4C7BA

Complex of human sirt3 with bromo-resveratrol and fluor-de-lys peptide
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
272
structure length
261
Chain Sequence
KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Sirt3 Complexes with 4'-Bromo-Resveratrol Reveal Binding Sites and Inhibition Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/peptide
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-3, MITOCHONDRIAL
total genus 86
structure length 261
sequence length 272
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4c7bA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4c7bA01
1YI0A 4MQ5A 3ZGOA 3D4BA 3JWPA 4IG9A 4UUAA 1Y9DA 2X7JA 4J1TC 3ZG6A 1T9DA 1U31A 4FZ3A 2JI9A 1ZPDA 5EJ4A 1PTJC 1QPBA 1UPCA 1EFVA 1V5EA 3GLRA 1UPBA 1V5GA 5MFZA 5K2OA 1Q1AA 1U2DC 1PO7A 4UTZA 3RIYA 4HD8A 2H59A 4FVTA 1SZDA 1N0HA 2BRUC 4BVBA 4KGDA 1Q6ZA 2AG1A 4UTRA 2OD7A 4KXQA 3K35A 4QQ8A 1BFDA 1ICIA 2B4YA 2Q27A 4JU8A 3CLRD 2NYRA 4UTXA 4BVEA 2IHVA 2Q29A 4BUZA 1M2NA 4K9QA 1M2HA 2VJYA 4QPZA 5DGTA 4K9MA 2FRDC 3CLSD 2V3WA 3U3DA 4L3OA 4BV3A 1YI1A 4IF6A 2JI7A 2VK1A 1JSCA 2IHUA 5DEIA 2EZ4A 4Y6OA 5MF6A 1YNOA 5D7NA 3D7KA 1U2GC 2Q5LA 1PYDA 2OD2A 4I5IA 2UZ1B 5MGNA 1NM5C 4JUCA 2QQGA 4X3PA 3F6EX 1Q17A 4G1CA 4O8ZA 1PNOA 5BWNA 2VBGA 3CLTD 1M2GA 2H2HA 3FSJX 4K9KA 4BN5A 4ZZIA 2HJHA 1HZZC 1POXA 4JUAA 1OZFA 4V1CB 3CF4G 3ZGVA 4UTVA 4UU7A 4FEEA 4QELA 4K9PA 4COKA 1YHZA 2H2IA 1O97D 2EZUA 2W93A 3PKIA 1YHYA 5EJAA 4RMJA 2UZ1A 3FLMA 4F56A 2PANA 3JR3A 2VBFA 3EA4A 4K9NA 4RJKA 4D5GA 4GM4A 3IAFA 2C31A 2Q5JA 4GM0A 1EFPA 4ZP1A 3U31A 2FWNA 3PKJA 2WVHA 4RMGA 1PI3A 4MPPA 4MPRA 3GLUA 3RIGA 1MA3A 2QQFA 1S7GA 4RMIA 2A1TR 4IAOA 1OVMA 1J8FA 1PVDA 3GLTA 4V1CA 4UUBA 5K6TA 1YC5A 2H4JA 1Q14A 3LQ1A 3F6BX 2IHTA 4BVGA 5FEMA 2H2DA 1OZGA 1PNQA 1PT9A 4GP9A 2OORC 4MPJA 4JD5A 2H4HA 2FSVC 5FYQA 4L2IA 2AG0A 1UPAA 3EY9A 1M2JA 4HDAA 1T9AA 4K9LA 1T9BA 4KPUA 2JLAA 4UU8A 1DJLA 4F4UA 2EZ9A 2JI8A 2H4FA 1O96B 5EJ5A 2JIBA 5BWOA 4RJIA 1YC2A 5EJMA 4GG1A 1YTLA 4Y6QA 2PGOA 2OO5C 2JI6A 2VK4A 4GPEA 1Z8NA 4JUBA 5DGDA 2FN3A 4X3OA 1POWA 3PDHA 4JT8A 2OD9A 1YBHA 2WVGA 4Q9DA 5BWLA 1T9CA 1MCZA 2PGNA 3GLSA 2VBIA 3CLUD 4K9OA 5EJ8A 4BN4A 2JLCA 5IMSA 5K6RA 4BVFA 2A1UA 4TWJA 2H2FA 1XLTC 3HWX1 4JUDX 4JU9A 4R8MA 4JT9A 1S5PA 2DJIA 2WVAA 4MZXA 5EJ6A 2Q5QA 4GM1A 5EJ9A 1SZCA 4JSRA 1U28C 3E9YA 2Q28A 4C78A 3EYAA 2H2GA 2VK8A 3HWWA 5AHKA 4RMHA 3D81A 4FEGA 1V5FA 4JUFA 4TWIA 2NXWA 5K3SA 3OE1A 4Y6LA 4BV2A 5MFPA 1M2KA 1E3TA 2EZTA 4BVHA 1OZHA 4UTNA 5EJ7A 4V1CI 2EZ8A 4J16C 4D5EA 4C7BA 3FZNA 4RJJA 2FR8C 2Q5OA 1D4OA 3IAEA
chains in the Genus database with same CATH superfamily
4TTIA 5HF8A 4Q9IA 3T12A 3E8MA 1Z5GA 2EG9A 1KO1A 4UMFA 4AWBA 5LDGA 3A3PA 4MKRA 4MUYA 3PUYA 2P9ZA 3RVKA 5CH5A 1J8YF 4Z7JA 1HY3A 5FNZA 2AYYA 2DTXA 1FYDA 4MB0A 1FS6A 1Q7RA 3ZH9B 4FQ7A 4CM5A 5KJ6A 4DMHA 1CUWA 3G2NA 1ATIA 3MIIA 3N1UA 3Q98A 1ZXXA 5AKHA 1S3FA 2BH9A 4I4NA 3B5EA 5A05A 4L16A 3K1AA 1FMJA 4KLAA 2OP0A 3PXCX 5FR1A 1CQXA 3CLRD 3GJ8A 3EXEB 3QKTA 2FSSA 1W47A 3COSA 1K6MA 4R2LA 5GVSA 3WK4A 1GQ2A 1Y63A 2PZLA 3OC0A 1EGVB 4U4AA 2WWGA 4AJ9A 1YQEA 3CZMA 1XXHA 1P2VA 2A9QA 1VECA 1G0NA 2SNIE 1HSZA 3BRWA 4MZDA 5E2IA 5TVKA 3UH0A 3OUUA 5IULC 5FV7A 4CV0A 3Q5EA 4JQCA 4R8LA 4GMGA 4KXVA 4ZVUA 3V1UA 3V3KA 3H5RA 1LLFA 3HA2A 4O1MA 4YVFA 1ZC3A 3A2MA 4XEHA 3JSAA 2YOGA 1AG9A 4HMQA 1B74A 2ZYWX 1JFVA 2PBRA 4Q4JA 5DK4A 1DWPA 1PWYE 1V8PA 2LKCA 4C01A 4FMBB 2AE1A 3UC5A 3P9NA 1RMTA 4D4GA 1RM0A 1D5WA 1Z7GA 3ZWAA 3N5CA 3L4EA 4KIUA 4CQJA 2BR4A 4KLRA 4ZYTA 3O93A 3NV9A 1J8QA 3SZGA 5A5GA 5F9HA 3QNUA 3VC2A 5E1DA 1SD2A 4DA8A 1MZVA 1T35A 1NW5A 4Q3OA 3SJUA 2DFKB 1EPUA 2PFGA 2WIKA 2EEZA 3FDIA 3T5CA 4A9AA 4N40A 1NVFA 5HRAA 1L2TA 1LC0A 3GLIB 3ZVKA 1RPNA 5KINB 1AUPA 1FYWA 3IQZA 4RVSA 4I4TB 2XB9A 3GLTA 1DKOA 2BFDB 1FF9A 1RIFA 4FW9A 4BMPB 1W8IA 3ETHA 5JS8A 2TECE 5F77A 1EP1B 3GCXA 2GRAA 2R66A 4AKSA 1G2OA 3GJ3A 1J9ZA 3C16C 4B8WA 1JS1X 2WIFA 4YRFA 2F4NA 2FG7C 5LB4A 1T9BA 1IULA 2HMUA 2JJ8A 4PCVA 1JQ5A 4S35A 2GD6A 1JLMA 2A0YA 3JVUA 1M54A 4FDMA 4QOJA 2AZTA 3KSMA 4MA5A 4D6YA 3O4HA 4EWLA 2XE8A 1RRGA 3HKBB 1W0JA 2G83A 3UCFA 2FPLA 1IIRA 3F4LA 4PZZA 3WO1A 4CDGA 3RAFC 3LOPA 4NEQA 4YBRA 3VH2A 2O54A 1QYDA 1JG3A 1E3EA 5TMDA 5AW1A 4KH0A 3R9KA 1XLWA 4KRGA 4QU5A 4F84A 1HQKA 1W87A 1YDHA 3ZU3A 4Z9BA 2C94A 1H5NA 3DAGA 1I2AA 2NUBA 3I9V6 4YLYA 2E3JA 2WB4A 4MLDA 2AUNA 2VT3A 3JQ6A 3FFBA 4BN0A 5IT9A 1Z2EA 1DG9A 4X8LA 1LSOA 3BD9A 4TXLA 3RANA 3HDTA 1KWGA 3QF4A 2BTOA 5K7SA 3MF4A 3WNZA 3LDHA 5B3JC 4OHRA 3RNLA 2JLYA 2QX9A 3AETA 4NCNA 2XXJA 4P08A 4I1SA 4TYMA 4BNTA 2C2OA 2QUBA 4PIMA 1KYIA 1E7YA 3H8WA 2XECA 3WIEA 2RK6A 3PGJA 4R05A 4RK6A 2R1UA 3G2PA 3PC4A 2ZRQA 3I9LA 1PT8A 5JISA 4TZKA 4QJ5A 2BFOA 4I9FA 4HNAA 4UUPA 4M8SA 1E2GA 3SNKA 3ZW8A 1XXHE 5K20A 1BAPA 2WWWA 2BVNA 2EFHB 1XELA 3BILA 3LYAA 3NC0C 3TX2A 4C21A 3N2YA 3WDLA 1SA0A 1M6NA 4MKHA 4I4TA 1X87A 4FONA 1RC1A 2CCGA 4HDOB 3QVGA 1PZFA 3D1JA 3HJTA 3P96A 4U7DA 1HRDA 1PR0A 3OLWA 4AW9A 1TZKA 4CU5A 3QMWA 2AZXA 2BLNA 3TOVA 3NUQA 2P6UA 2WAMA 4MJ3A 5H0IA 3GWZA 1NFFA 1LTHR 3B6MA 4F1KA 2XADA 4UXIA 5TQVA 3ZE2B 