4C7MA

The crystal structure of tcpb or btpa tir domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
134
structure length
132
Chain Sequence
SNADFFISHASEDKEAFVQDLVAALRDLGAKIFYDAYTLKVGDSLRRKIDQGLANSKFGIVVLSEHFFSKQARELDGLTAMEIGGQTRILPIWHKVSYDEVRRFSPSLADKVALNTSLKSVEEIAKELHSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TIR DOMAIN-CONTAINING PROTEIN
publication title Mechanism of Bacterial Interference with Tlr4 Signaling by Brucella Tir-Domain-Containing Protein Tcpb
pubmed doi rcsb
source organism Brucella melitensis
molecule tags Signaling protein
total genus 46
structure length 132
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4c7mA00
4LZPA 3UB4A 4C6TA 4EO7A 4OM7A 1FYWA 4C7MA 4C6TB 1FYVA 1FYXA 2J67A 5FORA 2Y92A 5KU7A 4LQCA 3UB3A 4DOMA 5H3CA 3JRNA 3OZIA 4C6RA 1T3GA 3H16A 4LQDA 2JS7A 4W8HA 2Z5VA 4FZ5A 1O77A 2M1XA 4W8GA 3UB2A 4C6SA
chains in the Genus database with same CATH superfamily
2NU8A 2VL7A 1REQB 1LDNA 3NTLA 3L77A 4OXIA 5AW1A 5E0KB 3C3CA 3X1XA 3O2SB 4DRZA 4ILKA 4P6VF 1LBQA 2Q6OA 3DS8A 5LFAA 4FHEA 1CD5A 4RHTA 1WSAA 2G6BA 1OXVA 2QMZA 5ECYA 2QTBA 4PEVA 3ZW8A 5TLSA 3FOAA 2XODA 3LTNC 1EP2B 1JTVA 3OZEA 4FEEA 3BREA 2XD4A 3QQPA 3G5TA 2KYRA 5LU9A 2WKWA 1PG0A 3ODPA 1MN6A 3TLXA 4U5QA 3MTEA 5A4FS 4D26A 1KZYC 1T2AA 4LQDA 3JWGA 4DQ0A 4J2HA 5LQSA 5B5SA 2VJQA 1E5DA 4FPXA 3TLYA 4FNAA 1USGA 1Z7GA 1Z7BA 3FETA 3H2BA 3KQTA 4I50B 4DIMA 1NRJB 3QVJA 1SXQA 3CURA 1D2EA 3C4VA 5DGHA 4DT1B 2Q5IA 5KQSA 4HJXA 5CU7A 3S5UA 3PQ4A 4NVRA 1KBQA 1RQNA 1JSLA 4LYEA 1H2WA 1E4VA 3PQ7A 3TDNA 2OMEA 2TECE 2C5EA 4FYPA 4ZIRB 2I99A 3K0BA 4F85A 1LDMA 5AK4A 2B4RO 3DD1A 1DCFA 5I5GA 3LXRA 5JANA 3TOZA 1VIVA 1HEUA 4EGCB 2HK7A 1PR9A 4IHJF 2V6GA 4A8TA 5KCZA 1RABA 2NZVG 1M2OA 3HG7A 2ZDGA 3KJHA 3RG8A 3N9IA 1P5ZB 4D3FA 1QPGA 1JJAA 1EUYA 4LYHA 5IJAA 4QJ3A 2Q7OE 2R25B 4ARAA 3K3PA 5IKMA 1MR3F 4CDRA 3DHNA 3PNMA 3C8UA 3S8YA 1NLYA 2RHJA 2IXGA 4HKTA 5BUZA 3IR6A 2ZB3A 3ON5A 4E1AA 3QSYA 4Y2XA 1BQEA 5K0FA 3PNOA 1W93A 3OJFA 1MFPA 3PUYA 4M7RA 4LZNA 3T1HB 4ZTZB 4XA8A 3SOZA 2BFFA 4DYDA 4NNJA 4BFVA 1NZDA 2F8LA 3ADKA 1R4MA 5WRFA 3RC3A 4M38A 1E1YA 3CLUD 3WQRA 2AXQA 4BRUA 5JFOA 4NDNE 2G5GX 4KR9A 1WSDA 4EX7A 1XN1A 2P6OA 1EDEA 2LCIA 3UAYA 3VSAA 4B34A 4BNIA 3L4KA 3I5XA 3JASB 2JLWA 4WECA 3KZMA 2BP7B 2JJ1A 4EY7A 3U6KA 4LHWA 3B2NA 4BTVA 2F90A 1IDOA 1OH5A 1IZZA 1FX0A 1DEOA 4H7HA 1DKMA 5DW3A 1Q0RA 3PXBA 3UV7A 2Y0PA 3E8XA 1SVSA 4X7BA 4XKJA 2P9BA 5A4DA 1TVMA 1XQ1A 4NHEA 4GVPA 2LGJA 4QOSA 3RUIA 4UHDA 5HZKA 3HWRA 1YR2A 2AQHA 2FMIA 4K9SA 4LECA 3EH1A 4ND6A 4EGAA 4NOLA 3LWDA 5BW4A 1I6WA 4AROA 1KE2A 1ELOA 1M2NA 1M6VA 3PDIA 3Q72A 3VSEA 2QLBA 1U0JA 1Q5PA 4D1YA 1RRCA 1IJFA 1U5BA 4FP9A 4KL8S 4X1KB 1NC1A 3TPCA 1MB0A 1ZN9A 1CULC 2F1RA 1Y82A 2FZ4A 3C6XA 3EGOA 3ZU5A 1L5LA 5LKRA 1PVOA 2CHFA 4L02A 1YH3A 4CMHA 4DMFA 5IKPA 1R8YA 3G2MA 3LQ1A 3IUPA 4HYTA 5AHKA 2WD7B 3PUWA 3R77A 1KDZA 4CQLA 1KR5A 1JEJA 1XD8A 2AN1A 1Q6ZA 1CX9B 2O59A 3KALA 4RU1A 2REQA 2B6NA 4R3UC 5JQGF 2FWIA 2QZ9A 3GI1A 4QREA 2DRIA 1UF9A 1IYZA 4MEJA 1ZUWA 2FQ1A 4RPCA 3ND6A 2PWYA 2YXLA 4JLKA 1V7CA 1X9IA 3ETLA 1K5DA 3LWBA 3BB3A 3H5RA 4AUMA 1Y1SA 5JSQA 3R9XA 1EE2A 1QVZA 1U3TA 5I7WA 3ET5A 3RIGA 2VJBA 3IEXA 1GU1A 5EKXA 2PSFA 4C3UA 2C58A 3SYKA 3ZIAD 5EWMB 4C1BA 2QAGA 1GL3A 3I9MA 4WZ6A 3WGQA 4A2QA 5JSFA 1QP7A 4N41A 4RORA 4PM4A 2PHZA 3BZUA 3T4EA 1BOFA 2H2DA 1DG3A 2J46A 4QXOA 4D8UA 4EF5A 5CD9A 4FYIA 1SZJG 2G4LA 1EFUA 1PUXA 1RXSA 2VKTA 3F4LA 4AS2A 5LQAA 1QONA 4NCBA 5LYJA 3SN6A 1VFPA 2R11A 3S2IA 5CM2Z 1YONA 2EP8A 3A9TA 1HYQA 4M9UA 1P9LA 1ZM3A 3AY7A 2OC9A 3GN1A 2CL7X 3EFOA 4EW6A 1R7RA 1LVGA 2EARA 2FUEA 2FUKA 4ODIA 1LZLA 1UK8A 4I1YA 4GX2A 2FZCA 4P7GA 2IHTA 4NEGA 4Q9JA 1L4NA 2YHBA 4QPJC 2H9IA 3AW9A 1UJ2A 5TX7A 3OICA 5E6UB 3PQ6A 3U9TA 1MB4A 4K6CA 1SC3A 3FLEA 2FRVA 3QNMA 3WIUA 1ONNA 3TOCA 1Q19A 1YAHA 2B69A 3JWIA 5ENZA 2AYYA 2MTBA 3ETGA 3H18A 5G53C 3L6CA 4YYZA 5LJLA 3MTAA 2PRZA 3EVTA 3VVBA 3T34A 3U3RA 1YB1A 2NP6A 1E1QD 1RNLA 2ZJ2A 1NVAA 5JC1A 3B3FA 2DQZA 1QYXA 1UMBA 2FPSA 1TL7C 1TO6A 2O23A 2I3ZA 2JD1A 3BKWA 4RPLA 4CI9A 1U0FA 1XP5A 3IA2A 1DIBA 1N2JA 1TEHA 3PI7A 5EIFA 4QXMA 5ALVA 5A6SA 5CD1A 3EODA 5K8JB 1KC3A 1PFGA 1ZXBA 1YZHA 2X3YA 3I9FA 4UE3S 5E1DA 1Q7BA 5TGTA 3SE0A 4BKOA 1IB0A 1L4KA 2G08A 2QLMA 3WBFA 4LEIA 1GSHA 4RW0A 5ABPA 3BIWA 5FUYA 3HJFA 1UBRS 4JASB 2ATIA 5BQPA 5KJEA 4NQRA 1WHTA 3FGPA 4IIEA 1EKXA 2BFAA 3AVYA 5CG1A 3ICWA 1N6KA 1NFQA 5F35A 3FMVA 3Q3IA 1MW9X 1BRTA 4MWOA 4B46A 1QH8B 4PIMA 1MVLA 1J2RA 3SAJA 1X8XA 3WXMA 3ECAA 4WADA 1R27A 5CVCA 4IZ6A 3P2YA 5FADA 4OAOA 5CPFA 2I0FA 1LZKA 4P4NA 4ZHSA 1IOLA 5L53A 1PEKE 3ZXXA 5KNCD 3IMKA 1MG5A 3H2ZA 1CZKA 3OE7D 4X24A 4QOFA 4OKIA 1GIAA 1BQ3A 2NNWB 5AVXA 4C0KA 2XB9A 2EP5A 4V3BA 1X3SA 4FSXA 3WK4A 1E6MA 3QVGA 1UXOA 5FOWA 2NNLD 2P78A 3RTBA 5LDDC 5AHWA 3DOOA 1V3QE 1YRAA 2AJTA 2JA2A 3LCVB 1CS0B 3F78A 4NCNA 4GPD1 5JBQA 1HDRA 2DUWA 2Z0MA 2PT6A 1W2HA 2NTVA 1JT9A 2IHZA 3OBBA 4OFBA 4R98A 4C7MA 4NV3A 2A2ZA 3E1GA 2RAVA 5GOZA 2FN7A 2FPGA 2QLTA 2WPNA 3CSUA 3GZNA 1YR7A 1Q0SA 1SR8A 3KU4A 1Y1PA 2YFHA 2Z2KA 2JBWA 4YP5A 5DHRA 3WGVA 1ZGGA 2O5RA 3N76A 4H6PA 3N8IA 