4C7MA

The crystal structure of tcpb or btpa tir domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
134
structure length
132
Chain Sequence
SNADFFISHASEDKEAFVQDLVAALRDLGAKIFYDAYTLKVGDSLRRKIDQGLANSKFGIVVLSEHFFSKQARELDGLTAMEIGGQTRILPIWHKVSYDEVRRFSPSLADKVALNTSLKSVEEIAKELHSLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TIR DOMAIN-CONTAINING PROTEIN
publication title Mechanism of Bacterial Interference with Tlr4 Signaling by Brucella Tir-Domain-Containing Protein Tcpb
pubmed doi rcsb
source organism Brucella melitensis
molecule tags Signaling protein
total genus 46
structure length 132
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4c7mA00
3OZIA 3H16A 4LQCA 1O77A 1FYWA 4W8HA 4C6RA 5KU7A 4LQDA 1T3GA 4OM7A 5H3CA 2Z5VA 2Y92A 4LZPA 3UB2A 4C6TB 2J67A 1FYVA 2M1XA 1FYXA 4FZ5A 5FORA 4C7MA 4EO7A 2JS7A 4W8GA 4C6SA 3UB3A 4DOMA 3JRNA 4C6TA 3UB4A
chains in the Genus database with same CATH superfamily
2VPIA 5JI2E 1DFIA 2PM8A 2PVSA 3MTJA 2OLEA 5JZ9A 1TMKA 1H9AA 2V6BA 4I1RA 4DQUA 1LDMA 2MSEB 2I2DA 2PSHA 1MT0A 2YWFA 4DVGA 1D4ZA 2O1XA 5FI3A 1Z36A 3IVCA 3HL0A 2BFDA 3G2LA 3U4QA 1KBOA 2G76A 3TRKA 4F8YA 13PKA 5JADA 3ZE0B 5FTJA 5TIIA 4DLWA 5BN4B 1MPTA 3IMEA 4C0HA 1NJ8A 2CJYA 1ZIDA 5B12A 3TZBA 3WTBA 1YRLA 3D1JA 5CXUA 2E37A 2KX7A 1F7VA 3V42A 1SBQA 1P33A 2WJIA 3GJ6A 1NSYA 2Y1KA 1E5VA 1YIOA 3IUNA 2GI4A 1DLJA 1UWCA 1JB1A 4Y9UA 4XOIA 4LBVA 4BLTA 4CT0A 2ZROA 5DN6A 3NGXA 5L53A 3IP8A 4NWIA 4QTXA 1NIJA 2DG2A 3IHLA 4L22A 4R9RA 3A1EA 3M9XA 1SG0A 1TXGA 2WUFA 5DGXA 1Q20A 3A9WA 3FYSA 1QZZA 4G07A 4IS2A 2E82A 3PR1A 4D96A 4ZMRA 5IBPA 5HOQA 1L7EA 5EZYB 1KJNA 4P0TA 4XYGA 3L1HA 5K20A 1AK9A 2CFSA 3CVVA 1CVLA 1WOMA 5E9AA 1TU0A 3CX8A 3IR7A 4PX3A 3P0HA 2J0EA 1E1KA 2R1UA 2I91A 5C8YA 3EPRA 2X6QA 3BZUA 3W05A 