1QHYA 3OLXA 3WDKA 3GLGA 1TPYA 4RZUA 1IPHA 4CKWA 2YMPA 4Q15A 1BQ3A 4EPWA 1DKLA 1JNXX 1KR2A 2OCXA 3K15A 1N2SA 1E6UA 1V7CA 3PA6A 4ZARA 3DEJA 1WBDA 4JUCA 5IM4A 2DCMA 2WWXA 3FMFA 4Q9HA 1H9AA 4AF6A 4UNIA 5CD1A 4E5PA 1BXKA 1DHRA 1K3UB 4UUQA 5BNZA 5IT4A 5K8VA 1ZJ5A 4RK7A 3WGVA 4UTVA 1JG4A 3AJDA 3EZYA 3KKNA 4ZVSA 3TOCA 4M9ZA 5J1TB 1F8GA 1R7RA 1VC2A 3NEYA 4UNRA 4AC9A 3MJRA 2WAYA 1XV5A 1BZYA 3ROGA 1Y7TA 1E2KA 4KYIB 3CUTA 4CQLB 4EI8A 4CGZA 4XWOA 4RE5A 4C0AC 4A0QA 4ID3A 2ZUCA 4H2DA 5IXYA 1ZG3A 3I61A 4TS3A 4BVKA 2X9QA 1A8PA 3IV6A 5BQXA 1YKSA 1WP9A 2P2NA 1ODFA 2WSLA 3GFFA 5EKDA 1M1NA 1NIPA 2YHIA 3BMQB 4MRAA 2J9FB 4N5IX 1ACMA 4PIPA 1GNVA 4BP9A 5KBYA 3GQBB 2I78A 1VJ1A 5B7GA 1OXKB 3M34A 4FSDA 4XM1A 5EJ2A 3RQIA 4DARA 2Q4RA 2PT9A 1GXSA 3FLBA 3SJCA 4QWMA 4MO2A 2I34A 3MMPA 1H1TA 4A16A 1T0JB 2W6JD 3E9NA 2XUIA 2Z2XA 2Y0EA 4GKVA 5JDIC 2C0QA 3IT3A 2XB4A 3DGEC 4OHFA 2DFTA 5AW4A 3C6ZA 4BO3A 5BVGA 1ULAA 3DZGA 3KKKA 3W4IA 4NDNE 2CVZA 2XDWA 3D8RA 4KXMA 1FZTA 2Y77A 1OLXA 1UC9A 2QUAA 3W5HA 4F4HA 4KBGA 5B36A 1AQ6A 1EUDB 1K6IA 4YC7A 2J0UB 5FHRA 3HKDB 1CEQA 1NIJA 1X42A 4UBMA 3DP9A 4N6NA 2QR5A 5AVWA 4YBZA 1JAYA 3AGPA 1D9XA 2HRDA 2ZDQA 2JKZA 2J5RA 3CNNA 3DL2A 4Z4IA 4YPVA 2GFIA 1YUNA 2PBLA 3GGDA 2F00A 1M6HA 3TN7A 1NQOA 2HK8A 2OCKA 3OEED 4JDPA 2D1SA 5DSTA 2EV9A 2P1DA 4BMVA 3RYHA 4TV8F 3BIJA 3WZ2A 5HUHA 1WCV1 3HM9A 1N32B 1AKQA 1P75A 3DDZX 3N3AC 4HGZA 4PRZA 2R5FA 5HF5A 3WGYA 4Z0TA 1F8FA 4JLUA 1JE1A 4N9WA 2ZVDA 3RSFA 4CL0A 3F3YA 2FPMA 5DCLA 3TVDA 1U7TA 5A1TA 1DEKA 3AUYA 3K6RA 1GTL1 3HSSA 2I6TA 2OCBA 3PFHA 2WBLC 2CLEB 2NO6A 3FPCA 2FK7A 5KOJB 2JFQA 2AG6A 1MXFA 2DHDA 2P9TA 2Q27A 4AXXA 5JD5A 4R9NA 4HDNA 4LEIA 3AJ8A 1GKKA 4NICA 1GGFA 3UXHA 2CV2A 1KQOA 4H3SA 3USES 3ZLJA 1TM4E 1QANA 4PC7A 5T8KA 3IUMA 1XHLA 3ZWDA 4DA6A 2AYZA 2QV0A 3O2QB 2NP7A 1CS0B 4LXIA 4YCNA 1E1MA 4ARAA 5JPDA 3AEZA 3HVUA 3K92A 5F33A 2WLTA 3LUFA 2XYHA 5FRDA 4HMPA 4XCQA 2F3TA 2O8BB 5TY0A 5LKRA 5MGNA 2VSOA 2FSIA 3OU7A 2YBEA 3FOEC 3TR0A 5C4IA 5CK5A 3OTIA 3SE0A 3WFIA 4YXFA 3FSJX 1K2WA 3IAUA 3KSZO 1PK7A 2JAXA 4BNDB 3TLMA 1QB7A 3K4HA 4LYEA 1KOFA 5LXTF 2XNJA 1PGQA 3U4MA 5ICCA 3FPAA 1R0YA 5KCMA 1Z3IX 2J3QA 3DLAA 4YMUA 3W1VA 4O4JB 1PS9A 3W78A 2QTVB 4I8DA 4W5WA 3K1TA 4R6WA 3EVDA 3ESZA 2PNFA 1NNSA 2QAGC 2X1VA 1D0VA 2J0EA 1JEDA 2NTNA 3DWEX 3LS2A 3UOAB 3WLQA 2F64A 5KYWA 1OFUX 2NU6B 3AJ9A 1KK2A 3AHIA 1QIIA 1Y4UA 1XDSA 3P26A 5I7WA 3G59A 3GCZA 2VSXA 2E48A 1RRFA 3EF0A 3ZE7A 1SM4A 1X1AA 1GT6A 4GYKA 3PVZA 3OICA 2WABA 3EY9A 4P53A 2BGJA 1V47A 3AIOA 4QOFA 5BT8A 3ZXYA 5H80A 1GCGA 3G68A 1PJZA 4RF4A 4TSKA 4AFNA 3F73A 2BMDA 1Z2OX 3K5PA 3KZ1E 5ECYA 5H1YA 2AR0A 2G5PA 2ZWMA 4HAOA 2QZ4A 3DMTC 4TVBA 4PXYA 4EECA 2J09A 2JGDB 1CYDA 1GUDA 2ODWA 2XWBF 3B6KA 3KXPA 4MDFA 4GE0A 3VYWA 4LZOA 2JLCA 2OAQ1 5ALMA 3REQA 1M1UA 16PKA 1UMCB 3PWTA 1US8A 2F8SA 3KUDA 3OE4A 4KMRA 3I04A 3SOZA 4IHJA 4TVSA 4CI0B 5IUNC 5BYJA 2DFVA 2VPQA 3RYFA 2BGIA 2ZPAA 5HFJA 4ZCMA 4OMUA 4PBTA 3T38A 3RS9A 1KYXA 3FUXA 1SN7A 3LPAA 5EQTA 5KNBA 5AVXA 2C5FA 2MYUA 2PKYX 4D6PA 1PJ4A 2HNAA 4E3WA 3B51X 3T4XA 3M6IA 3CZCA 2M6LA 4CCYB 3CJQA 4IDGA 4AKIA 1KXJA 4DB2A 1L5MA 1LX6A 1Q0UA 1LW6E 1Y3FE 3ANLA 3B2EA 1J97A 3QI7A 2OQIA 4J1TC 2VF5X 5DHSA 4Q5IA 5EXTA 2BZSA 1I24A 3ZJTA 3I01M 5BQ3A 1P6XA 2FPPB 2UAGA 4HADA 1NKSA 3DXZA 4MGIR 4OAQA 2WLSA 3L7AA 1ZVMA 2G9QA 1VI6A 1E0JA 2N46A 3IS3A 4TTSA 4E12A 4KWHA 2HCBA 2ZB8A 3R7WB 4WY5A 4ONEA 1JR2A 5F12A 3CA8A 4XPIB 1O0SA 1WNTA 2FDCA 1R5BA 1IXZA 4D4HA 2P3OA 4WZBA 1GZVA 3PJGA 1YDMA 2JIMA 3C85A 3JYNA 1J42A 4RZ3A 3ISVA 1ZUWA 4F9GA 4QT0A 3DXXA 1G42A 3RVDA 1DAPA 3C8MA 5EY5B 2KLBA 5I5EA 2BZ0A 2JCYA 3M1AA 1VLZA 3FOFC 1PQUA 1YVEI 2MINA 3KCNA 4UTOA 1JFRA 2F1OA 4WADA 1U7OA 2PUVA 5CLHA 1MN6A 3H16A 4FGZA 1ORDA 1QO0D 2BCJQ 3O73A 1X7YA 4I1RA 4W9RA 1IMOA 4XIYA 3RVOA 1DAHA 1ZM2A 2OVFA 4X1KB 5CNIA 2XB2A 1U7HA 2WYIA 2VXBA 4JJFA 3W9BA 1QTQA 2IH2A 4KFCA 3P0RA 2B92A 3FWYA 3HO6A 4LRXA 3VPGA 3E2IA 4GNRA 1N6HA 3TVTA 3D3QA 3GUCA 4PLYA 1NRXA 3GUUA 4KIFA 1P1JA 3OKFA 3F98A 4B81A 4CEIB 2Z5GA 3X1JA 3C3DA 5BUZA 1ID8A 3RHZA 3RD5A 2I9PA 1KO4A 3IQWA 1XA4A 2QN6A 2PKCA 4U7PB 4GBMA 3KQOA 4Q66C 1NBMD 3TINA 1IVYA 1MQ9A 3VO9A 2WM9B 2RIPA 2JCVA 4CLHA 1ETUA 2ZZKA 3ZJVA 3R3HA 1ADGA 4OOEA 3CO0S 3URMA 3ZPXA 1VMDA 3B85A 1J25A 3NTUA 4J0FA 2ZZMA 1UOQA 4IDFA 2BBWA 4K46A 3RTDA 3W2IA 4O3MA 4RQUA 2B21A 4LHSA 3ZWCA 3PITA 4W5QA 2XLBA 3H1AA 4HDAA 4F2DA 4URUR 3A9VA 2IWHA 1X19A 4MVJG 1PLLA 3ZDFA 1YNSA 1DEOA 5FR2A 1YRQA 2D8AA 2VZ0A 5HIJA 3KWJA 1YJBA 4ZAFA 4DUPA 5KU7A 1KFKB 2QG4A 1E18A 1JIIA 1RQLA 2B4RO 3OJXA 3P9PA 4KE6A 4MYRA 2QN9A 3RU2A 1R6UA 4IIEA 4US2R 4MRNA 4YN3A 1FK8A 5FI0B 3EBPA 2OFPA 2X4DA 3ZUGA 5BXYA 2GA9A 3G23A 4KVAA 1R4NB 4EPVA 1NJ1A 1MPTA 3AG5A 4NQZA 2ACVA 1XLTC 5A4JA 3R9IA 1AN9A 3M4JA 5JEDA 3HNPA 3QV2A 4QSHA 4BTEA 5JC8A 1VP9A 5E3JA 1H2RS 2PUJA 5ALTA 3SNHA 3V2HA 3D3WA 2LXNA 2LUOA 2RGEA 5BSWA 1TXGA 3GRYA 1C29B 1NQTA 3ILHA 4M46A 2PN1A 1KU6A 3KTOA 4B2LA 3VU9A 4F12A 2ZPTX 1VRCA 2VK2A 3LCVB 2CNDA 2XYVA 2WJPA 3RRXA 1E9SA 1PT5A 3RKRA 1LUAA 2MSWA 4TL6A 4U5XA 3O1HB 4LMAA 3NHFA 3UK6A 5KC9A 5LMCA 1SK9A 1AKVA 4UM9B 4DLZA 1HE8B 