4C6RA

Crystal structure of the tir domain from the arabidopsis thaliana disease resistance protein rps4
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
162
structure length
162
Chain Sequence
QHQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYEDRGQPLDVLLKRIEESKIVLAIFSGNYTESVWCVRELEKIKDCTDEGTLVAIPIFYKLEPSTVRDLKGKFGDRFRSMAKGDERKKKWKEAFNLIPNIMGIIIDKKSVESEKVNEIVKAVKTALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISEASE RESISTANCE PROTEIN RPS4
publication title Structural Basis for Assembly and Function of a Heterodimeric Plant Immune Receptor.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Immune system
total genus 61
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4c6rA00
3OZIA 2M1XA 4DOMA 4OM7A 5FORA 3UB3A 3UB4A 4LQCA 3JRNA 4C6TB 2Y92A 1FYVA 1FYWA 4C6TA 2Z5VA 4LQDA 4C6SA 1FYXA 3H16A 4W8HA 4EO7A 1T3GA 2JS7A 4W8GA 2J67A 3UB2A 5H3CA 4C6RA 4FZ5A 1O77A 5KU7A 4LZPA 4C7MA
chains in the Genus database with same CATH superfamily
4J90A 4EB6B 2FKNA 2HXSA 1YCGA 3NIDB 2YMQA 2V1UA 2C4UA 4PLWA 3V97A 2B20A 4RCYA 4DHWA 3OURA 1DXHA 3BDVA 4CR7A 1A0OA 4P4SB 4OHWA 4IMIB 3K8QA 2GETA 2O3TA 3I42A 1LU9A 3IJEB 2FX2A 1Q7EA 3PQ4A 1O94A 2LKDA 4IXWA 4WK2B 4ZOEA 5A6SB 4GLLA 4WCFC 5AK4A 5FUYA 3NNNA 1LNQA 2C8KA 3UYKA 1W85B 4RH3A 1F4LA 3VR3A 5B57C 1Z5GA 2PU7A 3DOIA 3MM4A 4O4LA 5JYDA 3PQ7A 2Y99A 3LDUA 4DFDA 1DTWA 1M2OB 3DTTA 3PI6A 1R27A 4U4AA 1SHKA 1EUYA 1CUJA 2BUCA 2R97A 3SJ7A 1JBEA 1I0IA 2F1KA 4YJFA 4MRNA 3AFGA 2SICE 2QXYA 1RXSA 3Q72A 4LXYA 3KJHA 4V3BA 1PJZA 4Y2RA 4WY8A 1P4JA 4Q9DA 3DKPA 1UEIA 5FNVB 4DILA 2IHTA 5EJAA 3R75A 1DV2A 2O8FA 3HN2A 2WAYA 1VFNA 3CPEA 3I05A 3DDSA 4B8WA 3VO8A 5L3SB 2WMNB 4RMNA 1VL1A 1W4LA 4JBIA 5KWJA 4RYLA 3FUUA 4BKUA 1JEYB 4FZRA 1SD1A 4IH4A 1ZUD1 3ICCA 3I6MA 4UVGA 1Z7GA 3WP0A 3GRKA 1GR0A 2PLAA 1L1QA 5JSZA 3I01M 4G0PA 4XSGA 1QF6A 3JZIA 3IA2A 1P6XA 1XE3A 4TRJA 4U7WA 2C4MA 3C6BA 4LN1A 2P3LA 4DUGA 3COYA 4OI2A 3VUFA 5BWBA 1PQYA 3VAAA 4K6MA 2CL0X 4FX5A 3PKJA 3B70A 3FW1A 2W4MA 2H17A 2JFGA 5AW0A 3IBYA 5DSZA 1NNI1 2NZWA 5U9CA 1UXHA 3KQUA 1D8TA 1W2GA 4LVUA 5KPDA 1IY9A 3OCWA 2IOFA 2XLBA 3DAPA 3H0EA 1LJLA 3I30X 2H65A 3RI3A 3RR2A 1DFIA 4YLGA 4B32A 5CFLA 1GQ2A 4ZARA 4UOEA 1XU7A 3H9QA 1V6SA 4UHDA 1HYQA 3NEYA 4WIAA 2Z30A 2CL6X 1KPHA 2EJCA 3O95A 1KK0A 4LY9A 4NCAA 1T4CA 1ANKA 1FQOA 1YDGA 3CEHA 4AVYA 1YKFA 1RM5A 3SM3A 4BLQA 3E70C 1HLFA 1B73A 3GN1A 3NHKA 3D5QA 3UCEA 1UBMS 3TSCA 5F4ZA 1IAVA 3SI7A 3ZDDA 2O20A 1C7QA 5TDHA 1XZHA 3KQWA 4RGQA 2QVXX 4TMYA 5KYYB 1QYVA 5LPNA 1G3UA 4E15A 1VC2A 4L7VA 3U4HA 3R74A 1NJ6A 3L8FA 2QTTA 3D54D 4K9LA 4DYVA 3GLIB 3BGSA 4W1RA 2P9BA 5CK4A 1TMKA 3GDOA 4AULA 3CW9A 3OH8A 5JS7A 1XXHB 3B9RA 5BSMA 1RZUA 3BFVA 3B53X 2XUDA 4PC2A 1TUGA 2NNWB 3INRA 5IH3A 1TQHA 1KJZA 4FC7A 3HZHA 1E3EA 4DBZA 1RLMA 1ZI6A 2IOFK 4JCOA 3U5ZB 5ECGC 2G77B 4B3TB 1FX0B 3TMKA 3LY5A 3SYLA 3IERA 2Y4OA 4GEGA 3IS3A 1CP2A 2J3EA 1ZIPA 2GCOB 3PUVA 4M3NA 3W3AD 2FG6C 1CUXA 3S7TA 3C7DB 4CLRB 1NNLA 1Z33A 4RHTA 5LQSA 5FBVB 3REQB 3HO1A 1MO3A 4BFUA 1RVV1 5IM5A 1FXSA 2ZXUA 2DXIA 3NWBA 1I94B 2F43B 2VNIA 3A8TA 3JQ9C 2Z5VA 1TVEA 3MRXA 3PQ3A 3IP7A 3ZHCA 4UNNA 2QPTA 4JLKA 3GCXA 3KEQA 1N7JA 2DQZA 4DPKA 3IKTA 2NT4A 2HKIA 2ZWOA 2HZBA 4IVRA 3QMWA 4FBLA 5B1EA 1HRDA 4Z9BA 4F9TA 2FSPA 3Q6MA 4B81A 5CTJA 4IJMA 4MQ5A 1WXIA 1E3QA 1R4MA 3EFOB 3CW8X 4Q82A 1R0KA 2EJWA 3A9UA 5DBIA 5ENVA 4DMFA 5ICSA 1GLNA 2VF5X 2WSYB 2XT9A 3H87A 3QPVA 3SIXA 3GRUA 4CHGA 5JATA 2J30A 1BU5A 1VG9B 3KRTA 3U60B 1BROA 3HTXA 3FFXA 1H0SA 1Q0SA 4DTCA 4FJ0A 4C2AA 2PCLA 3EEYA 3DAFA 2CLDX 4BMZA 2BBOA 3R3HA 1QIDA 1T5DX 4B5KA 3LU1A 1IWPB 3FF1A 5JEEA 2G5CA 4YUAA 4N76A 3DTVA 2ZIUB 3PNLA 3PPVA 1RYMA 4O02B 4UBKA 4X1IB 2W6OA 1AVTA 3SAJA 3I2KA 4IILA 5BNWA 2FZ4A 1SA0B 1JJFA 2GHQA 3CKKA 4LE2A 5EJ5A 1AGPA 1EWKA 3L7IA 3JQGA 3EODA 3AW9A 3LX8A 1DOAA 2I29A 2Q0QA 3QVSA 3NTVA 3UFXB 4XE5A 1Z38A 5DIZA 5BV8A 3EPLA 3V4VB 3IP9A 1RKUA 3HFJA 4L8WB 2I1VB 3C8ZA 3OZ7A 1DLIA 1EFKA 2F90A 2O7SA 4LZNA 3RANA 5CDFE 4DLVA 1HG0A 2PYIA 3ZD6A 3FSGD 4K87A 1KRXA 5EIBC 4PTZA 3UJCA 2H3HA 4D9KA 4EPWA 5ARBA 4K8RB 2XVXA 1IPHA 3GOQA 4M1QA 2EQ5A 2H4HA 2IHVA 3QI7A 2CHFA 1GUBA 3UK2A 1GA6A 3D7KA 2GN2A 1R9GA 1LSSA 4FR5A 1UXGA 2EWVA 1LPMA 1O95D 3KEOA 3O8OB 3FNFA 4H4CA 3TB4A 3WE7A 1VHJA 2FX3A 3A1FA 3BWBA 2HA7A 2UZ3A 3CBGA 2ADMA 4J29A 2F3PA 2RG7A 2X8WA 3AUXA 4HWSA 4P53A 3RTAA 3GP8A 3QVKA 5M29A 1WXHA 3F8SA 3T06B 4CMGA 1X1QA 5L7TA 2PWBA 1E7RA 3PLNA 3M9WA 3D3QA 3DW3X 1HX7A 3RRFA 3KT8A 4KSBA 4G25A 4H16A 3ZWNA 4FYWA 2MIIA 4Y6SA 1RZ3A 5F77A 5FUWA 3AG5A 5D1HA 3QEMA 1BHO1 3WLMA 3EIUA 3VO2A 1K66A 1Z6YA 2NPOA 2J3IA 2J07A 4M8LA 1JEJA 2NPFA 3QJYA 3ONDA 1WU8A 1Z34A 1Z7BA 4KQXA 3AF0A 1M7GA 3HDHA 1I3KA 4WKCA 2JBWA 4JI5B 1WX1A 3VRHA 3BXGA 1MIOB 3H05A 1BCSB 2QN6A 2ZIVB 3OX2A 2DH6A 3BDAA 4FFDA 4RQAA 3W2IA 3ZWBA 4HAWA 2HUPA 2CMKA 1SQFA 4MUBA 3IB6A 3JQCA 4OMDA 5F5NA 5KKCA 4EL0A 1LW6E 4R9VA 5FL7A 1THGA 5F21A 5DBHX 5G40A 5IX8A 1UAYA 4YCSA 3B5IA 4HDOB 5JPDA 2EJVA 4LX0A 5B58T 2RAUA 2NVBA 1PLKA 3E27A 4M8SA 3ZKWA 5JXGA 4KN5A 4LZJA 4KNYA 4UBIA 1MH9A 1GPYA 2PDAA 2B61A 4RD1A 4BE7B 4IDGA 2YXPX 2G1UA 4MRRA 1Y3AA 