4C7HA

Leismania major n-myristoyltransferase in complex with a peptidomimetic (-nh2) molecule
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Peptidomimetic Inhibitors of N-Myristoyltransferase from Human Malaria and Leishmaniasis Parasites.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 123
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4c7hA00
4B14A 4C7IA 4BBHA 4UCNA 5G20A 5AGEA 4CGPA 4C2YA 5AG4A 2YNEA 4B12A 4CAEA 4CYOA 3IU1A 2WUUA 4CYQA 4A30A 4B13A 4CGMA 5A27A 4UFWA 4A32A 4B10A 5G1ZA 4CGLA 4CYNA 4UCPA 4UFXA 2WSAA 2YNCC 4A95A 3JTKA 4C2ZA 4CGOA 5G22A 5AG5A 4B11A 3IWEA 2YNCA 4CGNA 3H5ZA 4UCMA 5AG6A 5G21A 4C7HA 4C68A 4A33A 2YNDA 4A2ZA 4C2XA 4A31A 4CYPA 5A28A 4CAFA 4UFVA 3IU2A 5AG7A
chains in the Genus database with same CATH superfamily
4TWEA 4UBRA 4AB7A 5G20A 2Q7BA 2JEVA 3G3SA 4B12A 4UIBA 4OP4A 2WUUA 3BI0A 1ON0A 2YGWA 2AFUA 2PJ8A 2Q43A 3DNSA 3KKWA 2OOTA 3NFZA 3SJFA 1Z4EA 2CTBA 4X5KA 2NSMA 4B6ZA 2BOAA 2GE3A 2JBJA 4B5OA 4HKFA 2YNCC 2PJ1A 4R9MA 4ONUA 1CM0A 4KOUA 2PR8A 3GY9A 4JZ0A 4MFPA 2PRQA 3IWGA 5J8CA 1LOKA 3PB9X 3DGVA 1VHSA 1S60A 4L8AA 2AFXA 1XIXA 4PV6A 4MCSA 1QSTA 5G21A 5K8PA 2ZEGA 2B4DA 3EY5A 4IF5A 1QSOA 2POKA 1KUVA 3NH4A 2DXQA 2GLJA 4QC6A 5F47A 2Z0ZA 4F0YA 4R76A 1YSJA 3FRMA 5CPAA 5G1ZA 1YVKA 1M44A 3K9UA 3QNVA 3VWEA 2DEAA 1MJBA 3FXTA 5F09A 3SHPA 4KOYA 1U6MA 1RO5A 1XMTA 5EBVA 4PSXA 4MHNA 2PSWA 3NE7A 3RO0A 3JVNA 2ZEHA 3FNCA 4A30A 3PGPA 2ANPA 3GYAA 3PFEA 4H6ZA 4BMHA 2F7VA 5KTAA 2PJ4A 5IB0A 1Q2CA 3BI1A 5H84A 2PR1A 2P0WA 1VHEA 3IGRA 5JM6A 4OKOA 4P45A 1M4IA 4CAXA 2JBKA 3I9SA 3D66A 2NYQA 3DLJA 3WC6A 2ZOGA 1CBXA 2HC9A 1M1DA 2DPSA 2ODFA 2HV2A 2B4BA 2FL4A 2ZXVA 4MRIA 4NJQA 4A33A 1IY7A 4F9UA 1HDUA 4I49A 3TOBA 1YVOA 4UA3A 2CIJA 1CPXA 1Q7LA 2PIYA 4NXYA 3L2NA 4BBHA 2GU2A 1XE4A 3V8IA 2GREA 3R95A 1M4DA 4XPDC 4Q38A 1Y9KA 2PQ8A 2AFZA 1TF8A 2ZEPA 3T8WA 1P4NA 4ZY1A 2Z3NA 2P6GA 2ZENA 1IOIA 4ONWA 2FIAA 2D4PA 3NA6A 2FSRA 3H8FA 2J8NA 2OZHA 2Z3LA 4M85A 2BL1A 4C2ZA 2PJ6A 1LAMA 5EC4A 4FAIA 4Z65A 3D7HA 3SXNA 4R3LA 2ZW5A 3GB0A 4X8IA 4R57A 5THWA 3KR5A 3LACA 3NH5A 4R87A 5C82A 2AFWA 4C7HA 5JGFA 4DYOA 2YNDA 4M6IA 2WYRA 2Z3PA 1ARMA 1DTDA 2VBQA 4MFZA 4UEFA 2HQYA 3ZZIA 1ARLA 4F0XA 1XRYA 4UCNA 4UWIA 4ZBGA 5AGEA 1IIDA 2EK9A 2PE3A 4XPDB 3B3CA 2A4NA 4A38A 4CYQA 3LODA 4FWUA 4K30A 5IV0A 4CPAA 3S9NA 3PP9A 2Z10A 1FT7A 4KZTA 3IFEA 1FY7A 2AJ6A 1CJWA 3OWCA 2K5TA 3S9MA 3B35A 4G1PA 3VH9A 4CGOA 2XEGA 4FD4A 4JWPA 5EMIA 4P4JA 5HMNA 1X10A 4OAEA 4C2XA 2OU2A 3B3TA 3WABA 2ZW4A 1K4JA 1HEEA 3TO9A 2JLMA 1AUGA 3PFOA 4QVTA 4LUAA 4OIDA 1ZLHA 4X2TA 3SJGA 2GIVA 4CAEA 4NFRA 2PC1A 2PVVA 2FCKA 4OC3A 1I1DA 4ZI6A 5IB9A 1DE4C 1Q2DA 2R7HA 4OC0A 4EMEA 4ZY0A 2ZW7A 2HB6A 2Z11A 1ZLIA 2PCUA 4KLVA 4RI1A 2P6EA 1YREA 4AVCA 4AVBA 3FB3A 1Y9WA 1SQHA 2RFHA 3VATA 4MMOA 4F9VA 1WWZA 5F49A 1RTQA 3CPAA 4MCQA 3IWEA 3WC7A 3H5ZA 4KVME 3B7IA 5LYFA 2VZYA 2OZUA 3D8PA 4B5PA 1PU9A 2PJ3A 3FJUA 3IO1A 4KVXA 2AFSA 3UY5A 2C1CA 1CPSA 4JD6A 4YRHA 1TKJA 4F8ZA 3KR4A 4MI4A 2OB0A 5JPHA 2PJ5A 2ZEMA 4LQGA 4P6YA 4PSWA 4P4BA 5CBMA 4DUKA 3PB4X 2PJ7A 2J8RA 1CP7A 2Z3KA 3V7ZA 4KLWA 1HDQA 1XJOA 3N7ZA 5J8FA 4A95A 1KWMA 2WPWA 3S6GA 4EVYA 4RUHA 3ZJ0A 1YGHA 1B87A 2WPXA 3KQZA 3TC8A 4EFDA 4B11A 3W6XA 3EC4A 1MJ9A 2QECA 5K8NA 3KI9A 2CNSA 