1NUHA 4WH0A 2NU9B 2HX1A 2OQVA 1GGVA 2GF9A 1SXJB 2OQ2A 1PWHA 2ZR8A 3GX1A 1RWPA 3WL6A 1ZPDA 2GYYA 3VVLA 1VHJA 1WZIA 2I99A 3AZPA 1NBAA 1PO7A 3RIYA 5IJAA 3AVPA 2ZCUA 3IIMA 1E1KA 2WPDA 3IAM6 1P29A 5KJEA 4YRTA 1RYYA 3GBSA 3NNNA 5SZHB 1BJRE 3CUKA 3PIDA 3UPUA 2ZR0A 3I01A 4BMXA 4FS3A 3IDSA 4QBKA 1PV2A 2ZJ0A 4ANFA 2DWCA 2GLXA 3HGMA 2WWTA 2WJ3A 3K1YA 3DEKA 3G8DA 4AT1A 1D1SA 2PJRA 2NSJA 5CU7A 4PVDA 1VYTA 3JASB 2ZEJA 4TV9B 1RKQA 2H4WA 2W11A 1LLUA 3M83A 3TQQA 4PSKA 4CG1A 2W90A 3GPBA 1F2VA 3FH0A 3MERA 4OATA 4YRIA 5C80A 4RQTA 2WG1A 3GUVA 2ETXA 3IH5A 3NTQA 1TF7A 4Q24A 3D8UA 4HWTA 5T6MA 1G5TA 4D0LB 5JQGA 2OESA 2ONYA 3SIRA 2G70A 3FDFA 3NV7A 1MABA 2J3MA 3OT5A 3V8MA 3TJMA 4L74A 2CW5A 2GX6A 2DFNA 2CVFA 4F85A 1VPWA 5CA1A 5FYDA 2FHSA 1ZD2P 1JUDA 2QZSA 4CR6A 3KJIA 3IT0A 4X7BA 3UM9A 1YJCA 2XUGA 3BJMA 3R0XA 5JE8A 3E5RA 3N2KB 1AZLA 2NZYA 2QUKA 5EIAA 1ONOA 2I4MA 3GLUA 2FN8A 5IS2A 3QU7A 1GSAA 3WLNA 2CT8A 5TMPA 3RUIA 2QD2A 3G79A 2ZVPX 3K3PA 3FSRA 4QBIA 4R3UC 4Q7LA 4DYDA 3L1KA 1YXMA 2H0AA 3UN1A 1WD7A 3A0RB 4IDPA 4Z2YA 3CEAA 4ZYYA 4QUAA 1M6EX 1QH0A 1YA8A 1VBNA 4J7UA 4NMMA 3MGAA 5EWLB 1UWLA 2RGAA 4MPTA 3BGVA 1X2BA 2IYOA 2VAWA 3EGEA 3LWZA 2IEBA 1WXGA 3SHFA 2J9XB 5F73A 5D7BA 3SXUB 4R71A 1M9NA 2PXHA 3H4VA 3HUFA 3MTGA 4AYWA 4LJ9A 2AFHB 2XEDA 3P9QA 2HW8A 2RDMA 3QPBA 3AR4A 4DM4A 4Q1EA 5D8DA 3K0AB 2EC5A 5GINE 2HDOA 2F9MA 5GGYA 3EBOA 3U0VA 3V4RA 4A15A 3WBBA 1YB7A 2BGRA 2XT9A 3TLBA 4JR0A 1G7CA 2QGFA 5G0VA 1BMQA 3ESXA 1BCSA 1PGPA 5HS6A 1R6XA 4B6EA 4A36A 3MWLA 4WPGA 1T8TA 4L95C 4TWIA 4Z0HO 5AXBA 2ZTMA 4YJ3A 3STTA 1YZQA 3U44A 2DYKA 3V4OA 4AUEA 1BVRA 4F5YA 1G8SA 3QKSA 1V1RB 5AHRA 2O5RA 3RS5A 1B16A 4IHAA 5EZQA 3AEXA 1KU0A 3KR2A 4EGQA 2JLVA 1JAIA 2QRVB 3TGLA 3TLGA 1CUIA 1FNMA 1Z0SA 2QTGA 4N12A 3V7UA 3EWAA 5AOAA 4D4LA 1ZOIA 2QJFA 3PD0A 2OK8A 3ZZTA 2D54A 3DL4A 1CVIA 2WNSA 3NYRA 2BUCA 3R7DA 2O4CA 1PF7E 3DPUA 4FYWA 5EHGA 4TS4A 4IDOA 2HMWA 3CX4A 3HABA 4OLHA 4BOYA 2WG0A 1JSRA 1NI3A 1ISSA 3FSGA 3VKFA 5E7MA 3PEYA 1KBOA 3DLPX 1OTYA 2FZVA 2JGNA 2ZRHA 3LPCA 1OPXA 4UM5A 5AKZA 5EP1A 3W5AA 1QG4A 5KTOA 3G0HA 1A71A 7REQA 4RGBA 4BGDA 3CNBA 5LZ7A 2FN9A 4CIWA 3FWPA 4YO8A 1LQUA 2OXFA 3PPWA 3V8VA 1XOIA 1IN8A 3HYSA 3MJCA 1HTTA 1QCCA 2NXEA 2W2TA 4NK4A 3EPRA 3FPKA 4Y2GA 1YI8A 3THOA 4MUMA 3G2MA 4CM8B 3BL6A 3CB4A 4S1TA 3IBSA 1GN9A 5IRCD 3NHAA 2NYUA 5C7IO 1EK1A 1TYZA 3HR7A 3DPIA 2QRUA 4G5HA 1N1MA 3ZTTA 3Q10A 3C8ZA 4M1OA 4U7GA 1MORA 5HIAA 1U3DA 2ATIA 4LF5B 3PI7A 4P34A 3HB5X 3IKJA 4CEJB 3BE4A 4QYSA 1FBTA 3BGDA 3GMTA 5NLLA 3PQ2A 3D3WB 4N39A 3T7CA 4EMBA 1KI6B 1T6YA 2Q5EA 2ZJ7A 1H5QA 1X1SA 3GLVA 4PG4A 4Q47A 1E9VA 5DI3B 2RGRA 4MJXA 4QICA 1BSVA 1CZOA 1KEZA 1ODJA 2V9ZA 3MFYA 5DHPA 3VMMA 1J00A 1NYLA 2CCJA 3QV1A 1P1IA 2IPAB 4GM0A 2EFGA 2P69A 5A3QA 4NP6A 3BEOA 3TS1A 3B3QA 3KETA 4FZVA 3P2IA 5DXFA 2I33A 4IM7A 4EG8A 3L6UA 3VOSA 3QLVA 4Q34A 1VMKA 1JVSA 3AP1A 3BXZA 5LQMA 3ZWOA 3KEMA 4MR9B 5DMHA 2OZLB 1MHPA 2HTFA 3GBVA 3IP6A 2YJNA 4NARA 3PUZA 5BQFA 4B85A 1MP0A 5K01A 1Z0IA 1W96A 2Q1UA 3ZWVA 1EFUA 2IYEA 1KH3A 3NOVA 4BNNA 4PCAA 2LRHA 1QE5A 5FL3A 3NCHA 4OBXA 1QIFA 5E0KB 3NBKA 2HXGA 1UBFA 4Y9TA 5LQAA 4LQCA 4G0WA 3DULA 1QBKC 2GOYA 2O23A 1E2UA 5THXA 1IAQA 3E2PA 1P4AA 4B6GA 2GB4A 1AKTA 2D4HA 3M4ZA 3UWKA 2AGVA 3RNOA 3UV6A 1Z16A 5CXXA 3FTEA 1UINA 2FXIA 3QWIA 4E51A 1L1FA 2G82A 5KUTA 1KQ3A 4HUTA 5A02A 1FNDA 3ZD9A 1B4DA 1W36D 1HQDA 4AY6A 1JZTA 4O2BA 1Z0ZA 1BHJA 3HTXA 1MEOA 5JCZA 1P3DA 5FORA 1M3SA 4BQIA 2J5XA 4OI0A 1HFWA 4EQ6A 1P61B 4RE6A 5AM1A 3DWFA 4UTPA 2P65A 3LT1A 5ECGC 3B60A 1YCFA 3X44A 1SCUB 1L4BA 1FSZA 1U3UA 4LJSA 2X0EA 5EMNA 1Y3BE 2ZRBA 1LF5A 1ZITA 2HV8A 3LA8A 5GMOA 3Q9UA 5DNWA 4OJQA 3OJFA 2OB2A 2H92A 2R79A 1ORRA 1Z9BA 1KSGA 4BNIA 5LSAA 1K98A 1OX6A 3LLUA 1LC3A 3CN7A 1RI1A 3ILYA 4HDMA 4J03A 3CEJA 5IVIA 4GXQA 5CDFA 4H7EA 3PQ6A 3WSWA 3ROPA 4HNUA 2HJVA 1O6FA 1NZFA 1VA5A 4PNZA 2JLRA 2PWPA 4YALA 4JUIA 1Y8CA 3LIIA 2FN7A 1RPJA 2QJTA 3O74A 2IEZA 1C9MA 3K0CC 2IY8A 4RADA 5FO1A 5JNVA 3T1QA 1XZJA 4G9GA 1O0CA 3FIUA 4RM2A 3CCCA 3O3NB 3OFND 1H93A 5JS7A 3ZY3A 3LAWA 2ZROA 1RZUA 5JZ9A 1X7ZB 1ECPA 4DV4B 1Z0JA 2V5UA 2YJTD 1EFDN 3K2EA 1R4AA 1Z25A 4RORA 3QVGB 4KDFA 1CJSA 3DBHA 1YZKA 3NCTA 2H17A 4I1VA 2MINB 4JLVA 2C1XA 3ODGA 4K0KB 3U26A 1KMHB 4IGAA 3ZGLA 3COYA 2CFCA 3DD1A 3WGZA 3ZLVA 1GPLA 3M6LA 3CKKA 4HEJA 4WOPA 3EPKA 3IPLA 3GRFA 4YRNA 1CR1A 1D2MA 1O8BA 2REOA 1ZD4A 1A72A 1LWNA 2OHVA 1OIVA 2Z43A 2QN1A 1GQQA 1WUIS 4I6EA 5FI1B 1YK0A 2Q5JA 1T3HA 3DOEA 2GASA 1ECJA 1RJ9B 3MHTA 1UF9A 3RIGA 2HR1A 4I9HA 3DLBA 2JD1A 2CK3A 5CGQB 4FHGA 5ALYA 4EY4A 5TGDA 1OWLA 4TYYA 1PYGA 2ZBGA 4AJEA 2D06A 4P84A 1SU6A 3A9SA 4M0KA 1WMDA 4EA7A 1IAVA 2E4AA 4DAOA 1XQ9A 2FPKA 3PHHA 1NYTA 4K9LA 4YTEA 2QAJA 1YFJA 5KSPA 4YDSA 3RVNA 3JD2A 1CYEA 5L4NA 2PRKA 3PEVA 4ND8A 3DKKA 1OROA 3LECA 2H52A 3BYZA 2FZEA 4LN1A 4OQXA 4X3OA 1SIBE 1V7ZA 1Z82A 1JQDA 1QUFA 2A9KA 2IU6A 1T9CA 2WD8A 1XDBA 3AINA 4PLFA 1S8OA 5BN5A 2CXUA 4PYRA 4TS9A 4UPEA 1Z7EA 5KQMA 3FHOA 2JGMA 3NORA 2HSWA 1SH7A 2C2ZA 5AJHA 1KDRA 1QIKA 3TQCA 4JT9A 4GOOD 2C42A 2PKQO 4MZXA 4OA8A 3HP7A 4KAJA 2QRNA 4DREA 3A4VA 4RXMA 4RY2A 3PDIB 2FSHA 2E7ZA 