4C7KA

11b-hydroxysteroid dehydrogenase type i in complex with inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
258
structure length
258
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPLVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPSRKILEELYSTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of Brain Penetrant 11Beta-Hydroxysteroid Dehydrogenase Type I Inhibitors and in Vivo Testing in Diet- Induced Obese Mice.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
total genus 99
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2013-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4c7kA00
3DZIA 2PZJA 2Z95A 1FDSA 1SZJG 4Q9NA 3GHYA 2DFVA 1MA0A 5JLAA 3ZU2A 4E21A 5T8KC 5L9AA 2Q1UA 4BO2A 3AFMA 1E3EA 3OJ0A 3WWZA 4YBZA 5I7SA 1OOEA 5JDIC 4PVDA 1KY5A 2HCTA 4EEZA 3GNTA 1HDCA 1IOLA 2NQ8A 2EW8A 4DQUA 4ZHSA 2NU6A 3JQGA 3SBOA 3OMLA 3H8VA 3QWHA 4WASA 2YDXA 5KJFA 1GZ3A 1VJ0A 1R37A 1P31A 3ABIA 4PLPA 1PSDA 1Q7BA 1LDBA 4WLNA 3I1JA 3PTZA 1IL0A 4JNKA 5A4DA 5LC1A 1DC6A 5THKA 4KUHA 1N7HA 1X7HA 2B83A 5CHEA 2BFPA 1K2WA 4J9VA 5BNIA 1K89A 3LT0A 4PLFA 3GN2A 3VH4A 4NBVA 2D1YA 3GG2A 1JN0A 1HLPA 4M87A 1IB6A 1RWBA 1ZFNA 5ENDA 4R5MA 3GY0A 3GG9A 4KZPA 1WW8A 2PA3A 1EK5A 5EJ2A 1H6AA 1UAGA 1U8FO 2PFGA 5B37A 4OKIA 5F1OA 3H5RA 3KLPX 1D7OA 3QWFA 5JBIA 2WD7A 5C37A 1XLTA 3GLQA 1NWHA 2H1SA 4M89A 4L4RA 3WJAA 5FEUA 4MVJG 4HUJA 5BR7A 4DYDA 2AMFA 3ZN2A 3RCBA 4B3HA 3TZ6A 1AN9A 4IZIA 3GOHA 3HQ4O 3RQSA 4IQ8A 3UH1A 1I24A 2BGMA 2FZEA 2GRAA 1UZLA 2DU8A 3I6IA 4XEHA 4RVSA 2PZLA 4ZQHA 2Z1NA 3I9KA 4HNHA 1C1DA 2VOEA 3EZYA 4RLHA 3L6DA 1E7SA 1GL3A 2DAPA 4BMVA 1HTBA 1PJCA 3ZHZA 1GUFA 3FWNA 4W82A 4MIEA 4P38A 5CFZA 4J7UA 1BXGB 1BXZA 5JFOA 2BMAA 3RKRA 2GERA 3MJCA 1HSZA 4YPOA 3ORFA 3FD8A 3JYLA 5LDHA 2NVUA 4RPHA 2ZTUA 1YQDA 3RU7A 4EUHA 5CEFA 5JC1A 4KTVE 4RDHA 3ROPA 4CMIB 3ADPA 3DHNA 3LQFA 3W1VA 4CR7A 3GVIA 1LQTA 1WDKA 4GWGA 1YBMA 3RBZA 3WB9A 4DQVA 3F1LA 5B4TA 3UN1A 1AE1A 1PJTA 3GEDA 5KVSA 5DOZA 3KVOA 5DP1A 2ZTMA 1O9BA 4IJUA 2VWQA 2VHWA 3PDJA 5I8WA 1UXHA 3WGTA 3Q2IA 2IZ1A 3ZU4A 2DTDA 1CWUA 4NDNE 3BIOA 3VTZA 1PR3A 4NU5A 4BNUA 2VYND 4BO0A 2HK9A 1ENPA 3DC2A 4JBHA 1HKUA 1FDTA 3PEFA 4I9NA 5L7YA 3ZNNA 2DUWA 4M8SA 3LF1A 4FFLA 3WBBA 2EP7A 3E18A 1SEPA 1P1RA 3PHJA 2VWHA 4G5HA 4YQZA 4OOFA 3VH2A 1YQGA 4Y6RA 1FJHA 3CMCO 3IP1A 1DC4A 1G6KA 3MJ4A 2BRUA 1VSVA 4Z6KA 2O2YA 1N5DA 4LMPA 4R4JA 2DKNA 3I5MA 4E5PA 4PZCA 3QWAA 1WWKA 4GQAA 1VJ1A 4J2HA 4I9UA 3F46A 5EMHA 4J9UE 5U9CA 5JDIA 1IULA 3F5QA 3RBXA 3HFGA 2VT2A 3EC7A 1ZSYA 2PH5A 3U0BA 5F3RA 1XKQA 3M6IA 5KJCA 1E7WA 4IIVA 3GDFA 4ONEA 3QVXA 1NHWA 3H7AA 2X0RA 2OHXA 2GZ2A 4FC7A 2ZB4A 1HDZA 3DOCA 4XWYA 4UUPA 2HO5A 5JW6A 1OBFO 3AJRA 4EITA 3A28A 2IDZA 4O59O 4HXYA 5ILOA 3S1LA 3JD4A 3VAZA 5H81A 5KJ6A 3H4VA 3S2FA 1U7TA 4CM9D 2X23A 2D8AA 2X8LA 3CTMA 3OFSA 3U4HA 4L75A 3BMQA 1EE9A 2B4QA 2GF2A 1JU9A 3O38A 2OFPA 4L0QA 4L73A 3QWIA 3JQ8A 4YJGA 5EQDA 1U7HA 1DFGA 1ULSA 4E2YA 1EFKA 5C7LO 3ZWXA 5CDSA 4HFNA 2JCVA 2D5CA 2E6UX 1WZIA 3E03A 1DJNA 3D4OA 4JLWA 4DPKA 4BO6A 5A9TA 3UCXA 1Z73A 3C24A 1NASA 1S7CA 5JYEA 4DMLA 2X58A 4GVXA 1AUPA 1P77A 2QRLA 4Y6PA 1MXHA 4WLOA 2B69A 2OORA 4ZN6A 1IZ9A 1P0FA 4JP3A 1EVJA 3B1KA 2BKAA 4GSKA 2CVQA 1PJLA 4JCOA 4OM8A 3BMCB 4U7WA 2V6MA 1B7GO 3KZVA 4YAEA 4Z9XA 3IJRA 1NQOA 3FPCA 4CQMA 3WLEA 1T24A 3PRJA 1ONOA 5KJEA 4KUGA 2FP4A 1XYGA 4CLHA 3MOIA 1D1SA 1LSOA 1Z7EA 1ZMTA 4P8RA 1YO6A 3KXDA 3CIFA 4JX8A 1ZMOA 3ZW8A 2G1UA 1I3MA 1F17A 3CZRA 3D3WA 2JAHA 2FZWA 4YA6A 3PJGA 4RORA 3ZCXA 1A71A 1XA0A 1CRWG 5HA5A 4Q3AA 1RM3A 1N9GA 1JAXA 2I99A 4TKMA 2WMDA 3QP9A 4YAKA 4GX0A 2NVWA 3G0OA 2VUTA 4NNJA 2Q99A 5EPOA 1KVQA 3E9NA 7ADHA 1NQAO 4W7HA 1PEDA 3H9EO 2BF7A 3E5MA 3K9QO 1B3BA 4XJSA 5ER6A 3GGGA 5CEJA 4CMJA 5A9SA 1U3TA 1ZIDA 3NJ8A 4ND3A 4J6FA 1T2AA 4RZHA 3L9XA 1ZK2A 4IS3A 5AOVA 4AFNA 1SOWA 4E32A 1C1XB 4Y98A 3GAFA 3ZWWA 4CODB 2JJYA 1VL6A 1GYQA 2Q45A 3DAGA 4BGEA 3L6OO 2VTEA 4JJGA 4R1UA 3K31A 4BMSA 3L4BC 3WGOA 5KJ1A 2A92A 1B14A 5KTKA 3TJRA 2I67A 3HADA 1X1TA 5JSFA 4IDDA 1E7MA 1DSSG 2RAFA 3Q3CA 5U1PA 1I3NA 3HE3A 2TMDA 3MTJA 4BOYA 2O3JA 1JAYA 4YT5A 1I32A 3N7UA 3VKUA 4QSMA 2NVBA 4MKXA 2RH8A 3Q9NA 5DCWA 4QQRA 4FW8A 4Y9DA 3OECA 4EZBA 1RM4A 2NQTA 2VCYA 5HS4A 1BXKA 3NT5A 1EZ4A 4RPGA 3VHRA 4Y8VA 5IXSA 5GY7A 1MX3A 4K6CA 3GAZA 3I3OA 4R16A 1PGOA 4TWRA 2GLXA 3EVTA 1HSOA 1QV6A 5AXAA 4N5MA 2GR9A 2D4AA 4BIIA 2X9NA 1LLDA 1QR6A 1VL0A 3VDRA 1GD1O 3D7LA 3S2GA 1JWAB 3RC9A 1LDEA 4DPLA 3GN1A 1LXCA 2EXXA 4FQ8A 3C7AA 2Q50A 4P4LA 5FF9A 1ENYA 3DFZA 1I33A 3QV1A 5BSHA 1WDMA 3PQDA 1LU9A 4J49A 4XR4A 1E7RA 4RDIA 3ZHXA 1WXDA 2QIOA 4ZRMA 1LA2A 3I52A 2YY7A 2C5AA 4JBGA 5EINA 3TZKA 3V2GA 5COBA 4BNFA 1ADBA 3WTBA 3GUYA 2CY0A 4DXHA 3CE6A 2RCYA 1PJ2A 3PFFA 4CMGA 1Z75A 4AJ4A 3WGHA 1LRLA 4R1TA 5A5FA 1YONA 3DBLA 1MFPA 2YQ5A 3QJ5A 1OMOA 2C59A 1ZH8A 3RUIA 5JAMA 4DC1A 1YRLA 3I83A 5F5NA 3O8QA 3SJ7A 3AUUA 3EZLA 4RLSA 3AU9A 1D8AA 4J1TA 4BNWA 2FSVA 2I76A 1E5QA 4RVDA 3JQBC 3LZ6A 1E7YA 1GEEA 3I4CA 4FJ2A 3VC7A 2VUSA 2O3SA 1TLTA 1VKOA 1KIFA 3F4BA 1NFRA 5DBIA 1E6WA 1F8FA 2GPTA 5ADHA 4JP2A 3GPIA 2O4CA 4JK3A 4Q3CA 5TRTA 1C14A 