1Y0YA 2Q51A 4KS9A 4P4FA 4CAVA 3A9LA 1JWQA 1Z8WA 4A2ZA 4P4EA 4Q36A 1LAPA 4MFQA 4RS2A 4UFVA 4XPLA 5D29A 4IAVA 2G0BA 2QMLA 4JXQA 5AG4A 3R96A 3FECA 2Q4YA 3B3VA 1VGYA 1AMPA 3BJ8A 5F48A 2V77A 2F8HA 1ZG7A 1S7LA 5D8NA 5K8MA 4Q7AA 4CGLA 4OC4A 1NE9A 2Q44A 4FD7A 1VHOA 2BUEA 3PB8X 3JTKA 2FE7A 4P44A 4M6GA 3RBUA 1LFWA 1Y7EA 2OR4A 3PEIA 4MHYA 3D67A 3BLNA 5LRJA 3GLJA 3GKRA 2HUZA 1OBRA 4P4DA 2B3UA 4YFJA 3ISXA 4J3GA 1MK4A 1XOVA 2B3VA 4UWJA 2QVPA 2YNCA 3PB6X 2ZELA 3C26A 1YK3A 3EFAA 3EXNA 3CXSA 2FXFA 2VZZA 4AVAA 4A94A 4OC1A 4F6AA 1M4GA 1BOBA 1M4LA 3EO4A 5ISVA 4KOVA 4MCPA 2CF4A 4QBJA 3B8GA 3CDXA 2PJ9A 4H6UA 5A27A 4NSQA 2B58A 4XPKA 3RNZA 1QSMA 3B2YA 4YU9A 4XNHC 4AG7A 3PBBA 2PDOA 3WC5A 3KZWA 7CPAA 5DWNA 1TXRA 1ZG9A 2DF5A 1NSLA 2REEA 2Q04A 3D4UA 3SJXA 4PK2A 3TCVA 3TTHA 2VEZA 4A37A 2KCWA 3D7GA 3D7DA 3H8GA 3JRUA 2AE6A 2VXKA 2Q4VA 1S7FA 4MCRA 3T9YA 4KSIA 4U9YA 4NGNA 1LCPA 3KHXA 4FD5A 4O23A 4KUBA 4RN7A 4U5YA 4KOXA 4NGTA 3HUVA 3TOAA 3TO6A 2QIRA 5CNPA 4E8OA 2ZEFA 1VKCA 3F8KA 2OH1A 4B10A 5C88A 2PJ2A 4PPZA 4XNHB 1S3ZA 5HVFA 4ORFA 5AG5A 3G8WA 2ZOFA 1EE3P 4UCMA 1Z9UA 2EWBA 1QMUA 3NE8A 2XEIA 3BXMA 4C68A 2RB7A 3I1UA 2GANA 3H8EA 1Y7RA 1OZPA 3SI0A 2ATRA 5J1QA 4CRZB 3DR8A 4Y49C 3SJEA 4C2YA 4OLLA 4OMEA 3W6SA 4NGSA 2O53A 3TX8A 3P2FA 3FEDA 3PZJA 2ZW6A 1BPNA 4UIAA 4ZYQA 1XFOA 3KHZA 4QUSA 3I3GA 4UEEA 4CYNA 3K2KA 2R98A 4PK3A 4UEZA 1ZO0A 4GXHA 1ELMP 2O28A 4NGRA 3CXQA 1S5KA 3BJ7A 3F0AA 4NGMA 1PYTB 2B5GB 4WJBA 3TE4A 4NF1A 2FS5A 2NMTA 1R3NA 4NGPA 3SI1A 3V38A 2JEWA 1X12A 1Z8TA 1L0CA 3MRUA 4HPSA 5E96A 4MFLA 5BWAB 1Z2LA 3R9FA 4CAFA 3LMSA 4ZX8A 2V8HA 4C7IA 2PRBA 1KUYA 1YLOA 2Q4ZA 3FX6A 4PXCA 2YNEA 4Y49B 4PXDA 4GM5A 2J9AA 2PVWA 3LD2A 2XEFA 1S7KA 2ZEOA 4PXBA 3W91A 4AG9A 4JYWA 2I79A 4II9A 1IYLA 2I3CA 3BHXA 4UFWA 3FF3A 4KOTA 1YX0A 4M3SA 4UCPA 4UFXA 2WSAA 1TF9A 1F2PA 2C6PA 1XEBA 2PIZA 4K3NA 2EBJA 4CS0B 1MJAA 5FVJA 4CAWA 4DJLA 2C6CA 2D4OA 3MN8A 3IEHA 3IJ3A 4WWVA 3T90A 3JUWA 2O4HA 2JDDA 1VIXA 3VWDA 1AYEA 2J8MA 1IU8A 4FD6A 1PCAA 3TT2A 5IX3A 1PUAA 2Y0MA 4TNUA 4PQAA 5HH1A 3DSBA 1FNOA 2GLFA 3R1KA 5LYIA 5LRKA 2IMOA 4X3RA 5KTDA 3D3SA 6CPAA 2BCOA 4CGPA 4M6HA 4HNYB 1R43A 1V0CA 4HNXB 1YLEA 1I21A 2Z3OA 3E0KA 3CPXA 2RC4A 3FEEA 4B13A 5JH9A 2B4DB 1CG2A 1QSNA 3PB7X 3R9GA 3S6KA 3PRTA 4PXEA 5HVGA 5LYLA 1YR0A 4W9YA 1TIQA 4OC2A 3DR6A 2REFA 5LRGA 4A39A 1XF8A 3QB8A 4KSAA 5DWMA 2AFMA 4DNCA 5LYDA 3S6FA 2V8GA 4MHZA 1XBUA 3P2HA 2V8VA 1N71A 4NGQA 2ZEDA 4R3KA 1H8LA 1RXTA 5I4MA 2CXAA 4CRYB 2C6GA 2IL4A 4MFKA 4BINA 2ABZA 2IJZA 4IUSA 3KGQA 2IQ6A 2VQYA 2JDCA 3D2MA 3MGDA 4FBEA 4IK2A 4ZY2A 2H5MA 1BAVA 1Z5RA 3K9TA 4MXUA 2ZPAA 2BEIA 1LRZA 1F2OA 1KUXA 4HNWB 4MHDA 3R9EA 5HVHA 1WK4A 2BO9A 4GS4A 2PJBA 2BSWA 4IHMA 1NMTA 4JXRA 1YW4A 4NEXA 4MY0A 2X7BA 5GCNA 1Z4RA 4OADA 1GYTA 4E2AA 8CPAA 5F46A 2F5IA 2VI7A 1YMEA 5K8OA 2Z3MA 5A28A 2WZNA 4KVOE 1CX8A 2EO8A 3IU2A 4KUAA 5AG7A 4B14A 1ZG8A 2G9DA 3FMCA 1J4JA 4MY3A 3WT4A 1BPMA 1GHEA 2ZEEA 2Q0YA 2XEJA 4H89A 2FVGA 1KZFA 4KOSA 3S6HA 3IC1A 1CP6A 1A2ZA 2C27A 4FUUA 3RYOA 3D2PA 2EVNA 4JJXA 2CNMA 1QSRA 2AFOA 4R7MA 3SXOA 1Z8XA 4H2KA 4R6TA 3TO7A 3LWUA 2G3TA 3KQXA 4KORA 4QB9A 1LANA 1F57A 4KOWA 3TFYA 3D68A 5HXDA 5JQ4A 1R57A 1IB1E 1Z8LA 4MBUA 1Y0RA 2FT0A 1UFHA 2ARHA 4OC5A 3IU1A 1B6BA 1I12A 3GIUA 3IIBA 3KASA 3S9LA 