4A27A 3UNXA 3VJMA 4C3VA 4YDRA 1KEEA 3A1WA 2PPLA 4MV9A 1CX9B 1OGJA 1WCXA 3WSTA 3SVTA 2ZUFA 2BGKA 3FMIA 2BFEB 3NWJA 4GYYA 4B4KA 5HUQA 3RF6A 3TQIA 3EFEA 4B45A 2ZJ7A 5JH7B 4NBLA 3OLWA 4L16A 3KAQA 5CB6A 4IKEA 5D2CA 3SD7A 3PGKA 3JSAA 1ZXXA 4ZU1X 3UBMA 3K0SA 3TEFA 3B3QA 3KWMA 2JGMA 4ALLA 4UU7A 3A9TA 5HUJA 4IDBA 4HPWA 2O9JA 3I5AA 4ZEOA 1KR2A 1J20A 3GC6A 1P5JA 4PEVA 4Q3KA 5DGDA 5LQMA 3DAYA 3MBOA 3S99A 2VT3A 3DDUA 4HG2A 1FXUA 3RS0A 1B42A 1N3YA 2E37A 3KT3A 1PW5A 4IHAA 5AK0A 3N2KA 2F1IA 1F2TB 1OJLA 1XK7A 1GCGA 4CLOB 5HIJA 1VA4A 3A7DA 2JS7A 3IVGA 4HXGA 1G18A 2HSWA 5CU7A 5KVQA 2VQ6A 2W8BB 1A27A 2DKFA 2J3KA 1O95C 4WVLA 5COQA 4Q3DA 2QRVA 2QW0X 2G82A 3MVEA 2AD1A 2F55A 1VHWA 4FGUA 1A8IA 1FLDA 1LRJA 2HLPA 4YRMA 1YOVA 3TSZA 3DB1A 3I9OA 1ACMA 1ILEA 1WNFA 5BMVB 4EFKA 4JYZA 5C81A 1QBKC 5FWNA 3H9GA 3L7LA 1AD2A 1JBQA 1XU9A 1T0BA 3RYTC 3STVA 1I33A 5KYWA 4RZQA 4XQ9A 3KZOA 3FFTA 3TFOA 1OX6A 3TIXB 3KPWA 4BFZA 1JEEA 2BW0A 2DUMA 4DRXB 4JJGA 5AJXA 2DZDA 1XTVA 4YLYA 5C8DA 5LYJF 3OC6A 4GS5A 1YDMA 3I23A 1Q21A 1UUFA 1QH8B 3ROFA 4B4VA 1F2VA 5FOQA 2B37A 2DVMA 2FPKA 4HAOA 1AQ6A 4Z1MA 1RFGE 4A92A 1UM9A 1AKNA 2JLUA 3M4XA 3GDWA 3QHPA 4KVFA 5H3CA 2YKGA 3NKFA 3ZWPA 3MNFA 4KDFA 1JUDA 821PA 4MUEA 1E3WA 3PITA 3EXEB 3GGJA 2F9LA 3G82C 3PFWO 4KBYA 3AETB 3NHJA 3PDIB 3TL6A 4B6JA 4E13A 3ZHUA 3LP8A 5L7WA 5FFMA 4F3NA 1YASA 3ZDRA 1NF9A 2JFNA 1OBCA 1RWVA 3GO4A 4GFDA 4Z9XA 3VU1A 1XCPA 4O0MA 3W4KA 2PAAA 4AYWA 2WE7A 5AW1A 4H1TA 2NUTB 4IH1A 1XN4A 1CUEA 3HHPA 1ZW6A 4Z8YA 2OK7A 2JI4A 4J3NA 3UHOA 4C1NA 1DMRA 2X0IA 2I9KA 3NOVA 3KZVA 4L51A 1VXOA 5E7IA 5ALPA 4NE2A 1RQGA 5C1PA 3C0KA 2C82A 4AZVA 1QZXA 1U9ZA 4EATA 4BQEA 4OATA 4Q1VA 3EMDA 4PVDA 2I22A 1FDOA 2R5FA 3GFPA 5JCZA 1WQ3A 3ZWMA 2X0JA 4BC0A 2WZCA 3D3WA 4IIUA 1S96A 3QA3E 3A1TA 4ASUD 3FMPB 5D84A 3DBOB 2XDWA 5AESA 3BGVA 4TTPA 4S1WA 3WA6A 1RRPA 3MTQA 3BWYA 4J07A 4TT3D 3O7MA 3RIYA 2KJQA 3SCZA 3W8DA 7ABPA 1STOA 3KHUA 4B2LA 1JH9A 1OIWA 1OQAA 3BTVA 1XHEA 3IPLA 3PC8A 2FOXA 1CQIA 3OAAD 1TAHA 3K6JA 2GAJA 4DMGA 1MC5A 1XVVA 1GN8A 5AK6A 2L82A 2PQ0A 1NZFA 1SVOA 2QMEA 3KQYA 1VCIA 3I62A 2Z09A 3ABZA 2W70A 4D4JA 1KP3A 5E9WA 2YJ4A 1Y34E 2FVXA 2H0AA 1SXHA 3GMTA 4JJ4A 1S9DA 3CRRA 3K9WA 3WWDA 3ZIAD 3ENVA 4J16A 3WL6A 2EZUA 2B2XA 4I8DA 3BJZA 4MRMB 1R1DA 1RW4A 4FB4A 1DMSA 3BGDA 2HRDA 4RULA 2HA5A 3DWEX 2FPIA 2XBLA 5AHRA 5HXAA 2RI0A 3E9NA 3GW8A 2YCBA 3KR2A 3RGWS 4TLAA 3ABQB 3ZBPA 1B0PA 3I6YA 5KCMA 4D0RA 2X0DA 3EUAA 2H1WA 1YJ8A 2WKRA 1AKQA 3JYQA 1BDBA 2WWFA 3QMMA 4RPIA 1YKSA 2DF8A 3CUYA 3ZVNA 1U9CA 4AL4A 1MX3A 1JHRA 3FVRA 1L8QA 3AM4A 2R6JA 5AJUA 3BD8A 1ORTA 3D1VA 4P2GA 3U17A 3V80A 1FJGB 1J5EB 1NVEA 4L9SA 4YRJA 1AGNA 2EW1A 5KNCA 3ICWA 1VMKA 3FUXA 3NP9A 3SFZA 5FPYA 3TFQA 1KXJA 5JZSA 3DMTA 2A92A 2C9CA 4XVCA 3BMNB 4LMBA 4YAWA 2XUIA 1JKXA 5BP7A 2B7CA 1LQTA 4OHZA 4E21A 4E5KA 1FUKA 4O4JA 1LJ8A 3ZTTA 4AZSA 3KZMA 4R41A 2CLKB 1IN8A 3NVMB 1QPZA 2M6SA 2QRGA 4OHBA 3I9NA 3C3AA 1CY8A 4R1SA 3EQ9A 3HWRA 3W8FA 3FBGA 2DPXA 3OCYA 4ETMA 4ZO7A 3PUXA 4C3ZA 1MB3A 2HWWA 4Q02A 4ENRA 1PT9A 1SCNE 1UIRA 2UU9B 4BGVA 421PA 4ETIA 4QDUA 5M3BA 5IEJA 3GB9A 4QUEA 1G21B 5KYYA 1KIFA 5ILGA 3ET5A 2IQ5A 1OX4A 1IXYA 5F73A 3RF7A 1D2MA 2I71A 1QAQA 1QTIA 2EBHX 3KHSA 3KLBA 5BOVA 1AX9A 1RXUA 3T3EA 1CZHA 2BGLA 3O8RA 5DYWA 4MGZR 1XXHA 5ALNA 1GU1A 2A7XA 4G1VA 1RWWA 1FW8A 2IYYA 4LFCB 4WV3A 3AIIA 4BMVA 3ZS9A 2PU5A 3EGOA 4HS9A 1MOQA 2JFBA 4IZ6A 3N2EA 4KE8A 3FNRA 1FX0A 2JGKA 4RXUA 2OENG 3ZZNA 3COWA 3EF0A 2GCOA 4PGMA 3GVPA 2CZCA 3TLKA 5LXTA 2GJ8A 1WABA 4CIAA 2GBGA 2VT2A 3WNVA 2CVHA 3GRVA 2QJOA 3LVQE 2R6HA 3WO0A 2O8NA 1NVFA 2PLNA 1AT1A 2JHAA 3CRW1 3EYWA 4LDJA 4M6WB 4BU1A 5GINE 3RU2A 4Q4LA 1A4RA 1E7MA 4FMDB 3TLGB 4X71A 1T3GA 1YNOA 4NMHA 3HFRA 4DKXA 3AMVA 1QUEA 4R1QA 3FYUC 2NSDA 5L40A 2XKKA 1NLZA 4RMIA 5CP8A 5AJHA 2C7BA 3ZDFA 4E5YA 2HCTA 2X1LA 3I8XA 3NHRA 5HZMA 3SFTA 1WB5A 1KGSA 2XQVA 4TZKA 4ZP1A 2WBLC 3ILYA 3RU3A 2P9GA 3NGXA 5LLSA 4DMLA 3O1HB 5A9SA 4XDZA 1RI1A 1U1GA 2H4JA 2H52A 4F2PA 2GN8A 4TL7A 1S3IA 4D9HA 3L01A 4B34A 4DTIA 5EHQA 4IDPA 3SF8A 4OUKX 3Q1LA 4UU0A 2Q7OE 2VYVD 5EIOA 4DJDC 3R7WB 4V0OA 1G1MA 3PX2A 1QFYA 2W2LD 1KDPA 5LP6F 3K72B 2W22A 3UQYS 2PSHA 3W1WA 3W4IA 4P58A 1N1DA 3NHBA 4GECA 1NNEA 1REQB 2QRZA 4Z51A 3O91A 1JH8A 2I3AA 1PGQA 3LQQA 1GA1A 1VPEA 4C2TA 1ISGA 3L05A 5CYGA 4QXQA 1CBUA 4M7RA 1JU3A 2JH8A 1RCFA 2L69A 4BNIA 2CLMB 5BV0A 4AECA 2P6RA 1P5FA 4O2RA 2H48A 4FFWA 5IDXA 3LO5A 4NOJA 4MKIA 2QZ4A 4XGIA 4P08A 2Y92A 4EEXA 2DJIA 3SXUA 3TNYA 5I4CA 5HE9A 1GSIA 1K7SN 4PG7A 1ZOOA 3PC7A 5L3QA 1JHAA 1G2PA 1VYUA 2EV9A 4GQBA 3U39A 2I67A 3DDOA 1MAAA 4MQEB 1Y7LA 1I4TD 4HB0A 4TOIA 5JCJA 4BKQA 3WAJA 1FMLA 1EGAA 4JI3B 4RAOA 1W49A 1B0UA 1OREA 4KC0A 4PBSA 1F8YA 5IFLA 4RTQA 3IT0A 4QUDA 4XCXA 3HRHA 2PX4A 3H2ZA 3W6NA 1E9CA 3QM1A 4NNPA 1D1QA 1T24A 1TD9A 3HJBA 4RD3A 3SS9X 2EG5A 3KPUA 3KQVA 1Z35A 4LYGA 4Q3LA 4XTRA 3WIBA 2E1RA 1QP4A 3RSOA 3OEEA 4NYJR 5IAGA 1AKEA 1M1YB 4FI3F 1XWFA 5T8KC 3A9SA 4IQ8A 3BD7A 1OGIA 2CNLA 3OSUA 1H2EA 4O2AB 1TVCA 5LQDA 5CHEA 1HH4A 4K40A 4U7FA 3VI3B 4WLEA 3IDSA 1ZVKA 4JQYA 2Q0XA 3K5HA 5KHOC 1FP4B 1P1JA 3HY6A 3NM5A 1W88B 1UKBA 1N9KA 1EWYA 3OO0A 