4C7HA

Leismania major n-myristoyltransferase in complex with a peptidomimetic (-nh2) molecule
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Peptidomimetic Inhibitors of N-Myristoyltransferase from Human Malaria and Leishmaniasis Parasites.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4c7hA00
4B13A 4C68A 4B12A 2YNEA 2WSAA 3H5ZA 4CAFA 4CGMA 4C2YA 4UCPA 4A2ZA 5AG7A 5A28A 4UFWA 3IU2A 4C2XA 2YNCA 4A31A 4A30A 4CYOA 4C7HA 5AGEA 5G1ZA 5G21A 4A33A 5A27A 3JTKA 5AG5A 4UFVA 4B10A 4CGLA 4CGNA 4CGPA 4CYQA 5AG6A 4CYPA 5G22A 4C7IA 4A32A 2YNCC 3IU1A 3IWEA 4UFXA 4CGOA 4CYNA 4C2ZA 4BBHA 4UCMA 4CAEA 4B14A 5AG4A 4A95A 5G20A 2YNDA 2WUUA 4UCNA 4B11A
chains in the Genus database with same CATH superfamily
3D3SA 1KUXA 4KVME 1DE4C 4MY3A 1JQGA 4E2AA 4JJXA 3H8FA 3I3GA 1F57A 4EMEA 4NGMA 3GB0A 3SXOA 4NXYA 4KLWA 2R1IA 5THWA 4NFRA 2OH1A 4MJ8A 3MRUA 8CPAA 5IV0A 2ZOGA 3SI0A 1XMBA 1IYKA 1F2PA 3GIUA 1OBRA 3PP9A 4KSIA 4R6TA 3BJ8A 2ZW7A 4NCZA 2FSRA 4EWTA 4MCQA 5KTCA 3ISXA 3GUXA 1YLEA 2Q0YA 4AVBA 3TT2A 3S9MA 1YR0A 3CZXA 4B6ZA 2YNCC 3B7IA 2PJ3A 3D7FA 1ZLIA 3DSBA 3KR4A 5BWAB 3S9LA 3TOBA 4XPLA 4FD4A 1IIDA 4OC1A 2B3VA 1Z8WA 4IUSA 3FB3A 4OC5A 4OC2A 4MY0A 3G3SA 4J3GA 1IICA 5G20A 1EE3P 2VQYA 4A95A 1M4LA 1BPNA 4MFPA 1Y7EA 2Q7SA 1S60A 3JVNA 3IO1A 3LD2A 4A2ZA 4KS9A 4P4JA 1IB1E 2YNCA 2B4BA 4UWIA 2RFHA 4PXDA 4JZ0A 1MJ9A 4MI4A 4IK2A 1YSJA 3IWGA 4MHPA 3KQXA 2JDCA 3LODA 4ZY2A 4A38A 2POKA 4ZI6A 1PYTB 4PSWA 2G0BA 1QSNA 4KVXA 4XNHB 4TWEA 3CXSA 4NGRA 4UEEA 3IWEA 3QNVA 1TKFA 4H6UA 2GE3A 3TE4A 1CP6A 1YMEA 2PIZA 4XPDC 5GCNA 1ZLHA 2PJ7A 4YU9A 3GY9A 5EBVA 1LAMA 5LYLA 2BL1A 2YNDA 2ZEGA 2WUUA 3VWEA 3ISZA 5KTDA 4KLVA 5LRKA 3H5ZA 2PRBA 2HC9A 1KUYA 2P6EA 3V38A 1QSOA 4R87A 3EC4A 3DR8A 4MFLA 2G9DA 1Y0RA 5EC4A 1AUGA 4DJLA 1VHEA 5J1QA 1GYTA 1VHSA 4R57A 5JQ4A 1K4JA 2VI7A 3FMCA 1XF8A 3H8GA 4UF4A 1LOKA 2FIWA 3IEHA 4MCPA 3TO7A 2PVVA 2VZZA 4G1PA 3LACA 2VEZA 2B5GA 3NE8A 4ZY1A 3DDDA 3WC6A 2Z3NA 1R57A 4B14A 3JRUA 1LAPA 2PDOA 2PJ1A 3GLJA 2WPXA 4LQGA 3RAMA 3W91A 2QMLA 4CPAA 4B12A 1MJAA 5LRGA 2V8GA 1ON0A 4X5KA 3R9EA 3LMSA 1WWZA 2P6GA 1RTQA 1Y9KA 2OU2A 4CYOA 5G21A 2I3CA 3FNCA 4B5PB 2EWBA 4CRZB 2DPSA 3IGRA 1HEEA 2O4HA 4KOUA 4CGLA 2CY2A 4EFDA 5ELYA 4MRIA 2DF5A 3QB8A 2FS5A 4CYPA 1IGBA 3KHXA 3VH9A 4M3SA 2V77A 3SJXA 3C26A 4X3RA 3SI1A 4DYOA 4MCRA 4OMEA 3TO6A 1I12A 2XEJA 2X7BA 2GIVA 2CTBA 2PR8A 4Q36A 3RO0A 4AG7A 1TKHA 1XEBA 4WWVA 2R98A 3PB8X 3WC5A 3BI0A 1Q2YA 2YNEA 2WSAA 4C2YA 4UFWA 2CTCA 2VZYA 4KOSA 4A30A 2GREA 4AVAA 2R8VA 3DR6A 1RO5A 1FT7A 4NEXA 4XNHC 1BLLE 2OZUA 4K30A 1F2OA 2IL4A 3PRTA 4P4EA 2F5IA 2QIRA 4PXCA 1TF8A 4AB7A 2XEIA 2YGWA 4UIBA 1YGHA 2QJ8A 2XEGA 3GKRA 1KZFA 2K5TA 2PIYA 4CAVA 4GXHA 5H86A 5K8NA 1Y0YA 2C27A 1FNOA 4P4BA 2ZW6A 1ZG8A 1A2ZA 2WPWA 4BBHA 2ZW5A 4K3NA 1KWMA 2EO8A 3D2PA 2ATRA 4OADA 1MK4A 3D4UA 4II9A 2FT0A 2CXAA 1VGYA 5HH1A 4C68A 1IY7A 4MHZA 1S5KA 2GANA 4U5YA 4UCPA 1PUAA 2WZNA 3KL9A 1S7NA 4KOWA 4YGOA 1BPMA 1IYLA 2GLJA 3B3CA 3KQZA 3W6SA 4P45A 3SJGA 4CAXA 3B3TA 1CX8A 2BCOA 1YVKA 3IWWA 2KCWA 5K8OA 3DNSA 2XEFA 4ONWA 5AG6A 4A39A 4L89A 4F6AA 5JPHA 3V7ZA 2ZPAA 3HUVA 4ZYQA 5DWNA 2JDDA 2QYVA 4E0AA 3PZJA 2EK8A 2F8HA 4AXVA 5JM6A 1YX0A 1TXRA 2PVWA 3BHXA 2D4OA 5C88A 1IOIA 3MN8A 4B13A 3B3SA 4Q38A 4P4IA 