5H86A 5I0CA 3B3WA 4LQ6A 3N5FA 1ELLP 2OZGA 1S7NA 3F5BA 2CTCA 4MJ8A 4U9ZA 4YWYA 4A32A 1NSAA 3DDDA 4P10A 3WR7A 1JQGA 3CT9A 4JLYA 4R8FA 4UF4A 4MHPA 1BO4A 4E0AA 3D7FA 5G22A 1QQ9A 2EUIA 3H4QA 3RAMA 2QYVA 3RZAA 4CGNA 2V8DA 3B3SA 4ZGYB 3FH4A 5ELYA 1TKHA 2P6FA 1IGBA 2PJAA 2Q7SA 2I00A 1IYKA 1IICA 4A31A 1YQEA 3SI2A 2B5GA 2PJCA 2VL1A 3IWWA 1UWYA 2QJ8A 2R1IA 3FYNA 4CYOA 4AXVA 4MFJA 5KTCA 2DPTA 4NCZA 2G3AA 4CGMA 3FBUA 1P0HA 3FIXA 4B5PB 2CNTA 4LX9A 3QAYA 1BLLE 4ZX9A 4KSFA 3PBEA 4BD9A 2EK8A 3NH8A 2PJ0A 3CXPA 1YW6A 3CZXA 3KL9A 4YGOA 1TKFA 2R8VA 3FVLA 3ISZA 4L89A 5AG6A 4EWTA 1Q2YA 2GFQA 4P4IA 1XMBA 3HLPA 3GUXA 3VARA 5DS0A 4NJRA 4OIWA 3QAHA 4CYPA 1IOFA 2FIWA 2CY2A
chains in the Genus database with same CATH topology
4UBRA 4AB7A 5G20A 2Q7BA 2JEVA 3G3SA 4B12A 2WUUA 1ON0A 2YGWA 3DNSA 3KKWA 1Z4EA 4X5KA 2GE3A 4B5OA 4HKFA 2YNCC 4R9MA 4ONUA 1CM0A 4KOUA 2PR8A 3GY9A 5J8CA 4MFPA 3IWGA 1VHSA 1S60A 4L8AA 1XIXA 4PV6A 1QSTA 5G21A 4IF5A 2B4DA 3EY5A 1QSOA 1KUVA 2DXQA 4QC6A 5F47A 2Z0ZA 4F0YA 3FRMA 5G1ZA 1YVKA 1M44A 3K9UA 3VWEA 3FXTA 1MJBA 3SHPA 4KOYA 1U6MA 1RO5A 1XMTA 5EBVA 4PSXA 2PSWA 3NE7A 3JVNA 3FNCA 4A30A 3PGPA 3GYAA 4H6ZA 4BMHA 5KTAA 5IB0A 1Q2CA 5H84A 2PR1A 2P0WA 3IGRA 1M4IA 4CAXA 3I9SA 1M1DA 2DPSA 2HV2A 2B4BA 2FL4A 2ZXVA 4A33A 4I49A 3TOBA 1YVOA 4UA3A 4NXYA 4BBHA 1XE4A 3V8IA 3R95A 1M4DA 4XPDC 4Q38A 1Y9KA 2PQ8A 1P4NA 2Z3NA 2P6GA 2FIAA 2D4PA 2FSRA 2J8NA 2OZHA 2Z3LA 4M85A 2BL1A 4C2ZA 5EC4A 3SXNA 4R3LA 2ZW5A 4R57A 4R87A 5C82A 4C7HA 2YNDA 2Z3PA 4MFZA 2VBQA 3ZZIA 2HQYA 4F0XA 4UCNA 4UWIA 4ZBGA 5AGEA 1IIDA 4XPDB 2A4NA 4CYQA 3LODA 5IV0A 4K30A 3PP9A 2Z10A 4KZTA 1FY7A 2AJ6A 1CJWA 3OWCA 2K5TA 4CGOA 4FD4A 4JWPA 5HMNA 4OAEA 4C2XA 2OU2A 2ZW4A 1K4JA 3TO9A 2JLMA 4QVTA 4LUAA 2GIVA 4CAEA 2PC1A 2FCKA 1I1DA 1Q2DA 2R7HA 2ZW7A 2Z11A 4KLVA 4RI1A 2P6EA 1YREA 4AVCA 4AVBA 3FB3A 1Y9WA 1SQHA 1WWZA 5F49A 3IWEA 3H5ZA 4KVME 2VZYA 2OZUA 2FIWA 3D8PA 4B5PA 1PU9A 4KVXA 3UY5A 4JD6A 4YRHA 4MI4A 2OB0A 5JPHA 4PSWA 2J8RA 2Z3KA 4KLWA 3N7ZA 5J8FA 4A95A 2WPWA 3S6GA 4EVYA 3ZJ0A 1YGHA 1B87A 2WPXA 4B11A 3W6XA 3EC4A 1MJ9A 2QECA 2CNSA 4KS9A 4CAVA 3A9LA 4A2ZA 4Q36A 4MFQA 4RS2A 4UFVA 4XPLA 2G0BA 2QMLA 4JXQA 5AG4A 3R96A 2Q4YA 3BJ8A 5F48A 1S7LA 4CGLA 1NE9A 2Q44A 4FD7A 2BUEA 3JTKA 2FE7A 3BLNA 3GKRA 2HUZA 2B3UA 4YFJA 4J3GA 1MK4A 2B3VA 4UWJA 2YNCA 3C26A 3EXNA 1YK3A 3EFAA 3CXSA 2FXFA 2VZZA 4AVAA 4F6AA 1M4GA 1BOBA 3EO4A 5ISVA 4KOVA 4QBJA 3B8GA 5A27A 4H6UA 4NSQA 2B58A 4XPKA 1QSMA 4XNHC 4AG7A 2PDOA 5DWNA 1NSLA 2REEA 2Q04A 4PK2A 3TCVA 3TTHA 2VEZA 2KCWA 2AE6A 2VXKA 2Q4VA 1S7FA 3T9YA 4U9YA 4FD5A 4KUBA 4U5YA 4KOXA 3TO6A 3TOAA 2QIRA 5CNPA 4E8OA 1VKCA 3F8KA 2OH1A 4B10A 5C88A 4XNHB 1S3ZA 4ORFA 5AG5A 3G8WA 4UCMA 1Z9UA 4C68A 2GANA 1Y7RA 1OZPA 2ATRA 4CRZB 3DR8A 4Y49C 4C2YA 4OLLA 3W6SA 3P2FA 2ZW6A 4QUSA 3I3GA 4CYNA 2R98A 4PK3A 1ZO0A 2O28A 3CXQA 1S5KA 3BJ7A 3F0AA 2B5GB 3TE4A 4NF1A 2FS5A 2NMTA 1L0CA 5E96A 4MFLA 5BWAB 3R9FA 4CAFA 4C7IA 2PRBA 1KUYA 2YNEA 4Y49B 3LD2A 3W91A 1S7KA 4AG9A 2I79A 4II9A 1IYLA 4UFWA 4KOTA 1YX0A 4M3SA 4UCPA 4UFXA 2WSAA 4CS0B 1XEBA 1MJAA 5FVJA 4CAWA 2D4OA 3T90A 3JUWA 2JDDA 3VWDA 2J8MA 4FD6A 3TT2A 5IX3A 1PUAA 2Y0MA 5HH1A 3DSBA 3R1KA 5KTDA 3D3SA 4CGPA 4HNYB 1V0CA 4HNXB 1YLEA 1I21A 2Z3OA 3E0KA 2RC4A 4B13A 2B4DB 1QSNA 