HA 3UY4A 2EBUA 3FNIA 1OXKB 4NH0A 3VU1A 1E3SA 1R0CA 2QPTA 2Y68A 2ALJA 4DTCA 3TLZA 3FHCB 4ZZ0A 1RZUA 4C4ZA 3H11A 1EGVB 1M9NA 2XMBA 3GDGA 3QVXA 3WR5A 4KFUA 5GWXA 2X0FA 2NP7A 2QRVA 2I76A 3U1VA 3LLMA 4WVLA 3SOPA 2ZUFA 3LSYA 3HJRA 5C31A 2W43A 5K7SA 2XRZA 1KRHA 2PT9A 3FPAA 4LE1A 4PC6A 3ZIAD 2O7SA 3CWCA 2LR0A 4OHOA 2JA1A 1GZ4A 4MUNA 1I3KA 2IJGX 3WZLA 1QYXA 2ZRJA 2CF5A 3PFIA 4O2BB 5FPPA 3U17A 3CE6A 4TYWA 4U00A 4Q6BA 2I2BA 2WIFA 2ZIXA 3RC9A 4ENQA 3G88A 4CCAA 5F3WB 1Z3IX 3JSAA 2NTEA 4HZIA 2TECE 2JGIA 1DQYA 3DMYA 3UAGA 1IRIA 1C14A 4BNVA 3DE2X 1JG7A 2O8EA 1LH0A 2BKAA 1Z4PX 1L8LA 3U26A 2P9HA 4LYJA 4K6FA 2N46A 1Y7HA 3ZXXA 2Y1FA 3QTLA 1XTRA 2FZKA 3CM0A 4OJYA 2Q3CA 3HKCB 2JHGA 4KI0A 1T4CB 3MN1A 5GGYA 3UCEA 4ARAA 3MYYA 1CF2O 4ITRC 3G5UA 2P9YA 3EZ9A 1O0BA 4I36A 1CD5A 3LUGA 3LDFA 3TM4A 621PA 4YAIA 4HPJB 3KXDA 2B0CA 4HXYA 1WMBA 1T0IA 4KGZA 5AH0A 2XCUA 4YFVA 2Z4RA 3MHPA 5SICE 5DWDA 3S2SA 1BHSA 4X1KB 2GF9A 3PEWA 4G63A 1THZA 1XAIA 2OZLA 3QKUA 4Y6SA 1HKUA 3RNOA 3VTZA 4DEXA 5KX5A 3U80A 2W6CX 4MS3A 4G5HA 2XYQA 3TG2A 4IJKA 1BOFA 1T1SA 1JR2A 2C59A 3TGWA 2HXYA 2QTBA 4WECA 3EFBA 3K9HA 2P1DA 3PXXA 5F1YA 3VSDA 1I10A 4TSRA 4AZWA 2C9DA 2B34A 4Z7JA 3MBKA 4AS3A 1J06A 5JE8A 2JFUA 4ENVA 3WLTA 1G2PA 1KEKA 1TMGE 1XX6A 1Y6ZA 3P2EA 1V16B 4LF5B 4NSNA 2W6PA 3A14A 5H16A 1XR3A 1DBVO 3SJBA 3NEYA 2CN1A 4B2PA 2Q4TA 5FT9A 2OBXA 1N33B 2IS2A 1DRVA 1KO7A 1M2OB 1NWHA 3CEPB 3DMTC 4NS4A 5TQ2B 2P2DA 1E1RD 1PJLA 1EWVA 4I55B 4RNDB 1EDBA 1SC1A 2JJ2A 3RDPA 1P4RA 2JGAA 4PLHA 2IEDA 3T7EA 3ESAA 3VOTA 3MFQA 4HQKA 1QM5A 3RTEA 1EBFA 2L18A 3G85A 2I9PA 1EWKA 3QEKA 3JWIA 2PNJA 3DFFA 3TUIC 3TZKA 2HWYA 1M2HA 3C3JA 2DFDA 2YRFA 2E37A 3IRUA 4MV5A 3VSEA 1JB9A 3C7CB 4E5VA 5BSEA 3F6SA 1ENZA 1S2GA 2IV2X 3LF1A 4TTVA 4LW8A 5JBIA 1TZCA 3K6KA 1XAJA 2C5HA 2J9FB 4MYHA 5IHXA 1KNQA 3H0EA 3PR1A 1T9CA 5ICEA 2TS1A 5DW0A 3BCHA 3QE4A 1PR2A 2Z1NA 4OQXA 4BB9A 1JT2A 1GPMA 4HJXA 4MMYB 3V4ZA 4D0LB 1HOTA 2DPHA 4RENA 2V6MA 4GGMX 5FULA 2Z5VA 3HYCA 4YASA 4P3KA 2Q5FA 2B99A 3WNVA 4UBKA 2F8MA 1TW3A 2P90A 2AQIA 2AYZA 2GERA 4X8OA 2ZIFA 3TH5A 4EPTA 1SUAA 5ALOA 1MU0A 1NUTA 4A0RA 1FNSA 4GG1A 2RKOA 2WPDA 3AQ4A 4HG2A 3ET4A 4PYOA 4RHCA 4TGLA 4UBLA 2WWWA 3U48A 4DG9A 3ZR4B 1N32B 4MQFA 1W2HA 3U9SA 4B44A 3IA7A 3GFQA 2Y71A 2FZ5A 3L84A 4ZI3A 1H93A 3QGMA 2O3JA 1EG2A 3SHTA 3I9JA 5DX1A 5DM4A 4KAJA 2ZW9A 2DX7A 3W6UA 2DTDA 3O21A 5EEHA 4RY0A 4PS0A 1KIFA 4RK6A 4X95A 2PD3A 5AI6A 4A2PA 2ZWMA 4HDCA 3LUPA 1G8JA 2BH2A 1PGPA 2GMWA 1P7CA 1Z35A 2RHGB 3D6JA 4HH0A 5A5DA 1JKJB 1TEVA 4EGCB 4EA6A 4II2A 3K1TA 3VKWA 3CCCA 2YHBA 3IO5A 4RFVA 5KWJA 1G21E 3IQFA 1P2VA 1EVZA 2FNAA 3GCZA 4X41A 3H4MA 2PMCA 3L6DA 2ODAA 1CRLA 4ZREA 4OL9A 1TJNA 3ZE7A 2P9ZA 4GPTA 1R9GA 4ZI7B 1EPUA 3QLUA 4L95C 4HADA 1HDCA 4YP7A 4C4AA 1QGUB 3L7AA 1J6UA 1E2QA 4ODIA 1JSRA 3V97A 4KQXA 4XD7A 5LYJA 1SC3A 3BIJA 2NUTA 4EY4A 2XUHA 4EJMA 5AKZA 3C41J 1GR0A 2VZ8A 2IYUA 5CNJA 2JFXA 1S89A 2OYCA 3A6LA 4QXMA 5JCOA 1T0PA 1T3TA 3NWOA 4P86A 4YFYA 5EHZA 4P35A 4PO9A 3K72B 2RC5A 3QUAA 3CF4G 1W0CA 3QV1A 4KWHA 4OB6A 3C5EA 4HD8A 4BLPA 2CFOA 2GSWA 1K7YA 4Q4JB 3ZBQA 5K1ZA 4XASA 1Z4JA 1E6CA 1JMVA 5FNVF 5FP0A 1QE0A 1WTCA 3RSOA 1QX3A 1PYDA 4JLSA 3T9AA 3W9SA 1KMCA 1U4NA 3RFXA 2OLKA 1XL0A 2VH2A 2DY0A 4QEZA 4V1CB 2WC1A 4WZZA 1RVV1 3U7QB 4FI3F 5CCBA 1ZM3A 3LHIA 4AYXA 1XBTA 3GN2A 5DXJA 8ATCA 5JTUA 3PJFA 3K70B 3STXA 1B0ZA 4BUZA 1YOVA 4NU6A 1ZHOA 4NMXB 3ZV5A 3I0MA 4LHVA 2JFZA 4RDXA 3ICWA 2IK8A 4MWDA 2GHRA 5CHYA 4LXTA 1IBKB 1CX9B 4JXKA 4F92B 3FGZA 3PPXA 4HMPA 1V7ZA 3CMCO 2AE1A 4XWWA 1XA3A 1FTQA 4R9NA 4I14A 2XY4A 3BWDD 4Z0HO 1OBVA 