2Z98A 2BPOA 3WI7A 2GBPA 4CBVA 1SXPA 1K0UA 1JHUA 1YDHA 1ISJA 1UMKA 1QE5A 3DV0B 4BQRA 3ST7A 3EXG2 2CYBA 2GTPA 2P41A 2Q9UA 3L0YA 2J6CA 4NBKA 3EISA 1MTZA 2I4IA 1PZMA 2TECE 3GRAA 3KVYA 2V6IA 2P4QA 2POQX 1R6VA 2X1MA 4P33A 2CFTA 1KSFX 2H5LA 4L16A 3NYRA 4PONA 3CEPB 3DAPA 3JPWA 2JHFA 3K53A 1PYDA 3MTIA 1NNUA 3IAEA 1L4FA 2QVYX 1YS2X 2ZUCA 4G9BA 1K86A 1OAOA 3O8OA 3A1TA 1Y3DE 4U2KA 2DHCA 1IEXA 1LTKA 4QQFA 1E8DA 2WAMA 3ZY6A 1LQTA 2YCBA 3CV3A 2BHLA 3CM0A 1PW7A 3HYLA 5F51A 1NVWQ 1YS7A 4PLYA 5IM5A 3IIMA 1P4HA 5DHUA 3B1ZA 1V8DA 1T9CA 2ST1A 3G2OA 1UPCA 2WJPA 1NI4A 4RPIA 1PTJC 4JODA 3M4XA 1DTWA 1IHDA 1VIVA 1U94A 2V8BA 5EP3A 4LEIA 5JCOA 2C7OA 4DANA 4YP7A 2CZGA 1C3OA 1P2FA 1L3CA 1YACA 4Z4IA 3LYLA 4M1SA 3OUUA 4MIYA 3KPYA 1E9SA 3WLMA 4BJHB 4BQPA 4E15A 4FFNA 4WBNB 1EX1A 2ZRQA 4XLZA 3VR6A 3T4XA 1JPUA 3A04A 2VF4X 1Q6ZA 2VZ0A 5TGDA 1UBCA 1PI3A 1Y1SA 1FTYA 2AR9A 2W6PA 1IBKB 4YJFB 1PJCA 3OFKA 3VVMA 3B85A 1HLFA 3KQQA 3G2JA 4Q4DA 4Z0HO 4EVSA 5BWCA 3F2IA 2R65A 2PT7A 2VKQA 4FX5A 1T4MA 4LNUB 4G63A 4ND6A 5AOCA 5FO1A 1WBDA 1H2HA 2IYVA 4YT2A 1AC5A 2CYAA 4O63O 4UE6A 4PBSA 2AF3C 3ESZA 4OQNA 1YE3A 3KU4A 3D3EA 5IC4A 2A88A 3Q6NA 3C48A 3U3KA 2XZDA 4PO3X 4RU1A 3RK4A 5B5SA 2JCBA 1I13A 3VYSB 3AHJA 2Z3VA 3EGEA 2HJGA 1XZPA 4G4JA 2D5AA 3E9MA 2Q2NA 3DLAA 2A94A 2RGNC 3BB4A 4WOKA 4HEHA 3NWBA 3E1SA 1RYMA 1IM5A 4ER0A 4PTYA 4PLWA 2FMUA 1GSHA 3M70A 4JUBA 2UZIR 3MQ2A 3LOPA 4J7CA 4DR3B 1CF4A 2W8ZA 2YMPA 1DT3A 3CKKA 3FKQA 3TLBA 1TVMA 4NABA 2XVZA 4E46A 4R9SA 3FUCA 3KVRA 3PDHA 4QHTA 4D25A 1S3FA 4DCPA 3VJMA 1P44A 4DNFA 4JU9A 1K7XB 2XKBA 4EG8A 4OIMA 2CF5A 1U7PA 1DIBA 3FWPA 1X86B 3I32A 1KSGA 5E2AA 2CEAA 4RIFA 1I36A 3FMOB 1PLKA 1NUQA 3ZWQA 2ZT7A 5C5IA 2ZT6A 5MFZA 1U0FA 4DABA 1ID1A 2J3JA 1M72A 3AF6A 1EB8A 5EKSA 3WHKA 2ZYDA 1PVVA 2W8BB 