5EN4A 2HA3A 3GLIE 5LPNA 4WCVA 4P80A 2HMUA 3WLRA 3EMKA 3IDOA 1XEXB 1RRVA 4U2FA 4C4ZA 2QPLA 4IDHA 3WWPA 1KTIA 2Z58A 5SZKB 3ZEIA 1TB4A 3WFJA 4D8VA 4PGGA 3PHJA 1N6PA 3LL7A 1YBAA 1U8XX 4DEVA 1DOAA 2H9AA 2VZ9A 1LUAA 3RT7A 3SFTA 4Q1EA 3ICQB 1EVKA 3CPHA 4N3NA 5EG5A 3NEAA 3D2LA 4M9ZA 4XWKA 4DUYB 4EO9A 3ONFA 4ZCPA 3C2QA 4RD0A 10MHA 1VPTA 5SV2A 1GGMA 3BYZA 3LX5A 3QWBA 1P39A 1IFXA 3I39X 3WJ7A 1M1NB 4MO9A 3RB8A 4GU5A 1U04A 5A2QA 2PU7A 5ERGB 8AT1A 2J3QA 1LC3A 1NPYA 2I8LA 3KB1A 2IPAB 3MSXA 3OBIA 1O5TA 4U7WA 1T9HA 4N49A 4XGIA 2CHQA 3EARA 1C1XA 3SFVA 4CR7A 3GVCA 4DJ5X 2PUAA 4P4SA 3HCNA 4GMKA 2ZJAA 4MV0A 3ZGVA 1WUHS 4ZC8A 5DN6D 1NSTA 1YASA 3RWOA 1HTBA 3K70C 2DEUA 4UMEA 4R68A 3KBOA 4CQMD 4D4HA 4QVIA 1XCOA 3G0OA 3IUMA 3WYAA 1CKEA 3AERB 4TLAA 3EXG1 4JYPA 2HPHA 1ZINA 3JRXA 2VYND 3WGGA 2Z2JA 5KDOA 4HHEA 1F8YA 4MQMA 2WMNB 2OQVA 1BQ4A 2RHMA 1FVOA 1ZDMA 3JWHA 3O83A 3DZIA 1JJFA 2VJNA 4O4IF 1U9JA 4RHXA 4WVFA 1RLUA 4A6PA 5JZVA 2HZBA 1E1KA 1I14A 3LUHA 4N7MA 1WIWA 3AZOA 2ZI3A 3SYNA 4ZHQB 2HRQA 4LMRA 4GKKB 2JNWA 3BXHA 4DBLC 3GLFA 2ZBQA 2BKAA 5ISMA 3R40A 2VPTA 1DBSA 1OTXA 3BE6A 3QBTA 2COUA 2CVFA 2FPKA 4I4IA 5AUNB 1RWMA 2A0YA 4LN1A 1THMA 2C7GA 5DI3B 1DDOA 4B3GA 4PX2A 4LPKA 3G79A 1VJ0A 1MAUA 3WJAA 2VNSA 3SMVA 2VPZA 2PX5A 4U6QA 5AESA 5A06A 3ZYZA 3HO6A 3P9NA 4L9WA 2VCHA 2CCJA 3G68A 4IILA 9ABPA 1FFEA 3P20A 4E70A 2AC7A 2HSGA 2ZJZA 3AP2A 3ONWA 2CLLB 1R12A 1WVGA 3ML1A 4HDSA 4L4ZA 4ZRNA 3BTOA 5PGMA 4DTIA 1SGWA 2D0OB 4MQEA 3BTVA 3EQ8A 1I5EA 3IPYA 4YP1A 3WV5A 2CNOA 1UBSB 2M98A 4I2NA 4KLRA 5B1DA 3TLBA 3JVUA 4W7HA 1WUKS 1D0IA 5HQJA 2JFGA 4IYJA 1EUQA 2WHPB 3EPPA 5DT9A 2XKJE 2DLNA 5DASA 4WASA 1ZMBA 1T8YA 1B74A 4JOBA 1A98A 4QYTA 1PWHA 4B9EA 3BIFA 4GR4A 4KO4S 3RYHB 5KI6A 1NQ5A 4HVLA 1PI3A 1P0CA 4TUYB 1EHYA 4JVSB 4S1NA 4J3NA 4BUJA 4XZ3A 3O2JA 2ZJ1A 4ZOLA 4E3WA 2ETXA 2P2ZA 4OCZA 1ESCA 1XTTA 1ZNWA 1UWLA 1NNEA 3EVFA 2RCYA 1CFZA 2EKLA 3ROZA 1CY0A 1ZEJA 2V7QD 3O0DA 1M0EA 1GD1O 5HW0A 5AKEA 1DWOA 3U4QB 1G8FA 1S02A 3DTNA 4Q4LA 4WNYA 2W83A 3NUZA 5EXEA 5HA5A 1KEKA 3INYA 4ILEA 4ZKEA 1E9AA 4U6NA 5UKDA 4B09A 1TX4B 4GLLA 4Q1VA 4B6FA 4IGEA 2V7UA 3RYCA 4D5EA 1X6VA 2ZDHA 3EW7A 4XLLA 5CJJA 4JP2A 1ZBQA 2WMDA 3NTXA 4GUDA 5JAOA 3HXOA 1N3YA 5K0NA 2UAGA 2O3TA 3SNHA 2CJYA 4M1OA 3HZZA 4Q9NA 5F3WB 4F2GA 1P9RA 2CFRA 4R1NA 1L5QA 1OXMA 2HA7A 2QROA 4RELA 2QTMA 3ESZA 2WU1A 5JD5A 4D9MA 4KXQA 2PTHA 3U6BA 1DAPA 1PHPA 1GWNA 4KVGA 4C30A 2DFVA 3K8ZA 4XVCA 5C4MA 2QRZA 4TVKA 1ZJ6A 2I3GA 3KAPA 3QVSA 4UU0A 5K0JA 1YFZA 3UWOA 4FJ2A 2ID7A 3VC7A 2F48A 3K0HA 2MDTA 2QUHA 2IYZA 1Z6YA 3WYDA 1NAHA 4L85A 3SSOA 1F9AA 1CF9A 3D6FA 2PNFA 3FWPA 4A23A 2HPVA 2IV2X 4E08A 5GADl 3EOZA 3CLUC 3OLZA 3VR3D 4QUKA 1I4DD 4GDFA 1RRKA 2HT6A 4YBRA 3GLHB 1HQDA 2HO5A 4G37A 3WSWA 2B4KA 4HNUA 3HCOA 2X6TA 2C3PA 1MC4A 3G9TA 1MO4A 1WXEA 2IYSA 4IJQA 4TS1A 1R0YA 2J3IA 2WUDA 1BHJA 3NYIA 4MPRA 5CXQA 3UICA 4Q24A 1C7FA 1EMDA 3V55A 4IP0A 4RIIA 2XNDA 3KVYA 4KNVA 2BUBA 1Y7PA 4FSDA 5JOQA 2AH5A 2I2WA 3G9QA 2YUIA 3JU3A 3NHJA 4YMWA 3BXFA 2D3WA 3L0OA 1WZNA 4KGZA 3FR8A 4WKGA 3RM3A 3ZXSA 4M1SA 5LR6A 1C1DA 4RZIA 2H29A 1YUNA 3UMBA 2PGOA 1J0XO 1TYDE 2DM6A 2V9CA 2HU8A 1TTQB 2QUJA 4OQYA 3OF5A 3KZKA 4YHHB 3NKVA 4LJ5A 4F5DA 3ESDA 2ZWVA 1AGXA 4D57A 3FCAA 5BQ5A 3KOZA 2V6FA 4CKBB 4D6YA 5L95A 2CDCA 5LD2C 1QC5B 3R5KA 1QRUA 3KJZA 1BXRA 2X86A 1A72A 3QF4A 3IP9A 2QTLA 2A94A 1XK6A 4QFMA 1CUYA 3S2GA 4F2HA 5AVVA 1FXSA 1K5HA 1A82A 1NMXA 1ORDA 3UUWA 4J76A 3D6VA 3SG0A 4AVYA 4WPGA 4BLUA 1H42A 1OV6A 5I4CA 1QYVA 1VHQA 1Y80A 3I34X 4X8HA 3T12A 5JZ9A 5B37A 1NXOA 1Q1GA 3OI7A 1E2IA 3GRYA 3FXAA 3KV1A 2OO5C 4GM4A 5E0OA 1OB5A 1RYNA 3IAM1 5DE3A 2XXBA 1QHGA 5EZQA 4NK5A 2RIPA 3MT8A 1SA0B 1C4WA 4JYAB 3GVIA 5JDCC 5JLAA 3OY7A 3T7IA 5L3SA 5KTTA 1MVNA 1AZLA 3EISA 3GLIA 4YMHA 2F43B 3GJZA 2X77A 2VP9A 4UKDA 4ZU3A 5SYAA 2Q5LA 4BVGA 4YQFA 3KOYA 2PXAA 4A2CA 3FTNA 3KOWA 4JC8A 2H51A 3KHTA 4Q01A 4E14A 2N1MA 2QRPA 3OFND 2VSQA 2QN2A 2IYQA 1IATA 2OPBA 2QZJA 3KPWA 4FBGA 4BCDA 1OT3A 2QDXA 2J6BA 1YVPA 1ZRSA 2IE0A 2HJWA 3UOGA 1PWZA 3JQGA 3LP5A 1CF2O 1H2YA 4KQGA 4M1WA 3HSYA 1QGZA 3EF0A 3OX4A 4L4SA 4R1OA 4YP6A 2YJTD 3S1LA 4B3IA 5K20A 3EVAA 4JKIA 1KO7A 5FNVA 5IFKA 1KZ4A 1E66A 1K98A 3B48A 4F1JA 4K87A 4PSKA 3EHDA 1KPIA 3ZHYA 3GFOA 1VKJA 2CLOB 3H5AA 4AXBA 3UWDA 3JQAD 3OZXA 2EZ8A 5IM4A 2CDAA 2I3AA 1T1GA 3WWEA 4KK3A 1AK2A 2QDKA 3KZCA 4JI1B 2R87A 5FFNA 4FI3C 3T3PB 4RWZA 1I1QB 4YQYA 1A9QA 5BMVF 3NBAA 4MX8A 3DFIA 4EMUA 5I9BA 3PEUA 2P0EA 4PZZA 1PN3A 3DWEX 4OGWA 1HNXB 3CNHA 3BD9A 3A14A 4CL8A 1MB3A 4LBWA 4I9FA 4A9AA 5ES4B 1HC7A 1RLTA 4YCLA 1TA0A 2JAUA 2OBXA 2BCJQ 1EU1A 2YFKA 2J0UB 3EIEA 2BGLA 3NTUA 4D9IA 3HB5X 4LF8B 2V7EA 2IZ1A 4HL6A 3U0VA 1C41A 1HE4A 1LA2A 3PC3A 1DO8A 2FEOA 3JQEA 3TEMA 3GB9A 3AHGA 2Z2ZA 4GW3A 4URHA 2YCLA 4OQNA 3RTCA 1P2FA 3I09A 3FHJA 3HKEA 4FFOA 4G1CA 1Y48E 5EXPA 5LA6F 1YZUA 3KQMA 3W3AA 4RTOA 1SZCA 5D5PA 1TK2A 2RHGB 4G86A 1Z2DA 1THTA 1HRDA 2IP2A 4Q1CA 1UMDB 1SD1A 3WIBA 3HMQA 1VKOA 1E2EA 4BKMA 4YDRA 4ARVA 4RTNA 3A31A 2DUMA 3KLOA 4IDAA 1OX5A 1Z34A 3T5AA 2XWJI 3KJXA 1QVRA 1N3BA 2F3PA 4L2IA 5IAJA 3B52X 1FJXA 4XUCA 1OH6A 1T9DA 3MQFA 5DRTA 1Z8HA 