4YJDA 1R12A 1U1IA 4WCFA 1R6DA 1KVSA 3PLRA 2IZ0A 1YGYA 3TZCA 5H82A 1DOHA 1R66A 2VNAA 3CMMA 4X54A 1KC1A 3Q1LA 4NFYA 4NH4A 4EJMA 3Q9UA 4WE3A 2JCXA 4XQ9A 1J49A 1JKJA 1PR9A 2FOIA 3SLGA 2YZ7A 2O4UX 5G2OA 3UAGA 3RD5A 4JIGA 2QX7A 3G49A 4XR9A 2RH4A 4DREA 1BRMA 4A26A 1KBZA 2AG5A 2W2KA 1DIAA 4TKLA 3GRKA 3PXXA 3D5QA 4R51A 2EWMA 3TZQA 5MGBA 5KVQA 3OH8A 3FTPA 3GVPA 1ADGA 3WFIA 1B2LA 5DOVA 5B12A 2BFOA 2HK8A 2PNFA 3MJSA 3O4RA 4FFRA 4R9RA 3LT1A 3NTRA 4HP8A 1GCOA 1I30A 2JD0A 1EUZA 1FDWA 1PZGA 2B35A 3HWRA 3ASVA 5IDQA 3K30A 3PLNA 3VKVA 4XYGA 1TXGA 4NG5A 3DTYA 4A73A 2WYWA 2V7PA 3EW7A 1Y5MA 2HDHA 3K92A 3L4SO 1DAOA 4BO5A 3DWFA 1HYEA 4BB5A 1E77A 4BGIA 1PZFA 3DMTC 4LRTB 5LCXA 4B7CA 1B15A 2ET6A 5ENVA 1B26A 4ALMA 4CMAA 4EJ0A 2PLAA 3GMSA 3PQFA 2FR1A 3ZWBA 5HM8A 4WLFA 4QFDA 4BV8A 4G81A 1LBEA 3R1IA 1DPGA 1PGPA 4PFJA 3TN7A 2X9GA 4EEXA 1WP4A 4FC6A 1PQWA 2WM3A 4M1QA 2AEMA 4DLBA 1P45A 2AEFA 1Q0LA 5DDIP 4YRDA 2YJZA 4W4TA 1E3WA 2GSDA 3KSUA 4WLUA 3ZWMA 1RPNA 4CMEC 3W8EA 3WWYA 2DQ4A 2FHSA 1WNTA 2Q1SA 5G0TA 1Y9EA 1EVYA 1RM0A 2X9VA 1TT5A 3FHLA 3TWOA 2WYVA 4BNLA 2D59A 4HADA 4OXNA 2EIHA 1IPEA 1YH3A 4D0SA 4BUCA 2IODA 1YWGO 2JFHA 1EBFA 4S1VA 4BKOA 3GF4A 3H9QA 1RKXA 3ZHBA 3ZNQA 3TF5A 1NFFA 3DTTA 1HF3A 3A1NA 3HDHA 4DGSA 3DOOA 2EHDA 5G4KA 3CSDA 3RUCA 1XU9A 4MP8A 1EE2A 3ETDA 4WKGA 1NYTA 1DFIA 3U4IA 3WFJA 1HDGO 3JTMA 3FCOA 2ZTVA 2PH3A 3QQPA 2GD1O 1ENZA 2EP5A 2HLPA 1W73A 3DAFA 3INGA 4YJFA 3UUWA 1L7DA 3JYPA 3KTDA 3ICPA 3JQGB 1N2SA 2Y05A 4FIZA 5L40A 5IG2A 2DPGA 3UFXA 5A04A 1WZEA 4MO2A 2DBRA 4ZQFA 3AM5A 4CV0A 3D4PA 5I7EA 4I9HA 3ZNOA 2EGHA 2NUAA 5IDYA 3ETGA 3TDKA 1T2EA 4XB1A 4JJIA 4II2A 4RF3A 4HY3A 1B0AA 1JLLA 2VHXA 3V8BA 3E6AA 1FDUA 4DRYA 1M67A 1NTOA 4OXYA 4OQYA 4MVJA 4XB2A 1PJ3A 5JY1A 3I9LA 3SVTA 3INRA 4HKTA 3OIGA 3GMDA 4MPDA 4Q3BA 3AY7A 2OO5A 3QW2A 4ZVVA 4FR5A 3N58A 2OL4A 4IIUA 3QWBA 3PZRA 3GVXA 2C82A 4CV2A 1TT7A 2I66A 2UV8A 1LNQA 2VYVD 5C7IO 1NXQA 1PIWA 4TMFA 1QV7A 3WIDA 1O95A 2YV1A 1NQTA 4ZRNA 3I23A 4A03A 3WYCA 1W4ZA 3LYLA 1ZEMA 1V3UA 3C1TA 4WCFC 1UDAA 2X1HA 5EESA 2DVMA 2FR8A 3EDMA 2ZCVA 4BNJA 1TB4A 4WEOA 2W2KB 3FRJA 5CAEA 4UUNA 2IEDA 3OBBA 1IZ0A 4PG6A 1VPDA 5KWEA 1VLLA 1X0XA 3VVCA 1PWZA 4Y67A 1LDGA 5ICSA 1MLDA 1H2BA 3ZV4A 1QYCA 1C0PA 4CMIA 4BL5A 1EUCA 1NX6A 3H5AA 2HJRA 5DN9A 1HDOA 4RF5A 2V6FA 3DHEA 2Q4BA 1XHLA 3Q0EA 4YEDA 4NFSA 5FYDA 2J3IA 2IYOA 4ND4A 1P0CA 4IXWA 4DQXA 2YHUA 4YAJA 3RI3A 3WQRA 4R54A 3RUAA 5K6AA 3DMYA 4AJKA 3SJUA 5L3ZA 4YAGA 1EUDA 3ZWCA 5A02A 3ONDA 4D3FA 2BFMA 4EUEA 1DIGA 1XGKA 5TX7A 3RWBA 1IHYA 5TIIA 3LVFO 3FNHA 3E82A 1X13A 3JQ8B 4CV1A 5K0ZA 3EMKA 4XGKA 4CMEA 1BGVA 5H83A 2RIRA 1J5PA 3IOYA 3WYEA 3BMQB 4R5HA 1ZK0A 4GWKA 2BLLA 3B6ZA 1NP3A 4CLRB 1NR1A 4NU6A 4LRSB 1JA9A 1Z45A 1ARZA 2DM6A 2VN8A 1UXIA 3KUXA 3IL2A 4GPD1 1DLJA 4E2XA 2YV2A 1XELA 3PK0A 3BMOA 2EERA 1I5RA 1AHHA 4FJ0A 4IDBA 3BHMA 1EFLA 2PD4A 2VHVA 2VYVA 2DBQA 3INTA 4TROA 4PG4A 3PWKA 4IGFA 4IJKA 3LT2A 3NAQA 1C0LA 1FK8A 2Q46A 2J6IA 4TRNA 3ZU3A 4BGVA 4XQEA 3PPIA 4I5FA 1Q2XA 1NAHA 2P5UA 3HUDA 4DBZA 4XYBA 4BNXA 5EERA 2P2SA 5TQVA 3K96A 4E4YA 2GN8A 3RJ9A 2BD0A 3B1FA 4DIFA 3NT2A 4BNGA 3PYMA 4AJJA 2ZYAA 1K6JA 4ALKA 3IDSA 5L95A 4INAA 3LC1O 1H0KA 3R3JA 4MVJH 3U4CA 2PY6A 3JQFC 2VQ3A 4PZEA 3TQHA 3H5NA 2G5CA 3PGXA 4W6ZA 1GQYA 4CM8A 2CNBA 1SC6A 3AU8A 4BVAA 2ZJ1A 1E92A 2FRDA 3WJ7A 1PJSA 1W6UA 3SC6A 5F21A 3B70A 3FR7A 4AJNA 5K6AC 1NFQA 3AI2A 3P5SA 4D41A 3LF2A 2ZCUA 3VTFA 4XGIA 1FDVA 2A35A 3L9WA 4F45A 4WOJA 3JYNA 4F6LA 1KETA 1T2DA 3T7EA 4HX5A 4IM7A 5JCJA 3S55A 2BI8A 1H2HA 4PVCA 4IS2A 1N92A 2WSBA 2SCUA 3UW3A 1U9JA 5A9SB 1YJ8A 1ZVMA 4WGGA 5G0VA 2ZYGA 3TL2A 2O3TA 3GEMA 4J1SA 2I6TA 4MVJP 4CM6A 5AVOA 3WNQA 3I9JA 3JQ6A 5JPIA 5LDGA 4AJOA 4W7IA 1JKFA 3ENNA 1FXSA 4TQGA 9LDBA 3R6DA 4IMRA 2O2SA 2PWZA 3KYBA 4CMKA 2OBYA 4FSHA 4MVJF 4BQPA 2NV6A 3DZHA 1LLUA 1R0SA 1WDLA 2VRCD 3MWEB 2NU7A 2UUOA 4E13A 3JQAB 1PX0A 2FY8A 4ND2A 2A4KA 3NDRA 4GX2A 3GRPA 3F5SA 5AXBA 4RGBA 2EGGA 2C0CA 2VWGA 2W90A 3VOSA 1NR7A 3PWSA 1U8XX 3L07A 4WCDA 4QO8A 3UXYA 4CJXA 3JV7A 6ADHA 3HDYA 1NHGA 3DBLB 2EKQA 2FSSA 3O03A 3CH6A 4II3A 2O50A 2X0IA 4DVJA 2W2LD 4J0FA 8LDHA 1Q0HA 2DC1A 2WE8A 3JYQA 1MG0A 4B8ZA 1VSUA 3F3SA 1Y1PA 5JCJD 4HFJA 3M1AA 2VRCA 4N5LA 5B4VA 2NLOA 4BNMA 2NTVA 2OXIA 2BH9A 2ZB7A 1I3LA 5IFLA 3MJVA 1I8TA 1DO8A 1HYGA 2WJPA 2HAEA 4R3NA 1ZBQA 1HZZA 4NBWA 3NGLA 2GASA 4G2NA 4YVFA 1HEUA 4BGUA 1HE2A 4IINA 3D4NA 1X1EA 4XDZA 5L4SA 2GN6A 1ZXLA 3W8FA 4E5YA 4PLHA 3WSVA 1U2GA 4NK5A 4EBFA 3KYCB 2UYYA 3EYWA 1UZMA 1WMAA 1GDHA 2PGDA 3LK7A 2CVZA 4GMFA 4U5QA 4CM3A 1L7EA 3E9QA 3OP4A 2IXAA 3HNPA 2E37A 4OXKA 4YT4A 4LCJA 4AJIA 2YQ4A 1DRUA 5L4LA 4TRRA 4CLRA 3PHIA 4AJ1A 3D3EA 4PLYA 3PJDA 3JD3A 2HSDA 1XQ6A 4EGFA 3EVNA 3HDJA 4J4TA 4PG8A 3QVSA 1PZEA 3W4KA 1P9LA 4ZQGA 4B8WA 1E5LA 3U3XA 2FWMX 4XRRA 3B1JA 1Y5RA 3KHUA 1AXGA 1OC2A 4O0LA 1LC0A 4XIJA 3U9LA 1Z74A 2LDXA 2WDZA 1T4BA 1VM6A 3GDGA 3WTCA 5U4QA 1ADCA 2X5OA 5JAZA 4AJHA 3M2TA 3KOUA 5KKAA 4HWKA 5L51A 5L45A 2B5WA 4RVUA 4ZA2A 1A4UA 1ZXBA 3GC6A 3E5RA 2P68A 4MOWA 4D42A 1RJWA 3ZWVA 3JQDA 1J4AA 8ADHA 1MUUA 1ZZEA 3OQBA 1DC5A 3ZWOA 2Z5LA 1P1IA 2Q2QA 5IZCA 