1P72A 3KTDA 2PT5A 3B3AA 3MAGA 4GSLA 4KXYA 1IJKA 5ALQA 4Y6LA 1BX3A 1Z8FA 3NKFA 3RAGA 5EYPA 4OQEA 5F1YA 1YR6A 3F9RA 4WKNA 2R751 2W2VA 1MJGM 3T3EA 4S0ZA 3P27A 5LR6A 3QFCA 4O4HF 4MYCA 3M81A 4C1NA 4NZZA 2Q5OA 4V38A 5LOVF 3SZUA 3A36A 3U61B 1DDOA 2CJXA 1R5JA 4ZVTA 3U7QA 3UK2A 4O4HB 4HQKA 5COAA 3HRHA 3TF5A 4FYMA 1WXWA 1N5JA 1D8AA 2FR8A 3L04A 1N5RA 3T4EA 3WL5A 3DEAA 4CHGA 2X14A 2AB0A 3M9LA 2RKOA 3GFOA 1FQOA 2YZMA 3ZE0B 5L6MB 3GJSA 4UUOA 4F2HA 1MV5A 3WGQA 2H1WA 1QG0A 2OLJA 1XEAA 1T1JA 4IPTA 1I5RA 1DBWA 1U9YA 4P3YA 3VSBA 1CUGA 1H6BA 1U2ZA 1WVGA 4FSHA 1QG2A 2V3VA 4F7WA 3QLUC 5F7XA 4INJA 3AKEA 5BR1A 1I1HA 4G56A 4P58A 4BQEA 4DIFA 1LBSA 4E6EA 3ER8A 1IK6A 2ZXEA 5LDHA 3CH5A 1OA0A 2OOSA 1IZYA 1N3LA 2AFRA 4L0CA 1H1LA 4WTOA 3RIMA 4CMGA 1DSSG 5KREA 3O8OB 4XKJA 4C7JA 4FJ1A 4CM1A 1ZK1A 1A7KA 4O0LA 1OLSB 3C3WA 4OK5A 2H2HA 4P9NA 4XJSA 3EXFB 1DIAA 4E22A 2FLKA 4B6RA 2JLWA 4D25A 1RZ3A 6YASA 1RT9A 4ACAA 2ZUBA 1ZIPA 3QBVA 2OO5A 3W5UA 4C22A 2YJGA 4ZOAA 2P6PA 4HAIA 1Y6GA 5LUBA 3O31A 3OBIA 3SSNA 1TEHA 3MLAA 4II3A 3KT3A 4HWSA 1XNRB 1QS0A 3QA9A 5FA8A 3BDAA 1R74A 3AHJA 5J58A 4I19A 1Q7GA 3DGFC 1SUWA 2WUVA 3NTXA 3HN2A 1H2BA 1C3XA 4ZVPA 3UEOA 3L1IA 4YMTA 2Q2VA 2NYVA 1OASA 3ZKWB 4OL0A 4WUVA 2GSDA 3FWKA 3GMIA 3TRIA 4E1VA 5M29A 2CFOA 4LK2A 4GLJA 1GKYA 1UXKA 4KAXA 4MMYB 3CVUA 3UFBA 1XZCA 1ZN7A 1PGJA 1VGRA 1AIPA 3RUFA 2H65A 1Q12A 4JVSB 3U56A 4WY8A 3WLOA 2P4UA 1T36B 4Q00A 3CRRA 1EWKA 3HKCA 1L8OA 3WRWA 4E03A 2QTLA 3K0SA 4WUTA 3KQKA 4OLBA 4ZVVA 1RBYA 3GT3A 1I10A 1DTEA 1JMYA 1YZGA 2BCEA 2VDWB 3PVCA 4OPMA 2VC2B 1E2DA 2EP8A 2AXQA 4ZV9A 2BTEA 5IDYA 5ADWA 3EC7A 3ADBA 2Q1SA 4HJRA 5KX5B 3F4KA 4XWTA 4ZOQI 2WHRA 2PUDA 1DWQA 1DAEA 1KYZA 1Y5NA 5LJLA 3JYLA 1SUCA 2W8BA 3KQYA 4MVCA 2QJRA 3Q7IA 5EJFA 1Q6YA 1BDJA 5EJ9A 4CIYA 1NSTA 5DOVA 3T5DA 2FMFA 3W1EA 3ZW9A 1XJ0A 1ONNA 2EKQA 3E9YA 1NZJA 4XD7D 2V7WA 4RM3A 3DNPA 4ZQEA 4COOA 1CZNA 3AI1A 2CHGA 1E7MA 4E15A 3DEFA 4EUKA 3W5CA 4LDZA 4CODB 4M53A 5K8IA 4U7FA 1B93A 4NCHA 1CETA 1MC5A 3KSBC 4J16C 4Q93A 2D2XA 3HR8A 2O2HA 3U60B 3QIVA 2QSUA 1Y7LA 1P5JA 3L4JA 1ZLXA 4RABA 3HUDA 4U1RA 3NW9A 4OM7A 5GM1A 2GAIA 4EMTA 3ZG6A 1JIKA 2CBXA 3Q3HA 4L7QA 3T0IA 1KKLA 2DQ4A 5HIKA 1KBQA 1RAFA 1XTSA 1Z15A 2FY8A 2UZ3A 4JXZA 2BM0A 1ZWLA 2BI8A 4MWGA 4PSVA 1AKNA 4WRRA 3KXKA 4LE0A 3TRJA 4KGZA 4NBRA 3BK7A 4CF7A 4NDAA 3N5KA 3PXBA 2AHRA 2ZE5A 4PYQA 3EGXB 2HJ9A 5DNCA 3ZHSA 3Q11A 4B6SA 1E79A 1CY1A 5E0OA 3WGOA 3IE0A 1KY5A 3TMKA 2GJ8A 3PJFA 3SSOA 3AZQA 2DPLA 3FOCA 1YS6A 2G09A 4DF3A 1KIFA 2HGSA 4DJTA 1X1TA 3PKZA 2DR0A 5I7OA 2XUHA 9LDBA 1P91A 5I7VA 4LMBA 3U4QB 1FP4B 1YNOA 2CZGA 2C7BA 1EZ4A 3EAFA 1KEVA 4HPJB 3D8HA 1DIOB 2IYFA 1RRVA 1G41A 3A05A 5LOVB 4G1CA 2H3EA 4N7MA 2J07A 3LUAA 4ZI2A 3VR0A 5KJFA 2GUGA 2BFDA 3FKSA 1WCIB 4CMCA 3ZGVA 1HNWB 3AF1A 2D2IA 3G0GA 4YCAA 3BE5A 5K4HA 4EZEA 2EZUA 3N8GA 3AZOA 4TM8A 1GCAA 5A71A 2HUNA 1JEYB 4H1UA 2QLTA 4AO6A 5KNCD 1WU8A 2IZ7A 2O2IA 4NAUA 4C9BA 2RK3A 1RLTA 4N8EA 1NJ8A 1SCIA 2CXTA 2XMPA 4Z9XA 3ICEA 3OIYA 5JADA 2VSNA 3D59A 3GAZA 4WEOA 2B5VA 1V5WA 1XCOA 3JU3A 1KWKA 3DJYA 3WNDA 1IBSA 2XYPA 3KKEA 3R2JA 2VYVD 2Z95A 4ZOEA 1S2MA 4ZA2A 1SUEA 2DUJA 2YVQA 2H4HA 4MGZR 3VR2A 3HI4A 3FVVA 3I4FA 4OQYA 3UMYA 1A1SA 1I2DA 4MS3A 1RBMA 3G13A 3R4VA 2B5WA 1WY5A 2ZJ1A 3MRTA 3Q3JB 4DKJA 1H9CA 1W93A 3JQCA 2BSXA 5CHYA 4AF8A 3QZUA 4CZ2A 2VJMA 5JNTA 1T6NA 3ECSA 4EVQA 1L5NA 5D5HA 1QFZA 1CQPA 2O1WA 2ECOA 3WGKA 3L77A 1SU8A 3HJAA 1J49A 3HU1A 1E92A 4D43A 1MC4A 1WX1A 3Q6MA 4FI3C 3UQZA 2F3RA 3ZI7A 3I5XA 5FQNA 1ZKDA 4EFKA 1QOZA 2HRQA 2P5UA 4QDJA 2YZ7A 3SZMA 4D8WA 3LG2A 1NBEA 3V1LA 5HUQA 4ZGBA 1KTIA 3VOBA 4G2NA 3D43A 2XUQA 1G4HA 2BFCB 3Q7SA 4WCFA 4REMA 5AHKA 1IEQA 1LX7A 3K73O 1ZD8A 1X1DA 1TX4B 5LLSA 2F43B 5LWQA 4KV9A 1Z7YA 2B7LA 1GITA 1T4MA 3DV9A 4RHTA 5DLDA 1UKEA 5FBQB 1J90A 4AX4A 5FH9A 2PWAA 1BU5A 4GOXA 4PICA 4R1NA 2XGMA 4BVHA 3RWBA 1QV7A 4B6PA 5FADA 4UHEA 1YS2X 5JNLA 2ZS7A 3IPAA 3MD0A 1Z18A 4R98A 4PLVA 5A3SA 1AF7A 2A30A 2VYQA 1CXZA 1D4OA 3K20A 4V2UA 3RC2A 3VMFA 4BO9A 3CVVA 4D26A 5TIIA 2J08A 2FEAA 4Y8VA 3QVXA 5AW0A 1ZM9A 3SJZA 2H7CA 4LY6A 5F35A 4IDEA 3B7PA 2AQ8A 2WJZB 5CMLA 2LW7A 1O97C 3AXTA 3FMOB 1X86B 1P4GA 3IHKA 4BRZA 2C3MA 2ZP1A 1O6BA 4ZQBA 4C06A 1XALA 4C4RA 5JROA 4H77A 3RI3A 1DBPA 2R6ZA 3GCGA 1JJAA 2FMHA 5FNVA 3WYGA 4F1JA 1JR3E 1BXRA 4RZXA 1N9ZA 4C0KA 1JYEA 4P3PA 2H57A 5ENVA 3BGSA 1JW9B 1XE3A 4X24A 1KYYA 4BV3A 1NA5A 4B43A 3ACDA 4K9RA 3MMNA 1ML3A 3P4XA 4YJ3F 4H7DA 3AEYA 4D9NA 3SYKA 5CFMA 5HNKA 4DR1B 1FNBA 1JBKA 1QIMA 1ZVJA 2Z3WA 3A6ZA 3JQFC 2WUDA 3LDAA 1N3BA 3M89A 1ZGZA 1Q17A 1BH2A 1XLVA 4C04A 3WWPA 1TW2A 3U37A 1KS2A 3KPWA 1NUQA 2AKAB 4ARZB 4YMVA 1Q7CA 2RGGA 1B6SA 1VLJA 1XQWA 2ZI7A 3JQFA 4ZV7A 1NXQA 3VGPA 4MYTA 1OTXA 4LWQA 2ZT5A 3OY7A 2GFQA 1UDXA 4RZSA 4TSFA 2XKJE 5CVTA 3D3KA 1A9ZA 3LC2O 1XZDA 1SMKA 4L4RA 1W30A 4XD7A 1NW8A 1JKMA 1XTQA 3EXEA 2WU4A 3A1WA 2RC5A 3CYFA 1V3VA 1JVBA 4M6WA 4MS4B 4PSDA 1V4VA 3TZ6A 3EWSA 2TRSB 4EY7A 1CSEE 3DZBA 4HNHA 1OVMA 3FRHA 1ADYA 2UVPA 4WFJA 2RH8A 3SF8A 4F3NA 2AFIB 4WNIA 5ITSA 1UBCA 2IIBA 4ZVKA 3VDXA 3KAQA 3QYPA 4GP9A 4C4ZA 1SHUX 3FUCA 1K7EB 4CV1A 3HY4A 2NNWB 