1C3XA 4J29A 1D4OA 1PU2A 2ZP1A 4ZO8A 3KX2A 3SZGA 3LUFA 5BY2A 1P7PA 1HQCA 1YULA 1P1KA 2HWKA 4MO2A 5FNZA 3P4UA 4Y6OA 1N6RA 1MAAA 4NKRA 3D54D 1A04A 4QSMA 2PMDA 4JLWA 4BE4A 1JYFA 2Q2VA 5AVTA 3DO8A 4Z9YA 4KBYA 3CX3A 2OZLB 2DX7A 2AE2A 4AM8A 4G5HA 3SJ7A 3G1TA 1LI4A 4EAAA 3EIHA 1KP3A 2EFGA 4CWAA 3KL4A 3ZW9A 2IXTA 4FFBB 3WIVA 1VGVA 1L5HB 1H94A 2GLTA 2W6JD 1GZDA 2H48A 1K7CA 4M9SA 4S1PA 5AKZA 4BX2A 1ZWKA 4MR8A 2HL6A 4AYWA 4BQIA 2ZRMA 3HKDB 5EXDA 1JJVA 1HI9A 3DOEA 1TVCA 3BGWA 1T8UA 1VMAA 3LPMA 1PBTA 3DKVA 3NDIA 4ISBA 4N9QA 3MMSA 2PXCA 3DVAB 4JENA 4X9XA 2GYWA 4XQGA 3L40A 2P3OA 3NYQA 4PRKA 3H5VA 4WI1A 3T1TA 4LQCA 1Z22A 1BVRA 1NZFA 4RGYA 2I29A 5EKUA 1T5DX 2EF1A 2COKA 1H23A 2G40A 2GZ3A 1PLLA 4ZPXA 3JAMA 1CUGA 1C0EA 1Q74A 2GO1A 4GBED 4PLPA 1AHNA 1TYAE 2KLBA 2RGUA 4MJLA 1JXQA 1R5OA 1J0DA 1E89A 1AZSC 2VNKA 3A1EA 4LRUA 3KXKA 4ZYXA 3S27A 1O0BA 4BYMA 2WIAA 1P5HA 1U1CA 1W0JD 4B31A 1MH1A 3H8SA 3T94A 2X2PA 2PSJA 1E79D 2PTGA 4ZOCA 4DRXA 4DHWA 1O87A 4QEKA 3LRXA 1T4GA 4GQBA 3G85A 2F3UA 1IEQA 5G4KB 5K6AC 2WHYA 4K8RB 5IYZA 4DG5A 2VDWA 2O2EA 3DEKA 5IC5A 1T5HX 2EJVA 1GRVA 2PZJA 3SZUA 1PSDA 3Q0TA 4DZRA 1KFBB 1CQIB 1NI5A 4GI5A 5DZSA 3S2SA 5JS2A 2IHUA 4UPVA 4RHCA 2Z4TA 4YT5A 1XEAA 3N28A 5FOQA 1YIAA 1V26A 3T1OA 3WLEA 1UBCA 3N2EA 1AKNA 1DXQA 2XKBA 1R0ZA 2I7DA 4OOFA 4ND1A 4Y9SA 5IF3A 1RRPA 2MWMA 3VU0A 4OI4A 2YJGA 1I7NA 3C1TA 1O8BA 1Z5UA 4PRYA 2QT9A 2GRUA 4ITRC 4O2RA 4XM0A 2JIDA 2C84A 1C0KA 1UP4A 2C1ZA 4D74A 1TUBB 1WA5A 2IYFA 4XXHA 4KQEA 2ZB8A 3WL3A 5H68A 3GGOA 2CVOA 4LOKA 2P1RA 4F8EA 3RBXA 1IMJA 4RO0A 1T1SA 3DE4X 2IZOA 2YWHA 4ZAXA 4QUDA 3LI2A 5J4LA 1ISJA 4YRPA 1VJCA 4P5PA 2GPYA 1DAHA 3DQQA 4PG6A 4RKRA 3SBDA 1E1CB 1VL5A 4QUIA 2C97A 2GF0A 2VZLA 1ISMA 3HE3A 3R6DA 1K2WA 4HB3A 4U1RA 2DTDA 3A4LA 3CEJA 4NL4H 1K6MA 5B2ZA 4Q7KA 5CHEA 4KYUA 5CIQA 1N3LA 1NTOA 5JAQA 4MICA 2EKQA 1X7XB 5FD8A 4AJNA 5B58C 2EF0A 4RMIA 3NASA 4XYEA 1HX7A 4CMIA 5SY6A 2BOVA 3QE0A 3KZNA 4N8EA 1GKLA 4JWTA 2YRWA 3HWWA 3EPRA 3Q12A 5H82A 4IDPA 3V42A 5HGJA 2BTEA 4CR8A 1E2JA 2CGEA 1NLFA 3FZEA 3U7GA 2G09A 4KO1S 1PL6A 4BGIA 1XMQB 2E1RA 1G6KA 1R9MA 2MYUA 1NI4B 3OFSA 1Z4OA 4DNQA 1GTRA 3T4UA 1Z6QA 4C5CA 2HHAA 3AVQA 3URMA 2I9KA 4XIYA 2CNNA 1BMFA 5C1BA 5EQFA 2H7CA 1KIMA 1IU9A 3MWLA 2YZ7A 1Y4UA 1EG7A 1WCWA 2VYCA 4QPNA 3THOA 1GTSA 4HNRA 2C3YA 2GFHA 4IVRA 4BJ5A 2JFVA 1F0NA 3THWB 3ZZNA 4YJKA 5GJWC 5IH7A 3QJYA 1S2DA 2GZRA 1MCZA 1XV5A 3ZXUB 3A1DA 4IKOA 3B6ZA 1D5CA 3QVLA 2PD4A 4OHBA 3BWEA 3IOEA 4E5VA 3EVNA 1EM8A 4CLRB 2EG5A 3FWHA 2FAXA 4MA4A 4DMLA 2A9PA 1KMCA 3JQ7B 2E0IA 3L05A 4QXQA 2GTHA 3C3AA 2BUAA 3I9V1 4FEYA 1Q7GA 1WDKA 4C6SA 1H8ED 1ILWA 2XUHA 1JA9A 3QVTA 2QVYX 4C4SA 3U4MA 4DHEA 4OLAA 1UBOS 1JR6A 1WLSA 1QTIA 2R66A 3K0FB 2RC5A 1WXXA 2VNJA 3RSGA 1XTVA 3CU5A 3GZTB 1NT2A 5DH9A 3AHJA 4QU9A 3HSSA 2XT0A 1GLVA 3RVLA 4B8YA 1MIHA 1A8UA 1GARA 5LSAA 2FXIA 2CXNA 1JNXX 1XJCA 3BWDD 3NVMB 3P0IA 4RXMA 8ADHA 2GZ1A 3MBKA 1SPBS 1BA3A 2O2HA 4YAUA 3ZI7A 1KI6B 2AJBA 1L7NA 3R3HA 5BYJA 1VJ1A 2HIAA 2XXJA 1JTEA 4E5YA 4KOAA 1L5YA 5KB3A 1H2ZA 3C3WA 5TIIA 4NFLA 3GDWA 1XYVA 3WTBA 5E38A 5IJ9A 4IXDA 4RDXA 1GG2A 1LBHA 4TMVA 4A6DA 1Y7LA 1GRQA 3W5UA 5M7EA 3AETB 4C4RA 2C3MA 4K9RA 3VTZA 4E5DA 1RXUA 4LXGA 3CZQA 1DADA 1AXRA 1NNLA 1MA3A 3KVOA 4EHKA 3M1LA 1T9GR 4IHJB 1MKYA 4TV8F 2FG5A 2X2EA 1SXJB 3DTYA 4ALJA 1T13A 3N8NA 2CJWB 4RK1A 5F9FA 3M83A 2BRUA 1W85A 4MYCA 1XGKA 4A8HA 1GA4A 4J0DA 3LO8A 4TV9A 5LYYA 2H00A 4WNIA 3N2GB 1K75A 3ICPA 5KDLA 1L1FA 1PJZA 2YJ4A 4N47A 4BNHA 5C9ZA 2PX6A 2YWGA 1PJLA 3HBLA 4ETWA 3IQGX 2RKOA 3P0JA 5I8PA 2HV9A 2QE6A 1VMKA 1OA1A 4YP0A 9ATCA 5D3KA 2OHFA 5LQJA 2P0AA 1F14A 3UA3A 3G7UA 3OQJA 4Y30A 3Q2KA 2HCFA 2JIZA 2Q6VA 2R1TB 2P3QA 3KJNA 3KTAB 3W1EA 3ESYA 5KO2A 3NPMA 2CXSA 4QC2A 5JLJA 1XU7A 1X7YB 1BA2A 3GJXC 4J2TA 2WWIA 4DN6A 4DIOA 1MFZA 2QTTA 2XGGA 2C7RA 1NXPA 2PX0A 1F51E 1E2LA 4WFJA 4KJXA 5HFNA 2W00A 2HDNB 5IDQA 4LOAA 3O4IA 4KI7A 5IDVA 3S28A 3RYFA 1OHHD 3LOUA 4M60A 3W3AH 3KCNA 1H6CA 3R0VA 1YTLA 2RHWA 3Q2OA 4FI3F 1I30A 2GVNA 4WFQA 4YMIA 4OQXA 1PBNA 2APJA 3JYOA 1LFAA 4O2BF 1S2GA 5MN5A 4PC3A 1KJ8A 1NVEA 1T35A 1ZD9A 2ZRKA 3EULA 4R69A 1E18A 5K05A 1E2QA 3HS3A 3UOWA 3K0SA 4AD8A 1ADCA 4H1TA 2BV3A 4HWOA 1W88A 2IXEA 1LPMA 3GFPA 1NW9B 3QLUC 4FN4A 2O8FA 2G04A 1MXHA 4P4LA 3GCZA 3LUAA 5F77A 4CM3A 3L1KA 2JH8A 1I4EB 4MGKR 2EL9A 3CH4B 4FJ0A 3CZ5A 4GYJA 4FCVA 5DX8A 5THKA 1ZH4A 2PAFA 1Q7TA 3OTGA 3ZDEA 3GDOA 3PXCX 1O03A 3BVPA 3AG5A 1EGVB 1BGVA 1IUKA 1PFWA 3NWJA 4C2UA 5TV2A 1VZ2A 2V55B 1PV4A 4RVGA 1COWD 1PNTA 2FPPA 1V43A 2GJ9A 1Z5NA 1VECA 3NIWA 4H4EA 5EE0A 1XZBA 1GSOA 2HQOA 1T9GS 4KPGA 3B53X 1P18A 1VI2A 4UVGA 1Q0QA 1UR5A 4KKXB 3TXXA 2PJDA 1EFRA 3FN4A 4HFMA 3L5KA 3WYCA 2GYYA 3AGPA 3FYTA 1I1OA 2X4IA 1ARZA 1Q0UA 3PQCA 5AUOB 1IBLB 5FUWA 4KXLA 1WMBA 5CEFA 5IZCA 2XLBA 4JYBA 3UK2A 4RV9A 1E1DA 5FL3A 2BY4A 4ZXFA 3MWEB 4NMMA 3G6WA 4H3VA 5IH3A 4BP1A 2O0KA 2AXPA 2R68A 2X40A 5KINB 1GXSA 1XCBA 1NOIA 5AJYA 1VG9B 5AW9A 5HJ5A 1GTG1 3FFWA 1R2QA 2B3DA 3EQ2A 5KYKA 1Y8ZA 2OG1A 3PLNA 3HCFA 1FUKA 1UODA 3GOHA 4DLSA 1T3ZA 4R1MA 3FJOA 3OD5A 3UXEA 1MRZA 3OSZA 5REQB 4LDZA 4TMFA 3VJMA 2Q9AA 3IQHX 4PSDA 4L73A 