3R9GA 3S6KA 1YR0A 1TIQA 3DR6A 2REFA 1XF8A 3QB8A 4KSAA 5DWMA 4DNCA 3S6FA 3P2HA 1N71A 4R3KA 1RXTA 2CXAA 4CRYB 2IL4A 4MFKA 4IUSA 2VQYA 3MGDA 2JDCA 3D2MA 2H5MA 2ZPAA 2BEIA 1LRZA 1KUXA 4HNWB 4MHDA 3R9EA 1WK4A 4GS4A 2BSWA 1NMTA 4JXRA 4NEXA 4MY0A 2X7BA 5GCNA 1Z4RA 4OADA 4E2AA 5F46A 2F5IA 2VI7A 2Z3MA 5A28A 4KVOE 3IU2A 4KUAA 5AG7A 4B14A 4MY3A 1J4JA 1GHEA 2Q0YA 4H89A 3S6HA 1KZFA 4KOSA 3RYOA 2C27A 3D2PA 2EVNA 4JJXA 2CNMA 1QSRA 3SXOA 3TO7A 2G3TA 4KORA 4QB9A 4KOWA 3TFYA 5JQ4A 1R57A 1IB1E 4MBUA 2FT0A 1UFHA 2ARHA 3IU1A 1I12A 1B6BA 5H86A 5I0CA 1S7NA 2OZGA 3F5BA 4MJ8A 4U9ZA 4A32A 3DDDA 3WR7A 4JLYA 1BO4A 4E0AA 5G22A 2EUIA 3H4QA 4CGNA 4ZGYB 2P6FA 2I00A 1IYKA 1IICA 4A31A 2B5GA 3FYNA 2R1IA 4CYOA 4MFJA 5KTCA 2DPTA 4NCZA 2G3AA 4CGMA 3FBUA 1P0HA 3FIXA 4B5PB 2CNTA 4LX9A 4KSFA 3CXPA 4YGOA 2R8VA 4L89A 5AG6A 1Q2YA 4CYPA 3QAHA 3PZJA 2CY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B14 A;  4C7I A;  4BBH A;  4UCN A;  5G20 A;  5AGE A;  4CGP A;  4C2Y A;  5AG4 A;  2YNE A;  4B12 A;  4CAE A;  4CYO A;  3IU1 A;  2WUU A;  4CYQ A;  4A30 A;  4B13 A;  4CGM A;  5A27 A;  4UFW A;  4A32 A;  4B10 A;  5G1Z A;  4CGL A;  4CYN A;  4UCP A;  4UFX A;  2WSA A;  2YNC C;  4A95 A;  3JTK A;  4C2Z A;  4CGO A;  5G22 A;  5AG5 A;  4B11 A;  3IWE A;  2YNC A;  4CGN A;  3H5Z A;  4UCM A;  5AG6 A;  5G21 A;  4C7H A;  4C68 A;  4A33 A;  2YND A;  4A2Z A;  4C2X A;  4A31 A;  4CYP A;  5A28 A;  4CAF A;  4UFV A;  3IU2 A;  5AG7 A; 
#chains in the Genus database with same CATH topology
 4TWE A;  4UBR A;  4AB7 A;  5G20 A;  2Q7B A;  2JEV A;  3G3S A;  4B12 A;  4UIB A;  4OP4 A;  2WUU A;  3BI0 A;  1ON0 A;  2YGW A;  2AFU A;  2PJ8 A;  2Q43 A;  3DNS A;  3KKW A;  2OOT A;  3NFZ A;  3SJF A;  1Z4E A;  2CTB A;  4X5K A;  2NSM A;  4B6Z A;  2BOA A;  2GE3 A;  2JBJ A;  4B5O A;  4HKF A;  2YNC C;  2PJ1 A;  4R9M A;  4ONU A;  1CM0 A;  4KOU A;  2PR8 A;  3GY9 A;  4JZ0 A;  4MFP A;  2PRQ A;  3IWG A;  5J8C A;  1LOK A;  3PB9 X;  3DGV A;  1VHS A;  1S60 A;  4L8A A;  2AFX A;  1XIX A;  4PV6 A;  4MCS A;  1QST A;  5G21 A;  5K8P A;  2ZEG A;  2B4D A;  3EY5 A;  4IF5 A;  1QSO A;  2POK A;  1KUV A;  3NH4 A;  2DXQ A;  2GLJ A;  4QC6 A;  5F47 A;  2Z0Z A;  4F0Y A;  4R76 A;  1YSJ A;  3FRM A;  5CPA A;  5G1Z A;  1YVK A;  1M44 A;  3K9U A;  3QNV A;  3VWE A;  2DEA A;  1MJB A;  3FXT A;  5F09 A;  3SHP A;  4KOY A;  1U6M A;  1RO5 A;  1XMT A;  5EBV A;  4PSX A;  4MHN A;  2PSW A;  3NE7 A;  3RO0 A;  3JVN A;  2ZEH A;  3FNC A;  4A30 A;  3PGP A;  2ANP A;  3GYA A;  3PFE A;  4H6Z A;  4BMH A;  2F7V A;  5KTA A;  2PJ4 A;  5IB0 A;  1Q2C A;  3BI1 A;  5H84 A;  2PR1 A;  2P0W A;  1VHE A;  3IGR A;  5JM6 A;  4OKO A;  4P45 A;  1M4I A;  4CAX A;  2JBK A;  3I9S A;  3D66 A;  2NYQ A;  3DLJ A;  3WC6 A;  2ZOG A;  1CBX A;  2HC9 A;  1M1D A;  2DPS A;  2ODF A;  2HV2 A;  2B4B A;  2FL4 A;  2ZXV A;  4MRI A;  4NJQ A;  4A33 A;  1IY7 A;  4F9U A;  1HDU A;  4I49 A;  3TOB A;  1YVO A;  4UA3 A;  2CIJ A;  1CPX A;  1Q7L A;  2PIY A;  4NXY A;  3L2N A;  4BBH A;  2GU2 A;  1XE4 A;  3V8I A;  2GRE A;  3R95 A;  1M4D A;  4XPD C;  4Q38 A;  1Y9K A;  2PQ8 A;  2AFZ A;  1TF8 A;  2ZEP A;  3T8W A;  1P4N A;  4ZY1 A;  2Z3N A;  2P6G A;  2ZEN A;  1IOI A;  4ONW A;  2FIA A;  2D4P A;  3NA6 A;  2FSR A;  3H8F A;  2J8N A;  2OZH A;  