1TLFA 1GIAA 3I9V1 3WIDA 2RGNC 4BTVA 1GYPA 3K9WA 3SQOA 2QS9A 3VNAA 2GXAA 3IAAA 1JJ7A 2WZQA 2XEDA 1L0BA 4KH1A 3CKYA 1JLMA 4P83A 4WBSA 1L5HA 1EXMA 3O2NA 4IFIA 1F3OA 1O77A 4XWYA 2DKNA 4MAAA 5K6AC 4BNNA 1QDLB 4GX2A 4QNNA 2EGUA 1B43A 4D9GA 1EUDB 2NZXA 1A8SA 2BW0A 2V3VA 3AUYA 3KSUA 1TQ8A 1N0VC 2ABWA 2QORA 4ZI5A 4OU4A 4ZEOA 4ZCIA 4ZVKA 3TTYA 1KAGA 1S2IA 1L7DA 4H0FA 1XU9A 5CVJA 1QAMA 1AS0A 1TIPA 3U60B 3QKRA 2WJIA 3Q5GA 4LV5B 1R6VA 2IS4A 1P4JA 2BAGA 3GLHB 2IKSA 2VJDA 1M2VB 1HK7A 2O2JA 2V5AA 3KPJA 1BS1A 3Q6NA 4H7FA 4O0MA 1PN3A 4OGFA 4PN7A 2JIZA 3NDRA 3X1MA 2OQ2A 2RHLA 3A4TA 2XCOA 3UENA 5D00A 3JXEA 3L7IA 4BTLA 4XLZA 4OHBA 1W36C 4F21A 4CEHB 3H8JA 1Y0BA 1B8VA 4RH3A 3DMGA 1U7UA 3VPBA 4Z99A 1KGDA 5EZYF 2VHWA 3ZIUA 2NTJA 4NE9A 5IBPA 2X1MA 3T5AA 4TT8A 4WLEA 2O5VA 4M38A 3HP4A 1E79D 2P6UA 1RIIA 2HDWA 2NIPA 2QF7A 2YWJA 3CCBA 3EW9A 4JVNA 4QLOA 1QV6A 1TYBE 2FMHA 3DOFA 4PY2A 3GUVA 5EN4A 3CLRC 3GWZA 3NJ4A 2M32A 1GL6A 2IIQA 3DE7X 2HXSA 4RELA 4NPCA 5SV2A 1C4KA 5DB4A 4TMWA 3CG4A 1CEYA 1F4LA 4LECA 1K9VF 5BR4A 3IE2A 4EIWA 3UT0A 1JIQA 4CMBA 1CULC 3I0ZA 4UUPA 2XMPA 4X20A 2WSLA 4CLHA 3AW9A 4Z49A 1KDRA 3ZDDA 4K26A 3HJCA 4MHTA 1JMKC 2Q6VA 5EUMA 1YS9A 2I87A 3QWHA 4CGZA 1Z3CA 5CAEA 1ISMA 1DC4A 1ZZEA 1DUVG 3DR3A 5CG2A 1JEAA 5FBVB 4IRMA 4F93B 5L4SA 4OTZA 3DCJA 5F7ZA 1MIOA 1OLUB 4ALIA 3KLOA 2VJYA 2DSNA 4C2AA 5KEIA 2WR8A 5B6IA 2P9CA 1YAJA 3AV0B 1WEHA 2WJ6A 3NTRA 4FQ7A 2OESA 4TTRA 5EFOA 3GUHA 2ZYRA 5FOVA 3RBXA 2CXHA 1JJVA 3B9RA 3AKZA 2Q28A 3NV7A 3PXAA 4CWAA 3QELA 1EK6A 3FOEC 2J41A 2I1VB 1I0IA 1OIVA 4QZVA 2FSVA 3H2IA 4OXQA 3RFTA 1G18A 1KI3A 2AFIA 2JZNA 4CTOA 4MDEA 2RGRA 1XZAA 1DVRA 4IJQA 2R4UA 2V65A 3W77A 1XOIA 1I2CA 1V8FA 4C3ZA 3PICA 3QEOA 1P9NA 3G8CA 3TKAA 4ZVRA 1AT1A 2AT1A 3K71B 2BFOA 2B0JA 1A9QA 3MBIA 2HOQA 4ZT2A 1BFDA 1N8KA 3WLSA 4AJNA 2O52A 3LS2A 4ND7A 4DARA 3LT2A 5ISMA 3I1YA 4II3A 4AULA 1T4MA 3O4RA 4QGHA 4CI0B 2Q3JA 4GL2A 4MYTA 3RRYA 3GVXA 3T38A 1N9GA 4FWTA 3LBAA 3IP9A 5ALNA 4EX7A 4TTTS 4YLEA 2ORED 1HF3A 1QCDA 4CQMB 2JLWA 1N1MA 4QOGA 1AQJA 4B82A 3OZUA 4YRPA 4A3SA 1CDEA 3AIOA 2QY9A 5IN4A 1E9DA 4BLQA 4XAQA 1AQNA 1V25A 2NZ8A 2ZIUB 1F6WA 2OHIA 3C6YA 3N5CA 3S81A 2PE5A 4MUYA 3MSXA 3KJHA 4CPDA 3BJRA 3R0XA 2YKGA 4KREA 3LXXA 4TMVA 2KYRA 2XMQA 5KOYA 4KW7A 3V55A 4HAUA 1KR2A 2PUGA 4U7JA 1CFJA 2GZRA 2A9QA 4HDMA 4JR1A 4TTAA 1NBWB 3OCUA 1OFHA 1FFHA 4IM7A 1PGOA 3EISA 2X0DA 3PF8A 4MKRA 1NXOA 3A6DA 4OV6B 1KY2A 1FP1D 1WA5A 1Y37A 1ADCA 3N0XA 4X90A 4MDFA 3OP4A 1NT4A 4MITA 1QHIA 3D8TA 1OROA 4Y9SA 3WC4A 2BR5A 4UQPA 4BMCA 1ZXXA 5I3ZA 4JVOA 1TTHA 2VNJA 3E70C 1UBLS 4ONEA 1RTKA 1NXVA 1RXCA 2KLHA 1T5IA 3GB9A 3KL2A 3UMRA 4JEHA 4D81A 4D0SA 1PT9A 1MZVA 1RE0A 4L76A 4F5DA 5HPYB 2FGJA 2XQVA 2PRJA 1C3JA 1H0HA 4QTTB 3B6IA 4RLFA 4P2BA 2F00A 4YMUA 1YQGA 1KOFA 2IVZA 4WNYA 1JL3A 1PBNA 1Z45A 2HDHA 1UEXC 1PTJC 3GZNB 3NC4A 4G4SO 1QE5A 1J8DA 1L4EA 1G1MA 1IH8A 3AUTA 1ISJA 5DEIA 1DOAA 5ALFA 4CM6A 4QARA 1JAHA 3RAEC 2G88A 2HA0A 1RU3A 4ZZ2A 3SKXA 2DHEA 5EXEA 4XX0A 2A5LA 4O4JF 2O1SA 2PIDA 2CCJA 4FFNA 3UAVA 1BXKA 1YR8A 4HFRA 4HX9A 4AWBA 4DF3A 1A0OA 1X3SA 4KDFA 3RYCB 1MHTA 3ELDA 4F4JA 2NNWB 3OWOA 1WY7A 2B8EA 5IT4A 2EFDB 3QV2A 4M9CA 5JJ5A 1T6BY 3DV9A 1IUNA 1GRQA 1JT9A 1UBEA 4EYKA 4B32A 3WNCA 4EYEA 3S8YA 3FKSD 4TQ9A 4OXRA 1O94A 2PX6A 1A2KC 1C30B 1EUCA 5EKXA 3IXMA 4R51A 5KTSA 3IJRA 3K2IA 3TLGB 2D1YA 3SE7A 5C8YB 3PRKE 4MW5A 3OIYA 4A1OA 3QY0A 3FHOA 1GSIA 4OQQA 3VX4A 2K6GA 3IUSA 3FDFA 3OZCA 4OB8A 1K8YB 1E3JA 1KC3A 1RLMA 4MCIA 5H1YA 1GLVA 1YV9A 4JJ4A 2ZSHA 1P2TA 4R2KA 2H1CA 3H99A 1AKWA 2MSEB 3A1TA 4PONA 4QQNA 5EVCA 1H23A 