3RIMA 1WCIB 1FJHA 4K2AA 3FUWA 2R1TA 4ZRNA 4FC6A 3EPRA 1SEVA 4IXMA 1GGJA 4ZCQA 1XCGB 1BQ4A 3EVZA 1NMXA 3GBSA 2ZT7A 3EB9A 3JWHA 2Q0HA 3OIYA 3NBFA 4XAQA 2ALJA 3L0IB 3LWDA 1AH2A 1XD8A 3T3GA 3CH7A 3DVSX 4EGCB 1II9A 3CRQA 4YAEA 4BYMA 4BB5A 1IXKA 1PK8A 4MHOA 2NX2A 4DWWA 4YRAA 2O3UA 4DAOA 3GUUA 4IEEA 2FYTA 3T95A 3WNZA 1DUSA 1Y8QB 2W2VA 2QWXA 1VSTA 2JAWA 3KIPA 4RA9B 3WMRA 3KP1A 4AICA 3PD0A 4L73A 4C4SA 5FTLA 2BFEA 2GF9A 2CD9A 1NVUQ 1DJNA 2XIJA 3QXXA 4OAOA 1OIVA 1H8ED 3VR5H 2YHBA 4X91A 1HEUA 4X3CA 2Z04A 1NBAA 3EXIA 5HRUA 2RAVA 1XDBA 3O75A 4D3ZA 5K0TA 5HK9A 3TJRA 2C5SA 1ULBA 3FIUA 3QU2A 2WHYA 3MUNA 2VDOB 2I91A 4Q03A 4P5DA 1YRYE 2NSJA 5BSKA 2QZPA 3K4PA 4V02A 3PS9A 3H42B 4RNCA 5TPWA 3MQ2A 2D5CA 4HLCA 3RHZA 3WLKX 4CCWA 1KZGB 1MG0A 1RQRA 2QZSA 3FROA 4BAUA 5BSVA 1JHQA 1U2RA 3QFHA 1MVLA 2W8BA 1JVSA 4C78A 4KFRA 4MUJA 1TX4B 4P86A 5FLEX 3ZHBA 5L45A 4Z4FA 4GC5A 3UHJA 1IDN1 2GYVA 2VH2A 3FPLA 3JQPA 4XIYA 4FHZA 1Y3FE 3N0TA 4HDSB 4MVJD 2ZUEA 4AJHA 1QHSA 4GR5A 1UOPA 1GYQA 2PMDA 4M83A 5IZ4A 1JI0A 1U6JA 2Q3CA 1LS1A 3LWZA 3NBAA 4M76B 2OM2A 2WJWA 3NHPA 3RFVA 1NN1A 3Q2KA 1LLFA 1XA0A 3CINA 2A5GA 4JLMA 3TRJA 5COAA 2QBYA 3B1KA 4UNIA 4ETWA 4KFSA 2UYCA 3O8QB 3F7OA 5E7MA 3USCS 4DRXA 2EYQA 4YVFA 3NM6B 1JXOA 1Y1TA 2EKZA 4YASA 3DMRA 4EARA 5DCLA 3K20A 4P54A 5L6LB 1QIKA 1USVA 1WV0A 4XIFA 3ZTWA 1F9AA 5IHPA 1FBNA 4ENUA 4YCCA 1ZJYA 2VYNA 1H0RA 1UFRA 1KYVA 1WQ4A 2RDMA 4GE0A 1QJ4A 4KQWA 2X77A 2QTGA 2D1RA 3W3ZB 1EEXB 4ZD6A 4QJ5A 3JZMA 1RJFA 1CZNA 2P68A 3H2GA 3E48A 1CUSA 4DZTA 5JMPA 4L27A 2FZKA 4FUQA 2A86A 3TBFA 4IHKA 1BRTA 1FL9A 4QDTA 5EUMA 5CIWA 1EAMA 1QCZA 4R0VA 2IXFA 4LBWA 4D74A 3EEOA 1PK7A 2GT1A 4TV9F 1E8DA 5FEMA 3IVCA 3KB6A 3ZV3A 4WBSA 3RFUA 4P33A 1IUPA 4E14A 3O9ZA 5JJCA 1PEKE 3QUBA 4EAAA 2JFHA 5CEEA 1E4OA 3ELUA 4I4NA 5LSAA 1OH7A 3OZSA 3SIWA 1ACJA 1SU8A 1H5UA 3BQMB 4OMFG 3AESB 4RZUA 2QTHA 3F3KA 3WR5A 5C5EA 1T3ZA 4B7ZA 1QYWA 1GGHA 3FSRA 2ZJ4A 3TMAA 5CB4F 1CUVA 3WTCA 3EA5A 4ND8A 4RPGA 4X8HA 2C8JA 3ND9A 2R9VA 4LRXA 1IXSB 2RHRA 4XSHA 3R7FA 5CEJA 3E3NA 1Y37A 3R9IA 1H5NA 2ZBPA 2B9EA 3PDCA 2OAP1 4ACAA 5BN4A 2HLDA 2ODBA 5EE9A 3UBTA 4MGYR 1WVMA 4I9HA 1UXOA 4QAJA 2CVZA 4UFNA 5DNVA 1N0HA 1JE0A 4NBRA 4DXDA 4H15A 2SKEA 3GGOA 3IPYA 2HWXA 5IJWA 4MKHA 2YS7A 2QT1A 1ZGBA 2HJWA 4PS1A 5DWQA 1ZINA 2IDKA 5FTMA 4IM7A 1KDTA 4BUCA 2H2AA 3T9FA 1C50A 1SB9A 2CCKA 2D2XA 5AKIA 1MXHA 5TS3A 3MCAA 4XWYA 2P9QA 1GKYA 3MMZA 3OE7A 3VR4D 1QR2A 2HBZA 1JLRA 2J85A 3G9TA 1JFFB 2XTMA 1DO8A 4GMGA 2CV0A 5JECA 2HMAA 4M8IA 2VQEB 4LI3X 4Z3OA 4ZKEA 3HNOA 3SSOA 3MJ4A 3UJ8A 3ZHOA 1LH0A 3QPAA 2J5XA 2AOUA 2M1XA 3IV9A 3ZHRA 1IWOA 2CFIA 2G08A 4KDEA 2F64A 4HX9A 1HL3A 3VYVA 1MORA 4P38A 1RZVA 2JH9A 5TARA 5F64A 4I4TF 2XCOA 4LI0A 3ITKA 1RDFA 4WKGA 2WWXA 4OYHA 4PPQA 4UC0A 3P2IA 4MRMA 4W8OA 4F92B 5HZHA 5HTOA 1GGKA 5CMLA 4JX8A 1QDLB 1JAXA 4L4ZA 5AXDA 5LL6P 2R7NA 5BUCA 1F14A 3M70A 3OO1A 1OFUX 1AQUA 2ZZMA 2FMTA 4M87A 1XMOB 1DKMA 4Z9FA 4O2BA 5FBQB 4Y7DA 3AIKA 4ZGGA 4FZ3A 3ZNQA 1QV6A 3KVRA 1OWPA 2XDAA 4CE6A 4QAQA 4G84A 2ZJZA 4JOSA 1YUBA 2VDUE 4KK4A 1DTEA 1X1SA 4H1HA 1KDOA 1I4EB 3A2LA 1NX9A 4FJ1A 1GM5A 3IEXA 2XCSB 3FR7A 2QE7A 5CLFA 4WK4B 4BQSA 1DG3A 1P9OA 2I2AA 1XZKA 3VC1A 2J9GA 1KQOA 1YB1A 2EBWA 4J94A 3DFIA 4BV3A 3K9CA 4TTIA 3BHMA 3R3VA 3RBVA 5LZ7A 3CSDA 1QO7A 3CWQA 1FRQA 4J3JA 1Q7TA 2EGHA 4KDRA 4OH1A 3HU2A 3FKQA 4NBWA 3C3PA 1NPTO 2LVBA 3G13A 1KHHA 1MB2A 1O8BA 2B3TA 4AJ4A 4DLPA 1CNEA 2DTDA 2Z8XA 2DYKA 3I9MA 4FWTA 2YRFA 4P7GA 1DAFA 2JCGA 1SOUA 2C0PA 1GL6A 2YFHA 4PZCA 3WNDA 2X3FA 1E1NA 4RYDA 1PDOA 4AXBA 1XD2B 2CJXA 3GJTA 1IY2A 3IX7A 4KUGA 4LYDA 4XM0A 4B74A 3DBRB 4ZYYA 1SPBS 9LDBA 4UU1A 4RS4A 1HO3A 4NYMR 2OV8A 4H7JA 1XKQA 4CQMD 5KOIA 4FOOA 4NE9A 3OZDA 4XB1A 2VPQA 1YZNA 1HKHA 2ACKA 4G5GA 3SJUA 4UJ5A 4L2IA 4G89A 3QLUA 5B37A 2VPWA 1GZVA 3MJFA 2M32A 1J0EA 4JXXA 2XQFA 4B3SB 5CDFA 4MQ6A 2FA9A 2Z4TA 3I83A 1PKEA 1DO2A 4CMAA 3TF5A 2GZRA 2OFPA 2Q6LA 2Z4RA 4TYWA 4JVOA 3F96A 4D5EA 1GQYA 3A27A 3GHYA 2G9UA 2OPBA 1YKGA 4MLDA 1X1DA 1K97A 3QYFA 4UARA 5AVKA 5HM6A 1V9LA 2GPNA 3TD6A 2G1PA 1UWKA 1AGYA 1BAPA 2GILA 4ACBA 1R0ZA 2TECE 4QPZA 3ESQA 3IB3A 4F3TA 1A2OA 5IP5A 3HXTA 4FHCA 1TPZA 3RHTA 5KSOA 1E3TA 1ETUA 3C3XA 3N76A 3QBEA 2PCJA 4ARUA 2G25A 1UT5A 2BEVB 2PUTA 1CPYA 1N9ZA 1XVLA 1DEKA 2P8SA 4I3FA 4RQTA 3JQFC 3UV3A 4B3DA 4JYMA 3BH0A 2JCVA 2XGGA 3D0OA 1Z6TA 1MVNA 3TLGA 3O6VA 3QQPA 2XYPA 1EDEA 3P27A 4G1MB 3VUEA 4YAIA 4JI8B 1SUSA 5D6OA 2P4EA 2JA1A 2HXGA 3JD1A 5FYDA 1Y7HA 1L1FA 1TJ4A 2FR0A 2FFRA 4J91A 5A4KA 3PC2A 4P5PA 1V3VA 2JIZD 4NYIR 5A4IS 1Z6GA 2VJMA 5DW0A 3ONWA 4F93B 4P9NA 5HIKA 4MW4A 1A88A 1R5BA 3ICVA 1B8OA 2OKGA 3GEEA 4G2TA 1N3BA 4X9XA 1QQAA 1UT6A 2VPZA 3BL8A 5AXCA 3R76A 3SZ3A 5K0SA 2B8TA 3R5TA 1YVRA 3T41A 4A82A 3RVOA 1Y6GA 1HM5A 2DBQA 3IT1A 4B87A 2R5NA 2POCA 1P18A 3IDAA 3SZRA 4ZQEA 2V3VA 1Y7IA 1BHJA 4HRAA 5T4FA 3IIKA 1U98A 4MCAA 4AT1A 1VCHA 2DPHA 5HFJA 2FE1A 4AYTA 4QGSA 5DI3B 2DPMA 2V7VA 3K0EA 4CHTA 1M8PA 1EFCA 2XQKA 3C5WP 4Z0HO 3M34A 3FOAA 1ZGZA 1K0FA 4EB3A 2QTMA 1GUZA 3K70B 1DAEA 4MYSA 5HR5A 1JEQB 5EKTA 4RBNA 3WMFA 2PUGA 1C1XB 1Z5PA 3A3PA 1TZMA 3I09A 4CMIB 2CUNA 3GJ8A 5A1TA 3LG2A 