1R15A 2H6EA 4W9NC 4CQLB 1ONPA 3D0OA 3VZSA 4BMNA 3KLMX 3F47A 1G0NA 4D79A 3IUPA 1V3TA 2WYUA 3PHLA 3H2ZA 2PGJA 4RPLA 5IJZA 3GPDG 1E6UA 4GVLA 5F1KA 3FTNA 2VT3A 3F6YA 4IDFA 1E1KA 4ITUA 4CQLA 5JYDA 2XOXA 1ZJYA 2NNLD 3DL2A 5CPBA 4R69A 4FB5A 2GZ1A 2AEJA 4Q3DA 4RPKA 2V6GA 3ENKA 3ZWAA 4J2OA 5T64A 5ER9A 1TI7A 3VPFA 3DBHA 4NZ9A 4PLWA 2DT5A 1XSEA 1NWCA 3DBRB 3JQCA 3B20A 3WGIA 1TA4A 5A06A 1ENOA 1P3DA 1UR5A 4YT2A 4MKRA 3ASUA 1GTMA 1B8UA 3MTGA 3JD2A 4U8GA 4W99A 2NWQA 5T57A 4JGBA 5A5EA 3NDIA 1PL7A 4OYRA 3OETA 2ZATA 4P22A 1ISHA 2CZCA 3GUCA 2C29D 3JQ7A 1M2WA 1NPYA 4MP6A 4PRKA 4OOEA 2AQKA 1CIVA 3HDQA 4JBIA 3GK3A 4XYLA 3KM0A 5KKCA 3OIDA 4IBOA 2XF8A 3I6QA 4D3DA 1LC3A 5HRUA 4GMGA 2Y1DA 1P1JA 3H3FA 3KYDA 4H7PA 4Q39A 1I0ZA 1UXGA 5G4LA 1MC4A 1PGQA 5I7VA 2G82A 3BMNB 1KS9A 3V1UA 5FFFA 4L9RA 4CLOA 3LSYA 3ZWYA 1GV1A 2E82A 2P9EA 3G79A 4OO3A 1ISJA 2HK7A 3R3SA 4M49A 3WNVA 1AXEA 5IAAA 1M76A 1HYHA 3H3JA 2HKIA 2FPIA 3OEYA 2C5EA 4IDCA 1U4SA 4ND1A 5TS3A 1YB5A 1X7GA 3V1YA 3I9MA 1MP0A 3GQVA 2VOJA 3OQ6A 4RQTA 1E0DA 4XJTA 1E3SA 4NK4A 4DIBA 1GYPA 2QRJA 1SO8A 1QYWA 2FMUA 4CMBA 3RC7A 4C7KA 1CERA 3OJOA 3QRWA 4GGOA 2ZQZA 1CJCA 2CF6A 1U4OA 4XRGA 2C2YA 1EK6A 3JQ9C 3ONEA 3S2IA 2JHGA 5T8KA 1LLQA 1O0SA 1HXHA 3DBHB 1SB8A 3OJLA 3RJ5A 3RUDA 5A9RA 1X15A 3GFGA 4IDAA 4J3FA 2W4QA 7MDHA 4E33A 2OP1A 2G0TA 5ICMA 1T1RA 1MXFA 4OH1A 1EEHA 1JQBA 2OBNA 2GZ3A 2XPCA 1DIBA 3JQEA 3AI1A 4PRLA 3VZQA 1B3RA 1CYDA 2D3TA 4AJPA 4QUKA 2LDBA 4HFRA 1JWBB 4QO7A 2QRKA 3VPGA 1A4IA 4G65A 1CDOA 3VPHA 3BTSA 4PLGA 3AM4A 3OM9A 4CM4A 3EUWA 1UH5A 4WEQA 3PYXA 1PWXA 3C1AA 2VNSA 3JD1A 4NI5A 5CP8A 3HB5X 5GZ3A 3CEAA 3I4FA 3DZKA 2AQHA 2PD6A 3SC4A 1K6IA 5G0UA 4OSPA 3K2EA 5HBRA 4UUMA 4CLXA 4WCFB 2Q1TA 3QVTA 2NTNA 2YHIA 5ITWA 2J8ZA 4RF2A 3WMXA 4DMMA 3DHYA 3KEOA 1KEUA 4ILKA 3WG9A 4FCCA 1NNUA 4GKVA 3OJEA 5IDXA 1E6EA 1TEHA 1KVUA 3WGYA 3U49A 1Y81A 1N1EA 3DQPA 3H6KA 3OJFA 1WMBA 4Z3KA 2XXJA 4KWHA 3ROKA 1ZK4A 2X0JA 1JVBA 4BO1A 1OC4A 1CQJA 2NVUB 3ANMA 1DXYA 2HMUA 4UULA 3U09A 1BW9A 1YL6A 5FI3A 3G1UA 3K6JA 4OMUA 5ILGA 3EAGA 1QYVA 2X86A 2R00A 4J1NA 4M86A 4Z0HO 1YVEI 1IUKA 3UVEA 4E12A 3GGPA 5A3VA 1YBAA 2EV9A 3A9WA 4EJ6A 4NBUA 3G17A 4GGPA 5HS6A 1C1DB 2IXBA 3T4XA 4GLOA 4R41A 1P44A 3PJFA 4KDFA 3TL3A 1D1TA 1NM5A 3FF4A 5JCXA 4LSWA 2BELA 1LTHR 2EEZA 3CINA 2DBZA 1PJQA 1E1LA 1BDMA 3O9ZA 1QYXA 1Y9AA 4S3MA 2CMDA 2PR2A 5IN5A 3IC5A 2J3KA 3UCEA 4B4WA 4PG5A 1ORRA 4MKZA 2ZIZA 3I9OA 1EDZA 3P2YA 2PKRA 4UREA 4ALNA 5BSGA 3LLVA 1CQIA 1TT5B 5DCUA 4ND5A 4B7UA 4IZHA 5CDTA 2G17A 1SMKA 2B4TO 3ZDFA 1E3LA 2AG8A 1G0OA 1E3WB 1E1NA 2Z1MA 5FI5A 1U3UA 1DJQA 3IKVA 1YE3A 4E5MA 2QYTA 3DZJA 4KQWA 1KEWA 1ZJZA 3GFBA 2DLDA 2HJSA 1S6YA 1GV0A 2PK3A 2AXQA 3L0DA 1UDCA 5DBFA 1QORA 3PQEA 1Q7CA 4A7PA 4WPGA 4I5EA 3P7MA 5F5LA 3WIEA 5EN4A 4Z9FA 3QSGA 2W8ZA 3NEPX 4NJMA 1XCBA 2ZB8A 1UZNA 1F14A 1GAEO 3ROMA 2RHCA 2X7HA 3DMTA 4R68A 5AXDA 2P9CA 4IQ0A 4XX0A 2EW2A 3V1TC 4NJOA 4CV3A 2ZJ0A 1UXKA 5I8ZA 5JS6A 2PGLA 4OSOA 4OQZA 1Y6JA 2GN9A 1T2CA 3CKYA 3NUGA 1H6DA 3JQBA 3K73O 4PLZA 1X0VA 4GKBA 3MCVA 4YDRA 3WR5A 3NYWA 1P33A 4AJLA 4E5NA 4MIOA 1GADO 1JW9B 4PCVA 1TVEA 2Y0DA 4RVFA 5T6BA 1ISMA 3F1KA 1T4DA 3BHIA 1IPFA 2G76A 3D5TA 4FPXA 2O3QA 2DPHA 1ML3A 1SPXA 2OUIA 1H6BA 1YQXA 4ZICA 4CLDA 1WLYA 1P1KA 1EDOA 1SOVA 3C7CB 2JD1A 4B3IA 4PLVA 1K0UA 4B4UA 5B4UA 4KMSA 2I9PA 3C8MA 5DF1A 1XR3A 4QX6A 3ZW9A 2Y1EA 5A3JA 1H5QA 4ALJA 5CDYA 3LC7O 1HDYA 1BVRA 2UAGA 1J0XO 1UXJA 1N9GB 1DDOA 1A9ZA 3BMCA 4J7XA 4C4OA 4XCVA 4GH5A 3PDUA 2P4HX 2Y1FA 1YKFA 4RL6A 3G1TA 3GZNA 4WLEA 1UAYA 4CM8B 1W8DA 3DEYX 5C5IA 1RYDA 2B4RO 3PHHA 3BAZA 3PJEA 1BHSA 3SXPA 2J5KA 3AY6A 1XU7A 3ZHYA 1QKIA 5JAQA 1DIRA 4CQMB 4UUOA 4CUJA 5A1TA 3TOXA 2EJWA 2Y1CA 1ONNA 3VDQA 4ZQBA 2VTDA 2YYYA 2JFFA 3JYOA 4EUFA 1ZO8A 1DRVA 1PJ4A 3BTVA 2Y0EA 4J4BA 2HRZA 5DULA 1I10A 2XAAA 2CSUA 3HSKA 5G4KB 5IN4A 4N5NA 2Y66A 5JC8A 1HZJA 3MJTA 1Y8QA 1SAYA 4JQCA 4CUKA 4D45A 2R00C 2PZKA 3L6EA 1LSSA 2WEKA 2FN7A 3ZWNA 3CUKA 4YTEA 1PQUA 4AG3A 3MJEA 2QYSA 3GNQA 1GZ4A 4MIYA 3FSRA 4BKPA 5JXWA 1U3WA 2F00A 3K8ZA 4XQGA 3OSUA 5KOIA 3UKOA 4BKRA 2Q1WA 4JXKA 3IS3A 4YAIA 4ROSA 1V6AA 1GU7A 3PZBA 4LGVA 4R01A 4XKJA 3SX2A 4N54A 3D64A 2GO1A 2C07A 1HDRA 3WS7A 4ZJUA 3NT4A 2NU8A 3W6ZA 1IE3A 3DZBA 1ID1A 1GUYA 4CM7A 3QVOA 4B3JA 4QEDA 3BTUA 3HG7A 2DBVO 2IYPA 2E48A 4JROA 2Y99A 3ZH2A 1T2FA 2NSDA 4IDEA 4J0EA 4WK6A 1Z7BA 4DTIA 2DUUA 2H5LA 4Q3NA 3PGJA 2QQ5A 2HMSA 3NDJA 2ZYDA 2EJVA 1OAAA 1D3AA 3WLFA 1KOLA 2ZQYA 3AOEC 1N7GA 3WICA 2FPPA 2OGUA 2BGKA 1C0KA 2Y93A 4J1QA 1YS4A 2NU9A 3COSA 5TJ9A 1VI2A 4AJ2A 2X5JO 3VZPA 4CR6A 1YDEA 2HU2A 4L4SA 3H9UA 2GNAA 4D3SA 2O3UA 4OIMA 4HFMA 2YW9A 3BA1A 4B4OA 2FR0A 3JQAA 3W4IA 5DBGA 4WNCA 4K28A 2AW5A 4I5DA 2VHZA 1EMDA 5EQFA 4LW8A 3ZV3A 3BTOA 3RUHA 4OGWA 4MVJE 1RYEA 2OMEA 4PIVA 3UICA 1M6HA 4Q3EA 4OHUA 3ON5A 3DZGA 5IZ4A 4E3ZA 3IJPA 3E8XA 4BQRA 1ADFA 1QG6A 4ZU3A 1GCUA 5HWSA 3VH3A 5ITVA 4UEOA 2NTJA 2O48X 1UJMA 4CM4B 4JN6B 2X22A 2QW8A 4P4GA 2QZ9A 3ANLA 5JNLA 3N74A 2DFDA 3RASA 5I9NA 3T7CA 1DC3A 4XDYA 4E31A 5BT9A 2AHRA 1L1FA 3GGOA 4NJMB 1I2BA 1ZCJA 2Y0CA 3MWDB 5JO0A 4BS9A 1GZ6A 2YDYA 4MJLA 4YJHA 3HJAA 