4C6SA

Crystal structure of the tir domain from the arabidopsis thaliana disease resistance protein rrs1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
142
structure length
142
Chain Sequence
EEFVCISCVEEVRYSFVSHLSEALRRKGINNVVVDVDIDDLLFKESQAKIEKAGVSVMVLPGNCDPSEVWLDKFAKVLECQRNNKDQAVVSVLYGDSLLRDQWLSELDFRGLSRIHQSRKECSDSILVEEIVRDVYETHFYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE WRKY TRANSCRIPTION FACTOR 52
publication title Structural Basis for Assembly and Function of a Heterodimeric Plant Immune Receptor.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Immune system
total genus 52
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4c6sA00
4W8HA 5FORA 1T3GA 3UB3A 5H3CA 4C6SA 2J67A 1O77A 1FYXA 5KU7A 4W8GA 3OZIA 4LZPA 4C6TA 3JRNA 1FYVA 3UB2A 3H16A 1FYWA 4LQCA 4C6TB 4FZ5A 4EO7A 2Z5VA 2Y92A 4LQDA 2M1XA 3UB4A 4C6RA 4DOMA 4C7MA 4OM7A 2JS7A
chains in the Genus database with same CATH superfamily
1HDXA 1C7JA 1E6KA 4MS4B 5A6SB 1Z18A 4HZUB 4RZUA 1OXXK 2IIVA 3PNLA 1TA4A 4WFIA 5FYQA 1WNFA 3WMFA 1A4XA 4M76B 1PU2A 2HJWA 2IF0A 3QLEA 5BOSA 1P6XA 1QCYA 1W47A 5BRNA 3TL6A 3B3FA 4FLFA 1DCMA 4DDVA 4BQFA 5LDHA 3MUFA 1IXRC 3REGA 2NUBA 2X3FA 1UBRS 2QBYA 1JLMA 1U2PA 3ON5A 4M9QA 4IUCS 5D6NA 2QB5A 3WLJA 4F56A 2QHXA 1BHJA 2NAPA 3FWKA 3IBYA 4RK7A 3WLPA 4G65A 5C51B 4Y9UA 2C7PA 2JVIA 1R5BA 4CLDA 4KR6A 1S0UA 4GKVA 2FZKA 4BATA 2XUAA 5L53A 2XIJA 5T7BA 1M8KA 2Z1MA 2JH9A 5H80A 2WJZB 1V3QE 2HJSA 5TJ9A 3WK6A 1YS9A 4NVRA 1BCRA 4D8UA 5FOUA 3F74A 5IYZF 3QVGA 2NYRA 5A3SA 3SXJA 3WYNA 1D2AA 3DCYA 2UYOA 4R71A 2C2WA 3HR7A 3QKTA 1UBOS 5JEEA 3PRHA 1J0DA 3D6AA 2OGUA 5CGQB 2WV9A 4DQ0A 1LPNA 3WL6A 2VDPB 1KH2A 1EA7A 121PA 2A5JA 3L1JA 3WYEA 3UT0A 5HUJA 3V4VB 4RD3A 5HIJA 4FYJA 5C35A 4CIYA 3QVLA 2I6QA 4PS1A 4PIVA 5AW8A 2X14A 3TZKA 4JU8A 1W9MA 3VR6A 5CRIA 2QVCA 3CPJB 1Y7PA 2RBGA 5CNIA 1C3OB 1RABA 2E48A 3FYCA 4YDHB 4TGLA 4Y6GB 1Q2UA 3LCVB 4ZP1A 3S2SA 1X92A 2CNDA 4R2HA 2JARA 3TVTA 4F71A 5HM6A 4YO7A 4PPGA 5FBKA 1JRLA 2IKSA 3FFWA 3IUBA 1E8DA 4L1KA 3EIUA 3NVMB 2KJQA 4V02A 3X1YA 1EVQA 1OY1A 3CXUA 1QR2A 2BUBA 2YYYA 1ZGBA 3DMRA 4ND6A 4QTUB 5C31A 1W1WA 4REQB 1EINA 3HYNA 3BWYA 4KDEA 3ZUGA 4E0BA 2H1RA 4RPKA 3C1OA 4CRWB 2P67A 1LJUA 3OD1A 2JFGA 5CAEA 2JFVA 3C87A 3QI2A 3OZUA 4CCAA 5I7VA 2GVNA 1B73A 3ZD8A 3MSXA 1NBWB 4H7FA 1K7CA 3H9QA 4FMDF 1XLTC 4G1EB 5HTOA 2DSNA 4ILKA 3OP1A 1VTKA 1SD5A 2MDTA 2X9NA 3ONNA 1X0VA 1KSJA 2QTCA 2ZTHA 3NTRA 3B6IA 4ECAA 1VECA 2B21A 3VU0A 4LEIA 1KETA 2B69A 2ZIXA 4AWAA 3UBTA 1NNEA 2JBAA 1CEEA 1KH1A 4KPEC 2W6MA 4L0QA 1NUQA 1C1HA 1EX1A 1G0OA 1KAMA 2WUWE 3IQEA 1R0SA 2HY7A 4O2AF 4Y6PA 4EHLA 4G1BA 3SEQA 3ZHCA 1FVHA 2ZUWA 4OFZA 4ESHA 2QXYA 3FSJX 2OHFA 4ARSA 1KJWA 3ZCUA 1AXRA 1YQGA 3I0NA 2H08A 4CJXA 4W5OA 4DB2A 3I2YX 5H68A 3TK1A 4OK6A 3P2IA 4J16A 2ZZMA 3QA3E 3ICCA 3PDCA 2VKTA 1HE4A 4URYR 3GFBA 3LWNA 1TCVA 2BGGA 1GZ7A 1SC9A 3N58A 1Q50A 3FOFC 5EJ4A 1XX6A 4A8HA 5J2UF 5H02A 2O2CA 4YAFA 3VNAA 4HFMA 3GVHA 3W06A 2BSAA 4D80A 4D3XA 5BN1A 4X1YB 4EW6A 1HO3A 1OXTA 3UUEA 1JYSA 1W49A 2WIJA 3F6EX 2O6HA 2CFCA 2O2JA 4B35A 3HP1A 4U0KA 1RRPA 4EHAA 3MXOA 2HLDD 2I3GA 3DOCA 4M8NE 3SC2A 3ZWDA 3OZ7A 1IQUA 5JUWA 1MW9X 2IOYA 3O3OB 4A2QA 3JATB 4AWXA 4A91A 5BR7A 1E6EA 1DAKA 2GB4A 2I22A 1M33A 2I2CA 2X4LA 4L07A 1WMFA 1JQDA 1H4VB 2AWOA 1OH7A 3TMAA 3HVKA 4F84A 4RTPA 1XCLA 3D4IA 1IG3A 4BB6A 4IYJA 2PT5A 3E3MA 4URFA 4WVFA 5KEIA 1QO0A 1Z45A 4QYMA 1NLMA 3WNCA 5AW6A 4IMPA 3OM1A 4GOXA 3IR7A 5E38A 1N0UA 3Q0EA 1UZLA 4DT1B 3I5MA 2Q3FA 4LY0A 3N7TA 4ZOCA 2ZIAA 4FFBB 4MKZA 4P5DA 1TYZA 4A5OA 5KMGA 2WJPA 4YO8A 2FVXA 1K4MA 4NJOA 4ZEXA 2P2LA 4RZ2A 2XI4A 3UOWA 4W8GA 4YV0A 2FGKA 1W76A 4D92A 1BFDA 4BLPA 2GCOB 1GXSA 4ID3A 3H1FA 4I6EA 4AF6A 4BP3A 4Z9XA 3NWPA 5DN6A 4TTQA 3WLAA 1DX6A 1GHTA 3VPFA 5K8LA 3CNEA 3RAJA 4EKYA 3DHNA 4EI7A 3F5MA 4EBBA 1Y3FE 1SH7A 2L19A 1NX9A 1RXSA 4RV5A 1Z34A 2VYNA 3ZIAA 2H07A 4BNZA 4K26A 4K9MA 4OOFA 4DANA 1UBKS 3ZLUA 1TQ2A 3H99A 4OH7A 3DBIA 5TT0A 2AD5A 1A98A 2JRLA 2RARA 4RPGA 4DJTA 1U2DC 5CHEA 1O8BA 2FPIA 4OAQA 4OJNA 4P3XA 2HF2A 3A8TA 5AI4A 1T3GA 4UAUA 3IL2A 3WWYA 3JWPA 3DLHA 3D4PA 3R6WA 4AN1A 1P3JA 4X64B 4FOTA 1JMYA 3Q12A 4KPGA 5CX1B 3TQTA 4XWGA 1QH9A 3E23A 5BSMA 3RCBA 1QRDA 3AHGA 3KSUA 4OY3A 3QLVA 4XUDA 4ITRC 3PQ8A 4KHZA 3QEBZ 5JYBA 2C82A 3KELA 1TLLA 3LKDA 4QOHA 4UASA 1PFYA 4HVAA 4WA7A 3FUWA 4MS1B 4RDCA 3TCNA 2POQX 2NP6A 2B20A 3VNVA 1W36D 3IMGA 1RXWA 1YB7A 1CRPA 4AJHA 4H17A 2BM9A 2WE8A 3R3ZA 1BDHA 1UBNA 3BN3A 4N48A 3WGLA 2IHZA 4MYTA 3L8MA 1CBUA 1C0EA 1YNOA 1CE8A 3GW8A 4E3WA 2VNJA 1P1KA 1MMFB 2MINB 1SKQA 1ISHA 2J6HA 1RE0A 5KBYA 3SFTA 5TGDA 1SVKA 4GC9A 4NBRA 4RBNA 5HMMA 5SY4A 4H6WA 1P91A 3AEXA 3I64A 3L8EA 2BR5A 4EB8A 4HH0A 2N0SA 1ESZA 2ZQYA 1F17A 4UMFA 5BSHA 6NULA 1JKIA 1VYUA 4HB0A 5H7XA 1WXIA 3DCIA 4KSYA 3UAWA 5ITZB 1V6CA 3Q8KA 5AICA 4KDRA 4I7EA 2C5EA 4DNFA 4YMSA 4ARCA 2HHAA 5A3JA 1KOGA 3LYUA 1YXMA 3LLVA 3B1FA 1PTJA 1XTBA 1Y4ZA 4RAOA 5JC8A 1GZHB 1PZMA 2P1ZA 5AKLA 4R0NA 3WE7A 1MTOA 3PENA 2ZI7A 2K5UA 5ADUS 5IXYA 4PS0A 4MV0A 1UT8A 3LZDA 1MN6A 4LFBB 4MLCA 2VBIA 5F21A 2O2YA 1Y3IA 2JG3A 2QAJA 3RHZA 1WHTA 1A9XA 3LO8A 