3WHKA 3ESDA 4I55A 3IVRA 2H54A 1MPTA 2AJLI 3VTAA 4LZWA 3F3MA 3R44A 1PEYA 3PGA1 4IRXA 1J00A 1KMIY 2ZRLA 4PGAA 2ZWPA 3HA7A 4W6ZA 1SG0A 2HX1A 2WJ6A 2BP7A 2X0FA 4YV7A 1NT2A 4QWMA 4ATNA 2RONA 1J5PA 4L8FA 2IYFA 2BR5A 2COUA 2JFPA 5JTTA 4OQFA 4ZDWA 3K31A 3CPJB 3QI2A 1ILWA 2K4MA 4IQ0A 3ZD7A 1BE1A 1PT7A 2YWBA 1E2PA 5IEBA 3SIRA 3D7SA 1R0BA 1ZM9A 3AP1A 1NW8A 3U7FB 3NWEA 3SZUA 5CM9C 1SK8A 1TPYA 2XE8A 3ZD9A 4MULA 4W7SA 1S8AA 3IO5A 1FVFA 1NUAA 2D74A 2C5EA 3PPYA 4LMAA 1A9ZA 1E92A 1HSZA 3PZBA 4KMRA 4KV9A 3ZLBA 5AJVB 4KNWA 3CRZA 2D1TA 4BTLA 5P8WA 2IXTA 2X6RA 3O26A 4G36A 1OA0A 1X1BA 2HRRA 3RS4A 4RHCA 1WMSA 1GQSA 3C1AA 4RF5A 3W1EA 4JMLA 1EK2A 3ZDXB 1LBQA 3AR3A 3ET4A 3L7KA 1M7BA 4BO1A 4EW1A 2JJYA 2VRCA 2RC6A 4C22A 3PTAA 1I9GA 1H85A 2RHDA 2W6NA 3CJTA 2XUHA 2QX9A 4C2UA 5IYZF 1XDSA 2XWJI 3I3SR 3JQ7B 2I6QA 4CM3A 5HPYB 1JAYA 1XRSB 3TTVA 5EFOA 2VHTA 4DCNA 2GESA 2N42A 4B3BA 3NJRA 5BRAA 4PNHA 5JAZA 1DBVO 4DRYA 4Q4JB 4Y1EA 1OTYA 4R2MA 4NF2A 1GTVA 5TQVA 5JY6A 1BU8A 1Y8RA 1GCOA 3M0EA 3PDUA 1QMGA 4ZXFA 3IQGX 2NT3A 4KQIA 2GZSA 4NU8X 3QQ5A 3RG2A 2J7KA 3KKEA 3P9PA 3TOCA 1NUSA 1J9ZA 1G6KA 3PR2B 4P4LA 1HFEL 5D86A 1P2DA 4X95A 3TZBA 4E2XA 3QPCA 5DRTA 2XQJA 3CKYA 2JLXA 1XMSA 3RBAA 4QTYA 1T3SA 3ZUGA 1OZAA 2VJLA 4MUKA 4ZREA 2VDWB 1XNQB 1C4KA 3PRJA 2EEZA 4HO1X 2JGEA 4XCVA 3JATB 4DJTA 5LU8A 1XLVA 2B69A 4GLJA 5IK2D 1Q11A 1ZGAA 1ZJWA 2QVZX 1W87A 2RKOA 2XNJA 3E9EA 1D07A 3I04A 3F3YA 4Z4HA 5KDDA 2Q5FA 3BKXA 1CG6A 2OXTA 1GA4A 5DNAA 4CMHA 5EVCA 1RYYA 2B7LA 1FTWA 1NPYA 3VBCA 4KAAA 1HV8A 1PR1A 1Y1KE 5LYJB 2RJOA 5H3HA 2X2OA 2Z98A 3TZ6A 3HR8A 4G4JA 2R68A 3EVBA 2CJWB 5LA6A 4MTLA 1RVDA 1V4BA 1ZL0A 1SBCA 2JFOA 2HRQA 3ZJYA 2P9TA 2I3DA 3MAJA 1DHRA 2C2WA 2ODAA 3FHOA 5A3VA 2POQX 3GYBA 3UG7A 2NMVA 1YZLA 4AMUA 1TM1E 3T0GA 1RLIA 4N0EA 3KV3O 3V7WA 4C87A 1VLHA 4BNDB 1NYLA 3NUZA 1QGUA 1FRVA 2XH8A 1UPXA 3B38A 3ONNA 4IUDS 2EKBA 1M0SA 2XXJA 3DD5A 3PC6A 3KYIB 4HLNA 3AV3A 4NH0A 4LC0A 4HR7A 1A04A 3KOOA 5E6UA 3VNSA 4PAOA 2BEWA 5FTKA 4YUZA 2HT6A 1V7PC 3UAOA 2HMUA 2ZJ6A 3AUYA 4FE4A 1FK8A 3BREA 3EGVA 4I14A 1IWBB 4QATA 1GR1A 3ROXA 4BMDA 4D8WA 3BFJA 5KC9A 1XUOA 2YZ2A 3KBBA 3NASA 4R1PA 1B3BA 1C14A 1OFTA 5F3DA 3CMCO 1JDJA 2WJ4A 3O8NA 4RPKA 1L5SA 4X0EA 1HDOA 3KE8A 1A4UA 3PWZA 2ETXA 3FM9A 3VA7A 4UMDA 3ED5A 4HD8A 1L5HA 1GKLA 1VL2A 1JT9A 5FTWA 2WOOA 4ERXA 5EZQA 2KE5A 4HCJA 1ABBA 2P41A 4TYQA 1Z8DA 3E1SA 3NRCA 3WLPA 3EXG2 1P4AA 3W5JA 4YV2A 4GIBA 2YDYA 1ST2A 4M1SA 1COWD 1YQUA 2JHPA 3D6FA 1SC1A 4OYRA 4BJ3A 3C3BA 3OA2A 3NP7A 4P83A 3ZGYA 3EIWA 4EQZA 4RPJA 3A6FA 3VO1A 2ZP1A 4TYMA 2CBXA 3AJ8A 3KD3A 3MSXA 2C2XA 4P7KA 3MFYA 2H8KA 2JASA 2V03A 3P2YA 4ARSA 2QI9F 3NYWA 2A33A 4LVCA 4Q4CA 5D7BA 5E1DA 3OX4A 2ZKIA 2Z8ZA 5K8IA 1BJTA 2CEKA 2PGLA 2VBCA 3DEIA 2NU9A 4JLWA 5KNCH 3SVLA 1LRKA 4BASA 5JDCA 3NC0C 2I7TA 1NJSA 1JPNA 1E2KA 2X3UA 4N12A 1JQKA 1M74A 2JL1A 4L95C 4LJKA 5CH5A 4YTEA 2AMLA 3P1JA 4B35A 3RB8A 4D6XA 5C5IA 2JW5A 1CV2A 3RRBA 4HDMB 1G5PA 1TQ2A 2DKNA 1CQXA 1KTVA 4LWQA 4ZAWA 1ZESA 3QNMA 2ODQA 1J25A 2CBGA 2I0FA 3DLTA 4DLXA 1G5FA 1X0VA 1A97A 2CLOB 3LTEA 1AMUA 3M1LA 1MX1A 3H5TA 2DSTA 4IHQA 2VI5A 1KJ8A 3I73A 1S1CA 1N5JA 1VECA 4B5LA 3DNFA 4EENA 1G8PA 4YBRA 2LGJA 5KDLA 3OPYI 4NJMA 3EK2A 4F85A 2CWWA 4WGFA 1RYEA 1A71A 1FTNA 1V47A 2C3PA 2NO1A 2ZATA 3IUJA 4H0NA 3RO7A 5B7NA 3HWWA 2H1HA 2GDZA 4EHBA 3LP5A 2FFBA 2NUPB 2FQQA 3E9CA 4ZN6A 2AE1A 5LDHA 5ESWA 4J6FA 1DV1A 2WPDA 2Y66A 2HEGA 3JVVA 1YJAA 5F9MA 2AC4A 1NRIA 1ZOIA 1KC3A 2ZWAA 2BMAA 3NH6A 3NNDA 4E7PA 4ZCMA 2IF0A 2FMUA 2G8NA 2PL3A 2C54A 1OKKD 2WF8A 4H59A 3L7AA 5GM1A 1FFYA 4LISA 4BNZA 3HB4X 4AKSA 5AI4A 1NQOA 2BWJA 2BV3A 4ZQGA 3KC2A 2JCBA 1LVUA 2ABWA 4XOIA 3ASZA 4FCTA 4BGUA 2HPVA 3RYHA 4UTNA 1V2HE 1W4RA 2Q5JA 4OH7A 4Y2PA 3WGTA 4ZOLA 1D6JA 1QG2A 4QHYA 1JTFA 1I5OA 5CA1F 1SXJD 2FZ5A 1NLUA 2P5TB 1QRSA 2FKAA 1FFGA 2YHIB 4PHGA 4C0BA 5LVAA 2VATA 2HOQA 2PANA 3PHJA 1GQQA 5JVDF 1PWEA 3DT9A 1H2BA 3L7YA 2JCYA 2RH5A 4L8YA 4G63A 4L9AA 5CGQB 4C5AA 2ILVA 4G9BA 1VA5A 5AKEA 4TKVB 2FQYA 3M6VA 1MJGM 5TQ0B 1YJ5A 3GXOA 3WKCA 1CZRA 5I4KA 4BIIA 3I34X 4RVNA 1JIQA 1Z5VA 3MWLA 1XHFA 5DM0A 1GNVA 3AZQA 1SCQA 5LUBA 4HDNA 1HSOA 3JTMA 1PT6A 3EXG1 3HYLA 3LCJA 5G1PA 4GXQA 1Y6ZA 3UMBA 4V1CI 1PTJC 4M88A 3S28A 3N53A 3UAVA 1E7QA 5B3JC 2RH9B 3ORRA 1S7GA 2VQSA 1FMJA 3KT6A 5ISMA 3UJ6A 2ZDHA 4H17A 1E2HA 1J1IA 1JKMA 1HY3A 2GZ2A 2M9MA 4LWZA 2D1YA 2PV0A 4OAQA 3OE1A 2Q6IA 3T7CA 2ATXA 3AKZA 1C30A 4QDJA 2DSNA 3H97A 5FA6A 1MNQA 5ENZA 1UF9A 3K3PA 4PXSA 2AQKA 5BWOA 1ECFA 2XZOA 2YINC 2FN4A 3CZRA 1YRAA 4AJOA 1E69A 3CX4A 4OUDB 3DZJA 5CH3A 5LIRA 1FYWA 1NW4A 3FCXA 4MUGA 3JQ6A 5KI6A 4E2YA 1FFBA 2K2QB 3F8WA 2P3OA 3KSMA 3GUVA 2A58A 3ZH2A 1K63A 3FCSB 4DM4A 2NU6B 4JLPA 4PV7A 5LQUA 5FOSA 1JDUA 2JLSA 2XJ4A 5FBLB 5DNWA 2C0CA 1CRWG 2IEGA 1JWBB 1KZYC 2NO5A 3LVBA 4Q3EA 2XB9A 5EJ6A 4HQOA 2Z6AA 4OKSA 1L5QA 2IUSA 3IH5A 1IMJA 3P45A 5D00A 3W78A 4D0SA 4TYNA 4FKMA 4WBNF 2H8GA 3PYMA 5KO2A 4G1UC 4RGYA 5K0ZA 5BV2P 1V43A 3IGFA 1U2DC 3MPOA 4CEJA 5GJVC 1EGQA 2ZTUA 4QYXA 3RSSA 4WLFA 2VJDA 5LP6B 4QBGB 1PNRA 2PZLA 1OC4A 3AHFA 4L0QA 3D3EA 4GMHA 2LV8A 4PXAA 4TMWA 3ZH9B 5HJ7A 3H19A 1GRQA 1JX6A 1NMYA 