3KO8A 3EGOA 3DFUA 4BHTA 3CPSA 3FWZA 3PHGA 3RSHA 4L8VA 1V0JA 3A4VA 1O94A 3P19A 1VC2A 4LK3A 4A2CA 2DTXA 5GMOA 1HLDA 4YJFB 3E9MA 2D2IA 4DLAA 2WD7B 1N8KA 1PS0A 1GUZA 1Y8RA 3FNFA 1HT0A 1LX6A 1QLJA 4HBGA 2R6JA 1E3JA 2PTGA 3AWDA 3C3XA 1R0KA 4IMPA 1VKNA 5TT1A 3NTQA 1YL5A 2C7GA 3LU1A 2YUTA 3QIVA 4D0RA 5BSFA 4CM1A 4CR8A 1NPDA 2CDBA 4YRBA 2CVOA 1NVTA 3WGQA 4I1IA 4TRJA 4H3VA 4UEKA 4FDAA 4R1SA 5I9MA 4CMHA 1JTVA 3O26A 1GPDG 3OQ1A 4RVGA 1NAIA 2JFGA 4K1LA 1GPJA 3PYLA 3BMNA 1R0LA 1T25A 1V9LA 2RHRA 4GI2A 4LMRA 1MV8A 2W98A 3RUEA 2WE7A 1ISIA 3A14A 4BO3A 2X6TA 1BSVA 3WGGA 4QT0A 3W4JA 1MFZA 4XIYA 5CEEA 2VYNA 1DEHA 5L53A 5JDCC 5BSEA 1HE4A 2P5YA 1BW9B 1QMGA 1HE5A 2BI7A 4B4VA 5FWNA 1A5ZA 1LDMA 1YL7A 1BMDA 1O6ZA 4ZGWA 1DFHA 1Q1NA 4UVDA 4YB8A 4CM5A 4FFPA 3JQFA 1I2CA 1U5AA 5KNLA 3JQ9A 4FBGA 5JMWA 1AGNA 5A03A 3RC2A 5B1YA 4DC0A 1XIVA 4IQGA 2TMGA 3AUSA 4JJFA 5L7WA 1NPTO 4Z3DA 3NX4A 3DBRA 3BZUA 3PP8A 4E6PA 4UVGA 1VE9A 2OOSA 4K6FA 4FS3A 1KEPA 3GH3A 4I08A 1NQ5A 3DXFA 3WMWA 3WYBA 1YB4A 3F9IA 4J7CA 1O5IA 5JO9A 4BB6A 2BHLA 4D7AA 5TGDA 4WNIA 2Q2WA 1Z6ZA 2IZZA 1LDNA 3ROQA 1D4FA 4FFNA 1AHIA 4AICA 1LI4A 1YBVA 5KIAA 4LSMA 1FMCA 2YFHA 1U5CA 2J5RA 2B5VA 3F4LA 2AE1A 3R0IA 3AOGA 3ULKA 9LDTA 3IKTA 5TC4A 4QECA 4TRMA 4YYZA 1R4NA 4ALLA 1R4NB 1DAPA 4MVJI 2Q3EA 4CM9A 1XEAA 3VPSA 5IF3A 1I3KA 5G0SA 1F06A 1ZW1A 3AK4A 4BNVA 1O89A 4RF4A 3C85A 3L77A 2J3JA 4NR0A 4IPTA 4E2ZA 5T67A 1BG6A 1O8CA 1V35A 4OAQA 4EW6A 4BNTA 5TF4A 1U28A 1BXGA 3HN2A 1QXSA 5KVCA 1GEGA 4D43A 1T26A 1SEVA 1M66A 4BO8A 4MP3A 3HB4X 5T5QA 2F1KA 4E30A 4YXFA 3VPXA 2P9GA 4F46A 3OIFA 2P4QA 3QY9A 3W6UA 3NGXA 3RUFA 3EK2A 4WJZA 5HTOA 2HMVA 4J4HA 2OZPA 5JDCA 1Z82A 4U6SA 3C7DB 4IGEA 3DAPA 4BO4A 2JCYA 4YJGB 5ES3A 2WD8A 2AA3A 2I5PO 3GNSA 4P4NA 4LCEA 1YOVB 1LRKA 3AOEA 1F0YA 1QP8A 1SNYA 2J3HA 1ZSNA 2ZTLA 4UVIA 1QLHA 4IY1A 4RO0A 5JE8A 1ZEJA 2HMWA 3AUAA 2AQIA 5TSDA 4PG7A 4QXMA 1N1GA 4D44A 3WX0A 2IE0A 4PZDA 5I7FA 4CQMD 3KETA 3W8DA 1LDYA 5JAIA 4Z0TA 1H6CA 1JVSA 4XA8A 2ZK7A 1KY4A 3FBGA 3H9GA 3RC1A 3KYCA 3EY4A 5F1PA 1GFSA 4EDFA 1YDWA 3E1KA 3RAJA 3TSCA 1DBVO 4Z9YA 2WWRA 5I9LA 1HETA 4BO9A 3AM3A 1DHRA 2ZKLA 3K5PA 3DONA 2Q4EA 1ISGA 4LVUA 4XYEA 5BNTA 4KOAA 1EQ2A 3KBOA 1H93A 3JQ7B 4FFOA 1PZHA 5AYVA 3LC2O 4GSLA 4O6VA 4BNKA 2A9FA 3MEQA 4J90A 3QHAA 4UAGA 4RVHA 2D5AA 5J23A 2DTEA 2X5KO 4E0BA 3RFVA 2IEBA 4BKUA 1CEQA 4NQZA 2QHXA 3KSDO 1Y8RB 1UP4A 2PV7A 1ULUA 3IQDB 2VZ8A 3MOGA 4DLLA 2B36A 2JKVA 2O3RA 4YWJA 4DYVA 5DNAA 3Q6IA 3M1LA 1IHXA 4HNGA 4RPJA 2WTBA 1ZUD1 4TVBA 1A9YA 3DB2A 4FGWA 5DP2A 3KV3O 4CUZA 1V8BA 2VHYA 4KWIA 5L4NA 4FGSA 4YT8A 3RU9A 4E5KA 1I36A 1ZNQO 4DWVA 5COAA 5GZ6A 4KTTE 2ZB3A 3IUSA 4R3WA 4YJHB 3LDHA 1R4MA 2B0JA 1C1XA 3UOGA 5CDUA 2YFQA 2VRBA 4KP7A 4YRAA 1SBYA 2JL1A 2PZMA 3WXBA 3GEGA 3D1LA 3ZWPA 4IUYA 2JHFA 4FN4A 4MVJD 3BHJA 4WECA 4U6QA 1KERA 3IAHA 4W9NA 4EYEA 3BXXA 4DA9A 2H9IA 5BNFA 5C7OO 2QG4A 3RROA 3I9NA 3PVZA 2CFCA 5EL0A 3AFNA 1K6XA 3H65A 4IXTA 1H9AA 1WPQA 4PGFA 4CMCA 4RV9A 1A7AA 3PIDA 2JD2A 4NBRA 1WVGA 4NHEA 1F12A 1PQPA 3LLSA 2PKQO 3JQAD 4WLVA 5C3MA 3GDOA 2Q2VA 4UVEA 2R2GA 1QRRA 3GVHA 4WOKA 3TPCA 1W0CA 1C0IA 2A94A 3UGKA 1LLCA 1HE3A 1PGNA 2Y1GA 2VZ9A 2O7QA 1P1HA 1X7DA 5G0WA 1DLIA 3AUTA 5DT9A 4B7XA 1K3TA 4R1NA 3JSAA 4CL8A 2H63A 3LT4A 1OZAA 4RCVA 4A5OA 2UDPA 5THQA 1HL3A 1WAMA 5DZSA 2HRBA 2I65A 4XYMA 3DO5A 1MB4A 4KDEA 1J6UA 3UCFA 3PI7A 3S8MA 3WDSA 1DB3A 4K26A 3ZV6A 4TZKA 2GDZA 3JD0A 4FD3A 1ZSVA 2XXBA 1T1SA 3DZFA 4YQYA 4J43A 4XD2A 5A05A 3V5NA 3O8QB 3ITKA 3SLKA 2D0IA 1GR0A 1K5HA 4A27A 3QLJA 1E7QA 1ZKMA 3U5TA 1SCUA 5IXYA 1I01A 4XZ3A 2W2LA 1B16A 1UUFA 1H9BA 4D46A 4M55A 1HRDA 3IIEA 3HHPA 3TOZA 3DBVO 1YXMA 1Q7GA 1CF2O 5IZCC 3SEFA 3X2EA 2EKLA 3ICCA 3K2BA 3Q11A 4BNIA 2Y1OA 2EF1A 1NVGA 1ZK1A 1VRWA 1UDBA 4OJNA 3TFQA 2E4AA 3ZI0A 2NM0A 3RFXA 2I3GA 2CDAA 1MC5A 3UF0A 1PL6A 3FI9A 4BNHA 4F6CA 1I2ZA 1V3VA 2BGLA 1JKIA 2V6BA 3FR8A 3NTOA 3RIHA 1A7KA 4I8XA 3PFWO 4CLOB 3E48A 2VWPA 3TRIA 1Y7TA 5GZ1A 4GBJA 5KCZA 1BWSA 3ST7A 1PS8A 1PL8A 2EG9A 1EVZA 2GCGA 3WOHA 4RQUA 3BYZA 2GUGA 2YV3A 2UUPA 3H2SA 3PIIA 4LN1A 1LSJA 3EHEA 1BDBA 1VJTA 3ZV5A 1UP7A 3GT0A 3VZRA 3ITDA 4KQXA 5IDWA 1EBUA 4LISA 1EQUA 3ZU5A 3CZMA 5K9ZA 5AQ1A 2Q49A 3HZZA 3WGZA 1XG5A 2OP0A 3H9JA 2NADA 2POQX 2O7SA 3KB6A 3TNLA 3ZZNA 4GL4A 4LVCA 1PTJA 2JAPA 1E3IA 1PU2A 3DR3A 3GA0A 3IP3A 6LDHA 3GZNB 4RZIA 4YACA 5TNXA 1M75A 4U0KA 4OL9A 2Y67A 3FNEA 3P2OA 2AE2A 4CPDA 2CDCA 4Z0PA 1A72A 2RBEA 4PLTA 5TLSA 4IDGA 1MGOA 4BNZA 4FOOA 2FPGA 3ANNA 3QE3A 3FBTA 4O63O 3ADOA 4XQCA 1FF9A 4PLCA 4KUEA 3RVDA 4GAEA 4HV4A 1LEHA 3UHAA 4DPMA 4IJVA 4URFA 2C7VA 4CL3A 2PD3A 4F3YA 3CXRA 2IRWA 5CPFA 2HMTA 4YCAA 4FOSA 3ONFA 4AJEA 4DL9A 4ALIA 2ILTA 5MDHA 4NIMA 4BNYA 5AXCA 3JCZA 3WBFA 1DIHA 4R9SA 4EI2A 3HN7A 3M2PA 4O5OA 2CD9A 3RKUA 2HQ1A 2C2XA 5COQA 4WUVA 3D3WB 1PS9A 1OI7A 4NFHA 4NBTA 2BFAA 3G3EA 4DIOA 1XQ1A 3OA2A 4UVHA 1A27A 1GQQA 4ZD6A 4BKQA 5JY6A 2VZ0A 3FNGA 1R4MB 3QVWA 4ZQEA 4NMHA 1G1AA 4E2WA 3NRCA 1C3VA 2UVDA 4TVOA 3TZHA 3DDNA 3S2EA 4A10A 1GQ2A 4AL4A 3OHSX 4AVYA 3OA0A 1P74A 3FN4A 5BQFA 4ID9A 4N7RA 2I3AA 3C1OA 3WQSB 4DUPA 4A0SA 2GYYA 1YB1A 1LSUA 5KVVA 4L4XA 