4C7MA

The crystal structure of tcpb or btpa tir domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
134
structure length
132
Chain Sequence
SNADFFISHASEDKEAFVQDLVAALRDLGAKIFYDAYTLKVGDSLRRKIDQGLANSKFGIVVLSEHFFSKQARELDGLTAMEIGGQTRILPIWHKVSYDEVRRFSPSLADKVALNTSLKSVEEIAKELHSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Bacterial Interference with Tlr4 Signaling by Brucella Tir-Domain-Containing Protein Tcpb
pubmed doi rcsb
source organism Brucella melitensis
molecule tags Signaling protein
molecule keywords TIR DOMAIN-CONTAINING PROTEIN
total genus 46
structure length 132
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4c7mA00
4OM7A 5H3CA 3UB4A 1FYXA 5FORA 4LQCA 1O77A 2M1XA 4W8GA 3UB3A 2Y92A 3OZIA 1T3GA 4C6TA 2Z5VA 1FYVA 4C6RA 4C7MA 5KU7A 4EO7A 2JS7A 4LQDA 4W8HA 3H16A 2J67A 4DOMA 3UB2A 4C6SA 4C6TB 3JRNA 1FYWA 4FZ5A 4LZPA
chains in the Genus database with same CATH superfamily
1NMYA 4ASUD 1JFFB 1JP7A 3EZNA 3KAJA 1VRWA 2UYYA 4Q3LA 5FBRB 1K2WA 1YUBA 2BOVA 2XB4A 3DE1X 3TWOA 4ARVA 4BMVA 4F0JA 4KAJA 1UIRA 3PFKA 4KHPB 4X3CA 3BJEA 4J0CA 1RZUA 3ZGZA 2OPBA 2F3RA 1RE1A 1PFUA 3NVDA 1X2EA 4JUFA 1HE4A 1PE0A 5GZ1A 1UMCA 1FFCA 3RC3A 5BN5A 3AHGA 1I7NA 1J2EA 3LY5A 1XJCA 3MCUA 3DHWC 3ENQA 3UTDA 3UPDA 2P90A 3CH7A 2EFDB 4UU7A 1QV7A 2JJ2A 2ZIAA 1U7PA 1K88A 2EIXA 3V7UA 1W2HA 2DULA 2OV3A 4JI0B 1L4FA 2BDEA 3ECSA 3FZGA 3QYAA 4NDZA 2VJLA 5KAPA 3X1XA 1A82A 1EQAA 2H57A 4B32A 2V4MA 4X7RA 2IZ0A 3DEZA 4FGUA 1EFVA 3VC7A 5BWNA 2CNWA 3BA1A 4KH1A 2H51A 2ILVA 3D8RA 4W9RA 1VSBA 1AGYA 3DVQX 1G7SA 3ROGA 4QLAA 1QHXA 3HGMA 4LZJA 3HBNA 1JKIA 3IIJA 1Z3CA 4FMCB 1QRUA 2IE0A 4ZAGA 1L9KA 1YV9A 1ABFA 1ZK3A 4K0KB 4YV7A 5LDDC 1KQOA 3MTQA 3L7BA 3WA6A 3AEZA 1B0PA 3KJHA 5KJEA 4UASA 1ULAA 5AVOA 5KB3A 4NE2A 2H1VA 3OPMA 4U2BA 4Y2SA 4LDAA 3QEBZ 3HN7A 3ZZUA 3DOIA 4UQPA 2UYHA 4OF4A 4YRAA 1RRGA 3M81A 1KO4A 2RONA 4Z4QA 1JB9A 1OYWA 2YN0A 2CT8A 1U5CA 3IAUA 4QRIA 1OILA 1XD2B 3B1KA 4O4HA 3ZWPA 4DRZA 1H3EA 1LRKA 4ZVTA 5C2JB 2JI9A 3QBDA 5HIIA 5KNLA 1L6RA 1NVTA 1TM4E 2VLIA 3IP1A 1PJAA 3DFUA 4QVKA 2WW8A 1DAIA 5HQ3A 2JFOA 4ZEMA 4RTLA 2Q6TA 3FFBA 4IIJB 1PTKA 4KKVA 2C94A 3OWHA 4KO3S 4YJ3B 1OVGA 5ALRA 5L7WA 3ZTTA 1ZJ5A 3A4MA 2XBMA 1H3FA 4DSUA 1EWRA 4JXZA 2F3UA 2R79A 3ER8A 2D1FA 3GR6A 4Y1EA 3EQ7A 5HOQA 4Q01A 3TIIA 4D25A 5E6SA 2JB9A 5B12A 1FXWF 3ORHA 3ROEA 4UTNA 5K99A 2ANCA 1XNJA 2ZZMA 1BDBA 2ON6A 2X4DA 1J8FA 1HF3A 1N5LA 4Q4JB 5HTOA 1H8ED 2VDUE 2NTYC 3K96A 5DM60 1B7GO 4BRZA 1UPUA 4Q1EA 5AM4A 2GBLA 4CCAA 3FFWA 1WBBA 1L7OA 1QHEA 4RDIA 3NDBB 5BMVA 1UKBA 2C92A 3N8GA 2C31A 1BHO1 4HYEA 5G1OA 3TKAA 4D8VA 4DT1A 1GG9A 2XEDA 2WTAA 2DFDA 2ZWIA 4HD8A 1ZGHA 1RSZA 2A86A 3FPBA 4NPAA 1WV0A 5EEGA 2AN9A 1MB4A 3VAAA 5J2TA 1DKRA 4RK6A 1Y4UA 4KBYA 2OWDA 2NPOA 2ZUCA 5AJYA 3WRVA 3AVXA 4LXXA 4P4LA 4D3DA 1IEVA 2FUNB 5C1IA 4R40A 2WY2D 4BRWA 4POOA 2ZRMA 3SC6A 3P2YA 2DUJA 1BGVA 1OASA 4ES6A 5JOQA 4B76A 3Q1LA 1NKSA 1ESCA 3H9BA 1UFOA 3SDBA 5B1EA 3SX0A 2CDBA 2QRQA 1MC4A 3EPPA 4DA0A 2HA7A 4GP7A 4NQRA 2IS6A 2CBGA 4IHAA 3UJNA 4WIAA 1ETHA 3UFXB 2VSFA 4RSMA 4U6SA 1IOLA 1KDOA 2PGLA 1DAHA 1XN4A 3BEOA 4OJTA 1E6CA 1LF0A 4EJSB 4FFOA 2WWTA 3FPGA 3H16A 2Q3HA 3WK7A 2IELA 2O0LA 1J99A 2HGSA 1RJGA 1N9ZA 2BI7A 5IN4A 1K97A 4LXTA 3T9DA 3HSSA 1AKMA 3SBXA 1ZONA 3REOA 2NV2B 4JYCA 3EB9A 3F9RA 5FWDA 1E2DA 3SU8A 1S0UA 3VR2A 2FMUA 1I24A 3RS9A 4X90A 2XQJA 4L9AA 2Z4TA 3HUUA 4RKEA 3RHFA 2P9CA 4BQEA 2IZOA 3AB8A 2KX7A 1YS7A 4EGFA 1O5TA 2RGCA 4CNQA 1PR3A 4GBED 2A1UB 4D6XA 1XXHA 4J76A 1RAFA 3RTAA 1LSOA 1TADA 2GBCA 2KB0A 3CX7A 3LECA 4GZ6A 4XDHA 4F4DA 1U8TA 3MBIA 3NC4A 2BZ0A 2AA3A 3K0FA 1AB5A 1IN8A 2XVZA 3GI1A 2CNWD 3TXYA 5I7EA 3DD5A 4UHCA 4HGRA 3RS4A 2XTAA 2XW6A 5K0LA 4AO6A 2OV1A 1I3NA 2WIJA 3U81A 1J39A 3L0YA 4QNMA 3VSAA 5FFMA 1V1MA 1OFIA 1PJ8A 2G0AA 2CF6A 2PZEA 1RFGE 3KWJA 3TR5A 2PIDA 1CRZA 2I54A 3S2SA 4HEJA 3K4HA 4S1OA 1R5OA 4XJVA 4ZDWA 2OAEA 1I0IA 1V16A 8OHMA 4TRJA 5KTYA 4GNKA 2GN2A 2Q4BA 3AP2A 4NV1A 4Q48A 2HXYA 2GK6A 3AU8A 2HH9A 3NWOA 1I2BA 4E0BA 3UOAB 4MYRA 5I7VA 1WQ3A 4M3NA 3FAZA 3KOYA 2BEWA 3D6TB 5IT4A 3HWX1 5JFOA 1TA9A 2H4XA 1Y42X 5KOIA 4C6TB 2B30A 1CJTC 4WKCA 1RZ3A 3BGOS 2XJ4A 4UM8B 3ILHA 2C4WA 4LOJA 2JH8A 2ISQA 2O5RA 3RUDA 4KNWA 3TR0A 1ESEA 2G8LA 2AFIE 3U9TA 2GLXA 3HPRA 2XOXA 5ITWA 2GVDC 1KRHA 1XYGA 4MJLA 5I51A 2BGIA 2QX9A 3A1FA 3NYWA 3Q3HA 4EQ6B 3PC6A 5IJ9B 2ZXFA 1F8UA 1Z2EA 2I7XA 2FMHA 4RANA 3BMOA 4YONB 3BQNB 2NU6B 3B6ZA 1K63A 3WLSA 4BV3A 5LP1A 4P9NA 2CNDA 4EMTA 1I4DD 4OLFA 4QEDA 2G36A 3ZGXA 1Y8QB 2VJOA 3ABRB 4CM8B 4C2UA 3OTGA 2WAMA 2I67A 1KEEB 3CRRA 3HZZA 3H0CA 1QOQB 2XWPA 3GEGA 1VI2A 1DB3A 1V9CA 1JG7A 2W6OA 4HADA 4Q1BA 4FKMA 4MI3A 4QYSA 4WOCA 5F5LA 1OXKB 3SICE 4AECA 4AY2A 1NSYA 3PJDA 4IS3A 4M0DA 3K6SB 1NX9A 2WQ6A 3FGNA 3N6XA 1GHTA 3ML1A 3IBYA 1P2TA 1QGZA 4LGCA 1B76A 1Z35A 3GRCA 4N49A 1XTBA 3KDPA 1PJBA 2AFVA 3DE4X 4WTOA 2QQEA 2AE2A 4PXAA 5TSDA 1M2KA 3FKSD 4GWLA 1TIPA 2D62A 1GRNA 1TYDE 3P7MA 1GYQA 1ONNA 1Y33E 3IA7A 2VDLB 4QPDA 3CS3A 2R1VA 3F2VA 4JIMA 2FUKA 4PLPA 4PY2A 4D82A 4EDFA 4KN5A 4O4IA 5C35A 2CV1A 2ODPA 1DRVA 5E2IA 5CFRA 3X1ZA 4X95A 4ETMA 1XTRA 2R5WA 