4YB8A 2QORA 2R8ZA 4JWTA 4PINA 2PT7A 1BGXT 3DKRA 4LV6A 4GOXA 1R2QA 3L6RA 5DNEA 5KWVA 3BL5A 4XCQA 5BNTA 3L8YA 1OH6A 3EXHC 3AV0B 1CE8A 1YRLA 3HYRA 3TVTA 3WK9A 4Q3AA 3ZZ1A 2HBRA 2XTAA 5JY1A 4DSTA 2I3ZA 3RVPA 1QE5A 2IT1A 4R54A 3X1MA 1SXJC 1LF5A 3IC5A 1JXQA 4BMNA 4CM4A 1QG0A 3FDIA 3WICA 2NACA 3D1JA 3BSYA 3EC7A 1X7XA 3OQHA 1ZDMA 2NTYC 1IB0A 2PQMA 2XNHA 2WHPB 3A11A 5AK5A 3G02A 4DZRA 1CUHA 1EFRA 2GXQA 4KVGA 1UP7A 1QRUA 1KI6B 3DDCA 1LCIA 1XK6A 2BFNA 3N7TA 3QP9A 1KNQA 2G0AA 3UJHA 4UQLA 3ZE0B 2WK1A 2IE8A 2YY6A 3AVQA 5ERXA 3GGSA 2KPOA 1EM8B 1JEQA 4H1UA 3WHLA 3AEXA 3AJDA 2FMKA 2GVDC 5JSFA 3CVXA 3C87A 4Q5IA 3L8EA 1T0JB 1JVNA 4US0R 2QSUA 1XI2A 3HR7A 3RC7A 1GDHA 2W6ID 3VR2A 1LRLA 2WKPA 2XMGA 1VGRA 3GJ5A 5F7OA 3T35A 5I7WA 3QFTA 4IQGA 4F6LA 4DLYA 3CURA 3AG6A 1LV8A 4IDOA 4MJXA 5C7YA 1DU4A 3WDMA 3ANSA 3BSSA 3WS7A 2PUJA 4YJ2A 1UBKS 3IALA 2ZLBA 4CMKA 3N7AA 4D4KA 1EUCB 1WCV1 1YJQA 2BI8A 2I4IA 2J9XB 5EFZA 3VKUA 3KXLA 4G07A 1AMOA 1CB0A 3FSJX 4M89A 5FTJA 5D01A 1XCOA 2SCUB 1EZ4A 2A67A 2RD2A 3UW3A 2WAOA 1D6NA 4RS3A 1T15A 1XRQA 1BJRE 2A7QA 2FOIA 3BMCB 3E81A 4BC1A 3HJFA 4YV0A 4RTLA 1XLTC 2NV6A 3MCWA 1EVJA 3NT2A 1WDMA 2DFPA 4HNVA 2I62A 3LHSA 3A10A 1VJ0A 2JGNA 3RT7A 1JU4A 3FPSA 4IF4A 1PS0A 1YMUA 4NS1A 3X1DA 2ZAOA 2CT8A 1YZQA 1VJGA 4F11A 5BV1A 5KSPA 4HNSA 2CXNA 1LPSA 2GEKA 1OI3A 1XZAA 1ZOPA 3R5FA 1A9SA 4IEFB 2VNSA 4U7GA 4XIGS 2IU3A 2CD7A 3DBIA 3T1HB 2EF0A 1NQUA 3CCFA 2YN0A 5I7OA 2C9DA 5AT1A 1N2SA 2YNMA 2XUJA 1R8YA 3RTCA 3T0IA 4ZVPA 3AM5A 3H04A 2YVLA 2QL5A 4J0HA 3B48A 5JPCA 4HN4B 4DIBA 3LSYA 1G1AA 1JQJC 2WVAA 3LXXA 4MWOA 1G60A 3R7DA 5IBCA 5IKOA 4CR6A 4RVDA 2HSGA 4PRLA 4HNAA 4OL0A 1CSEE 4ND4A 3FNGA 4MEBA 4Q4JA 1E3DA 3JQEA 4H1VA 1C2YA 3MS7A 4QJBA 4DV1B 5LD2C 1W34A 1UJBA 2V6BA 1YIDA 5EL0A 4NRDA 1BA2A 3NC4A 4KKXB 1V96A 2XMCA 3AF4A 5A03A 5KNDA 1VPDA 3IAEA 1CXZA 2PZJA 4NG5A 5EWJB 5LB4A 2V7UA 3WGMA 4QT4A 4UUPA 1OXKB 3VPAA 2O52A 4I3GA 1CQWA 1V1RB 2QNBA 5HMMA 3S2YA 1VIVA 4BO4A 1AKUA 2UXCB 3D59A 4MP8A 5CDYA 3N8IA 5DN6D 4PYIA 5ALKA 1SQ5A 2BOVA 4H7DA 4CIDA 1J4AA 2PSSA 5KHLB 2WFLA 4PYMA 4LOHA 5E2BA 4RVUA 1P1RA 2MSCB 3T4EA 1PBTA 4BVLA 4DGQA 4BLTA 1RYZA 4PSCA 4JKYA 3UA4A 2PGNA 5A05A 3KXDA 4V1CB 1JDNA 2HQ1A 1MZVA 2XJ9A 3BJEA 3K6KA 3K09A 4S12A 2F3SA 2FUKA 4I5GA 4AUEA 4NU6A 3ZEIA 4AKTA 2X58A 4JKIA 4QOGA 4Y2HA 4L1KA 2CJWA 2WIDA 2ZIXA 5JRJA 1EESA 2AR0A 4WWHA 2JA2A 4C1BA 2DHQA 2R8BA 3MTAA 3R5KA 2HO5A 2W98A 3IAUA 4FW9A 1ZZEA 5I8PA 1ZIDA 1NNSA 4I9UA 1V48A 1GWNA 1Y0BA 2ORIA 2PUHA 3WLAA 2CSXA 2J0SA 1RMYA 2Y1OA 4K9PA 1TEVA 4ESHA 1NC3A 1Y6FA 1NBME 4PM4A 5AI5A 3KUXA 1MABB 1K6EA 4TV9B 1LBTA 5DK6A 4II2A 3AR9A 1SBZA 2HJSA 1ZY2A 3FWYA 2I6FA 4EJSB 5C1BA 3ABSB 4IG9A 4OQYA 4CF7A 4WXEA 1B74A 1JQ3A 2QRNA 3M5CA 3SYRA 3S1SA 3IOMA 4H6WA 1IBSA 3RJTA 2F9FA 1A5SB 4DNPA 3FYCA 4TSFD 4XQEA 4BJ1A 4F2HA 3G0HA 4E5DA 5JC8A 4LBZA 2CFCA 3RUFA 1QFMA 4ZQHA 4E22A 1QORA 3CEPB 4WW0A 2WQ7A 3OZGA 3Q3HA 1SXIA 4JFRA 3N2GA 4YT5A 1H42A 4KH1A 1Q6YA 2CXXA 2FG7C 4D96A 4HAVA 3SHOA 2NAPA 1Q1EA 2D2FA 4U6SA 4YCNA 1EDZA 1OT5A 3H9CA 1NV8A 5EMKA 5TC4A 4XRRA 1E6WA 2CE2X 3U40A 2H9AA 4IINA 5D51S 5HGJA 3ZY4A 1XRLA 2FHSA 4E6PA 2BE7A 5A0VA 4BFTA 1GOTA 3EEFA 3EA4A 4JB0A 4JP2A 5DULA 2VIIA 2XV1A 3TSWA 4HFNA 1MT0A 4ZCPA 4X3PA 2FN3A 3DZCA 4ESOA 1Z06A 3HKDA 4BECA 1EZZA 2C00A 5G4LA 3L7DA 4AIIA 1QOQB 1R37A 1TZBA 5JROA 2EKPA 2Q5IA 1ENOA 2OBMA 1RJEA 3UC5A 4BLOA 1CU1A 2PZAA 5A4AA 3GFTA 4JGGA 3HDTA 4I4TB 2PL1A 1E1LA 4Q7EA 1JE1A 4QU0A 1XTKA 1ML3A 3Q3VA 4HRYA 4MEJA 1EE1A 4CN8A 3RJMA 2AR7A 4WXPA 3VDXA 2C95A 2O1WA 3M9XA 4CLXA 4IZHA 5I48A 4PIMA 1BX1A 4R8VA 1Q57A 3UGQA 3WSWA 3TECE 1NMEA 2OGZA 3AIMA 1ZCFA 3RYFA 5H7XA 5BW8A 2FLKA 2ET6A 4HMPA 1CDZA 3U0BA 4P3KA 1UKEA 5LWQA 1XQ6A 3RDPA 1VKRA 1T3TA 1FFHA 3F49S 3QKIA 4GI3A 1VZ3A 4BVBA 2O19A 4IL5A 3E0QA 4UBMA 3PXXA 1GAWA 2IIBA 1JQBA 1YK0A 4J4HA 4Q21A 3AM1A 2QHXA 1QIFA 1TYBE 1OXMA 1U6IA 1Z0SA 2BGNA 2XCLA 4D4GA 1TCUA 2RC5A 2REQA 3GROA 2WUGA 1I10A 4WI1A 1E9RA 4ZGBA 3VDQA 4UHFA 3ZD8A 2JHCA 1C4WA 1V4NA 2NIPA 1UFVA 3CN7A 3LQ1A 1ZUWA 3HYSA 4KXNA 4RK4A 4EA8A 2XEXA 4G9GA 3S7ZA 1AF4A 5K3SA 3G79A 2DFNA 3DVAB 1EA5A 1NXVA 1R5NA 3UF0A 4X66B 2XT6A 4GRAA 4WT7A 5HFNA 2QAJA 2IIQA 3GZNB 4RHFA 1HQKA 1WNTA 3HP7A 2PX2A 4ZV9A 5JS1A 1ODKA 1VG0B 3P9NA 1DOHA 1M2VA 2B7BA 4L75A 2J9ZB 2YHIA 1EYZA 1MH1A 4P8RA 1YI1A 1Y5IA 3ZS8A 3EY4A 2R00A 1A9YA 1QIHA 2YIMA 4LMRA 4S1OA 3X1JA 4D0LB 3AKCA 1VPVA 2COKA 4ZT7A 4LF7B 2I3GA 2I4LA 2YYZA 1FDTA 1NKTA 3C3KA 3EDMA 3EG9B 2ZG6A 1QQ6A 3U3XA 4ZFNA 2XBMA 1CETA 3RV3A 4WZZA 4CNQA 2XGSA 1KS2A 3L0ZA 1PWZA 1JYFA 2NTJA 4QSHA 4R16A 2I8AA 2C2BA 2ORYA 4LZZA 4PX2A 1M1NA 4RD4A 3LYAA 3SN6A 5K20A 1ZPDA 3CE9A 2GAFA 5ED4A 2ASVA 3LVFO 5FWDA 1BMTA 2D3WA 3OLZA 3LCCA 1P45A 5SZHB 1ESDA 1HQCA 3V8EA 4EOGA 3OWHA 1O7JA 1MC8A 2A14A 3K73O 5ALJA 4BFYA 1Z36A 3DZKA 4BO5A 4MUIA 4JYBA 1MX9A 1J8MF 2BN4A 4IWYA 1OUMA 1L0BA 2ZETA 4RFVA 4B79A 3WO1A 3PNMA 1NOKA 1WHTA 1Z3CA 3MTGA 4H7FA 5JAQA 2OORC 2Q6KA 1DB3A 1NFRA 2VSFA 4MUYA 2VUHB 2PGDA 3O1LA 1CJKC 2I4MA 5ESRA 4A0SA 2ZR0A 1Q2XA 4A8JB 1DAGA 1WVGA 1M2NA 4ENPA 1VG1A 5GVRA 1V8BA 2NU6A 1NI4B 1E1RA 5EZYA 1MRSA 4FEEA 2DY1A 2V6MA 