4OKNA 3WQQA 5DCYA 4O1MA 2GN4A 3BMOB 1LUAA 3GZ4A 1ZK3A 1R16A 3FPLA 4GX1A 1H94A 2X4GA 3KSZO 1LRJA 3KYDB 1KYQA 3RFTA 4J91A 2QZZA 2NACA 1B8PA 2CUKA 3NJ4A 3ZNPA 4RJTA 3V2HA 1P1FA 3Q2KA 4XGNA 1Y8QB 1U2DA 1DHTA 4BO7A 1BTOA 5CDGA 2GGSA 1YOVA 1KVTA 3L4BA 1JDJA 4H16A 3V2UA 4MDHA 3U4DA 1EVIA 4IJWA 1RM5A 3HFSA 4FFMA 2V65A 4GX5A 4N18A 4BNNA 4QFCA 3AW9A 3ETEA 3X2FA 2X0NA 4QTZA 3MZ0A 4YR9A 5L7TA 3U62A 1MG5A 4MVJM 3AI3A 1QSGA 3WSWA 1KVRA 5JMPA 4H15A 1PJBA 1NBOA 4TZTA 3GHHA 1KEVA 1IY8A 2HUNA 2C54A 3VVBA 1ISFA 1VL8A 4M54A 4B79A 1IYZA 3DOJA 4C7JA 1PGJA 4TSKA 4BV9A 4PN3A 2J5QA 3OEWA 4UEJA 4K9DA 2O23A 1BVUA 1DRWA 5CG1A 2AQ8A 1CETA 3NV9A 4L76A 4DBVO 5TJHA 4NPCA 5TT0A 1YJQA 2PKQP 4GLLA 2EKPA 3STHA 3VH1A 2CF5A 5CG2A 4CLEA 3T4EA 3PWZA 3OICA 3GVCA 1LJ8A 2E49A 1XWFA 3QA9A 3NKLA 1HDXA 1X14A 3KRTA 2YHIB 1E1MA 1QYDA 1LQUA 5EIOA 3KEQA 1U3VA 1XDWA 1Q0QA 1M6WA 4MINA 1GY8A 4J16A 3RBVA 1F8GA 1SB9A 4I5GA 1UP6A 4Y6SA 3GR6A 3AY3A 3OF2A 2C20A 4U0JA 1GYRA 2P91A 2VUUA 3TFOA 3A06A 2B37A 4FJ1A 2Y68A 3IMFA 4L74A 4ESOA 1B8VA 1NVMB 3ZGYA 1KC3A 1HWYA 1OFGA
chains in the Genus database with same CATH superfamily
3UG7A 2PZJA 1N5LA 2BZ1A 2IDKA 4UBJA 4DZTA 5BMVF 2PGAA 2DFVA 4E21A 5FL3A 2IIVA 2D7DA 5I7SA 5JNVA 3ITEA 4MS1B 3PKJA 2G7ZA 3KXIA 3K1AB 1NRWA 4FMDF 4TXMA 2MU1A 3BWMA 3DMHA 5DTJA 4JYAB 4LRUA 1CUCA 2QM0A 4BPRA 1XAGA 3P94A 4JDUA 2EWVA 3IYLW 1XRRA 5KWJA 1M9NA 4ZHSA 1LW7A 1NSFA 1NXTA 3DEKA 1GZSA 3JQGA 4OPMA 4RSHA 2BN4A 1ZD1A 2NO1A 3G1WA 4N65A 3WRXC 1UBCA 2SBTA 4Y9TA 3WLTA 5KJFA 1VJ0A 3BB3A 3O47A 3T1YB 4C0LA 1PSDA 1Q7BA 3WLOA 3RANA 3M83A 3PTZA 1IL0A 4JEMA 5FFMA 4A4DA 2ODEA 3RR2A 3QF4A 2YZGA 4F5DA 4C2TA 2VQDA 4BASA 2X5NA 1IDN1 4O2BF 1HT2E 1DC8A 2CNWD 2GFHA 2HF9A 3DJYA 5CHEA 1K2WA 1OWOA 3LCCA 1OLUB 1OXUA 4J9VA 2BGTA 3LT0A 4YRNA 1F5NA 3GN2A 5DGCA 1T8TA 3ZIAA 1Y7IA 4M87A 1OT5A 3CHYA 2QD3A 4UEQA 4WZZA 5IKPA 1FCJA 1VJRA 2ONCA 4B3DA 1ZFNA 2V7XA 4PE5B 4JYBA 4R5MA 5SZKB 621PA 1OX4A 4Q34A 1HYBA 4KZPA 1QTIA 3R20A 1PWYE 5FXMA 5EJ2A 3UHJA 3GO4A 5BVGB 4BFTA 1OBVA 1XZQA 2QXUA 4K6MA 4KREA 1U8UA 2XYVA 5F1OA 3H5RA 3DXYA 4FNAA 3ZZMA 5EKTA 1RAAA 5JBIA 3HRIA 3QVGB 5A0TA 1E3TA 2UYOA 1N5RA 5AK0A 1FYXA 2CE7A 1CUJA 4CIDA 4KBYA 4XSHA 3VYRB 2AMFA 2ZAOA 3ZN2A 3N86A 2VK2A 4IZIA 2A5DA 3HQ4O 5JATA 4NCAA 3OEEA 4IQ8A 3F3MA 1I24A 2COUA 4D4HA 2FZ4A 3JASA 1QIHA 4FUTA 1UZLA 2I78A 3I6IA 5DE3A 3VSDA 4B6RA 5KREA 1B1CA 2I91A 3HY3A 4HNHA 1XRMA 1C1DA 5AKGA 5HTKA 2DQKA 1WTAA 3EZYA 1LS6A 3HU5A 1SIWA 2FAXA 2DAPA 4LXQA 4W82A 4UC0A 1VKJA 4Y2HA 4HH1A 4RIEA 4R0MA 2EFYA 2XW6A 3CV3A 1NBEA 3K16A 1M2NA 4J7UA 1BXZA 4F06A 1YRBA 2OC9A 2V98A 3FCAA 3RKRA 4OA5A 1AX9A 1HSZA 1TC2A 3EA4A 3F97A 3EEFA 5F51A 2NVUA 2ZLBA 3K9LA 4KXMA 4RPHA 2ZTUA 1YT5A 2FX5A 1YQDA 4Z51A 3QX9A 3DMFA 3RU7A 1KE1A 5J3JA 4TS4A 1QQ7A 4RDHA 5TGTA 4CMIB 5AW1A 3DHNA 3B51X 5EG5A 3W1VA 3FVVA 3GJRA 3LWNA 2GSWA 4JMPA 1VJDA 4GWGA 3PUIA 4ZVQA 2F1RA 3O4HA 3RBZA 3D2BA 3RREA 5B4TA 5JAOA 1GUBA 3UN1A 3K0AA 2PCJA 2BONA 3GEDA 3KVOA 3A6GA 2IWRA 2CNOA 5HKOA 1XMVA 2XXAB 1D4AA 1DBSA 3CISA 3GNLA 1NI5A 4COOA 1APBA 1J06A 2ZI9A 3LW7A 4PC7A 1QPZA 3OE7A 4Z8YA 1UXHA 3NBAA 1NBWB 2PRKA 2YC2C 4UFPA 1CWUA 1J97A 1NF2A 1GZ7A 1UC8A 2FCAA 2OM2A 3BIOA 1WW3A 3GT7A 3OJXA 5CVDA 3WQHA 3L6CA 4C87A 5HGJA 1HKUA 2C5FA 1U5BA 4GI5A 1FDTA 1UBGA 3AFHA 3D7KA 4I9NA 4YK7A 3ZNNA 1UWLA 2WBLC 1O1YA 1CVRA 1W29A 4F2DA 5KYXA 3K6SB 1D0IA 5FBVB 1P1RA 3L0PA 1DUIA 3PC7A 3D2LA 3VH2A 1KJWA 3MS2A 4Y6RA 1JKXA 1Z2DA 1G6KA 3MJ4A 3A4NA 3PB3A 3R76A 4P9NA 5EIEA 1C9NA 2GCIA 5IHXA 2O2YA 3W79A 3IR7A 2JJMA 1H85A 1SWWA 4LMPA 4HXEB 5EIBC 4B3XA 4EJSA 1M8FA 4JBWA 3QSYA 4PYOA 4DAEA 4LECA 3QLTA 4GQAA 2ZUTA 4Z4QA 2XD9A 2WJZB 2XVYA 4J9UE 1N2ZA 4NARA 2I55A 4XVHA 5FR2A 2GFQA 2AHOA 2X8AA 3QXHA 2HNKA 3FNIA 3QPDA 4XARA 5F3RA 4F4UA 3OQMA 1M5RA 3EZFA 5SZJA 1X9HA 3D6NB 2COKA 3GDFA 3QVXA 4DRXA 3N3BC 4HATA 1UKCA 3ESXA 4HQLA 4PEVA 3N76A 4KLAA 3WNCA 1ADYA 3RTEA 1O9HA 4FC7A 4ER3A 2ZB4A 3ETLA 1HDZA 1EWVA 4OGFA 4A8JC 4C6SA 4DY6A 1JLKA 2JAQA 3CX8A 3AEYA 5EXEA 5AKJA 4YJ3B 1RCFA 4KRXA 5CVEA 3VDMA 2BFWA 1Z3CA 3CB2A 4O59O 4HXYA 3UOWA 1W2HA 2YZNA 2OZLB 3OVMA 3BD6A 3UWMA 4DCVA 3AC0A 4H9GA 1N5OX 3FB1A 4Q9DA 3ZWQA 1U7TA 3ACBA 2NXCA 2WABA 3G82C 4OL0A 4WERA 4YRPA 2OBFA 1L4FA 4MCHA 3G7NA 2OPHA 4JJKA 3KZNA 4JAVC 2ZYUX 5EXTA 1MNAA 5K3AA 4CKYA 2B4QA 1MQAA 1SRQA 2OFPA 1U63A 4LOHA 1YFZA 1YZKA 4AURA 2GUWA 3BKWA 2GH1A 4BBJA 3AVUA 3AUKA 2YOFA 4JJEA 1DFGA 3R09A 1EB9A 1EFKA 2JHAA 3D6FA 5D3MA 6AT1A 3TW8A 5J4VA 4EUNA 1RJGA 1UT8A 4MX8A 3SD7A 5EJFA 1KZ7B 4G1VA 2O19A 3OLWA 3T3OA 5HK8A 3VUEA 4C0BA 2AZTA 1ZKDA 5FQOA 1FL9A 5I7RA 5A9TA 3LGXA 1Z73A 2FU5C 3O2SB 1S7CA 1SKQA 5BMVB 2RI1A 4JCCA 1OASA 4BZXA 2ZITA 3PE3A 2X58A 4GVXA 1AUPA 1XN1A 2OKCA 4PYJA 1MXHA 4KXXA 1CQWA 4M88A 1P0FA 4AKEA 2TMYA 4Q00A 3B1KA 2Q41A 4F9TA 4GSKA 3K7EA 4GDMA 4DIDA 3ELUA 4ZHQA 1UM9B 4OM8A 3ORRA 4JLKA 3G5TA 3L18A 3FGPA 4UHBA 3ZY3A 4EH1A 4CG1A 1WCV1 3KZKA 2V59A 1CR4A 3KZVA 5JARA 3IJRA 5KTTA 5J5AA 3DLBA 4A6DA 5EHNA 2Q27A 4LVOA 4R83A 3UYLA 1L7AA 3N2EA 1G55A 5JCOA 1F1JA 4V03A 1T24A 3ASYA 3G8CA 3SHWA 2Z1DA 4WTOA 3DGEC 2NZVG 4IWYA 2W70A 