2Z3L A;  4M85 A;  2BL1 A;  4C2Z A;  2PJ6 A;  1LAM A;  5EC4 A;  4FAI A;  4Z65 A;  3D7H A;  3SXN A;  4R3L A;  2ZW5 A;  3GB0 A;  4X8I A;  4R57 A;  5THW A;  3KR5 A;  3LAC A;  3NH5 A;  4R87 A;  5C82 A;  2AFW A;  4C7H A;  5JGF A;  4DYO A;  2YND A;  4M6I A;  2WYR A;  2Z3P A;  1ARM A;  1DTD A;  2VBQ A;  4MFZ A;  4UEF A;  2HQY A;  3ZZI A;  1ARL A;  4F0X A;  1XRY A;  4UCN A;  4UWI A;  4ZBG A;  5AGE A;  1IID A;  2EK9 A;  2PE3 A;  4XPD B;  3B3C A;  2A4N A;  4A38 A;  4CYQ A;  3LOD A;  4FWU A;  4K30 A;  5IV0 A;  4CPA A;  3S9N A;  3PP9 A;  2Z10 A;  1FT7 A;  4KZT A;  3IFE A;  1FY7 A;  2AJ6 A;  1CJW A;  3OWC A;  2K5T A;  3S9M A;  3B35 A;  4G1P A;  3VH9 A;  4CGO A;  2XEG A;  4FD4 A;  4JWP A;  5EMI A;  4P4J A;  5HMN A;  1X10 A;  4OAE A;  4C2X A;  2OU2 A;  3B3T A;  3WAB A;  2ZW4 A;  1K4J A;  1HEE A;  3TO9 A;  2JLM A;  1AUG A;  3PFO A;  4QVT A;  4LUA A;  4OID A;  1ZLH A;  4X2T A;  3SJG A;  2GIV A;  4CAE A;  4NFR A;  2PC1 A;  2PVV A;  2FCK A;  4OC3 A;  1I1D A;  4ZI6 A;  5IB9 A;  1DE4 C;  1Q2D A;  2R7H A;  4OC0 A;  4EME A;  4ZY0 A;  2ZW7 A;  2HB6 A;  2Z11 A;  1ZLI A;  2PCU A;  4KLV A;  4RI1 A;  2P6E A;  1YRE A;  4AVC A;  4AVB A;  3FB3 A;  1Y9W A;  1SQH A;  2RFH A;  3VAT A;  4MMO A;  4F9V A;  1WWZ A;  5F49 A;  1RTQ A;  3CPA A;  4MCQ A;  3IWE A;  3WC7 A;  3H5Z A;  4KVM E;  3B7I A;  5LYF A;  2VZY A;  2OZU A;  3D8P A;  4B5P A;  1PU9 A;  2PJ3 A;  3FJU A;  3IO1 A;  4KVX A;  2AFS A;  3UY5 A;  2C1C A;  1CPS A;  4JD6 A;  4YRH A;  1TKJ A;  4F8Z A;  3KR4 A;  4MI4 A;  2OB0 A;  5JPH A;  2PJ5 A;  2ZEM A;  4LQG A;  4P6Y A;  4PSW A;  4P4B A;  5CBM A;  4DUK A;  3PB4 X;  2PJ7 A;  2J8R A;  1CP7 A;  2Z3K A;  3V7Z A;  4KLW A;  1HDQ A;  1XJO A;  3N7Z A;  5J8F A;  4A95 A;  1KWM A;  2WPW A;  3S6G A;  4EVY A;  4RUH A;  3ZJ0 A;  1YGH A;  1B87 A;  2WPX A;  3KQZ A;  3TC8 A;  4EFD A;  4B11 A;  3W6X A;  3EC4 A;  1MJ9 A;  2QEC A;  5K8N A;  3KI9 A;  2CNS A;  1Y0Y A;  2Q51 A;  4KS9 A;  4P4F A;  4CAV A;  3A9L A;  1JWQ A;  1Z8W A;  4A2Z A;  4P4E A;  4Q36 A;  1LAP A;  4MFQ A;  4RS2 A;  4UFV A;  4XPL A;  5D29 A;  4IAV A;  2G0B A;  2QML A;  4JXQ A;  5AG4 A;  3R96 A;  3FEC A;  2Q4Y A;  3B3V A;  1VGY A;  1AMP A;  3BJ8 A;  5F48 A;  2V77 A;  2F8H A;  1ZG7 A;  1S7L A;  5D8N A;  5K8M A;  4Q7A A;  4CGL A;  4OC4 A;  1NE9 A;  2Q44 A;  4FD7 A;  1VHO A;  2BUE A;  3PB8 X;  3JTK A;  2FE7 A;  4P44 A;  4M6G A;  3RBU A;  1LFW A;  1Y7E A;  2OR4 A;  3PEI A;  4MHY A;  3D67 A;  3BLN A;  5LRJ A;  3GLJ A;  3GKR A;  2HUZ A;  1OBR A;  4P4D A;  2B3U A;  4YFJ A;  3ISX A;  4J3G A;  1MK4 A;  1XOV A;  2B3V A;  4UWJ A;  2QVP A;  2YNC A;  3PB6 X;  2ZEL A;  3C26 A;  1YK3 A;  3EFA A;  3EXN A;  3CXS A;  2FXF A;  2VZZ A;  4AVA A;  4A94 A;  4OC1 A;  4F6A A;  1M4G A;  1BOB A;  1M4L A;  3EO4 A;  5ISV A;  4KOV A;  4MCP A;  2CF4 A;  4QBJ A;  3B8G A;  3CDX A;  2PJ9 A;  4H6U A;  5A27 A;  4NSQ A;  2B58 A;  4XPK A;  3RNZ A;  1QSM A;  3B2Y A;  4YU9 A;  4XNH C;  4AG7 A;  3PBB A;  2PDO A;  3WC5 A;  3KZW A;  7CPA A;  5DWN A;  1TXR A;  1ZG9 A;  2DF5 A;  1NSL A;  2REE A;  2Q04 A;  3D4U A;  3SJX A;  4PK2 A;  3TCV A;  3TTH A;  2VEZ A;  4A37 A;  2KCW A;  3D7G A;  3D7D A;  3H8G A;  3JRU A;  2AE6 A;  2VXK A;  2Q4V A;  1S7F A;  4MCR A;  3T9Y A;  4KSI