3RRXA 3T38A 1UFOA 3ISJA 3CSSA 3QPVA 4FTWA 1XNHA 1Y1PA 4LVOA 1KVUA 1FTNA 1SOAA 4PLVA 5G0WA 2N3ZA 2FN9A 2PRZA 3MFQA 3UYKA 1DQYA 4YQEA 1RYEA 3K8OE 3PICA 4N01A 2BKVA 2FN4A 2JARA 4L3WA 2HU2A 1T10A 3BWMA 5KSOA 3W8NA 2CNOA 3C6BA 5EAIA 1XTBA 4R5MA 3IE0A 1KWKA 5LL6P 3S70A 3MCTA 5EKTA 3LPCA 3F71A 1PT6A 2R62A 1R0ZA 3FW1A 4LPSA 2ZSKA 4TRNA 5IARA 1BYIA 1NAIA 2I1LA 4P7KA 4OBXA 3WKEA 2WT4A 2GZSA 2H11A 1G19A 4MI6A 5IPFA 3CVWA 3BCSA 1KYQA 4NG5A 4LJLA 2OAEA 3LFTA 2LZ0A 1SKMA 2Z95A 2H5EA 4FKZA 4BO9A 4RGQA 3GNLA 2PX3A 1HLGA 1IATA 3GRZA 2JAQA 4DDUA 4LFBB 2XNDD 3MTGA 1NBHA 3MJ4A 3UFXA 3OA2A 1UC5B 3PG5A 4DEYA 2BIFA 2OP0A 1NJ6A 2FWIA 1Z4PX 4H7HA 2OY0A 4ZD6A 1L4LA 1JBQA 1UMDB 5DNYB 1JI0A 3H1AA 3EA5A 2ODQA 3K4QA 3R0ZA 1E5XA 2CNKA 4ZCMA 3V4OA 4ITUA 3DCIA 3JAMA 4J0FA 2AL7A 1RP7A 3CZ9A 4QFCA 3LAWA 4RELA 5IVDA 1HA3A 3GA0A 2OHIA 4BRWA 2XNSA 1CUXA 3PDUA 3M83A 1XLVA 3G2QA 2BUAA 2Q3DA 1ZMTA 5AKGA 4DSOA 3FI0A 1U02A 2GBLC 1ODJA 4I4TF 5HQ3B 3ZDCA 3BFXA 4FR0A 5T6BA 3BHMA 3CX7A 2ZJ2A 1AKYA 2AX3A 3EMDA 3ZWDA 1II9A 1W4ZA 3D43A 3GVPA 2IV2X 2HNAA 1T91A 1BMTA 3H5AA 4B75A 4I4TB 3COPA 4MVJG 2VIIA 4D46A 2WICA 1IH8A 1WMFA 2BFEB 1HNNA 1JE1A 4IV0A 1CVRA 4MDHA 2ADOA 3IUMA 5E0KB 2AXEA 3UT0A 4GC5A 3K72B 2FMIA 3P2JA 5FYQA 2LE0A 4EPXA 1YH3A 2WZQA 3HSKA 3SSOA 3W5JA 3AOEC 3FMGA 1TYCA 3UA3A 1TQ2A 3D4NA 3MW8A 4CV2A 1Y4SA 3G02A 4YDHB 4HGQA 4LYGA 3KXKA 3DDNA 3RUHA 3TVTA 3H8JA 4TMXA 1OH6A 2ZYHA 1E9EA 2UUAB 4X8MA 2BMFA 2H18A 2V6MA 2ZI4A 5EIBC 4XPIA 4IFBA 5AKHA 4GL2A 2HPVA 4N3NA 4FGKA 2M9MA 4V3CA 2Y6VA 2GEVA 1CQJA 3ZTYA 3EIOA 1ZL0A 3ABZA 1OBFO 2Q8PA 1FSZA 3AG6A 1N5OX 2G06A 2GAFA 4RE6A 2G8NA 4URFA 4A0SA 1B1CA 1V8ZA 2FCRA 3T1YB 2BM0A 4TLMB 5JDIA 3KS9A 5DU2A 1VJRA 2ZE7A 2C94A 1EQ2A 3DVAB 1J9GA 3HR8A 3PUVA 1KAMA 3QUQA 5DI9A 2PX5A 3NETA 