5FUMA 1I0IA 3HR7A 4X1KA 4BGDA 3KXDA 5DI3A 1FYWA 4EPRA 3VMFA 1EHYA 3ZW8A 3MWEA 1MR3F 3DBOB 4X3PA 4ZT3A 3D3WA 2YN2A 4KKXB 3RS5A 4Q9IA 3PJGA 5JROA 3TEJA 1A71A 4ZZ1A 1CRWG 2LZ0A 4E2FA 2XVAA 1Z0UA 1VRCA 4FEAA 4GR9A 1JAXA 4TKMA 1IY0A 2R6GA 1XHEA 2WMDA 2YXDA 3BBPA 3Q5DA 2JJQA 4I6EA 4PC1A 5CBPB 1OV4A 7ADHA 1NQAO 3DKRA 3CRVA 1E9DA 3M3PA 4JJ8A 4V2UA 2RE8A 3ZJVA 1KWKA 1IG3A 1GG9A 4AW9A 1RACA 1ZVVA 2UXBB 1DG3A 5CD1A 1U3TA 2QUIA 1PBNA 4PR3A 4ND3A 2HU8A 1JB1A 4RZHA 5LPNA 5TEWA 1LWOA 3MB8A 1A98A 1U0NA 3NHYA 2VTBA 4AFNA 3A9RA 2F8TA 1SOWA 2BHRA 3GBPA 1JHZA 2JNWA 2WICA 1N2CB 2ZS8A 2HL6A 3ZVMA 1EJBA 2MR6A 4D8VA 3EXFA 3PQ4A 1C8BA 2AR7A 1IWBB 2W7TA 3L6OO 3OOHA 4RCZA 4OLBA 4A5SA 3A9UA 4BMSA 2BTQB 4EAQA 2A92A 4G8CA 3TTSA 1QVRA 2KLBA 4E08A 4ARVA 1L3IA 1E7MA 4IDDA 1LK0A 1DSSG 1YCGA 2RAFA 5LD2C 3DUFB 3EFHA 3NHFA 4QARA 1I3NA 4WUTA 1OIVA 4U7DA 1CDDA 2FX2A 1JAYA 2O3JA 1QHHA 2QIPA 1I32A 1OSNA 2FW1A 4QSMA 2E4ZA 2RH8A 3LSTA 4KBFA 4LXHA 4EHJA 2FB9A 3Q9NA 4S24A 4ZZ0A 5DHRA 5GV7A 1JBKA 3LA8A 3LUBA 3Q0TA 3M3DA 2VCYA 1ZI6A 3NAZA 3RVMA 4EZBA 5HS4A 3NT5A 2EZ8A 5IXSA 4EG8A 1M1ZA 1NQXA 1PD1A 1BS9A 5JTTA 1PGOA 3C8ZA 3EVTA 1USKA 1ZWLA 4R1MA 4G8BA 2WIJA 4LXYA 3KHKA 1G3QA 2R1VB 3D3QA 4QU8A 1QC5B 2GR9A 5EWMB 3RTAA 3OHPA 4D9FA 4US2R 1CS0A 4ZARA 2OXTA 4A2PA 3LG2A 3NAMA 2WI8A 2OOKA 1MKYA 1JWAB 1LDEA 3CQ9A 7AT1A 1HDEA 3GN1A 3I34X 4OG2A 4G85A 4PZLA 2Q50A 3BH6A 3C3CA 5FF9A 1XTIA 3DFZA 3TEMA 3E3OA 2DZDA 5AUNB 1WCYA 1E7RA 1USUA 3EODA 2OWDA 3ZHXA 1GZDA 5AM2A 5JRZA 4KO4S 1P3Y1 3HXQA 2CUNA 4LZOA 1XVVA 5AW3A 3L6UA 1YKGA 1QH8A 1ADBA 2BAGA 1TPZA 3GUYA 3RV3A 1UOQA 5KB3A 2CY0A 4DXHA 1M0WA 3IBGA 2J67A 4KXFB 5ALUA 5KBYA 1XNQB 1PJ2A 3A6JA 1Z75A 5F77A 4AJ4A 4DDKA 2EWWA 5E2AA 4F93B 3KELA 4R1TA 1ZLYA 4Z7JA 1GO2A 1CUIA 2PVPA 2OFXA 1EJ0A 1YS6A 3DBLA 3M5CA 5DK6A 4C4XA 1I94B 1G8FA 2QT9A 5ALKA 5EWLB 1UPAA 3RUIA 3SEZA 1XZHA 3ZH9B 1GGVA 1GFZA 1A8PA 1K92A 3IQZA 1OBOA 3KXKA 1C9MA 3ZBPA 1EFCA 3ZWKA 4D99A 2CMFA 2CLSA 5F5NA 3VNSA 2XMQA 5ERXA 4NENA 5HZMA 5SYAA 2HHAA 1KJ8A 1KQGA 2H4JA 3CZ4A 2GWHA 2R86A 2JLAA 2I76A 3B3AA 4I4IA 5CK5A 4RYLA 1GNTA 4RVDA 3LZ6A 1L8AA 2PLFA 3HRKA 1VKOA 1KIFA 3F4BA 3RARA 1TVKB 4D8TA 4E11A 2GPTA 4L6AA 4URXR 4TMZA 4GW3A 5C4MA 4HVTA 3RAPR 1RBYA 1SXJA 5J5VA 5KHLB 2B99A 5TARA 5JAUA 2O4CA 2VSFA 4DJ5X 5TRTA 1ECFA 5BN4B 3HCAA 5GJCA 4WCFA 4TTAA 4CHGA 1R6DA 5CD9A 4Q12A 3WHKA 3BXPA 1SHJA 1WS6A 3OWOA 1J2RA 2VNAA 1KC1A 1PZXA 3ECSA 1ESZA 2ERXA 1N2CA 3MHPA 2YASA 2ZYVX 1V6CA 3Q1LA 4M60A 1KMQA 4QYTA 3PGA1 1WEKA 3SLGA 2HYIC 2Q5QA 3C87A 4MUNA 3ET4A 1SBQA 1S4MA 1X1RA 2HNAA 4KE8A 1PSZA 1WVIA 2QX7A 4JIGA 4QNRA 4WOPA 1SBNE 1AZWA 1UKZA 4FTWA 4LZJA 1WHSA 2AG5A 4RVOA 5I5GA 4C06A 1HNZB 1YR1A 5TQ0B 3ZTTA 1JR6A 1WBJB 1YZNA 4MGZR 5AVUA 5AW9A 4LHVA 3D5QA 3EQ6A 3KQYA 1QCYA 3OJWA 3TZQA 4DCNA 1I1NA 2M6RA 3PQ3A 1EXMA 1G16A 1KTIA 3FTPA 1Z2AA 4Y9RA 3JATA 2Z6UA 1B2LA 2BSXA 2C99A 3H99A 4OAPA 2PNFA 4US1R 3WK4A 3X44A 1A9TA 5ILQA 3LT1A 3FCSB 3NTRA 5AKEA 4BCDA 4EHKA 1EUZA 1FDWA 1AQIA 1PZGA 2C3OA 2BH2A 1PUJA 3PLNA 3VKVA 3UPTA 4OA8A 1ESEA 2WYWA 3KQPA 2V7PA 4CN9A 4MHOA 2PT5A 2BR4A 1W5AA 2HDHA 3N6VA 2XGJA 1DAOA 2RFLA 3DFKA 3CG4A 3DWFA 4XLZA 4V2IA 4BO5A 3QX8A 4KN8A 3CY6A 1NLYA 2ET6A 1D5CA 4UARA 4ALMA 2I03A 2QSJA 2PLAA 4F72A 1PWEA 1F4PA 2CV0A 3LUKA 4FWBA 4F3RA 3DV2A 1H0RA 4ZHQB 1Z7GA 4JB0A 1MIOA 2HA5A 2QS9A 3OTQA 4FHDA 5FT9A 3ROGA 4FINA 4PFJA 1ZGZA 3TN7A 3TRFA 2ZPUA 3N2KA 3WQBA 2H1HA 4OI2A 1IRIA 1PQWA 3T1HB 2WM3A 4FLMA 3W90A 1A9XA 1ILEA 5LA6B 5AVWA 4DLBA 5LLDA 1RXSA 3NFRA 4HGOA 4ABYA 3UWOA 1ZMXA 2AEFA 5F78A 1IMJA 5DDIP 4QYXA 2YJZA 4UDOA 4W4TA 5FPPA 2Z6AA 1A7UA 1RPNA 4E09A 4A8TA 2WU0A 3P9SA 1RJ9A 1V8PA 2DQ4A 4L2IA 3UJ8A 3WWYA 4CKCB 2Q1SA 1YJCA 2H11A 2VAMA 1O95C 4JODA 3LQQA 1A9RA 1SBHA 1N9ZA 3FHLA 2ZBRA 4P4UA 4E3WA 2D59A 3WLQA 1F2TA 1Q3KA 4OYLA 3FSGA 1IPEA 1YH3A 2R8PA 3K4HA 2HCBA 4N82A 4PAMA 4Y18A 4D0SA 2Q29A 3J81k 2E4UA 1NVEA 2EKDA 1EBFA 4P6VF 4O4JA 2DH5A 3H9QA 2M9MA 4JMLA 4EMTA 3DTTA 3NTXA 3N5KA 3HDHA 1U3DA 2ENWA 2V58A 2WHYA 1SZPA 2EHDA 1JEYB 1XU9A 1AH2A 1L4UA 2I80A 3K1YA 1NVAA 3BCRA 3ETDA 1FUKA 2VKQA 3I5AA 1NYTA 2P6UA 1HY3A 4WKGA 3RS2A 3WFJA 2P69A 3TLXA 2HA0A 2ZTVA 5HF8A 5B55A 1PQYA 3UUWA 4G0QA 3HDVA 3KTDA 1C4KA 3ZDQA 4DAOA 1N2SA 2OV4A 2RJ3A 3BERA 3ESYA 3O2JA 3GGSA 4GOKA 2P7IA 3RSOA 2NO7A 4MO2A 4PTLA 3NANA 3PNOA 2X2PA 4ZQFA 1B00A 1EGMB 3M4ZA 4Q05A 4CV0A 3D4PA 4WQMA 1G5HA 4I9HA 2EGHA 2LKCA 2UYCA 4OHVA 1RTKA 3TDKA 2DYKA 1O95D 2HTFA 4AWBA 4II2A 2AX4A 2L0XA 4LMAA 3HO8A 1JLLA 1FLVA 4DTCA 1ICIA 1G7RA 2XGMA 3AEQA 1H69A 1VIVA 4XB2A 4AX8A 5ALVA 1WTCA 1SULA 1QIGA 3INRA 4PO3X 2DGDA 3SXUB 3OQVA 4EJ2A 3PU6A 1GQSA 3L7DA 3PC4A 1ZZGA 1ECCA 2OL4A 3N58A 3R3HA 2VTKA 4ZVVA 1H8HD 5HQ3A 1E1CB 2FWIA 2IL1A 2PPVA 3RB8A 5KQRA 2BW0A 5KDLA 3PZRA 3W5CA 3RVNA 2QL5A 3EJ6A 1QNFA 3RVPA 4D81A 2VZLA 3T34A 2BHNA 3UENA 2I66A 2O8EB 3T9CA 1RWMA 2B61A 4YMWA 3G9UA 4B6GA 4HAYA 1AIPA 3E58A 2W6CX 3QOWA 1NQTA 1DBWA 3ABQB 3I23A 1L7MA 4B73A 5AW6A 4RULA 2I6SA 2LV8A 4YPVA 1V3UA 2GBPA 4QGHA 1SCAA 2FEAA 2PBFA 3GFPA 1V8FA 5D1NA 4Q0MA 2CXQA 4X8HA 2W2KB 4UHCA 2A0FA 3VR2D 4UUNA 2IEDA 4WI1A 