3FF3A 5I0CA 3SJEA 4H89A 4F0YA 1FY7A 2PJAA 2ZENA 2DEAA 2PCUA 5AGEA 3R9FA 1CBXA 2P6FA 3R95A 4B10A 3FJUA 3NH8A 1X10A 2Z3KA 3NH5A 4OAEA 3I1UA 1Z4RA 1QQ9A 5CPAA 4FD7A 4R76A 4JXRA 3RBUA 3N5FA 1LCPA 3F5BA 2Q44A 3B3WA 1ARLA 1R43A 3N7ZA 4KUBA 4CS0B 5IB0A 1ARMA 2OZHA 3FH4A 3S6HA 3P2HA 1VKCA 2Q04A 2WYRA 1QMUA 3FXTA 4JLYA 4LX9A 4QVTA 1LANA 4U9YA 2Q7BA 3PB7X 4MHYA 2ZELA 3TFYA 1LFWA 1XRYA 4M6GA 3DGVA 4JD6A 3PFEA 3P2FA 3VWDA 3VARA 2PJ4A 2ZEDA 4C7HA 4MCSA 4FBEA 4ONUA 3TO9A 3D67A 5LYDA 1YLOA 2PQ8A 4OC4A 4YWYA 3D8PA 3TC8A 5KTAA 4OIDA 2P0WA 1CP7A 2V8DA 1CG2A 1GHEA 1VIXA 1NMTA 2AFZA 2JEVA 2V8VA 3B2YA 4KSAA 2ANPA 2ZEHA 3WR7A 2ARHA 1CPXA 4ORFA 4OC0A 1XMTA 2ZEOA 3PEIA 4GS4A 4F8ZA 1SQHA 1Q2CA 2G3AA 3PBEA 5HMNA 3A9LA 4JXQA 2D4PA 1AMPA 2REFA 3EO4A 3IC1A 5LYFA 4QUSA 3ZJ0A 2A4NA 2EBJA 4C2XA 2ABZA 2FE7A 1M44A 2CNTA 5A27A 2BOAA 3L2NA 2QECA 3FIXA 4ZGYB 2QVPA 4Z65A 4H6ZA 4MFJA 3S9NA 2AFUA 3K2KA 5E96A 4A32A 2JBKA 2CNSA 2PJ9A 1HDQA 5CBMA 4DUKA 1TIQA 3LWUA 3SXNA 4CGOA 5F49A 3WABA 3E0KA 1M4GA 4P4FA 2PJBA 2Z0ZA 4CAEA 4E8OA 3G8WA 2Q4YA 3OWCA 3EXNA 4P44A 2FL4A 1S7LA 3FVLA 2OB0A 5F47A 5H84A 5DWMA 3B35A 2ZEPA 4MFKA 4NGPA 4M85A 5D8NA 2J9AA 2ZOFA 5HVFA 1YREA 3PFOA 3D2MA 3UY5A 4CGNA 1Z8LA 1BAVA 2EVNA 1HDUA 4DNCA 3TTHA 2F7VA 3FRMA 5DS0A 1QSTA 2CF4A 3FEEA 1IOFA 1YVOA 2C6GA 2FCKA 2BSWA 2PJ6A 3FEDA 4OLLA 5ISVA 3BI1A 2IQ6A 1DTDA 2CNMA 2Q51A 2C1CA 4R9MA 4IAVA 3KZWA 2ZW4A 4JWPA 4F9UA 1XBUA 2ZEFA 1UFHA 2PRQA 1YW6A 4P4DA 4NSQA 5CNPA 3W6XA 2BEIA 2Z3MA 2FXFA 4M6HA 3TX8A 1H8LA 1MJBA 1TF9A 2OR4A 4UIAA 2Q43A 1I1DA 4NGSA 2BO9A 1CPSA 4YRHA 4MXUA 1P0HA 1S7KA 5HVGA 4QBJA 5J8CA 4IHMA 4CGPA 4CYQA 4HPSA 3D66A 3HLPA 2Q4ZA 2C6PA 4R3LA 1NSLA 3TCVA 4XPKA 1B87A 4MMOA 2OOTA 3I9SA 2VBQA 1YQEA 1XIXA 1L0CA 1BO4A 2B58A 4UCMA 5AG4A 1OZPA 4NJQA 4OP4A 1JWQA 3V8IA 2BUEA 3R1KA 4OC3A 4UEZA 2Z3PA 1YW4A 4UCNA 4A94A 4B11A 3K9UA 4UWJA 4CAFA 5I4MA 1ZO0A 5HXDA 3PB9X 2EK9A 4GM5A 3KKWA 3R96A 1U6MA 4A31A 5LYIA 1Z2LA 4QB9A 3NFZA 4M6IA 1B6BA 3FBUA 4PSXA 3T90A 5IB9A 3CXPA 4ZBGA 5JGFA 2O28A 1M1DA 1KUVA 2VL1A 2FVGA 4X2TA 4Y49B 3RZAA 3IU1A 1Q2DA 4KVOE 4RI1A 2ZXVA 3SI2A 4AVCA 4RS2A 2Y0MA 4X8IA 3NH4A 2B4DB 2Z3OA 2JLMA 3EFAA 1Y9WA 3WT4A 4A37A 1AYEA 1Z8TA 1PCAA 4WJBA 4B5PA 2FIAA 4HNXB 1ZG7A 4P6YA 3IIBA 2PR1A 4RUHA 2HUZA 3B8GA 3D7DA 4PQAA 4UEFA 1YK3A 1Y7RA 3F8KA 4R7MA 5AG7A 4PXEA 5A28A 5J8FA 1Z5RA 3IU2A 3JUWA 4NJRA 1S3ZA 3PB4X 4F9VA 2NSMA 4MFQA 3CT9A 1TKJA 3B3VA 2PJ5A 4PV6A 2G3TA 4LUAA 3FYNA 2VXKA 3NE7A 4AG9A 3IFEA 5G22A 4CAWA 2HB6A 3RYOA 3S6GA 4UBRA 4H2KA 3H8EA 1ELLP 5F48A 4FD6A 4UFXA 1XFOA 2CIJA 4EVYA 2ZEMA 3K9TA 1WK4A 3T8WA 4ZX9A 1M4IA 2EUIA 4KUAA 4QC6A 5EMIA 5D29A 4NGTA 1CM0A 2IMOA 4MHNA 2OZGA 3RNZA 1CJWA 2PJ2A 3F0AA 3FECA 2NYQA 1M4DA 5G1ZA 5LRJA 2ZEEA 5AG5A 4R3KA 2PC1A 4NGQA 6CPAA 2NMTA 1LRZA 1XJOA 3KASA 2RB7A 4C7IA 3CDXA 1R3NA 3WC7A 2R7HA 7CPAA 4LQ6A 4CRYB 1XOVA 3KR5A 1IU8A 3SJFA 4CYNA 4L8AA 4JYWA 4C2ZA 1RXTA 2JBJA 2ODFA 3CPXA 4Q7AA 4UA3A 3KHZA 3R9GA 2C6CA 2PJ0A 3SHPA 2PJ8A 1I21A 4IF5A 2I00A 1QSMA 1ZG9A 4KSFA 4PPZA 1S7FA 3FX6A 1N71A 3NA6A 3DLJA 3S6FA 4FAIA 4U9ZA 3S6KA 4CGMA 2H5MA 1V0CA 1NE9A 5F46A 4ZX8A 1UWYA 1P4NA 3D7GA 3TOAA 2JEWA 4NGNA 3MGDA 4FWUA 4RN7A 3T9YA 2REEA 2AFSA 4A33A 5K8PA 3JTKA 4UFVA 2HV2A 4PXBA 4Y49C 2PE3A 