2ECPA 3BFKA 1KU0A 4AO6A 1JG1A 2A0XA 1QFYA 2R25B 1P7WA 3WNVA 1IJFA 1PFYA 4ZT5A 4ZQCB 1ZPDA 2O1WA 3S4YA 4ANFA 2CKDA 2WB2A 4ALJA 2B0JA 3BUSA 1PWHA 3HMQA 3HV0A 4X1KA 2NXNA 1C3JA 5BXYA 4BFYA 2O8NA 4Q00A 2QVZX 1YRQA 2QTFA 3DXYA 3QF4A 4JLDA 5TMEA 9LDTA 5LZ5A 3KKZA 1Q2XA 4GMDA 1MCZA 2R1TA 3ZWVA 1PE0A 2W0SA 2SCUB 2W90A 2F4VB 2AFHE 3DFFA 4RY0A 4WZBB 4EHJA 4LHYA 3GHHA 2IUFA 2NXEA 3I2KA 3KLBA 3HDTA 4IILA 3TLKA 2C31A 1BQEA 3QIAA 4XR4A 4XUEA 2OO7A 5DRTA 3OE7A 1LGYA 1GTZA 1Q14A 2M6LA 1YR6A 3RS3A 3BMCA 2XW6A 1F0YA 2QU7A 1W36D 4KVAA 1Y9EA 2J3KA 1SUFA 3O5AA 1V3QE 4ISBA 5AM5A 4KKVA 5FI0B 4AICA 1CZOA 2J0UA 4CM1A 1F2VA 5LDHA 3TSCA 1H94A 1JDVA 1DP4A 1O6ZA 1GPDG 1I2CA 3AUXA 1HEYA 1NXTA 1MG0A 1G9XA 1YRYE 2G9RA 3AXTA 3JWGA 3H9JA 3WGJA 4CMEC 1TF5A 3HHEA 3SHOA 1VL5A 1GA1A 3O73A 2ZSUA 1IL0A 2QN1A 3UC5A 3ERCA 4I6GA 4FYYA 3ZDRA 1POWA 4WZAB 4C0BA 1XBTA 4QBFA 1IK6A 2F59A 3FB4A 2N46A 4KQ1A 5FQNA 4Q7EA 4V24A 2OPHA 3SFVA 2PZEA 4LC9A 4F3CA 4DLXA 4HDSB 4A2PA 2V97A 3LBNA 3E9ZA 4RY2A 3UXHA 1LF0A 4Q9HA 4C6HA 1TYAE 5A4FS 8ADHA 5LU9A 1L2TA 2A0KA 2ICAA 3OURA 2F1HA 3KZVA 4RA9B 5D3MA 5DNAA 3ZD9A 1YVEI 3DMFA 3NQ41 5KNDA 1J7JA 2IXAA 3FSGD 2XQJA 2E87A 3Q0TA 1PQWA 1O54A 1TVEA 4XFJA 4EJ2A 2VPQA 4BNVA 5KIAA 4ZOLF 3VNSA 4DLAA 3C3CA 4RPJA 3KVNA 1FEZA 4C4AA 4EPTA 1AXEA 3PQ2A 3EZFA 2NX2A 1GNVA 3OIGA 2V9PA 1Y8CA 2C7VA 3TL3A 1X3LA 1NQOA 1E9VA 5BSWA 4NU8X 4ZOLB 1ZD3A 5HQTA 5DWDA 3R5KA 2NP7A 2YFHA 1SUDA 3ENKA 1Z0FA 4WLEA 4Y6OA 4YCJA 3GLFE 4DR7B 5G1OA 4AS1A 2EERA 1NVVQ 3JATA 4O0MA 3H5RA 2B4YA 5BSVA 4YRCA 4CDMA 2WRZA 3TAUA 5DBGA 1I2DA 1XPJA 3UBMA 2VATA 5T4EA 1PD1A 5PNTA 3WSVA 2DYKA 2B25A 3BL8A 2FEOA 3GGDA 3PRJA 1NNSA 4O2AA 1UL1X 5SYMA 4EY4A 4ZEMA 2X0KA 1I7NA 1W4LA 1UDRA 3FOFC 1A5TA 4JR2A 4DIMA 4IKEA 4H3VA 1L5GB 1IYZA 3ZIAA 4BTVA 1XZGA 