5U4XA 3TTUA 3ZW8A 1MB0A 2VBGA 2R97A 5ER9A 2WSIA 5COAA 4IV8A 1SM4A 1PFGA 1BKDR 4KNVA 5C0OE 5JR3A 2C8JA 3AJRA 3ROKA 1J09A 4G5SA 3BXOA 1TUBB 2CDRA 2ZRCA 4H08A 4MKZA 5FO1A 5FYDA 5LQJA 1TTQB 1N3YA 2XCQA 3I6ZA 3FDZB 1QZXA 3UWSA 4UFNA 2XVAA 4Q9KA 4I1PA 3QVGA 1P9WA 1PDVA 4YRAA 4OH1A 4D92A 4G97A 4JC0A 1Q91A 3SI7A 4G37A 4H1UA 1K7XB 4H2DA 4Q4AA 4RV4A 2H7XA 1DE0A 1VLQA 5E7MA 3W34A 4TLDA 3LNCA 4J2TA 1GEEA 1CPYA 2ZP1A 4NU5A 4O8ZA 6YASA 4YJHB 1KK2A 1QHEA 3MOSA 3RYIA 4EQ6B 2V03A 3AKCA 1NONA 4E70A 1U0TA 4KOAA 1M1YA 1ULTA 1RFLA 4K5QA 4PGMA 5ALLA 3DDHA 1D6NA 2W2XA 4MRAA 1MW9X 1OFIA 2VNIA 3VRHA 1DKNA 3EN0A 2FPUA 5JG7A 2JKZA 2FQWA 2ZUUA 3RCBA 4OOFA 3U7JA 1FJ2A 2XUZA 1KJQA 3ETLA 4ND1A 3RABA 5IMSA 1FS6A 2DB3A 4WDRA 4J4BA 4QNRA 1QRDA 3PA8A 1OBHA 1UBKS 1SELA 4RVFA 5G4LA 3QFHA 4R9VA 2UXCB 5ILOA 4E07A 5AM2A 1QP0A 4QPZA 5TY0A 4EW1A 1KDZA 4URXR 2AZMA 1HC7A 2GAOA 1CWUA 2GVZC 1OPXA 3PCRB 2OWEA 1U7XA 1E9RA 1RI4A 3O6VA 1Y1TA 2TMDA 4G5FA 1Z7YA 3PNSA 1YCGA 2X6RA 4LV8B 3HDJA 5LU9A 1XRLA 3U13A 4ALLA 2QNBA 4F12A 4PZ0A 1F0PA 4URHA 5A0TA 2JAHA 1JEDA 5H80A 1K7EB 1UCFA 4FZRA 4IGKA 4AJLA 3A9SA 4RX1A 1YQTA 1ZJ6A 4R2IA 1WCWA 1IG0A 1LGYA 2XPCA 1EP9A 5C8VA 1P73A 4CKEA 3F6EX 4UUAA 4UD6A 2AMJA 1C9YA 4F06A 3X1XA 3L7JA 3HP1A 3QTTA 4J0DA 4BQQA 1AXGA 3BUSA 1KARA 5A2QA 3QPVA 1TMOA 1Y8ZA 3O74A 2O05A 3NFRA 1GGHA 3GEGA 1E9FA 3PWZA 3A26A 1OX4A 4YRIA 4AZ3B 4D6YA 3V48A 1W29A 4B81A 2PZGA 4QOSA 1KP9A 1NVUQ 1BXZA 2H5JA 1T9GS 3ID6C 3O8NA 1Q7BA 5AOVA 1F1BA 5BV8A 3FM9A 1M67A 1E5XA 1R6BX 2BBSA 3NO4A 4EGSA 4F91B 2GSDA 1D2CA 2H00A 4FBMA 1W8DA 1X94A 3EOAI 4LYGA 3SN6A 4EO9A 4NK5A 4FI3C 4WUVA 3ZHBA 5AXDA 4KZPA 2JBAB 3A9UA 3DJFA 1V5GA 4XLLA 2W2KB 4LC1A 3EZ7A 4B7UA 3V2GA 1JJAA 3EYAA 1G7SA 2JPDA 3ISTA 4JBGA 3B8HA 4DE5A 5JH7A 1EFHA 1MEEA 2FF7A 4HUJA 1XLTA 4UJ5A 5FOUA 4HB2A 3RV4A 1QZTA 3PGLA 1F6DA 3PFBA 2Y9MB 1CJBA 4NQZA 4LNUA 1M75A 1W85A 1ZR4A 1UT5A 1N92A 5KTNA 1GL9B 2PT7A 3GA7A 4PZYA 5CB4A 3F4BA 2NU9A 1QJ4A 3JAWB 4QVKA 4REQB 4XDYA 3LO8A 3S2YA 5A3QA 5BNZA 3OTWA 3ZHRA 4GOOD 4MV0A 3KEOA 4OHUA 5KVCA 3W05A 1E1RA 3HCCA 3TXYA 3TRJA 4Q05A 4BLWA 2PVCA 3AY3A 3TE6A 5D3ZA 3BQ9A 3KUCA 2G8NA 3EUAA 1IM8A 5EJ4A 2V74B 2P4HX 1UXJA 2JKYA 3U44B 3HDHA 5K3AA 2NO4A 3ZWMA 2H2WA 1OI3A 4JEUA 2FPPA 1IQRA 3FZGA 1OLOA 1Z28A 2LKCA 3BMOA 1KEPA 5ALEA 4K9SA 3KKZA 4C3OB 4LJ9A 5KSZA 2BI7A 2H1HA 4WXPA 4C14A 3OMXA 4CM4B 5LBTA 5DXFA 3R44A 1GUBA 1Y1SA 3JQ9C 3JQAB 2R44A 4PTYA 4DTIA 3RGWS 3KJNA 1NJ1A 1Q7RA 4LYDA 1T8SA 4JJ8A 1MX9A 1ICIA 5ALUA 2X76A 3CJRA 4GMGA 1MJGA 1ZCZA 1CUGA 1UDXA 2YIVX 4KV9A 3RJ9A 3KQUA 3OZXA 3B53X 1ZX1A 3NWEA 4CR6A 5I51A 2QA5A 4LXXA 2QUJA 5DT9A 1A5BB 3BA1A 2JK1A 4TV9A 1HQCA 1XL1A 2CZGA 2GBGA 2GFHA 2KWIA 4LMAA 2V8OA 4U4AA 1Q16A 5DVZA 4FM9A 2B30A 1RWQA 3HZOA 3MTIA 4HWOA 2A0YA 1GPBA 3EMDA 3QVLA 3DLBA 1N1DA 2AG0A 3QZUA 2PJDA 2EKZA 3MINB 1QH1B 3FE2A 5BXYA 1FSSA 2P79A 3NHYA 2QVCA 3M70A 2P62A 3QKTA 2Q49A 1R4AA 3TUZC 3FNQA 3OM1A 1NMEA 4H4CA 1PW5A 4FLMA 3Q9NA 3IAUA 1IULA 1VFNA 2PZAA 3P9RA 1EEHA 5GONB 1ISSA 5NULA 3AR7A 5EXDA 2HMSA 3L6BA 3NZEA 5AKLA 2RB5A 4DADA 1NDQA 2ASVA 3NORA 5KSWB 3TSWA 5FOSA 5CVUA 3MYRA 1AE1A 2IHBA 1E4EA 2R1UA 1AHNA 1SCUA 2QL7A 5L3QA 1NJ6A 3FUXA 5E8RA 1G8FA 5IAOA 1OHHD 3P0EA 4HDRB 3GRVA 1RHRA 1JUDA 1GQYA 5F2KA 2R6ZA 5HW0A 1UXGA 1L5KA 3HMKA 5D6OA 4KN8A 4E88A 4RL4A 4KRYA 3OCJA 1SKUA 2YY5A 1PWZA 4PZAA 2G4VA 2J3KA 1G6HA 4PZCA 4UE6A 5EG5A 1E66A 5D7NA 3SE0A 2NT3A 3NAZA 4MVJP 4HYQA 5CVVA 1G8PA 1UDAA 5JMOA 5KKCA 3ROPA 2D00A 1GWNA 2A14A 2IOQA 3QKWA 4MS1A 4QC2A 4BLUA 3BJEA 5J2UF 1W47A 3F98A 4KG7A 3ZGLA 3G89A 2A0XA 