2PMFA 3PVZA 3RNOA 5DBHX 3BMQB 5J5CA 3THSA 4D43A 2I2XB 4DJFC 4JT2A 5G1NA 3P9QA 4JQCA 4V02A 1I3KA 3WGKA 1SBIA 4A6XA 2QIPA 4H0FA 1Q84A 1SFRA 4DMCA 4B6JA 3ZD8A 1HT0A 2ZJYA 3BB1A 4EJ6A 1OZFA 1SCUA 3U16A 2PX4A 4EBBA 4DM7A 1ZD8A 3AMVA 3ETLA 4BV9A 3MHTA 3TCKA 4TLMB 5AXDA 1CY7A 3IC5A 4DWOA 1M2OA 1HNXB 1PAUA 3UJDA 1KPHA 2A30A 2P2DA 2FPOA 1UXHA 5AQ1A 3HU1A 1WO8A 2BZGA 2Q5LA 5GIPE 2V7UA 4PGMA 1BVRA 4AULA 1ABEA 3JQ8B 5E9QA 1G8FA 4US1R 3Q7RA 2XBUA 3I2KA 4HLCA 4N1AA 3FPJA 4AL4A 4R0MA 5DF1A 1UDCA 1G4UR 2YW2A 1C80A 3CKLA 4TVSA 1T8WA 3QJ5A 2FZ4A 5AVTA 2GNAA 3NEPX 3U19A 1HDEA 1NTRA 4YMVA 2HJGA 2BTEA 3ADBA 1KI4A 2BPOA 5EZYB 1W48A 5IT5A 5AUPB 4KR2A 5LLSA 2FN4A 2SCUA 3PQ6A 3BREA 4FMBB 3IPYA 1N8TA 4UZEA 4CTOA 2AQ8A 3U6BA 1H22A 3HU3A 1OV4A 1T3GA 2W6ID 3I45A 2HLDA 3SR4A 1RLTA 1V3QE 5EKXA 2QD2A 5T3YA 3I9LA 5FWXB 2ZWAA 1ORTA 1Q6YA 1LRLA 1WCV1 4IQFA 4TMKA 1QB8A 3OBBA 4FVTA 4CPDA 3GRKA 5CVCA 1UANA 2H7VA 5I9BA 5JIBA 2CE2X 3PR1A 4MP8A 4P35A 3LLMA 4WJKB 3AIOA 2XXJA 8ADHA 1BD3A 2OV8A 4H7EA 3OTOB 4ZI5A 1K7CA 5DTQA 5B3AA 2IH4A 3B53X 3GARA 4ABYA 4F1JA 4IDHA 1B6RA 1YC2A 2XODA 3EUWA 4E4YA 3K5WA 1AJEA 2NNLD 2PHZA 3CSDA 4ZZIA 3K0CA 2A0WA 4JJEA 4Z0PA 5F3WB 1X7DA 3W79A 4CG0A 2HEIA 3CXRA 4N0MA 3EUEA 4H17A 4HLUC 4BNDA 1BJTA 3PTAA 1I2CA 3AM1A 2P4SA 1WXQA 3FYUB 2N0SA 2OOSA 3INYA 1TE2A 3RU2A 2RKOA 3KYCB 1KMHA 2O2IA 2QRLA 2HW8A 5FPPA 3G02A 3ICWA 2IL1A 2OO5C 4R6WA 4R7GA 3R9IA 3AY7A 1YKSA 3H4MA 5CU7A 2D5IA 5FOUA 2ZYIA 4JVLA 3QM1A 5FUWA 3UK1A 2ZAOA 4D0GA 3ETDA 4BKMA 1CUAA 2X7HA 3DE5X 1JR3D 3KB8A 4Y1GA 3ZY5A 4Z2AA 2X0KA 3D1JA 5CVEA 5K05A 1V26A 1P75A 1JXAA 4LJ6A 3ENZA 2AMYA 2EFYA 1K8XB 3IH5A 5J23A 2J3QA 4I66A 2JW5A 3PL5A 1UJ5A 2RG1A 5I7OA 1UZUA 2CY0A 3BRQA 5G0TA 3QX7A 3AHDA 3BRWD 4PYJA 5JZOA 4XWWA 4PS1A 1V8OA 4B9EA 2ZIUB 4CN8A 3CLRD 1KKMA 3BEDA 4M7WA 4UDYX 3OCCA 1GEEA 3DQZA 5DMXA 4V39A 3T1VA 3MSXA 4J2HA 2EJUA 1SKAA 4N7MA 4N8EA 4BAZA 1BYIA 3PHJA 5CDSA 3RBVA 1Z07A 2CJXA 3OZ7A 1Z7WA 3KWFA 2YDXA 4MKZA 3INGA 3VVLA 1I94B 5K4AA 3OC0A 7GPBA 3FDZA 3IKMB 4GOND 4XLZA 3BDVA 5KVSA 5JXJA 2FTKE 3L5KA 5K0NA 4FSXA 3ZCTA 2NSDA 4C29A 3WDLA 1BOFA 3DT8A 2WA2A 3EA0A 3FKSA 4V2IA 4CM5A 1RQLA 4DSAA 5I8ZA 3M4YA 1BXGA 1PUJA 4D3XA 3IP8A 3VHXA 3L6EA 3CG0A 4FFWA 4FSHA 2BGRA 4XD2A 3MERA 1SCBA 5JLJA 2ESRA 3TEFA 2A9KA 3WGLA 3BS4A 3HNRA 3I34X 1Q21A 3A31A 3OX2A 4PG4A 5CNKA 2ZYAA 4FINA 1GNPA 4UBOA 4XZ3A 5DPMA 2O19A 4FYYA 4TMWA 3DDNA 3DBHB 3WV4A 4OQMA 1C7QA 3HVUA 4BBZA 2F1IA 4P38A 1OT5A 1DBQA 3L6BA 1UKYA 2C2ZA 4ONEA 4QYMA 3U4AA 2WNIA 3ZGNA 2RAFA 2GPNA 5E6SB 2WYIA 2PQ2A 3LMKA 4XKJA 3T7CA 3PXBA 1G21B 3LSTA 2VWQA 2FN8A 1P3Y1 4GOKA 3KDSE 3ZHOA 2UYOA 5CLJA 4E14A 2YV5A 1JQAA 3SKYA 3RGWS 1T5DX 2Q99A 1Q7TA 3HDVA 4BMSA 3ZDCA 1SCQA 1XRQA 1LDEA 3Q7TA 1GPDG 1KEPA 3R7AA 3IHWA 1ULZA 2NU7A 3CZRA 4TXJA 4FYKA 1FMLA 4BNMA 4CL8A 3QE0A 5E1BA 1BSVA 1WCYA 4XR4A 1IUOA 5G2OA 3RUIA 3ZDRA 5IN5A 1V0JA 1C4XA 2CBXA 3EVNA 4ZZ1A 4J07A 1QFJA 3L46A 4ZOLA 3KFLA 4RWEA 5IAOA 3AINA 4B5KA 5AW6A 4UBIA 5FQNA 2HPAA 4BLVA 3CH5A 4D46A 1KPGA 4F2HA 5C53B 5CRIA 3HXOA 3OIDA 1DJMA 3SS9X 5K6RA 1KYTA 2D8MA 4WESA 5C52B 1NT2A 3O8OA 4FTWA 4KSCA 3K70D 4HDNB 1JKFA 2C00A 1E61A 2ZR7A 3G6KA 1GZDA 1T9ZA 3FX2A 4P36A 4UJ5A 4F3YA 3PBKA 1NRJB 4X8LA 2QA5A 2ZBQA 2BKVA 3C8DA 1GUAA 4E1VA 4I9FA 4URHA 4DQVA 3LLUA 3DB1A 4RK0A 5G3ZA 2ZQYA 3QUBA 4AMZA 3I0NA 1JKJA 2BSXA 4F9EA 2V7XA 2XHZA 3IXMA 3PE6A 4X0EA 1AKNA 2GARA 3ZHVA 1WMAA 3CLSD 2FUG6 5EQTA 4Z7OB 1BO6A 2I03A 2XCTB 1W85B 2C5GA 1YDWA 4HDQB 1FZTA 2EEZA 1NMZA 3WYCA 3W8EA 1WPGA 3B6IA 4R8SA 5CR9A 4IIVA 1PGOA 3OKAA 4AF6A 4P0QB 2J7PA 4KGZA 2FZWA 2R00A 1NIPA 4MR9B 4U4AA 5KQGA 2GTIA 4CNBA 5JNWA 2ZYWX 1ES9A 1XEXB 2XUDA 4U2GA 1RD4A 3IFSA 5FFNA 2BEKA 3GT0A 1EFAA 3OZFA 4NP6A 3ONVA 2YV2A 4DLVA 3ONDA 1KBQA 2XJ9A 5EQFA 1IRIA 3O8QA 2WHPB 3BWCA 5ECWA 1UP4A 5IT9A 1VP9A 1AURA 2H18A 1RXYA 1SBCA 1NPDA 3AF5A 3ZW8A 1I8TA 1UR5A 2ZS7A 3NAMA 4JB8A 1FDTA 5C5CA 5KTRA 2BMWA 3RYHB 3PJEA 2J4CA 5IEJA 1R0KA 4Y6GB 1JJFA 2J9RA 1QCDA 5K6AC 2ORED 1DJNA 3REGA 1O6GA 1U2TA 2GTPA 3PXUA 2QLTA 4LVCA 1KH3A 1TVKA 4UUNA 2ILTA 1CPYA 4FX5A 4XDGA 1SXIA 2OV6A 4RAQA 1E9EA 2VXYA 4GI3A 4KP7A 2HR1A 2XYRA 4I4CA 1VP3A 2JA1A 3DB2A 1APBA 2X7JA 1OE0A 3PNLA 4E13A 1U6IA 3HCBA 1P9RA 5CNJA 4PSVA 3A7EA 3W7BA 1GN8A 5B1IA 2H1WA 1PP4A 5TLSA 1EUDA 1GJRA 3R2JA 4B6SA 721PA 1RQGA 3M6MD 3OCXA 3CUWA 4KE9A 1MVOA 4M4SA 3ZU5A 3IUQA 1KMHB 5EP3A 5JJLA 3H83A 4ILKA 1M66A 2G7MC 2A3NA 3FN4A 1WDWB 5EJ9A 5HR5A 1U8UA 3SSOA 5KYYB 1K6XA 5EPEA 1HKHA 3GZNA 3OE4A 4RH3A 4C5AA 1XALA 5JBNA 5K9ZA 3U4QB 4CTKA 5IUNC 4OA8A 4TTPA 5IUJC 4UM9B 4JLVA 4BRSA 5GADl 1MW9X 1IJKA 3TF5A 1VL0A 5KYXB 3Q5DA 4MI6A 3IEMA 3QY0A 3S6JA 3IRUA 2HJSA 4KXYA 1UP6A 1JQKA 1B0ZA 3OJEA 1D4AA 3OE1A 4NC9A 4EY5A 3HI4A 3G89A 4LNHA 3CURA 1PR1A 1IE3A 2EFHB 3R3XA 3OU2A 1O03A 1CB0A 2PKEA 4GI5A 1ZNZA 3HJUA 1MGPA 4AZ0A 4I1OA 2IZZA 1QV9A 4G5SA 4NCHA 2WV7A 5CVTA 2VAPA 1RYEA 4NZZA 1LBIA 2VG8A 3K0FB 3ROZA 2I1WA 4PNHA 4WXYB 1KU0A 4Z99A 1FXSA 4NYMR 5CX1B 5EKUA 2OXFA 3PI7A 4ZYUA 821PA 3OE5A 1KZ9A 2QL9A 1PHPA 4OFXA 3ER6A 4EO7A 1H23A 3BKWA 4MUMA 1LB1B 1M2NA 2XT9A 4F8YA 4KITB 5JRDS 1FRVA 2FMTA 