2RC4A 2DPTA 3CXQA 3GYAA 3KGQA 4R8FA 2J8MA 2Z3LA 3PBBA 4B5OA 1Z8XA 5C82A 1XE4A 3CPAA 4HNWB 4OIWA 3KI9A 4BINA 4HKFA 2AFMA 5HVHA 1J4JA 2PJCA 2AFXA 4KOXA 1X12A 2GLFA 3D68A 1NSAA 2O53A 4FD5A 3QAYA 3ZZIA 1ELMP 4BD9A 2J8NA 3BLNA 4ZY0A 2AE6A 1PU9A 3D7HA 4HNYB 3VATA 4PK3A 2PSWA 2AJ6A 4OKOA 2AFWA 4XPDB 1QSRA 4KZTA 4KORA 5FVJA 4MHDA 4P10A 5IX3A 2HQYA 2IJZA 4O23A 4W9YA 4PK2A 2B4DA 1Z9UA 3PB6X 3QAHA 4NF1A 1VHOA 3BXMA 2Z11A 3BJ7A 2AFOA 2I79A 3H4QA 2B5GB 4BMHA 2J8RA 4I49A 4KOTA 5F09A 4KOVA 4YFJA 4MBUA 2GU2A 4FUUA 1Z4EA 1Q7LA 2GFQA 2V8HA 3PGPA 4KOYA 2B3UA 2Z10A 4MFZA 4F0XA 5JH9A 2Q4VA 4TNUA 2DXQA 5K8MA 1BOBA 3IJ3A 3EY5A
chains in the Genus database with same CATH topology
3D3SA 1KUXA 4KVME 4MY3A 4E2AA 4JJXA 3I3GA 4NXYA 4KLWA 2R1IA 2OH1A 4MJ8A 5IV0A 1IYKA 3PP9A 3SXOA 3BJ8A 2ZW7A 4NCZA 2FSRA 5KTCA 1YLEA 2Q0YA 4AVBA 3TT2A 1YR0A 2YNCC 3DSBA 5BWAB 3TOBA 4XPLA 4FD4A 1IIDA 2B3VA 4IUSA 3FB3A 4MY0A 3G3SA 4J3GA 1IICA 5G20A 2VQYA 4A95A 4MFPA 1S60A 3JVNA 3LD2A 4A2ZA 4KS9A 1IB1E 2YNCA 2B4BA 4UWIA 1MJ9A 4MI4A 3IWGA 2JDCA 3LODA 4PSWA 2G0BA 1QSNA 4KVXA 4XNHB 3CXSA 3IWEA 4H6UA 2GE3A 3TE4A 4XPDC 5GCNA 3GY9A 5EBVA 2BL1A 2YNDA 2WUUA 3VWEA 4KLVA 3H5ZA 2PRBA 1KUYA 2P6EA 1QSOA 4R87A 3EC4A 3DR8A 4MFLA 5EC4A 1VHSA 4R57A 5JQ4A 1K4JA 2VI7A 1XF8A 2FIWA 3TO7A 2VZZA 2VEZA 2B5GA 3DDDA 2Z3NA 1R57A 4B14A 2PDOA 2WPXA 3W91A 2QMLA 4B12A 1MJAA 1ON0A 4X5KA 3R9EA 1WWZA 2P6GA 1Y9KA 2OU2A 4CYOA 5G21A 3FNCA 4B5PB 4CRZB 2DPSA 3IGRA 4KOUA 4CGLA 2CY2A 3QB8A 2FS5A 4CYPA 4M3SA 3C26A 3TO6A 1I12A 4Q36A 2X7BA 2GIVA 2PR8A 4AG7A 1XEBA 2R98A 1Q2YA 2YNEA 2WSAA 4UFWA 2VZYA 4KOSA 4A30A 4AVAA 2R8VA 3DR6A 1RO5A 4NEXA 4XNHC 2OZUA 4K30A 2IL4A 4AB7A 2F5IA 2QIRA 2YGWA 1YGHA 3GKRA 1KZFA 2K5TA 4CAVA 5H86A 2C27A 2ZW6A 2WPWA 4BBHA 2ZW5A 4OADA 3D2PA 2ATRA 1MK4A 4II9A 2FT0A 2CXAA 5HH1A 4C68A 1S5KA 2GANA 4U5YA 4UCPA 1PUAA 4KOWA 1S7NA 4YGOA 1IYLA 3W6SA 4CAXA 1YVKA 2KCWA 3DNSA 5AG6A 4L89A 4F6AA 5JPHA 2ZPAA 5DWNA 2JDDA 4E0AA 3PZJA 1YX0A 2D4OA 5C88A 4B13A 4Q38A 5I0CA 4F0YA 4H89A 1FY7A 5AGEA 3R9FA 2P6FA 3R95A 4B10A 4OAEA 2Z3KA 1Z4RA 4FD7A 4JXRA 3F5BA 2Q44A 3N7ZA 4KUBA 5IB0A 4CS0B 2OZHA 3S6HA 3P2HA 1VKCA 2Q04A 3FXTA 4JLYA 4LX9A 4QVTA 4U9YA 2Q7BA 3TFYA 4JD6A 3P2FA 3VWDA 4C7HA 4ONUA 3TO9A 2PQ8A 3D8PA 5KTAA 2P0WA 1GHEA 4KSAA 1NMTA 2JEVA 3WR7A 4EVYA 2ARHA 4ORFA 1XMTA 4GS4A 1SQHA 1Q2CA 2G3AA 5HMNA 3A9LA 4JXQA 2D4PA 2REFA 3EO4A 4QUSA 3ZJ0A 2A4NA 4C2XA 2FE7A 1M44A 2CNTA 5A27A 2QECA 3FIXA 4ZGYB 4H6ZA 4MFJA 5E96A 4A32A 2CNSA 1TIQA 3SXNA 4CGOA 5F49A 3E0KA 1M4GA 2Z0ZA 4CAEA 4E8OA 3G8WA 2Q4YA 3OWCA 3EXNA 2FL4A 1S7LA 2OB0A 5F47A 5H84A 5DWMA 4MFKA 4M85A 1YREA 3UY5A 3D2MA 4CGNA 2EVNA 4DNCA 3TTHA 3FRMA 1QSTA 1YVOA 2FCKA 2BSWA 4OLLA 5ISVA 2CNMA 4R9MA 2ZW4A 4JWPA 1UFHA 5CNPA 3W6XA 4NSQA 2BEIA 2Z3MA 2FXFA 1MJBA 1I1DA 4YRHA 1P0HA 1S7KA 5J8CA 4QBJA 4CGPA 4CYQA 4R3LA 1NSLA 3TCVA 4XPKA 1B87A 3I9SA 2VBQA 1XIXA 1L0CA 1BO4A 2B58A 4UCMA 5AG4A 1OZPA 3V8IA 2BUEA 3R1KA 4UCNA 4C2YA 2Z3PA 4B11A 3K9UA 4UWJA 4CAFA 1ZO0A 3KKWA 3R96A 1U6MA 4A31A 4QB9A 1B6BA 3FBUA 4PSXA 3T90A 3CXPA 4ZBGA 2O28A 1M1DA 1KUVA 4Y49B 3IU1A 1Q2DA 4KVOE 4RI1A 2ZXVA 4AVCA 4RS2A 2Y0MA 2B4DB 3EFAA 2Z3OA 2JLMA 1Y9WA 4B5PA 2FIAA 4HNXB 2PR1A 2HUZA 3B8GA 1YK3A 1Y7RA 3F8KA 5AG7A 5A28A 