1YULA 1TKBA 3HUFA 2CXRA 4F3YA 1REQA 4U63A 1UINA 5GJCA 5JEDA 5SYAA 2RGYA 3PQEA 2VRNA 3TQTA 2C8KA 1X19A 1OXMA 1P61B 3GUUA 1SHLA 4OQYA 4YJ3B 3IQDB 5B1HA 3ORQA 2GK3A 2GM4A 2JCXA 2LIVA 2XHZA 4F2WA 1UQUA 3G9XA 3F49S 5E6RB 3K05A 4JFAA 1Y6JA 2PY6A 3IP3A 3L1IA 4F56A 4RJKA 1K0FA 1YI8A 4DYDA 5KOHB 4PZ9A 1PL0A 4ZTBA 2R62A 1IMJA 4OMCA 1ZGCA 4JLAA 1NUPA 2EFGA 3DP9A 2C0CA 2EKLA 3A06A 4HQ6A 4YPVA 2PXXA 2ROQA 3Q5EA 1Y6QA 3N2ZB 4BX9A 3O8OB 5CR9A 5BSVA 1VB5A 2ZT6A 5AXCA 3MXTA 1A7KA 2I7XA 2R5WA 1TA9A 3E2IA 4ND2A 1DUSA 1NN5A 2GK7A 3RAPR 4MV3A 3IIKA 2A57A 4HFMA 3GK3A 2HQOA 2FKNA 3OPMA 4O5OA 3LKBA 2P77A 2KE5A 4XM1A 3RD5A 3T9FA 2BFBB 3L79A 4JP1A 2XDAA 5KYUA 4KXMA 4BV9A 4LPSA 1KI7A 4H1WA 2WYHA 3DR5A 3M6XA 1BMFD 4FGZA 1GKLA 4RQAA 2R25B 2KW5A 1TF2A 2JLYA 4EJFA 4KPYA 1UM9B 1FPMA 5HZMA 4UUOA 2HY7A 1JS1X 1PHRA 4Y2RA 3L7CA 4ZVPA 2XUIA 5H3CA 5BSWA 2PSSA 3TLYA 1R6XA 4G1MB 5AM0A 3F67A 5AVKA 4ESOA 4OLBA 5ALDA 4X1YA 1RHKA 3GU3A 1MC4A 3NGMA 4TKLA 4GX0A 4BE7B 4FT2A 5IT0A 2P5SA 2CJPA 3GLGB 1DEOA 1JU3A 4PYLA 4U1RA 1E0JA 1P62B 3T12A 1XZLA 2IE0A 3EGDA 4KMSA 3W2IA 2R1ZA 3JQQA 4G1VA 4ND4A 3HCAA 2QM0A 1ZJ4A 2X7HA 5FR2A 1E99A 5CXQA 3KC2A 2K7FA 1X80B 4KO2S 5F64A 1E5DA 4G25A 3RTBA 1R8JA 2NPFA 4B5KA 1RCUA 2DJIA 2R6CA 3EAQA 3LVQE 3MF4A 3Q2KA 4KQ6A 1ZN2A 4PC3A 5E95A 1L5WA 3ULKA 1U6JA 5I5EA 1W30A 4V39A 4Q4LA 4LOLA 1T9HA 2W90A 5BY2A 3ADOA 1X7ZA 4CCYA 2H9YA 1Z36A 2VP3A 4NYJR 3HN7A 4M1MA 3PD1A 1Z2DA 1NVBA 4IEFB 2CSXA 2I8LA 5F5LA 2RHWA 1SG0A 4HWKA 3SGLA 1EFPA 1OLXB 5BT9A 2C4WA 2WG2A 3VAZA 5A4KA 1E9CA 2C7RA 1K7CA 1JHQA 3W2TA 1HH4A 1GNQA 5HF6A 3E35A 4YACA 3UOGA 1RYBA 2Q8QA 3A11A 4GRIA 1IY8A 1ZC3A 3NHMA 4J0EA 3EGXB 2GZDA 1JQEA 1N5MA 1K3UB 3QXCA 3M49A 5MGNA 5K0CA 1J0AA 1CXZA 3W0LB 1TO2E 4ALJA 2NX2A 3TO5A 1FVHA 1EZ1A 1F2DA 4P3XA 1SIUA 1P18A 2CFRA 3Q0TA 2Q0SA 5C8ZA 3HVKA 4B4DA 3V1NA 5KTTA 1X70A 4UVGA 1B6TA 1JDJA 1U2RA 3V8QA 5KVAA 3IILA 3T7DA 5B4VA 1PRYA 2HWWA 1VPTA 3SC6A 3CPJB 2PX3A 1KMHB 4GP7A 521PA 4JBIA 5C53B 3IV6A 1A9XB 2C2BA 2XOEA 4MP8A 3HJAA 2O07A 3O75A 2I2WA 3L6RA 1SN7A 1RXUA 3HEBA 5DF1A 2X0IA 4B17A 3IHLA 2O59A 4MVJI 3ED1A 4A8HA 1A1VA 1Q7TA 2CL7X 5LN1A 1CY2A 3E5NA 4WKBA 5ED0A 2QLTA 4XRRA 2E4VA 3DC7A 3IIMA 4WXEA 4LRYA 3ZHZA 1B8NA 1U28A 3TW4A 3I73A 3G17A 4HZGA 3RLFA 4QJBA 5JANA 1EIWA 3NYIA 8ADHA 4UU8A 5IJWA 4NOKA 5DLYA 5JAHA 3LOUA 1NJ8A 1MT3A 2I4NA 4FYXA 5ARDA 1T13A 3EIHA 3HCRA 4E22A 5DW3A 2GCNA 3DAFA 3RVBA 4B9AA 4DCSA 1EJ0A 4URUR 4WGFA 4LJRA 3SHWA 3ZC3A 5BO5A 4N7MA 4QUBA 3MQ4A 1CJSA 1XLWA 2HMAA 2HHHB 2RJOA 1NFRA 2XA1A 1HV8A 2E87A 4JBYA 2M1XA 1EKXA 4F3CA 1JSXA 2FPMA 1HYEA 3TQIA 3S2IA 3S2UA 4TXLA 4GIBA 2YWXA 2W0SA 3BYZA 4PGAA 5G0SA 4IZOA 2OHHA 2Q2NA 4HN2A 6LDHA 3AKDA 1OH5A 5EWLA 3DQZA 2QVZX 1G4HA 1BMTA 1X7YB 3KT3A 3IQGX 4UAJA 3DL0A 5CYPA 5G41A 3R9IA 2IPAB 1SHZA 1U8EA 4YRDA 4CIBA 3CG0A 4K6CA 4CGYA 4E3ZA 1FRFS 1UL1X 1Y42X 2WJWA 3I5AA 4KQJA 3Q8MA 4I4LA 4C0QC 4E6EA 3H05A 1U2QA 4BO2A 3NYRA 3OZGA 1H69A 1Z5PA 2HSGA 5HILA 4CTMA 4OQNA 1VJRA 3U4MA 5CX4A 4KQWA 5AI9A 1TRKA 4X7RA 3DQQA 4JX8A 4REQA 3CUTA 3OLWA 4Q19A 2ZREA 4ZQEA 4JQOA 4ZV4A 3TLAA 2Z1DA 2VJAA 3A9RA 1Y3IA 4P8RA 2WHPA 1TJYA 2RMKA 2NQ2C 4RSHA 2F9FA 4IFEA 1VE5A 5LOVB 2EJWA 2VWPA 1LLQA 1Z47A 3HJTA 2XYGA 4U7HA 4PF1A 2FSFA 3N8KA 4KSYA 2PLRA 5AVSA 3WIOA 5KYNA 2OAQ1 1WULS 4EF4A 8AT1A 2HF7A 1SVLA 3FKSA 5BOSB 1K08A 2ADMA 5HKKD 5LFAA 4Y30A 4N3BA 4XSVA 2AOVA 3HCPA 4INPA 2NTVA 2XUKA 5JXIA 5FLYA 4H15A 4TLLB 4MH0R 1ZRMA 4IO0A 4AMVA 4AWAA 2AC7A 3UFXB 1RKBA 3ZKWB 2VJLA 3PNQA 1P60A 3HUUA 3MZ0A 2ORIA 4G1UC 1JPVA 3U3ZA 4WCFC 2CUKA 3IUQA 4U3JB 2C9OA 1MGPA 