A;  4U9Y A;  4NGN A;  1LCP A;  3KHX A;  4FD5 A;  4O23 A;  4KUB A;  4RN7 A;  4U5Y A;  4KOX A;  4NGT A;  3HUV A;  3TOA A;  3TO6 A;  2QIR A;  5CNP A;  4E8O A;  2ZEF A;  1VKC A;  3F8K A;  2OH1 A;  4B10 A;  5C88 A;  2PJ2 A;  4PPZ A;  4XNH B;  1S3Z A;  5HVF A;  4ORF A;  5AG5 A;  3G8W A;  2ZOF A;  1EE3 P;  4UCM A;  1Z9U A;  2EWB A;  1QMU A;  3NE8 A;  2XEI A;  3BXM A;  4C68 A;  2RB7 A;  3I1U A;  2GAN A;  3H8E A;  1Y7R A;  1OZP A;  3SI0 A;  2ATR A;  5J1Q A;  4CRZ B;  3DR8 A;  4Y49 C;  3SJE A;  4C2Y A;  4OLL A;  4OME A;  3W6S A;  4NGS A;  2O53 A;  3TX8 A;  3P2F A;  3FED A;  3PZJ A;  2ZW6 A;  1BPN A;  4UIA A;  4ZYQ A;  1XFO A;  3KHZ A;  4QUS A;  3I3G A;  4UEE A;  4CYN A;  3K2K A;  2R98 A;  4PK3 A;  4UEZ A;  1ZO0 A;  4GXH A;  1ELM P;  2O28 A;  4NGR A;  3CXQ A;  1S5K A;  3BJ7 A;  3F0A A;  4NGM A;  1PYT B;  2B5G B;  4WJB A;  3TE4 A;  4NF1 A;  2FS5 A;  2NMT A;  1R3N A;  4NGP A;  3SI1 A;  3V38 A;  2JEW A;  1X12 A;  1Z8T A;  1L0C A;  3MRU A;  4HPS A;  5E96 A;  4MFL A;  5BWA B;  1Z2L A;  3R9F A;  4CAF A;  3LMS A;  4ZX8 A;  2V8H A;  4C7I A;  2PRB A;  1KUY A;  1YLO A;  2Q4Z A;  3FX6 A;  4PXC A;  2YNE A;  4Y49 B;  4PXD A;  4GM5 A;  2J9A A;  2PVW A;  3LD2 A;  2XEF A;  1S7K A;  2ZEO A;  4PXB A;  3W91 A;  4AG9 A;  4JYW A;  2I79 A;  4II9 A;  1IYL A;  2I3C A;  3BHX A;  4UFW A;  3FF3 A;  4KOT A;  1YX0 A;  4M3S A;  4UCP A;  4UFX A;  2WSA A;  1TF9 A;  1F2P A;  2C6P A;  1XEB A;  2PIZ A;  4K3N A;  2EBJ A;  4CS0 B;  1MJA A;  5FVJ A;  4CAW A;  4DJL A;  2C6C A;  2D4O A;  3MN8 A;  3IEH A;  3IJ3 A;  4WWV A;  3T90 A;  3JUW A;  2O4H A;  2JDD A;  1VIX A;  3VWD A;  1AYE A;  2J8M A;  1IU8 A;  4FD6 A;  1PCA A;  3TT2 A;  5IX3 A;  1PUA A;  2Y0M A;  4TNU A;  4PQA A;  5HH1 A;  3DSB A;  1FNO A;  2GLF A;  3R1K A;  5LYI A;  5LRK A;  2IMO A;  4X3R A;  5KTD A;  3D3S A;  6CPA A;  2BCO A;  4CGP A;  4M6H A;  4HNY B;  1R43 A;  1V0C A;  4HNX B;  1YLE A;  1I21 A;  2Z3O A;  3E0K A;  3CPX A;  2RC4 A;  3FEE A;  4B13 A;  5JH9 A;  2B4D B;  1CG2 A;  1QSN A;  3PB7 X;  3R9G A;  3S6K A;  3PRT A;  4PXE A;  5HVG A;  5LYL A;  1YR0 A;  4W9Y A;  1TIQ A;  4OC2 A;  3DR6 A;  2REF A;  5LRG A;  4A39 A;  1XF8 A;  3QB8 A;  4KSA A;  5DWM A;  2AFM A;  4DNC A;  5LYD A;  3S6F A;  2V8G A;  4MHZ A;  1XBU A;  3P2H A;  2V8V A;  1N71 A;  4NGQ A;  2ZED A;  4R3K A;  1H8L A;  1RXT A;  5I4M A;  2CXA A;  4CRY B;  2C6G A;  2IL4 A;  4MFK A;  4BIN A;  2ABZ A;  2IJZ A;  4IUS A;  3KGQ A;  2IQ6 A;  2VQY A;  2JDC A;  3D2M A;  3MGD A;  4FBE A;  4IK2 A;  4ZY2 A;  2H5M A;  1BAV A;  1Z5R A;  3K9T A;  4MXU A;  2ZPA A;  2BEI A;  1LRZ A;  1F2O A;  1KUX A;  4HNW B;  4MHD A;  3R9E A;  5HVH A;  1WK4 A;  2BO9 A;  4GS4 A;  2PJB A;  2BSW A;  4IHM A;  1NMT A;  4JXR A;  1YW4 A;  4NEX A;  4MY0 A;  2X7B A;  5GCN A;  1Z4R A;  4OAD A;  1GYT A;  4E2A A;  8CPA A;  5F46 A;  2F5I A;  2VI7 A;  1YME A;  5K8O A;  2Z3M A;  5A28 A;  2WZN A;  4KVO E;  1CX8 A;  2EO8 A;  3IU2 A;  4KUA A;  5AG7 A;  4B14 A;  1ZG8 A;  2G9D A;  3FMC A;  1J4J A;  4MY3 A;  3WT4 A;  1BPM A;  1GHE A;  2ZEE A;  2Q0Y A;  2XEJ A;  4H89 A;  2FVG A;  1KZF A;  4KOS A;  3S6H A;  3IC1 A;  1CP6 A;  1A2Z A;  2C27 A;  4FUU A;  3RYO A;  3D2P A;  2EVN A;  4JJX A;  2CNM A;  1QSR A;  2AFO A;  4R7M A;  3SXO