5J8FA 3IU2A 3JUWA 1S3ZA 4MFQA 4PV6A 2G3TA 4LUAA 3FYNA 2VXKA 3NE7A 4AG9A 5G22A 4CAWA 3RYOA 3S6GA 4UBRA 5F48A 4FD6A 4UFXA 1WK4A 1M4IA 2EUIA 4KUAA 4QC6A 1CM0A 2OZGA 1CJWA 3F0AA 5G1ZA 1M4DA 5AG5A 4R3KA 2PC1A 2NMTA 1LRZA 4C7IA 2R7HA 4CRYB 4CYNA 4L8AA 4C2ZA 1RXTA 4UA3A 3SHPA 3R9GA 1I21A 4IF5A 2I00A 1QSMA 4KSFA 1S7FA 1N71A 3S6FA 4U9ZA 3S6KA 4CGMA 2H5MA 1V0CA 1NE9A 5F46A 1P4NA 3TOAA 3MGDA 3T9YA 4A33A 2REEA 3JTKA 4UFVA 2HV2A 4Y49C 2RC4A 2DPTA 3CXQA 3GYAA 5KTDA 4B5OA 2J8MA 2Z3LA 5C82A 1XE4A 4HNWB 4HKFA 1J4JA 4KOXA 4FD5A 3ZZIA 2J8NA 3BLNA 2AE6A 1PU9A 4HNYB 4PK3A 2PSWA 2AJ6A 4XPDB 1QSRA 4KZTA 4KORA 5FVJA 4MHDA 5IX3A 2HQYA 4PK2A 2B4DA 1Z9UA 3QAHA 4NF1A 2Z11A 3BJ7A 2I79A 3H4QA 2B5GB 4BMHA 2J8RA 4I49A 4KOTA 4KOVA 4YFJA 4MBUA 1Z4EA 3PGPA 4KOYA 2B3UA 2Z10A 4MFZA 4F0XA 2Q4VA 2DXQA 1BOBA 3EY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B13 A;  4C68 A;  4B12 A;  2YNE A;  2WSA A;  3H5Z A;  4CAF A;  4CGM A;  4C2Y A;  4UCP A;  4A2Z A;  5AG7 A;  5A28 A;  4UFW A;  3IU2 A;  4C2X A;  2YNC A;  4A31 A;  4A30 A;  4CYO A;  4C7H A;  5AGE A;  5G1Z A;  5G21 A;  4A33 A;  5A27 A;  3JTK A;  5AG5 A;  4UFV A;  4B10 A;  4CGL A;  4CGN A;  4CGP A;  4CYQ A;  5AG6 A;  4CYP A;  5G22 A;  4C7I A;  4A32 A;  2YNC C;  3IU1 A;  3IWE A;  4UFX A;  4CGO A;  4CYN A;  4C2Z A;  4BBH A;  4UCM A;  4CAE A;  4B14 A;  5AG4 A;  4A95 A;  5G20 A;  2YND A;  2WUU A;  4UCN A;  4B11 A; 
#chains in the Genus database with same CATH topology
 3D3S A;  1KUX A;  4KVM E;  1DE4 C;  4MY3 A;  1JQG A;  4E2A A;  4JJX A;  3H8F A;  3I3G A;  1F57 A;  4EME A;  4NGM A;  3GB0 A;  3SXO A;  4NXY A;  4KLW A;  2R1I A;  5THW A;  4NFR A;  2OH1 A;  4MJ8 A;  3MRU A;  8CPA A;  5IV0 A;  2ZOG A;  3SI0 A;  1XMB A;  1IYK A;  1F2P A;  3GIU A;  1OBR A;  3PP9 A;  4KSI A;  4R6T A;  3BJ8 A;  2ZW7 A;  4NCZ A;  2FSR A;  4EWT A;  4MCQ A;  5KTC A;  3ISX A;  3GUX A;  1YLE A;  2Q0Y A;  4AVB A;  3TT2 A;  3S9M A;  1YR0 A;  3CZX A;  4B6Z A;  2YNC C;  3B7I A;  2PJ3 A;  3D7F A;  1ZLI A;  3DSB A;  3KR4 A;  5BWA B;  3S9L A;  3TOB A;  4XPL A;  4FD4 A;  1IID A;  4OC1 A;  2B3V A;  1Z8W A;  4IUS A;  3FB3 A;  4OC5 A;  4OC2 A;  4MY0 A;  3G3S A;  4J3G A;  1IIC A;  5G20 A;  1EE3 P;  2VQY A;  4A95 A;  1M4L A;  1BPN A;  4MFP A;  1Y7E A;  2Q7S A;  1S60 A;  3JVN A;  3IO1 A;  3LD2 A;  4A2Z A;  4KS9 A;  4P4J A;  1IB1 E;  2YNC A;  2B4B A;  4UWI A;  2RFH A;  4PXD A;  4JZ0 A;  1MJ9 A;  4MI4 A;  4IK2 A;  1YSJ A;  3IWG A;  4MHP A;  3KQX A;  2JDC A;  3LOD A;  4ZY2 A;  4A38 A;  2POK A;  4ZI6 A;  1PYT B;  4PSW A;  2G0B A;  1QSN A;  4KVX A;  4XNH B;  4TWE A;  3CXS A;  4NGR A;  4UEE A;  3IWE A;  3QNV A;  1TKF A;  4H6U A;  2GE3 A;  3TE4 A;  1CP6 A;  1YME A;  2PIZ A;  4XPD C;  5GCN A;  1ZLH A;  2PJ7 A;  4YU9 A;  3GY9 A;  5EBV A;  1LAM A;  5LYL A;  2BL1 A;  2YND A;  2ZEG A;  2WUU A;  3VWE A;  3ISZ A;  5KTD A;  4KLV A;  5LRK A;  3H5Z A;  2PRB A;  2HC9 A;  1KUY A;  2P6E A;  3V38 A;  1QSO A;  4R87 A;  3EC4 A;  3DR8 A;  4MFL A;  2G9D A;  1Y0R A;  5EC4 A;  1AUG A;  4DJL A;  1VHE A;  5J1Q A;  1GYT A;  1VHS A;  4R57 A;  5JQ4 A;  1K4J A;  2VI7 A;  3FMC A;  1XF8 A;  3H8G A;  4UF4 A;  1LOK A;  2FIW A;  3IEH A;  4MCP A;  3TO7 A;  2PVV A;  2VZZ A;  4G1P A;  3LAC A;  2VEZ A;  