3RAGA 1CW2B 3BJIC 4CCYA 1E6MA 4Y2SA 3OEHD 4IV8A 4E03A 2DQYA 3T9AA 1MJGA 2VPTA 1VLLA 4ZOQI 3CTPA 1LDGA 3BE8A 5DYIA 1EXWA 1P7PA 4ZOAA 5ERYA 3WLLA 4KR9A 2HQOA 5SY6A 4S1OA 5AW7A 1C0PA 2W4IA 4CMIA 2OCXA 2ZUDA 3H5AA 2HJRA 2P27A 2JLZA 3HCNA 4FONA 1HDOA 3KT6A 3DHEA 1QKJA 3VVLA 4KO1S 5CK4A 3NP7A 5DM70 3TSAA 1QONA 1S2IA 1XMPA 5CLJA 5FV7A 3IV6A 3RI3A 3A3KA 5BYBA 1XA3A 3IIKA 4FMDB 4TQAA 2AN3A 1B23P 2FP3A 3SG0A 2PGNA 3ET5A 4HI0E 2YWJA 3HZHA 4U2CA 3UA4A 3W05A 3ONDA 1CBUA 1QF9A 5LQDA 1DIGA 2VH5R 5TX7A 5K8IA 1IHYA 5JJIA 4PXYA 4OB8A 2H3EA 4Y7DA 4FMCF 1NF3A 1KHHA 1KARA 2V7BA 2PCLA 2W6OA 1QIKA 3RRMA 4CV1A 5IJ9A 3HB0A 4UKDA 3MQFA 3IDQA 5EP4A 4PCAA 2QAGA 3U26A 4CG2A 2QYOA 3LZDA 4FN5A 2YMLA 1J5PA 1NP6A 3IOYA 1GJRA 3WIUA 1FRFS 1QU3A 4US0R 3SDZA 2F2TA 4I6JA 4BP9A 3SSAA 2PYZA 4Q9LA 3LTNC 3H42B 1M2VB 4JGGA 2BCEA 4IEEA 3RT7A 1D4ZA 4V02A 5GJBA 4KLNA 3GI1A 1DEXA 5GONB 5BOSB 3IL2A 1DLJA 3IHKA 3RYHB 1RAFA 4I50F 4X5OA 5F12A 4Y3UA 1NXWA 1ETHA 3T54A 5EQJB 3ER9A 1Z0JA 1AHHA 2AUTA 3L1KA 4OP1A 5EFOA 3H1GA 4X94A 4IJKA 1Z5WA 4AROA 2W2TA 1PT6A 3NAQA 1FQWA 3LQ4A 3GL9A 1K66A 4RIGA 1Y6QA 2FOXA 4S12A 4I5FA 1PLLA 2P5UA 3DAYA 1PG0A 4XCXA 1XKXA 3LPMA 3SE0A 2VHEA 4RGQA 3OPYA 2VAXA 3A9CA 5EERA 1EP1B 2P2SA 2O8CB 1X74A 1DEAA 1XTVA 2LE0A 5TQVA 3RJ9A 1P9RA 4B4DA 4E4YA 4F8YA 5B64A 4CEIA 2BD0A 2EIXA 3U3JA 4K03A 4EKYA 1KPGA 3DZCA 3IUEA 4TLAA 3LYUA 2J30A 4EHHA 1K6JA 2QLMA 2GESA 2CK3D 3QKRB 4AIRA 5L95A 1CSEE 1UOOA 3R3JA 4MVJH 4OLFA 2RGGA 3TLKA 2PY6A 2VNHA 3JQFC 4PZEA 1S2NA 3L05A 1OTHA 2XWBF 3NVDA 2G5CA 4KAXA 1GTVA 5KC9A 4R2IA 4BJ3A 2J6HA 1OU0A 2ZIFA 3KQSA 4JVSB 1BDIA 5LDDC 1NUTA 3DFMA 1UDWA 3KKLA 2E4YA 1PT8A 2EDCA 4NCBA 1CQZA 1PJSA 4MS1A 1PFVA 3K09A 3N53A 4WK0B 1KZHA 4CRWB 5EJ6A 2IXGA 3FR7A 1T4MA 4UCQA 2W0SA 1KMMA 3D6MA 1F8YA 1NFQA 4MRPA 3OCXA 4QJ5A 2F3UA 2WU8A 3MRSA 1F1BA 4HH0A 3TSOA 4LJ5A 2A35A 3ZQKA 3RVJA 5AD1A 2D7JA 1J42A 3AL2A 4XWTA 3B3GA 4C20A 3PEWA 1KETA 2B9VA 2IYUA 1KA9H 3A9VA 3KZCA 3VNRA 2OHVA 3NJRA 3TNFA 5TXGA 2VF8A 3UK6A 4MS4B 4UASA 1MH9A 1UC9A 2GOYA 1H2HA 4PVCA 2PRJA 4QHTA 4IS2A 1U9JA 3IAM1 4LF8B 4G41A 4LJLA 5A9SB 3E53A 1YJ8A 1ZVMA 5G0VA 3TL2A 3GEMA 1NULA 2RK4A 4CM6A 1DX4A 5HIAA 2CXNA 3I9JA 2VL7A 3IKLA 3JQ6A 2GJAA 3IAUA 3LO8A 1I4DD 5JPIA 3ROFA 2JKZA 3H2HA 3KALA 1YZQA 2CFOA 3QKTA 4AJOA 3ZQJA 1R9NA 3AT1A 3FCCA 4WW0A 1JKFA 3BRCA 1FXSA 3TMAA 3HVJA 3NALA 9LDBA 1TECE 4P58A 2HU5A 4MQFB 1NMEA 2G7MC 2MSLA 3RYFA 4CMKA 3GGDA 4BQPA 2NV6A 2EL9A 1YRQA 3A25A 3F49S 2UUOA 2QAIA 3ILSA 3RAEC 3EUAA 1X2EA 5DX8A 2A4KA 1W1IA 1N6HA 1UFQA 3I1FA 3NDRA 4MI9A 1Q21A 1CLEA 1P2VA 1XE3A 4INJA 5TQ2B 4AX4A 4X66B 1AKEA 5AXBA 3F6PA 1RLTA 2W90A 3QUBA 1JQAA 3OZXA 5JZOA 1SVSA 3WHIA 2VUIB 4FBMA 1SUDA 4HGRA 2GETA 2G77B 3LQKA 3P0FA 4WCDA 5K3CA 4O1IA 3V8MA 3T4PA 4E70A 2GA8A 2WB4A 6ADHA 3A1VA 3HDYA 3LUJA 2EKQA 4ZK6A 3O03A 3CH6A 2O50A 9GPBA 2W2LD 1T13A 3OPYB 4N0EA 5SZHB 2HH9A 2ATIA 5JI2E 1VSUA 3EXHC 2WWVD 1S3SA 1V8DA 1Y1PA 3F5DA 4NOLA 4B80A 2VRCA 5FQNA 3DYBA 3OOWA 3G0HA 3GPLA 2BZSA 2ZB7A 1D6JA 3NETA 2WW8A 3G85A 3TW0A 3IP6A 2H2WA 3C3AA 1HYGA 1XDUA 2WJPA 3KNZA 1TF5A 1X86B 3HMKA 2VYQA 1PBTA 3NBZC 3IBFA 2GASA 3NGLA 3IIJA 1UKAA 4FHZA 1O0CA 2FETA 1P2SA 1EGQA 1ZN8A 3KKQA 4GHWA 1XL0A 3GUZA 1XTTA 3WKDA 2TMKA 4IINA 4XDZA 4YP1A 1XAHA 3WLKX 4MQUA 2GN6A 1ZXLA 3W8FA 1Q92A 1SKAA 2H7XA 4NK5A 4LTMA 1UDRA 4Z0NA 4N9WA 2FN8A 3BWDD 3MXTA 1I4WA 4NNOA 2PZBA 3CLUD 3V6LA 1WMAA 3IRVA 1SXQA 2WLTA 1USIA 2W6QA 3WRYA 1QQBA 3LQRA 4WESB 4U5QA 3W04A 4D3YA 2IZ5A 5AR1A 4H27A 1P62B 4B82A 2IXAA 4OXKA 3VAYA 2O2ZA 4KFUA 2N9UA 1Q0SA 3TX2A 1W5TA 4AJIA 1H4SA 1CF9A 3HCWA 3HMQA 4TRRA 4D8YA 4V0RA 4CLRA 2AL7A 3KCNA 2LCFA 3OLQA 4PLYA 1JAHA 1MZVA 2Q1YA 3UMYA 4QTUB 1YD7A 5ABPA 3EXHB 3ILYA 2Q6KA 1IZZA 4BFVA 2J5BA 3QVSA 2OLKA 1Z0ZA 4B8WA 5J4KA 2CLOB 3D43A 3IOEA 4PPFA 5CT8A 2DFLA 3U3XA 3TG2A 4JUIA 3K8QA 4XRRA 1AKNA 1X1BA 1Y5RA 1NW7A 3DDCA 3KHUA 4O0LA 4OJQA 4QDOA 3ZJYA 4AAYA 5JYBA 1XMJA 4BMZA 4EVIA 1OAOC 1E2GA 4KN5A 3GDGA 4QBKA 4C5AA 3P45A 1XUOA 3QLEA 3S2UA 3WTCA 1K7YA 1JBEA 3TOCA 2CN1A 2QAGC 3H5IA 2XVXA 3T5MA 3M2TA 5KKAA 2OO3A 5LQSA 4WADA 5L45A 2B5WA 4DCUA 2XTNA 1XZCA 1H0SA 3G8AA 4MOWA 4RADA 4D42A 1XTJA 3N2IA 3O4JA 4X93A 2EVWX 1J9EA 3ISTA 2I3BA 3KJQA 1MUUA 5IBRA 2W8BA 1SU7A 2N1BA 4BY9E 3U80A 2PGIA 2Z5LA 3AV3A 4B2LA 4D5EA 5B5SA 2WDPA 3TR6A 4DV2B 2GLTA 3LWZA 4FYYA 3SS8A 2OZKA 1H66A 5GONF 5KAPA 4O5AA 4PNEA 3I9FA 4BMNA 3BUSA 3KLMX 5GTDA 4UNPA 1PKXA 2NT4A 3T6KA 1V3TA 1VSBA 2WYUA 2I34A 3D59A 3H2ZA 4RPLA 4EHBA 1E1CA 4IKEA 1UINA 3SWWA 2CVFA 1CY4A 1Y7PA 4GVLA 1QFXA 3FTNA 2VT3A 3QUCA 3KDSE 3T7SA 4CU5A 1ZGJA 1HGXA 2NXNA 2F67A 4ZCSA 5JYDA 3SXUA 1ZJYA 2DBYA 5T4FA 1V37A 4FB5A 1HFEL 1L4GA 3GP3A 2WJAA 3AEQB 3W6PA 2CXRA 5T64A 5ER9A 1U3GA 4ZVOA 4KHPB 1KNQA 2OV3A 3L8ZA 3U2QA 1W44A 2FF7A 4NZ9A 5B1DA 3TIXB 1WLSA 4JA2A 1XSEA 2ID9A 3JQCA 1G3IA 3NIGB 1JYSA 4BB9A 3WGIA 2JI6A 2CL6X 3UGTA 4YT2A 1UR5A 1W4BA 2FN3A 3W3AA 4HYYA 2J5XA 3GRRA 4MKRA 3FM9A 3RSSA 3FXAA 3ANYB 3ASUA 3B36A 3WFZA 3RNOA 2O06A 4QUHA 3QYAA 1RXYA 3CR3C 4XLTA 3CNQS 3JD2A 1VKHA 4IEFB 5T57A 4U7JA 1J5EB 3OLYA 2RHBA 3UMMA 3DKKA 2ZULA 1RDFA 