2CJPA 5JAHA 1NG9A 3DUFA 1Q6YA 1GY8A 1JLHA 3F7NA 1J8DA 3KP1A 4RC9A 5JUWA 1EFVA 1CUIA 2G82A 1NXXA 2PFSA 5FQOA 2H3HA 2ZR0A 3RR2A 3TOZA 4NJEA 1SUAA 2IF2A 2Q4EA 4NOJA 1T0JB 1ZK4A 3MWEB 3Q5EA 2AJBA 5JCXA 4UMVA 1WW2A 5F7ZA 3U7IA 2YJ3A 4K9DA 4E5KA 5CBPB 4M22A 5BNTA 4HQFA 1F0KA 4BNIA 4O1IA 2V98A 2GJSA 2PRJA 3JX9A 3L4BC 2CL7X 1NQVA 5FYDA 2PZ8A 2CMFA 2PWBA 2XUZA 2PANA 1BN6A 3Q7IA 4LDJA 2C07A 3T5PA 3CVUA 4OQDA 5TXGA 4NAUA 4CDNA 1HYHA 3R6GA 1GCAA 2VOJA 4PPFA 4RW0A 5DSXA 4ZRNA 3RO7A 4CMJA 5C7LO 4UTNA 3CIOA 4RSGA 4ARCA 2XGMA 4HAYA 5BPFA 2JIDA 2QN7A 3HO6A 1I0LA 1KMMA 2QRMA 4C7OB 4N7JA 2O20A 2GWRA 1E1RA 1HX7A 4DR2B 4QTUB 4OVKA 3VU9B 5B3JA 1TECE 2VJQA 3B1WA 3NPAA 3OZTA 4NATA 4G67A 3I64A 1RM0A 3CRNA 4MJLA 1N2XA 2FYTA 1OKKA 4MTCA 2XKJE 1ILWA 3IQGX 4YAOA 1Z33A 4NS4A 3S6JA 3WFIA 2FR8A 2QRPA 2HWXA 4UASA 3AX6A 1Y1TA 3SJCA 2ZUFA 4J4HA 4U7HA 5C34B 3AW8A 2D13A 1CCWA 3I4FA 4URWR 2ID7A 5CFRA 1Z08A 3EPJA 1CJUC 4MVJM 3FZQA 1I9GA 2BFCA 3KJHA 2J6IA 2ZRIA 3QBVA 4W7SA 2BISA 4ALKA 3MWJA 4OHVA 3R9XB 3N7UA 1LS1A 1B8VA 1JU3A 3THXB 1H1LB 4NCIA 3PGVA 1Z5WA 4OXNA 3JTEA 1U0LA 2WJAA 1Q12A 2W58A 2YN0A 2R4TA 3CQ9A 3HVUA 3PRYA 4IRMA 4MYDA 1NG1A 5ALZA 5I7EA 4FOTA 1E4EA 4EEZA 5M2QA 3RVRA 3L7IA 2Q4RA 1JVNA 4KLNA 1ORVA 1PT5A 2PX0A 3P0EA 3WJAA 1RXEA 2H59A 4XKJA 4Z1MA 4ZCSA 5FR2A 1KNXA 5IEBA 4IV5A 4NDAA 3AKDA 4RADA 1MO3A 4WJKB 3U3MA 4E5PA 3KSRA 4WOBA 1NRXA 2G71A 4D2IA 5JDCA 3PUHA 2CCJA 4UEOA 5GGXA 5CEJA 1XDGA 1Y8RB 1RHKA 1MPXA 2VP6A 4UXHA 3IPAA 1RLOA 4DLUA 4RZSA 1PK7A 1TADA 4DAOA 2HQ1A 3Q8WA 3LPLA 3C70A 2BP7B 3W3AH 3AEKB 1P62B 3ZKWA 4IIHA 5KOHB 3A25A 2Z04A 3BK2A 1U3TA 2DUNA 1L5QA 1UT6A 3E58A 3FB1A 3JQ9A 1QPZA 1WF6A 2YBEA 5ALPA 1UDCA 2PGOA 4WZ6A 3MT8A 4OGFA 4FFWA 3L7CA 1WCYA 5CIWA 5AK5A 1EAYA 3ZZNA 2QM7A 4H27A 3TL2A 3VZCA 