2B5G A;  3NE8 A;  4ZY1 A;  3DDD A;  3WC6 A;  2Z3N A;  1R57 A;  4B14 A;  3JRU A;  1LAP A;  2PDO A;  2PJ1 A;  3GLJ A;  2WPX A;  4LQG A;  3RAM A;  3W91 A;  2QML A;  4CPA A;  4B12 A;  1MJA A;  5LRG A;  2V8G A;  1ON0 A;  4X5K A;  3R9E A;  3LMS A;  1WWZ A;  2P6G A;  1RTQ A;  1Y9K A;  2OU2 A;  4CYO A;  5G21 A;  2I3C A;  3FNC A;  4B5P B;  2EWB A;  4CRZ B;  2DPS A;  3IGR A;  1HEE A;  2O4H A;  4KOU A;  4CGL A;  2CY2 A;  4EFD A;  5ELY A;  4MRI A;  2DF5 A;  3QB8 A;  2FS5 A;  4CYP A;  1IGB A;  3KHX A;  3VH9 A;  4M3S A;  2V77 A;  3SJX A;  3C26 A;  4X3R A;  3SI1 A;  4DYO A;  4MCR A;  4OME A;  3TO6 A;  1I12 A;  2XEJ A;  2X7B A;  2GIV A;  2CTB A;  2PR8 A;  4Q36 A;  3RO0 A;  4AG7 A;  1TKH A;  1XEB A;  4WWV A;  2R98 A;  3PB8 X;  3WC5 A;  3BI0 A;  1Q2Y A;  2YNE A;  2WSA A;  4C2Y A;  4UFW A;  2CTC A;  2VZY A;  4KOS A;  4A30 A;  2GRE A;  4AVA A;  2R8V A;  3DR6 A;  1RO5 A;  1FT7 A;  4NEX A;  4XNH C;  1BLL E;  2OZU A;  4K30 A;  1F2O A;  2IL4 A;  3PRT A;  4P4E A;  2F5I A;  2QIR A;  4PXC A;  1TF8 A;  4AB7 A;  2XEI A;  2YGW A;  4UIB A;  1YGH A;  2QJ8 A;  2XEG A;  3GKR A;  1KZF A;  2K5T A;  2PIY A;  4CAV A;  4GXH A;  5H86 A;  5K8N A;  1Y0Y A;  2C27 A;  1FNO A;  4P4B A;  2ZW6 A;  1ZG8 A;  1A2Z A;  2WPW A;  4BBH A;  2ZW5 A;  4K3N A;  1KWM A;  2EO8 A;  3D2P A;  2ATR A;  4OAD A;  1MK4 A;  3D4U A;  4II9 A;  2FT0 A;  2CXA A;  1VGY A;  5HH1 A;  4C68 A;  1IY7 A;  4MHZ A;  1S5K A;  2GAN A;  4U5Y A;  4UCP A;  1PUA A;  2WZN A;  3KL9 A;  1S7N A;  4KOW A;  4YGO A;  1BPM A;  1IYL A;  2GLJ A;  3B3C A;  3KQZ A;  3W6S A;  4P45 A;  3SJG A;  4CAX A;  3B3T A;  1CX8 A;  2BCO A;  1YVK A;  3IWW A;  2KCW A;  5K8O A;  3DNS A;  2XEF A;  4ONW A;  5AG6 A;  4A39 A;  4L89 A;  4F6A A;  5JPH A;  3V7Z A;  2ZPA A;  3HUV A;  4ZYQ A;  5DWN A;  2JDD A;  2QYV A;  4E0A A;  3PZJ A;  2EK8 A;  2F8H A;  4AXV A;  5JM6 A;  1YX0 A;  1TXR A;  2PVW A;  3BHX A;  2D4O A;  5C88 A;  1IOI A;  3MN8 A;  4B13 A;  3B3S A;  4Q38 A;  4P4I A;  3FF3 A;  5I0C A;  3SJE A;  4H89 A;  4F0Y A;  1FY7 A;  2PJA A;  2ZEN A;  2DEA A;  2PCU A;  5AGE A;  3R9F A;  1CBX A;  2P6F A;  3R95 A;  4B10 A;  3FJU A;  3NH8 A;  1X10 A;  2Z3K A;  3NH5 A;  4OAE A;  3I1U A;  1Z4R A;  1QQ9 A;  5CPA A;  4FD7 A;  4R76 A;  4JXR A;  3RBU A;  3N5F A;  1LCP A;  3F5B A;  2Q44 A;  3B3W A;  1ARL A;  1R43 A;  3N7Z A;  4KUB A;  4CS0 B;  5IB0 A;  1ARM A;  2OZH A;  3FH4 A;  3S6H A;  3P2H A;  1VKC A;  2Q04 A;  2WYR A;  1QMU A;  3FXT A;  4JLY A;  4LX9 A;  4QVT A;  1LAN A;  4U9Y A;  2Q7B A;  3PB7 X;  4MHY A;  2ZEL A;  3TFY A;  1LFW A;  1XRY A;  4M6G A;  3DGV A;  4JD6 A;  3PFE A;  3P2F A;  3VWD A;  3VAR A;  2PJ4 A;  2ZED A;  4C7H A;  4MCS A;  4FBE A;  4ONU A;  3TO9 A;  3D67 A;  5LYD A;  1YLO A;  2PQ8 A;  4OC4 A;  4YWY A;  3D8P A;  3TC8 A;  5KTA A;  4OID A;  2P0W A;  1CP7 A;  2V8D A;  1CG2 A;  1GHE A;  1VIX A;  1NMT A;  2AFZ A;  2JEV A;  2V8V A;  3B2Y A;  4KSA A;  2ANP A;  2ZEH A;  3WR7 A;  2ARH A;  1CPX A;  4ORF A;  4OC0 A;  1XMT A;  2ZEO A;  3PEI A;  4GS4 A;  4F8Z A;  1SQH A;  1Q2C A;  2G3A A;  3PBE A;  5HMN A;  3A9L A;  4JXQ A;  2D4P A;  1AMP A;  2REF A;  3EO4 A;  3IC1 A;  5LYF A;  4QUS A;  3ZJ0 A;  2A4N A;  2EBJ A;  4C2X A;  2ABZ A;  2FE7 A;  1M44 A;  2CNT A;  