1GFWA 3LOUA 1P4SA 3EBPA 4TZTA 4YS6A 5IT5A 4JLJA 4TWBA 5K3AA 1XPJA 5FWXB 4BDSA 1G8KA 1M8JA 2CDRA 1GITA 2H57A 3PQCA 1G291 3NDJA 3QY9A 3EFBA 3OU2A 4CWAA 2YZMA 3THXA 4X6UA 1YO6A 4YRPA 2ATVA 4YCBA 3IXMA 2GM3A 3P71T 4WEQA 4H0CA 2FFQA 5AXBA 1K6XA 2WG2A 2NO4A 3TSOA 1I2DA 4UM9B 1CT9A 3IQDB 4HC4A 2ZRAA 2IYUA 3V4SA 4RLSA 1G7TA 2MINA 3K0FB 3RK1A 5JR3A 5LM3A 3PU6A 5EE0A 1S4QA 1Q3KA 2ADOA 3MQFA 4FWIB 1DIAA 5TRTA 3N3AC 3VYSB 5HE8A 3BN3A 4HQKA 5CDHA 1SELA 2VP4A 1P39A 2GHRA 3CISA 1WRBA 3KQMA 2FUG1 4K9KA 3LYHA 5F35A 4BLRA 5HOEA 3N0WA 2EJUA 1KWKA 1EIWA 3B12A 4C6RA 2GN4A 4X6XA 5E4FA 3ZDQA 1TVKA 1E61A 1C8BA 3ESBA 1U7HA 3KTOA 3LPAA 4FJ2A 4JGIA 4E5UA 3KUUA 5FJIA 3TM4A 3NETA 3AM3A 2FCRA 3DF7A 2ZTMA 4UTOA 1XIVA 4XVHA 3OY2A 3HVKA 2ZWMA 1P1BA 3CF4G 2WLTA 2ZK7A 1DC7A 3TOXA 3NBMA 5JWHA 3UH1A 1JGTA 1Q5PA 4X1YA 2FEKA 4A4DA 2CY0A 2EIHA 2GBFA 3A4IA 1L3IA 1SC3A 2EX1A 3IBSA 1TU3A 1W9HA 3I72A 4MPDA 1Y7PA 1BVYF 2ZTSA 3KR0A 4S0ZA 1NU6A 2GRUA 2IYEA 5JHHB 3ER6A 3OLVA 2GHTA 3SR3A 1VI5A 1ZN8A 4CI0B 3F2VA 2ZYDA 4HKTA 4XW2A 4ESEA 1KAQA 2B8EA 4ZV7A 1JDZA 5A06A 4RVGA 3E6AA 2HWKA 3I32A 4WRRA 4YPFA 1A2KC 2GBIA 5G0UA 3LF2A 3C7KA 5TT0A 3ZV5A 4CUZA 2P9HA 5FKJA 4EF4A 1JNYA 1H9BA 1KH2A 1P4RA 3VTZA 1PQPA 3ISTA 2E5WA 5HIIA 5EHXA 3AOEA 3EZNA 5AJTA 2JHFA 1XVIA 1TCBA 4LXHA 5IARA 2IPLA 1IN4A 2HEIA 3VNAA 1J56A 3VU8A 3DKIA 3ESZA 4JVNA 2RK6A 3IBFA 3HJGA 1KBOA 3PX7A 3BJMA 4MS3A 5IYZB 1C2TA 2E4WA 3EIOA 4ZRDA 4A8PA 2VXYA 2J9YB 4WZBB 1MLDA 2R0QC 3F6BX 3I01A 2GA8A 2PJRA 2VAWA 4TXNA 2Q5QA 2R1VA 1Z0KA 2WTMA 4CMJA 4PZEA 3PHLA 4N5NA 4UUNA 3FX2A 1WCYA 5EIEA 2OCDA 1ULTA 4XFJA 4FFBA 2RFLA 1AMNA 1BHQ1 2W8ZA 3WYFA 3OPYA 4LNUA 3MTEA 5K3EA 1DEAA 4OIFA 3KHTA 3OF3A 3DWGA 3VKFA 1NI5A 2MR5A 3S1AB 3JY6A 3GHHA 2QT9A 1O94C 3WQSB 1YNSA 4LC1A 1RR6A 4O4IF 3QOFA 4MKXA 1FFXB 1X6VA 3IQXA 5G1OA 1HNXB 1EFAA 2IH5A 2AJTA 2HT1A 4BQPA 2E5LB 1FTSA 2OECA 2Z8YA 5B1SA 1JSXA 2GZHA 3AY6A 3Q3CA 4JVLA 4L9RA 1XPRA 2PSFA 2QLNA 2P30A 3EGXA 1KRHA 1IK6A 4YDHB 1VB3A 2OYSA 1UBUS 5LDDC 2BJHA 4G24A 5CNJA 3EWNA 3LNTA 4W1QA 4H77A 2BTQA 5CYPA 1BWRA 3MJSA 2PSDA 4NE7A 2V96A 3B60A 4E2FA 4KCGA 3U7RA 2W5UA 1VLVA 3EGCA 1A3CA 1GPAA 1YBHA 1Q44A 4ZAGA 3TIGA 1A5BB 1YC2A 2PS0A 3QXCA 4YJHA 3N39C 3WGOA 1VMDA 1W35A 4IIBA 5AUOB 4QYIB 4XLZA 1GFSA 4EYQA 5ESDA 3EBLA 2OV6A 3LGXA 3REOA 2ZE5A 3ORQA 3UV7A 2BC9A 3ZWWA 2IYNA 2PNFA 1EB8A 3CV3A 4M1ZA 1V0JA 1VKZA 2MSKA 4GL2A 2CK3D 2HI0A 2B2NA 3DYIA 2HXYA 5TPZA 4BFXA 4ECEA 3DE0X 1KMQA 4YMIA 1W96A 3SDZA 4BZWA 1TM2A 3KYDB 2XKAA 3MG9A 1WSDA 1X8JA 3D1LA 3HJUA 1WOMA 2PK3A 4CFZA 3WWCA 5L4LA 1L7QA 3LDFA 3VZDA 4G2NA 3UJNA 3O3NB 2JIQA 3KVOA 1E2JA 1HI9A 1DEHA 2YS6A 3Q6IA 1DNPA 1N6NA 1GSAA 4GM4A 4WNAA 1RBYA 2XPCA 5DIFA 3TGPA 4M9XA 1NNUA 4TMVA 4Y0AA 4LQDA 1JXMA 4BBJA 4K6HA 1ADBA 2QM0A 3A04A 3EZFA 1I1OA 4DDTA 4Q1EA 3IULA 1J09A 1DCFA 3E84A 3AWDA 4ZHSA 2HDHA 1O4VA 5F9HA 1ATIA 3U7HB 2ZIZA 2BBTA 2V6FA 3AR7A 5KVSA 4N8EA 1E59A 2AK2A 4Y9SA 2OSBA 4B46A 2FH5B 2LR0A 4ERNA 2B8JA 5K2OA 5K8VA 1CJUC 1PR4A 2E4XA 3NTXA 1RWQA 1K2WA 3N0RA 3BF7A 1QVAA 4GDFA 2J09A 2JGAA 3KM0A 3QPBA 3ZJTA 3GCDA 2RI6A 1G0OA 3UAZA 5K5EA 2PMWB 3HUEA 3HNRA 3Q2IA 3WGNA 2X5OA 2ZRNA 3NYRA 1CQPA 2G1AA 8OHMA 3MAGA 3OTQA 3PPXA 1GLVA 3ZGXA 1SBHA 1WMEA 5IVKA 3AVYA 5HKLA 4RVCA 1XBTA 3BCRA 2AW5A 1TIPA 2QAGC 1D1PA 3MD0A 1I9CA 1SKQA 4ZVSA 2GYUA 3VXKA 3ZQJA 1MB9A 3D6HA 4WK0B 4LJ9A 2FPSA 1TUIA 4JT4A 3P9QA 1X3LA 2YVAA 4YJGB 2GEBA 2QN3A 4IUBS 2J3HA 1HNNA 3BXFA 2L42A 2JIDA 4J1NA 3C7TA 4E31A 1K4KA 1T3HA 4OAPA 1B6TA 1M75A 5E4JA 5CFRA 1G64A 4CV0A 3BGIA 3I2HA 2W6JD 4YT8A 5A5FA 4DLNA 1E79D 3W6ZA 1GDTA 2X8BA 3MFQA 4HQFA 4HTAA 3RAFC 5DGXA 4ZQCB 5ABPA 5A5VA 3KO8A 2C3YA 1XQVA 2QTRA 4HTFA 4PGGA 4MARA 5KBYA 4GE3A 1X94A 4B6SA 4F21A 1PNOA 1W5TA 1HE1C 1WLYA 1Y6QA 2FXVA 2QSJA 5F78A 1Y9AA 3U0VA 2JF0A 4AMVA 3CNEA 1NN5A 4CG2A 1OJ7A 1JILA 2D6FA 1W73A 3H9EO 3LJKA 3KDAA 2ZT6A 3L6BA 3EDQA 1U11A 5DCWA 3CSUA 4URWR 1NW5A 3R7SA 2ONYA 4CKCA 2VTBA 3K1TA 3TNDA 3TB6A 4GU5A 5KZMB 3G5AA 3WYNA 1YQQA 1W1UA 4NWIA 3RS8A 4EABA 1SKMA 4CKYA 1KVSA 1E8MA 4GT1A 3Q40A 1SOMA 4YQEA 3RSHA 2YZ7A 1RTTA 3AR6A 3OHSX 1K8YB 2NXEA 4X84A 4HUQB 2QX8A 1HRKA 3C1TA 4XEHA 5HQ3B 5BVHA 2WT4A 4WASA 1FB5A 1T6YA 3V2HA 2AJDA 1BD3A 4JBYA 5ULLA 1SURA 1SULA 1U3TA 4FGLA 2QL6A 2OVBA 4AROA 1XYVA 4RELA 4TMZA 3MF4A 1XTRA 1WV1A 2P62A 2WWGA 5TXGA 4MDEA 4I7EA 1KEKA 4DSUA 1ZWKA 1AO3A 2JLYA 2VBGA 2OYCA 3LO8A 2H4FA 1L3CA 3GLHE 5A4DA 4YHHB 2IYPA 5EJEA 3FSEA 4HDQB 1OLUB 5CA1B 2Y3IA 4AI6A 3A0UA 1U8YA 2OFOA 3BWDD 4OLJA 4YMVA 3DFZA 2B4YA 2H31A 4I1VA 2DY0A 4P31A 5JVDB 4JP3A 4CPDA 1HE3A 2YYYA 3UWPA 3SJZA 2VC2B 1NG1A 3MWEB 3ULKA 2D1SA 4FNMA 4HMQA 2M6KA 4OLAA 2V98A 4OA8A 5BSRA 3M6MD 1NVVR 2A0WA 3AY7A 3A25A 2WM2A 3BK1A 2B8NA 3GJSA 4BPBA 2Y71A 3IKLA 2NO7A 4OXXA 2NP7A 1RKVA 3EAFA 4Q7JB 3AONB 2G4LA 3DG9A 5BQOA 3H65A 2Q7DA 5FPTA 1Q7GA 4XWAA 1HDZA 1Z07A 4XYGA 3WL4A 1JG6A 1O9BA 4OK6A 2XCTB 3BORA 3T15A 2YJTD 4L5BA 4BS9A 4FLMA 3HL4A 3DVAA 1ZXLA 2VDKB 2LDXA 3LECA 1JJVA 3O31A 4N0PA 2FVYA 3NBYC 1EXVA 1TKBA 4C0QC 5GOTA 4X20A 2OGUA 3ZTYA 4QJ3A 3PCRB 3FBWA 3JVUA 1XZIA 5LZ5A 1JG3A 5F7ZA 3CT4A 4ENVA 1TYAE 4TV8F 1UWVA 