4JL8A 4XGKA 4GKJB 2OG2A 3CVXA 3C3MA 3EN0A 1YB5A 4KB5A 5BT8A 5BQFA 3ONNA 3OC0A 4YNBA 3WRVA 3VHXB 4DCMA 3R5SA 3SJAA 2GPWA 2W8ZA 5FFFA 3TBHA 5CXUA 5T7BA 2O6LA 1UEXC 3GVHA 3NBYC 5IRCD 4MVJP 5KS2A 3TZKA 5FA5A 1BDBA 3AR4A 4QGSA 1CJSA 2B5OA 3F3KA 3W8EA 1FY2A 3K0AA 3RRMA 4Y6GB 4G65A 2XYQA 5DLQC 2IYNA 4WY5A 1JQ5A 1XMSA 4J1QA 4BNXA 5AKYA 4Y1FA 3DMHA 2OO7A 3BMOA 1UMKA 2O8BA 3G2NA 5AM2A 2H8GA 4WJKB 2AWOA 3FZNA 1POXA 3D8BA 5DTJA 1C9YA 2IIQA 4M83A 2KPOA 4ZT5A 4EHAA 4IW3B 5EWJB 3R3UA 5BNWA 5K9ZA 1N0IA 4CT0A 4EENA 4C6TB 2JCSA 4QOHA 1S2IA 4FHDA 4DREA 3S1SA 4BO1A 2BZ1A 3EPHA 2Z6VA 1TRKA 1Z8DA 2CNKA 1FFCA 2GZAA 2IP1A 3H3XA 3HYRA 3LYUA 4FU0A 4RADA 4RGQA 3TK1A 4MUAA 5F1PA 1PD1A 3PKJA 3VU1A 4H60A 3GXOA 2XLCA 3TH5A 1DVRA 1WHSA 3FVTA 3QW4B 1B42A 4XRGA 3KYJB 1K2VN 4ZJYA 3LU1A 3VR5D 1Z62A 5LNK1 4UAJA 3ORHA 5AW6A 3M6IA 1KSHA 2QTGA 4DWVA 2YOFA 4N12A 4BVFA 5LDHA 2PD3A 4L8GA 1XWWA 4V39A 2POQX 1DQNA 5FULA 5A4KA 2GOYA 1HOXA 1YCDA 2C5FA 2W11A 1DC5A 1KZ7B 1M2FA 1V1JA 2Y2UA 4ZCSA 4IH4A 4ENVA 4TMKA 3U3DA 4QT0A 4W5NA 2XQIA 4IWNA 3LYLA 4ITVA 1IPHA 5CVDA 1CR4A 2FSPA 1G21B 3RBAA 2B1IA 2YIJA 4QXAA 3P2OA 4KRFA 4MKIA 2ATCA 3CN9A 2HIHA 2JF0A 4FDMA 4BVLA 3KQVA 4J75A 4RH0A 4ON9A 1TM5E 4HNAA 5AXBA 1QIKA 2ATVA 3BJMA 1VFNA 3IDFA 3SJCA 1IZ9A 5LP6F 6GPBA 1L5FA 1PZXA 2W2LD 3IVXA 4P3PA 5DK4A 4D4GA 1V7QA 3DPIA 3HDJA 2R1VB 5B1YA 2Q9CA 2PZ8A 1RPTA 2IOQA 5AVUA 5JBNA 3RRYA 1DT3A 2OSVA 5ALXA 3ZE2B 1F8UA 2PG3A 1QGUA 2VSFA 5GM1A 4OBWA 3RKSA 4MDHA 2B61A 1PR3A 5ALLA 5LB4A 1LBSA 3OQHA 4DV0B 4LGMA 1KEEA 3HKBB 4TZTA 3OQNA 1WB9A 1D2MA 1LQUA 4HQFA 2ZITA 1QS0B 3COPA 1DUIA 4RAOA 4W7IA 5BN5A 3C4JA 4OQ4A 2FOXA 1I4LD 1RWBA 1B3BA 1XIVA 3ONEA 5TQ2B 2NQTA 3GARA 4D5GA 3U26A 3D5TA 2QP4A 4X1OA 3T3MB 4COKA 4V0ME 1JKMA 2AN5A 2OAGA 1JH8A 4HEA6 3EQ6A 1U7UA 2CJXA 4OYRA 4KFRA 4AKSA 3V1KA 1LPOA 3N0TA 5BR7A 4KLNA 4XCVA 3DBRB 5CTJA 1GILA 3E5HA 4JELA 4QDTA 1UL1X 1ECGA 1E9EA 3NYWA 4P4TA 3RANA 1L1QA 4BMZA 3UGJA 3PPVA 2VJYA 4OKSA 3R4CA 1R37A 1NXXA 3K5HA 2AT1A 1TKBA 2WJWA 3HACA 3OIWA 4F0JA 5C1DA 1U0LA 3GLUA 4PHTA 3COJA 1ECLA 1JQ3A 2R62A 1EVJA 3S99A 3A11A 1U9ZA 4K8OA 3UMRA 4K40A 4E0BA 5ENDA 2XF2A 3CM0A 1DCKA 3W1VA 2PE5A 1HO3A 1XRQA 2R5WA 1YDWA 4TMWA 1XTQA 4KQFA 5C8YA 3OM8A 4TSRA 1V96A 1QGYA 3L8EA 3KC2A 2X5XA 5D85A 4L0CA 4AY5A 2I2DA 4D4IA 1G8KA 5IVPA 2ONKA 1PDOA 1S2OA 2A3RA 2PKEA 2A88A 4A8JA 1M0WA 5KVSA 4D9EA 1E4EA 5LM3A 5GMOA 5HKLA 3U44A 5KCMA 2Y4NA 4UULA 4O4IB 2NZYA 4OV6B 1RYYA 1UDXA 3T7TA 1P7WA 5C1PA 5FB3A 3GCDA 1A5ZA 2IXAA 3H8JA 4C7BA 4DC1A 2FMFA 2WYHA 2V5VA 3OEEA 2A4MA 3P9PA 4N4AA 1WZCA 1GFWA 3K9WA 5FTKA 2VSYA 1KIFA 4I1SA 2X1LA 3U37A 2MHCA 3ILSA 5DBHX 5KOHA 4GX0A 2ROQA 2EFCB 3FBWA 4EDFA 3DR5A 4KREA 1XHLA 1DWPA 3OZAA 1HNWB 4EPVA 3WQBA 2WVJA 3GPLA 2BMWA 4FHCA 2QPTA 1N6NA 1F6BA 1U0NA 3T6KA 1L5OA 3DW3X 3R0XA 1F0KA 1KZHA 1Y1LA 4IZIA 4O4LA 5DSTA 3SI7A 5BSHA 2G83A 4BLWA 5E3JA 3SR3A 4CKYA 5LL6P 3K4QA 3OKAA 5D51S 3L79A 5HDQA 2QD2A 2INGX 2QIOA 5EIEA 3ECCA 3DMTC 3KQSA 2L2QA 2FJUA 1NR1A 2VJOA 4BFUA 1QDEA 1T0JB 2DUNA 2HDWA 2EQBA 1SIUA 2WJIA 3OKFA 4MS3A 2VQFB 3OIVA 1C4KA 4S1OA 2QRVA 1OJ7A 2W90A 2Z6UA 3WO0A 1E5TA 3MC1A 3U0BA 1NR5A 4DWJA 5GGYA 2WJ6A 5K01A 4H31A 5GZ3A 4R3NA 3FNGA 5C81A 1HYEA 2NSLA 1S3SA 3CBQA 5CEEA 1NN3A 2C88A 3CKKA 1QJCA 2W0SA 2FDRA 3HJNA 4YI3A 4DGSA 5FWYA 2NAPA 3FPJA 1VPEA 3FKSA 3O38A 3UAZA 4DDTA 2CCKA 2PX3A 3B20A 3CW9A 3TQTA 2IIPA 3GMIA 3PJFA 3DXFA 4AK9A 4E46A 5JH7A 4UNRA 2QN8A 1TT5B 4JJFA 4LZOA 1K9VF 3KE8A 4UBOA 5EVCA 4V0LA 1Z6TA 4Z9AA 5ER9A 4C05A 3ZCQA 2VT3A 5KTKA 5FWAA 3E9RA 1W9MA 3ZJ5A 4F6RB 4F1WA 3T5CA 4QATA 2GBGA 2YMLA 1FBNA 5KBYA 1R5JA 1TUEA 1YCFA 2ZRJA 3OP4A 4L5JA 4XDYA 3D7LA 1NUPA 4EF4A 1Y6QA 4MUYA 3A6GA 4LISA 4TKVB 3I9KA 1I8TA 4E30A 4JUFA 4D82A 3ZQ4A 1LLQA 2ECOA 5FWXA 3TR0A 4ZCQA 1VBFA 2AKEA 3P9IA 4D9JA 1ZU5A 3SDZA 3TW4A 5HKAA 2G1UA 5BR8B 1PYGA 2AD1A 3OQBA 2AUMA 4HF7A 2KS6A 4EZIA 1RD4A 2P9QA 3VAZA 4ZQCB 3F5MA 3CHYA 2EG9A 1ZXXA 2QYSA 2OFXA 3SXUA 3L7OA 4FWIB 1APBA 1P1JA 1ZM7A 2G3YA 1GY8A 2VUSA 4GXQA 4RVCA 5G1NA 3DE7X 3GA7A 1JBEA 4NJEB 4OJTA 3C3BA 3CRRA 3RBVA 5LZ4A 3ZDAA 1GZ3A 4S0ZA 4QJIA 5KNDH 3S8MA 2G76A 3CNBA 1ZJJA 3U3XA 3J80A 3HXKA 4HGQA 1JDPA 3E0XA 5TQ0A 1QK4A 3ADPA 1UBTS 2IDKA 4JVNA 4CMAA 3SC6A 3WYEA 2HV8A 4GHWA 2WFLA 1W4BA 3W3ZB 2A9QA 2CVHA 5HSGA 3OESA 4B3BA 3C7CB 2I6TA 3IUQA 2JKZA 3CUEF 4WZAB 2AS0A 3VI3B 4X63A 4BQRA 4RZSA 4MIOA 4Y6RA 4W8OA 3G02A 3TSCA 4RACA 4DMHA 5GIPE 3RQSA 4BQOA 2R3SA 3FSGD 5FBQB 3ZCRA 4QQFA 4ZOAA 1B8PA 1JJ7A 2E48A 2LBPA 2OWEA 1FVFA 1YIDA 2ODWA 4UHBA 2DYKA 4HBGA 4M1YA 1BYUA 2G7ZA 3F4KA 1KAQA 4UZEA 3VV2A 3K6RA 3LVQE 4JBNA 6REQB 1C3OB 3HFRA 2J9GA 4RPHA 3ZY2A 3IFSA 1J0AA 1P1RA 2Q0QA 4AO8A 4V1CA 2L82A 3KP1A 1CZOA 1E5QA 1KI2A 3NX4A 3FYCA 2P40A 1DKQA 3I1IA 1NJ2A 3O9MA 3ETDA 4G5FA 4OQFA 5I47A 4I3FA 4N3CA 5BNFA 4FFVA 4IEFB 5B30A 3DWFA 3A10A 1TW3A 3VOTA 1MG0A 4MDYA 2A5FA 3HQ4O 4FYWA 5HKOA 4D6XA 2BBOA 2NVUA 4I3GA 2M1ZA 2XT6A 1FRQA 4O2LA 1OIXA 2WJ3A 5EE5B 1G3IA 1GZ5A 3BH0A 5K4HA 5FBKA 4LDPA 3RC1A 2GN6A 3ZI0A 4KN6A 4ZT3A 3ZQKA 3CX4A 4ZAVA 5I51A 2P9EA 3FI0A 1UM9B 2I2FA 4KMOA 4RSMA 1LPNA 2B8EA 3QEJA 1U8ZA 5D00A 