5A27 A;  2BOA A;  3L2N A;  2QEC A;  3FIX A;  4ZGY B;  2QVP A;  4Z65 A;  4H6Z A;  4MFJ A;  3S9N A;  2AFU A;  3K2K A;  5E96 A;  4A32 A;  2JBK A;  2CNS A;  2PJ9 A;  1HDQ A;  5CBM A;  4DUK A;  1TIQ A;  3LWU A;  3SXN A;  4CGO A;  5F49 A;  3WAB A;  3E0K A;  1M4G A;  4P4F A;  2PJB A;  2Z0Z A;  4CAE A;  4E8O A;  3G8W A;  2Q4Y A;  3OWC A;  3EXN A;  4P44 A;  2FL4 A;  1S7L A;  3FVL A;  2OB0 A;  5F47 A;  5H84 A;  5DWM A;  3B35 A;  2ZEP A;  4MFK A;  4NGP A;  4M85 A;  5D8N A;  2J9A A;  2ZOF A;  5HVF A;  1YRE A;  3PFO A;  3D2M A;  3UY5 A;  4CGN A;  1Z8L A;  1BAV A;  2EVN A;  1HDU A;  4DNC A;  3TTH A;  2F7V A;  3FRM A;  5DS0 A;  1QST A;  2CF4 A;  3FEE A;  1IOF A;  1YVO A;  2C6G A;  2FCK A;  2BSW A;  2PJ6 A;  3FED A;  4OLL A;  5ISV A;  3BI1 A;  2IQ6 A;  1DTD A;  2CNM A;  2Q51 A;  2C1C A;  4R9M A;  4IAV A;  3KZW A;  2ZW4 A;  4JWP A;  4F9U A;  1XBU A;  2ZEF A;  1UFH A;  2PRQ A;  1YW6 A;  4P4D A;  4NSQ A;  5CNP A;  3W6X A;  2BEI A;  2Z3M A;  2FXF A;  4M6H A;  3TX8 A;  1H8L A;  1MJB A;  1TF9 A;  2OR4 A;  4UIA A;  2Q43 A;  1I1D A;  4NGS A;  2BO9 A;  1CPS A;  4YRH A;  4MXU A;  1P0H A;  1S7K A;  5HVG A;  4QBJ A;  5J8C A;  4IHM A;  4CGP A;  4CYQ A;  4HPS A;  3D66 A;  3HLP A;  2Q4Z A;  2C6P A;  4R3L A;  1NSL A;  3TCV A;  4XPK A;  1B87 A;  4MMO A;  2OOT A;  3I9S A;  2VBQ A;  1YQE A;  1XIX A;  1L0C A;  1BO4 A;  2B58 A;  4UCM A;  5AG4 A;  1OZP A;  4NJQ A;  4OP4 A;  1JWQ A;  3V8I A;  2BUE A;  3R1K A;  4OC3 A;  4UEZ A;  2Z3P A;  1YW4 A;  4UCN A;  4A94 A;  4B11 A;  3K9U A;  4UWJ A;  4CAF A;  5I4M A;  1ZO0 A;  5HXD A;  3PB9 X;  2EK9 A;  4GM5 A;  3KKW A;  3R96 A;  1U6M A;  4A31 A;  5LYI A;  1Z2L A;  4QB9 A;  3NFZ A;  4M6I A;  1B6B A;  3FBU A;  4PSX A;  3T90 A;  5IB9 A;  3CXP A;  4ZBG A;  5JGF A;  2O28 A;  1M1D A;  1KUV A;  2VL1 A;  2FVG A;  4X2T A;  4Y49 B;  3RZA A;  3IU1 A;  1Q2D A;  4KVO E;  4RI1 A;  2ZXV A;  3SI2 A;  4AVC A;  4RS2 A;  2Y0M A;  4X8I A;  3NH4 A;  2B4D B;  2Z3O A;  2JLM A;  3EFA A;  1Y9W A;  3WT4 A;  4A37 A;  1AYE A;  1Z8T A;  1PCA A;  4WJB A;  4B5P A;  2FIA A;  4HNX B;  1ZG7 A;  4P6Y A;  3IIB A;  2PR1 A;  4RUH A;  2HUZ A;  3B8G A;  3D7D A;  4PQA A;  4UEF A;  1YK3 A;  1Y7R A;  3F8K A;  4R7M A;  5AG7 A;  4PXE A;  5A28 A;  5J8F A;  1Z5R A;  3IU2 A;  3JUW A;  4NJR A;  1S3Z A;  3PB4 X;  4F9V A;  2NSM A;  4MFQ A;  3CT9 A;  1TKJ A;  3B3V A;  2PJ5 A;  4PV6 A;  2G3T A;  4LUA A;  3FYN A;  2VXK A;  3NE7 A;  4AG9 A;  3IFE A;  5G22 A;  4CAW A;  2HB6 A;  3RYO A;  3S6G A;  4UBR A;  4H2K A;  3H8E A;  1ELL P;  5F48 A;  4FD6 A;  4UFX A;  1XFO A;  2CIJ A;  4EVY A;  2ZEM A;  3K9T A;  1WK4 A;  3T8W A;  4ZX9 A;  1M4I A;  2EUI A;  4KUA A;  4QC6 A;  5EMI A;  5D29 A;  4NGT A;  1CM0 A;  2IMO A;  4MHN A;  2OZG A;  3RNZ A;  1CJW A;  2PJ2 A;  3F0A A;  3FEC A;  2NYQ A;  1M4D A;  5G1Z A;  5LRJ A;  2ZEE A;  5AG5 A;  4R3K A;  2PC1 A;  4NGQ A;  6CPA A;  2NMT A;  1LRZ A;  1XJO A;  3KAS A;  2RB7 A;  4C7I A;  3CDX A;  1R3N A;  3WC7 A;  2R7H A;  7CPA A;  4LQ6 A;  4CRY B;  1XOV A;  3KR5 A;  1IU8 A;  3SJF A;  4CYN A;  4L8A A;  4JYW A;  4C2Z A;  1RXT A;  2JBJ A;  2ODF A;  3CPX A;  4Q7A A;  4UA3 A;  3KHZ A;  3R9G A;  2C6C A;  2PJ0 A;  3SHP A;  2PJ8 A;  1I21 A;  4IF5 A;  2I00 A;  1QSM A;  