4BLPA 3BSSA 2WTBA 1Z2AA 4YRKA 4DQ0A 3VNSA 1CHNA 1R9GA 4KG7A 4V0LA 4AZWA 3IOBA 4UBNA 1O96B 3TBFA 3OQ1A 1OGYA 5BN5B 3HP4A 4TMWA 3MOIA 2R96A 3ZX4A 1MX3A 3BGWA 3IURA 1MB0A 2FW1A 4K9DA 4JP2A 4NYIQ 4XQCA 3KOUA 1N4AA 5AOVA 2LV8A 4YQFA 2DUMA 1ISPA 3AUFA 2MOKA 5DTJA 4MUFA 4RK4A 3MCAA 2A1UA 3SHWA 1BHSA 4A92A 2UUBB 1XLUA 5DYYA 1U0EA 4N0PA 4CMIB 3P0JA 4JGGA 1ECFA 3TZEA 1RP7A 5LWHA 5EJ6A 5T6BA 1EEXB 1DIRA 3JQAB 1RM3A 5IYZB 1FDIA 1VLVA 1C7ZA 5AI6A 3N2ZB 4M8IA 1IQUA 1YOVB 1VJDA 3RS8A 2IZ1A 5AVZA 3CPHA 1LBQA 3KP1A 4BVLA 3KZOA 1V45E 4CN9A 1KAOA 1U2PA 4YRPA 1XF9A 1NJ6A 1SIOA 1O4WA 4MWTA 3QMPA 4RDCA 3B5IA 1IN7A 1LF0A 1IZ7A 3C8DA 1V11A 3D4BA 3HUEA 1ISGA 3EEQA 2XZOA 1TCAA 2EX1A 3MAJA 5FXMA 3OQ6A 3VNUA 1NW6A 2EHJA 3L93A 4H3KB 2DOKA 3GLRA 4NEGA 5CBPB 1IHYA 1X1EA 4WOKA 1GZ5A 3RUDA 2BHNA 5LD2B 1K08A 3SVZA 1UOEA 2XQVA 2XYGA 4G97A 4KW7A 2FZGA 3UENA 1VE9A 4G23A 1A0OA 1U0RA 4BVJA 4OUKX 1W48A 3MJEA 3ZXIA 1A8SA 1A5AB 4FDUA 2QXUA 4UEKA 1P9OA 3WRVA 2QIPA 2PZJA 1H8EA 1DAFA 2GZ2A 2F4VB 1EQ2A 2DLNA 2GR9A 4KQCA 2BDTA 4OU4A 5GVRA 4WBNF 2ECFA 5HQ3B 2H2WA 4CLOA 1E69A 5GJBA 4AJIA 4CEHA 2J87A 4MW9A 4XJVA 4DIEA 1EDEA 2R3SA 3Q1KA 1JIVA 2J5BA 4CCSA 5FUBA 4FINA 4TTAA 1IRXA 3I12A 5T5QA 3RPEA 4HPWA 3ZDZB 2O2JA 2OD2A 4D9JA 4QVKA 2XTJA 4YNBA 2XT6A 1FMTA 1O77A 3NBMA 3IXLA 2ZW9A 2Q5FA 2MYNA 1B42A 4RK1A 2RJNA 4IOMA 5DASA 4BX0A 5F2OA 3Q40A 3U9SA 4KQFA 4BNXA 3SK0A 3ZXSA 3GY0A 2QJOA 4UVHA 2C78A 2P9HA 3PQ3A 1L7DA 1BCRB 4JHXA 4CTMA 2PH5A 2JIDA 4FGUA 4Q82A 3ND6A 3C98A 1QBGA 4KC0A 4MYUA 4FYPA 4QFMA 2V1UA 4XUDA 2FMXA 2O0HA 3NRBA 4OSOA 4J4TA 4J0EA 1JLRA 3FJYA 3ONDA 1A5ZA 2QX7A 1R10A 1RSZA 2Y1EA 2B99A 1ZUNA 2A1TR 1DC6A 1ZMRA 1NJSA 4IGEA 4EJ0A 3K9HA 3W8EA 1QHIA 1OZGA 5BSGA 5C7LO 1SKAA 2AWNA 1MO4A 2PGLA 2QRGA 3O91A 5BSHA 4Q02A 2NXCA 4RV9A 2X0IA 5HM8A 4K6CA 3AXSA 3PHJA 4I81A 1C7EA 1Z0FA 2ODEA 3C2QA 4CPDA 1X8XA 4KVGA 2CFRA 1DC4A 2CD7A 1GZ4A 3ZCVA 3H7IA 4Y6QA 4H0FA 4D9MA 3BERA 4R8KA 5IC4A 2P6NA 2QRPA 3MLBA 1GQRA 1ZIOA 2NN3C 4KZPA 3R7AA 2RHGB 4L76A 5L4SA 3GEMA 2LKDA 3SYRA 4XB1A 3DBRB 3X1ZA 3P32A 4U2KA 1YQGA 1Y7HA 3PHCA 3KQUA 1R6VA 1TQ2A 1TLTA 4W7SA 4Z5XA 2I6UA 3D7SA 2G40A 4ZKEA 3U4CA 4BEVA 2I8AA 3AEUB 5FAKA 3RE1A 3BAZA 2RHHA 3CUWA 3H99A 4C14A 2MWMA 2WA1A 1XRNA 2HA7A 2C8LA 1QLWA 4TQUS 1WMFA 1SBQA 3ACCA 4LBVA 4NOJA 2H48A 5JI2E 5C1PA 5JRJA 3KOZA 3GFBA 3ZWKA 1SWWA 1GSHA 1Z5OA 4MLCA 1ANKA 5LNK1 1OFIA 1HE2A 2P27A 1WAMA 2A0UA 2UZ1B 4JJGA 4NTZA 1QYCA 4C7VA 3I5UA 5I7UA 2J3LA 5F5LA 1XZNA 2QTHA 4CLOB 4DS3A 1JG1A 1WUHS 2H1HA 3DEHA 1A9YA 3NDPA 2AV6A 3DWGA 3K30A 2HPVA 1U5CA 1G9SA 1Q22A 4MV7A 3VPFA 1U0SY 4YI3A 1HFKA 4C6RA 2XAAA 4FUTA 1JWAB 3FPGA 3VR6H 4YYEA 2CZCA 1MRSA 4YT5A 4Z1OA 3V4PB 4QZVA 1F7UA 4XR9A 1FUUA 4LWPA 4QARA 3EIHA 3WYDA 3FOZA 2GXSA 4C4XA 4Y30A 4DZZA 1BDIA 2PMWB 4ZICA 1I7QB 3E3LA 4EB6A 2DH6A 1CPYA 1W4BA 4MI1A 4NCKA 3JAMA 5MDHA 2WE7A 3G8BA 3EVAA 2PRSA 2RAUA 3CLSD 2V8OA 3KBBA 3O1LA 1RPZA 3UMRA 3H5OA 4TMYA 1JSCA 4YB8A 1E2QA 1MEEA 2G1KA 4BFTA 4G5QA 2IPMA 2YV2A 2Q0SA 4KXWA 2V45A 2CL6X 1N2OA 2RARA 4HGOA 2I7TA 3F1KA 1BWPA 1K7YA 3G8YA 5AVOA 2PL9A 1UMKA 3FDZA 5FLEX 3EIFA 1FRZA 4BMDA 3DTVD 3O8QA 2HMSA 3CF6R 4POAA 4QEDA 2PUFA 4R6XA 3EN0A 1V8BA 3JWHA 1XQXA 3FN4A 1IBCA 4H7JA 2Z6QA 1WKCA 3I8OA 3KIPA 4GKAA 2CUTA 2HDWA 2MHCA 2IFTA 4L4ZA 1WG8A 1PD1A 2QSZA 3G5LA 9LDTA 4NMWA 1RACA 5EMKA 2PEYA 1RWNA 1JLLA 4PLTA 1MO5A 5DCUA 4HDNB 1KDPA 4WQMA 2UZIR 3FOAA 4DSAA 1OH7A 5T8KC 1YWGO 2PZMA 3HN7A 3UWSA 3DDUA 3DAPA 1MG0A 3TZQA 3ZQ6A 4BMNA 2NVUA 2II6A 2ODPA 3CQ9A 3KVYA 1ZBQA 3RG2A 4AROA 3I52A 1LPAB 5E4JA 3HPRA 5FWYB 3EEFA 3R6WA 3PC2A 3RK4A 3IBFA 5BUCA 2D0IA 1TKBA 4BAUA 2O3UA 1USKA 1YMVA 4K03A 4LAFA 4QODA 2G28A 1T9AA 2EARA 4Y1GA 2TS1A 2XDYA 3LXRA 5TPZD 4YFVA 1ZIYA 1EFKA 1XEWY 4E88A 5HMMA 4F7DA 4L5JA 1LBIA 4S3MA 2IOHA 3FCUB 3LJKA 4DT1B 5JSFA 1NVWQ 3OU6A 1U0HC 3KM0A 4KQMA 4PRYA 4XIIA 4MVJP 2ZYUX 5ALZA 3SZLA 4BTVA 5BNWA 1JIQA 3EIEA 2GN4A 3ONNA 5C81A 5ILOA 3OFJA 4UHCA 1MQSA 1H8ED 4BATA 1TTPB 2QXYA 5HJ7A 4TWJA 2WHQA 1ST2A 5IJZA 5C52B 1HDOA 2I80A 3BMXA 5AHXA 5BR7A 3MTBA 3GH3A 1RM5A 3ETDA 3GJQA 4UBJA 5DM0A 1H3FA 5TQ0A 4PN3A 3GYGA 3WGIA 2Q9BA 1YIAA 1AD2A 2YHSA 1NVUQ 1MAAA 5FWYA 3GXOA 2WYHA 4FEGA 4E5SA 2BSQA 1UAGA 4EZBA 2LNDA 3KFLA 4C6HA 1MU0A 3V8PA 1I51A 1SVSA 1DXHA 4C88A 3ZU6A 1IXSB 1XTUA 2XSZA 2Z6VA 4KO3S 3VSCA 2BFPA 4BLUA 1D9ZA 2HNBA 4A26A 2AIRA 3GELA 5EZ5A 3SFTA 2V7GA 1QGYA 2ZUVA 3PWSA 1XTJA 4L6CA 2VTEA 3AB7A 3BL5A 3RSZA 1QO7A 1T8SA 4M89A 4EKDA 1OF1A 2LCQA 5DGIA 4Q3DA 3A0UA 6REQB 2G8NA 4ZHQA 3SIPA 1OY1A 5FNVB 1ZI9A 5DRTA 1ZK3A 3D3NA 3H6GA 1R8XA 1RYBA 2PD3A 2VG8A 3B6JA 1YR9A 3AJRA 1E9EA 4AS1A 3VAYA 3W1WA 1FYEA 1UAYA 1DQSA 2O1XA 1JQBA 3HU3A 3WL7A 4EJFA 2EDCA 4BWYA 4Z9YA 2ZBEA 3NG1A 3PL5A 3S8MA 4W6QA 3EGDA 5C5DA 1TT5A 2AOTB 1H6DA 4Z49A 4G9BA 1Z22A 2HMAA 5CAEB 2SKDA 3ZV5A 5BXQC 5IT5A 4KDEA 2CFSA 5KTYA 4L3OA 3S2UA 2F62A 3I37X 1QHXA 1CB0A 3LWBA 1P73A 2ZSHA 2WDZA 4D9BA 3PGXA 1U9CA 3LT0A 4HLQB 4UE6A 4M8KA 3WJ2A 2GPTA 2V03A 2WD7A 1WMEA 1TLFA 2GNAA 3ES9A 4XGIA 2VBGA 4JLNA 4BNZA 3KJFA 4BN5A 2WD9A 4G4SO 1O9GA 3WLTA 4EO7A 4IYJA 2VDJA 3BXXA 2ID4A 1DCTA 