1FU4A 4MCJA 3K0FB 4MEAA 1OBFO 3VYVA 4QDXA 1OC2A 2PHZA 1HNNA 3WGHA 3WQSB 3H5OA 1PZEA 5B2FA 1G38A 2Z2ZA 2J87A 3BGVA 2HIGA 4C0KA 1H2XA 1U6IA 2ZR0A 3D5QA 4WOJA 4E94A 4ZKDA 5BWMA 3STTA 5CVEA 2UYGA 3VZRA 3DJYA 4MUIA 1WDKA 3MJDA 1TJPB 1KEZA 3V80A 1U1IA 1IDOA 1T43A 1T5TA 1XYGA 3DEHA 4XJSA 5IKPA 3VZQA 3Q7RA 3C3WA 3DULA 4ZV9A 4BDSA 2ZK7A 4CKYA 4EOGA 4CIYA 5JSQA 2FW1A 3AF0A 5C1DA 2X2FA 1JJBA 3PKIA 1PJRA 2GUWA 1Y4AE 4WK2B 4EKNB 2ZATA 5KTYA 3VO2A 3G0IA 3IDSA 3HS3A 5IK2D 2OO3A 5KAPA 1EGAA 1XC7A 2HA5A 3DYVA 3LHKA 4I50A 4K6OA 4YHBA 3WB0A 2GBLC 2FPGA 1DEHA 3PXDA 5J1SB 1E60A 2V6FA 3AGQA 5F78A 4H17A 2GBCA 1G6OA 4J1NA 1Z39A 4L73A 5AJXA 2OGSA 3UXMA 3UBTA 1NE2A 2DWUA 3D4LA 2WAXA 3OBBA 4DIOA 3FPKA 3GHYA 2XNCA 8GPBA 4JJKA 1T2VA 1KBZA 2C3YA 4DREA 3AC0A 3EXEA 4H6PA 2YWRA 3TLXA 3LSTA 1SULA 3U3KA 1MQ9A 1FMLA 2Z3ZA 4WNIA 4D4IA 1XEXA 1A8QA 4KV7A 4EUSA 3IBFA 3BWXA 1DQNA 1KRXA 5H83A 2JBWA 3FNEA 3IULA 2BL4A 2QRZA 5AI0A 4BZPA 2EF1A 1RYFA 3WADA 1UBNA 2QL9A 4M0CA 1KS2A 4OHFA 3MS7A 5A7GA 3G2LA 4WLNA 4KXYA 4KXQA 1POWA 4NDAA 4DR3B 4AZ0B 4B2IA 8OHMA 1GNVA 3FPLA 5FO0A 1L5YA 2D5LA 2FWRA 1G7RA 3T34A 4DSAA 3BZBA 3THYA 2WZCA 4WLOA 3W8DA 3H9JA 2WD9A 1RM3A 3CKKA 4J91A 1PJ4A 2YVQA 1YKGA 3FOBA 1S3IA 4IHAA 2EXXA 3OLQA 4R68A 2VPXA 4Z2YA 4JBHA 4C0LA 4CQLB 2OVFA 1GHTA 3ASUA 2HQRA 3A6PC 2AL7A 3WV5A 3L02A 3C6ZA 3HO6A 1YU9A 3OZBA 3BKXA 2B1IA 4QGGA 3QXSA 5DNDA 2PEZA 3HKDB 3QE0A 3TEMA 4WLVA 3SF8B 3CCFA 2DE0X 3FDIA 1RWKA 3L9WA 4KU4A 1WXXA 2CDBA 1JFFA 1GR1A 1BS2A 4U39A 5CYOA 3WGZA 1JTEA 2H1VA 3GAAA 4Q4DA 3W6OA 1OMOA 3WYEA 3OBIA 4LJYA 4B48A 3IR5A 1IM5A 1YHZA 4WZBB 1OVGA 1TCAA 2YJTD 1MB9A 2HUPA 1W46A 3E7WA 1TKAA 3NT5A 3LUAA 4N5HX 1E1CA 1BX1A 3KPYA 1KP3A 1XQ1A 3F5FA 4H6XA 1UXHA 2ZULA 1VJ1A 4XQ0A 5JMTA 5HZKA 4NNPA 3AF1A 5H82A 2WF6A 1CUEA 2YVLA 3WYDA 5WRFA 1N7GA 3W7VA 3DOCA 3B1VA 1FFXA 1Q0QA 1QVWA 1E4VA 4QJ5A 1NW7A 5FLXA 1W5FA 2I5PO 4G5OA 1MR3F 2O3UA 2VC2B 3F4LA 1ELOA 1C4OA 5C1OA 3WLAA 1NASA 2BKUA 3EZLA 1W5TA 3A7EA 4RF4A 4PG5A 4G09A 4WY5A 2ZCUA 4MULA 2JI9A 1CTQA 1T5BA 1H0KA 3CPSA 3PC3A 2FG6C 4M9XA 4CG0A 1D6JA 1GPUA 1VE1A 3BDVA 3AFGA 5LMZA 1WMFA 2BEWA 4JR2A 2B83A 1XZ8A 2C82A 1ZMRA 3QNWA 4MPDA 4OOEA 2P78A 5TARA 1KYWA 4A0QA 2R96A 4RXTA 3TOSA 4BVLA 3FYCA 1ECLA 3CZAA 3E48A 4BB0A 1JAXA 5BW4A 4FYPA 2G4CA 1SBTA 3KAPA 1S8AA 6REQA 1WUHS 1CQZA 1TM1E 1J2YA 4ZU6X 4MI6A 3AT1A 2K2WA 1N3BA 1XWIA 4F1JA 1KAOA 4HO1X 2NGRA 3EFHA 1ESMA 3AOGA 1PL6A 1ADBA 3T5CA 4EMTA 5D3MA 3RVMA 4ARIA 5ITZA 3PPYA 1ZMTA 3BMNA 3CN7A 1YVRA 3V7YA 4CL0A 4GM1A 5B4UA 2QE6A 4EX6A 5H0IA 5K99A 3L43A 1AV6A 5EL0A 2ZB2A 1EAMA 1VDZA 5JARA 3OZEA 1T1EA 4EJ0A 1ZEJA 4E0BA 3HNOA 4YXWD 2Q3LA 2CV2A 1KJYA 4JI1B 2H2GA 1K8RA 4FYIA 5FA8A 5AW9A 5GAJA 2X3FA 4HEHA 3O4GA 4OP2A 4UPDA 2ZJ1A 5E3JA 1D6MA 1UBOS 3NHKA 2FZEA 1Z74A 3F7OA 4IFTA 2C4HA 4WBNF 3MM4A 4C78A 1EM8A 3BHJA 4BZQA 3LBFA 1O7JA 3A9CA 1N2CB 2YHIB 1JGTA 3AV3A 4IIJA 4QRDA 1IATA 3K6RA 3EC1A 4KK3A 4YT2A 1U63A 2CXNA 3G5TA 3H42B 1Q21A 2D5CA 3C7DB 1HFKA 2R1TA 1M83A 3F3KA 1ZN7A 2G9QA 2XB4A 2IUTA 4YUVA 2H2AA 1IBSA 4FHZA 4Z4HA 3PC8A 3PLNA 2WTUA 3CX7A 3OZSA 4OI2A 3E22B 3T61A 2C1ZA 1XMVA 1YIDA 4M6WA 2IIPA 3VJLA 1Q6YA 2ERCA 2JAOA 2QX8A 4MYUA 5EWMA 2QSZA 3ZQUA 1SUWA 2H1WA 1J70A 1R4NA 3GLUA 5HQ3A 1ORDA 2AZDA 4NCBA 2H31A 4P31A 3FIUA 4AS2A 4WKOA 4YJ2A 2Z04A 3E18A 1KI9A 1WLYA 2WU4A 4BN5A 3MT0A 4EI9A 3DW3X 4CF5A 3AU9A 1L7OA 1G8GA 2P4UA 3LI2A 4GLFA 4I5EA 2X7JA 2A9JA 3R20A 4I99A 2NUPB 4ZAXA 3BGDA 2ZJ5A 2V4ZA 2J46A 2A84A 4UBNA 4PQRA 3T7KA 2QQGA 4I8XA 1B6GA 1SURA 1SUCA 3UHAA 3JYNA 1CZKA 4BNZA 1JI3A 1XCBA 3GLGE 3KOYA 4QL3A 