A;  1Z8X A;  4H2K A;  4R6T A;  3TO7 A;  3LWU A;  2G3T A;  3KQX A;  4KOR A;  4QB9 A;  1LAN A;  1F57 A;  4KOW A;  3TFY A;  3D68 A;  5HXD A;  5JQ4 A;  1R57 A;  1IB1 E;  1Z8L A;  4MBU A;  1Y0R A;  2FT0 A;  1UFH A;  2ARH A;  4OC5 A;  3IU1 A;  1B6B A;  1I12 A;  3GIU A;  3IIB A;  3KAS A;  3S9L A;  5H86 A;  5I0C A;  3B3W A;  4LQ6 A;  3N5F A;  1ELL P;  2OZG A;  1S7N A;  3F5B A;  2CTC A;  4MJ8 A;  4U9Z A;  4YWY A;  4A32 A;  1NSA A;  3DDD A;  4P10 A;  3WR7 A;  1JQG A;  3CT9 A;  4JLY A;  4R8F A;  4UF4 A;  4MHP A;  1BO4 A;  4E0A A;  3D7F A;  5G22 A;  1QQ9 A;  2EUI A;  3H4Q A;  3RAM A;  2QYV A;  3RZA A;  4CGN A;  2V8D A;  3B3S A;  4ZGY B;  3FH4 A;  5ELY A;  1TKH A;  2P6F A;  1IGB A;  2PJA A;  2Q7S A;  2I00 A;  1IYK A;  1IIC A;  4A31 A;  1YQE A;  3SI2 A;  2B5G A;  2PJC A;  2VL1 A;  3IWW A;  1UWY A;  2QJ8 A;  2R1I A;  3FYN A;  4CYO A;  4AXV A;  4MFJ A;  5KTC A;  2DPT A;  4NCZ A;  2G3A A;  4CGM A;  3FBU A;  1P0H A;  3FIX A;  4B5P B;  2CNT A;  4LX9 A;  3QAY A;  1BLL E;  4ZX9 A;  4KSF A;  3PBE A;  4BD9 A;  2EK8 A;  3NH8 A;  2PJ0 A;  3CXP A;  1YW6 A;  3CZX A;  3KL9 A;  4YGO A;  1TKF A;  2R8V A;  3FVL A;  3ISZ A;  4L89 A;  5AG6 A;  4EWT A;  1Q2Y A;  2GFQ A;  4P4I A;  1XMB A;  3HLP A;  3GUX A;  3VAR A;  5DS0 A;  4NJR A;  4OIW A;  3QAH A;  4CYP A;  1IOF A;  2FIW A;  2CY2 A; 
#chains in the Genus database with same CATH homology
 4UBR A;  4AB7 A;  5G20 A;  2Q7B A;  2JEV A;  3G3S A;  4B12 A;  2WUU A;  1ON0 A;  2YGW A;  3DNS A;  3KKW A;  1Z4E A;  4X5K A;  2GE3 A;  4B5O A;  4HKF A;  2YNC C;  4R9M A;  4ONU A;  1CM0 A;  4KOU A;  2PR8 A;  3GY9 A;  5J8C A;  4MFP A;  3IWG A;  1VHS A;  1S60 A;  4L8A A;  1XIX A;  4PV6 A;  1QST A;  5G21 A;  4IF5 A;  2B4D A;  3EY5 A;  1QSO A;  1KUV A;  2DXQ A;  4QC6 A;  5F47 A;  2Z0Z A;  4F0Y A;  3FRM A;  5G1Z A;  1YVK A;  1M44 A;  3K9U A;  3VWE A;  3FXT A;  1MJB A;  3SHP A;  4KOY A;  1U6M A;  1RO5 A;  1XMT A;  5EBV A;  4PSX A;  2PSW A;  3NE7 A;  3JVN A;  3FNC A;  4A30 A;  3PGP A;  3GYA A;  4H6Z A;  4BMH A;  5KTA A;  5IB0 A;  1Q2C A;  5H84 A;  2PR1 A;  2P0W A;  3IGR A;  1M4I A;  4CAX A;  3I9S A;  1M1D A;  2DPS A;  2HV2 A;  2B4B A;  2FL4 A;  2ZXV A;  4A33 A;  4I49 A;  3TOB A;  1YVO A;  4UA3 A;  4NXY A;  4BBH A;  1XE4 A;  3V8I A;  3R95 A;  1M4D A;  4XPD C;  4Q38 A;  1Y9K A;  2PQ8 A;  1P4N A;  2Z3N A;  2P6G A;  2FIA A;  2D4P A;  2FSR A;  2J8N A;  2OZH A;  2Z3L A;  4M85 A;  2BL1 A;  4C2Z A;  5EC4 A;  3SXN A;  4R3L A;  2ZW5 A;  4R57 A;  4R87 A;  5C82 A;  4C7H A;  2YND A;  2Z3P A;  4MFZ A;  2VBQ A;  3ZZI A;  2HQY A;  4F0X A;  4UCN A;  4UWI A;  4ZBG A;  5AGE A;  1IID A;  4XPD B;  2A4N A;  4CYQ A;  3LOD A;  5IV0 A;  4K30 A;  3PP9 A;  2Z10 A;  4KZT A;  1FY7 A;  2AJ6 A;  1CJW A;  3OWC A;  2K5T A;  4CGO A;  4FD4 A;  4JWP A;  5HMN A;  4OAE A;  4C2X A;  2OU2 A;  2ZW4 A;  1K4J A;  3TO9 A;  2JLM A;  4QVT A;  4LUA A;  2GIV A;  4CAE A;  2PC1 A;  2FCK A;  1I1D A;  1Q2D A;  2R7H A;  2ZW7 A;  2Z11 A;  4KLV A;  4RI1 A;  2P6E A;  1YRE A;  4AVC A;  4AVB A;  3FB3 A;  1Y9W A;  1SQH A;  1WWZ A;  5F49 A;  3IWE A;  3H5Z A;  4KVM E;  2VZY A;  2OZU A;  2FIW A;  3D8P A;  4B5P A;  1PU9 A;  4KVX A;  3UY5 A;  4JD6 A;  4YRH A;  4MI4 A;  2OB0 A;  5JPH A;  4PSW A;  2J8R A;  