1DIAA 4QTXA 2OPHA 3FDFA 3NEAA 2JGAA 3PKZA 4C0SA 2Y71A 2O9JA 4LQCA 2MYNA 4LJ9A 3RBZA 3VO8A 1W5TA 4D4GA 1Q44A 2GK6A 1WVGA 3HFJA 3IIKA 2MT9A 5JS7A 1ORIA 4MVYA 1L7MA 2K7FA 1R10A 1PL7A 2OILA 2QQFA 5GVRA 4ME6A 3SIXA 4Z86A 2YBEA 1Z6TA 3DTVA 3FYHA 4F96A 5LCXA 1J0AA 2HQ1A 5CYPA 3W8FA 2Y66A 3GEBA 3GRZA 5LC1A 3S29A 4M1WA 1HEIA 3CNHA 3MJSA 1T10A 4UCFA 1XPRA 5BVGA 3V34A 1CG6A 5LUBA 3LAWA 1H3FA 3BRWD 1OMOA 1R9JA 4UBIA 4V2UA 3I12A 3WGUA 4F1KA 5B30A 4FHCA 4MWOA 2VOJA 4TQAA 3RI3A 2H4XA 1EEXB 4LC1A 5BYAA 3GIDA 5LMUB 2DCMA 3A37A 1PWHA 2IZZA 3QKRB 4PNZA 4AYXA 1H0SA 4BFUA 4ETWA 4FGLA 1DG9A 4J49A 2G7MC 3FTPA 1YCGA 3N05A 1P17A 3AFOA 3MN1A 2YV2A 1F51E 3BMXA 4QHSA 3T1NA 1MAVA 5CDGA 4FD2A 1GKYA 3E3NA 3ZV7A 2B1RA 5A7FA 1LC3A 1SPBS 5IM5A 2YJ4A 3CZQA 4FIDA 3MQFA 2Q0XA 4ZHSA 4L3OA 4YRDA 3WISA 1P1IA 1XQ6A 1ZISA 4YPOA 5IT9A 1Y9DA 2Y6VA 4QGAA 4CMIA 3ODPA 1U63A 2WU3A 1T3ZA 3EXFB 1FP7A 1JLSA 3PPXA 4J4BA 3HY4A 2H1IA 1Y7TA 3FFXA 5HQJA 1RQLA 2A7QA 1VJRA 3SYRA 3CLVA 1GSAA 4HN2A 2WMNB 4TMZA 4UJ5A 4CLXA 1QV9A 1LK0A 1QANA 2AQHA 4YLGA 4YI5A 3VTKA 3TLGA 3LCMA 2PZFA 1SHLA 3T7IA 4D45A 5D5QA 4MV7A 2C59A 5DNAA 3LUJA 4M8LA 2Q0SA 4RVGA 5K0SA 2CXSA 3C14C 5ES3A 1TIBA 3NBZC 1AXGA 3KHUA 4EY5A 5JAMA 5LMNB 2BL4A 3T1HB 3K94A 3U7EB 3HRKA 1SKAA 3BH0A 3PNVA 2ADOA 1C0PA 2TS1A 3WAGA 1EM8A 2VI5A 1MF7A 3LX5A 4G1CA 3AV0B 1SG6A 3OTQA 1YRBA 1F20A 1OLSA 3GI1A 1SB8A 4F8YA 3STVA 1DHTA 3EA5A 5AJHA 1GZUA 2RSLA 1FYDA 3DSRA 3MGBA 3OFND 4YVFA 1F6WA 1ND5A 5AKJA 1MJGA 2PMBA 3G3EA 5JCJA 4C0JA 1EK2A 2WHPB 4JUCA 4RY2A 4I46A 1GR1A 1USGA 1IBCA 1ZM9A 4MPTA 4DC0A 3LL7A 1V1JA 3T3EA 1AMUA 2IUTA 3DFKA 3TG2A 2C4NA 3H1TA 3MJTA 3C7DB 1GPWB 3VPAA 4W9NA 3ZXXA 3W5IA 2UUBB 3W6NA 1QGYA 4LW8A 3K20A 5BWMA 4KVFA 3PGVA 2PLNA 1JI0A 2XF2A 2ZRLA 4JODA 3RFCA 4F9EA 5KYNA 1KY5A 2FPWA 3BB3A 4WE3A 4YRKA 3FJ1A 5SYNA 2JCXA 5IAEA 3IIEA 5HJ5A 1VE3A 4X44A 5AOAA 3WOVA 5J5CA 2GCGA 2XA1A 2HPHA 1A5BB 5A7GA 1P3Y1 2ZANA 4XDZA 3O74A 2MSKA 3IAHA 4LY3A 3M9LA 4EYEA 3OKAA 1QDUA 5HE9A 5FPPA 1SAYA 3H5RA 4XXHA 1HFEL 1Q74A 1RBZA 1EP3B 1EDEA 2OEPA 5BSVA 5J58A 4ZOLB 2AFHB 2XOKD 1GA4A 3F3KA 4D4JA 4JI0B 3F73A 2CBGA 4HC4A 1FLAA 3FPEA 4CFSA 4QQNA 2H18A 1EBFA 4X1KB 2CK3D 3AP2A 4HDNA 2ZRFA 2VH1A 1KAOA 1DWUA 3TR6A 2WG0A 2QROA 3JD0A 2DLNA 5LYJA 1KSGA 3UQYS 1P73A 4HMQA 3WKAA 4UTVA 2F9LA 1MFZA 2Z5VA 4IDOA 1JVSA 1VHWA 2NXNA 1Z0AA 2WIKA 3KOYA 4PRKA 4WVLA 3FPGA 3IILA 1NBEA 1WL8A 4UE3S 3FDXA 1FNSA 3ABZA 1OPRA 2OCKA 3GRAA 2WSLA 4UTOA 1KYYA 2IV3A 2X0KA 1E2IA 3RQSA 4DADA 1K75A 2YXBA 3OQOA 1KRXA 5LIPA 3QE9Y 1E5LA 4Q9NA 5BORA 3LSTA 3NC0C 3W4JA 5C34B 4ND1A 3DWEX 1PL8A 1TOAA 4YCDA 4B8WA 4D5EA 2UUPA 4PC7A 1AHPA 4DYDA 2RHJA 3ZWWA 3K5PA 5KYXA 1W93A 3ENKA 3R1IA 3U3JA 3VR2D 5HHTA 2ZGVA 2YTZA 3E9DA 1U02A 2IXAA 2YUTA 1IJBA 3F5FA 2FQXA 1DJNA 1P2UA 2OHIA 4LV5B 4N7MA 3U61B 4A15A 4UTXA 4WA8A 1ARZA 721PA 1FMFA 2X7JA 1P7PA 3T9DA 4QM7A 2Z2KA 3L0YA 2RJNA 4BB9A 3TLJA 4B5KA 4CLOB 4DIOA 1RHJA 1EWRA 1LNQA 2X0NA 3MINB 4TKUA 4V03A 2Q1UA 5AQ1A 3NPMA 5EWJA 1DTWA 2R47A 4DCVA 2DLDA 3MMPA 1X1QA 1V37A 4JY7A 1NBME 5B57C 1N75A 1MXFA 3FCYA 3LQ4A 3UUFA 1NI3A 1NJSA 3EDOA 3EEQA 3W6PA 2UV8A 4NJMB 4RORA 4AIIA 1GNLA 1UDCA 1VOTA 3N8NA 4UEWA 4F2GA 3L7YA 1L5FA 4CBVA 1GLVA 1BE6A 3KFLA 3A58B 4D26A 6YASA 2WFMA 4BRUA 2J9ZB 3QUCA 1YL6A 2FE1A 2EX4A 2EKLA 1QIIA 4FNAA 4A0FA 1GTMA 1Y81A 2A6PA 5IN4A 4EG7A 1ODKA 5DNVA 1AJEA 2QKYA 1H2WA 1D2HA 3E1KA 4AJLA 3UUWA 2WJAA 2FX5A 3A9SA 4RABA 1FQWA 1XA3A 4X90A 5AVOA 5FUVA 4RSRA 4YC7A 3ROGA 5CW1A 3G8CA 1NQ5A 4IIGA 4J7UA 4DLSA 2BOVA 1PP4A 1ZD1A 3PNBA 2NQTA 4A2PA 3A6DA 4WXMA 1L4FA 1SQGA 2QPAA 4MI9A 2AG8A 4FZ3A 5JD6A 4XJSA 1PF7E 1FL9A 1TPZA 1FYEA 1OFVA 4KE8A 3T99A 2BBWA 2KLBA 3VC2A 3VVLA 4U00A 1ZH8A 3FOAA 2E0IA 1QIFA 1ZBDA 2RHDA 2XT6A 3CYFA 1YA8A 2YQ5A 4FJ1A 3GYBA 2J5RA 2DVMA 3GLIA 3AVXA 1H5QA 3ZDRA 3N5KA 2ZWAA 4HDSB 3FOZA 1U3WA 3EWSA 1AZSC 5FUYA 2GMWA 2NTJA 4EKGA 4DKJA 3UBMA 2WPNA 3RV3A 3M9WA 4IEFB 1AN0A 1HUQA 2XUGA 1P5ZB 4QNRA 5JU6A 2QSUA 1DV1A 2FEOA 2Q6LA 1DU4A 3AHEA 5H82A 5KTOA 1QV7A 3TB6A 4JX8A 4F3CA 1E2GA 2QM8A 1QWSA 2WWWA 3M1LA 3QBTA 3ZC3A 1XALA 3B1VA 1C9YA 1XNJA 4Q6BA 4G5XA 4TMKA 4CIBA 3E3LA 3WBKA 3SQXA 2P7IA 4FDMA 1AH2A 1H9CA 2GJ8A 3DZBA 4O4JA 5CIWA 4OHPA 4Q01A 1DKUA 2CMFA 4MMYB 1E0AA 3PXBA 1UJCA 1ID8A 5A0FA 2XAAA 3G9XA 4P4TA 1X2BA 3CNNA 2GYUA 4N54A 1W0JD 3ANMA 1NBHA 2H51A 2CLDX 5EYPA 3TNLA 2C2ZA 2Q5FA 3L02A 1N9GB 3VRHA 4C0KA 4A5SA 1J33A 3CW9A 4DUZB 2P91A 2XVYA 3KYCB 4F12A 3A9RA 4IZ6A 1ADCA 3VO2A 2PT7A 5FLYA 5DM2A 3C8DA 1DC4A 1ZICA 3COWA 2HWKA 5CA1B 1TCAA 4F11A 5EY5B 1RYZA 1EFCA 4HS9A 2I3AA 2D1YA 3SYLA 3W05A 2EKDA 5KX5A 3A9CA 4IVRA 3OURA 3A2LA 4LI0A 4NICA 3QOXA 3F4KA 4G67A 4L8GA 4NYMR 3CUUA 4N1AA 3OAAD 3PHLA 4K0KB 3KXPA 2ZRKA 3WXMA 3RSFA 4EGCB 2JCBA 5LP6B 1TMKA 2C42A 2VHWA 1Z4IA 2V6FA 2JZCA 2PZJA 3LQ2A 1P2SA 2BBTA 5F35A 4AG6A 1BWRA 3A3NA 2AXPA 5DBOA 2GUWA 1KMHB 2NYUA 1MV5A 3TEFA 2EFJA 3V4LA 1SBHA 3DVQX 1RM4A 4DXDA 1SQ5A 5D84A 1JA0A 7MDHA 4W5JA 3LIIA 4KU4A 2C03A 4QU8A 1JEQA 3MERA 4YJDA 4ZWNA 3TFWA 4RS4A 4NCKA 3SD7A 3B3JA 2YMLA 1RI3A 3PE3A 5CUQA 1M1NA 2YWHA 5CXXA 4Y2GA 5HZHA 3U5TA 1E3WB 4QPCA 3QF4A 