3FX2A 3PB3A 5HIKA 5JZOA 4NEHB 3M6UA 3IE1A 3IUMA 1S8FA 3DOHA 2LCIA 5EIFA 1VLJA 1OHHA 3QWFA 2GBIA 4LZZA 1TA0A 4K3UA 1LX6A 3BC1A 5I9SA 4G8BA 4UPVA 16PKA 2Z09A 4UVDA 3KTOA 3WDLA 3WJ2A 3ZJUA 1W44A 4BEVA 3IBTA 4G0ZA 3TGPA 1HE8B 3PPVA 3FNRA 4D44A 3UJCA 4NVRA 5HCUA 2HO5A 1LDYA 2QTVA 2CEAA 4HDNA 4HLUA 2UU9B 1VFPA 3MCTA 3QFTA 2R8RA 2ZWVA 5GM1A 3ZI7A 4DJEC 2GNOA 2XSZA 5C7OO 1GV0A 1R6AA 1I94B 1RLJA 4FEEA 1UIRA 2WINI 2BF4A 3HR7A 4WNAB 4Q3OA 4D8YA 4M21A 4OGWA 3TTTA 3MEQA 4CQNA 3SYLA 5FD8A 1UZAA 4TUYB 2G9RA 1Z6PA 4R98A 3ABOB 1TF7A 3R9XB 1PR3A 4V02A 1PX2A 3KYCB 3UV6A 1DKQA 2J3JA 3RUCA 1E2FA 3IOCA 1FYEA 2YQZA 1NNEA 1CRPA 1VRVA 1R1DA 4IEIA 3EGCA 3CZQA 4WDQA 4BJ3A 1M6NA 1YB7A 1JHUA 1YO6A 3QLJA 1X1DA 4M88A 4KWEA 5HIMA 3ZHCA 1TCVA 5E2AA 3ST7A 3TQHA 4EKYA 3GFFA 3U7GA 2FMTA 3ZGOA 1GTG1 3AFOA 3K1AA 4CMHA 4UTVA 4DEYA 3I5XA 1ZYUA 4H35A 3QPDA 1NR7A 2JH3A 4KFRA 4RIIA 1ADGA 1JE0A 3ZK9A 2KLBA 2J0UB 3BIOA 4X45A 3SXUB 4A9AA 3UMCA 4L74A 3AVYA 3GGPA 1N2SA 4D0RA 4CLEA 2C04A 4CEIB 3MMNA 2BM9A 3BD6A 3E3MA 3AUKA 5E3HA 1EUQA 4A6XA 1MENA 4ETIA 4QU8A 3JQ7A 1M0TA 1QLJA 2M6LA 4YAKA 4D02A 2CD7A 2XZDA 2CMHA 4HQFA 2ZT5A 1LF5A 3ZWPA 4IRUB 1BMFA 6CHYA 4KEAA 4XYBA 4RWEA 1DIAA 1C9DB 2I80A 5ALIA 2QQFA 4RJLA 4FGUA 2Q5IA 3DBRA 1K8ZB 4NWIA 4V0MA 1JB1A 5D84A 4EUKA 5IXJA 1J0EA 1HSOA 2C4NA 2WJZB 3MTEA 2CYCA 4GNKA 1UF9A 3OY2A 2JFOA 4HNVA 3D7MA 3AEQB 3WL5A 4FFVA 5FL7A 1E2UA 1DAIA 1TNDA 2HGZA 2VZ9A 5GVSA 3TIFA 2I6SA 4POOA 2RFLA 2AR0A 4EY3A 4R0MA 2FDCA 1GV1A 4FGJA 1RABA 1NYTA 5E0OA 1GPDG 3VR6H 3ZTWA 3B1JA 5CDGA 1X9GA 5J5CA 4C21A 4R1UA 4DCJA 2P5YA 3U5TA 1OYYA 3ROEA 4A2QA 3MTJA 4GYJA 5TF0A 3R5XA 3PIIA 3G59A 2VTBB 4HWTA 3HB1A 5F52A 2HT6A 2HMYB 4I8DA 4DMFA 1CUYA 1M8FA 4L4YA 5EIXA 4G23A 5EJEA 1M54A 3L8FA 1JEQB 1W5BA 2RB4A 3E9MA 5ILGA 4KWTA 5JAPA 2AOTB 4YDRA 1AX9A 2P9QA 3C70A 5AVTA 2G08A 1V47A 3W6NA 2MSWA 3OLYA 3R3ZA 3JY6A 5COBA 1IWOA 1ZVKA 4E14A 1G20A 5CEFA 4TSKA 4P7BA 2PKCA 1PZNA 3WGOA 1FUIA 4WPGA 2CLEB 3GVIA 4FIZA 3HUEA 5DE3A 3I83A 2JH9A 4YMLA 1LC0A 5L9AA 1W4AA 1NUHA 2BP7B 2CB9A 2EV9A 2XOXA 4W5TA 3AERA 2JGFA 7MDHA 1QUFA 3C14C 4DLYA 2DLNA 3RU7A 4CKCA 5K6TA 3F9IA 2XZOA 1AK2A 1NP3A 1RW4A 4HHEA 1AKYA 1YR6A 3QEMA 5AIAA 3SNHA 1EDZA 1FDWA 3QHPA 1ORHA 1W75A 4B3XA 1XJCA 1XNRB 3JASB 4RZ2A 3DO6A 1U02A 4MB2A 4A26A 2FQQA 4OFZA 4QO8A 4YMSA 2CE7A 2FGKA 1Q0RA 4A23A 4EB3A 3K2EA 4MWTA 4BGEA 2OGZA 1HUQA 1DT3A 2PDAA 3AM1A 4MP6A 2VJBA 2JI7A 4G5GA 3L7MA 1X8XA 5LQSA 3ZV3A 3PR2B 4XWGA 1MP0A 1NVTA 1SG6A 3ZHSA 3PFCA 4QHSA 3DAGA 1Y5RA 2FCAA 1FY2A 1F8FA 4TTQA 1JNXX 4FYHA 3SX0A 1NW3A 1YDWA 1TADA 4D9EA 3QLVC 2FK8A 2JARA 3ZDRA 3B6MA 1FX0B 2EWWA 2OFWA 2WUEA 3NRJA 3LA8A 3GAFA 4KO8A 1E3EA 3DZFA 4BMDA 1Z0KA 3VR2D 3TEJA 2OFFA 2W2NA 1KH3A 2PUVA 3QWAA 4XA8A 3E9NA 4A8JB 1IEVA 2VK2A 4B8WA 1O8BA 3PLAE 1JJFA 2H3HA 3UKOA 3ECCA 1BW9A 1CBUA 1T0BA 2QJOA 4JNCA 5LZ7A 5BSFA 1Z25A 4G9EA 1TM2A 3WBKA 1PFKA 2BFWA 4AJJA 2G4LA 5HGXA 1S5PA 3LRXA 2HCJB 3EBLA 2GZAA 5EJIA 5DKFA 4EB6B 5BP7A 4FT4A 1HGXA 4L2IB 4LEIA 4IW3B 4N9QA 1KAHA 4ZAVA 4B47A 5L95A 5LKAA 3LW8A 4CM9D 5LIPA 1A9PA 3DD5A 1G5QA 2DTXA 4EHAA 2J5XA 3D6UA 4NCAA 4OHCA 4GLJA 1HDYA 5AKEA 3BMCB 4BPRA 3ZH2A 1BJTA 2RHBA 3BHMA 3KQOA 1QPBA 1GSOA 1VKZA 1Y7TA 2CMGA 4BIMA 1IXYA 4YAOA 4RFSA 1RADA 2HF9A 3CPHA 4DJTA 3Q7TA 3KU4A 3ZE9A 3UJ7A 4FFOA 2VL7A 3G5MA 4N3AA 1AURA 1BVYF 1GZ5A 4IOKA 1X1CA 4QEDA 2BFEA 1K6EA 5DNEA 421PA 5F9MA 1AA9A 3SC2A 2HRZA 4A92A 3OUUA 1CQJB 3B8EA 4COKA 5I7FA 4UDXX 5ADUS 4JJGA 2H3EA 5DWVA 3TVDA 5ICMA 3NETA 2RBGA 4MQEB 4TM7A 4LNHA 4LYYA 2CLOB 1XZBA 4W9MC 2M9MA 3HRHA 5G2OA 3RRMA 