1W4LA 2XGSA 4OKSA 3SVLA 3NO4A 4LBYA 1B8VA 1OV6A 5TV2A 3FVRA 5IVKA 4WMLA 1QORA 2EFJA 4C0HA 2J59A 4L15A 1NLZA 1W0CA 1E1KA 4ZMBA 2V6GA 4X5OA 3MCAA 3QVXA 2HK6A 5FOWA 3ABIA 4GI1A 4HP8A 5JDCA 2YKGA 3NJ4A 4JNCA 3RO7A 5LQUA 2PJZA 3MWKA 5JV5A 2CLSA 2PQMA 1U8FO 2EFGA 1Z6XA 1BXKA 2H2GA 2O3UA 4RD6A 3X1KA 3OZGA 1BMTA 2YJ6A 3HR4A 2GB4A 4G6ZA 3SLRA 4X1YB 1CY6A 4PHHA 1ZVMA 3WLAA 1ZJJA 1ZS9A 4E2ZA 1Q83A 4A1OA 1HM5A 1PFQA 5TRTA 1D3AA 8GPBA 5KOJA 1U6KA 2OM2A 3I37X 1Z6PA 3I9OA 4J43A 4JASB 5EHQA 2F67A 4QAQA 4CQLA 5LIPA 4U02A 1J9EA 2H7CA 4NU6A 1NZDA 1KPIA 2CXTA 1XFAA 1YB4A 3F5QA 4B46A 1JVNA 2LVBA 2P77A 3THXA 1M6EX 3BXGA 3VZDA 4X61A 1R12A 3KUDA 4URWR 1I9GA 1OCEA 4CN9A 1Z2OX 2VFAA 3OIVA 1MX1A 4NYMQ 5I7AA 3C8HA 4LJRA 2J7PD 2XVMA 3HBLA 1AN0A 4N5IX 5IEBA 5HS4A 3AJ8A 4YCDA 2HPVA 4MYCA 3Q7SA 4TLEA 2B20A 3R6WA 3KG2A 4XQEA 3HDYA 2P40A 2H1FA 2YHBA 3QX3A 1C9KA 3PWTA 3AQIA 4GPTA 2QNRA 4BN0A 3CU5A 2CWDA 5AK0A 3PWSA 4C2TA 2Z9DA 4RDXA 3TJZA 5AI5A 4EHDA 3D3NA 3A1TA 3G7NA 3WB2A 1X8KA 3CWZA 3E18A 1OLXB 1IPEA 1MQ9A 1G1AA 2FMFA 1BS9A 3SS8A 3I1YA 4IGFA 4WXMA 3WIDA 4L02A 2FJ0A 1RMTA 3LOQA 1G2OA 2A88A 1K89A 3LP5A 1Q95A 2IPOA 4LXUA 1H1LA 3B82A 2L82A 2J9FB 3NBFA 4CLEA 4G8BA 10MHA 3LHSA 2DCUA 3D7NA 1TTQB 4NATA 4FONA 2V7QA 4UBMA 5DLDA 3IUMA 1FJ2A 1UKAA 5LU8A 2UUCB 1LLCA 3QYJA 1KC1A 5LWQA 4KXWA 1G60A 2QZSA 1Z25A 3RRYA 1CDDA 4O2AA 4PIPA 2XECA 4Q9IA 1C30B 3CZCA 4W82A 4XM2A 5AM2A 2F55A 3HCCA 3ANSA 4U63A 2GD0A 1PDWA 3EEOA 5DO9A 4FZJA 3R7WA 3CEPB 4NH4A 1JDSA 1DBPA 2EJTA 1T34A 2R87A 3C8ZA 4U6NA 1AIPA 5KKNB 2KM1A 4RMNA 1FXWA 3EYWA 1ZBDA 3AJRA 3KXDA 1MORA 4KC0A 4L8VA 3SKXA 5CB6A 3PNKA 3RAJA 3WL5A 2UYCA 3KSUA 2V74B 2OZLA 2R6HA 2O8DB 2J5BA 1Q0QA 2IHTA 4PC2A 4Y1FA 2BN4A 4AF8A 1RMYA 1N5MA 1M10A 2ROQA 2BHNA 1S3FA 5ELXA 4JXXA 1I7LA 4ZAYA 2VQSA 4X9XA 4L85A 1JWLA 2MSWA 4BNLA 1EIZA 1ONSA 1QVZA 1F60A 2VRNA 2VRCA 3ADOA 1F0KA 3QFHA 4YGYA 1AX9A 5EQDA 1A69A 5AR1A 1XZIA 1ZUIA 5KZMB 5L3QA 3LIIA 3RU9A 1PUIA 3OJFA 2P6NA 2R2GA 2BTQB 1CP3A 4H1TA 2ZXUA 1J42A 3IJEB 4RSHA 2Q4DA 4XARA 2FQ1A 4K8OA 3PA6A 5CA1B 1CY8A 3ESXA 2Z8ZA 4RTKA 1JR3E 3OMXA 4G36A 3T61A 3UMJA 3R3ZA 3QUAA 4WZBA 1WL8A 3K72B 4FBGA 4L72A 3VJKA 3LXRA 2C7QA 1EZZA 1SR8A 5BYJA 3PCXA 2O1EA 3VPGA 3I01A 5I5GA 4ZYYA 1GL3A 3STYA 2HJHA 3SC2B 2YXNA 1N6NA 3VDNB 2VLBA 1E9CA 1C7JA 2HRRA 5D1HA 2NAPA 2BLNA 3BZUA 1E7SA 5B57C 3DOJA 4Y67A 5JY6A 3FOFC 1LU9A 1NONA 3LOPA 1LQTA 1YHNA 5GGXA 1SXHA 4TN1A 3ZNPA 4JU8A 5LFAA 4X62B 2IEAA 2ZM5A 1NL3A 1K27A 2YFHA 3TTUA 3VKWA 1PZXA 2ZI7A 1JS1X 2I76A 5K3FA 3W3ZB 2W11A 5TEWA 1TQ6A 2FQYA 4B4VA 2ZAMA 2C54A 5FR2A 3AUTA 4R4JA 4RELA 3BH0A 4EDHA 3V97A 2CMKA 4HZIA 2P3OA 2PRJA 4NENA 1EB8A 2WJJA 1W35A 2EQ5A 3LXUX 3RRMA 4U0KA 3ZVRA 4DCNA 1RACA 2Z04A 4OMDA 3JYOA 4FX2A 1ZP6A 1T1RA 2IP2A 4R2JA 3EA5A 5J1TB 3RFCA 4ZVOA 4EBFA 5DI3A 3ET4A 3I9V1 4TMFA 4FHGA 4LOAA 4BFSA 1G3IA 3MGAA 4FDLA 1PFWA 3FMFA 4LVOA 3S1LA 2K2WA 1MO6A 3COVA 3FF1A 4MIOA 4ZIRA 3FNGA 3I9NA 1XMVA 2AJBA 1WP4A 3BKXA 4P4SA 3G9TA 1JE1A 1F12A 3GJ3A 4YACA 2E4ZA 5T8KA 5CLFA 2GBLC 1N2CB 1NW6A 1KAQA 1P9LA 3L7CA 5A9SA 3W2IA 1P0IA 2QR3A 3CF0A 5DGTA 4W5TA 5EINA 4G4SO 2X0FA 1YNSA 2JIPA 3P5SA 4N01A 4DCPA 1C9EA 1LH0A 5IASA 1U7UA 5IVPA 2OFWA 3NEYA 4TYPA 3WBFA 1JF8A 4UNQA 3VR6D 4ZI3A 1CFZA 2WM3A 1E98A 2VQ6A 2W2TA 3G5LA 2PA3A 3D81A 3EEFA 2PX5A 1JBEA 3AWIA 1QHHA 4R2IA 4X20B 3O8DA 4GI7A 3E15A 1GGEA 2J5QA 2AJCA 5BN1A 1PNRA 2JI6A 1JHUA 3LRTA 1J1UA 3ACDA 1Z18A 1JKMA 3I04A 2DU8A 3ZWOA 1KC3A 4CF7A 3QF4A 4UNIA 3TM5A 4H1HA 1M0TA 3D8NA 1BWPA 2HRCA 2ZI3A 2XQGA 1UAYA 4MB0A 4Y1RA 4UHEA 3LQKA 3DF9A 3EIXA 1DRWA 3X1JA 4QJ3A 5BSWA 4K03A 2WWGA 3OZTA 3SBDA 1K0FA 3TBKA 3SLKA 1WAMA 2Q5FA 1XKTA 2O7SA 3U17A 5T3UA 3DLHA 4N40A 4FYJA 2HRZA 3HV2A 1JIKA 3ESQA 3MUEA 3WK4A 3I09A 2Q49A 3CR3C 1JAZA 2PZLA 1OX4B 1JILA 1PDOA 1VJRA 3CLTD 3D7LA 4L6IA 5MFZA 1VHLA 2NO9A 2WD9A 1A9QA 1E3JA 1MB2A 3ZEAA 4N3AA 1T6ZA 2PXHA 1FOEB 4FJ0A 3L9WA 2Q46A 3TYXA 2PH1A 4DRXA 3LRPA 2O2DA 3COZA 3ZBQA 3W3AD 3FWNA 2ZT6A 4GLOA 1IH8A 1F5NA 3KYIB 3EIEA 4XFDA 3GFRA 1AB6A 3L84A 1XZHA 2CVHA 1ZUD1 2DOKA 4G4GA 3C5EA 2OP1A 1RXSA 1D1TA 1ZPDA 3TQRA 4DUPA 2WSYB 5EJ8A 3Q4GA 2F8TA 3C3JA 4GMKA 1WABA 3NB0A 1COWD 3CX4A 3PF9A 3E27A 2XLBA 1SQFA 4UTVA 1BN6A 3H5OA 4MAAA 1TQDA 4LJ7A 1E9FA 2XNSA 4FT4A 1GN9A 3PT5A 2ZDHA 2C7RA 1TZCA 3EH1A 1ZVKA 2QRJA 3UT5A 1ZXLA 4OMCA 3U09A 4U2KA 5BVGA 4CFYA 2RJNA 4UBLA 4O4LF 4K2AA 3DFMA 3KOOA 2ASEA 3HO8A 4I5DA 3VTAA 2HA2A 2G63A 3C4JA 3FRJA 3BFVA 2FNAA 5LP6A 3QPAA 4NICA 1P7PA 3DBLB 3NKFA 1KARA 5AIBA 3ORFA 3DUFB 4L22A 1XWWA 1X39A 4HRAA 5DGCA 1WV1A 2H4JA 2LUOA 2XTMA 2ZUSA 1DJOA 5ALOA 4GYYA 4II3A 1TAQA 2EOAA 3CUVA 2A3RA 4BIMA 4BTLA 3M6UA 4G65A 1QQTA 4Y2PA 4UOEA 3NFRA 3DR5A 1I7QB 1DBVO 2XYQA 1QO7A 2BV3A 3MLEA 3Q7PA 2XH8A 2GRAA 2VT3A 4JVMA 4YO7A 4UULA 1ESDA 1TD9A 3CNQS 4GM0A 1A5ZA 2DH6A 1M67A 5CLIA 4PWZA 2WT4A 4HNAB 4B48A 1YR8A 2HU2A 3C7TA 3NIWA 4W5JA 2POQX 2FWBA 4U3JB 2ZUVA 3HXPA 3GFBA 4W8OA 4CMAA 3JARA 1A5BB 2GEUA 1R5BA 2JGIA 1ULSA 4FDVA 5FLXA 2ZRDA 3VYSB 5AVKA 5HKKD 3HADA 3KJQA 5ILQA 4L6CA 1JHQA 4Q7LA 1UCFA 1MC1A 4KAFA 2W43A 4H7DA 4FB5A 3HTXA 3HN6A 2K4MA 4C30A 2PX8A 