1AO0A 1A1SA 1IOVA 1UMCA 4CL2A 1ZRSA 3GFFA 2OB1A 1K8QA 3MTJA 4OYLA 1XZEA 2A9FA 2HXSA 1MO6A 2DQKA 1DFIA 4QDTA 3DBRB 3MELA 4IX9A 4JEHA 4X20A 3RKRA 2XPCA 5K0GA 2FWRA 1W4ZA 2QU8A 3TW8B 4TTTS 4QBIA 4QDUA 4I4IA 5IDWA 5KYYA 2OCLA 1A8PA 3BJZA 4YMGA 1ZNYA 2JBWA 1UJNA 4IPTA 1UPCA 4LV8B 1U9YA 2YN2A 2UZ4A 1T2CA 1O5IA 5A3RA 4NCXA 2ONCA 1NQVA 2FDXA 1QJCA 1AGXA 1KO4A 1LKZA 2CHQA 3FF4A 3OLCX 1DAMA 3QHQA 3R0JA 4YQYA 3AEQB 1K06A 2TSYB 1Q17A 1EK6A 4BNNA 1YR2A 3RVLA 3S2IA 7REQA 3IFSA 4NK4A 4DR3B 3IT2A 3UMVA 1PX2A 3P27A 1PJRA 1VCIA 4KR2A 3EF0A 3PDIA 3QJ5A 2RB4A 1F1JA 4ZU1X 4KQCA 4RXMA 4IHJA 1PV4A 2RGRA 5DTEA 1X8KA 3FVTA 1G8KA 3H1PA 3PGA1 1RWWA 2DTEA 3LD9A 1KYZA 5DE3A 4MDFA 3ZWYA 4UUAA 3MWEB 4G24A 4D1YA 2BSQA 2IUSA 4TPKA 5FTMA 3R9IA 3L05A 4C6SA 5KCMA 1QZTA 1Y63A 1P4RA 2VJLA 2W4MA 3CPHA 4E21A 2WDZA 4G5RA 4EW2A 1C7RA 1RHKA 4YAJA 3R9XB 3I9FA 2WFAA 5K8IA 4CM8B 1D4ZA 3F7OA 2OFOA 3BFJA 1N5LA 1QQ7A 2JFOA 5F7OA 5TRTA 4INAA 2QX7A 1FSFA 2JAOA 3IEPA 2C7VA 2O7QA 2JJ1D 3N3BC 1IN1A 1NTRA 1PQ4A 4BMSA 3DO8A 3DL0A 4IXNA 3WHIA 1V8BA 4HDKA 1ML4A 3ZQJA 3GJ0A 1WD7A 2F8SA 4EY7A 2Z9CA 2NVBA 3IEUA 3V32A 1YFZA 4YYZA 4DR5B 2ZT8A 3T4XA 5LQDA 2VL7A 1HQYE 4PC2A 1I13A 4DS3A 3EOZA 3HXLA 3IELA 3R5KA 4FMCF 3CR8A 3VQTA 4UUOA 1A8QA 1GNTA 1NVKA 3ZLTA 1A5ZA 1S1MA 3NV7A 3U40A 4UHFA 3PBKA 4CNQA 1M66A 3JQ7A 1CVLA 1UL1X 4BFZA 4PNPA 3BG5A 5C4MA 4NAUA 2IU4A 1R7RA 1W581 5EP2A 1K4KA 4LWQA 4LK2A 4XVQA 6LDHA 2JB9A 5E6UA 3UENA 3K0FB 1DAGA 1NVVQ 2QT0A 3VKVA 4DCOA 4YT8A 4BXOB 2QZSA 2O2SA 3PR3A 4D4KA 4J0IA 1WCXA 2BI4A 2JAPA 5DTIA 3KHTA 1L5NA 3JALA 4JJ6A 1ZNXA 5K8CA 2W9XA 2BTOA 4A4DA 3B78A 5PGMA 1YQTA 2H4HA 4AY6A 1JF8A 4P4SB 2ZU6A 1N5MA 1KO8A 1Y8CA 1VBFA 2QRKA 4KUHA 4YMUA 4TUYB 3ZU5A 3FPHA 2EDCA 1NW3A 3FKJA 1V3VA 4LDAA 5C7LO 1K92A 1XRQA 3AETB 3GA7A 1IQPA 1C3JA 2ZB4A 1ECFA 4JI8B 6REQA 1TECE 4GKAA 4QOEA 2XMQA 2YR0A 2ID9A 2JEYA 3FY4A 4G5FA 4R5MA 4D56A 1ECBA 2QN7A 4DV3B 1APBA 4XWTA 1ZK2A 1HGXA 2PH5A 2VXBA 3NLLA 4J0GA 5ALRA 2CKDA 3RG2A 4B3JA 4DVJA 2O8CB 4G37A 4FI3F 1OFTA 3ESAA 4ZPJA 1P8AA 4B4VA 1ZSVA 3LVRE 2X3YA 1XNRB 2V7WA 3S1LA 2XOEA 1GZ4A 2ZYGA 3FIJA 3PWTA 4FFOA 4YDRA 4B8ZA 5KYWA 4HZGA 5FWXB 5I4BA 2IQ5A 4YRBA 2QJWA 4GKBA 2VPWA 2FMHA 2NPFA 1SXJE 3H3JA 4H4CA 3U7QB 3RHSA 1I3OA 1UWLA 2HA0A 3PFBA 3L0CA 4KBYA 4P34A 4TV8A 3UJ3X 2AN5A 5CDYA 2YYZA 3I6ZA 1VPLA 2CLEB 4J76A 1FQJA 1LBTA 1R6TA 2DUWA 4OJQA 4U5XA 4YN3A 1NTOA 2W0SA 1YOBA 3K2BA 4BMPB 4LPSA 1ND6A 2RI6A 1FMLA 2BKUA 3N2NA 2BJWA 4J4HA 4LG1A 3IMFA 5JO9A 1TQ6A 5K8JB 2FP3A 5AMXA 4U3JA 1M7GA 3D6FA 4B3CA 2M6RA 2ZJ8A 4OI2A 3BJEA 4WJLA 3HC7A 3KZKA 3HVJA 3V8VA 5AI0A 4EF4A 4NXMB 3UW3A 4HBGA 4HDQB 2HXGA 1G6HA 1U28C 2DQYA 4HEHA 2DYKA 2E4VA 3HKCB 3O9VA 1E8MA 1RI4A 1URPA 2PZBA 1ZUNB 3JQ6A 1O95D 3BILA 1M34A 4FC6A 3K70B 4JH0A 4RHUA 4D3ZA 1JL3A 2J32A 4HRXA 2OSVA 1I94B 2UZ3A 4J0HA 3GZNB 4GIBA 4TTJA 3VGPA 3WLIA 1DEXA 1OLXB 1N5OX 2Q2OA 1B8OA 3MMNA 5E6SB 5CDTA 1E1MA 1Z22A 3EEIA 3L7LA 3VTFA 2AFVA 3IHKA 1N9ZA 3GHHA 1E5QA 3CLHA 3OLQA 4EX7A 2XOXA 1J00A 5IAJA 2VBGA 5HRCA 1M6HA 4JOQA 3EXG1 1C4OA 3K09A 5FOWA 5IHXA 5LSAA 1BMFD 3R7BA 3BPSA 4IKPA 1TCCA 3SHQA 5HKKA 1SHUX 4EYKA 3HXTA 1E99A 4CEIB 4E1VA 4MH0R 4UVDA 5CCXA 2JIRA 3QHAA 2C8LA 3FF1A 2Q1WA 3EE6A 2IYSA 4QGHA 1HC7A 5BN5A 1MJFA 3HKDB 4DIFA 5BOSB 2DQ4A 3AY3A 1CUJA 3QWFA 1KRWA 2CMDA 2JLSA 1G4AE 1O0BA 3TZQA 3KCNA 3SE0A 3K6SB 1SCIA 2PUJA 1SBTA 2WLSA 3FN4A 4CCYA 2D59A 1KKMA 4MJLA 4KJXA 3SDSA 2PD3A 4E2WA 1N2SA 4GOMD 4BDTA 3EEFA 4WW0A 3K70C 3CF4A 3GQVA 4HUJA 1AQJA 2AV6A 1QPZA 3F8TA 2EZUA 2R84A 3O8RA 2J59A 1Z3CA 2B92A 1GSOA 3KQVA 4MVJA 1YH3A 4HY3A 4WXEA 3L0IB 4UBLA 4CI9A 3I3SR 1KDVA 3RT7A 4G8BA 1I30A 2YVLA 3E8MA 1HMPA 3LUFA 4TV9A 5IAGA 4GOJA 4ZVQA 4YH1A 3PJFA 1W52X 4M36A 2O8FA 5JEDA 3LX4A 1DKLA 2K4MA 5G4LA 1UK9A 4MXDA 1CUIA 3PS9A 2OO5C 2QVGA 3P2EA 2IHUA 4ZOEA 1U2SA 4BBZA 4D3DA 3RK0A 4LDRA 3AU8A 2FZGA 3P2MA 3I2HA 4LPKA 3RAGA 2PR7A 4HGZA 4B7ZA 1VCNA 1VCMA 4TMFA 2QUIA 1E9AA 1TJ3A 2HRBA 2JKVA 3E81A 1WMSA 2Q62A 2J87A 5L3ZA 3TQQA 2ZAGA 1P0PA 1GOTA 2RGNA 3ESXA 2O0JA 4GPIB 4HAOA 2QRNA 1GCUA 1LDGA 4HBZA 3U2QA 1QLJA 5T5QA 4DQDA 5HQ3A 2TMYA 3HU5A 2WJ3A 2RKWA 4YP9A 4Z0HO 2B4KA 1DAHA 1N3LA 1QIKA 3DV2A 3IPYA 3M2PA 4OATA 5TVKA 1W44A 3TRDA 1ILEA 2AWNA 2HQBA 2AG5A 5JS8A 3CLRD 3JQQA 2QM3A 1XRNA 1EQUA 1ODCA 4Z9FA 4ZI7B 1VLLA 5CMLA 1HQDA 3L40A 1ODTC 1Y5MA 2WU4A 3MHTA 1RWBA 3AO0B 4IIEA 3R3SA 5CK4A 1ZVMA 2B4YA 4IVPA 1N6KA 1WW2A 2M98A 2DWCA 1QO7A 1SIWA 2YUIA 4R6XA 4L2IA 3O4FA 4M22A 1ORTA 3MWGA 1ZO8A 1G7CA 1JPVA 1OLUA 3PEYA 2GBLA 1CRLA 4HUQA 3I34X 3JQ9A 4OB8A 1PNTA 2GN0A 2ZIXB 5C7OO 2HMWA 1G5FA 2JBAB 3LCCA 4S1OA 1V5IA 4IH4A 3WDKA 4N76A 2W8ZA 2J6IA 3GFOA 3MG9A 4AYTA 1K88A 4I0WB 3E58A 1RMQA 4IX1A 1JVBA 4OEHA 4S2EA 4AURA 2OFFA 5A9SB 2LKCA 3LOQA 1AK1A 1J8VA 2YZNA 4HMPA 4K40A 3WSTA 1XZGA 1NVDA 4B76A 1F7VA 1LFAA 5CVDA 1VC2A 4D6PA 2W4QA 4R05A 2R8BA 3AG5A 5T3YA 3V33A 4JXXA 1IJEA 2Z2IA 8MHTA 2J9FA 4HZIA 1XP5A 2AFRA 1GILA 1PI3A 4BMVA 1WVIA 1KI9A 2BFBA 4D3SA 1Z4NA 4ZOAA 5D1HA 5KYUB 2C5AA 5IJXA 1Z26A 2C0CA 4LJ4A 2LV8A 2RGGA 2WP8J 5INTA 1WDMA 1S7GA 3EX7C 4HLCA 3RAPR 1IY1A 2HFJA 3OLVA 2P2ZA 2XUQA 2NACA 