2Z3K A;  4KLW A;  3N7Z A;  5J8F A;  4A95 A;  2WPW A;  3S6G A;  4EVY A;  3ZJ0 A;  1YGH A;  1B87 A;  2WPX A;  4B11 A;  3W6X A;  3EC4 A;  1MJ9 A;  2QEC A;  2CNS A;  4KS9 A;  4CAV A;  3A9L A;  4A2Z A;  4Q36 A;  4MFQ A;  4RS2 A;  4UFV A;  4XPL A;  2G0B A;  2QML A;  4JXQ A;  5AG4 A;  3R96 A;  2Q4Y A;  3BJ8 A;  5F48 A;  1S7L A;  4CGL A;  1NE9 A;  2Q44 A;  4FD7 A;  2BUE A;  3JTK A;  2FE7 A;  3BLN A;  3GKR A;  2HUZ A;  2B3U A;  4YFJ A;  4J3G A;  1MK4 A;  2B3V A;  4UWJ A;  2YNC A;  3C26 A;  3EXN A;  1YK3 A;  3EFA A;  3CXS A;  2FXF A;  2VZZ A;  4AVA A;  4F6A A;  1M4G A;  1BOB A;  3EO4 A;  5ISV A;  4KOV A;  4QBJ A;  3B8G A;  5A27 A;  4H6U A;  4NSQ A;  2B58 A;  4XPK A;  1QSM A;  4XNH C;  4AG7 A;  2PDO A;  5DWN A;  1NSL A;  2REE A;  2Q04 A;  4PK2 A;  3TCV A;  3TTH A;  2VEZ A;  2KCW A;  2AE6 A;  2VXK A;  2Q4V A;  1S7F A;  3T9Y A;  4U9Y A;  4FD5 A;  4KUB A;  4U5Y A;  4KOX A;  3TO6 A;  3TOA A;  2QIR A;  5CNP A;  4E8O A;  1VKC A;  3F8K A;  2OH1 A;  4B10 A;  5C88 A;  4XNH B;  1S3Z A;  4ORF A;  5AG5 A;  3G8W A;  4UCM A;  1Z9U A;  4C68 A;  2GAN A;  1Y7R A;  1OZP A;  2ATR A;  4CRZ B;  3DR8 A;  4Y49 C;  4C2Y A;  4OLL A;  3W6S A;  3P2F A;  2ZW6 A;  4QUS A;  3I3G A;  4CYN A;  2R98 A;  4PK3 A;  1ZO0 A;  2O28 A;  3CXQ A;  1S5K A;  3BJ7 A;  3F0A A;  2B5G B;  3TE4 A;  4NF1 A;  2FS5 A;  2NMT A;  1L0C A;  5E96 A;  4MFL A;  5BWA B;  3R9F A;  4CAF A;  4C7I A;  2PRB A;  1KUY A;  2YNE A;  4Y49 B;  3LD2 A;  3W91 A;  1S7K A;  4AG9 A;  2I79 A;  4II9 A;  1IYL A;  4UFW A;  4KOT A;  1YX0 A;  4M3S A;  4UCP A;  4UFX A;  2WSA A;  4CS0 B;  1XEB A;  1MJA A;  5FVJ A;  4CAW A;  2D4O A;  3T90 A;  3JUW A;  2JDD A;  3VWD A;  2J8M A;  4FD6 A;  3TT2 A;  5IX3 A;  1PUA A;  2Y0M A;  5HH1 A;  3DSB A;  3R1K A;  5KTD A;  3D3S A;  4CGP A;  4HNY B;  1V0C A;  4HNX B;  1YLE A;  1I21 A;  2Z3O A;  3E0K A;  2RC4 A;  4B13 A;  2B4D B;  1QSN A;  3R9G A;  3S6K A;  1YR0 A;  1TIQ A;  3DR6 A;  2REF A;  1XF8 A;  3QB8 A;  4KSA A;  5DWM A;  4DNC A;  3S6F A;  3P2H A;  1N71 A;  4R3K A;  1RXT A;  2CXA A;  4CRY B;  2IL4 A;  4MFK A;  4IUS A;  2VQY A;  3MGD A;  2JDC A;  3D2M A;  2H5M A;  2ZPA A;  2BEI A;  1LRZ A;  1KUX A;  4HNW B;  4MHD A;  3R9E A;  1WK4 A;  4GS4 A;  2BSW A;  1NMT A;  4JXR A;  4NEX A;  4MY0 A;  2X7B A;  5GCN A;  1Z4R A;  4OAD A;  4E2A A;  5F46 A;  2F5I A;  2VI7 A;  2Z3M A;  5A28 A;  4KVO E;  3IU2 A;  4KUA A;  5AG7 A;  4B14 A;  4MY3 A;  1J4J A;  1GHE A;  2Q0Y A;  4H89 A;  3S6H A;  1KZF A;  4KOS A;  3RYO A;  2C27 A;  3D2P A;  2EVN A;  4JJX A;  2CNM A;  1QSR A;  3SXO A;  3TO7 A;  2G3T A;  4KOR A;  4QB9 A;  4KOW A;  3TFY A;  5JQ4 A;  1R57 A;  1IB1 E;  4MBU A;  2FT0 A;  1UFH A;  2ARH A;  3IU1 A;  1I12 A;  1B6B A;  5H86 A;  5I0C A;  1S7N A;  2OZG A;  3F5B A;  4MJ8 A;  4U9Z A;  4A32 A;  3DDD A;  3WR7 A;  4JLY A;  1BO4 A;  4E0A A;  5G22 A;  2EUI A;  3H4Q A;  4CGN A;  4ZGY B;  2P6F A;  2I00 A;  1IYK A;  1IIC A;  4A31 A;  2B5G A;  3FYN A;  2R1I A;  4CYO A;  4MFJ A;  5KTC A;  2DPT A;  4NCZ A;  2G3A A;  4CGM A;  3FBU A;  1P0H A;  3FIX A;  4B5P B;  2CNT A;  4LX9 A;  4KSF A;  3CXP A;  4YGO A;  2R8V A;  4L89 A;  5AG6 A;  1Q2Y A;  4CYP A;  3QAH A;  3PZJ A;  2CY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...