3RUPA 1PJAA 3D31A 3Q11A 3WC4A 1XRRA 3QY9A 1UXJA 2J07A 3A3YA 4DBLE 3LVFO 5CP8A 1YK1A 4DG9A 1R4AA 3CUWA 1CQWA 1YQTA 1FFAA 1SXHA 1XMIA 2R4UA 5K0EA 1HEIA 4B47A 3CMCO 3SCZA 2AE1A 4RE5A 1NQWA 4FW9A 2J9YB 1VKZA 4HO1X 4KHZA 4BQSA 4YALA 4DWOA 2YWFA 5IUJC 5K4GA 3LZDA 3NRBA 4ND3A 1XVVA 2D6FA 3SS8A 1CZRA 1IN8A 3W2EA 4V02A 1DFGA 4DNXA 3ASYA 3JQ9C 2QRGA 3PYXA 4FK8A 4LRWA 5IEJA 1N33B 2HZ7A 3I0NA 5T64A 1GRRA 3X1KA 4C21A 1R4MB 2IPLA 2EJBA 3HDVA 4HDKA 4DM3A 5CB0A 2LKCA 1XB2A 3WHPA 3DGEC 5I7RA 1BZYA 3EVBA 4EGJA 1QR2A 2EBFX 3IUJA 1CUZA 1LF0A 4OSOA 3UM9A 4C6HA 5ADVA 5EQTA 3IAEA 3ULKA 1SKMA 1ANKA 4GIBA 1VIYA 2I7VA 1GU0A 3IQEA 3RARA 3OLWA 1K7XB 2ACEA 2Z8XA 2ZIEA 2X0NA 3C5EA 1J23A 1QV9A 3B13B 3E9CA 3GT4A 4AN1A 1XDWA 4PGMA 1YBMA 3U39A 3DB2A 4G5RA 1GUZA 2PQ2A 2PFSA 3H5NA 3KR0A 3T1NA 5JAHA 5HKKD 3RJZA 5BMVB 1TTTA 4QG7A 4Z4QA 3OU6A 3JWEA 5FXMA 1DTEA 5JPDA 4OU4A 1J49A 2Q3BA 4YREA 3S1AB 5FHQA 1BWSA 4UXJA 3IAS1 5TXGA 2OZPA 3UNXA 3EX7C 2GJSA 2ISSD 2XR1A 1WB5A 4WKBA 5C4IA 3TF5A 3BOSA 1L7QA 4HZGA 2XUZA 3RWBA 4CMKA 4ECEA 1K6EA 1ZLXA 1RLMA 2HCBA 5LXTA 3ADCA 1GGEA 1RMYA 4GWKA 4JT8A 5L3RA 3HJCA 2XA2A 3P9YA 5DO9A 2Q21A 4N1AA 2G1KA 1M75A 2VXBA 4NP6A 2XV1A 4D9KA 1D1TA 1EFVA 5LA6B 2M32A 4IHKA 4MRMB 4PHHA 3UAVA 4BLSA 1N7JA 4BPRA 4YV7A 4DSAA 1D2NA 1Y1KE 2XJ4A 4KTTE 5M29A 2GVZC 2Q2QA 1H0HA 1YGPA 4I5EA 1JS1X 3RC8A 1U4NA 1YZQA 2BJHA 1GG5A 3EAFA 1JDVA 3UK7A 4MTLA 3L7JA 3UENA 2OXEA 4E5KA 5DGDA 4BKRA 3KWJA 5L7WA 2QTFA 1PK9A 1FC0A 2B7CA 3SDSA 2BTQB 4LXHA 2J6HA 1ABEA 4GWGA 1EAYA 8LDHA 2NX2A 1OUMA 3TL3A 2P0YA 4BNMA 2H4FA 3NWBA 3B1XA 4CQNA 5MFZA 2G1AA 1ONOA 3EBOA 3SC3A 4ZCTA 4AG5A 5AKGA 4RKEA 4LX0A 3DCYA 3KWMA 3QVMA 3E84A 1RC0A 3C7AA 4DC9A 4ARUA 2G36A 3TKYA 4QULA 3BMNA 3AR7A 1H2XA 2FSVC 4HH0A 1A9PA 2NGRA 1P4SA 2R1UA 2RONA 3EFOB 1CLUA 4M98A 1KEZA 5DVZA 1TU3A 1CQZA 3JX9A 1UWCA 3RV4A 1U3GA 1E77A 1E3DA 1WMEA 4MUKA 5FJIA 5K1ZA 2Y0CA 4C43A 1XNQB 4EHHA 1QIJA 2R2GA 5BV2P 1GJRA 1I2DA 5BRJA 1IDN1 1SUIA 1ZX1A 4UREA 5K3CA 2XX3A 3AYXB 3RSSA 1EBBA 4QU8A 3GA0A 2DBVO 3RVOA 4BLTA 5JBIA 4KEAA 3TLCA 3R6WA 4UNPA 4Q9LA 4ZPJA 3Q9NA 2X15A 4WBXC 5BR1A 4HLDA 5IBQA 2GERA 1WZ2A 1MQ8B 4FFNA 5F64A 2Q5CA 1AV7A 3WXBA 3K31A 2ZS9A 4ALNA 4EHDA 4X64B 1ZBDA 1EVQA 3KS9A 4RTMA 5HZGA 1P9WA 3RU9A 1SUAA 2NIPA 4QHSA 1UWKA 4UDNA 4Y2SA 4BU0A 4K05A 2QNRA 3WAKA 3HI4A 3TVYA 3UMGA 1YQXA 5KOJB 5A04A 3JYHA 2YHUA 2KM1A 3CUVA 1L5NA 1KDYA 2GHQA 4RQTA 3S2FA 2E5WA 2PT5A 1JR4A 3BIXA 3Q85A 2TRSB 3A9WA 2V1XA 1JMKC 1C3LA 2B92A 3WQQA 1ZVJA 2XWSA 1W73A 4X71A 1X7GA 1KK1A 2ZYDA 2JLRA 3ZWMA 3TM4A 4TRMA 4KDFA 2BHRA 3NEYA 3HBMA 2WWVD 4ND8B 4UEQA 1U99A 1BX0A 3VAAA 2IHVA 1CSEE 1JQKA 1IHXA 3MCUA 4B0PA 4EUEA 1YRQA 3ZHSA 3GD5A 4KG7A 4DKJA 1Z0ZA 1O6BA 3CV3A 4PLHA 1D8TA 2WTXA 1ID8A 1XUOA 4OI1A 1SZPA 1Q50A 1W8DA 1CUUA 4M21A 4TQUS 1HG0A 3RC7A 5EKSA 2CHVA 4MV7A 1K5GA 3N3AC 4YN3A 2HSZA 4F84A 1R6TA 2GEKA 4YRSA 4JLOA 4V2UA 3L49A 4KDCA 4WNAB 4IRMA 5JXJA 5EYPA 3ZX4A 2CEKA 1FU7A 3QVOA 4L5IA 4MPDA 5FORA 3ZD9A 2P1DA 5JMWA 3Q8LA 1JH9A 4XIIA 1H2EA 1TOAA 3H11A 4R6XA 5TDHA 5A0VA 2GCIA 5BVHA 3CJTA 4BX9A 3EVCA 4PQYA 4ZODA 3L1UA 1EEXB 4CCAA 3LBIA 5FO1A 2QNIA 4PG4A 5CFRA 5I7SA 5KX5A 3N2YA 1TEXA 3HKCA 5CA0A 1QIIA 4QRHA 1P0PA 1TK3A 1KQPA 3DLTA 4RZ2A 2YJ5A 1IOWA 1LX6A 5ITZA 3KHKA 1DOHA 1XPRA 2HU5A 3DDZX 3T3IA 3W9SA 1OWMA 3UMYA 5ESWA 1EB9A 1TQDA 4X3OA 1EZZA 1GYQA 2I2XB 4LXTA 5ITSA 1KSFX 3LIIA 3AG6A 1IHPA 1VPDA 1BD3A 2X22A 3CRQA 3WK9A 4JI8B 1Z12A 5EESA 5C53B 1T6YA 1M34A 3ZWKA 3D5EA 4HX9A 1QSGA 1VJTA 2DF8A 2E4AA 4NYIR 4PZAA 4RF4A 2H0RA 2PANA 3TZLA 3L7MA 4X65B 4NARA 5HK9A 5KWEA 1O3YA 2O2YA 1B1AA 4LNHA 4RFSB 1E0DA 3A7EA 5JYDA 3PC8C 4EPTA 1EXWA 1JR3E 3IJPA 2FF5A 4DILA 1PGPA 1XO1A 2QJFA 1JSXA 3IVAA 4XUEA 3T9EA 4CKXA 4YA6A 3RTDA 2ZIGA 3AHHA 3LC7O 4KVZA 5I8WA 3QPVA 6ADHA 5J2UB 2BHTA 3IKTA 2FPUA 3H8WA 4F4FA 2B4QA 1YO6A 5FTMA 4EMBA 1NBIA 5JE8A 2ZBUA 1F0YA 4CF3A 4DF3A 1MTOA 2QVXX 4OHOA 5G3YA 3CF0A 4D3SA 1IWBB 2GB4A 1F2UA 4K81B 5MHTA 3E4CA 1V1RA 2EKDA 2JI9A 2VQEB 3EJ6A 1H1DA 1E3JA 1Z63A 3TAUA 4Z4GA 3U4CA 4BB6A 1U0BB 3LDHA 1VKNA 2X0IA 2YXPX 4DCSA 3TPZA 2BONA 1WZIA 1CY6A 1J5PA 3C3EA 3DZFA 4WWHA 2VF2A 1BE8A 3V4SA 3P4YA 4U63A 3H9CA 4BAGA 2G07A 2Z6QA 4I1IA 3OTHA 4TTSA 1IUNA 1ODLA 1OF1A 3LWZA 3PZBA 4L1KA 3VKHA 5AVSA 3FFAA 4TSFD 4FYHA 1ES9A 4CMEC 1PEAA 3OHPA 4AFNA 2CT8A 5CB4F 3CA8A 5A4IS 4NCJA 1H0KA 1F6WA 5ICCA 1JDJA 2WQ6A 3FPFA 2GPAA 4IQGA 2PK3A 5F1KA 3VH3A 4XD7D 4LKOA 1TC1A 3PXGA 1G9TA 2ZZKA 4E07A 3EXHB 2YWDA 2QSJA 4MQEB 3U60B 1J06A 3IB6A 4CVNA 1K7SN 1KKMA 2E4UA 1WOMA 1WP9A 3CPEA 3O6VA 3QXGA 1YA8A 1NYRA 2IX9A 1C7IA 1P72A 2DMRA 2OBFA 2RG7A 1QGOA 1UMCB 3B8EA 2BZSA 3D8SA 5A2GA 4TV8B 2C99A 3W5IA 3DT8A 1CPYA 1B6SA 5AOCA 2WTEA 3S4YA 2X8LA 5AVWA 1MOZA 4MRVA 5DM2A 1ZRNA 3QEAZ 3E5MA 3NTQA 2ILTA 3WHKA 1BMQA 4OGKA 1Q57A 3IEUA 4LZJA 5H1YA 3INGA 5IN4A 2G06A 5FR2A 3RSFA 3LCMA 3FRIA 2FZEA 2IS4A 5EUMA 2Q5HA 4JOQA 4EKEA 1CUHA 2WWWA 4UE6A 1XD2B 1PEYA 4GOOD 3LV8A 4P3KA 2AQKA 2FPIB 2BEVA 4OHZA 5KQLA 4B3JA 1N2IA 1U8FO 4X6XA 2ZROA 3RODA 1EI9A 3IE0A 2BM1A 2R7LA 3GFBA 1Z6XA 4UZSA 4B4KA 3OUTA 4WA8A 2NO1A 4ENPA 4C20A 4IUCS 5D3ZA 3GN2A 