3BDVA 3OCXA 3P9NA 1ZGZA 3G6WA 3OFJA 4QBFA 1PJ3A 5CLIA 3SSOA 2O4UX 1NV8A 2WT4A 3FLEA 4DLXA 1N9KA 1YSCA 3AFGA 1SCAA 3PNYA 4IG4A 1KAHA 3RJMA 3SZ3A 3VO1A 4AZ0A 1BXGA 2EGGA 5JDCC 2IS4A 4XM0A 4DJDC 3D64A 4KLAA 4CL3A 4ENQA 2OXCA 4FTWA 2H2FA 1JTEA 1R4AA 3MJVA 4H35A 3KJHA 1NW4A 1COWD 5HKOA 4AKIA 3AM5A 1SUIA 3I6IA 1JU4A 4GI1A 2R6DA 4C4ZA 5KMGB 3BM5A 2J6BA 3LUKA 2R87A 4ILEA 2YW9A 4LK3A 2OOKA 3C74A 1SWVA 2C9YA 4R81A 2G5GX 4J16C 3FPAA 3DKRA 2GA8A 3PGKA 2VP6A 2WI8A 1TI7A 3KLOA 4PLZA 1FLVA 1P2DA 3A05A 3PFKA 4WZBA 2HU5A 3FFTA 4LXHA 4YR9A 2B2NA 3UT5A 3OFKA 4ZT5A 3FOEC 4JQYA 3DDNA 4JROA 2FRVA 1TJ4A 2J4CA 4TTPA 5IVHA 4GPD1 3BE8A 3AIIA 4U7WA 2HL6A 3DAFA 4KK4A 1U4SA 4DG9A 3T41A 4Z4CA 5BNWA 1AKRA 3TLAA 4QDKA 4LXUA 4R1TA 3RS2A 2OP0A 3I9V6 1EFTA 4RHTA 3KSDO 4KNWA 1DGQA 3WL5A 3AVVA 5KJ1A 4WD3A 1ZM4A 2HDNB 4GP7A 3SJ7A 3A0UA 2AA3A 3WK5A 4DPLA 5JMWA 2VHVA 3B53X 4HCJA 4F4JA 1PD0A 5JAZA 3RVQA 4AUKA 4IQFA 4R8SA 4ZMSA 2R25B 4LMRA 3DYIA 2PUGA 4N0DA 3TEMA 3AHIA 4DDKA 4EHNA 5AW3A 4R3NA 1UBHS 3RVRA 4EATA 1B7GO 3AF6A 3OT5A 2OBFA 2PMKA 2YKGA 3FYDA 5LQJA 1KFKB 5JI3E 4ZGWA 3SR0A 1DC8A 2VJPA 1AMOA 3KKOA 2OD7A 2OYSA 3LL4A 3J80A 3O95A 1OZFA 1CE8B 1Z07A 3QYJA 4MS3A 2PZLA 2GM3A 3TFQA 4BUJA 4P0PB 4UQOA 1FSZA 1HX7A 1R9NA 2OBXA 2GJKA 1JJIA 3TR5A 3RUDA 1JSZA 3ZE7A 2FSSA 3UHJA 3ZX4A 3ZCRA 1R9MA 4OM8A 1PFQA 2OAQ1 3U4QA 3Q1KA 1GLGA 1NT2A 4QOJA 2R68A 1OZAA 3TN7A 4QBTA 2C94A 2E7ZA 1Y3AA 3DAHA 1GPJA 4RVSA 3Q85A 1P62B 1DQSA 1TC2A 2EKBA 3CMCO 1PBNA 3BRQA 3HL4A 3I32A 1KL7A 3QKUA 4JLPA 4RK4A 1H3EA 2OLEA 2ZJ4A 5AT1A 3ER8A 3E03A 2Q5LA 3STWA 1TVMA 3L41A 4C3VA 2C8VA 2C9DA 1A8SA 1QF7A 4DCCA 1SULA 1Z2NX 4G9BA 2YZGA 5EE3A 4LOAA 4B34A 3QLVC 3BXOA 3RFVA 5KQLA 1QFJA 2DUUA 1IHDA 3B9PA 3F47A 1A88A 1ZGCA 4GO1A 1MFPA 5GTDA 4ND5A 1ZN2A 5EIBC 4PZLA 1PJ2A 4ENSA 5FFFA 5AW7A 2DWUA 1YR6A 1AF4A 1NUHA 1UF9A 3T9EA 4DQLA 1WHTB 1A9XB 2HYIC 4IIXA 4QREA 4FOLA 3FCAA 4EYSA 3LT5A 2CNBA 5FFNA 1Z63A 2DFTA 3HCBA 5EOVA 3O0DA 4MUYA 4H16A 1R8JA 4B6FA 4OFBA 3M3PA 4F46A 1BXRA 2ZDGA 3H5AA 1OHHD 2C54A 2VDRB 4P5EA 1RR6A 3MTGA 4BQRA 4NTZA 3GNLA 3AFIA 1VL8A 9MHTA 3DE3X 3RRYA 1R6XA 1OGYA 1OXBB 2W6QA 3DTVB 3FOCA 1YE5A 5EEHA 3WJAA 5JJ5A 1G19A 3QWHA 3NHBA 3CKKA 2HLHA 3I9V1 4C0LA 5C5CA 5K4HA 1XZFA 3NPAA 3F6RA 1TAHA 2ORWA 1XTTA 5EQFA 4EY3A 4OX9Y 1HDEA 3PFCA 1Z4QA 3ND7A 4AZ3B 5JS1A 4BNLA 1PTJC 2Q4OA 1STOA 2A1UA 3RUAA 2CVHA 3ASUA 3JSAA 3A1UA 3IO3A 3DMHA 1I0IA 3KPWA 1WZ2A 1NBMD 5HTKA 4QG7A 2QQ5A 2XE7A 4X61A 4WKCA 1K3FA 1TW2A 5FPSA 3MD0A 3KDPA 3CZMA 1SBCA 2DRIA 4CIXA 3O90A 3RIXA 1NF8A 5FPYA 3B6KA 1JYEA 1TF7A 3N87A 3OZWA 4TTRA 2G9VA 2WJ4A 1U8EA 3GR6A 5K09A 1YS7A 2ZRBA 1B8UA 1C4KA 2ABWA 2P4HX 2FMXA 2J5BA 4NFYA 1V8FA 1KVTA 4Q03A 5DYGA 1Q1QA 5K4AA 1MC8A 2J7KA 2WSSD 3C6ZA 3W4KA 1IM8A 5A6VA 1U3UA 3MRTA 1H5NA 4JU9A 5F73A 5CB4B 1TYEB 3WGQA 1RMYA 3U7HB 1T5LA 3BZBA 4ND2A 4IDHA 2J46A 5DM60 4UJ3A 5ILQA 4L5CA 4EY8A 4Q7EA 4QQ8A 2O19A 1P4JA 2Q49A 1X0XA 2TMGA 1ESCA 3F7MA 5IDVA 4DQKA 5IKEA 5AKHA 1IBKB 2FYTA 1VL2A 1WCIB 3KKNA 3E9ZA 3X1MA 3GLHB 3IHTA 2Y3IA 4CMGA 4DVGA 5JYDA 2P5YA 1B8PA 4INZA 1PEYA 4LWZA 4QASA 4XVRA 2Z4SA 4RHXA 1TZMA 4E1BA 2BGRA 3AVOA 1EM8B 4E2XA 3QUSA 4KXVA 5A4KA 3BRWA 5CXQA 3AVUA 4FFNA 3EPHA 2R751 3NBXX 4OQXA 4LYJA 2WWHA 4JL6A 3OCWA 2YN0A 4XSHA 1G8MA 3I62A 1OLSB 4FKMA 1QHXA 2FR8A 2GHQA 1FMTA 3RSOA 3OZAA 4GYJA 2C2KA 2V8BA 1G20E 5B1IA 2D8AA 5U4QA 3EQ7A 2I9KA 3N2IA 1QE3A 3WGVA 1Y8AA 3IPXA 1LLUA 3ANYB 1T6XA 1KFCB 4MV1A 1GPKA 1N3IA 2V1XA 3BHNA 2BHLA 3RFFA 3H0EA 3ZOKA 2O1WA 3FWZA 1TU4A 4AK9A 5FORA 1H4TA 1TJPB 1N92A 4PW0A 4J9VA 3QITA 4Q9JA 5DIFA 1XAHA 3P9YA 5IF9A 1II0A 3HDGA 3LC2O 1A7AA 1EYZA 1Z0JA 3AZQA 4FNOA 4XM1A 5HZKA 5IM4A 5J43A 2H1FA 1ULBA 2WKQA 3INRA 4X97A 4CNBA 4KMOA 4BMZA 1V2GA 3NDPA 5CFMA 4A6PA 2BKLA 1PZXA 2FUEA 1B3BA 1WKBA 2JGNA 4ZFNA 1ONNA 2GZ3A 2LUOA 2CXNA 3E9RA 4NENA 3S7TA 3ZNNA 1C9JA 4OMUA 3IUMA 3ND5A 2D1RA 1J1ZA 1TKBA 1UPFA 1Z83A 4FYKA 2PA0A 2QSZA 5J47A 4TZ0A 1P1JA 4LYHA 3SBDA 3HYTA 4GGOA 1Y6QA 3D3WA 4H77A 2PFKA 4Y0AA 2W6NA 2VBFA 1V45E 1BXKA 4C3UA 2I91A 3O73A 5CH3A 4G81A 4MPDA 1V47A 3IUYA 1NOIA 4OXXA 4E70A 3BMCB 2IPXA 1KJIA 1RYMA 2X4IA 3OIUA 4JP2A 4KRGA 3A1EA 3S2FA 1UKAA 1BQ4A 1XCGB 4GUDA 4HDNB 1QRTA 3H9BA 4D8YA 4B6RA 1JEEA 3OFNA 4QTTB 4TKZA 2VDKB 8ABPA 4W9NC 5LN1A 3A9TA 3LK6A 4WUVA 1LLFA 3WS7A 2IYOA 4GKJB 4P2GA 3QW4B 1CRZA 3QMPA 4XFKA 2CLIB 2Y1DA 4CKXA 3QVJA 4R2KA 4JVMA 4PHTA 2GOYA 4WK2B 2AZDA 2IL1A 3FAKA 2GTHA 3N0TA 1C80A 3WC4A 1SBYA 5DJ5A 4BECA 2HRQA 5EPEA 1EDBA 1DBSA 2WNHA 1OYYA 1SUPA 2DHEA 2QLBA 1GYQA 4OXYA 4DRXB 2BSXA 1QE5A 3ES9A 5BT9A 4I1SA 3RU7A 1CPYA 1I4LD 3IP3A 1TDJA 3EG9B 4LGMA 2AEJA 3IRVA 4BMCA 1YHYA 3B3AA 1JZSA 1YO6A 2XKBA 3AQIA 5BUZA 2DFPA 3KALA 1HY3A 3EQZA 3K73O 1F2UA 1QB7A 3PFIA 5KYXB 4Z4FA 1L5YA 2NZYA 3QEKA 5JTTA 1KE1A 4XH9B 2VPTA 4FQ5A 1VA5A 3ZDCA 5JE8A 3VH1A 4A8JB 1DKNA 1FDRA 2W90A 1DI0A 4KYUA 1YFJA 1ISSA 1Z06A 2YVQA 3AF1A 4P92A 3TB4A 4YRZA 1O08A 2ZSUA 5DHUA 2FCAA 2XOKA 1DWPA 4KVZA 1KI2A 4LOLA 5CFZA 5FWNA 3V48A 3ZNQA 3LHDA 4YCAA 3DEZA 3UMJA 5EWJB 1DTWB 2GCNA 3HPQA 3C3DA 4K46A 2CK3A 4RKRA 3FTFA 4HD8A 2XWPA 1JIUA 1N32B 3KJFA 2QD4A 3N0XA 