4KZPA 2DFPA 2BM8A 5JDCC 3QHQA 2ODBA 3VBEA 4A6DA 4DLBA 1ZD4A 4NJMB 4K88A 4J9UE 1Y7TA 4RL4A 4Q7EA 3S7ZA 1HT3A 3NASA 3KXPA 3K9LA 4YP9A 3MMXA 2PWPA 3KZKA 1HYEA 3MNFA 4IDGA 4CBVA 4Q24A 2UVDA 3W0LB 4C01A 2FV8A 3CONA 2C3OA 3W5JA 4D97A 3BFPA 3B8EA 1XZAA 4HAWA 1FFDA 1MG5A 1G5IA 1NOIA 4RJLA 3K6JA 4X63A 5KX5B 5DRTA 3I4LA 4EJSA 2ONJA 2DCMA 2GD1O 2IYPA 2IEIA 4AFNA 1OVMA 1TZKA 1GPUA 1JA0A 2COEA 2LXNA 3C2QA 4XYMA 3SY8A 5CXQA 1F3OA 5BR7A 2FWNA 5AK6A 3FCUB 3FBTA 1ECJA 2CCKA 1MAVA 4FWTA 3UMCA 2GAAA 2P9QA 1WB6A 1I5RA 4U6QA 1NHGA 1AQ6A 4QLOA 3MM4A 2VPPA 2NVOA 3RIHA 5A6VA 2Q62A 5IJZA 2CL5A 1O58A 1S2GA 4HQFA 2XGJA 4M88A 3C16C 2Q3DA 3U62A 5E4TA 2OQIA 3LL7A 3O9ZA 3USZA 2FPGA 5JCJD 3V1TC 1CC1S 4F3CA 5CFPA 2OBLA 3NV7A 4R2WA 1XN1A 2QLFA 1OC4A 4OMUA 4CDMA 4CL2A 5EJ7A 2JBAB 2XOKA 5I45A 1P7CA 1Y4DE 2GPWA 2JFHA 2YS6A 4BUZA 1F6WA 3UVEA 1W0KA 3JU3A 3N59A 1C0LA 4P4NA 4C2BA 3VPHA 1C3LA 3I2YX 3O38A 3EBLA 4WA8A 2P27A 3QXCA 4FFPA 1OFTA 1GZ7A 4GE0A 3DZIA 2QLBA 3GGOA 1S4MA 3W1WA 3AY0A 2X0JA 1QTNA 3UAOA 3O4VA 1JAXA 2I2AA 4WSOA 1F9EA 5HJ7A 1F06A 3WFZA 4JBIA 4PGAA 1U02A 2RI0A 1ITZA 4JL6A 5B6PA 5CAEB 2OY0A 4AD8A 2D5AA 3NUGA 1C29B 3NTVA 4IDPA 5ECGC 3WGNA 6ADHA 4TXHA 3RPEA 3OF3A 1IU9A 1M7HA 4TRMA 4K0RA 4YJ2F 4Z1MA 3ZY6A 3I0MA 4LX8A 2JGNA 2C4TA 2PDAA 1H0SA 5ER6A 1DP4A 2XBLA 4DMGA 4PYIA 1UFRA 1OYOA 2C5EA 1MH1A 2MINB 5LBTA 2IBSA 1JLHA 2ERXA 1WKCA 2EYUA 3R0IA 4OGFA 4D6YA 2ZB7A 1EH5A 3O8OB 4CHTA 4UFOA 1LD3A 2HMYB 2B9VA 1JLMA 2G9ZA 3TLXA 5B36A 1P4HA 2ZU6A 3TLJA 3A2LA 4GR9A 5IAKA 1CX9B 4LBWA 1Z4MA 2ZYUX 3K4QA 3ZQ4A 3D7KA 2JCSA 4LKOA 4B8WA 4HDSA 1C9YA 1YRWA 2POCA 1LPOA 4BZXA 1TCBA 4HBGA 2X7XA 5DBGA 4WGGA 2W8BB 1YI0A 2G9UA 5KUTA 1O89A 1E5QA 1R6UA 2ISSD 4DYVA 3MTEA 4Y2UA 1G2QA 1FMTA 1U0FA 1Z4IA 1JT9A 2B98A 2OLJA 3MBOA 2LR0A 3SQOA 2H92A 4ENPA 5I3CA 4DHWA 2C7PA 2XZTA 2V9CA 1OAOC 1NC1A 1Z7GA 2FPUA 2IP1A 3OQHA 2UYGA 4JQYA 3K94A 4XIGS 3RYFA 1CS4C 1RYMA 1W36C 2QQ0A 1LW6E 2C5SA 2IZ6A 2QRVA 3RB8A 4C22A 5DU2A 3Q0IA 1W0JD 2V5AA 1RQXA 1UJ2A 3M9LA 4B3DA 3HUEA 1AY0A 2R6FA 3EDMA 4YRFA 4J0DA 5A5VA 3AILA 1T4GA 4M1OA 1E9VA 4Z0TA 5HA5A 1GZ5A 1NATA 1XKXA 2PR7A 1Y48E 4DCMA 1XAJA 1YQDA 2PSDA 4M8IA 2W00A 2FFHA 1W29A 1YB5A 2OBBA 2P2SA 4HN2A 4L3WA 4QTYA 1NQVA 3UB3A 2C2WA 1WEHA 3JXEA 3ZH2A 5LMUB 2VXOA 4KQIA 4MUYA 4JUBA 1NULA 2B1RA 2PWBA 5IYZB 2PIAA 5LA6B 2Q3FA 4KPEC 1H5UA 4LV5B 4O1IA 4Y9UA 4IWXA 4OHCA 1KJYA 1AKRA 5BYKA 1X38A 3R44A 1Z2PX 3UGQA 2GFHA 3D6NB 1H65A 4DLUA 5CDFE 1M34E 2EQBA 1H4TA 3E53A 1IEQA 4P8RA 4DQLA 1GQYA 3RRJA 3L7IA 3WQQA 2V54A 3A1NA 3GFTA 5LBIA 1Z39A 3TOSA 1N5RA 3NTRA 5DNCA 1IN1A 3PHLA 4W1RA 1V6CA 4KV9A 2ZGVA 3GEEA 4EX6A 4YROA 4BU1A 1C50A 1BHSA 1QHFA 1SG9A 2BUAA 2L18A 1TO2E 2QDXA 3PI6A 4UEJA 1MFPA 2WWXA 1GRCA 5IVDA 4ANFA 1ZITA 3A4LA 4H31A 1A9SA 2VAWA 1EB9A 3JWPA 2FMXA 2C03A 2OSBA 4DZTA 1RAHA 4ZO9A 3GDOA 4L76A 3CNLA 3GLGA 2ZUBA 1XVIA 2CUNA 3KQQA 1WCWA 3RTGA 3LQFA 4M60A 3PNMA 4EUNA 1FS5A 3PNYA 2XVYA 4JHXA 4ZYLA 2D6FA 3CTPA 5KYXA 2P0AA 1OIVA 1OLOA 4LYYA 5TMPA 3HB9A 3PZRA 3DDOA 3UJAA 3EIOA 4F11A 3W90A 1HEIA 4E11A 4FHZA 4GOMD 4PZEA 1XCGB 2WHEA 5MN4A 3D02A 2J9XB 1G3RA 2AMLA 1CY2A 3IURA 5D01A 1HURA 3RD5A 3ED5A 1N3IA 2QL5A 1BNCA 2H5JA 2XF2A 5BWCA 2C58A 1JIXA 3LP6A 1NNUA 3LQRA 2W8BA 1G5PA 3IVAA 5BOSA 4UXJA 4EB6B 3FYUC 5LU9A 1M0SA 1UBRS 4OQZA 1OROA 4GOXA 1TPYA 1QYRA 3JD4A 1HDCA 3PCRB 2HEGA 3QLJA 4JFRA 4EFNA 4YRBA 1U8YA 4TVBA 4YT2A 5I48A 4LVNA 4BVGA 2PUFA 3I2FA 5JD4A 4LTMA 1GRRA 3IQDB 5E7JA 4GLFA 2XGMA 5LP6F 5SZJA 3BIWA 3H2BA 5JECA 3CT6A 4KAAA 2F1OA 3RS0A 4AJOA 2ACEA 2EV9A 3U3JA 4ER3A 2ZTLA 1USUA 4YVFA 5KYUA 1C7EA 3MCZA 3QMPA 4CW7A 4Z3OA 2C5FA 1P0FA 4HPWA 5CA0F 2HNBA 3OA0A 4LSMA 3R7WB 2BFCB 1ESMA 2NADA 2R11A 3IEXA 4FR0A 5ALIA 3NPAA 3PT9A 1XZDA 1P2UA 2QT9A 2BBOA 3D31A 4RIGA 4TWAA 5AKEA 1TFUA 3ZQJA 4RTNA 4KQWA 2OO5A 4HX2A 1SBQA 3GO4A 4J29A 3SIWA 1DTEA 2CYBA 5LZ9A 4MHSA 4QWMA 1M8JA 4A6PA 1WWKA 1JPNA 3O1LA 5TDHA 2X0RA 1H0HA 3AI1A 4LC1A 3RIGA 1NPTO 1ZD5A 1WPXA 2KW5A 3TQOA 5EE5B 1ZC4A 5BV0A 3WL6A 3VGJA 5JS6A 2VK8A 3KHSA 4P34A 3EPJA 2J3DA 1JMKC 5DM1A 4AW9A 5K0SA 2XRYA 1DTWB 4WKBA 3IRVA 4MRSA 4A8TA 1WHSB 3FTQA 2PU5A 4I5EA 4MEAA 1MN6A 4PLZA 1IB6A 3PE4A 1Y7LA 3H5IA 4FFDA 4LJLA 2QBYA 1XK7A 4J0QA 2WSMA 2L2QA 1TCCA 3DMGA 2IWRA 2G17A 1Z15A 4GMFA 2X3UA 1BWQA 2BP7A 2XE7A 1M2HA 3CLKA 4WVLA 3LO8A 2Y99A 3AHCA 4IBOA 4C5BA 4Y6OA 5KNCH 1Q5PA 4W5RA 4B3IA 2GPJA 5FV7A 5KWIA 2P6RA 3ZWNA 4NPHA 1R50A 1IK4A 2RBGA 2REQB 4IHKA 5TVGA 4C4YA 2AZDA 4M7PA 1I13A 3DVAA 4O4IB 3RAPR 1DPGA 3JQBA 3T1TA 4DUGA 5ALPA 2GT1A 4KIWA 4DR4B 1FK8A 1Z5GA 1N9KA 2FSSA 4LNUA 1D1SA 2PBLA 2QPOA 2Z2YA 3VYRB 4LY6A 5FEUA 1Z0IA 1BEZA 3AETA 4QNNA 4UOQA 2O8FA 3WOVA 1S96A 3L6UA 4MV0A 3N70A 2AIRA 2QD1A 3DDCA 5IAEA 3UAYA 1CQIA 4L08A 5L3RA 3W2EA 3P9PA 2BGLA 1L5RA 2TMGA 4UM7A 3VOSA 3MK31 4AJLA 2X13A 1LJLA 2G77B 3D0KA 2GHRA 3F5DA 1HE2A 3L8CA 1N5OX 3N6RA 4IDFA 4N8DA 4CQJA 1DADA 4DLZA 4WZBE 1B41A 2BJVA 3S1AA 1A4XA 2JJMA 1S01A 1CR6A 2JLCA 4MDYA 4F5EA 5KOYA 1ZOSA 2JFUA 4YJFA 3ZQ6A 2W2VA 3L0BA 4NU8X 4JKOA 3W2TA 3ZHQA 5E4FA 1IUKA 3V8NA 1Q0RA 5CLLA 2IV2X 121PA 2CMHA 2OCBA 3M3HA 2OCPA 3W6UA 1SXQA 