4RZHA 3PJEA 4G4SP 3CZ4A 3FDZA 4MCIA 4XR9A 3ZX5A 2BH9A 1J39A 5IPFA 2D00A 3KKQA 1TQ6A 3PUJA 3PNQA 2VUTA 3GGCA 4Y2UA 3CIFA 3KQQA 4YRJA 2ZQ5A 4X6YA 2R6GA 2QUKA 2JGNA 5HGXA 3OQIA 1X7WB 2X4DA 3PUXA 1LBIA 1VOTA 4I55F 3ADOA 3PKZA 2GCEA 4JHXA 1QU3A 3UK1A 1BJRE 3I73A 4YIHA 3C1AA 3QX3A 3EBPA 4W8HA 5KYWA 2IY9A 2PFGA 3R41A 3PLAE 4YAEA 2OBMA 3LGXA 4RVDA 2DR3A 2BI7A 4IDOA 4Q5IA 2BW0A 2Z5FA 4MJ3A 2FSHA 4NZMA 2O3RA 2DQYA 5TF0A 4R8LA 1L8XA 3NNNA 1VYTA 2Q5OA 1J99A 4BL5A 3ERCA 1DTWA 4PLZA 3G23A 3VDQA 4JKOA 2CLEB 2ZGVA 4W9NC 4EUFA 1XSEA 3A6EA 3MAGA 1J5EB 4FGJA 3RROA 5MN6A 4NBWA 1G16A 1O94D 2X6QA 2QAIA 3PF9A 2VHXA 3LKBA 1YU6A 3CJRA 2HM7A 2PM8A 3EFHA 1I9CA 3UHPA 3V4OA 4ZTUB 1E3WB 3ZIAA 1YJCA 4MWEA 2OO5A 4E3ZA 5IAEA 4GZ5A 3WGOA 3IHTA 3PP8A 1V8OA 1NMZA 4KGXA 5FBWB 3H2KA 3HEBA 1QJ4A 1TCBA 3SQXA 5JDCA 2HWUA 2Q46A 3F49S 1H93A 4HD8A 1POWA 1XDGA 4OIFA 3VYRB 2O2CA 1QYCA 2FR1A 2XE6A 3VKVA 1HDOA 1L5SA 1WB6A 1CRZA 3BFXA 3J7TA 2YZ2A 4RD4A 1RQXA 1OE0A 1M8GA 2SBTA 2ZJYA 2V3VA 3CO0S 3TTYA 2ECKA 2I33A 2JFOA 4CV1A 1JP7A 5AK5A 3RRZA 4HAIA 3DHVA 5EQJB 1H05A 3HPRA 1Z8FA 2IY7A 2YICA 1KYXA 3D3WA 4W5HA 2UYOA 4Q47A 2ZUFA 3AEYA 2H2AA 3BQ9A 2W2QA 3GLVA 5GONA 5SY9A 4H27A 2ZZMA 4GF5A 1NVXQ 3RG2A 3DAHA 5CYGA 4ZWNA 4TVSA 3SU8A 2FWNA 1JILA 1MX9A 3H6HA 1CJUC 1T15A 4J16C 5DHAA 3V3TA 1PHRA 4WLEA 4I5DA 4JH0A 5DP2A 4HGYA 2ZRBA 4JSYA 2GN2A 2GZSA 3MUFA 4RDHA 5L3SB 3G0CA 3TEFA 1I01A 3L84A 3ZV7A 1A4UA 4HP8A 4G8JA 5EZ5A 4ZIRA 1FP6A 4O2BA 3WO1A 1DIOB 1Z36A 3B8HA 1MOQA 2PS1A 1AZTA 4G0PA 1FQWA 3LYAA 4PW0A 5BSFA 4PAGA 2ZYGA 3GF4A 3ROKA 1A8SA 1HKUA 4F2DA 1KQ3A 1XLTC 2LV8A 4B7UA 1E0JA 3OKPA 1XQ9A 4GZMA 4YDQA 5G0TA 3LC0A 4GOMD 1NG1A 1V1MB 2WK1A 1U0RA 2C2YA 2XTAA 4IDCA 1N36B 1RKUA 3DTVD 4MGEA 2Z56A 4RA6B 3FFTA 4EYGA 2VP3A 1BROA 1C9NA 2Y1KA 4D45A 1XHFA 2F9MA 4LJRA 2PIAA 5K0LA 3PNKA 3VH4A 5EEHA 2QWXA 3O1IC 4EHLA 5AM4A 3C3PA 2WT4A 4KMRA 5JDIC 3JYQA 4UNNA 5KNCA 1FMFA 5AW7A 2WHRA 1SOUA 1BVYF 1NR7A 3OE7A 1L7DA 4MUXA 1HMPA 2PSSA 1H5NA 2XTMA 3L6DA 5EIAA 5JC8A 1J00A 5CMLA 3MIZA 1NLZA 1Q77A 3B1WA 3K1JA 3A0RB 1R6AA 4NBTA 4V38A 5I3ZA 4GRAA 2UUCB 3KFLA 3EC7A 5JTTA 1IRXA 4BJ3A 4IDGA 4YONB 1TUIA 1JMYA 1O97D 4INZA 3RTEA 3ZKAA 1SCKA 3EEQA 5C3UA 3NJRA 3QK7A 1N9KA 3WGLA 3SZOA 2QT0A 1W35A 1Y63A 3VU9A 4GI3A 3FYSA 4YR7A 4U2DA 1NVKA 2OSBA 3QTBA 4WZBE 3BAFA 3AR9A 3E05A 4B4DA 1XA4A 1KNXA 4UOEA 4J0CA 3BICA 3MCVA 3NKLA 3Q0EA 2GX6A 5J2TF 3TE6A 1NVDA 3WL5A 5K7SA 1FSFA 3AX6A 1Y8QA 2ACKA 2W4QA 1O8CA 3TRJA 3DT9A 3IMGA 1OXBB 3TNFA 3WB9A 4PG8A 1FFXB 4RFLA 3GELA 5CXSA 5DGIA 3E7XA 1E9FA 3NFYA 3ZU6A 4DPLA 5FUQA 5KSYA 1XK7A 4XQ0A 1XZ8A 4TX1A 1UK9A 1I0ZA 1OBOA 3I83A 3X2FA 4TYWA 1RI5A 2W98A 2AOTA 1NIJA 3B70A 1X38A 2NPIA 4H3KB 4Q34A 1WD5A 2HYDA 5IMBA 1FJHA 3VQTA 5KC9A 3D7SA 3N58A 2FLKA 3R8XA 3UT5B 5KUTA 3BQMB 5JS1A 1I6MA 4WACA 2UYHA 2JFQA 4RZXA 1CBUA 4CFZA 2QR5A 3NDRA 4HH3C 1U9CA 1ZIYA 2XMGA 3F9CA 3HDQA 5ALDA 3F71A 2RAFA 4L07A 3P97A 4JCOA 1O89A 4X84A 4JDUA 3HA3A 3QU9A 5DN6A 2B3TA 4B7CA 1P4RA 1VKHA 1ZD8A 4ARZA 2FH5B 4R9UC 1M74A 1LRKA 3RC9A 1ZSYA 2OLEA 3AIKA 4HEQA 4JLAA 3AYZB 4O4HA 2CYBA 1U9IC 2DKOA 2NUBA 4C7KA 2YW2A 5IHPA 2P9HA 1YI1A 5K6AA 2VYNA 2CUNA 3A6LA 4ZJUA 1V5IA 4N5LA 5JJKA 1YQ9A 1QIEA 1Q0LA 1YBVA 3HCDA 1LLFA 4TLBA 1RKXA 4RS3A 4AULA 4BB5A 5I7HA 2PV0A 4JNKA 2BEWA 5G4LA 1BIFA 2C7PA 1WQ3A 3D8HA 2RJOA 2VWPA 2X0KA 3VYUB 2FETA 1BX3A 1RAHA 1WV0A 3N7AA 1QQ6A 3BRSA 1X1RA 4M9CA 4ZD6A 2P5SA 1HE5A 2H5JA 3I37X 2NSDA 4RLFA 2RHCA 1JIUA 2SKEA 1XALA 3AF1A 3LC2O 3QHQA 1K3UB 3HV2A 3PICA 2CFIA 3OZUA 4G4IA 3WYBA 4FQ5A 4D4JA 3I2JA 1M67A 1GZ7A 2HR1A 1YOVB 4D92A 2VP2A 2FB9A 5EGSA 3WBKA 3ZWPA 3PHLA 5FPQA 3HCAA 5TS3A 4R8RA 4EW1A 1EG2A 1ZI8A 3C8ZA 3HPQA 3EYAA 3AEZA 5BRAA 1V39A 2GZHA 3AC0A 3DHEA 1G3RA 3G17A 3M0EA 3P2MA 4MLPA 1NVBA 4M7OA 1Y5MA 1PVDA 1RWKA 2M9MA 3E61A 1G63A 2XGMA 1S89A 2M6RA 3D1JA 4HXYA 3L18A 4XLTA 3WISA 1ZN2A 1XE3A 4AXXA 2RGEA 3TSWA 1XZGA 1WSBA 1FLAA 1H6BA 3I52A 5FOUA 3RF7A 4HI0E 2HJVA 3PQFA 1W36B 2J3HA 2WZCA 1TDJA 2AQ8A 3M1YA 1BEUB 3M4NA 2JLVA 2P6PA 2IEYA 3RPEA 1W1WA 4BASA 4MZDA 1SC9A 4ALIA 1RBYA 1Q0HA 2OXFA 5IZ4A 3A6ZA 4HGPA 3N0XA 1VG1A 4JGBA 1SELA 4EUSA 1NZJA 1U94A 6Q21A 1XCMA 3NC1C 3MINB 1Q6YA 1DG9A 4M37A 5SYMA 4HG2A 4N7BA 4F4DA 3KU1A 1CLEA 1ZIPA 1Q83A 4ROSA 2V7QA 3PQEA 4G6ZA 4KSCA 1JECA 1Z13A 3CT4A 3FCXA 3LK7A 3DC2A 4BWYA 2P4SA 5TJHA 3E9EA 4JHLA 3KB6A 1V45E 3LWNA 4NOMA 1XR3A 2N75A 3PYLA 1F2TB 1II0A 1SFRA 4IFTA 4R0NA 3EDYA 3LP6A 1A9YA 2P35A 4M0FA 5JZSA 1ABFA 1QG6A 3COYA 2C31A 1OWNA 1MO5A 3CXRA 2A1TR 2C0CA 4NBRA 2GA9A 3RNOA 4JXXA 3T5BA 1S5PA 1XG5A 1R6VA 1Y3BE 1SC1A 1LW6E 1M33A 1W581 3HVIA 4CLEA 2EERA 4FYMA 4N5IX 3AEQA 5F1OA 3QE2A 2NADA 2NO7A 4ND4A 1F2DA 2P7IA 4I14A 4RD1A 4WZBB 4DCOA 4N18A 4MI1A 4P36A 4HZUB 1RFLA 2C1EA 2GD6A 3U2QA 2O19A 3U61B 1ISRA 1SJ9A 2GBLC 3Q3HA 1DB3A 3LAWA 2FZVA 4H7DA 4IEIA 4JIGA 1K3TA 1ESEA 2BSXA 4TWIA 4AZVA 2ZJ0A 1Q92A 5JI3E 3RK0A 4LHZA 1Y4SA 1N2OA 3BPSA 5D84A 3R9IA 2DSNA 2JGDB 1NN1A 1UPCA 2WAOA 4JBGA 1VQ1A 1J8DA 1RC1A 3OZSA 1B41A 3VR3A 4EVIA 2Z5GA 4N0MA 2HW8A 2OGZA 1T4CB 1KF0A 1USUA 2BLLA 1CW2B 3IPLA 1SRRA 3CR8A 3GP3A 1K7YA 3V4ZA 3UZUA 