2CL7X 3OFND 1ID1A 1E1KA 1TMYA 1OE0A 1F4PA 4GI2A 1Z29A 3AY3A 3RRYA 4QOHA 3HI6A 1TU4A 1NSYA 4BXOB 2AUTA 4K1LA 1JDVA 4QT0A 1YA8A 5FIUA 2JB9A 5AW3A 1Z12A 4MPTA 3BXOA 4NEHB 1P2UA 3CNQS 5T67A 3T94A 3VNQA 4WBNB 3WRVA 3I1YA 5F2NA 3I58A 2BH9A 3NZEA 3UXYA 3L6DA 4UREA 1XJ5A 3ZVRA 2J48A 4AMZA 5AOVA 4CLHA 3RAEC 2EQBA 1JDTA 2EU8A 3UPUA 3PC4A 1MW9X 2HIAA 1WD5A 2IL1A 2HLNA 3WJ2A 1D6MA 1G8FA 3T3DA 1R6UA 4Y6PA 4DG9A 2GF0A 3HXQA 5BOSA 3E03A 1PUIA 3C48A 3MCVA 4M22A 4UD6A 5CVJA 4XJVA 1KI4A 2OV4A 2DWOA 1PR5A 2IDJA 1J8QA 3COPA 3FKSA 3JU3A 1Z8FA 3OCXA 3OPXA 4ZVMA 3WX0A 1O0CA 1EFVA 4GWKA 4G0ZA 1NI4A 1QKIA 2VSYA 1KFKB 4OOEA 5JD5A 3TE7A 2RHHA 3M1AA 2WJ3A 4ZQFA 5FWXA 1KYTA 4NBVA 4D98A 3N74A 1ZN7A 2YQ4A 4R1LA 5CXUA 3O94A 3OOEA 5EIFA 2JDIA 1YB5A 3SS8A 1SBNE 1XTTA 2UDPA 3A4YA 4TYPA 1THMA 2OC9A 3UK1A 2CYAA 2EX0A 3JQAB 4KVAA 1NW3A 5FOWA 1NZDA 2VCYA 1Z5OA 1XWWA 2GF2A 4GKKB 5CDGA 3AEKA 4MWZA 3JARB 4QG3A 2XUFA 4FZJA 2SECE 4KXUA 5F33A 4K0RA 3FNHA 3AL3A 2GWHA 3GQVA 3ANMA 4ZIRA 1U3GA 2EVWX 4QHTA 1NU8A 2R6FA 1XV5A 3LQYA 4QYTA 2NP6A 2R96A 3H3XA 2AFIE 3HY3A 3VZCA 1BS2A 3IAS6 3B5EA 1JHDA 4G0XA 4LBYA 5G3ZA 3ZV4A 5KHAA 1IJBA 4I81A 4F5EA 3Q8LA 1QU3A 3QWFA 3RNLA 3W5UA 5D85A 3G0GA 4PO8A 4R3UC 2WQZA 1G7SA 2IPNA 3WWYA 4Q7LA 2QMUA 1QVRA 2A9OA 4QLOA 3IRVA 1KDYA 4N0MA 4U1RA 3OSZA 2X5NA 4PQEA 2IHYA 4C0WA 3V9PA 2LCIA 3EAGA 4JSRA 2J3DA 5AFSA 3BGWA 1A50B 1T5TA 3E58A 4DADA 2QAIA 4R7ZA 5HDQA 1LPAB 2X86A 1XAJA 4TVKA 1QBGA 4Z3DA 3VDMA 4LWOA 4E4TA 1WSWA 1WPXA 1B1AA 4Q9NA 3BRWD 3GFOA 4X00A 5CJPA 4EZBA 1UDXA 1VXRA 3MINA 1E4YA 2FPGB 1KNXA 5K0LA 2QLTA 2V5VA 2WHXA 1LPBB 1T35A 4MLPA 4XYBA 1O0SA 1QO0A 3UA3A 3G6WA 3QGMA 1GJRA 1L5GB 3PXGA 1Z2DA 3FOBA 4MLCA 1BFKA 4K3UA 3OOYA 2P6MA 5T6MA 2F7SA 3P9XA 1L4NA 1HLDA 1K0UA 1E2QA 3ZZUA 4BNNA 3SHVA 2LW7A 4B7XA 5C7IO 1RHJA 3VNVA 1GPWB 4NULA 4KR0A 5T57A 5KJFA 2VA8A 3DFKA 1QAMA 3IDFA 3RLFA 1Q20A 2TYSB 3AHEA 1W0KD 3TNLA 3WLTA 2XCRB 4GBMA 1Z0ZA 3FDZA 4BAGA 5A1JA 2NQ8A 2J0VA 2OLKA 3EA0A 1ZONA 1PJAA 1RFLA 3B2EA 4XJSA 1D2EA 3PEFA 2ICAA 5ETJA 1GEEA 3L0CA 3DJFA 5HF8A 4XASA 3T9BA 3CMMA 3KKLA 1T2EA 4OX9Y 5BVGA 3LIPA 4MNTA 2FEPA 2Q4TA 3DZIA 4J03A 3EUEA 5J2TA 2C7QA 4KACA 1OYYA 3S4YA 1B6SA 4WFQA 3N59A 1QVVA 4A6DA 2IGBA 4HS4A 2IDZA 4RPLA 1X70A 3OWXA 3S1AA 2PQ2A 4IYRA 3PTLA 3A26A 3LPMA 1TCCA 3OUTA 3FVWA 2GDJA 3WNQA 1FFXA 4CETA 4YRQA 2YY7A 4QFDA 1E6CA 3UMCA 1LDMA 2Q9CA 2WFMA 4IJ5A 4UTPA 3D7LA 5FRDA 3IAS1 4UHKA 1KQFA 2Z6UA 1SU7A 1OBFO 3PC8C 4TLBA 5FPQA 4KQ6A 3VAYA 3STWA 4UBNA 3HWX1 4D1YA 2HCBA 3O8BA 4DG5A 4EYGA 2GR9A 3G2PA 5T4HA 4W5HA 4N48A 4EY8A 5CX4A 1LDNA 2ZZKA 2PFSA 1T1SA 2O1XA 4IH9A 1I51A 4FFNA 4J16C 1AUVA 1LKZA 1GG5A 2AMJA 4R8SA 3ANXA 5B6IA 1DC3A 3VYUB 1LC0A 3KOXA 4C6TA 4OQEA 3MT0A 4P0TA 1AY0A 5DMHA 5EJ7A 5KQLA 5T5QA 2PMCA 2VPIA 3FPFA 1G17A 2RHBA 4DT1A 1CY2A 2ZKLA 4G0UA 1BXKA 3PQFA 2QD3A 4BHTA 1O4WA 4FNOA 1E0JA 2LP4Y 4YMTA 2WICA 4PRZA 4W1PA 7AT1A 4M1OA 4RK0A 3PENA 1W36B 3ELWA 1Y8CA 1ZRNA 4RFSA 4RTKA 4OHPA 2KI5A 2WJZB 9LDTA 2CLSA 2O07A 2PH3A 1Y3IA 4KPUB 4FYHA 3DXZA 4BV8A 5CT6A 4RQBA 1ZBQA 3VNUA 1BDJA 3PX3A 1BS9A 2IS2A 2P40A 4Q1CA 1IBRA 1A9QA 1ORRA 3RC8A 3DMTC 1GRCA 5AVTA 4S35A 4B76A 5E9JA 1UBTS 3VH2A 1GU7A 4JLDA 2FWBA 2GZAA 2G9ZA 4KJXA 3RCBA 3VV2A 2AEFA 3R3UA 3CNBA 4J4BA 3RG8A 4BNWA 5KC8A 1JF8A 2WJHA 1N1GA 2HBYA 4UEWA 3ZLTA 1JFTA 3D7RA 3SXJA 4D8TA 4XYMA 4DVGA 5AW7A 4GC9A 3GAAA 2QOEA 4C89A 2JZCA 4BCBA 2AOXA 1Z6PA 3RFCA 4NBSA 4ZVVA 1Z6AA 5KNLA 3VH3A 5FO0A 1HZJA 2GKSA 3KOMA 5K8CA 2X0KA 5KYGA 1AQYA 2X6TA 2ZB8A 1QYXA 4FILA 3Q88A 1UK9A 3KLNA 3AVXA 2ZE6A 1ZVMA 3C5CA 4Y9TA 5H82A 4BO3A 2UVQA 3UFBA 3HLTA 2I1LA 2D2IA 4ZK6A 4HNTA 4YY3B 2CUZA 3SQMA 5ALMA 5BO5A 2WB2A 4TT8A 1TO1E 1YACA 1PEDA 1FUEA 4ZZ1A 3H5LA 4M0PA 1SIWA 3HBNA 1BW9A 1R9MA 3WBFA 1NRWA 1VZ2A 2HJVA 5JUWA 4QM7A 2FZCA 1CR2A 1YZUA 4BFCA 1SXQA 1GRNA 3IR7A 2ATEA 3KPYA 3OZRA 2B0CA 1R6TA 5HP4A 3CR7A 1PIWA 1Z47A 3KZXA 3L4BA 3W2HA 3FOZA 1QX4A 4B3XA 1JI3A 4B4WA 2PV7A 2C2ZA 4F2DA 2YFYA 4HZGA 1Q2UA 4UTVA 3OQIB 3SBXA 3TRKA 2FEOA 4C7XA 5IHXA 3PLRA 4QXMA 3FPGA 1YQWA 3WSVA 1HLPA 2UVPB 4IXDA 2MHCA 1EUQA 4QDZA 2PRZA 4C6HA 1F6DA 1G66A 4FFPA 4C05A 2HK7A 2MR6A 1N6PA 1QPBA 1ZGGA 2OHHA 2AG8A 5BSFA 1XQYA 1U1CA 3KVYA 2H1VA 1I24A 4OJQA 2WKQA 4O5OA 1CUIA 1D0SA 3HN6A 3RVLA 5JWOA 2BSAA 2P9JA 4DCSA 1JIVA 1A69A 5DLPA 5CXQA 1ZNXA 5JZVA 5DF1A 5C3UA 1U9IA 2GJKA 1NXTA 2B1JA 2P0AA 2QN8A 2ZSKA 1GO2A 3PD1A 1JJAA 1UDWA 3MOSA 3RC2A 3ZDEA 4C7BA 3HB7A 5BR4A 3KPJA 4ZTBA 4G4IA 2BR3A 1E89A 3G6KA 2OCGA 4DV3B 2A1UB 2WYVA 5G4KB 4BNYA 4ZT5A 2FSUA 1XQ1A 2GSDA 3N75A 5EP3A 2B92A 4UAGA 4M8KA 4UCFA 1R74A 4CGZA 2CFSA 3DFUA 1J7KA 2IK8A 1RXYA 3PHCA 3FPBA 4Q00A 5SICE 4EBFA 1C4OA 4IZOA 1KMHB 3MGBA 2V55B 4KWHA 4N03A 2ZRGA 1BE8A 3JAKA 3H2JA 1M0WA 2QM3A 3FZYA 3BQ9A 4F5DA 1CY4A 5SZKB 1UC5B 1QXSA 2OZLA 5DNUA 1M6NA 4Q9JA 5EIAA 3THWA 1Z2AA 2WV9A 4C88A 2ZTHA 2NUAB 5BT8A 3E22A 4O4LF 4I9NA 3PWKA 5C4GB 2EFYA 1PUJA 2IXAA 4HJXA 2RHTA 3GL9A 4DRZA 3OOWA 3PQ6A 2BCGY 2YJ3A 1P0IA 2QN7A 1BKYA 3HKEB 3QVMA 3WAKA 4EQ6B 1YL6A 4B80A 5EN4A 3A05A 3MWEA 2WU3A 1RKBA 4CFYA 2PYDA 2REBA 4F4HA 2OXIA 4JLAA 4Y1RB 4DR7B 3PVZA 3NR2A 4D3FA 