2Y1WA 1ZJ6A 3PGXA 3OIYA 5CK5A 4K40A 5ITZB 3U3OA 2WF7A 3RSFA 2IU6A 4DEVA 4E7OA 4EPTA 4FYWA 1ISSA 1GPMA 1C9DB 4HH1A 4IXTA 4N54A 2O1WA 3U37A 3HYRA 2GCOB 2HXSA 1O6ZA 2GCIA 2XXBA 1T10A 3L93A 1RQ2A 1ZJ4A 1P6XA 3UAXA 1JQBA 3QU4A 1GR0A 3OZEA 2HJ9A 4P81A 2F4VB 3V7FA 4M0PA 3TQSA 3FNEA 1QVAA 4YR9A 1DX6A 4CKWA 2FRVA 1JUDA 1GCAA 1OIWA 4UHHA 4ARAA 1OKKD 4S1VA 1NI4B 1V3VA 1S2DA 2R6ZA 4OG2A 2X40A 1M6YA 1XYYA 2DHCA 1MO4A 2XDQA 1CQWA 3ZVNA 2R4TA 4BGDA 2PRYA 1YVUA 2G72A 1UDWA 3TQTA 2G1PA 1TW2A 3K2BA 3GLTA 1L7DA 3A4YA 4TQUS 5CMLA 5BQFA 1KMCA 5LKRA 2J09A 4MW2A 1NZFA 3SC2A 3DE6X 4LYGA 2X1VA 1GDHA 4GZMA 1U9JA 2YNMA 3FCSB 1Z38A 5AW4A 5AVSA 5BN5B 1L7QA 3N05A 4I5IA 1BTOA 2YOFA 4RAOA 2II6A 1SKUA 2PMEA 2WZCA 4XYBA 1EFRA 1YOVA 3IBSA 4JLAA 3EZ7A 1H85A 3OVMA 5DYIA 3OQBA 4MKGA 4EA7A 4EHNA 2XDWA 4EW2A 1X74A 4R7TA 4V0SA 2B3TA 5JWHA 1ORVA 4PE5B 2J87A 4Q12A 4YAWA 2CVZA 3AM4A 1RPNA 1JLSA 3LW7A 3M4NA 3MPUA 1A76A 4KXUA 2HCFA 4OHXA 4EH1A 2GBGA 1DQRA 3ND9A 4DABA 1TO6A 1RWQA 4KI7A 1U0EA 4NULA 1WMBA 3SYRA 1VE6A 3NBZC 2J5RA 3ABSB 4MR7B 4BLOA 4JMLA 3UHAA 3D8SA 1TTHA 2OUIA 3U6KA 3R0XA 3VO1A 2Z6VA 2Q3JA 4IXWA 2AMJA 3EDCA 5ECYA 4AUEA 2VJBA 4EI9A 3QRWA 3ZJUA 2QW0X 1ZD3A 2GBIA 1UBTS 1H6CA 3ZHXA 5CB8A 1VDMA 1T5LA 1GTRA 3PDJA 5BT9A 1TYCA 4BQQA 5DT9A 5DOVA 1QJCA 3PUIA 5GVRA 1JI3A 2DBRA 3A0RB 4TSKA 2WDZA 3ZU6A 3AG5A 4LHZA 2FW6A 4AS2A 1ORIA 2O57A 4N5MA 1CUXA 1Q77A 4R51A 1HNNA 4LF4B 4JOCA 2REOA 4UHKA 1N2IA 4DV0B 5TF4A 2C29D 1U7HA 3KYDA 4TZKA 3U31A 5B3LA 2P9ZA 4S24A 1JB1A 1KOJA 4UHJA 3RUPA 3ONFA 1A27A 4ARZA 3R3VA 1U3FA 3DCYA 2HBZA 3GL9A 3C4VA 4BQRA 5FTLA 1Z0SA 3UWOA 4I4LA 1A50B 2J9YB 2Y8EA 2V3WA 2BIFA 1CZNA 3ZBPA 2ZIEA 2WKPA 4OOFA 2PCJA 2RBEA 4AI6A 4CV1A 2OBNA 3ABOB 3I0ZA 3P9YA 4WCFC 2G82A 3RJ5A 4B44A 1LEHA 2AJLI 1V96A 4PN3A 2GASA 4GR4A 4OHRA 5LSAA 2Y1GA 2FVXA 2LBPA 4GO1A 1F4LA 3LQ1A 5FBKA 1UAAA 3UEOA 4WHMA 4RO0A 1DMRA 4LYAA 4XGRA 5ILOA 4Z4EA 2VJPA 3OZRA 1T4DA 2HU7A 5CH5A 3FOWA 2HMUA 2DUMA 3HNPA 3DZCA 4RD1A 1Y8QA 3QW4B 3B38A 4J3FA 3KUKA 5BR4A 5A4KA 2QY6A 1R0SA 2D1QA 4QD3A 3DMNA 5CT4A 1R15A 1KJ9A 2AJTA 1M2FA 3B3FA 3RG8A 2Y4OA 1OBOA 5C1DA 3ZPXA 5KWSA 3KXLA 2B7LA 2I3BA 2GPAA 2DAPA 2XWBF 3HC7A 2EZ9A 4JZYA 3C5HA 1O08A 1JFSA 3PXGA 3BH6A 1SCUB 2DB3A 1SWWA 1XZGA 2VSQA 1YS2X 3FSRA 1CNMA 3IOBA 2R62A 4IWNA 4DOMA 1V95A 4NNOA 4CT0A 5B1SA 2VDOB 3QQ5A 3UAGA 3T3DA 3BCRA 4K46A 1W2GA 4H27A 2CJWA 3D6JA 4RJIA 4WEQA 1K86A 1X1EA 2ENUA 1GZVA 1ECGA 2XGGA 2R0QC 3K70B 3CZ9A 1W4CA 3GOQA 2X9QA 5THXA 1JJBA 3AIIA 4Y3UA 3OTHA 3TNFA 4GT1A 2FXIA 4MQEA 4RHCA 1I5OA 2ZQ5A 3OIFA 1AQYA 1F2TB 1RJEA 3VKVA 4ZARA 3RADC 4IMIB 1P45A 2R1ZA 5IJWA 2G4CA 2PSJA 3JWEA 3B7PA 2YZ7A 1YRBA 4BNZA 1QAMA 4JJ4A 1ZXXA 1O9GA 3CMMA 4QPJC 1HDZA 2IIQA 2JIZD 3R0JA 2ZWMA 1PTJA 4TX1A 3KQWA 3SXUA 1P77A 2WOJA 1YC5A 2FX5A 3WKDA 2GOYA 4D6PA 2QD3A 4MMZB 1UM8A 4QSMA 1ZN7A 2HY7A 4URFA 4A10A 2WMOB 1MBZA 4CMIA 2XE4A 2XVXA 3SCZA 3TD9A 1K7XB 3DKIA 1FP1D 5L3QB 1FCJA 2IXFA 3GUUA 1D03A 3BFKA 5EN4A 1GKUB 1SCJA 1WXIA 2BBSA 1N1GA 3DHYA 4N0QA 1SC9A 1O87A 1THGA 3ONWA 1UMDA 4NK4A 4Q4HA 2H2FA 3ZBUA 5H5JA 2OBXA 4BB9A 2ZAIA 1Z22A 3KU4A 3C5VA 3EWSA 1V25A 4UBJA 4AUNA 1HG1A 1S8FA 4KHZA 4P08A 3K6KA 1XZNA 1S5PA 4EVIA 3ZWBA 1L7RA 3LF2A 1IK6A 1II8A 2VHYA 4JI3B 5KNDA 1H8HD 4W9NA 5CVVA 4DIMA 4YRSA 1SUCA 5EWJA 9GPBA 1M6NA 1WUTA 2Z9CA 2W2MA 4KOAA 1R8JA 4ZCRA 1E4EA 5CURA 5CVDA 2HBQA 3LU1A 4I4TF 3IQWA 5KSZA 2QZJA 3DDSA 4CTJA 3PUXA 5BURA 1NFFA 1PG2A 1UZMA 1L9XA 3OOWA 4QNRA 3ANYB 3OQNA 3ND8A 2ZE6A 3VJLA 1B26A 4TXNA 3F96A 5IZ4A 3RVMA 4RHXA 2OQVA 1KETA 2D2FA 4JJ6A 3K8OE 4M9UA 1IQPA 2VCEA 4XIYA 5DDIP 4AJ4A 4ENSA 4DR2B 3UTCA 1YBAA 3S99A 5FYQA 4YCSA 1EK2A 1YACA 2O3JA 3N8NA 5ICSA 1CW2B 3H17A 3KOWA 4PLHA 4KQMA 2WIFA 1J8YF 1SVMA 2AN1A 4WBNB 5F9HA 2AC7A 1TVKB 3QXXA 2ZPAA 4NBKA 4NLLA 1ZAYA 3IBFA 5BQOA 1N8NA 1UQUA 2IFTA 4GXTA 2WF6A 4AM8A 1N3YA 3LT0A 2FFBA 3G7UA 5CX4A 4EHKA 1EHYA 1OLUA 1SKBA 2FJPA 4E32A 1KTIA 3H9UA 1W73A 4BKRA 4K1XA 2LDBA 4KRGA 3IEUA 4FLFA 5CG1A 4ZK6A 1KI3A 1N2BA 4GXRA 2GETA 5KVCA 4RXTA 3R4VA 1Q1AA 3EF3A 1E5XA 3DM5A 1G6Q1 1GNVA 3H5RA 4IJQA 3W8NA 4C05A 4PO3X 4TSRA 4ZQCB 4AMVA 2F1KA 4B45A 2FP4B 2YQ4A 1AKVA 2JNWA 4X6XA 4CCWA 1BU8A 1TM5E 2RK6A 3NDPA 1MEJA 1YCDA 1E1DA 4UVGA 1W1WA 4QPZA 5C8YF 4LFBB 2VTEA 4P3NA 2C7VA 2JK1A 2HJVA 1T91A 3H19A 3QWBA 4NV3A 4AZVA 2X9NA 3LQQA 5E2AA 4W8GA 4FP9A 2EZ8A 5HIMA 3K0SA 1UOPA 3FXAA 4GRDA 1RP1A 1U2GC 3FPEA 4MA5A 4CLHA 5KVAA 2VTBA 1R64A 4PAGA 4YV0A 2IF0A 4CQMA 4YRDA 4IYRA 2VF4X 1N3LA 4N3CA 1RLMA 4CHGA 5ICFA 2PMCA 4BVHA 2QMQA 3RS8A 5LQNA 1E6KA 3EWIA 1TK2A 2PM8A 4CMEA 2PKCA 2BSAA 3HWSA 3Q10A 3MB5A 1YJBA 5FA5A 5KMGA 1QPBA 1OI7A 2R8XA 4WXHA 5KYUB 4RJKA 5BMVF 1ADGA 4QYWA 4KWHA 4B35A 3U1VA 1JHXA 7YASA 1I2AA 1ZL0A 1C7IA 1R27A 4EABA 1WW3A 5FEMA 3KSAC 1JEQB 4P5DA 3DCNA 3FKQA 4ZKDA 5K7SA 3T1HB 2AKEA 4V0ME 3KS9A 3I9MA 4C4PA 3A70A 4DN6A 4ZOLB 4I99A 5JQGA 1Y8CA 3DYVA 3EXIA 5BNTA 1FVFA 4G8DA 1O8CA 3I5YA 2H5LA 1E9DA 3I8XA 4HB4A 2IYEA 3W1EA 3WNCA 3R5TA 3DNFA 4JP8A 2MOKA 3IX7A 4G24A 1ZK1A 3CO0S 5CLGA 4J6EA 2UZ3A 4NONA 4AUMA 4CIAA 3R5JA 1QZTA 1KQFA 1W44A 4QTZA 3LHDA 3SJ7A 4EM6A 3FETA 4OMFG 