1ZG9 A;  4KSF A;  4PPZ A;  1S7F A;  3FX6 A;  1N71 A;  3NA6 A;  3DLJ A;  3S6F A;  4FAI A;  4U9Z A;  3S6K A;  4CGM A;  2H5M A;  1V0C A;  1NE9 A;  5F46 A;  4ZX8 A;  1UWY A;  1P4N A;  3D7G A;  3TOA A;  2JEW A;  4NGN A;  3MGD A;  4FWU A;  4RN7 A;  3T9Y A;  2REE A;  2AFS A;  4A33 A;  5K8P A;  3JTK A;  4UFV A;  2HV2 A;  4PXB A;  4Y49 C;  2PE3 A;  2RC4 A;  2DPT A;  3CXQ A;  3GYA A;  3KGQ A;  4R8F A;  2J8M A;  2Z3L A;  3PBB A;  4B5O A;  1Z8X A;  5C82 A;  1XE4 A;  3CPA A;  4HNW B;  4OIW A;  3KI9 A;  4BIN A;  4HKF A;  2AFM A;  5HVH A;  1J4J A;  2PJC A;  2AFX A;  4KOX A;  1X12 A;  2GLF A;  3D68 A;  1NSA A;  2O53 A;  4FD5 A;  3QAY A;  3ZZI A;  1ELM P;  4BD9 A;  2J8N A;  3BLN A;  4ZY0 A;  2AE6 A;  1PU9 A;  3D7H A;  4HNY B;  3VAT A;  4PK3 A;  2PSW A;  2AJ6 A;  4OKO A;  2AFW A;  4XPD B;  1QSR A;  4KZT A;  4KOR A;  5FVJ A;  4MHD A;  4P10 A;  5IX3 A;  2HQY A;  2IJZ A;  4O23 A;  4W9Y A;  4PK2 A;  2B4D A;  1Z9U A;  3PB6 X;  3QAH A;  4NF1 A;  1VHO A;  3BXM A;  2Z11 A;  3BJ7 A;  2AFO A;  2I79 A;  3H4Q A;  2B5G B;  4BMH A;  2J8R A;  4I49 A;  4KOT A;  5F09 A;  4KOV A;  4YFJ A;  4MBU A;  2GU2 A;  4FUU A;  1Z4E A;  1Q7L A;  2GFQ A;  2V8H A;  3PGP A;  4KOY A;  2B3U A;  2Z10 A;  4MFZ A;  4F0X A;  5JH9 A;  2Q4V A;  4TNU A;  2DXQ A;  5K8M A;  1BOB A;  3IJ3 A;  3EY5 A; 
#chains in the Genus database with same CATH homology
 3D3S A;  1KUX A;  4KVM E;  4MY3 A;  4E2A A;  4JJX A;  3I3G A;  4NXY A;  4KLW A;  2R1I A;  2OH1 A;  4MJ8 A;  5IV0 A;  1IYK A;  3PP9 A;  3SXO A;  3BJ8 A;  2ZW7 A;  4NCZ A;  2FSR A;  5KTC A;  1YLE A;  2Q0Y A;  4AVB A;  3TT2 A;  1YR0 A;  2YNC C;  3DSB A;  5BWA B;  3TOB A;  4XPL A;  4FD4 A;  1IID A;  2B3V A;  4IUS A;  3FB3 A;  4MY0 A;  3G3S A;  4J3G A;  1IIC A;  5G20 A;  2VQY A;  4A95 A;  4MFP A;  1S60 A;  3JVN A;  3LD2 A;  4A2Z A;  4KS9 A;  1IB1 E;  2YNC A;  2B4B A;  4UWI A;  1MJ9 A;  4MI4 A;  3IWG A;  2JDC A;  3LOD A;  4PSW A;  2G0B A;  1QSN A;  4KVX A;  4XNH B;  3CXS A;  3IWE A;  4H6U A;  2GE3 A;  3TE4 A;  4XPD C;  5GCN A;  3GY9 A;  5EBV A;  2BL1 A;  2YND A;  2WUU A;  3VWE A;  4KLV A;  3H5Z A;  2PRB A;  1KUY A;  2P6E A;  1QSO A;  4R87 A;  3EC4 A;  3DR8 A;  4MFL A;  5EC4 A;  1VHS A;  4R57 A;  5JQ4 A;  1K4J A;  2VI7 A;  1XF8 A;  2FIW A;  3TO7 A;  2VZZ A;  2VEZ A;  2B5G A;  3DDD A;  2Z3N A;  1R57 A;  4B14 A;  2PDO A;  2WPX A;  3W91 A;  2QML A;  4B12 A;  1MJA A;  1ON0 A;  4X5K A;  3R9E A;  1WWZ A;  2P6G A;  1Y9K A;  2OU2 A;  4CYO A;  5G21 A;  3FNC A;  4B5P B;  4CRZ B;  2DPS A;  3IGR A;  4KOU A;  4CGL A;  2CY2 A;  3QB8 A;  2FS5 A;  4CYP A;  4M3S A;  3C26 A;  3TO6 A;  1I12 A;  4Q36 A;  2X7B A;  2GIV A;  2PR8 A;  4AG7 A;  1XEB A;  2R98 A;  1Q2Y A;  2YNE A;  2WSA A;  4UFW A;  2VZY A;  4KOS A;  4A30 A;  4AVA A;  2R8V A;  3DR6 A;  1RO5 A;  4NEX A;  4XNH C;  2OZU A;  4K30 A;  2IL4 A;  4AB7 A;  2F5I A;  2QIR A;  2YGW A;  1YGH A;  3GKR A;  1KZF A;  2K5T A;  4CAV A;  5H86 A;  2C27 A;  2ZW6 A;  2WPW A;  4BBH A;  2ZW5 A;  4OAD A;  3D2P A;  2ATR A;  1MK4 A;  4II9 A;  2FT0 A;  2CXA A;  5HH1 A;  4C68 A;  1S5K A;  2GAN A;  4U5Y A;  4UCP A;  1PUA A;  4KOW A;  1S7N A;  4YGO A;  1IYL A;  3W6S A;  4CAX A;  1YVK A;  2KCW A;  3DNS A;  5AG6 A;  4L89 A;  4F6A A;  5JPH