4CG3A 4B5KA 1AX9A 3VU8A 5KSWB 1VYVA 1JZQA 2P30A 5A5DA 3OAAD 1LQTA 1B0ZA 1FB5A 1SVOA 2HIHA 2IYRA 3K16A 4OI4A 4ZOLF 3DDNA 3TD9A 3ZV4A 5TLSA 1M34A 3MEQA 1DQZA 3ZEAA 4X00A 1HT0A 4FYYA 4GKJB 3N0WA 1K4MA 1NULA 1SR8A 4HX2A 4N5HX 4FN4A 1YZUA 4Q7MB 4TQGA 1OXTA 5BVHA 5FOQA 3AF6A 2LDXA 4KXLA 2Y9PB 1Q1NA 2A94A 2YJ6A 4X0EA 4MUAA 3SX2A 2AXEA 4QXMA 3LHKA 4ZC8A 4DV3B 3RC9A 4AG6A 4P86A 4JI5B 3AY3A 3PGVA 3E15A 2R1TA 2JAQA 3THWB 2PSJA 2GBLC 2CNBA 2GWHA 2IJGX 1OPRA 3NH9A 2JAPA 3WYCA 1QHGA 4L78A 2O2GA 4YRMA 4L9AA 5H3CA 2CEAA 1RHJA 1G9XA 1I0IA 2MSDB 3IDQA 1IG3A 3NJRA 3TL3A 2OZPA 4D3ZA 3UPDA 1RZRD 3EX7C 2DPXA 1TRHA 3A26A 2XNDA 1Y98A 5DLEA 3L1JA 5K9ZA 4QRHA 3HB1A 5DNAA 1PR1A 2JEZA 1CUBA 2ZJZA 5ICEA 1Y3IA 1ESZA 5E8RA 2OA0A 1KIMA 1Z0DA 1FFBA 1S2OA 1ZISA 2Q3JA 3KYJB 4QPDA 5JRDS 1SCNE 2V6BA 1BX1A 1TB4A 3AFIA 3KG2A 3JQGB 4OAOA 5AKEA 5HIIA 3WV4A 3LCJA 2HSZA 1N25A 3ADCA 1V35A 1DIHA 4XLZA 1OAAA 1O4VA 4CN8A 3ICWA 4YCDA 1RRMA 3ILXA 5AOCA 4LSGA 5K0CA 3L8ZA 2AEMA 3GJXC 2DPYA 3PEFA 4UBKA 1BHQ1 3WMFA 5IM4F 1PKEA 5F7JA 3UAXA 5CFQA 1WDTA 1SG6A 2YZNA 5ABPA 3GHHA 2ETVA 3OLCX 4E2YA 3ZR4B 1IDOA 4Q1DA 4I55A 3KJHA 1E79D 2COKA 3E4DA 2Q7DA 3RSSA 3JWPA 1P80A 1R64A 4X6UA 3R0VA 3F5SA 3JZAA 1QH1A 3GK3A 2Z2IA 2I7XA 3BWEA 3USZA 2NO5A 3GGCA 3OTQA 1E60A 1DKRA 4WBNA 1A96A 1B8OA 1H6CA 1W94A 3H4IA 4BGUA 3U48A 3RIXA 3DUWA 1HH4A 3DW3X 2O8FA 1VSBA 3CE6A 4IIGA 4IH1A 4O08A 4TXHA 4CTKA 2M32A 2Q6TA 4CVNA 5HX7A 4AMUA 4GXTA 3E9DA 3GIWA 4KJXA 3ZDRA 4BLQA 4WNAB 3QPDA 2JGEA 3GGPA 3HXTA 3VR3A 4F96A 2XIQA 2R48A 1ZWKA 1V8OA 3V7WA 4DW8A 3NXSA 2BJVA 1CRPA 1WZ2A 1NI4B 2HJRA 2W2LD 3OX1A 5JATA 1KJJA 3GRRA 4HZUA 1TUBB 1KE1A 4KSYA 4BZZA 1SKYB 3OWXA 1FDOA 1GZDA 4X1YB 4JP5A 4ZPJA 3T15A 5JLJA 3RBVA 3OMLA 1KSFX 1KP9A 1M0TA 3BQ9A 2IZZA 2OAEA 5BWNA 2C98A 1U0OC 4CF3A 5IEJA 8ATCA 4XTCS 4ZU6X 4FE3A 1D2HA 2QI9C 4LX8A 3W3ZB 5JS1A 4FMCF 4LCJA 3S55A 3I23A 5IASA 3HYNA 1YCDA 5FTNA 4PHTA 2DCUA 4YT8A 3K71B 4HRYA 4UHBA 4E5KA 3WR5A 2XNDD 1T24A 1OREA 1NMQA 1FNNA 1EFPA 4ND5A 4R0VA 1VYHA 5JZOA 3SDBA 2ZK7A 1H66A 4WZBB 2BZGA 4POOA 2MSEB 2PUWA 2QP3A 1PCXA 1H2XA 3C24A 4JC5A 1KDTA 4MUGA 2I2CA 4M0LA 4JLDA 3S99A 3WGJA 4BLVA 3RJMA 3KQLA 3MS2A 4MVJD 3FAKA 3E3AA 3A3NA 3EC1A 4PNEA 1MNQA 4YECA 5BO5A 4C7MA 1YTUA 1TE2A 2Q7XA 3L4BC 1ZGCA 3CSSA 3T6KA 3VTFA 1EQUA 3DP7A 3WWEA 4E31A 1AJEA 4FR5A 3VOTA 2RCYA 1E7WA 1A5BB 4HL6A 5ESRA 1CJBA 2Y1WA 3D2CA 2YWFA 4HYQA 1XQ6A 2EYUA 4RGVA 3U7QB 3BWYA 5K3FA 4D6XA 3LX4A 2Y27A 1N0WA 4B33A 3USCS 3WLIA 3MQ2A 1KJZA 1P1FA 4OBBA 4NRDA 5JY6A 1J9EA 3BCHA 1I7DA 1WW3A 4CKCB 4RLQA 4TROA 1HDYA 5C5EA 4EG7A 1UH5A 1DUVG 2NPFA 2Q1WA 4RHUA 5BSUA 3HNRA 3THXB 3RV3A 1RJEA 4WY2A 1JQJC 1CIPA 2DJIA 3MG9A 1Z68A 1AK9A 1CJKC 1VZ2A 2E37A 2Q5QA 2W6NA 4G63A 1IL0A 1L5WA 3A4TA 4GI1A 5ECWA 3ZW7A 4C2TA 4TQAA 3WL4A 3QVSA 3TH5A 4FFSA 2BKEA 2Q5CA 5BOSB 4ZYLA 1W4CA 4DXDA 1QZXA 1M2WA 2I29A 4BV2A 2ZIZA 3IP8A 4YPOA 1Z83A 1RC0A 3H2IA 3M5CA 4B71A 4ND1A 4KXUA 2IV7A 3LWDA 4QXPA 5KS2A 1QGED 1FA9A 3ZTWA 1HQCA 1X13A 3CEHA 2FZ4A 4Z9AA 4D41A 4NMHA 4IQ0A 3T0FA 5ISMA 1YAHA 4QUGA 2IH5A 4FNGA 1Q0ZA 1EK5A 3JQEA 4E4YA 6CHYA 1JH9A 3UBTA 1G59A 1IN4A 3QXJA 4ALLA 1SCJA 1UPCA 2HQRA 1QH8A 1R0KA 4II2A 5I48A 4DMKA 3CRVA 2NQ2C 4DE5A 3SZOA 1GPWB 2P4QA 1QZTA 3L2OB 2AVDA 5HM6A 3ZY5A 3KE8A 3HY6A 3A6DA 3CZAA 5E9WA 1KK1A 1TJNA 1J1ZA 1YULA 3G0CA 1M5RA 2V6MA 5K0GA 4E09A 2IQ5A 2CJWB 2BT4A 4CM6A 1T26A 5JXWA 4EY3A 1XKTA 4XWYA 3F67A 4ASUA 4L6IA 2WM3A 3BXOA 2DKFA 4ZCSA 3RUAA 3K05A 5DTQA 4PWYA 1UIMA 2B36A 2OT3B 2VH1A 3K1JA 3MS7A 1PYDA 1Y4AE 1TQDA 3IMFA 4LECA 3N8KA 3IMGA 1W0KA 2DPGA 1IC6A 4MUBA 4ZGGA 4XWKA 4LFBB 3BFVA 3U7FB 1NJ2A 4DWOA 4OJTA 3TB4A 2X9GA 3STHA 4DRZA 2M6RA 4IFTA 3JX9A 1I4TD 4QU0A 5GWXA 2AQKA 2R85A 4ZXPA 3ABSB 2PX8A 3QYFA 5JJ5A 3CRW1 4FZ5A 2J4DA 2KLHA 3CW8X 3R20A 5KYYA 1F6BA 3RYHB 2EBFX 2J3KA 3K72B 4IHJF 1CR6A 1NVTA 5AKJA 2WU8A 2FX2A 3WK8A 5KTTA 4WZZA 4REOA 1W35A 2HBRA 1VJTA 4ID9A 3NAZA 1R5OA 2PGJA 1PSDA 1U7ZA 4KI0A 1N9GB 3RTBA 3V97A 4CIXA 3VFDA 4S1PA 5E7JA 1Y1RA 1T1GA 2JA1A 4G1MB 4IICA 5LP1A 1Y8ZA 3H11B 2ZJ5A 2ADMA 4IFBA 4B83A 1ZZEA 2FN4A 3OCWA 1OX4B 4YP6A 4P81A 1ULUA 2C59A 5C4MA 2HRZA 1N5OX 2MR6A 2HSGA 2GQ0A 3EZFA 3ONEA 1UFOA 5CT6A 3V2IA 2AI2A 2G63A 2APJA 3R6DA 4OREX 3LOQA 3BD6A 5JJLA 5JWRA 4Y2SA 4EF6A 3E27A 3CRQA 5HUJA 3L82B 4LV8B 4PZEA 3RC3A 5JSQA 1L8QA 1Q11A 2OHJA 2GDJA 3PZRA 3PUVA 3HCEA 3UOGA 3MNFA 4YMHA 2HYIC 7YASA 2WU0A 2H8GA 2W48A 4IZHA 2W43A 5I9SA 1QK5A 3OPYA 3N0RA 1DJQA 1VIDA 1GFZA 2QU7A 2ZYRA 1BGXT 2JARA 2OV6A 4FC6A 4ZODA 2JGLA 5KOYA 3ICOA 3DTVA 3GEBA 3PEUA 1CUFA 3ROEA 4R8RA 4BEBA 2ZTUA 1CB7A 1ZRHA 4Z86A 4A1FA 3ZWQA 1CV2A 5L9AA 3KFVA 4PYIA 3FFTA 2AW3A 3UJNA 4BB6A 2DR2A 4LIPD 3R44A 5CR9A 1LKZA 4GMDA 3ZVRA 3NHYA 3TW4A 1GYRA 3ERCA 4M0CA 1P4RA 2Y6VA 4MROA 5AVRA 3F96A 4IUDS 1DDGA 2XZDA 3M49A 3LQKA 1F17A 4FLMA 4P33A 5LZ4A 1TAHA 4C7XA 1CZLA 5KEIA 1WCIA 3FGPA 1UZUA 4UBOA 2Z3ZA 3O82A 3ZE6A 4D81A 1U8FO 1GKUB 2OECA 4KO2S 1WCWA 4RSGA 3WG9A 1OT3A 3ZS8A 2QN3A 2K2QB 3PNVA 4LHXA 4Q05A 1GTZA 2NTJA 3FFXA 3WXMA 4R01A 5T3YA 4X71A 5TARA 3T1VA 1ML4A 4LSZA 4X1YA 1FP6A 1XVLA 5J47A 3OC6A 2N0SA 