4N0EA 1C7FA 4P3KA 4UPDA 3OP4A 1C7ZA 2OECA 3P97A 2EJVA 1VI6A 1NBIA 3GRKA 5KHAA 3RVSA 1UP6A 1CIVA 4C07A 3L49A 1FFBA 4R6WA 3S70A 5J59A 4WHMA 1EM6A 3ORFA 3PNKA 1GGJA 3OJEA 5FAXA 4D7AA 1Y9EA 4HQKA 5K8UA 2X1VA 3KSRA 4K8OA 3G2LA 4Z99A 2G0NA 1AF7A 1J21A 3PFGA 1B2RA 1Q0UA 2CL0X 3A6HA 1P39A 3BXXA 2PZEA 5EHNA 3D6VA 3ENQA 3F7NA 1L7QA 3WGJA 5KIAA 4EAAA 4B87A 3KKEA 1AT1A 4TL8A 2EYUA 1DQZA 2DKOA 1SZCA 4XZ3A 4A8JC 3DYVA 3L6EA 4MKGA 1Q7CA 1XDSA 3X1JA 3RU2A 1TM3E 1IAVA 2BGIA 1VGVA 3GLQA 3N9IA 5HDQA 4EA9A 4OKSA 5IP5A 3SY8A 2R60A 2XE8A 1ZLXA 2YJGA 1KFJB 3AP1A 4LBWA 3TX6A 4HNQA 3V9PA 3U39A 4FYMA 1ZX1A 3GLIB 4D9BA 1GV0A 2HMSA 3WV5A 2HA3A 5C1PA 2GUGA 2XWSA 3BJRA 4P32A 4FIZA 4LFCB 3S8MA 1YDMA 4ZV9A 4L4UA 5FRDA 4C4PA 3TLKA 2X77A 4CV3A 2F1KA 2QWXA 5H4HA 4D9JA 2QY9A 3GGOA 1YB6A 4B43A 1M2NA 4CQJA 2XD4A 1KZ7B 2VSFA 4LNUA 1I6KA 3CEJA 4J2OA 3X1DA 3AEUA 3QOYA 5HMLA 3LPAA 4MYHA 1FTNA 5D85A 4KGZA 1CYEA 3UWPA 3VJLA 3KVVA 4MUXA 3P4YA 4NULA 1CJUC 2ZUBA 1XN4A 4X7MA 4JC4A 3CZPA 1U0OC 1GU7A 1IRIA 1IUPA 2XE6A 2HCBA 2IZ0A 2YRWA 3KTDA 4OQMA 4O08A 5DF1A 4EYQA 4YP5A 2BLLA 1K4YA 2EZ4A 2NZ8A 1VBKA 3Q6IA 1RHUA 5DGXA 1I6WA 4H7IA 1MIHA 5ADWA 5KWSA 5ER6A 2X0FA 3DTYA 3RYHA 1ZK4A 3PDWA 5LNK6 4YTEA 4HGRA 5EWMA 2D2EA 3I53A 2VHYA 1V16A 4DGSA 3DVSX 3NRBA 4R9RA 3TBFA 5CA1F 2OL4A 1POXA 2LIPA 2D1SA 3LHIA 4OHXA 2ZJ0A 4XQ9A 5F33A 1U6IA 3F78A 2VP4A 4MUIA 4PYKA 4DDUA 4D8VA 4CM4B 1JEYA 2IZ7A 5K51A 2WY2D 2JF0A 4G1UC 3MTQA 2XIQA 2FZVA 2X8WA 1E79D 3DXYA 3EVGA 1P7CA 2YL2A 5AJYA 4Y1RA 1ZRMA 1JE0A 1YASA 3ISJA 5KX5B 2OZLA 4RTKA 2G9QA 2GR9A 3G68A 4ZVVA 4MWCA 1PR6A 2WYUA 4P7FA 3VZQA 3CVJA 1E2JA 3DOJA 4DUGD 3ZU6A 5LP6F 2XQVA 1G2QA 3L8YA 3MYYA 4JP3A 1P2VA 1QQ5A 3LF2A 2XXBA 3PTZA 1ZESA 2JANA 4GVPA 4C6RA 4BP9A 4AKSA 1SXJD 3E8XA 3N28A 4Q7JB 3JS5A 1JU3A 4PPQA 3KDSE 1I4OA 1KS2A 4YMVA 4JASB 5JECA 2EFYA 1N2OA 1AQ6A 3SKVA 3ZE2B 9GPBA 2B5WA 3L6CA 1N2ZA 1PL0A 1PUXA 2H4JA 4BZPA 4EG8A 1PR9A 2V5AA 1Y33E 1EG7A 3IIMA 4J3JA 1KORA 3GT3A 5DEIA 5AM2A 1ABBA 1DXHA 3BTSA 5DHRA 2RK6A 3TZHA 3K71B 2KYRA 1MG0A 3RF6A 4C20A 5F23A 2SCUB 3OIFA 4CR7A 3K1AA 2QS9A 4CMEA 5AUOB 2ZS7A 1NXSA 2XVXA 3BGWA 1PT9A 1L7XA 4F60A 2WWTA 1NG9A 3KQYA 2AKEA 4O4IB 3CT6A 4TT3D 3QF4B 1QHYA 1UMCB 1W0JA 1R0LA 1UZUA 1JG2A 4J0FA 3RR2A 3KQLA 4HADA 4R7TA 4IDEA 4WK6A 4H6XA 1BSVA 3CR3C 1XRRA 4HDAA 4UTNA 4Q3BA 1PKEA 5HEKA 2IH5A 3EYAA 4Q4JA 1AS0A 1FX1A 3T7CA 3C6YA 4DG8A 1JHPA 5KYYB 3I28A 5J5AA 1D2NA 1OF1A 2QE6A 4BFSA 2ROQA 3CGGA 4MCIA 2PL9A 3L93A 4MDEA 3NO4A 1G7RA 1XU9A 2VYQA 2P3QA 3LH5A 4HATA 5TXGA 3SF8A 3ILYA 2PLAA 3SZRA 5T8KA 3ZBQA 3H3XA 1Z2OX 2CUNA 4RVDA 4Y67A 3TUJC 4QFBA 4JD5A 4EX6A 1ZIDA 1ZVJA 4PTLA 4DWOA 4OBEA 3VXKA 4CUJA 2AFIE 2AN9A 4K3UA 2QTVA 1U0FA 2Z83A 5CFPA 1ZOLA 3B13B 3EN0A 3ESZA 3I3OA 1YZKA 1TNDA 1ST2A 2Y93A 5LNK1 2GCEA 3WLKX 2AQKA 1E7MA 1YFKA 4IHJB 3R0ZA 3RWBA 3T5BA 5G1OA 4BU1A 4CPDA 1JDBB 3OJXA 3IVXA 2OHVA 2Q3CA 2IYAA 3NDBB 2JLRA 4CYMA 1RP7A 2G1JA 1TLFA 3ZW9A 3OOHA 1TM4E 4YBRA 3T9AA 1N5RA 2AZ4A 2G07A 3TDNA 3Q8XB 2Z8YA 1NLYA 3JQRA 2FP4A 4IF4A 5BN3A 1BGVA 1QF9A 1PK8A 2C8KA 1BS1A 2REOA 2E49A 3TXXA 1C8KA 3IR5A 2A0UA 2IA5A 4QECA 1KIFA 2R48A 3BL8A 2OUKA 1QZXA 1P72A 3NHAA 2YWBA 3NVDA 5C4IA 1AGRA 4NECA 2FUG6 3ECSA 3HO6A 4BUCA 2D3TA 3KQOA 1GPH1 2ZI5A 4I50A 2JIBA 3FCXA 4W1QA 2PGNA 3P9IA 2H5EA 4MCHA 4DKXA 2GT1A 2Q9AA 3SHTA 4ZC8A 3OI7A 1QDEA 1FPQA 3MZ0A 3WP1B 1WBBA 4PTZA 1ZOOA 1RWVA 4Q9KA 4WFJA 2GEDA 3G59A 3NDRA 4ZYZA 3LW8A 1XXHE 2R97A 4XOIA 4DM3A 3PPYA 4AIRA 3ECAA 3UJ8A 4MQUA 3OCVA 1D3AA 1USVA 1JDBC 1PR4A 1SOWA 1TT5A 4TLMB 5KPJA 2P0EA 4MQMA 4QGBA 2DWOA 3SNKA 1E1DA 1LVGA 2JFBA 3JQ7B 2M1XA 1Z39A 4K9OA 2BKEA 1ZP6A 1XKQA 3PEVA 3VR5H 4IQ0A 2XDAA 3B85A 1BMTA 3H6GA 4RE5A 3JQFA 3T5CA 1HZJA 1R2QA 1UK8A 4JBGA 4DILA 5J4VA 1F7UA 5E6UB 1JILA 2CBZA 3U4GA 2YQ4A 5DSZA 1TU0A 1EZZA 5DYNA 3D8UA 5H83A 3T3GA 4UVEA 5ITSA 1G59A 4UD6A 3I6QA 3HEAA 4M60A 4F91B 3PC4A 2IYXA 1O77A 1NF3A 2W6PA 1QG2A 1KQOA 1QYIA 3FH0A 3JALB 3M83A 4TUYF 1DWQA 3NB0A 1R50A 2D2FA 2SBTA 3RLIA 2W2MA 2PZAA 3VR4H 5EWLA 4Y9TA 5J40A 5EZYA 3RPEA 1IMJA 2HW8A 2FZLA 2OHJA 2IXTA 2QXUA 3RIEA 2EDAA 4RETA 1Z08A 4X7BA 1U0RA 6REQB 4FZJA 4HGNA 3R7SA 4XB1A 2J9YB 2H65A 2W42A 1YUMA 3HJBA 3RAFC 2R6GA 3MCAA 4HNRA 2AQ8A 4N7JA 1YMQA 3R75A 3DE5X 4U2FA 5AK5A 1VB3A 4EI2A 4MW9A 2HSWA 4NBKA 2RAVA 2PAFA 4TQ9A 2R7MA 2ZK7A 4YLYA 3LI2A 3PYMA 1C1DA 4LXXA 2PYDA 4Q37A 2JJ2A 3TRIA 2F6RA 2D13A 2D5CA 1FU8A 2BCJQ 2AN1A 4WNCA 2O3UA 4GX1A 3IQHX 4YMIA 5ENVA 3S1SA 4LWOA 2IVZA 3R7DA 4OG2A 4XLTA 5KSWB 5ECWA 4OJYA 3JWJA 1XVTA 4A0QA 3GRCA 2OCAA 2BR4A 3LF1A 4KEAA 2C00A 3A1CA 1PS8A 2AW3A 4REOA 4TV8B 4YMWA 3SYTA 3CX7A 4MVJG 1ZA1A 4J91A 4IUBS 1WABA 3LXMA 4IJMA 3STXA 2GPJA 4EJFA 3ASYA 3OCYA 1BH6A 3DKVA 4MRVA 5L3RA 2FUG1 3EXIA 1E9DA 1CY1A 1W0KD 4BIIA 2BMFA 2CNWD 4C14A 4O0LA 2ZYIA 3E0QA 4P4LA 2FUCA 1QHHA 1QRRA 2XMPA 4M8SA 5JG7A 1DC7A 1BOOA 3D7SA 3ZV6A 5C1OA 1VKOA 5JWHA 4JJ7A 3ZDFA 1RMTA 2H8GA 4E6PA 1UDWA 3P94A 4NBSA 3EUAA 2ZB8A 2DBVO 2I1LA 5ESDA 2UZ0A 3TF5A 1AM4D 4JL5A 1QP7A 1M34B 2B98A 2HK6A 1ADGA 3L7AA 5JJBA 3KBBA 5LLTA 4M3NA 4N9WA 5FX2A 4IXWA 4M9XA 1SIOA 1GARA 4PGHA 3WRXA 3I76A 