A;  2ZPA A;  5DWN A;  2JDD A;  4E0A A;  3PZJ A;  1YX0 A;  2D4O A;  5C88 A;  4B13 A;  4Q38 A;  5I0C A;  4F0Y A;  4H89 A;  1FY7 A;  5AGE A;  3R9F A;  2P6F A;  3R95 A;  4B10 A;  4OAE A;  2Z3K A;  1Z4R A;  4FD7 A;  4JXR A;  3F5B A;  2Q44 A;  3N7Z A;  4KUB A;  5IB0 A;  4CS0 B;  2OZH A;  3S6H A;  3P2H A;  1VKC A;  2Q04 A;  3FXT A;  4JLY A;  4LX9 A;  4QVT A;  4U9Y A;  2Q7B A;  3TFY A;  4JD6 A;  3P2F A;  3VWD A;  4C7H A;  4ONU A;  3TO9 A;  2PQ8 A;  3D8P A;  5KTA A;  2P0W A;  1GHE A;  4KSA A;  1NMT A;  2JEV A;  3WR7 A;  4EVY A;  2ARH A;  4ORF A;  1XMT A;  4GS4 A;  1SQH A;  1Q2C A;  2G3A A;  5HMN A;  3A9L A;  4JXQ A;  2D4P A;  2REF A;  3EO4 A;  4QUS A;  3ZJ0 A;  2A4N A;  4C2X A;  2FE7 A;  1M44 A;  2CNT A;  5A27 A;  2QEC A;  3FIX A;  4ZGY B;  4H6Z A;  4MFJ A;  5E96 A;  4A32 A;  2CNS A;  1TIQ A;  3SXN A;  4CGO A;  5F49 A;  3E0K A;  1M4G A;  2Z0Z A;  4CAE A;  4E8O A;  3G8W A;  2Q4Y A;  3OWC A;  3EXN A;  2FL4 A;  1S7L A;  2OB0 A;  5F47 A;  5H84 A;  5DWM A;  4MFK A;  4M85 A;  1YRE A;  3UY5 A;  3D2M A;  4CGN A;  2EVN A;  4DNC A;  3TTH A;  3FRM A;  1QST A;  1YVO A;  2FCK A;  2BSW A;  4OLL A;  5ISV A;  2CNM A;  4R9M A;  2ZW4 A;  4JWP A;  1UFH A;  5CNP A;  3W6X A;  4NSQ A;  2BEI A;  2Z3M A;  2FXF A;  1MJB A;  1I1D A;  4YRH A;  1P0H A;  1S7K A;  5J8C A;  4QBJ A;  4CGP A;  4CYQ A;  4R3L A;  1NSL A;  3TCV A;  4XPK A;  1B87 A;  3I9S A;  2VBQ A;  1XIX A;  1L0C A;  1BO4 A;  2B58 A;  4UCM A;  5AG4 A;  1OZP A;  3V8I A;  2BUE A;  3R1K A;  4UCN A;  4C2Y A;  2Z3P A;  4B11 A;  3K9U A;  4UWJ A;  4CAF A;  1ZO0 A;  3KKW A;  3R96 A;  1U6M A;  4A31 A;  4QB9 A;  1B6B A;  3FBU A;  4PSX A;  3T90 A;  3CXP A;  4ZBG A;  2O28 A;  1M1D A;  1KUV A;  4Y49 B;  3IU1 A;  1Q2D A;  4KVO E;  4RI1 A;  2ZXV A;  4AVC A;  4RS2 A;  2Y0M A;  2B4D B;  3EFA A;  2Z3O A;  2JLM A;  1Y9W A;  4B5P A;  2FIA A;  4HNX B;  2PR1 A;  2HUZ A;  3B8G A;  1YK3 A;  1Y7R A;  3F8K A;  5AG7 A;  5A28 A;  5J8F A;  3IU2 A;  3JUW A;  1S3Z A;  4MFQ A;  4PV6 A;  2G3T A;  4LUA A;  3FYN A;  2VXK A;  3NE7 A;  4AG9 A;  5G22 A;  4CAW A;  3RYO A;  3S6G A;  4UBR A;  5F48 A;  4FD6 A;  4UFX A;  1WK4 A;  1M4I A;  2EUI A;  4KUA A;  4QC6 A;  1CM0 A;  2OZG A;  1CJW A;  3F0A A;  5G1Z A;  1M4D A;  5AG5 A;  4R3K A;  2PC1 A;  2NMT A;  1LRZ A;  4C7I A;  2R7H A;  4CRY B;  4CYN A;  4L8A A;  4C2Z A;  1RXT A;  4UA3 A;  3SHP A;  3R9G A;  1I21 A;  4IF5 A;  2I00 A;  1QSM A;  4KSF A;  1S7F A;  1N71 A;  3S6F A;  4U9Z A;  3S6K A;  4CGM A;  2H5M A;  1V0C A;  1NE9 A;  5F46 A;  1P4N A;  3TOA A;  3MGD A;  3T9Y A;  4A33 A;  2REE A;  3JTK A;  4UFV A;  2HV2 A;  4Y49 C;  2RC4 A;  2DPT A;  3CXQ A;  3GYA A;  5KTD A;  4B5O A;  2J8M A;  2Z3L A;  5C82 A;  1XE4 A;  4HNW B;  4HKF A;  1J4J A;  4KOX A;  4FD5 A;  3ZZI A;  2J8N A;  3BLN A;  2AE6 A;  1PU9 A;  4HNY B;  4PK3 A;  2PSW A;  2AJ6 A;  4XPD B;  1QSR A;  4KZT A;  4KOR A;  5FVJ A;  4MHD A;  5IX3 A;  2HQY A;  4PK2 A;  2B4D A;  1Z9U A;  3QAH A;  4NF1 A;  2Z11 A;  3BJ7 A;  2I79 A;  3H4Q A;  2B5G B;  4BMH A;  2J8R A;  4I49 A;  4KOT A;  4KOV A;  4YFJ A;  4MBU A;  1Z4E A;  3PGP A;  4KOY A;  2B3U A;  2Z10 A;  4MFZ A;  4F0X A;  2Q4V A;  2DXQ A;  1BOB A;  3EY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...