2Q28A 5IKEA 2K5UA 4DNQA 1ZW6A 2UVQA 1FP2A 3U4AA 2D2XA 1X14A 2GYYA 3IAFA 3PITA 2DWOA 1UC4B 4GKJB 3B6MA 2HO4A 3ON5A 4ND3A 4R4JA 1D03A 1XZ8A 1YOVA 3RLFA 3F98A 3IP1A 5TNXA 3KZMA 4PNEA 4JB0A 4MUMA 2WWYA 1YQEA 5A0TA 1Z26A 4AYXA 4J6EA 4ARBA 4PGHA 3KJQA 2E48A 1QAMA 2G1AA 4Q82A 2G9VA 4R2WA 2OGWA 4YWJA 2OBNA 1T8UA 1NBME 1VE9A 4B7CA 3A1UA 5B53A 1W85A 2BCEA 5JZVA 1UOQA 1R4NA 4Z9XA 2KBEA 3QOXA 1FQJA 2ES4A 4MVJI 3TZ6A 3B5EA 1Z75A 1NTRA 2Q6OA 3OOYA 4W5HA 1EDDA 1YZGA 2B0CA 3PXAA 3KTAB 4RY9A 1T9GS 2J3LA 4S2UA 3ZDXB 1NMEA 2DQKA 1JWLA 1KEPA 4PW0A 4C7KA 4U7GA 1B8PA 2MR6A 4A2CA 2PA3A 2GM4A 2WU3A 4FMDF 2COUA 3PFFA 4US0R 3TD2A 4DCOA 4M4SA 3OJWA 4HZUA 1V1JA 1F4LA 4MYSA 3MRSA 1LWNA 1ADJA 4MMXB 4S12A 2X86A 3CXRA 1WQ1R 4GDFA 3FUXA 2R97A 1PO7A 5AIAA 2X1HA 4BVGA 1E1CB 1M1NB 1XV5A 1RAIA 2KLBA 3DVQX 3MJEA 3CLTC 3NHBA 3PEEA 4G41A 4IGFA 4LX0A 1TLLA 3VNQA 4LMAA 4IKPA 3CNLA 5CYPA 4LXTA 5C32A 2Y76A 4OJMX 1X8JA 1U0EA 1VXOA 3GVHA 4NP6A 5BUCA 1ZJYA 2IKSA 3N0VA 4YV0A 1FU7A 2YWJA 4JVSB 4CCAA 1OT5A 3F9CA 3KU1A 4X3PA 4ZXPA 2PNJA 1O03A 2G9QA 3KKPA 4HB3A 5KPDA 4US1R 5JQGB 5F1KA 4TSRA 1Z8NA 1V8FA 3AVQA 4R2XA 4CLEA 2PUEA 3FX2A 4WFJA 3OAAA 3WFZA 3UJPA 1NLFA 3W9UA 1TQHA 4LNAA 1MJHA 4WHMA 5L6LB 4O59O 5CTAA 3EIEA 5CDSA 1MO5A 3WNQA 4EO4A 4FPXA 4KXNA 1CR6A 2IS4A 3TCKA 3G5AA 1KRHA 1UEXC 4HLUC 5LYJF 3UPTA 3ZTTA 3UANA 1UODA 2C03A 3KQYA 3N70A 4Y3UA 1AUOA 4ZEWA 4ABYA 5JMWA 1GCOA 3ORSA 1F4VA 4GWGA 4LWQA 4O5AA 2ZIWB 5LUAA 4PN3A 3IB6A 2B94A 2LCFA 4BV9A 3DB2A 3GEMA 3D3NA 1ENZA 3ZBTA 1XA3A 2VBGA 4CF6A 2NZXA 1UT8A 3DCYA 1SVUA 4YGXB 1LBHA 1HQCA 2NW6A 4ND7A 4ASUD 4TLBA 3MT0A 1Q0SA 1QFJA 2PKRA 2CFIA 2ZWAA 4WKOA 2Q7XA 1HDXA 2VR1A 4L5JA 4ZI2A 1FXWF 4W6ZA 2WOJA 1YHZA 4FGJA 3Q0IA 4I1OA 5LKAA 3OC6A 4K87A 2PDAA 8LDHA 5DHTA 3IIEA 3NKFA 3TCXB 3GJ8A 