1H5QA 5K09A 3W8RA 4BMOB 1Q3KA 1ZGHA 2OCXA 5HF5A 3EIQA 1ULZA 3P9RA 4UQPA 5CIWA 4DTCA 3I01M 1J2YA 4PCVA 3NYRA 4EFDA 2XXAA 3A1FA 3QX8A 3KT3A 5LP1A 2PGXA 1JLLA 1G8YA 1U0GA 2WM3A 2ZVQX 3U09A 3GBSA 5DX0A 4LFCB 3NGMA 4ND2A 4BS9A 1ICIA 5DBGA 4DJAA 4P33A 5KHAA 3ONDA 5HJ7A 3WWDA 4ZZ1A 1VA5A 1HRKA 1H4TA 2MT9A 2QTVA 3HFGA 3UV3A 3RLFA 3UPUA 4X60A 1LB1B 2CHEA 3JVIA 4XDGA 1X1EA 2MSCB 2Y76A 3KE9A 2P62A 3K16A 3QG5A 4HTFA 1DMSA 2O6HA 4IAOA 1N2SA 5JSKA 3RAFC 2R8RA 4TTTS 4X5OA 4ER5A 2SKCA 4C03A 1FS6A 1ONSA 2QVBA 4H0NA 4OFXA 4U3JB 4Y6SA 5DNWA 3I64A 4AG3A 1DGQA 5AVOA 1RM5A 2I8AA 4UTVA 3GZ4A 1QQAA 2C8LA 3NR2A 3CZMA 2OWDA 3QU7A 4M1MA 1FF9A 1I2MA 1K8ZB 2CLMB 4JYCA 3M6VA 4MUGA 3ESRA 3MJDA 2HSWA 2QMYA 5EZYA 4AJEA 2A1TS 3AW8A 2V5UA 2IELA 3LZ6A 1AS0A 2AFVA 2PZLA 4R1LA 4RS4A 5CITA 3WGIA 2QRJA 1O94C 5AO9A 5TEWA 3ZLVA 4X1IA 5E9AA 1K97A 1TIKA 2GM5A 3VGJA 3MRSA 3MOIA 1M1YB 5D3QA 3X2SA 1CY4A 1NLUA 1SUDA 3LVRE 1P19A 4YJ3A 5AVRA 1QQ5A 2PX4A 2X8JA 3F7MA 2GUWA 1XQVA 2ODEA 3CZRA 2HHCA 5C3MA 1VRVA 4C04A 3LHDA 3JQ8A 5DOZA 3BG5A 1CCWA 4DR3B 1X80B 3EDOA 4F4UA 4TYNA 4G4SO 5T6BA 2Z3WA 3EWSA 2JBAA 3KPYA 3OTIA 4ACAA 3VZSA 2JATA 2BAGA 5F7ZA 1JEEA 2NXEA 2Y4OA 2ZWOA 5KDDA 5HK8A 2W43A 1XA0A 5KNCH 1CQJA 5EIBD 4EJ6A 2AMJA 2F67A 1EXMA 5DIFA 1GL6A 1FTNA 1A9RA 3H6KA 3OFNA 4Z54A 1RJGA 1VHLA 1VPLA 4MQFA 1G20E 1AOXA 1ZZEA 2NACA 4EK9A 4DR1B 2HRCA 2YFYA 1JHXA 2YR0A 3QLUA 1UANA 2L19A 4BNKA 2CDBA 5K8VA 3TCKA 4NNPA 3H04A 4ZRMA 4URFA 2DBQA 3LKVA 4KP7A 4JA0A 1OFVA 3DYBA 4KFTA 1WNTA 4I2VA 4E2YA 1YB7A 1EIZA 4HH4A 5ULLA 4F6RA 3EXEB 3KPVA 2WNHA 3DBLA 4K7JA 4G23A 1Z0FA 1F3OA 2YMPA 4DJTA 1UXIA 1XPJA 2YWJA 5AW8A 3LRPA 4RQAA 3T8YA 1D4AA 3L8FA 4N0EA 3H0EA 4R3WA 3JQAA 5BUCA 2EZ9A 5DHUA 3B7WA 3CB4A 1RJFA 3AFNA 1JLRA 2XQGA 4NFSA 5IC6A 5HOQA 3AOEC 3MS2A 5COQA 4EHJA 1LQ2A 2P68A 1J1ZA 4ABYA 1Z37A 3WQSB 1MENA 4G1UC 1SG6A 4L8VA 2W71A 1JFVA 3FNHA 4MUFA 4V0RA 3S2EA 5B3KA 2O8CB 2WFMA 4M7WA 5AJUA 3HR8A 4LYFA 3LLCA 4ZOBA 5JI2E 2B5WA 3NXKA 3S40A 5LIRA 1NBAA 2VQ6A 3QOYA 2KBFA 5IAKA 4KPYA 1A7JA 2BJVA 1SCUA 3RK4A 4QLBA 3ZZMA 1OFTA 4UU8A 4AJ4A 2BGWA 2BTOA 5C2JB 1QP0A 4E5UA 3OPMA 1A71A 1FP7A 2X3FA 3KEFA 1JFRA 1I3KA 4W5WA 5T41A 2WVGA 4P35A 4ZT6A 1SBNE 1AXGA 3ZKWB 2IYVA 3BE5A 2C5LA 4P86A 4TTVA 2G5TA 2NU6A 1O4WA 4BMPB 2AYXA 1SIBE 4YT4A 1S0UA 4KPUA 4LWPA 4Q3LA 1OZHA 4RKQA 4TXLA 4M22A 4XEHA 3ROGA 3U4HA 5IASA 2XUOA 3N8HA 3U4GA 2IYOA 4MW6A 2PR7A 1TO2E 2BGNA 2YV4A 2QOEA 4INJA 4JB2A 1RBQA 5IBCA 2Q6TA 3C6MA 2GAFA 3GGGA 3RI3A 4EY4A 3F6BX 4X3PA 1Y37A 1K6JA 1P60A 3EC1A 4EUNA 2H16A 1YJ5A 2WB4A 3HNPA 4D02A 1AKVA 1M0TA 1NV8A 3T3NA 1WQ1R 4P2GA 1UH5A 3ZWOA 4E03A 3H4TA 3PGVA 1L4HA 3TTXA 2JLYA 1DQPA 3L6OO 4HNQA 1XTSA 4URXR 1FRFS 5LZ9A 1O97C 3OCZA 2RK6A 3RUHA 1JG7A 3IP7A 4UFOA 4ZZ0A 4X93A 1AT1A 2XTNA 3F1KA 4LA4A 1UJCA 3WADA 4TTPA 1QG4A 4INAA 2QTAA 3FFXA 1OVMA 1D2HA 2G71A 4LHEA 1BRMA 3OU7A 4BNGA 3UCXA 4O2AF 1EJ0A 3H9GA 4WUTA 4A16A 1F0PA 2M2IA 2Y1EA 4HGOA 4JQSA 1QLJA 5JXGA 2HLNA 2W6JA 4Y0VA 2HDOA 1KOFA 4J9VA 5E6SB 1JAHA 2AFIE 1HE3A 1AHHA 4NBSA 1VMIA 2Y92A 1Z07A 4GPAA 4PHCA 3WMGA 3WLNA 5K45A 2W22A 4GQAA 3H6GA 4NJMB 1QU2A 2CJPA 3H7AA 1RJ9A 1P0FA 3CX8A 4NH4A 5I45A 3KSUA 2QXYA 3FPSA 1ND5A 1SEVA 3ILHA 3JAKB 4R31A 3H87A 4NCXA 4REMA 5D3MA 1FCJA 3BMCA 3VVLA 4L08A 3ZY3A 4AUEA 4UBLA 3SZRA 3QLVC 1O6ZA 4NCHA 2BFDA 2WOJA 4Z4IA 3A27A 3V4VB 2HBRA 2W4IA 2W6ID 2FCAA 3TW8A 1W5BA 4BZXA 3NV7A 1KPHA 4JI5B 1SHZA 5B1EA 3T3EA 3O4JA 4ZOQI 4RNDB 3R1IA 4OJQA 1I24A 3ER6A 4F71A 1W0JA 1SH7A 3LW8A 4PBTA 4A2WA 1CVIA 1OMOA 2Q4DA 1E79A 4X8OA 1PX2A 2PZMA 2PPLA 5E7IA 3QV1A 3G5UA 1ZK3A 3CVOA 1Z2EA 3CPSA 3GH1A 1TMOA 1YVRA 3KSAC 3CZ9A 3NAZA 3D5QA 4WW0A 2ATEA 1YJQA 3WLTA 3PXXA 2FR8C 3BK7A 3M2PA 2DLDA 3QEBZ 3ZHUA 1KDOA 1CR2A 5DWVA 3NBKA 4TL9A 5K3SA 4DSTA 1U65A 1BO6A 1D9ZA 2JFNA 5K5EA 4M89A 1HL3A 6LDHA 2UUBB 1NMYA 3S6JA 4MV9A 3VC2A 2X0EA 3G49A 3W4KA 2XUIA 5FF9A 1NVVR 1HTTA 2CXQA 2JK0A 1A4RA 4Q4HB 1TECE 3TX2A 1SHTX 2YWXA 5IVIA 2QORA 3TO5A 3UQZA 3U3ZA 5FBVB 1U31A 4AQYB 1I5RA 1EX1A 3FW1A 1E6CA 3LHFA 5CDFA 4NCAA 3IILA 4DDUA 1IQUA 5IT4A 1BGWA 3TLZA 4OGFA 5IJ0B 1JYSA 4K9KA 4CKEB 2EYUA 2R84A 3ZWAA 3DZDA 4JEHA 1VZ3A 1GFZA 4Y9UA 2MCFA 1Z2NX 2IUTA 1RKQA 4NONA 3C1UA 5ALUA 4ZK6A 2CCGA 1R4NA 2Q5QA 1ZD1A 3BUSA 1E7WA 4GS5A 4J49A 1QFMA 1J22A 3R8FA 1D7AA 1SHKA 1PQYA 3JQDA 4X7RA 5EEGA 1Z26A 2EBWA 4B40A 1WVIA 5ERXA 3H5OA 5DT2A 1JZQA 2D06A 2C77A 3O8QA 1Z18A 3O0TA 2PCJA 4GRIA 2GAIA 4DMRA 1OFGA 2EDCA 4Q18A 4GT1A 1C30A 1UPUA 2XOKD 4ETMA 1SD5A 8MHTA 2NV6A 4KUHA 3DOJA 4YRAA 4I9NA 3GRKA 4QICA 5TARA 4FHGA 4DLYA 2BKVA 4GP9A 1UT5A 4CTMA 3IDQA 4ETIA 2VDVE 4Q7QA 2QPOA 3K53A 2E49A 2WE8A 3O8BA 4E31A 5K3OA 4XTRA 4C3ZA 3CBGA 2P8SA 5FBHA 3DZGA 5EIOA 2NUPA 3AF2A 1Y9DA 3TX6A 3JQRA 3W1WA 4I9GA 4FNGA 4L0MA 4B76A 3F6RA 2C7BA 2L17A 2HTEA 3F8WA 3ZLJA 1OXTA 2MINA 2C8VA 5G02A 2PNJA 3T7SA 4R9RA 3U80A 5KTMA 5DLYA 2QT1A 1UKZA 4POAA 4F93B 2P4EA 3D0QA 2C54A 1P6QA 4KR6A 4BNYA 3L04A 3WRXC 4IG9A 2WD8A 1PO7A 2JEZA 3HN7A 3HO8A 3WSTA 5EJMA 3B6IA 3SP1A 1HXHA 4D25A 2RJNA 1G20A 4H6WA 4AZ3B 1PFUA 4C89A 4LI0A 5JO0A 2YHIA 3I6ZA 3MJRA 3IOYA 4ZO7A 1HL7A 1LJLA 2C4VA 