2O5CA 2MU1A 1XKXA 3F3SA 4BFLA 2XXJA 4JK3A 5B1DA 4WK0B 4ZT6A 2O3QA 5F3WB 1UM9A 1DUSA 3H2JA 2VRCD 4E09A 4JQCA 4ZYLA 1WDKA 1CUXA 1RQNA 3F67A 4C03A 1LS6A 2KSQA 1LY1A 3BB1A 1ULAA 3OWHA 3U80A 5I7HA 3IP8A 1RYDA 1KK0A 2C0QA 3BMQA 1R4NB 1TZKA 3AP3A 3O4JA 4FXPA 2FG5A 4V0ME 4KIUA 2R00A 2B4QA 1CNFA 4DCUA 4D25A 1PEKE 3DUFB 4C0XA 5K0EA 4OGLA 4RMJA 5IT0A 2BJHA 2CL7X 3SM3A 4DF3A 4H3HB 2H5IA 3H87A 4MB0A 3CZCA 3G79A 1TTPB 1AQYA 2GBCA 4W1PA 4X65B 2VSXA 1PEDA 2MSLA 6PFKA 4RDHA 4X0EA 3V6LA 3DR5A 1FIUA 4QQKA 2KBFA 2NV6A 3LS2A 5IC6A 1FP4A 2E18A 3GLSA 1LK7A 3LP5A 1DJQA 5A1TA 4BLOA 3B1JA 5AXBA 2JHGA 2WKRA 3BF8A 1NURA 1O95A 5DLPA 1RXEA 4A6EA 1J7JA 3MOIA 2PGIA 3ABOB 3VOSA 2CV0A 3PHHA 3EOBI 1F4VA 1OKKD 2X1LA 4PGMA 2O8FB 1XQXA 1A95A 3GWGA 4YJGB 1PWXA 2GDJA 1U90A 2ERXA 3ELDA 3EAGA 1OPXA 4Q1EA 1GL9B 1TPYA 2XNSA 4HX2A 4MI1A 1PT6A 2WMYA 3L3BA 4YJ2A 1V7PC 2QDXA 1JKJB 2BRUA 3DLTA 3TJZA 1BMFA 4RDIA 2CXRA 3TQRA 3PHIA 1ES9A 3PC3A 4P8RA 1KO5A 1A5SB 5FF9A 2ZITA 2BCEA 2WTMA 1Z25A 3D4BA 1ZL0A 5I5EA 5KNBD 4DR7B 1IBRA 3NX4A 5BQFA 5ICGA 5EMNA 1MU0A 1XVIA 2NPOA 4MGYR 4A9AA 4WK4B 1P5FA 5GMOA 4ZI7F 1N2BA 1V71A 4YUZA 3FI9A 1GVHA 2VT3A 1F8XA 3E7DA 4HYTA 1JR3E 3BWDD 2BCGY 5BQOA 4ZAWA 3DE6X 3S40A 3FZQA 1VDZA 2CJFA 4WERA 1HI9A 1TAUA 4BO8A 3H1BA 3ZGOA 4OQNA 4YDQA 1RWNA 4DWWA 1AKMA 5KOHB 4BNKA 2IVFA 1E4EA 3NHKA 2I4IA 1ABEA 3A1SA 4ZO7A 3IQZA 3MT8A 3DULA 3L0BA 4H15A 3TAHA 2PX0A 3T9BA 2X8LA 2VLBA 4L2IB 3NHJA 2R4UA 5EZ6B 4J6FA 1I5RA 1P5RA 1OLUB 2CVOA 5HCNA 1QIJA 4B81A 3DTTA 2ZR9A 3GA5A 3R6LA 4D8XA 3M4NA 4W5HA 2UAGA 4DCPA 2ID4A 3CY6A 3EUEA 4A6XA 4JITA 2D1FA 4F21A 2Y0EA 1L9KA 5FYDA 3ZCPA 1E2MA 4HPXB 1W6RA 3WGIA 3BERA 1P2FA 4DIMA 3A6EA 3AIKA 1Y7IA 2H06A 2VLIA 4L9SA 4Q3EA 5T4BA 3U62A 3ZWBA 2SKCA 1R64A 4IM7A 4PZYA 2ATIA 4KMMA 5GY7A 5C37A 4JLSA 2R1TA 2OZEA 1EFLA 1VPEA 2X23A 4CIDA 1DPFA 2OCGA 1OB2A 3LXXA 4DDHA 1KVRA 5I4KA 4LVOA 4NL4H 1G16A 1XMJA 3ETGA 1DKQA 3VR0A 5DBGA 5HF6A 4H1WA 2C99A 3I9OA 4MWBA 2BFBB 3UMFA 3W1WA 4LYFA 3P7MA 2XYVA 2RK3A 4KO1S 4RIFA 4C1BA 1AY0A 3V9AA 1H65A 2GH1A 4L5YA 2PLWA 2DAPA 3GRRA 1M76A 5KNCA 2CHVA 3BTOA 2FDRA 2WA2A 2BHSA 3QLJA 2C3MA 1I7LA 5IF3A 3CUVA 2NXEA 5EQTA 1JKMA 4DYHA 4YASA 4OBWA 1X1AA 2V7TA 4JHLA 3OTGA 5TQ2A 4ZALA 1VKNA 1BXGB 3MPUA 3OPYB 4LTDA 1CUCA 4FEAA 4F5DA 2V0NA 5CLFA 2OGWA 2PWAA 1GCGA 3DWGA 1G1AA 2D7JA 2I8CA 2VAWA 2L42A 2DFDA 3A70A 1C0KA 3FPKA 3PCTA 2DQSA 4JEIA 4WQMA 1B8VA 1ZUWA 3I23A 4FDUA 4NU0A 5IUKC 4GI7A 1P5HA 3MVEA 3RM3A 5K3SA 4LZNA 4L08A 4OMFG 3VX3A 4AF8A 2C61A 5ECDA 2HSDA 4C3ZA 1F60A 4O8CA 1YZHA 2PO7A 2X6QA 1NHWA 4MUEA 3UAXA 3Q5GA 3RQIA 2G83A 2I2AA 3OKFA 4JELA 1YR7A 1T9DA 4GMFA 2B9VA 2QN8A 2XWJI 3A0RB 3F1LA 4YRRA 2GKOA 2IQIA 5AW9A 3UAYA 1Z62A 1XTPA 5JDIA 1Y6RA 2TMDA 1O9HA 3WLHA 3WAKA 1U7OA 2IZOA 4I55A 2ZPUA 2JLQA 3Q87B 3ETEA 1G3UA 1VKRA 1QVAA 2A0YA 2UVDA 3ETLA 3K7EA 4L5JA 4QYXA 4HEA6 4UBNA 4ZANA 3BT7A 2P79A 4DRYA 4NATA 4MQ5A 4QOIA 1G17A 3CJQA 4YP0A 4Z1OA 4BFWA 1H0RA 3TXYA 2UDPA 1E1NA 5GJWC 5DNEA 1IPHA 4WESA 4C30A 3X44A 2R6FA 5ER9A 1P19A 4DBVO 1H2ZA 1W30A 2GEKA 1UFOA 1T2DA 4M0LA 1DSSG 1EBBA 3ZU3A 3KTAB 1AKTA 1N7IA 2ZBVA 3LVBA 3N6XA 2CLCX 4MWTA 1A8HA 4HJXA 4YBZA 3DAGA 2NO7A 4MR8A 5KJCA 2C7QA 2P3LA 5KHOC 2X9LA 1Z12A 2HDHA 5L3SA 2FPGA 5KUTA 3G0HA 2I67A 5AKIA 1CY8A 2XMZA 1CDOA 3DZGA 1L9XA 2GDZA 2OUIA 1MTZA 3PUZA 5IN5A 4CMJA 2ZBPA 4NEHB 2NNLD 4D4IA 4DSNA 4UHCA 3VH3A 1WBDA 3C5EA 1COWA 2M6KA 5F2OA 1MD9A 3SQDA 4MS3B 1BHQ1 3DE1X 3TPZA 3TECE 4L5BA 2PS0A 4QWWA 3DPIA 3TNYA 4YCCA 4QYWA 2R1UA 4BFXA 1KPHA 1VIAA 1GYPA 2K2QB 5FTWA 1MOSA 3U4QB 3M89A 4PAQA 3OZCA 4AMZA 4JUDX 3SVTA 1YA6A 3KP1A 1J0BA 1TL7C 5JNUA 3ABRB 4MQEB 4M7RA 2JGLA 5D7NA 3BK7A 2YW2A 1N2EA 2FWPA 4JBNA 3GD7A 2CFOA 2ZSFA 3HA2A 4RENA 4GPZA 1JAHA 2VPQA 2RKOA 3VDQA 2I2WA 3WGHA 5K8TA 3NI2A 4IFTA 4P7JA 2FJUA 1QK5A 2CVPA 4W8HA 4X41A 4IJ6A 4N8DA 4P54A 4MGZR 1SUCA 1NP7A 2KLHA 4HLNA 4IO1A 2EJWA 2ODNA 1YBHA 1FYVA 1SD2A 3N86A 2XCRB 1GRQA 3QPUA 3JZAA 1C9KA 1GR0A 2PGAA 3WZMA 2DJIA 3QUTA 5IFKA 1K7YA 2B3DA 1RXCA 2FN9A 3FGOA 1RAFA 1SM4A 4PQYA 3VC1A 2QZZA 4YR7A 4LE1A 2XE4A 1H5UA 1AUXA 1Y3DE 3FSRA 3U1TA 3VBEA 4ZIRA 5CVCA 5D86A 4W4TA 3SCZA 2BDEA 2UZ1B 2VYVA 3NS7A 1O7JA 3THXB 3HMQA 1Y1SA 2QW0X 4WLNA 1IN8A 2ZUVA 3EOAI 5AJVB 4Q1DA 4DNXA 4RC9A 4AW9A 4HEA1 1A82A 3UPDA 3VFDA 2ZUFA 2YQZA 2JH8A 4X6YA 5JS6A 5M34A 2KX7A 4JDUA 5H5JA 4DUPA 4QA9A 2QR5A 1CJMA 2A1UB 3A32A 3FXAA 2NW6A 3NH9A 4RFLA 4DLYA 3I09A 5FEUA 3WIVA 4MRNA 3SAJA 4Q3NA 3B6ZA 1LI5A 4XRRA 3ZHXA 5K3AA 1Y8QA 3Q3GE 2NO9A 2BEVB 1XZPA 2DEUA 2QEQA 5FTNA 2J3HA 2ZJYA 1PD1A 3JX9A 4J3FA 3ER9A 4P08A 1K08A 3T54A 3CVYA 2ZUEA 2HEGA 1FNDA 1DBWA 4UUQA 5G02A 4ABTA 4EMBA 2EU8A 2WD7A 9ABPA 4Z7QB 3LYAA 4DMGA 3V8RA 2XZPA 1FYXA 1NP3A 4PG8A 1TKRA 1DWOA 2E4UA 1DX9A 1WRBA 2ILTA 4MW5A 3MC1A 4OP3A 2V6BA 3W2IA 1Z88A 5CB4F 1VLHA 1XTSA 4UEQA 4KOEC 2A88A 4D4MA 2OGTA 3LG2A 5JC1A 4KB5A 5AP9A 3JYQA 1KYTA 3KLBA 2I3BA 3WLTA 4BMYA 1NRWA 5E4JA 3NANA 5JOQA 1GG2A 1FLDA 1WUKS 5B2EA 4Z2YA 1OHHA 4MWEA 3BGIA 1U0JA 1W19A 1E1QD 2EWMA 2HNAA 3NHMA 5KOYA 1Z68A 4GBGA 3FDZA 1KO7A 4DFDA 4KITB 1I3CA 2NSHA 1V41E 3DDSA 1I33A 4BLUA 2GI4A 5F1KA 2FK7A 