4MA5A 4RLQA 5ALPA 1O6CA 4U7FA 5CW2A 2GN4A 3V6MA 1QVZA 5EJ8A 1GADO 1MG5A 3GCWA 5HYVA 1M8GA 2JFBA 1RKVA 3WGYA 1D4AA 2P3OA 3F2IA 3OPNA 2OILA 3EXFB 3STWA 3WWCA 2DPGA 5B3JC 2YWDA 4P38A 5DM1A 1U8XX 3H2KA 4AP9A 2BVNA 4MI3A 1ORVA 1X38A 3QLTA 5IM4F 3MJHA 1KKLA 3SHQA 1O0SA 3ADPA 2CL6X 4N5MA 5HKKA 4RSGA 1TKCA 1HEYA 1VJGA 1QOQB 3NBAA 1DKLA 1PK8A 3X44A 4J1QA 4I4CA 1XDDA 2VRWA 2PGIA 3OQJA 3H2BA 3P2JA 2WK1A 2XUFA 2SKEA 2IHKA 3COVA 5JPIA 4TZTA 6GPBA 3IESA 3D31A 3QTBA 4O1IA 1V4VA 1P7ZA 2CLLB 2DUUA 3ML1A 4NBTA 3WWZA 1GA6A 2ZBEA 4DUPA 4E2YA 5CFMA 2WSYB 1NJFA 4EGJA 5TQ0A 5K2OA 1RR6A 5AKHA 1PZHA 2YFHA 4IVPA 3FKQA 2QAIA 4XTRA 4DNPA 1NM5C 4L5CA 2A5YB 3HB0A 4D8WA 2IZ1A 5EIBD 1DAEA 2P2LA 3BTUA 2QL6A 4Y9RA 1Z5ZA 5L40A 4WZBE 4IQGA 4F60A 1IHPA 4YP1A 3RTGA 3GELA 2JLUA 1FJGB 4TTIA 1U0BB 1E6UA 4XLTA 4W5WA 4EZIA 2I4IA 1EP2B 3IX7A 3PBKA 3RU3A 2XDWA 2HK7A 4OEHA 4OJMX 2O20A 3KLBA 1ZNZA 5FWXA 2EGHA 2QQ5A 1H9BA 4H7KA 4B1FA 5EOVA 5D85A 5BVHA 3TMAA 2GR9A 3KEGA 2J9RA 2HLHA 3DO5A 2HLNA 2X8LA 1MC5A 3OSUA 1XMPA 1CY8A 2D7JA 4M0PA 5EIWA 5IK2A 2PUBA 3ZE6A 1DADA 1SG9A 1YASA 4I9UA 3PDIB 5LP6C 4A2CA 1G5RA 3IDZA 3T5PA 3F7NA 1RLIA 1DRJA 2AG8A 3ONFA 3CXUA 4HQRA 4OJQA 4S24A 1NI4A 3QVJA 3SXPA 5FPYA 3RHSA 1HXHA 3N2EA 3IP8A 1DO0A 1P3JA 3C1TA 2NSYA 5K9ZA 3DNFA 4LHWA 2O14A 4MJXA 1CZUA 1RWWA 4KLNA 1R16A 3BFJA 3OZWA 1NVDA 5BN5B 4UMFA 1Y48E 4FMCF 2CVOA 4H27A 2ZT8A 3S4YA 2AX4A 4KXFB 4RTQA 1J8MF 3K09A 3WP1B 1M2WA 1NBIA 2W4IA 4YAGA 1ZI6A 3PG5A 1J49A 3P9NA 3ET5A 3D3NA 1US8A 3N59A 5KNBH 1VMIA 2GAIA 2IYZA 2M6KA 2AOUA 2XNDA 5FWYB 1ECCA 1GQSA 1Y8RA 3ADKA 2YS6A 4ZJZA 3HHEA 2IIBA 2A92A 2OV8A 2MSDB 3IRVA 3FB1A 3IUBA 2PUJA 2OE2A 2DVMA 2R11A 3V7FA 2BZSA 5JZ9A 5F3DA 4PFKA 3T7CA 3BBLA 1E7QA 1NPDA 4AY6A 3QXGA 2FPOA 2VF5X 1PUXA 3CO5A 2R8ZA 2WYVA 3NC1C 1F0NA 4NZYA 4QDUA 2Z43A 1N2CE 6PFKA 3KEMA 4GEGA 1OILA 2CHUA 4A73A 2WG0A 1MB2A 4M7PA 4LXQA 2IA5A 1QH8A 1BFKA 2LV8A 2PKQP 3GN1A 4HGOA 2PKYX 3VBEA 3WDMA 4HGNA 3AEKB 3C74A 5EMHA 4CN9A 5CDUA 1UC5B 3H5TA 5GJBA 1O9BA 3JWJA 1II9A 4KBYA 3RFUA 1NXQA 3REGA 2G7MC 4QUEA 5ER6A 5JJIA 4PVCA 3GUZA 4X1IB 3ETDA 3UCXA 4NG5A 1U8TA 3WJ7A 3EFOB 2X5OA 1ND5A 3OG9A 1HZZC 2A9FA 3GQBA 2QLNA 5G0UA 1B8OA 2P2NA 4O4HA 5AUPB 1M5UA 1H05A 1SCKA 2VKTA 5CB0A 4IZIA 4OX9B 4TRJA 1Y1KE 4YUWA 4Q3BA 3CRZA 4YLGA 2VT6A 4JYZA 3AETB 2EWVA 5IJXA 1BHJA 1NVMB 1U9ZA 2Q62A 5LA6F 1UBUS 3W5JA 1H0SA 3H17A 4DA8A 1QH9A 4BO9A 3BSWA 3BVPA 2DFLA 2R00C 3F6CA 3FPCA 3GI1A 1OREA 2ZLBA 3HBLA 3NV9A 2A5FA 3OX3A 3PQFA 3T5MA 4EW2A 4PYKA 5E6UA 3JD0A 4UXHA 3VYWA 3B3JA 2Z6UA 1Y6RA 2BFNA 4A1FA 2I8CA 1T8UA 1G3MA 3AJ8A 2BH9A 1LK5A 4NATA 3OECA 4CT0A 1QZUA 4U2DA 1Z5GA 2ZB3A 4DJ5X 2JFVA 3FNHA 3KKOA 2ILVA 1NBMA 1E8MA 3C7AA 4C0XA 2BMVA 2Q4OA 3AKEA 5LYYA 3TX2A 4TKVA 5CCXA 4FLEA 3E1SA 2FN9A 1LJUA 1ECGA 1GKYA 1N75A 4GS5A 4HK4A 5HRAA 2QT1A 4L0QA 1LC3A 2NZ2A 3UMSA 2HM7A 2H1IA 4KDEA 4X3CA 5CFRA 3RG2A 4UOEA 2E3JA 1HDEA 4MI9A 2EKQA 4LHZA 3MOGA 2YWEA 4V2IA 3PCXA 4D74A 4Q47A 1MO4A 4ZO9A 3BSSA 2F9LA 4PSUA 4OI1A 5A1TA 1BCRB 4Y9TA 4NBSA 2GAFA 2WD8A 3S2ZA 3T7SA 3LX5A 1ULHA 4BU1A 1JDVA 4HTFB 4D57A 3BCRA 4UZEA 3IUEA 3X2SA 4YMVA 1W8IA 3D3JA 3IOEA 5LMCA 5DYWA 3UTCA 4PIMA 3TB4A 3UT5A 4L5BA 5JAZA 2ACEA 1CSEE 4DVJA 2Z8YM 4KHZA 3JZAA 1CLUA 3EDYA 4HNSA 1JLSA 3DTTA 4NYJQ 3TLGA 3EASA 1PKXA 1ZA1A 4N8SA 4YDSA 4AUEA 1XZKA 3VVBA 4LXYA 1Z2CA 1QHFA 4LJ8A 5F51A 5JD3A 2QROA 1FU8A 3RROA 4RMGA 1QO0D 3OZVA 2VWHA 2IIVA 2RHJA 3QFSA 5EYPA 4UNRA 1F2UB 3K9NA 3BE8A 4JL8A 1AB5A 3UJ3X 2JLBA 3GFOA 4OUDB 4CV3A 3FYSA 3GFTA 1N0WA 5JMPA 1J0CA 2V7TA 2I34A 3RK4A 2CD9A 3TEFA 4I66A 1BWQA 