4DPMA 1Z5PA 5B4VA 1FP7A 4BO1A 3B53X 5G0WA 2FJPA 4BVAA 5MN5A 2Q29A 5JQWA 1N9KA 4E4RA 3X1YA 5KDDA 4ZZ0A 3FFWA 1W2WB 3RTAA 4IMIB 4B3FX 3QOFA 3N7TA 1WSDA 2XMSA 3GVPA 2C2WA 3P2MA 3ZWXA 2P3LA 1SQFA 1RD4A 1SXJD 2R8EA 2BM9A 1OZAA 2W37A 3I2JA 1R3UA 4JJKA 4MUNA 2RAVA 1CQIA 2AI3A 2NPIA 4ZOLA 1NNUA 1CDDA 2LCIA 3H9GA 4JUAA 2V0GA 3OEEA 3H2JA 3GDGA 4B2PA 2WUWE 1PR9A 2ZFUA 1BE0A 3A9RA 3BSYA 3SICE 4TVOA 2FX5A 5G40A 2NTEA 4FFPA 1A4XA 4QHSA 1FLAA 2YN0A 4CDNA 3TTTA 4ZCRA 1W59A 2C31A 2PYDA 4GUDA 2ISCA 5LBTA 2EHDA 3P19A 1MAUA 3IAAA 2BBSA 2IT1A 3N7AA 1HSOA 1NAHA 2D0PB 1AK1A 3NWBA 3QXSA 1G5IA 2H63A 3FNQA 3HMQA 4LPKA 4UNNA 5CDYA 4C7OA 3AQIA 4KUHA 4RETA 2DUWA 3H0EA 3VTZA 5J4YA 1XP5A 5JNWA 2FSVC 3DQZA 4W5NA 1GTJ1 3WAJA 2AEJA 4IJ6A 2PWYA 1GWNA 3O4IA 1UC8A 3QHAA 3QXHA 2QW0X 3BXPA 4B48A 4JJAA 2ECKA 1JPVA 3BXEA 3D1LA 3MZ0A 1J1UA 3WWZA 3H75A 3R7SA 2FSVA 1DNPA 3EWIA 1LVHA 3DZCA 4LVCA 4XFKA 3PHIA 3I6BA 1WXDA 2GKOA 4L27A 5C7OO 2XRFA 2PA0A 2XMZA 4LRUA 4JITA 4ZV4A 2HAEA 3T1TA 3ZD6A 1REQA 1T3SA 2JRLA 3ROKA 3WLSA 5EVCA 2EBWA 4XDHA 1H6AA 3LPNA 5TXGA 1N2HA 4H0CA 3RASA 4R5MA 1NN3A 3R3JA 4X95A 3QM1A 1H1DA 4FIZA 3JVEA 2HHLA 3KOOA 3BFXA 4YAFA 2QY9A 2W2KB 2ONZA 4EA6A 4E46A 1EM8B 4DMMA 4RTMA 3U5ZB 4FR2A 2D74A 1DAMA 5K3AA 1RWQA 3S2SA 1RJFA 3GD5A 3FPBA 1WS6A 2A0WA 2Q41A 4WK4B 4ZPXA 4CCYA 1GPBA 1GL7A 1GG2A 4R9RA 4AMYA 3EZLA 4DCSA 4FWIB 4H7FA 2C0CA 3V48A 1C0PA 3Q9SA 2XZPA 4G8BA 4WBXC 3UAGA 2ICAA 5C8YA 2XVAA 4YGXB 4LBWA 3ETJA 5AXCA 4KK4A 3SBOA 3UAWA 4FB4A 2VUIB 3MGGA 1UT5A 1Z37A 1F8YA 2IZ0A 4LHEA 3EPJA 4RKYA 3E18A 2Q3EA 3OIWA 5F1OA 4HD8A 2D5LA 2BN4A 3I5YA 4TOIA 1CZKA 3HFRA 1W5SA 5DEOA 3JRNA 1DQNA 4Q4HB 1N1EA 2TMDA 5A4FS 5D3MA 1V9LA 2YV1A 4O2AF 2O19A 4M6WB 4WNCA 1IOLA 4RVUA 4NH0A 5F2KA 1M1XB 2C9BA 1OU0A 2EU8A 3IQGX 4GD3Q 3SC2B 1X1QA 2JCXA 5G3ZA 3WLMA 3UT6A 4A82A 1KJQA 2BFBA 1JPUA 4GR5A 2HA3A 1CUCA 3TGWA 5KNDA 1DG3A 4HAWA 3U49A 2H9AA 1YH3A 2B5OA 2PM8A 4G5RA 5J5VA 2IA5A 2R00C 2CY0A 3HMKA 2GZHA 3JZDA 4ETNA 4RACA 3WYAA 1GRVA 3UAOA 4K6KA 2DRIA 2PZEA 2QM0A 4U02A 2PRIA 2WFAA 4TN5A 1JRLA 3IEKA 2HY7A 2OCLA 3ABOB 4JMPA 3NBUA 5KQGA 3QHPA 1EFPB 2YRWA 4G5SA 2WINI 5HF6A 1IUNA 4LDQA 4TX1A 5HZGA 3FLMA 2Y67A 4RJKA 2PMCA 4B2IA 2J6BA 3AIKA 5G0TA 4D5GA 4LGMA 4HTFB 2DLCX 3HL0A 1FTQA 1XZHA 1XRLA 3G7UA 1AOXA 1ZA1A 2SKCA 3QP9A 3SD7A 1WXQA 3SQLA 4D9HA 1NI5A 3BWMA 1WVMA 2R6GA 3DNMA 2J4CA 3DEYX 4B76A 1DRWA 2VZ9A 4A8JA 1V4BA 2EKDA 2JHPA 1TYBE 2O2DA 2ONKA 4YJ2F 1F06A 4Z1MA 3UWMA 5EE3A 3CMCO 1QE0A 4RVFA 3ETEA 3E3MA 2GXQA 2WHEA 1DZIA 4IDQA 2VNKA 4J43A 3TSOA 5GZ6A 4XRGA 5EJ5A 3LPDA 4UE3S 5KJ1A 2WJVA 4Q1AA 3Q3CA 4MAFA 3E7PA 3QKRB 4AKTA 2FB9A 5JZVA 4ARBA 1HE3A 2V6IA 2VDPB 4BEWA 5CGZA 2IE8A 1GZSA 1RTTA 5KKAA 2CL5A 3F8TA 4JP8A 2XBMA 3F3SA 3T7AA 4HTFA 4AO7A 1NV9A 4RA6A 3D6UA 2W9XA 3ABRB 3DS8A 2OV3A 3CY6A 3PT5A 1YR3A 3KXDA 4QFBA 2YXNA 1QONA 3OEYA 2I4OA 1CUAA 4EHDA 3SJAA 4GRDA 2UVDA 4CG2A 2A2ZA 1GA1A 2DQYA 1I3CA 2GO1A 1XZKA 2J8ZA 2YUIA 1JU4A 1K9VF 1NLZA 2UYOA 2H2GA 3HI6A 4Q6WA 4BBZA 2JBAA 1Z7BA 5FT9A 3C1AA 3JR7A 3MXTA 5BV8A 1XCLA 1B14A 3CKYA 5HE8A 1RKBA 4F60A 2AFHE 3EZNA 3QU5A 3U5TA 2JZCA 2QY6A 1JDPA 4YEDA 1UM9A 3RC1A 2I7VA 1MR3F 4LCBA 1TAUA 2D7CA 1HG1A 4HSGA 1UMBB 4M55A 4OYYA 3VDQA 3KOMA 3WQRA 3ZQ4A 3IAEA 1J0XO 1OBFO 1YI0A 2HKIA 2LD4A 4LE1A 4WT7A 1XCJA 1VHDA 3NAQA 4J29A 4OY3A 1K7FB 5TQJA 5BWBA 4FNMA 2EYQA 3LHDA 1LPBB 4HWRA 2QVBA 4TZTA 3AESB 2ZSJA 1H4QA 4UZFA 3KKPA 4WBSA 1E6MA 1F3LA 4RTQA 1MBZA 1OVGA 3ABZA 5JZSA 1E8MA 2IYNA 2WC1A 4BFUA 1T2VA 3PXXA 1LU9A 5DM2A 3JCZA 4ETMA 3RSOA 4DNXA 1YKFA 1B0AA 1RBZA 3JZMA 3VR2D 2HNKA 2VDQB 3TDMA 4EG1A 2NU7A 3WKBA 2XH8A 1ORTA 2V3CC 2XZLA 4ACBA 4CDMA 4GBGA 3KB1A 3DE6X 1KC1A 3ZUPA 3W7VA 1VIMA 2Z04A 3OZDA 4OHMA 4IS3A 3WJ1A 1HLDA 3R0IA 3N6XA 4Y1RA 5DGHA 5F4BA 5B30A 2VK1A 3C8HA 3PG5A 4WEQA 1LZKA 2YFYA 4H7IA 1C80A 1QGUA 3RRFA 5EMJA 2GJKA 1BMFA 3ESDA 3MAAC 4X9XA 2GHRA 3M5PA 3QG5A 1ILEA 2J30A 1E63A 5KOIA 5GZ3A 3QY9A 5GJCA 3HCDA 3TNFA 1B8UA 5KHLB 3IP5A 3LBNA 4FKMA 4GDFA 1E1LA 3A8TA 3BS4A 3DZIA 1PEAA 4HWGA 2PZBA 4QDKA 4BJ5A 2R84A 4XDGA 4C6TA 4EY6A 3O4VA 4GQAA 4NR0A 4K0RA 1QQ5A 3FYUB 4M0EA 2H2IA 4I50F 5ALNA 2HRCA 2UZ1A 2W2PA 3FHJA 3SVTA 1IY1A 1EHCA 4HBGA 1IJFA 2GYVA 1OH5A 3ZBTA 2WPDD 2ZWOA 4D45A 1Y1TA 1Y3AA 4UNQA 2YWJA 4MPRA 7ADHA 1HT2E 3U3RA 4CKEA 3KZXA 4WK6A 3VV2A 1CUHA 4D3FA 4O4IB 1E4VA 3DAYA 3HWSA 2O3SA 5DHQA 5IK2D 1PNQA 2I66A 2OTCA 1P1CA 4G5GA 4HQOA 4B6QA 4JD5A 4F3CA 1M5TA 3C3PA 5CBPA 3I92A 5G02A 4I3HA 3ITKA 3RVRA 4WD3A 2HCTA 2F90A 4BO4A 4UU8A 2EZ9A 3IILA 3E48A 5EE9A 3RSQA 5GADl 4GYYA 2G1AA 4MRMB 1XJQA 5TEWA 4C0JA 2QX6A 3VHQA 3EDMA 4AZ3B 1IFXA 2C84A 1M76A 1BU8A 3DMGA 1QYRA 1HOTA 4QREA 4CR8A 4DV1B 1TI7A 4GPTA 3K1AB 5COQA 2ILTA 4CIDA 5KVAA 3P9IA 2E18A 3EVTA 1QHNA 3TUJC 3S4YA 2RI1A 3P4UA 3SZRA 1NXWA 3VVCA 4F1WA 5JUWA 2KX7A 3NHRA 3DTVB 5CM8B 5D6NA 2IW3A 1AQIA 3FHTA 5EHIA 3GAFA 4Q37A 3S27A 2WVAA 5IDQA 4M1MA 3FYHA 3NHLA 1JWBB 4WNYA 3PHBE 4M1TA 3SN6A 1ADBA 2D3WA 2XOXA 4HNSA 3T54A 3VR6D 1DC7A 5EIWA 3R9WA 1I6KA 4FOSA 2PX3A 4B75A 3IKLA 2LIPA 3L43A 3NEAA 2WG2A 4P38A 4DJFC 2YKGA 2AX4A 2KE5A 4DJEC 4L8WB 5KYUB 