4DMHA 3OZDA 3K0FA 1R10A 1Y7LA 2F00A 4PZEA 2WF8A 5BW6B 3DLIA 1RTKA 4HDKB 4EUFA 4ZHQF 1I7QB 1GVNB 1O6GA 1SWWA 5JNSA 2PLFA 1Z07A 1OBOA 2HA6A 2BGKA 4MPTA 4MUAA 4NZYA 4L9SA 3WLRA 4AJOA 4AI6A 2LKCA 4LHSA 1N9GA 4S1NA 1VMKA 4CHGA 2X0RA 2IHBA 2YNMC 1NX9A 1UJ2A 1BXKA 1ZMOA 1O7JA 2IYNA 1S2OA 2IEGA 3ESBA 3ITKA 1FDUA 4JOSA 1RWKA 3OFSA 2GUGA 3NCHA 4UARA 2G88A 4UCXA 4CU5A 4RL4A 4W9MC 3CEHA 5EHXA 1J20A 1IY2A 1GZUA 1AGYA 5HS6A 5A5EA 2DAPA 2VT3A 1RJ9A 1CJCA 2WAAA 8GPBA 1L1RA 1UKYA 4HWPA 4ZKEA 1CSEE 3BE8A 1HDCA 1OWPA 5EYPA 3W7BA 5K8IA 1U5BA 2A7XA 2GARA 2GF0A 4LDRA 1XQYA 2WA2A 3UHPA 1KYIA 4GI1A 1KAOA 2IT1A 3K9CA 4MGZR 1MX9A 1YKGA 3ONVA 1KOLA 2W2KB 3I9LA 4RNCA 2II6A 2VF8A 3BS4A 1G17A 1VMAA 2E18A 4LGMA 3NOOA 4INOA 2Z2KA 4JA2A 4M54A 1Y8QB 5J5AA 1ZCZA 1MMFB 2HT6A 4U00A 2WTAA 1XPRA 3ICVA 2RKBA 1GT91 4NQZA 3M1AA 5JPDA 1KYZA 4N3AA 2XPCA 3OTIA 4BO5A 3GA5A 2NUPA 5E3IA 1ZMXA 2FPKA 2Q5OA 3QLVC 3ANNA 3L9XA 3RKSA 4B3SB 1LPOA 5F5NA 3OM0A 4NS1A 4YAJA 4HQ6A 3VKWA 1HE1C 1EFRD 1I6LA 1VZ2A 1XFAA 2A1TS 2H1RA 2YHSA 3EJWA 4N5DA 4JSYA 4Y7CA 5J3JA 4Y2YA 4F91B 3QXHA 4PFKA 5FUBA 4MQFA 3TZLA 1E3EA 1ZRHA 2NZ8A 3EVNA 1BX3A 3QEKA 5CT8A 4LE1A 2ZRHA 3IERA 4DGSA 2UVDA 2CF6A 4L8GA 4P4SA 1EM8A 2XMZA 3K9QO 2OOSA 1O95A 2X15A 2HLHA 1OV6A 3MTQA 4KRGA 4RGBA 5CH8A 4E30A 1SFRA 4IMRA 4O2AF 5GIOE 4FDMA 4G97A 3WO0A 1EI9A 1G63A 4FFSA 3ZE2B 1V8OA 2NO4A 1VM6A 4M1QA 3WK5A 5EPOA 3OMXA 2JFNA 1PK8A 2Q27A 2WINI 2ZUEA 4JC0A 4NCXA 1HBJA 4U7JA 2VQ6A 1B2RA 4HEA1 1RWMA 4IL5A 4XUDA 3V34A 2JVJA 3I1FA 3RHFA 1FBTA 1PQYA 5LQSA 3S2SA 3W6PA 3PF9A 1BTOA 1U80A 5DGTA 2NUTA 5SZIA 4IHJA 3V3TA 2PBFA 2GCGA 4BB5A 2P7IA 4A92A 5K3EA 3GVCA 4RK5A 5KNBA 4M0FA 1NMSA 3DM5A 4KQIA 2QUIA 3NIDB 4Y98A 1C9JA 1A5SB 1PVDA 1WMAA 4ZOAA 2FI1A 1HG0A 3HB0A 4BKPA 2PJRA 3ETLA 3G9QA 