4KR0A 5IJZA 1U94A 3CH6A 4H7EA 4PHHA 2J0QA 1G4UR 1X2BA 1I2MA 1ACMA 3QOFA 1XQ6A 2QJFA 5TX7A 3DXFA 1FTWA 2CXXA 1YCDA 3KB6A 4FNGA 1ML4A 5IJ9A 2QLBA 3CB4A 1WVGA 5JVDF 1D4FA 1WZNA 3B3FA 2NXNA 3SZOA 2G63A 5A5FA 1W2WB 5D86A 5LQCA 1PHPA 2RI0A 4UAGA 3AVUA 2J85A 1O4VA 5GIOE 4PANA 4EVIA 1QFJA 2OCAA 3HYNA 2X3UA 2HHJA 3HYSA 2BLNA 2RGXA 2QPAA 1EVQA 1OE0A 1LSJA 3CV3A 3QBVA 4WXMA 3AW8A 2ORYA 1DC8A 3WL6A 2C95A 1KEEB 2G5CA 1ZGAA 3WE7A 1V35A 3QPCA 2WSBA 3SC4A 2PTGA 4KKVA 1R4MA 1XMJA 2PBRA 4RZHA 1RQRA 6REQB 2V54A 4V0NA 4DLKA 2NAPA 4KQEA 4G81A 4YJKA 3FMGA 1LQUA 5IRCD 5HGJA 3IB3A 2ZROA 1KBQA 3AYXB 4XH9B 3SQLA 4FBGA 2L19A 2DBYA 2H18A 3AFMA 3DLCA 1L7XA 2FWMX 3EUFA 4PRYA 5AKXA 3WKBA 2YH2A 3DXZA 4UXIA 4FS8A 1T34A 2Q3DA 2BGIA 4DHEA 1CDDA 2EZ8A 4NABA 4G0NA 4BWFB 2PRSA 1LTHR 2FSPA 4RHEA 5T64A 1EUCB 2WHXA 3RIGA 5CBPB 2RAUA 3IJPA 4BATA 2QBYA 3QU9A 2FJ0A 2NW6A 3GT4A 2Y0BA 3AR3A 3IEPA 4M37A 1PVOA 1DWUA 2HC9A 1GNRA 1W34A 2YCBA 1R6TA 4R8MA 2II6A 3TLEA 4MVJF 3E84A 4BS9A 5DK4A 1ZSYA 2QE7D 5KMGB 4KIFA 1RQXA 2NADA 1P4GA 2NZYA 3CO0S 4HJRA 4IWXA 5A3SA 3SCZA 3TL6A 3ABZA 1HDOA 3B9PA 2FQYA 1R0WA 2C58A 2M6RA 3DUFB 3EUEA 4RJ2A 3T4XA 3JATA 4UJ3A 4D46A 3A2MA 1WOYA 4OG2A 3SEFA 4L02A 2HL6A 2QRPA 3GIWA 3HA5A 4NEQA 1OT3A 1G42A 3RIEA 2ZWPA 3KTAA 4EHNA 2BKXA 3RW9A 2GCOA 2BFFB 2ZQ5A 2X8JB 3E82A 1SR8A 3H97A 4UNSA 2VJNA 4BEBA 1YE3A 4UEQA 5JCPA 1J8YF 1EXVA 2CHEA 3SJCA 5B5SA 1XCJA 1U2PA 3DT8A 2VP4A 1UBRS 2VK1A 4FUQA 2ZTSA 4MVXA 4UUNA 4UCWA 1FFAA 3FOCA 3GD7A 4QAQA 3L0YA 3GJYA 3JYHA 1RXIA 3TNYA 2ZAOA 4MUXA 2QUAA 2ZPTX 4L15A 3A6ZA 4G2TA 1ZQ1A 2J3IA 4AKEA 2OUKA 3EWIA 1ORWA 3WLNA 3NMUF 5I5GA 3QF4B 5FTLA 5CDTA 1I3LA 3FHLA 1SQGA 4R3UC 3ASVA 3JQ8B 3KXPA 2SKDA 3KKKA 1R27A 1DWPA 3ZWOA 4B84A 1L5OA 1XZMA 3O38A 2O23A 1MRNA 4FFMA 1JDZA 2HREA 4QUGA 3REFA 5LU8A 1AHIA 4DMLA 1SD5A 1XZEA 2J0VA 1L7VC 5JXWA 3J81A 2G40A 5BSRA 2UUCB 1SHTX 2XQFA 3AF2A 5TV2A 3ZY3A 4C20A 3R40A 2NYRA 3EWNA 1EFAA 3Q85A 1SUFA 4DR6B 2RIPA 1H85A 1WTAA 3LPDA 5F2OA 5K3SA 2RIRA 3SM3A 1SRQA 1EFTA 1ESEA 3AF4A 3LG2A 1YI0A 1QQ5A 2MINA 3ZBPA 3HCWA 4H1HA 5K0LA 3TGLA 3OZDA 4L6AA 1KVUA 3ERCA 2ECQA 3OH8A 1TPZA 1YZLA 1N5RA 3G82C 1ETHA 4C6TB 4GEKA 2V45A 1O1YA 4OHKA 3DF9A 1LW6E 2B8NA 1Z4NA 2QT0A 1KSFX 4HQLA 1J2EA 1WQ1R 4NHEA 4J03A 4AP6A 4HSGA 4J49A 5KX5F 5JDCC 2XUGA 3OA2A 2OSVA 2VYND 3TCNA 3UH1A 1BCSA 4AIRA 2VS1A 1T8WA 1MABB 4G84A 4HAZA 2JBHA 4ITVA 5JAIA 1WM1A 1IJKA 3B2QA 4RH1A 5EIAA 4EABA 1L7EA 4RKRA 3R0VA 3VISA 3N2KB 4IF6A 4DM7A 4PPNA 4LVCA 1XRNA 1E2JA 4Z0PA 1KE2A 2Z57A 1KMIY 5CPBA 1L1FA 4ACBA 4DV0B 2NUAA 4BP9A 1U0EA 2O5RA 2ZYDA 3AEZA 3EG9A 3H2SA 4N4AA 2Q29A 4AFNA 1SBIA 4BFWA 4ZCRA 1EUYA 2DFTA 4EJSC 2P6RA 3H87A 4PYQA 5U9CA 4OHPA 2R7LA 3Q3VA 3DE1X 4ASUD 2QR5A 4F9TA 1KTVA 2WTXA 2QWXA 1Z83A 3F3MA 1XTBA 1K1EA 3K9BA 1JSCA 1B93A 1XU4A 4D98A 2ODTX 3G9TA 3M1YA 3OEED 2B8JA 4NL4H 4DKJA 1FLNA 3K1YA 4GZLA 1TU3A 4MEBA 4CI9A 1JHVA 4KQFA 2ZYIA 1G16A 1R9MA 3O82A 3LRTA 1K63A 4W8OA 1N2XA 5HEKA 4LOIA 3DAPA 3DOOA 4OP1A 3H5IA 4KWIA 3G2PA 2CJXA 5TS2A 3NEAA 3V4PB 4AC9A 3VR2A 821PA 1Z6AA 3NYQA 1K86A 3MJ4A 4C22A 3IUNA 1SK9A 4OHXA 5HCIA 2BTEA 1G7CA 2ZXEA 5E4YA 5JU6A 1T3GA 2EKPA 3BMQA 3E9EA 5J2TA 1PSZA 3QOXA 1Y7LA 4HUQA 1E6LA 1KQOA 4KQHA 3H1EA 4KCGA 1YVDA 3OZTA 1BGXT 3AEUA 5CIQA 5HA5A 3SS8A 1O6GA 5C9ZA 5LNK1 4NJEA 1D2GA 3JARA 1AV7A 1MF7A 3G2MA 3UGQA 2AI1A 4DDVA 1Z29A 5E2IA 2C2KA 2XCIA 4AY5A 1ZZGA 2FPPB 3RHTA 4CQMD 2Z08A 1WUYA 4IIBA 4AB1A 1M10A 2BRUA 1TM5E 1J90A 1W87A 4TLCA 1G2OA 1T5LA 4HX5A 4INZA 3ICEA 5IDVA 2QUZA 3LZCA 1L7QA 3CUVA 4EFDA 2B5OA 3UA4A 4GOJA 2CT8A 2ZYUX 4RIFA