2X23A 3QLJA 4PLGA 1A2BA 1KQNA 2PX2A 3MLAA 3K30A 2M6LA 4ZO4A 3W5DA 1SVUA 1DPGA 1PYOA 5L3VA 1H8EA 2AFIB 2D2EA 4HPXB 3ZLUA 1M8FA 4LMAA 2WF9A 3DMTA 3NWOA 4F9GA 2PUFA 4GRDA 3KT8A 2Q8QA 4TQGA 4ZCLA 2P79A 4KIGA 4EA8A 4DMKA 4EKGA 1O95D 3B38A 1G8AA 1SAYA 3Q8MA 1MQSA 1P33A 2ZIXA 4OF4A 4RJKA 4L78A 2N42A 4N82A 1AHIA 3IEIA 2A86A 1RKBA 3L6RA 2IPOA 3B78A 5JJ5A 2IJGX 2ZRHA 1JPJA 2C5GA 5FTLA 5JNTA 3AI2A 4BVJA 1OGIA 4GBGA 1KQOA 2YOGA 3CH7A 4B7AA 1AY0A 1H4VB 1EIWA 1ZMRA 1ZFNA 3MTJA 5CB4B 4G56A 2F8MA 1M7HA 5LQMA 4RANA 2HIGA 2Q5EA 4ZGWA 1T1EA 5GVSA 1CUJA 2AZ4A 3EH2A 2E37A 1ST3A 2OXIA 5YASA 1VL2A 4F4IA 4MZXA 2FJPA 2ZT7A 5IK2D 1Y3AA 1SBZA 5CDUA 1XYGA 1AO3A 1E94E 2JI4A 4UCWA 3OMXA 3Q5DA 1TC2A 2PKQO 2XEXA 2EDAA 3RQIA 1ZMXA 1ZPDA 3VFDA 2HCRA 2WP0A 4UEOA 4UEKA 2Y93A 3QENA 1YDGA 2GPBA 4IF6A 4N03A 2ZI5A 3K1AB 3DMPA 4QYIA 3R7WA 4RCZA 5DTRA 1PZGA 1ZUD1 4P4GA 1NQXA 1P4HA 4Y18A 2OYRA 2PL3A 2ZVPX 3UW1A 1K27A 3HCEA 1P1BA 4PN3A 1BCSA 2ID4A 2YY5A 1T36A 4ZI3A 5C35A 1B1CA 4ZANA 2J59A 1QTQA 3IJEB 4KODA 4U8HA 1XPOA 1TNDA 2WTNA 2X42A 5TMPA 4FOLA 1R6DA 2UYGA 5IP5A 3VZRA 3BBPA 3RU2A 3W5AA 4RGVA 4JLBA 1JLSA 3K1YA 4RH3A 2IFTA 3A7DA 5G1PA 1JW9B 2O2XA 2RHRA 3M5CA 3O8RA 1W75A 2PKYX 4GOND 2YW9A 1Y9EA 2SCUB 1FDOA 5F4BA 1KYYA 5BV0A 7ADHA 2Y05A 1HWYA 5CDYA 1GZSA 2Q1XA 1S9HA 1Q11A 3S2UA 1U2SA 4DLZA 4QGHA 1OHHA 1OLUA 2EQAA 4IIGA 4QXRA 4TXHA 5J3JA 1OROA 1OU4A 1BJKA 3D7NA 4B7ZA 1PL0A 1BH6A 1PDWA 2R2AA 4IFEA 4EB3A 5BP7A 2XB6A 5FWXB 4FZ3A 5EIBC 4PZEA 2O50A 2OCIA 3JV7A 3C5CA 4FMCF 1EVLA 2QMUA 1HY3A 3DYVA 3OVMA 4FKZA 4PBRA 3URKA 2OO3A 5HIAA 2IHNA 2EX0A 2DSTA 4MQ5A 1YC5A 2HF2A 3ELYA 5GVRA 1IVYA 1VP9A 4I55B 3MILA 4P3OA 4XDZA 4X91A 3W7VA 1YS6A 1HYHA 2G80A 5JATA 1XMXA 1FDVA 4OAQA 5DX1A 3D43A 3IKJA 3JRNA 5BN3B 1DBQA 1TCCA 5DLPA 3PHIA 4BGUA 3IBSA 3ZVRA 1PP4A 1IQPA 1NMSA 2W0MA 4EHNA 4HXEB 3EWIA 1OH8A 5IX8A 1JU9A 3GV0A 1TZKA 4YRGA 3NTOA 4Y67A 1FW8A 1G9XA 2A9FA 5CCXA 2GXQA 3UAGA 3OSUA 4NBVA 3BULA 1IEXA 3C74A 1COWA 4XIFA 5CDHA 4K0KB 4B3MB 4OL9A 2BL4A 2Q0HA 4JMLA 1IN1A 1BXGA 2W93A 5KKAA 2CXTA 4C1NA 6PFKA 4MW7A 4U7JA 5AJWA 1CZHA 4JLDA 2RK3A 2PH1A 1Q84A 2GVDC 2ZE8A 5FJJA 1XRNA 2GZMA 4D3ZA 1DHTA 3JALB 4ZEXA 4KMMA 2WYIA 1G5RA 3G8YA 2A0UA 3L93A 3U31A 3MJHA 4U2EA 1ML4A 4CV2A 2XD9A 1UOEA 2JCXA 2NM0A 4UVIA 2Q0SA 2CXPA 4WMLA 1O5IA 1ND6A 3I2FA 4FC7A 4B3SB 1UPFA 4AKGA 4NY1A 5CNMA 1QFJA 3FCEA 3VNQA 1XC7A 1GPDG 1J0CA 3LMKA 2OZKA 2FZLA 3W2GA 4EFLA 1FYXA 4UUBA 1N25A 3CS3A 5CGZA 1QQ7A 3JQ9A 4ZFNA 3BXEA 2GF9A 2X13A 3B60A 4LUCA 3GPCA 1C8KA 4OQDA 1FSZA 3B1FA 3N8KA 3C6BA 1KMHB 3K15A 3Q7SA 2AW3A 1SU8A 4KIWA 2FE1A 3CINA 4ZVTA 4EF6A 2O7RA 3AO0B 3VJKA 5B64A 4YMVA 3ZCTA 3T0IA 2WIFA 4S04A 4DA4A 1TTHA 1W44A 1DKRA 3LDFA 5E1BA 4R71A 2WA1A 5C31A 5IU6A 1KXJA 3S68A 4G0VA 4WERA 2R7NA 4PVCA 1ACJA 4QL3A 3OEHD 4XIJA 2ZXFA 4IKEA 4Z7JA 2E5FA 1Z75A 5ELXA 4TL7A 1YE3A 5C7LO 1Y6RA 1QHXA 2EX4A 3MFYA 1BMTA 4YMTA 3X43A 3SLGA 4AAYA 1XTZA 5D7NA 4YVFA 2G63A 4DR6B 3NCTA 4II3A 1JN0A 4BE7B 1T3SA 4P54A 2ZEJA 4XVHA 3IPAA 2GF2A 2V4UA 5AJXA 3NTVA 2GN1A 3HZOA 4ESEA 2AG5A 2IA5A 4BV3A 2PBZA 3DP9A 5FLEX 4MJXA 4HV4A 3UJHA 1N4AA 4R2WA 2BE9A 2ZUDA 3AIIA 3G88A 4LC1A 4B83A 5CLQA 3O91A 4ZVOA 1SK8A 4KVAA 4LVCA 2ZYAA 3ZE7A 1D4ZA 1SBYA 3F9IA 3QH4A 3RSCA 1M73E 2Y66A 2BFCA 1JHQA 1N2CE 3IC5A 1N6IA 5IVHA 2OQ2A 3AVWA 3HBJA 4PQRA 2ECFA 5DP1A 3VR5A 5IULC 1LDEA 1DC6A 1A96A 4XWWA 3FHCB 4IXMA 6REQA 2GBIA 2WJHA 4IGFA 3CH5A 3AFHA 3WYFA 1WNFA 3SIXA 4Y6QA 2EFDB 2G9ZA 4OFZA 2I3DA 1YZGA 1IXRC 4XARA 3TZCA 1G41A 3VKUA 4CG1A 1P2TA 2AC2A 1KJZA 1RACA 2I4TA 4KYTA 4CL3A 4OA5A 1W46A 1CWUA 3C3DA 4V1CI 1ZUNB 1LK7A 1Z0IA 1V47A 3KOMA 2VSXA 5LZ5A 1FB5A 3WGMA 1IG3A 4M0KA 3GEMA 3P5SA 4R8KA 1QHHA 4FGLA 2AD5A 4CEHA 1NAIA 1F4PA 1TRHA 2AOWA 2NO5A 3D4OA 3NBFA 5DTQA 3TBFA 1LQTA 2E3JA 2W2LA 4NATA 1CT9A 1E6UA 1PJCA 2JIBA 4O4JF 1VE6A 2OVBA 4RLQA 5EAIA 5KVQA 3M81A 4CM4A 2G5PA 1ZGCA 4IVQA 3PC7A 1A7KA 1NA5A 4JDPA 3VUFA 4A0QA 4I4TA 4OREX 5HRAA 5DYGA 3OF3A 5JZOA 1HURA 1CVLA 3E9QA 4DA8A 1KMMA 7ABPA 1W49A 3LBNA 2GA8A 4X00A 4EGSA 5HPYB 1T4BA 1F8FA 3PT5A 2ZBVA 1VJRA 3AONB 2FSVA 4B3FX 4URYR 4P53A 4KYVA 4PYLA 2TYSB 3TLMA 3DDCA 3GG9A 2WJAA 1UXGA 2COEA 2QQ5A 3OHSX 4MINA 2PO5A 3LUDA 4L0QA 5CH3A 4ZAZA 5J2TB 2XCRB 4G07A 1E2FA 4BNZA 4NYJR 1XTJA 1GYPA 2IYLD 2JGEA 2IZ5A 1B8UA 2VHVA 2ISQA 4R41A 3AM5A 3U3MA 2FXVA 3INNA 5JG7A 2C57A 4AF8A 5B2FA 2P27A 5BWBA 4PZ0A 4TWJA 4UARA 5BVGA 3MRXA 2A9VA 1QVAA 2BFMA 4BIIA 3NP7A 1N78A 3TIGA 1JEQA 1G8SA 5JSZA 1ZAYA 2HXSA 5GM2A 1RAIA 1ZJ4A 4JI3B 2A84A 4WESB 4XJVA 5EHXA 4K1LA 2PR2A 3RVRA 3TVTA 4Q4JA 1KO4A 5DXFA 1B7GO 1GR0A 1UBHS 1EWTA 3CW8X 2NYUA 4KR3A 4YP7A 3SR0A 1L4LA 2XRYA 1LLCA 4YJ2F 1NFFA 2QRHA 2Z4RA 3TRDA 1OSNA 2JFXA 3RU3A 3WL7A 4HDMB 2R8PA 4WFKA 2FPOA 2OXTA 3FOCA 4X1YB 3RH0A 5KYUB 1WRBA 3HTXA 2NU9A 1GKIA 4KACA 5JRJA 5COAA 4JQYA 2X0DA 2XCUA 5E3IA 5C5EA 1ESMA 2J8ZA 3BGSA 3NHUA 3SF8B 2XITA 3T7RA 4C4YA 1QNFA 1PG5A 3UJAA 3NQ41 4BO6A 4XYGA 4AF7A 3GLGA 1BCRA 2CN1A 2ID8A 5JSHA 3MYRA 1IPFA 3KTDA 5KU7A 4JA2A 1UBLS 2UDPA 3PWSA 3BX1A 1JHDA 3UT6A 1ENPA 4RL4A 3FYUB 1TQ8A 9LDBA 1JE1A 4QRIA 4Z7OB 1B93A 2WM2A 3RUCA 1KK2A