4ODIA 2ZIEA 3FVTA 2OCLA 4C3UA 4F9EA 2VYFA 1Q17A 3R5JA 2PTGA 1Y6JA 4XZ3A 2JDID 3FH0A 4LDNA 3UUWA 1CZUA 2IZZA 5DX0A 1W7AA 2ZB4A 3THYA 1S7CA 1U3UA 4WPGA 3G2HA 5CEFA 5AW9A 1IC6A 5D5QA 5DP2A 3UKDA 7MHTA 1SK9A 4JNKA 4FZ5A 4PN3A 1BVRA 5KQPA 1UXKA 1KIAA 4DJ5X 3GVHA 3N58A 3E1GA 3AERB 5J5AA 3IKJA 3EPJA 2EYUA 2F1HA 2MOKA 3X1KA 3RUAA 4A73A 2ZFUA 4IIFA 1Q1NA 4R81A 4E5NA 2PQ6A 4ENSA 1O97D 4XX0B 4DLBA 1EZ1A 3BB4A 4PBTA 4MI9A 2OQVA 1SCUB 2PUFA 1PFWA 3DCIA 2EZ4A 4IG4A 3L5OA 5CVDA 1QH0A 3OUUA 1UBNA 4YQZA 1PGPA 4EB0A 5EP4A 3BB1A 3H13A 4G01B 4G1FA 1E3MA 2XNDD 3UUFA 4NICA 4KN6A 4JLOA 2PJUA 1ADGA 2P6UA 2ZE8A 3LZ6A 4KKVA 3UAGA 1OBVA 2XTJA 4XWWA 1QP8A 5EYPB 4PPGA 1I2AA 1VKJA 3QVOA 1DXYA 2I2BA 4BNMA 4AY3A 2BFDA 3PJEA 4DR4B 2HA6A 2MYNA 1Y3HA 5BN1A 1GKKA 3E7WA 1GP2A 5HF9A 1WPGA 2A9FA 2OCKA 5ALGA 4WKNA 4CKEA 3IE1A 1I7DA 1IH8A 1C3VA 4DA0A 1CUFA 1LNSA 2F8SA 2BI4A 4J0IA 4LHXA 2FX5A 3PUIA 4MW5A 4QIHA 3KB1A 4C7OB 3D4NA 2VHZA 2ID8A 3CLUD 3EZ7A 5JYBA 3U61B 1N5DA 3X1WA 2ZJAA 1DEOA 3LDHA 2BRUC 1S2OA 3LD9A 5CB8A 3TBKA 2IODA 4HVLA 1RQNA 4N5IX 1TUEA 3ZV7A 4UNSA 3GJZA 4AJNA 3KJEA 1EE2A 2W37A 1ULUA 4MWDA 5DHQA 1AJEA 5B4TA 4Z5XA 3OJLA 4HWKA 2RGBA 3ETGA 5HX7A 3TKLA 2BFOA 2PPVA 4GSLA 1QZZA 4PZLA 4GVXA 5TY0A 4ALNA 5C8ZA 4B85A 1T1EA 3LHKA 3CHYA 4S2UA 3T52A 4H4EA 2J32A 4RCVA 3VGJA 1XZJA 1CK4A 2E49A 2PL5A 3FGNA 2XWBF 3HADA 4WUVA 4C4ZA 5JEDA 1KY5A 4BN5A 1BGWA 5DFAA 2VP9A 2C57A 5BXYA 1G3IA 1WCWA 3S1LA 2QSYA 4PR0A 1MT3A 4FIZA 5EMHA 4XR4A 1MEOA 1LWOA 4EI7A 2DEUA 4M9SA 4G1BA 3QKSB 1WBJB 3GARA 4DCJA 5IVPA 1ZITA 1AM4D 2Z9DA 2QXTA 5DVZA 3AL2A 4JEHA 3KQNA 5L4NA 1I4OA 1CRPA 5ECYA 1UIMA 2PUBA 3EC2A 4FGZA 1Q19A 3BH6A 3ENNA 1DRWA 2HH9A 4QQFA 1SOAA 2F4NA 1AQJA 1BDHA 3NYQA 4QREA 1UQTA 3AFMA 3DEHA 4L6AA 3QLVC 2QPAA 4NOKA 4R51A 3I5UA 5IJ9B 3DOFA 3K2BA 4RKEA 3QBVA 1T3LA 2C7VA 2ZRDA 4PC6A 2XRYA 3PB3A 4MMYB 5DBEX 2H85A 5AVUA 1TQ8A 1JA1A 1FQKA 3MRVA 2REXB 2VRWA 3NOXA 1OH5A 2OP0A 1TB4A 3LQKA 2EQAA 4GWLA 1W5BA 5CXSA 3VSCA 1W75A 1R6DA 3DFFA 3OCZA 1VJ1A 4D4HA 2ZRIA 1ZWLA 3A3YA 3I4LA 3P9RA 4U02A 3REGA 3GH1A 2VF4X 5CT5A 2FPGA 4DJAA 5KU1A 1W2WB 2FFAA 1WKBA 5F1OA 1ZK0A 1ZK3A 4S1VA 1K89A 2XXAB 4LDRA 5K3FA 4LGVA 2AYYA 3KBOA 4JEMA 2AT1A 2OO7A 4MGEA 9MHTA 1N2IA 1DFHA 1SVLA 3P9KA 3BG5A 4Q34A 3QU7A 3QFSA 5CNMA 3BERA 4GP9A 4UCXA 1E2GA 2IHKA 4O4IB 4IAOA 4D4IA 2XWPA 4QBHA 3W06A 4B3HA 5IAOA 1G5TA 2W2MA 2FHPA 1OZ0A 1ZCZA 3G7SA 4FMBB 4WSOA 5F1YA 5JXHA 5KJCA 2H2WA 2EFGA 4UFPA 2OEPA 1VFPA 2P4HX 1VIAA 2UXDB 1NQWA 2QTZA 2V7XA 1U8ZA 3ZU3A 4DZZA 2IRWA 4KVZA 4KYVA 1QV7A 2OFWA 5LB2A 3WVNA 4YK7A 3U7GA 2G36A 5KNBH 5T4EA 1MDBA 1KJIA 1S3FA 2Z2YA 3CLUC 1XAHA 1H6DA 3AJ9A 1VCOA 1EWTA 3JCZA 4X63A 3V33A 1J07A 4MPRA 4B3FX 1IG3A 4MIKA 3S2EA 1NWCA 3DB2A 4HGNA 1AK9A 4I3HA 3FUTA 2IE0A 5K7SA 4MSUA 1QTRA 1X92A 4R2WA 4JUDX 3UENA 1QF7A 1IPEA 3EZ6A 1WHSA 2GYWA 4JIGA 3MJHA 1H2HA 4HZUA 1IU9A 1YDWA 2IYOA 5I4IA 1ADFA 3OU7A 4FOLA 3O8CA 3F8TA 3P9ZA 2G5GX 6PFKA 3EVFA 1VIDA 1K8XB 2OB1A 4JBWA 4ES6A 2QVCA 3GXBA 4AJIA 3WLLA 2C8VA 2FE4A 4PZDA 3KAJA 2PX6A 2CMFA 3G1TA 1ECGA 1ZK4A 2H5LA 3WNBA 2EP8A 2OLJA 3V00A 4WKPA 4RD6A 4YMHA 2AG0A 4LVNA 5DYIA 2W6PA 1M8KA 3G0OA 2H1SA 3W34A 2Q1XA 4XDYA 5LR6A 1ZNWA 2XNKA 4ISCA 4HP8A 1BXZA 1OXXK 5CNKA 4K9DA 1NVBA 2C2YA 2PZGA 3SZGA 4B83A 3OHMA 1KVUA 3LFTA 1V8DA 4PQGA 5LQJA 1WP4A 4AZ3A 3L9WA 3ENKA 3TFWA 1D03A 4II7A 2ZI9A 1Z3IX 2AEEA 5FX2A 1YBFA 1OAOA 2V8BA 3M6FA 3MJTA 3I9V6 3V2GA 2O5VA 2PFGA 4X1KB 3AVTA 3CLTC 1HYEA 1GZ5A 2LXNA 2AX3A 3B7WA 3L77A 3LOQA 1DIHA 4Q4HA 4U3JA 1HT1E 1W93A 1E58A 1NJ8A 5HWSA 3SK0A 4U7DA 2CW5A 2N47A 4RL4A 1QP0A 1P2TA 1Q1QA 1K5GA 4B4DA 5GIOE 2GN6A 1I80A 3SLGA 3HVUA 4KPUA 5DTRA 3AR5A 1KERA 3B51X 3ZWAA 4EHFA 4Z4GA 2ACEA 3I4FA 4FYYA 4Z2YA 3PK0A 2EATA 3ID6C 2EBFX 2CLHB 2Q3BA 4WJZA 4N01A 4GR9A 3CF6R 1QYCA 3DV2A 1MMFB 3VYWA 3WYAA 1YTLA 2BGMA 3GJ3A 1WE2A 9ABPA 1P8JA 1SCBA 4CDNA 2VL7A 4EA7A 4E3WA 2IYWA 2OAQ1 4ZEWA 3BJIC 2JJMA 1N7GA 3QG5A 1FNNA 3Q5EA 1X9GA 3N2IA 3TXXA 3CONA 1KEUA 1WKVA 3NDPA 5KU7A 3KAKA 1N2HA 3HUFA 4OL9A 1JAIA 1JNXX 2VZLA 4WMLA 1PQWA 2H9YA 1THTA 2ZCUA 5FNZA 2QX7A 3WDLA 1KK1A 2A94A 4KO3S 2RHOA 4KOAA 7YASA 2OFXA 1D2AA 4IP0A 4CJXA 5JAOA 4MLZA 2GAAA 2OO3A 4DV5B 1QK4A 2G8LA 2C1EA 1XVAA 4GI5A 4DF3A 2C0QA 3VKVA 3GCZA 3U1BA 5B2FA 3QLUC 3COVA 5AD1A 3AEQB 3BXXA 1Z0DA 3O73A 1S01A 1Z9BA 3B6ZA 3CBQA 4LYFA 2UUAB 2I54A 3AJEA 4V2IA 3ICQB 1YJBA 2P0YA 1XCBA 2Q3HA 2XZPA 3DHWC 1VL5A 3GNQA 4HEA6 3BE8A 2OPHA 4FSHA 4NBUA 5A0FA 3O83A 3FRJA 5F52A 2RAFA 3VJRA 2JLZA 1G20A 4HWTA 2QG4A 3ZWXA 2P27A 2ZJ5A 1SBTA 3A1EA 3VR6H 2FR8A 1FDRA 4BWYA 1PKXA 3PDJA 3PNYA 3TX2A 4AZ0A 4H3VA 4MS1A 1IUOA 5JDIA 5JXJA 4R5MA 3PFIA 3OQIA 3R0JA 2ID4A 3RIEA 3IAHA 4LCBA 4Z0PA 3DKVA 1T10A 1L4BA 3FB1A 1L5MA 3RHFA 2UVPA 3I9V1 1DQYA 5GV8A 3SQNA 4UHHA 5BNZA 3JS5A 1B0AA 3PGJA 3GLKA 2QUHA 2AVNA 4G1EB 3UJ7A 3G2NA 1E60A 3STYA 3ST7A 2GRJA 1Q1ZA 2AKAB 2BGJA 2FJ0A 4EZEA 1F9EA 3UEOA 5LMZA 4EUEA 4BX9A 4G3XA 3LPNA 5DHSA 4C4TA 1T36A 2VKQA 2JJ8A 4C4YA 1GNPA 1WXWA 2H4YA 3CUWA 5HJ5A 3OE5A 1C8LA 4K6GA 2NO9A 2BGIA 1X0XA 3PE4A 3DM5A 3ES9A 1KMCA 1KY3A 1WJGA 4ITUA 3UWKA 2GPWA 3WKDA 2QPOA 3TAHA 3CZ9A