1N0UA 3RIXA 1ZBDA 3WY9A 2CZCA 1OH5A 3P4XA 4DF3A 2QWXA 1M2WA 1U1FA 2QD1A 3U3RA 4NXMB 4RKFA 3AHCA 3GCXA 5EJ8A 1Q91A 3HDQA 4XYLA 5KKCA 5HUHA 2HRRA 2ZI3A 1KMHB 4JSTA 4P4SA 1WIWA 4JVMA 3ZHTA 1CNEA 3VR6H 3BXEA 3ENVA 4GMGA 4TTPA 3WK6A 1R5JA 4R71A 4MZDA 4P3PA 5FPHA 4RBNA 2QYHA 1NBME 2VI5A 2XWQA 3Q8LA 4H7PA 2I6FA 1D2HA 5G4LA 4RTMA 3IIIA 1ZC4A 2G82A 4Z1MD 1OV6A 4LMBA 4P86A 1OLXA 2VBGA 3IUBA 3OOYA 4JT9A 3U7QA 2GPBA 1GV1A 2WAYA 3DULA 3E0XA 3RTDA 5I6DA 5JXGA 2NZWA 3V4RA 2P9EA 5EVCA 4F71A 2J3QA 2X2FA 2NTEA 3VA7A 4OU4A 1YQEA 2D74A 2EJUA 3H3JA 3FPKA 1X7ZB 1DC7A 2XEDA 3L0CA 1XCMA 3OEED 3Q72A 2QAJA 2VDOB 4HLUA 4NAHA 4NP6A 4IDCA 4B09A 1U4SA 4ND1A 5TS3A 2OYCA 1YB5A 3H6HA 3U4QA 1DKQA 3KJIA 1MP0A 2J08A 3R7DA 2QW1A 2B20A 4YRMA 4YCBA 3STUA 3ZHUA 4KAJA 1L9KA 2FMUA 5BRAA 4CT0A 1KYWA 5IEBA 5DHQA 5JHGB 3R41A 1P80A 4H0CA 4IDHA 1CERA 1R0CA 4GYKA 3OMXA 1N3IA 4OUKX 4PHFA 3C41J 4XRGA 4YV2A 1JIUA 4NYJQ 4QZVA 1VBFA 4LV8B 2MMCA 3EY9A 4XDHA 5H3CA 4YJ2A 3GLFE 3JAWB 7ABPA 1LVUA 2VT7A 4ZI7B 4OI4A 2JHGA 5AW2A 5BW4A 3RJ5A 4PQGA 7MDHA 1X15A 2P5TB 3GFGA 4IDAA 2W4QA 4J3FA 4W1SA 2G0TA 3IR6A 5LLSA 2QRMA 1A1SA 3NBFA 1PNTA 4DVGA 2C0PA 5E2BA 1M0TA 3QLVA 4ZZ2A 5DM60 1WHTA 3JQEA 1QDUA 1EP9A 4LGMA 4PRLA 4TXLA 2ZAIA 4CEJB 3H86A 2D3TA 4ICIA 4QUKA 1G8GA 2XKJE 1JWBB 4X1YA 1BQEA 2B8TA 2QRKA 3G2PA 3R3VA 4Q7KA 3THYB 1A4IA 2NUPB 3H6GA 3BTSA 3CWQA 2H7VA 3QKIA 5LZ7A 4X84A 1GKKA 3OM9A 1DTEA 4AS2A 4BVEA 4DKXA 4LY0A 4WEQA 4XAQA 1PWXA 1S96A 3BM5A 3JD1A 3KZMA 4IXNA 4KQEA 4Y9SA 3HB5X 1GA6A 2X2EA 3V80A 2H31A 3ZOZA 3I4FA 2ILVA 3DZKA 4UW9A 4D8XA 1FX0B 2IOHA 3WADA 2ZETA 1XRJA 1EFDN 1K6IA 4MLPA 2WP8J 1D2NA 3K2EA 4MUBA 3SC4A 2RGNC 1BHO1 4WCFB 2Q1TA 3U1VA 1E2PA 4WN9B 3RADC 1E99A 2K5UA 1JIIA 4MI3A 5EEHA 3ESQA 2CZGA 3UW1A 3H97A 4RF2A 1DXOA 1Q3TA 1HOXA 5AKKA 4FDUA 3KOXA 3NUZA 4ILKA 3WG9A 3QMVA 4FCCA 3OJEA 3HCEA 3AB8A 3QX3A 5BSUA 4ZDJA 4L8LA 3WGYA 3DDOA 4C4RA 1Y81A 1N1EA 1XZNA 2YJGA 4NOJA 1IMOA 2FPRA 1PNOA 1T9ZA 1WMBA 4EA7A 2NSYA 3KB1A 3RRYA 2WA1A 2KM1A 1EVEA 3ROKA 1LNSA 1JR3A 4BO1A 4EVSA 1A1VA 5T4EA 2VSNA 4MRAA 1DXYA 4HDNA 5AHWA 4QM6A 3CX4A 3ND9A 5I9TA 4AD8A 2W2XA 3C6XA 4JXXA 1DKLA 1X2BA 5AM3A 2HTEA 2DF8A 2VAPA 1RJDA 2RGWA 4Z0HO 2QGFA 1YVEI 3S81A 1N6KA 1TU0A 3MN1A 2EYUA 1F6BA 4URWR 2ZIWB 1YBAA 3A9WA 5T4BA 2W42A 4M6WA 5DYNA 1RWKA 3IXQA 3T4XA 4K8OA 3SX0A 2PR7A 1I7PA 1SCDA 1U0LA 2FZKA 4JB2A 3PJFA 4YREA 3U6BA 3TL3A 3L49A 3V8NA 3VR3D 4LSWA 4JOQA 1SXJC 4HEQA 4A16A 2BELA 1LTHR 4D9KA 4DEYA 4WACA 2CBXA 1HL7A 5AKLA 1AB5A 2BMDA 2W0MA 1IY2A 3MF4A 1LBTA 5HRCA 4P81A 3D2CA 1Z12A 3KAQA 5B3AA 3MWFA 3DA8A 4ALNA 4ENTA 3W2GA 1EDZA 4D6PA 4URYR 1J0DA 3NOOA 4R1OA 3LLVA 1OREA 2C42A 1BO6A 3D8BA 3TGWA 5E7JA 5CDTA 3LFUA 1ILWA 3KKMA 1G0OA 1A7JA 1E1NA 1MAAA 3NGMA 1KRWA 2E4WA 1OBCA 3HA3A 4ARSA 1U3UA 1KYYA 1ZD4A 2PXAA 3ETJA 1Q1EA 3LE8A 3UGJA 1O77A 3GFBA 5L6MB 3IQHX 1RWNA 2ZVQX 3RTBA 3M1IA 4G6ZA 1K7EB 3ETNA 5CNIA 3O7WA 1USWA 3DE6X 3OOEA 1A2QA 4XIIA 4X60A 4IRMA 4Q7JB 5DBFA 4G63A 5DB4A 3W2EA 1Q7CA 2HK6A 5IW8A 1I7QB 5E4TA 2PG3A 1FFXB 1BMQA 1JHVA 4LDZA 3ENZA 5DIZA 2I3DA 2QLTA 2J46A 3LRXA 1KWGA 1NDHA 1QCZA 2BDEA 4IFIA 5EN4A 2WTUA 4TKVB 4JSYA 4AMGA 3JZAA 4NJMA 2X0KA 4TTSA 5KYWA 1XCBA 2VP3A 4NYIQ 1TRKA 2VQEB 4PIMA 4Y2YA 3FLEA 2X76A 3DMTA 5AXDA 3V4FA 1C8LA 3O91A 2JLVA 3EDRA 1OLOA 1RPTA 4LC1A 3CEJA 1Y1TA 2QJFA 4P3KA 4CV3A 1UXKA 1ST2A 2H16A 3FYHA 5G1OA 2AZMA 2RK3A 3NS7A 1TTHA 4WBNA 5JS6A 3E7WA 1Q84A 2GN9A 3NUGA 1KO4A 4PLZA 5CH5A 4BUJA 1WUIS 5ECGC 3WYDA 3MGAA 1PT9A 1WE2A 1P9WA 5JFGA 2GO7A 3A04A 4BQOA 3E61A 4AJLA 5GIOE 1MOSA 4L4UA 1GADO 1QZ3A 2CW5A 1JIVA 4MIOA 4DLVA 1JW9B 2Y0DA 2Q5OA 3C5WP 2Q7DA 3L7AA 1SQ5A 3BJRA 1T4DA 1STOA 4Z4HA 3D5TA 1UMDB 4FPXA 5ALJA 1A4RA 1ML3A 4BFZA 3G9XA 3ND8A 1SPXA 5DTRA 4EY3A 1LZKA 4PS1A 4CLDA 4YMUA 2N75A 1HEIA 1V26A 2ATXA 3PUXA 2VHJA 2CK3A 4WNAA 4B45A 4HT3B 4IHAA 3TVYA 5LQJA 4I2NA 1JYEA 1NYQA 4UDXX 4O4IF 4WOCA 2A1IA 4YRZA 4KMSA 3G2LA 3RSZA 3OHMA 3G5AA 4LNUA 3C8MA 4YO7A 4LYFA 5DX1A 3DO6A 4PGHA 5DF1A 3WYNA 1KFCB 4X61A 5A3JA 4UCFA 3EGDB 4NOMA 1X7YA 2G80A 4MICA 3LC7O 5C0OE 4LKRA 1J0XO 1ZRMA 3BCHA 3GFRA 3K71B 1UT6A 4TXJA 4C4OA 3A6ZA 1K2VN 5AP9A 4RL6A 5TPZD 4DV0B 8MHTA 1N5MA 1Y4DE 1UAYA 3N0TA 3BFXA 4I1YA 2B4RO 2IHJA 1M7GA 1THGA 1Z0AA 3CF4A 5I3CA 3BBLA 1WZCA 3UJ7A 5JAQA 1L4YA 5JHHB 2PLRA 2H1LA 2HO4A 2R8BA 2CNLA 4HNTA 1J5XA 3BL8A 2J3EA 3L0SA 4HMOA 3VR4D 4P33A 5KWVA 4HRYA 5D3MB 3FPHA 4QAQA 4YRSA 4J4BA 4N12A 5IVKA 2SKCA 1Y89A 4O4LB 1GUAA 1RMYA 5BORA 1VCNA 1P0PA 4G4IA 3HDTA 5JZ9A 1WB9A 5JC8A 2P9ZA 3MQ4A 1MRNA 3P96A 4K40A 1Y8QA 1PDWA 1SAYA 1CUSA 2P2GA 3T7IA 3K9FC 2PZKA 3L6EA 3HH8A 4X8MA 4ZPJA 2WEKA 5F76A 2PL3A 3ZWNA 2JBAB 3PNMA 2QY9A 1JDBC 1NC3A 5T3UA 3VTKA 4AG3A 4PQYA 2PS9A 3UWKA 4C4YA 4IYJA 2YJ5A 2HN9A 1KSGA 4J0QA 1FRNA 1U3WA 3OURA 3CO5A 3TQIA 3OSUA 5KOIA 1AZLA 1HE8B 1NP7A 4CU2A 4YRGA 1U0OC 3D6AA 3IS3A 4JXKA 3SOZA 4YAIA 3GYBA 3ZHVA 2BKEA 2OCKA 4JWTA 3M3HA 1V6AA 1GU7A 4LGVA 2X77A 4N54A 4K9QA 3HYCA 4AF8A 1GZ5A 3L0BA 5IK2A 1ZUWA 1HDRA 2A88A 4ZJUA 4ZC8A 1CUVA 1RKQA 3BSYA 1LPNA 3NT4A 2AB0A 2CLEB 4DWWA 2FMTA 2FKAA 3FF1A 5IM4A 1ID1A 3C8UA 3PA6A 4MLDA