4P3PA 2GGSA 3AR3A 4WKGA 3U7QA 3WLTA 2NU8B 1FFYA 1UH5A 1O54A 1FTSA 3EDQA 4MITA 1M3SA 1Q1BA 3ZV3A 5E9WA 3VSCA 1B4DA 5FLKA 1OPRA 1U4NA 2GMWA 2VATA 3D4PA 3GV0A 4JI6B 3R7LA 5K8CA 1NAHA 2GPYA 3DKRA 1P74A 4B81A 1Z0ZA 2CW5A 3KZCA 4L1KA 4M0LA 4G1VA 3OZIA 3UA3A 4EENA 4MVJF 5JEDA 1H2WA 1OBVA 1NHWA 2NPIA 1R74A 1U3CA 8ATCA 3R3WA 4JLWA 3ZZ0A 3GH3A 2IHKA 3E61A 2Q7OE 1IN7A 3ZD6A 2Y66A 3PUWA 1SOVA 4L2IA 4B6PA 1CVRA 1FUEA 3F8SA 3NHKA 1JT2A 2HI0A 2JCXA 2BWJA 4TSFD 5FI3A 4Q9KA 4B83A 4D8WA 4XPIB 1RLIA 2VBIA 1U81A 3SYMA 3AESA 3JQAB 4G5FA 2MDTA 4UAUA 2YQZA 3TK1A 3TPZA 3N0WA 3O03A 3ADKA 4TGLA 4EKDA 4XVCA 1EWQA 2ZPUA 3OQMA 3TBHA 3E48A 2H2AA 4AZ3B 4HFMA 1U0RA 2NN3C 1PVVA 3P0RA 3BXXA 3LX6A 3GYBA 2I1QA 4F60A 3FTEA 2Y1LA 2DPLA 2I1VB 5BV1A 3CCFA 4A8PA 2XUOA 1VPTA 2E5FA 3DLPX 2K5UA 3LUKA 1XF1A 4AMYA 4CRWB 1G7CA 4HH0A 4K87A 1HR0B 3C41J 5FXMA 1YBFA 1ADFA 4FBLA 1AQLA 2VBCA 1H2ZA 3W8DA 2GYWA 3CJQA 1OXSC 3D54D 3VXKA 1WDTA 1YZGA 1L8LA 1AK1A 4IZOA 1ZG3A 3V8MA 2IDKA 2A57A 5DMHA 5EVJA 5JMPA 1YRQA 4NJMA 4YJ2A 3DUWA 4ZO8A 2XZDA 2C3YA 5LXTF 3V2HA 1YQQA 3UKDA 3ITEA 1TT5A 3IJ5A 3ZVKA 2Z5FA 4L4SA 4ZTZB 1E2FA 3ZQKA 2IIPA 2QMUA 3CLTC 3MMNA 2XQVA 1M2GA 5ALNA 1U1FA 3D4OA 4NBLA 4W5WA 5HIAA 2HJRA 2W37A 4WOKA 1K0UA 1FC0A 2GAFA 4MW6A 3P20A 5E0OA 2CCJA 3VC2A 2C3UA 4PV7A 1N8KA 4EVRA 3N0TA 3MA0A 2OCDA 1XHEA 1XLWA 2W6NA 1J90A 2P69A 4G1EB 4KSBA 4Y6SA 2Q4TA 4AJEA 2OMKA 5HK9A 2WB2A 3G0BA 4E5MA 2AXEA 4JYAB 4Q19A 3S70A 3SEFA 1JIIA 1OWOA 2P7IA 5CA1A 3IE2A 3ZCVA 4D8YA 2JJ8A 2A0UA 4L74A 4C7XA 1IHOA 3LGSA 2JLYA 1N6KA 1QR2A 4YV2A 3O4JA 3FUCA 2WJGA 3B1VA 4V0OA 4D3FA 2WPDA 1ZNXA 3DZFA 2R751 1DDOA 4H7PA 4HWTA 2LRHA 2C0CA 3PV0A 1MC8A 2FW7A 3D7SA 4YPFA 3UFBA 2GQ0A 2JH3A 1Z8DA 2NO5A 2QTGA 3H3JA 4NE7A 5FPTA 2Q7DA 1EXNA 2IUYA 2P1ZA 2Q6LA 2CLCX 2WT8A 3EMBA 3ZDEA 2OGUA 3NGLA 2AN4A 2JARA 5ADUS 1XNGA 4LRYA 1QVVA 3E0XA 1VSQA 5LKAA 3GUYA 3KVNA 4A3SA 1XMSA 3MILA 3K1JA 1MO2A 4AY3A 1Z73A 4C7KA 5AK5A 4L78A 1UBOS 2C4MA 2IOYA 1F2DA 3STXA 3UV7A 4ENRA 4DDVA 1ISMA 3HKCB 1L4UA 4YA6A 1ISPA 4EY8A 1WSWA 4HH3C 2IYRA 4JODA 1CJKC 5JZVA 3LE8A 2FUCA 2W70A 1GFSA 1Z13A 3R3SA 4QO7A 1XPOA 3QBJA 3I1FA 5JO0A 2YS7A 1SMKA 3N87A 2C98A 1XEAA 2FVYA 4KH0A 4CF4A 1T1EA 4KQFA 2VPTA 5F5XA 3BD9A 3WMGA 1ZM3A 4RTOA 4G5YA 1PR4A 1IM5A 1A7JA 4CLRA 3HA7A 3KOMA 1XVUA 1BMQA 1VL1A 2JZNA 3A6EA 4QO8A 4LPSA 4A2PA 3L4JA 1XRSB 4K3VA 2P0EA 2FZCA 2HK8A 4DGQA 1XNRB 3AI2A 2Y3IA 3IAFA 1M54A 5IKPA 1R0XA 1IY8A 3VPAA 1P4SA 3B52X 2JANA 2A9FA 3T0FA 4KXFB 1NU6A 4J1TA 1VB3A 4B7ZA 1MTZA 3Q1KA 3OLVA 1YR6A 3O3OB 1OF1A 4RMIA 3S5JA 3IELA 4N5HX 2FSPA 1WSAA 4N9QA 4UXIA 5TXGA 1Z12A 2D4AA 5FPHA 1YR7A 1DOAA 1WS6A 3DEYX 3LT2A 4XIFA 1IY1A 4MVJI 4QYXA 1NVMB 1O95D 2WJ4A 2YMQA 4MX8A 5K3CA 3GLFE 1JG2A 3OY7A 1Q50A 3LGXA 2WJVA 2C7BA 3L8MA 5JNSA 1FQOA 3KZOA 1IY9A 2HLNA 2N1MA 2X1HA 1VA5A 3QLTA 4U9HS 5D3MB 5T4FA 5TQ0B 5AW8A 3BC1A 3E6AA 3HYSA 1KY3A 3FPFA 4HN4B 4B5LA 2IYTA 5A1TA 2X6QA 3IKTA 1M0EA 2ZI4A 3HHPA 4FHCA 3R41A 3H97A 2ATXA 1RXUA 1MB9A 2QVBA 4O29A 1KQNA 3D6FA 1ZI9A 1NM5C 4JA2A 4NAUA 1VYVA 4XIIA 1FA9A 1NF8A 1XRJA 3VZBA 1FRQA 1G21E 3ZU3A 2Z4SA 3NR2A 4A36A 1ZH8A 5KTKA 2D00A 2ZBPA 3AZOA 4ZOQI 4RMHA 1OU0A 4KW7A 3IMKA 4C4RA 2QK4A 4OKNA 2CE7A 4HWKA 4G5QA 1Z2NX 3EC1A 4IKPA 5DN6A 4M7RA 3ZJ4A 4BEWA 1D8TA 1X9HA 2IPNA 3OIUA 2M6KA 1G98A 4M9RA 5T64A 3UQYS 2QENA 4K6FA 1QPGA 1UPBA 3C3AA 3KKOA 2O8CA 3KKLA 3EF1A 2ZBRA 1ZRNA 4FFBA 3VBCA 1HDIA 2WJWA 5IJAA 3KJZA 2IKSA 3UJ8A 2PSFA 1B16A 2G04A 5CW2A 4OH1A 1XZBA 4JP3A 4DMLA 1OD6A 3GG9A 4OAQA 1JEOA 3C15C 3K92A 4AYTA 3QFCA 1GPNA 5GONF 3IEKA 3PLAE 2AFHB 3IS3A 2ORYA 3CKYA 3DYIA 4MKXA 3U7FB 1GL7A 4DJDC 3KEFA 3GFPA 1DS6A 2O1XA 1P73A 3DXXA 3H8WA 1RNLA 2OCXA 5JE8A 3SHVA 3SOPA 1IBCA 5KTTA 5KQPA 1G0NA 3O4GA 2GJ4A 4MWBA 3E2PA 5EMJA 1NVKA 3D43A 5JNTA 2GPTA 4K6HA 3G0OA 1FU4A 1UKEA 5CIWA 2X8AA 2JKYA 2YVQA 2ZWPA 3H5NA 4LCEA 2IZ5A 1V8DA 3BGDA 2DY0A 4I81A 4CGYA 2XDQB 4AMUA 2TS1A 1DEAA 3B3QA 4YCAA 3IIKA 1SVSA 3GLIE 1Y5RA 1MOQA 5A02A 5I9IA 4H6VA 3LC2O 4YHHB 2UZ4A 3P0IA 3JVDA 1KJNA 4E4RA 4JJFA 3AK4A 4LRUA 2MYPA 3RC7A 2GS9A 3N8KA 3VMMA 2WJIA 3FHOA 4JR2A 4O59O 5IS2A 3EDYA 1NUQA 3STUA 4Y0VA 2B36A 1QKKA 3OU6A 2GF0A 1AD2A 1X1BA 1ORRA 2Z8XA 1WR8A 1JAHA 3WE7A 1Z9BA 4M46A 4AJHA 5HVNA 5KVQA 1BRTA 1WNFA 2P9EA 3AU9A 1N0HA 3JQPA 1QE5A 2QSJA 4MI1A 4CMIB 1AOXA 1AHNA 4E6EA 3WYNA 3RFFA 4JC0A 1WD5A 5LUBA 1UK7A 2Y1KA 2CFRA 5DHTA 2G09A 3RU7A 4B4UA 3O26A 5ALGA 1DJLA 1FDSA 3BTOA 4JA0A 2V7BA 5TMEA 1G3QA 2FPPA 2WV9A 1Z7BA 4QXMA 2E89A 2VZLA 5BSKA 1HEUA 4YJGA 4YMIA 1DJPA 3QE2A 4FNGA 4RC9A 2BFEA 3P4UA 1SNYA 2O8CB 3THWA 2X6RA 1ISFA 1AO0A 1XEWY 2BF4A 3U61B 1SU6A 4CM4B 1X70A 1CEEA 2JDID 2EG5A 4EHHA 1WY5A 2C5BA 5HIJA 3WLOA 3OMWA 1KIMA 1RQRA 5EZQA 5BUQA 2DQZA 1P1CA 3JW8A 1AT1A 4D98A 4R98A 1A2QA 1YJQA 4KOEC 3WL8A 5LN1A 3A6PC 4UTPA 1TQ2A 2WM9B 5KKAA 3EISA 4LNUB 1RYYA 4RPGA 4J0HA 1DKNA 2Q3BA 1IVYA 3JTMA 2P6MA 3VKHA 2AOWA 2OGSA 1ZHHA 2H00A 4C2AA 2NUAB 1S9DA 4C3UA 5B3JC 5B64A 4Z4IA 4D96A 4O4JB 4MAFA 4ER7A 3CF4A 2FWJA 3IQIX 2P5YA 2CC2A 2IY7A 4YEDA 3IL2A 4WY5A 1PJZA 4I4NA 3GRAA 1KE1A 4BJ5A 3NH6A 4PFJA 4BDSA 2ZDGA 5C4IA 1SIUA 