2WJ4A 1X9HA 1SELA 2WMNB 3ORHA 4NZOA 1E9BA 5LQRA 5LQKA 1YZNA 1IE3A 1DMSA 1NGSA 1U4OA 2QTNA 3R77A 4H6VA 5FPSA 3VPXA 5AM2A 1K5DA 4Q16A 4XB2A 1T0HB 1E1NA 3SGLA 3PEEA 1DUSA 1SC9A 3ZJ4A 2X9LA 4WIAA 2YWXA 1MB3A 5D51S 2NU8A 1P9NA 1BCSB 3NYWA 3DHWC 4J6FA 2F1RA 3DFFA 1Y48E 2UUOA 2X5OA 3EB9A 1YZ3A 1KI6A 1E1QA 1IPEA 2D13A 2GEUA 4DWWA 5HRCA 1ZJ4A 2GRJA 2R4QA 4LJKA 1HE5A 5L4LA 4RLFA 3PLRA 2H4YA 2AK2A 4HVTA 2JFFA 2YV4A 2YMMA 1UJBA 3H7AA 1BWRA 3H5AA 2NSLA 5IVKA 3ASVA 1BS2A 1FPMA 1QHHB 2DY1A 1Z88A 2QQ5A 4NJEB 4B1FA 1K8QA 1UBEA 4OK6A 4FD3A 5IW8A 4TSFD 5J5AA 5K2MA 4RVOA 3WJ7A 3CCFA 1AB6A 1PDOA 2WMOB 2ZUFA 4FZRA 1KMQA 4IINA 4V02A 3OTGA 3ZBQA 1JIUA 3HVIA 1KI7A 2IKSA 5AW5A 2B2NA 3B3GA 4K9MA 2B34A 3OM0A 2BW0A 3FROA 3JTEA 1E62A 4KFSA 2Q3LA 3B38A 3I0NA 3AK4A 2OPHA 2WIGA 3AIIA 3B1WA 5CJJA 2CNWD 5DZSA 5P8WA 3ZXXA 1BVHA 2A5YB 1GR0A 3L40A 1MJHA 1WVIA 1MAVA 1NM5C 1J2YA 1P2UA 1XAJA 1A9PA 1OWNA 3AF4A 4DCJA 1B3BA 3TXXA 4G0ZA 1WO8A 2WQ7A 1DBRA 1IHDA 1E0KA 1U1EA 2ZSAA 4Q3KA 4DDHA 2IPOA 2PT7A 3ZE8A 1TKAA 1VPDA 4EX6A 5F3WB 1G2IA 2I0FA 1C3OA 5G3YA 4QQKA 3M1YA 5K0TA 1NVKA 1YB5A 4XGRA 3TKYA 3O8NA 4IZ6A 4MGHA 1G1AA 4R69A 5ALEA 4BPBA 4UASA 4C0SA 2HFJA 4ESVA 1YQQA 3NTRA 3CZ9A 1IOVA 1KJ8A 3B12A 4AYXA 2P3SA 3GF4A 4YXWA 4PC2A 1AC5A 3I1IA 5CDGA 2NZWA 3W6PA 1QC5B 1TAGA 4O5OA 2YHBA 1YS7A 1Z6ZA 3A06A 2C5AA 3BK2A 1GDDA 4KKXB 4HF7A 4IAOA 1NQUA 4ZO7A 2OZVA 2EW2A 1YC5A 1Z39A 2XBUA 3DXYA 3KZNA 1XEWX 3H2ZA 1ZD5A 3VR3D 2I6SA 2O5EA 1WR8A 4NFHA 4CKBB 1G21B 3OZTA 5AJTA 2HT1A 4S05A 4JJZA 3MQFA 4XFDA 3IBGA 2Q8QA 3REOA 3LKDA 4FFNA 3SXJA 4DJJA 1PQYA 2VO1A 4H0NA 3UXYA 4EZIA 4DTIA 1PJLA 1RZRA 4Z4QA 4NZPA 3CNOA 3Q7QA 1BW9B 3EXG1 1DAGA 5K0SA 3VR5D 1WXIA 1OFHA 1QLJA 1QOPB 1REQB 4ZVNA 5DXJA 1NVGA 5CW2A 3RUHA 2P62A 3WLFA 5K5EA 1J2UA 1C0KA 2XGSA 5LP6A 3AVWA 1N3IA 1NONA 3RAPR 4ALKA 3DBOB 2IELA 2ENUA 2RHDA 1XMIA 3CJTA 4AZSA 1TMYA 5BMOA 3ZCRA 4DLLA 4R8MA 3C43A 1ICEA 4N0QA 5DH9A 3BAFA 1QTNA 4TRJA 4DWJA 3PPVA 2H1VA 3AM3A 1SZCA 4LC1A 4NE2A 3G1TA 4ZTZB 4HN2A 1RLJA 2WV7A 2X13A 2WYWA 1ZD3A 4MVJI 4Q4AA 1UBLS 7AT1A 1QFMA 2QV7A 3I0MA 1UEXC 1PFYA 1OLSA 2RI6A 2YWCA 2GF0A 4FLEA 4EM6A 5I4KA 1MVLA 5MFPA 2VJBA 2A33A 2VA8A 5C4GB 2ZSKA 3TRKA 1XC7A 4FDTA 4V1CI 1AHNA 1XWIA 1WEHA 3A25A 4LRSB 4P54A 1OR8A 2GTIA 1OX5A 2H7VA 2NZXA 3W3AA 4N5NA 1RVDA 3W06A 2XYQA 5AJWA 3TIGA 4AY5A 5KYXA 4OYLA 4KBFA 4M1QA 2BHSA 1KDYA 4C20A 3L0CA 4XYLA 2OZEA 3PYMA 1BJKA 3TOSA 4LDRA 4KO4S 4KJZA 4PAWA 3VHLB 3GVXA 1GNQA 1E6KA 4HAYA 4ZC1A 4EJSA 3N2GB 2IW1A 4I1UA 3I0ZA 4J1QA 3ND7A 1J7KA 4R2HA 5E2BA 2YMQA 4D4JA 4DEYA 1W581 2JHGA 4X6XA 1DRUA 2BUAA 2D5IA 5L40A 1RJ9A 3I73A 1GL6A 3SEZA 1G55A 5JWHA 1MDBA 5FF9A 1G5HA 2QDKA 4TPKA 1Q0PA 2YVUA 3JQ8B 3H9QA 4BFSA 4WHMA 1L5GB 3FFAA 2ID7A 3FYUA 1A9TA 5MN6A 1HYEA 3I64A 1PG5A 5CT4A 4BASA 2FWBA 2ZI3A 1KOJA 5IUKC 1ENPA 3LZ6A 5AYVA 4JP3A 3FYUC 1PX2A 4U0JA 2YQ5A 4XGKA 1E9DA 5FOVA 4DAEA 2RK4A 2AF4C 3GRCA 3I04M 1HTBA 4GPIB 4X20B 2PE5A 3GFRA 1RLUA 3W4JA 5K8TA 5LLTA 2XUAA 3R7FA 3BSWA 1OLXB 5A4IS 2CMHA 2JNWA 1E5QA 1M8PA 1FRFS 3PRKE 4H3HB 1DAIA 3H84A 1EWYA 3MJ4A 1IZ0A 1KFEB 1M5UA 3QKWA 4FFMA 5CCXA 1EG2A 1E2HA 1B6GA 2V7QA 4NYJR 2NTVA 1JHUA 2FEPA 3GR6A 4W4TA 4RZ2A 1IXKA 2AE2A 4DEXA 3TUIC 5H02A 1ZMOA 3U4IA 3R24A 1VA4A 1AXGA 2GA8A 3LFUA 5DPMA 1Z6GA 4CLRA 4D9EA 4B3JA 1ZW1A 1R0CA 1O9HA 4I66A 5IJ9A 4ZVRA 5JT1A 2NT4A 3DOJA 1GU7A 5IHPA 3PTLA 3KL2A 1KPIA 3CR7A 3BIXA 2GXUA 3F5FA 3PJDA 3WFJA 5JAIA 1SKQA 2PGIA 4WVLA 5GJWC 1KZYC 2D5AA 1H2YA 1JAHA 2C3YA 2O0LA 3LYLA 4WLNA 4EHLA 2FAXA 2D8MA 1ORIA 3CRNA 1TK3A 3GMDA 1A2KC 1N8TA 2XJ9A 4G0OA 1GUYA 4ZAWA 3GW8A 5C37A 3CVYA 3QF4B 4DR2B 5K51A 4DG8A 3GNTA 1P6QA 1UBJS 3HRKA 1RPTA 4RKFA 4BBAA 1U02A 5EJ8A 2LZ0A 2PAAA 4BVFA 1XP8A 2ZIXA 2B0CA 2YNMA 3Q7RA 3OI7A 3V9PA 1KQGA 2H7YA 3IVCA 3OJOA 5CLFA 4JI4B 4MW2A 3K4QA 5EWMB 1TUGA 4MRRA 4FGLA 3T0GA 3NIBA 3ZHBA 1K5GA 3G88A 4WA7A 1U3WA 2YNMC 2QTMA 3FHLA 4C7OB 3EXIA 4YCBA 5JFGA 2EWMA 3PS9A 1ONSA 2ZI4A 2ZULA 1HLFA 3GA0A 1C3JA 4LYGA 4M9CA 1PK9A 1XMJA 2C9YA 2R5NA 3D6JA 3OIVA 4RTKA 1QNFA 3IEMA 3GNQA 5F64A 3OFNA 1G6HA 2FV8A 3BM5A 4XIJA 2CLOB 3HXQA 1HBJA 1VMEA 3CLSC 4YAOA 1IWOA 1X74A 2GHIA 1GJRA 4M86A 4LI0A 4UFOA 2YHAA 4B7UA 4GMXA 4H1HA 1D2GA 2IYQA 3A28A 3RFVA 4AB1A 4KRYA 4EBFA 2NU7B 4F45A 3MWJA 3S81A 5JAUA 2NZJA 5LOVA 1K9SA 1R8JA 2WFZA 4QYTA 1YU6A 5IAAA 2WMYA 4QGHA 4J9UE 5EINA 3O94A 5EOVA 3KR9A 4JI3B 4DLBA 2QLLA 1R8QA 1U2DA 1WZNA 2B78A 1N1DA 4D96A 4HNTA 4OHKA 4A1OA 2R4TA 3FLAA 4G8CA 3ZDAA 3VHXB 1GAQA 2ZR7A 2OK7A 4OUDB 5DN9A 3D0RA 4BU0A 1TQ8A 4K88A 2VKTA 3OQBA 4OBWA 2G6BA 2QUIA 1YI1A 3FB4A 4XX1A 3LRTA 3GRUA 4FFDA 4N6OA 5ALHA 4HFRA 4XSHA 3D7KA 2C7OA 3V32A 2JAHA 3I9FA 4MUJA 3H11A 5CPFA 3K0KA 2B61A 3KC2A 1JEQA 4M21A 3WO0A 1AQJA 4LF9B 3KDAA 3LM8A 1GNPA 3FZGA 2PY6A 3U3OA 2BR5A 4A5SA 5C8DA 4OI2A 1TJ5A 5I4CA 3ZHUA 3KYIB 1XTVA 4P0QB 1OZFA 4L5YA 5EPEA 1TU4A 4P5DA 3F6PA 2OXEA 3LNCA 3P9CA 4D9CA 2QNRA 1KAGA 1TEVA 2W93A 4PRKA 3LW7A 4WA8A 2BEVB 2WF6A 5F78A 3EE6A 1I4OA 1CJMA 1WXEA 2JANA 3GN1A 2MU1A 3D6AA 3ORQA 3QVUA 4Q9NA 5I9MA 5H9VA 2GEVA 4G41A 2QNBA 4LKRA 2BBOA 4ZAYA 5SY4A 1I6MA 1GNLA 2OCAA