2LDBA 2VTDA 1NN1A 2D54A 4MYUA 1EJ0A 3K1JA 4YEDA 3L4JA 3I52A 4NNOA 4V0NA 5KOJA 4RIIA 2AJ8A 1JHUA 2BFFA 2JDIA 3W5VA 1Q6YA 3NRCA 4PR0A 4EG1A 3JQ8A 3AR4A 3B8HA 1NBMA 3BZWA 2XA2A 1BRMA 4TWZA 3A25A 1MT3A 1XZIA 3IAS1 5D3MA 5F51A 1JJVA 3GDOA 5IVKA 4PZUA 2P9EA 4LXTA 3VU3A 2LD4A 3HBAA 3K16A 2JJQA 3DUWA 1GPLA 2ZE5A 1KEUA 1X7HA 2QL9A 3WSVA 4M1YA 2QE7A 3CLTC 1G8HA 1QNFA 4DTCA 2UYHA 1CUUA 1N7HA 2D4AA 3OUTA 4QBGB 1TM2A 1VL6A 2WSSA 1RW4A 2OSBA 4LE0A 1ZKDA 3P5BA 1J1IA 4YAOA 3C3BA 3BH7A 3Q8MA 3T3DA 3KAQA 2LNDA 4ES6A 1ULSA 4YLEA 2K2WA 3P2KA 3D02A 3QV2A 4AULA 3LFHA 4PYJA 1PJQA 2EHJA 4M9RA 5ALZA 4AJKA 1M0WA 1VSVA 4PSKA 4HLUC 1WB9A 1S9DA 4R2JA 4KAAA 4U1RA 3FHTA 2YWCA 4NENB 5AW5A 2QL5A 1Q22A 3KUKA 1B0PA 3GJSA 3KIPA 4EUFA 3L0PA 1WLYA 1G8YA 2V74B 1K68A 2VRWA 3WB9A 1HT3A 1JQAA 1NW5A 4AJNA 1SHTX 1K0FA 2ZWPA 4A8PA 1AGPA 3D3WB 1B6RA 3HCEA 2FR8C 1LPSA 3N75A 1K8RA 3TTXA 2GXQA 3WAJA 4V38A 1MO3A 2FJ0A 3DKKA 2BMAA 3N7UA 3FNQA 5C5IA 4TVOA 2OCIA 4PZ0A 3UMBA 1C1XA 4N9QA 3ZI4A 4XYBA 5FAKA 1TRKA 1KWGA 1UXOA 1COZA 4CR8A 1Q5PA 1DTSA 1TK9A 2D5AA 2V7UA 5ELXA 2V55B 1QUFA 1VDMA 4R68A 1HDZA 2BWJA 4P93A 2PRKA 3W77A 3OIGA 3IT0A 3M5DA 3Q41A 5BR1A 3UCFA 2F9MA 1Y1RA 3K0AA 3ETNA 2C7RA 4DE5A 4IO0A 3TBKA 2BAGA 2BF4A 2NSJA 2SICE 4V0SA 3GQBA 3RDPA 1FFAA 1IATA 4ML3A 2O7VA 2JHFA 1ORRA 1ZH2A 1HE8B 2IZ1A 3K9CA 1O8CA 4TL6A 4H3SA 1HLFA 2OESA 3Q4GA 3U9LA 4DZTA 1MQ9A 3PTAA 1P18A 2HJ9A 2XYPA 4E4RA 4E5KA 1T13A 1CF9A 4O6VA 5AWFC 1YDWA 2X4GA 1ZMXA 4RWEA 3VR5D 5JSUA 1MRNA 2UUAB 1W4LA 3JW8A 3GNSA 2D6FA 3ZHTA 1P2GA 2OY0A 2VWHA 4KH1A 1Y6FA 1E3LA 5FLKA 3H8SA 3GJ6A 5FJJA 1XFAA 1F2UB 5GWXA 3RW9A 1G3RA 2CL5A 2VWGA 2J0UA 3DJFA 3CX3A 4OJTA 5A2GA 4BNUA 2FRDA 2AOXA 1FMJA 2NPIA 4LBYA 2OVFA 2QTMA 3LHSA 2ZE8A 3B89A 1C3XA 4JLMA 3ESCA 1RT9A 2OQIA 1WG8A 2BI7A 2VQSA 3GV0A 3LCRA 4PAWA 2BT4A 3OHPA 3VR4D 3AHJA 3E1GA 3ZCTA 4CETA 3KPYA 5EP1A 2YVUA 3L6OO 1KEKA 2OFPA 1K27A 3PGMA 5DW3A 2C9OA 4O4HA 3MAAC 2C8JA 5GOTA 2OXFA 3DZDA 1U5BA 2NQ8A 1DBIA 1RAGA 3E82A 1HF3A 3QU5A 3U4CA 5KYKA 1Z4JA 2FQ1A 2ZIUB 4GU5A 1RCTE 2GX6A 2O3TA 3HH8A 3QVSA 4H18A 1YONA 5A02A 4IXMA 1AKQA 3OZEA 2WIDA 2OLKA 4KXMA 1U5CA 4EG4A 1E2FA 2WJ6A 1WUYA 2PSJA 1BX1A 4L50A 3D1LA 1OTXA 2E6KA 5T6MA 3JR3A 3DMTC 1CSEE 3IJ5A 4V0LA 3NC1C 1A9ZA 4ZARA 2Y6UA 4BKOA 5EHXA 2ZZNA 2PCJA 3OETA 3T8YA 4TZKA 1K63A 1AXEA 1SXIA 1SNYA 1PG2A 1XCOA 1YE8A 3P52A 3HUUA 4FCWA 3AZOA 4ZAFA 1PCXA 3L2OB 4LF4B 1JPJA 3L8ZA 3QWBA 4JSTA 3UWMA 1YR3A 1Y3HA 1PJTA 3PIRA 4KLNA 4PF1A 3L77A 4WSOA 5CLQA 1CLUA 2GZDA 4L6IA 4Q4LA 1G2OA 2EJTA 3Q3EA 1M7BA 4YRCA 4R7GA 4ZQFA 4MINA 3FNHA 4M6WA 5JCOC 1ZH4A 2IEGA 2ZTVA 3PZRA 1RYYA 3MJEA 5TEWA 3ZKAA 2A9KA 4LCBA 5C7IO 2AVNA 3ZBTA 4CGYA 2ZETA 2ZBDA 1PYDA 3OH8A 3SJZA 5A4MS 1IYZA 1H6BA 2H0RA 3H5IA 3P9CA 3Q9SA 4ETIA 4LF7B 1X7WA 5FOSA 3ENNA 1BQEA 1XF9A 1Z6AA 3AB7A 4DAOA 3I8OA 2XYQA 3CO0S 3OX2A 3HVRA 4W5NA 2FY8A 4AS1A 5KJEA 3GLHE 2R8ZA 5JFOA 5JI2E 3H86A 3EY4A 2PUTA 4LNUB 3MCVA 3KNZA 4QPDA 2XEDA 5EE9A 2WINI 3ED1A 3F71A 2ZQ5A 5FV7A 3AEUB 2F4VB 4N3GA 4YROA 2JD2A 1RNLA 1U2TA 3EGIA 5TMPA 3A1VA 1UANA 4RM3A 1BDIA 2PKCA 4WZAE 4NBVA 1Z74A 4GVXA 4MMXB 1Q15A 5JW6A 1CUHA 3C5CA 3L43A 3U26A 3RHFA 4RGVA 1AS2A 2HBYA 4M1ZA 1E92A 2PSSA 5B3AA 3GC6A 4ZREA 2EZTA 3SK0A 2F8MA 1JEJA 1JWBB 3FSGD 3JXEA 5EWMB 3WGGA 2GNAA 4RK6A 5IVPA 1RLTA 3TL2A 1V16B 4CKZA 2DE0X 3SVZA 1XEWY 2W6OA 1MPTA 4QDXA 5FADA 4E5VA 5LQSA 1TTTA 5HX7A 1NQTA 2ISSD 1JEYB 1NULA 3HXPA 3EIFA 3K0EA 1M2WA 2FSGA 4RY9A 5KX5F 2D2VA 3U0BA 1NPDA 3PK0A 1TCBA 3I45A 1WPGA 4L6AA 4YMHA 5JSHA 3R0XA 2ILVA 4K86A 1RRGA 5C1DA 4Y1RB 1BE8A 5A71A 2QLTA 1VSTA 3QVXA 4J3NA 4AY4A 1CY0A 3TSZA 1GPUA 1LEHA 2AN4A 1MAHA 2XITA 4IJKA 4M0EA 2PSFA 4X71A 4B4WA 4CQMA 4DZRA 1JMKC 2O57A 1M6NA 3RYCA 1UDBA 4UMVA 1XGKA 2G76A 4D81A 1NJ6A 3FGZA 3P9XA 1T6ZA 1TKAA 2HQOA 1SU8A 5IJ9A 3IKMB 1ZM3A 3RBVA 3LK7A 2OK7A 4IDQA 4C29A 1SVNA 2OBLA 5KNLA 3BXEA 1T1GA 3B6JA 3PI6A 1FFYA 2X8BA 1R4ZA 2H4YA 3CNQS 5JIBA 2C5FA 3ZE6A 1GTG1 3N2KA 2R44A 1KRHA 1QAOA 2SECE 4F3NA 4GI3A 3FCOA 4ZKDA 4RO0A 1CHNA 3EULA 3F5DA 5ED0A 5FEMA 2IYLD 1EFAA 4ARBA 5LA6A 4GHWA 4M9UA 1K6MA 4M46A 5T6BA 4ZODA 4EECA 3K1AB 3CINA 1Z8HA 1FP1D 821PA 2F67A 3D2BA 5J4KA 1KVSA 4N47A 5BY2A 1NE2A 3CG4A 3AJRA 2PNJA 2WJIA 1U9IA 1YL7A 1CUDA 4GLFA 2C1ZA 2Q4BA 1O94A 4J03A 5CR9A 3UB3A 4BYMA 4WJZA 3C3JA 4M2LA 2G1PA 1CULC 2PXCA 1W34A 1WMEA 4OGGA 2ZG6A 4Q4JB 3ZWXA 4JI2B 3CCBA 2AG6A 4G8JA 4LF5B 2VHUA 4HQ6A 3ST7A 5AM3A 4N5NA 3QH4A 1E79A 4KUGA 3V7FA 2Z8ZA 1SGWA 4AKHA 3RKSA 4Z7OB 3OQJA 3NOOA 3UN1A 3SF8B 3I5UA 3OF3A 4MKIA 3C6KA 1ZIYA 4G4GA 2NUAA 2Q6OA 4K9SA 2GPYA 3SFZA 4CQNA 5BNIA 5JMOA 1OW3B 3LV8A 3GFVA 3ILXA 5DYYA 5ITVA 2HK8A 1SXJA 3MRXA 1Z37A 4IHJF 2QTVB 3OE1A 4MR7A 4DMHA 5AM1A 4XVUA 3R44A 4KPUA 4O2LA 1V96A 4CM9A 3K8QA 1UMBB 3EISA 4K6OA 1BN6A 1LQ2A 1PSWA 3E1SA 4D96A 5B36A 5CYGA 2OV2A 1XRJA 3OOWA 5BW6B 1YD7A 1Z38A 1MHPA 1KEEB 3PXXA 4JQSA 5EHQA 3E4DA 4U7JA 1FX0A 2QJRA 3P1JA 3H5NA 1X7DA 2XW6A 4RE6A 1IEVA 4RVHA 4EGJA 1Q3TA 3CT4A 4FPXA 2XUKA 5E2IA 2DPXA 2AVDA 4PNEA 4IDFA 3NUQA 4INOA 3HGMA 4NOLA 2FP4B 4HDMA 5DM1A 5BN3B 5FUMA 5CG1A 4O33A 4TT3A 4MROA 5EPOA 1FXUA 4Q7MB 