3OEYA 3E05A 1SH7A 1JFTA 1I33A 3GRFA 1VGRA 3Q6NA 2XLCA 4Q4JA 4RGYA 4HDAA 3QFFA 4EG1A 3INRA 5KAMA 2YRWA 3WYDA 3JATA 4X54A 1H69A 1Y6RA 1KEKA 4G0UA 4HXYA 4P22A 2WWVD 3WNVA 2CLLB 5A7GA 5KINB 1S1MA 3RI3A 4GMDA 5JSQA 5JWRA 3ZH9B 3QY9A 4IDEA 3ZX4A 4ZO6A 4Z6KA 4HGPA 1RRFA 4Y1RB 2ZP1A 2CDAA 4DDHA 2HSEA 3C1UA 2IBTA 2PGNA 4AKHA 4MR8B 4YJKA 1IATA 1Z0AA 1ILWA 1T9KA 1Y89A 2D1SA 3WY9A 1LLDA 1PGNA 1E6LA 1XLTC 4ZDJA 3WLQA 3N6VA 2CFCA 3HKBA 3KLMX 1TM7E 2F48A 5EJ2A 3TAHA 3ADCA 3MS7A 5E7MA 2O8DA 5CH3A 3FB4A 3ZIAA 3NTQA 3KT0A 3NOXA 2GM9A 4ZOAA 2WU4A 1L8XA 3RRNA 1AGPA 4Q1VA 1YXMA 1Q17A 1YTUA 2EARA 4ZQGA 2X0IA 3IO3A 6YASA 2W22A 3TW0A 3TVYA 3ZI7A 2YWJA 3IHLA 4KL8S 3EQ2A 1MA0A 2R1UA 1R5NA 2NLOA 5KTMA 4KE8A 4ZTBA 1WZUA 5FNVF 3ET5A 4DAOA 1E4EB 4RTMA 5M29A 1LV8A 1ONBA 1P5JA 4B84A 1QU3A 3EVTA 4E03A 2A7XA 5GTDA 3NZEA 5EI5A 4WLNA 4C7MA 3MVEA 1GO2A 2XAUA 4JT8A 3NATA 4RBNA 4E6PA 1U31A 2F62A 2X8BA 3I6YA 3VR5H 2IIBA 1Z7YA 2D2XA 1UADA 4HZUB 2XNJA 4H7KA 2QQFA 4HAZA 3SX4A 1W30A 2R3SA 4DPMA 3AFGA 5HNKA 2IYFA 5FNVB 1KKUA 4IIEA 3QG1A 1Q7RA 3DWFA 4WWHA 1DDIA 2JJ1A 3MCWA 2FZKA 4PNZA 1QBGA 5CTJA 5K0ZA 2XE8A 3KT6A 4O25A 4RHTA 2CSXA 1H6DA 4J7AA 4BO4A 3FRHA 4RCVA 4QT0A 3FI9A 3PITA 4OPMA 2QAIA 3IP5A 3MB8A 2A1TR 3OLWA 3URKA 1F9AA 3IMEA 1NXQA 1NMXA 3Q5GA 3I61A 4QWWA 1TJ4A 3EPHA 5FAKA 2H5IA 2Q8PA 2IX9A 2JFPA 1C8KA 2PT9A 2SKDA 2MIIA 2JBAA 3AL3A 3F0TA 1OGYA 3T5MA 3QEAZ 3DW1X 3M33A 2E5LB 1QX4A 4PN7A 4KGDA 2N46A 2W6JA 5JS1A 3HRKA 3QKTA 1RYHA 3RVPA 5D00A 3E9QA 5DX0A 1VLHA 4K9LA 4A27A 2BMJA 3H18A 3PXAA 1WPRA 4WZBB 2OYCA 4B6QA 2IW1A 2ZXEA 2QVGA 1CKEA 4PO1A 2JLRA 2VHXA 3OFNA 1FYFA 2VZ9A 5TQVA 1BWSA 1EVIA 3KBBA 4WRRA 2OTCA 4RGQA 4BRUA 5REQB 2WD8A 1YVDA 3ESCA 2YYZA 5AKGA 5EKTA 3SDSA 4OYLA 3AEYA 2XRZA 4RD4A 4JI1B 1C81A 5KPJA 2R6AA 2XMCA 3KVVA 3GRVA 2UUPA 4O4LB 1DC6A 2DQKA 4BZWA 2Y0BA 4CV0A 2H16A 4OP2A 3G2NA 2G5TA 4YBRA 1DBSA 3MTBA 3D3KA 2J48A 4FOPA 2C07A 5EWLB 4AZ3A 4BU0A 2ENWA 2JAWA 3GUVA 4KDFA 2QEQA 4KLCA 4B31A 4BNGA 4IM7A 5D6NA 1BX3A 3GRYA 5K5EA 2W2LA 1U04A 4HCJA 4RNCA 1RXVA 2PUBA 1UT8A 5DP2A 3AFHA 2Q1WA 3KNZA 4Q7MB 2H0AA 1O6CA 4WZAE 4ENQA 5EJ6A 4NKRA 1W4RA 2GJ8A 3HUTA 3ZD7A 5LUAA 3V1UA 3VNVA 3JTEA 4N48A 2ETVA 2OD9A 5EFOA 1MW8X 3DXZA 1MJ5A 3TSOA 3NW9A 4D45A 1ISHA 2N42A 3CX6A 2VYVA 3QKIA 3GCZA 5EUQB 1XRPA 2PX2A 1J9ZA 3LUPA 3OLZA 3QEJA 2E4WA 4KO8A 5BP7A 1B3RA 4F21A 2AEFA 3OY2A 1FFAA 1NW5A 1U2ZA 2VYCA 2X8WA 4Q4HB 4DVJA 1ENYA 3G5AA 5CT9A 3N74A 3WP0A 1N2XA 1OJLA 5AICA 2I22A 3ETEA 5AM3A 3IE1A 2O0MA 3MD0A 4EG6A 4N41A 2MMCA 3OU7A 1PV1A 2JLZA 4JNKA 2OORA 2AT1A 1E18A 2HUNA 3AKYA 2Y1OA 1HYBA 4IUDS 4A0FA 4YLYA 2P6PA 4QQ8A 4P7BA 5AI6A 3ZXYA 3MCTA 4WOJA 4BCCA 2O23A 3ZIAD 4X8HA 1OOEA 3H99A 4EMBA 2XWSA 1TO1E 1Q1EA 3QNUA 1YQWA 4L5CA 3T5CA 1JG1A 3RSGA 4ZXFA 1EM6A 3EUAA 3HDTA 3GEPA 4ZU1X 3TXAA 1ZR4A 1YJ5A 1QO0A 1ZD1A 3T34A 1N33B 4J7CA 3GPBA 1OWLA 2B3DA 2PQ6A 1E7QA 3FGZA 3RRFA 2BJWA 2A0FA 1DG3A 2WMDA 2FEXA 1T2EA 2AD5A 5JS2A 3EQZA 2AF3C 1BVYF 1PT9A 2F1JA 4KTTE 1RWXA 3CNOA 1JIUA 4IF6A 4BO1A 3CIFA 4CKEA 3G1TA 1IZ8A 1BDMA 3GG2A 4WNAA 2FEPA 1HOXA 2XKJE 3BWYA 3UHOA 1U65A 2EKBA 3Q0EA 1O4WA 4KZKA 2BCGY 5HE8A 5KJ6A 3UUFA 3WLNA 4FU0A 3TSZA 1FVXA 1MH9A 1E2LA 1A8IA 3QSGA 4RVHA 3K4PA 4KDRA 4OA5A 1AKQA 2A9PA 5MHTA 5ESDA 2IH5A 3DZDA 1I0LA 3A4NA 4NMWA 2L42A 2O2SA 2TRSB 4PBSA 4ZEOA 1J07A 4E21A 2Q3CA 1VLZA 4UC0A 1Z4NA 4KYTA 5FCDA 1HKUA 5J1SB 2NTVA 3T3MB 3BWBA 4BS9A 4L7QA 1UZAA 5CIQA 2NOAA 5JVDF 2RGRA 1Z06A 3BTVA 1M73E 2O7RA 1X7WA 1IY2A 1ZRMA 2I4LA 4JS0A 1DOHA 5FUMA 1JDVA 5FYDA 4W1PA 1Q16A 2NZWA 3A1SA 1P61B 1SOUA 1VGVA 3EXEB 3M4ZA 3QV2A 2BKLA 3MEQA 3MWDA 2FUG1 2Z95A 1QGDA 3CINA 3B20A 3O83A 5DTEA 4QQRA 4YJHA 5PGMA 2IUSA 3TUIC 1AUXA 1JSXA 1P0MA 3ZV6A 1G291 4N7RA 2ZAYA 1K6MA 2YW9A 4KYIB 3HVKA 4IILA 5B3KA 2DQYA 1RHRA 5EIOA 1QH9A 2RSLA 4CI0B 1FL9A 1XZCA 4NBTA 3P2OA 4QFDA 3RUEA 2DLCX 4PRKA 4TVOA 1DO8A 4J03A 3RK4A 1DUIA 3BFXA 3NU1A 4REOA 4XH9B 4LHSA 5AI0A 4BX3A 2H65A 5IJ0A 4WE3A 3A58B 2CBZA 1IOVA 3DV0A 5A3RA 4V1CA 4D9EA 1E5VA 3OOHA 5L7TA 2LPMA 5ESRA 1RQ7A 1XDUA 2I6SA 3DMDA 2G6BA 2LP4Y 3PC3A 5CHEA 3C48A 1P2GA 4LECA 2DFVA 2ID4A 6AT1A 1GV0A 2P6OA 3TIXB 3SHTA 1GPAA 2HXGA 2J6BA 1V2GA 3BJZA 1AH2A 4K9DA 5EWLA 5DI3B 4TUYB 3E5NA 4OQYA 4Q9DA 4UFPA 3W6ZA 4F93B 1E6EA 2LDXA 2CXNA 4ECAA 2P11A 3QHAA 3SHFA 1VI6A 4N0PA 3EXAA 3UA4A 3V1YA 1CVIA 2C82A 1G9SA 4ZALA 3ZE9A 1H9BA 3VSEA 5G0VA 1ZSNA 5EE9A 5IKXA 2Q1UA 2G8NA 2NUTA 4GP9A 1PVOA 1RKVA 3EG5A 4LFAB 4F4IA 1AUOA 1K5HA 1NMSA 3GQVA 4W5QA 3TKYA 4JLUA 3PD1A 1QLWA 4IH1A 4X24A 5BO5A 3GZTB 4X85A 5G02A 2XIJA 5DHSA 1XO1A 2YYAA 2YIMA 3EGVA 1UDBA 1P7VA 4ENWA 5TR9A 4EUEA 1YF3A 2PZMA 2CLKB 4KXQA 2YHSA 1G5RA 1U28A 2AB0A 2IOHA 1YMVA 3QMVA 1LK7A 4YAEA 4P80A 5C7YA 1EAMA 4MGZR 3WXBA 4UEKA 3E82A 4L0CA 4BFTA 2R1TA 2JHFA 3SHWA 2MSNA 3HVIA 4EJFA 3UKJA 5LR6A 1Z36A 2W6QA 2QRNA 1BXRA 2EJWA 3CEJA 2V3CC 4Z86A 1JLRA 3C3BA 3KTDA 5G53C 1F8FA 4JX9A 2WPNA 2I7DA 2JFZA 2Q1TA 3MSCA 5JMWA 3N2GA 3CZMA 3ZU4A 5ER9A 2C9CA 4F72A 1KZ7B 3WI7A 1D04A 2FYTA 2XA1A 3PEUA 4HUJA 2UXCB 3C7CB 3BK7A 1VRCA 4BUCA 1GPKA 4WNAB 3B13B 1Y9ZA 2FI1A 3ISJA 1AA9A 5HX7A 2XNHA 3OETA 3F67A 3QI2A 1JHAA 2PE5A 3I58A 3GN2A 1UK6A 1JDPA 1PNOA 3H4TA 3GD5A 3L02A 4HXGA 4NZ9A 4PG6A 1YR2A 5CLQA 5D7NA 3AP3A 2ARKA 3I1IA 5K3SA 3CCCA 4HG2A 3GLFA 2YC4C 1YT5A 1Y3IA 3L0ZA 4QPNA 3T38A 2JI7A 3HJTA 2QB5A 1DWQA 2Q9BA 2WSSD 1EXDA 4K3UA 2CV0A 3EFEA 4W4TA 1Q0LA 4H3HB 4ZJUA 3CKKA 4WFQA 2QG9A 2HHLA 1MVNA 3R6LA 3UWDA 4FCCA 5FV4A 3CISA 2PPVA 4O8CA 1ZRHA 2HQSA 1QX3A 2VBGA 3OPXA 1PEDA 3L4EA 2I99A 4HFJA 4P2GA 4XJSA 1A5TA 4M8SA 2O52A 5DTMA 1PN3A 1Q6ZA 1EGQA 5K3DA 3S3TA 1YK1A 3SSNA 1SKMA 3O1JC 2ZRFA 4RTSA 4OAOA 3DZJA 2Q9UA 5AJVB 3PPYA 3HKCA 3UO8B 2R25B 1KMNA 1T8SA 1AMOA 3WAGA 1QG4A 1T4CA 1KJ8A 3F9CA 3DM9B 5ALVA 2GYUA 3O47A 4Z0NA 4DLRA 2VJAA 2VDVE 1CZOA 1WDLA 1XSEA 2WWIA 3D0OA 5EE3A 3PIRA 1PL8A 5EP2A 3LG2A 5TY0A 3WLEA 4BBJA 4KN9S 7MDHA 5JJCA 1AA6A 3PWKA 3OT5A 3L18A 4FYMA 1T15A 1XOIA 3U7QB 5AVUA 4KIUA 2B1QA 5ALYA 3K16A 2NW6A 1D9ZA 3MRSA 3OJCA 5EXEA 2D7DA 3DVAB 4FPXA 2PA0A 4XR9A 4JLOA 1D09A 3DWEX 1SOWA 3QEMB 3UJBA 1MZPA 1G16A 1CERA 4PHGA 1BXRB 2DSNA 1KL7A 3OUUA 1LS6A 4W9MC 1W36D 4NH0A 4Y7DA 5EKSA 3D0QA 3WX0A 5L7YA 3FYHA 1XQYA 2BKUA 4M37A 2P2CA 1X1DA 1KFJB 5DGXA 3M3DA 5A9SB 2IU0A 4Q9NA 4LDNA 1J00A 4LF9B 3KFXA 3MAAC 5K8IA 1YR9A 4RTPA 1QTRA 3QA9A 1Z34A 2KLBA 3KXKA 5TC4A 4CGZA 1FBNA 1MRZA 1Z8HA 3F3KA 1WE2A 4Y2HA 5J5AA 1KDYA 1ZU4A 3NALA 2ZULA 3HB7A 4G5XA 3U5TA 2XITA 3VNUA 4TROA 5IK2A 2C1ZA 3LHFA 5F64A 2X8LA 4I50B 1RKUA 1V9SA 2ZVQX 3OM9A 5B6IA 4QXAA 1V2HE 3EXG2 1AUVA 5IXJA 3T7KA 3O2NA 3ER9A 3TO5A 2H1RA 1SXJD 1PQWA 5CYFA 1VRVA 2H07A 4PGFA 5LZ5A 4JCCA 4MH0R 1FFXB 3FR7A 3OICA 4NG4A 1T26A 5IBCA 4WFKA 3MJFA 4CDNA 1GUFA 4EF6A 2FWIA 4HNUA 5MGNA 2DKNA 4TOIA 2GO1A 3HEBA 3P2JA 4OSPA 3W06A 2REBA 1U3DA 5K45A 3VX3A 5F3DA 1L7AA 5BV2P 3OUTA 4LUCA 3U7RA 5J4LA 1CDEA 3CGGA 3ETHA 4B4OA 3QP9A 3NKLA 1MNQA 4RPCA 5F9FA 2QTVB 1S02A 4I6EA 3EOBI 4CKCB 1LFDB 2I78A 4RQBA 2HAEA 2W58A 3K0EA 4LYEA 3IP9A 4IJVA 3CMCO 2W6MA 4B73A 3LWNA 1TC2A 4EKYA 2QUAA 2LE0A 4MUGA 2AV6A 1XU9A 2P9TA 3QH4A 1ZCBA 4NFHA 4BHTA 2VHVA 4ZVLA 5H16A 5BSFA 2VSXA 2BY4A 4TMXA 1UKCA 3RGGA 4QDJA 4DQKA 2J9ZB 1ZVJA 2GHTA 3C70A 4INAA 2RJOA 5D87A 3CLHA 1E0JA 5TGDA 2O6HA 2H3HA 4XWKA 1P29A 3PKZA 1E96A 2PU7A 1T5SA 3H5AA 4FQ5A 1I4WA 1RHUA 3DJFA 3QELB 4RJJA 4ZVUA 5HK8A 5I4BA 1SRRA 1R0YA 4RVDA 4WEOA 6Q21A 1J23A 2G9RA 2VJNA 5EHXA 3NOVA 2WRZA 2YH2A 1OTYA 1UEJA 3V2IA 3RYTC 3NONA 1Y5IA 4ZCQA 5GONA 4M9CA 3HB4X 4UTZA 1DELA 1QFZA 3G7SA 1XQ9A 3MOIA 1JALA 5HQTA 3OZWA 2PS0A 5LC1A 1GPYA 1FNDA 3B60A 4IH4A 5DCYA 5ESXA 3C5WP 4Z9YA 2QJWA 4MJXA 3VU9B 3H86A 1ZJZA 4MSUA 3IT1A 1W1UA 4O2BB 5ERYA 3VTKA 1XTJA 2FQXA 4RD2A 4NHEA 1GZHB 4L57A 4IIHA 1ADJA 2VKQA 3QENA 3H9JA 3QEOA 4HMOA 4M1YA 3GNLA 5KKCA 3DP7A 4DR5B 1SZJG 2F3TA 2Z30A 2HTEA 1Z8FA 1S8OA 2HZ7A 2JAQA 2VIIA 2XMBA 5A2GA 1W5SA 1PFVA 4ZT3A 1RXEA 4FEEA 2GRJA 1YA8A 3ASUA 1UDRA 4YUAA 4WW0A 3S29A 4LHEA 3NBAA 1QHGA 2Y1XA 3M2TA 5EGNA 2IVFA 2DFKB 4RYDA 4I08A 1EVQA 1EVLA 2ZIZA 4O5AA 1A72A 1OI3A 1L7NA 4ZP1A 5ALEA 5IBRA 3TOVA 3ZWVA 5B6JA 5ICGA 3T7EA 3CNBA 2V3VA 4UTOA 1D6MA 1DIGA 2B35A 1KVSA 1DQSA 5CTAA 5ITVA 3HBAA 1OBCA 2XPCA 2CF5A 3D1VA 1OFGA 2O48X 2VPWA 4LIPD 4ZAXA 4YWJA 3TJMA 4EG4A 3DVSX 4JJGA 3UK6A 1Z6GA 1YHYA 2VSOA 4F2GA 3DS8A 1GA1A 4Q7QA 1VE3A 4K6MA 2HMTA 4IR7A 3IALA 1XL1A 3DONA 1SCKA 4JUCA 2VDWA 3TSWA 4A8HA 4B3JA 1SC3A 3BAZA 1FNMA 5EPOA 3CUKA 4W5NA 2PSHA 4ZQEA 4RIIA 3SF8B 4WKNA 3GLHE 1PW5A 4QRHA 4QPPA 1XT6A 2X0EA 5JTTA 1FPMA 3V4ZA 3E9RA 4YMTA 3OTQA 1Z4JA 4Q34A 1NTOA 5D5HA 1H2HA 2I4NA 4ZMSA 5HGJA 2EGGA 3BM5A 1ZLXA 2FP4A 2JGLA 2DWQA 4ZYWA 1JTVA 3ZZ1A 2ZZNA 1XZQA 3IP7A 3NV9A 1GUYA 3A0UA 4MQ4A 5JASA 3DTVD 2Q9CA 2Z43A 1JA1A 1XLUA 5DWQA 1GY8A 2PXXA 3EEIA 4PSAA 5IK2D 3M6LA 4TTIA 4DMKA 1GFIA 1E3WB 1VCMA 1XNHA 1CDOA 3FCAA 4R2MA 3WMXA 1MJGA 5I7SA 3R0QA 1TEVA 2ET6A 4GBGA 5KDOA 4QYIA 1MVLA 2X8JA 1NXXA 1JH8A 4EUSA 4H77A 1GG2A 1N6LA 1OH6A 1J0XO 4OJNA 1ZK0A 3CN9A 1Z7EA 2XKBA 5IWAB 2FY8A 2WTUA 3UGJA 3R9XA 1CWUA 1DIOB 4MVJH 3H5LA 3ZV4A 3P4YA 4EY7A 1M8GA 4U8HA 1XCBA 4F1KA 2EFEB 1NE2A 2V1UA 4JH0A 1JXMA 2PL3A 4CVNA 3WSWA 4YUYA 2V0NA 3QFTA 5FOTA 4ND5A 2XUQA 1K6EA 2VC2B 4J0IA 3PF8A 4JOSA 2EGUA 4DCVA 3CM0A 3EARA 3NANA 1CJBA 3R09A 1VG0B 2ZRHA 3TL3A 4QSHA 3CF6R 1F8XA 4TZ6A 2UUOA 4WI1A 5AW7A 4G5RA 4F3RA 5DXJA 5EJ4A 2ZRGA 5E38A 2G9QA 1UF9A 4RM3A 2QNIA 4MW7A 3ENKA 3Q9UA 1YIDA 3GLVA 4TLCA 2RGNA 5U4XA 4XTCS 3OP1A 1Y6ZA 2JAXA 3PK0A 4ZU3A 1H4QA 2HGZA 5F7OA 1U11A 1GCUA 1DO2A 4BVLA 2H1HA 1ZD9A 1CLUA 4I2VA 1J6UA 2IP4A 2X42A 1XJWA 4AN4A 5K0BA 3LVBA 2KQUA 5B1HA 3I8SA 5BPHA 3WIBA 3NRJA 2CLFB 4Z7NB 1D07A 1U9IA 2DUNA 2VP5A 3R0VA 3B7GA 4B85A 5F2NA 1HE3A 4F71A 3ECAA 3IVMA 3KEMA 4GWGA 4IXDA 4J0JA 4RESA 5JXIA 5T6BA 3VA7A 1EUCA 1P1JA 1IZ0A 2HF9A 4V3BA 1AV7A 2A1UA 5LMZA 4D9MA 3OFSA 2WNHA 4ITRC 1XVAA 4JB0A 2X15A 4QBGB 5GVSA 4XSGA 3ADDA 3R8CA 1CJVC 4U2CA 4PG5A 3NRBA 3TMKA 4WA7A 1Y37A 3CRMA 2QRKA 4LTDA 3CUTA 4WLVA 5DHUA 5AKHA 2XCRB 2CCGA 3FOCA 4B6RA 2V59A 5T6MA 2PKRA 2V8OA 3JWIA 5TX7A 5LLTA 3GPDG 1W88B 1PWYE 3NJ8A 5FWNA 4QELA 3EGOA 3AG6A 1SWVA 4Q93A 5EUBA 2E9SA 3ZW7A 5I4CA 1Q2UA 3T1NA 2OYSA 1E2HA 1SA0A 2EAUA 2J1LA 3MJSA 3G8CA 1C3JA 5HM8A 1L1EA 3BB3A 4MYUA 3RQIA