1D6JA 3ZGNA 1TX4B 1XCMA 1RJWA 2Y05A 1OI4A 3RUPA 5CB8A 1N8TA 1NSYA 1L7AA 3EK2A 4Z7NB 5JZSA 3AV3A 3B1KA 2VXOA 4JR2A 5C4GB 1DKMA 2XGMA 3OE7A 4Y2UA 4DARA 1MHTA 3W5AA 1ESNA 1GPDG 3EH1A 2PXAA 1RP1A 1Y1QA 1Y8RA 5T8KC 1GIAA 1JE1A 3VV2A 4TLBA 1YMUA 4UNSA 4QVGA 1LWOA 1GKLA 4JOSA 2FI1A 3MEQA 1BHSA 2BZ0A 2DFKB 3EDQA 3H1AA 4GMKA 4MVJI 2W71A 1V26A 2XADA 3HEMA 1S5PA 3H5VA 2PG3A 4D0GA 4FFLA 4E14A 2B2XA 3R3JA 2IHKA 4AMYA 4JKYA 1X80A 4FUQA 1W73A 1W85A 2QT9A 2E4ZA 4G41A 2HIHA 5FULA 5BN4A 3UWSA 3HY6A 2NO6A 3ZY4A 1TT5B 1G5TA 5CXUA 4JOCA 1TO1E 1O4VA 2VJDA 3UK1A 2QNRA 1XWFA 3RIMA 1PGOA 3GLIE 4JZKA 2UUOA 1O96A 3OOSA 3KFVA 2MSEB 3K0BA 5DIZA 1Q1BA 5CLHA 3ZWKA 4U9IS 3EZGA 1U3VA 3KOMA 3PF9A 4CM3A 4GOOD 3ZZNA 2DTDA 4FE7A 3HZHA 1LBQA 3HUFA 5J1SB 1M0SA 1Y4DE 2JI4A 5HIKA 1JR3D 2CCGA 5HF9A 5KC8A 1O57A 4LJ7A 4BGVA 5J4YA 4L28A 3EXHC 1OAAA 4ZMBA 4FWIB 2XT0A 3UGTA 4BDSA 4L6CA 2PTHA 5EWLB 3BBPA 4PHFA 4FZRA 4G0VA 4JBLA 1EUCA 1XU4A 2I0FA 5DBEX 1LZKA 3K8YA 4WDRA 4Y2PA 3JYOA 3TSYA 1KI7A 3MQ4A 4G89A 3K0KA 1T2FA 1R74A 1WTAA 3PRJA 5F2KA 1GKIA 1FTYA 3U31A 2A0WA 5AKEA 5AVSA 4ZDWA 1V3UA 4FKBA 1SVOA 3NOQA 2E2WA 4KXFB 1MC5A 1T36B 2XUJA 2ENWA 1II8A 4LJ6A 1IK6A 3WVNA 4EHBA 1EEHA 1Z56C 4BMOB 2IUUA 3DWFA 2RAUA 3JRNA 3IB3A 4HF7A 5DM0A 1C1DB 2PD4A 4DMUB 4EKNB 1KYQA 3PDUA 4BO1A 5BR4A 3CPSA 3G1TA 3CZ4A 3IUSA 1QOQB 2FLWA 3EFOA 2X8JA 3LTEA 3S1AB 4EENA 4TV8F 1L6RA 3BORA 2UVPB 4NQZA 2R8RA 1K8ZB 2XUOA 4W99A 1C8BA 3SJBA 3EBLA 4MUKA 4A8TA 1EGHA 2I4NA 2X2OA 4YX9A 2NO4A 1RRFA 2PMFA 4B32A 3UA3A 1ENZA 1TD1A 3JVDA 2A86A 1HDGO 3AY6A 4ZI5A 3STTA 2SHKA 3K9HA 2PSEA 1U7UA 1P33A 2Z5LA 3VNBA 1MO4A 3GB9A 4RXTA 4BNFA 4YT5A 1JQEA 1WP9A 3OE4A 4M9SA 4YXWA 4QLOA 1L5VA 4CIVA 4EPWA 1EE2A 5ERXA 1YFLA 3DAYA 3OEED 5E7JA 4CE6A 1QHHB 2RHRA 4IXDA 5IFLA 4HDOB 4BFVA 5ICMA 3KSAC 4FYPA 3HYRA 3CLKA 1DLJA 1TTHA 3NH6A 3QVOA 4HI0E 5DHPA 3CWQA 2G1KA 4NBLA 1S2GA 3PT5A 4WOCA 4YHHB 5KJ6A 1SVIA 2VPXA 5JY1A 2W2VA 4I19A 5HE8A 5C8YB 1NIJA 2EF1A 3I42A 3R6TA 3C5VA 4JGBA 5K3FB 2G0TA 3LA8A 4RTSA 2ZSHA 3X1WA 2YH2A 3K53A 3PL1A 4G07A 2V4MA 1ZL2A 4FMBB 2XNCA 3L06A 4AJ1A 4EMUA 1UJ4A 1XD9A 2OC9A 2I6UA 2V7QD 1OU0A 2PUWA 1FVOA 4LRSB 1UZAA 1S2NA 4RZHA 4PCLA 3M70A 3OEWA 1UM9B 1RAIA 3A2MA 3SWWA 1BOFA 2GBIA 3QP9A 4KWHA 3EODA 5C7YA 3LHKA 3STYA 3JQPA 2CXHA 3K9LA 1DG1G 5I7WA 4BZXA 1QQAA 1OXSC 1ZUHA 1VL1A 3HGTA 4EIWA 1NONA 1KDZA 1BX0A 3LBNA 4UZEA 3BMQB 5HKAA 4JYZA 2NMVA 2ZE6A 3EA4A 4DV6B 5BO5A 1I3KA 1Z6PA 3FE2A 1S2OA 4GRAA 1YZLA 1U2GA 3MUOA 3ZUPA 4WLVA 2YFHA 4V1CA 1QVRA 5FWYA 3A2KA 4ALNA 1P7ZA 2CNWA 1CJBA 1TJNA 1QFMA 3R77A 4XVCA 1QYRA 3SIPA 1VYHA 1RYNA 3BQ9A 4C5CA 5JROA 1Z4PX 3B2QA 3ORQA 3HKBA 2CL6X 2C3OA 2H1SA 4PLTA 3PXGA 4MRPA 1N1DA 1XL0A 2VUHB 3U1VA 4MVJF 4IVNA 1VPVA 2O2GA 2HK7A 2GWHA 2OGSA 2ZFUA 5EIWA 2HF7A 2R4QA 1FP4B 4JB2A 3GBVA 4B7XA 1U3FA 2O4CA 5I7RA 2DPYA 3GLRA 3KZMA 3HUDA 3ICOA 4I99A 3OCJA 3UK7A 1N34B 3CW2A 3V4RA 3QY0A 3TQHA 2XRZA 2IS1A 3T1TA 4RPHA 4B45A 2CUKA 5IZCA 1G63A 1IQ0A 1U3GA 2YJ6A 4JCCA 1M5TA 1NI4B 5ALEA 3R6GA 2EWWA 1UBTS 3SQOA 4MZXA 4US2R 1MAWA 1V7CA 1SCJA 2PGJA 4Z4EA 1X7XA 1LRLA 3M3HA 3P9KA 4I4TA 1CY6A 2B36A 2OOSA 3JZFA 5KTKA 4GWGA 1QM5A 4YJ2B 1I2DA 1ZHHA 5EKUA 3ICWA 2D0PB 4LTNA 1RWOA 3ADPA 3I05A 3HFSA 2R00C 3ITEA 1WU7A 2E89A 4TS3A 4EVIA 3G9ZA 4Z3KA 2P4EA 2H9IA 2UZIR 2WZDA 3U44A 5CTAA 5A0VA 1F0PA 2G36A 3ZXUB 1MCZA 4TL7A 3OTHA 4BAGA 2HSZA 2NLOA 3DAPA 4MS4A 5A6SA 4JBXA 1TEXA 1VLMA 4BBJA 3WL8A 4ZVPA 3R3YA 4RY8A 1ZNWA 4ND4A 5DWDA 3L8GA 2Y9MB 2COKA 2Z43A 3DW1X 3MUEA 4M88A 5G40A 4F6RB 1UZNA 5C8XA 4NHEA 3NG1A 1AHHA 2G6TA 5EERA 3LPLA 3UMRA 4TMWA 2ZCJA 1E4EB 4PLHA 1YQ9A 4I3HA 1J8MF 2F1HA 4CW7A 4N3BA 5D01A 3JWIA 4ER3A 3G7NA 3K9FC 2W2LD 4BO6A 2WAXA 5THKA 4NPAA 3E48A 3N8HA 1M1YA 2P3SA 1XBTA 2I9PA 3ZJVA 3M81A 3BMOA 4LQDA 5KWVA 3BD6A 4S1VA 3MWDB 3ZJ5A 1J4AA 1OKKA 3L84A 1H0KA 3LO5A 3L7DA 3OIVA 1LDBA 1PT8A 1SKYB 1AKEA 1YZTA 5E2AA 1BEUB 3GMSA 2VA9A 4QNMA 5ENDA 3R7LA 3S6JA 1LF0A 3MJ4A 4LS3A 1P8JA 3TEJA 2C2BA 1LTQA 1XLTA 2O3RA 2YY5A 1E58A 1NYRA 3EB9A 3K4QA 1SUDA 1PEAA 3GIWA 4I4NA 2IE8A 1IY9A 1THGA 2R1TB 3PDHA 4J1SA 1JFLA 1N57A 3IMEA 4L9WA 4LY6A 4Q19A 1PW5A 4RKWA 3RYIA 5KNBA 1DBPA 3CVUA 4RH0A 4EARA 2HF9A 4W7IA 1H4QA 1IIBA 2P1DA 1JZQA 1XD8A 2GXUA 4XYGA 5E6RA 4B9EA 5HG0A 1MVNA 3B38A 3JQBC 2BM8A 2RG7A 1XTZA 5LBIA 3RFTA 3ZDZB 4HP8A 1OZHA 4EQ6A 3THYA 1JHXA 5JMTA 1RI2A 1YR9A 3QBEA 2LR0A 3SR3A 2ODWA 4WJKB 2BMVA 1GGNA 1XG5A 2DPMA 4AMBA 1YCFA 2GVZC 1WY7A 5K6RA 2Q5OA 2PUDA 2P8JA 4JKIA 4UHHA 3VSCA 4ZCMA 1H1TA 3D7MA 3I39X 3K1TA 1MA0A 3OLXA 4ZXFA 2IP2A 3VPGA 4G5HA 1XEAA 4JBYA 3SJCA 1CJSA 3O3MB 1H8HD 1UBEA 3OLZA 5COQA 5TQ2B 1Z7EA 4IQ8A 1QYWA 2YS7A 4BGEA 1M6VA 2O52A 1S89A 5BYKA 3CF2A 3G13A 1GT91 3HJFA 5TLSA 4OU5A 5CEFA 4K9DA 4BLSA 4MVJP 1LSUA 2Q2QA 1GPYA 2AOWA 2DF8A 1YR8A 4FGJA 2GM9A 2J5KA 4EG3A 1M34E 3OX4A 1T3SA 3UWKA 1U1FA 4CR6A 1EGQA 1QLWA 4YIHA 4MK4A 3S2UA 1H42A 4UE2A 5BUSA 2V9PA 3DZIA 4KRFA 3VHLB 4TWIA 1A77A 4MA4A 1J24A 1ZJWA 4JC0A 4B6OA 3JCZA 4IKOA 4I55B 1E9BA 3QFRA 4A36A 5DN6D 3CLRC 3VBCA 1VXOA 1SHZA 1CLEA 1CQIB 2VT7A 3MIIA 4W6ZA 5E3JA 2DX7A 3ZIAD 1GNSA 3KEQA 1LFDB 3F9IA 3UXMA 1K2WA