5DVZA 4RK7A 2YVUA 4KWIA 3WGLA 3ZW9A 2XRMA 4J9UE 4L4RA 4EB3A 3ZDZB 4TQUS 4S05A 2BEVA 4HKTA 3PNKA 3ROKA 5K8VA 1F2UA 2N1MA 3WK9A 3L0ZA 4R5HA 4D4LA 1RLJA 2J4DA 1PSZA 3AI7A 4NCNA 5AT1A 3ZNQA 4WCFB 3LDUA 2VXYA 3Q85A 4M76B 3LUKA 3E2MA 1U8YA 3UB3A 1ZUIA 4DA4A 2JGIA 1B00A 4MOWA 1TK3A 1FUUA 3HDQA 4QICA 4F86A 4FNGA 3OU7A 4LXHA 5KVCA 1PS9A 2FW1A 4U7PB 4AJHA 3ZJTA 3G2IA 3QEMB 3LT5A 3HJAA 2BYTA 2P9QA 1VKHA 3OQNA 1CZUA 3VNAA 3AVOA 4RK6A 2JFOA 4DUPA 3D7KA 4Q3LA 5GVRA 1M7GA 3EXHB 2DUWA 4KYVA 3KPVA 5BSKA 4CJXA 1UWLA 5B1SA 3MMZA 2YS6A 1IRXA 3B8EA 3HKCB 4JLKA 1G4HA 2VUUA 3DT6A 4LMRA 3RC1A 1L8QA 3UJ8A 3KR2A 3D1LA 1KDPA 3JTMA 4YP0A 2RI6A 2EIXA 2F3TA 3PUJA 1HH4A 1VJ5A 2QD5A 3TOCA 4W8GA 3RRYA 3E27A 3TSWA 3EEFA 3IJPA 3WOHA 2I4MA 1P18A 1W75A 5HK9A 2Z83A 4ON9A 3I39X 4NENA 4BFLA 2XUQA 3BFVA 4KR0A 4CIAA 4Q66C 4BWGA 3FKSA 2BUBA 2P7HA 1GSOA 4JQZA 3WA7A 3C3DA 4EK9A 1KZ4A 1UXIA 1B0UA 2FZKA 1X39A 2WTNA 4MQLA 3DKPA 3ROQA 1L5ZA 1V47A 3N2EA 3NCTA 4PPQA 3UPUA 3P2IA 4DR4B 1WDTA 2W4QA 3NDPA 4J8PA 4H77A 3SF8B 1K6JA 1TM3E 1LTQA 3OHMA 1TEVA 1CJVC 3DEZA 2VYFA 3GROA 4LOKA 4ZN6A 1TQDA 3MUFA 5CEFA 3X3HA 4ITVA 3E5HA 1SVSA 1CUCA 1EFUA 1JQLB 2F62A 4JZYA 1Q7CA 2FHPA 4CQMA 4F7WA 2ZIUB 2IPLA 5JATA 4XWWA 3ZU4A 2VYND 3ZHRA 4HN9A 4D8WA 4EI7A 2AKEA 5HXAA 1QVVA 2WWFA 3DYVA 3LBYA 2G8LA 3OLQA 3RTDA 2HRCA 3R7DA 1SXIA 1AKVA 1UKCA 3I5XA 3F5QA 3H8SA 2D6FA 2WOOA 4FYKA 3VPGA 3D1VA 1DRVA 4O08A 3TMYA 1WU7A 3REOA 4QYWA 1F20A 1Q84A 3I76A 2HTFA 2OM2A 3QI2A 1OB2A 5FWNA 1KPHA 1ZD2P 1PEYA 1PS8A 2AF4C 3P0JA 1YDFA 4GEGA 1KARA 2ZPTX 4I8XA 4WADA 1NP3A 4DMLA 4FMPA 1SUWA 3HP1A 4TV8A 1OT3A 1YQ9A 2ZWVA 1B6SA 1F17A 4NI5A 1MAHA 4M0MA 1K98A 4HOYA 4AY6A 2LIPA 1I4EB 2ZYUX 4TXJA 4RTPA 3WLIA 1OBHA 4PAOA 5F7JA 1N6PA 1XCJA 2D1FA 2OO3A 1KEEB 1DKPA 5H8WA 3E22B 4I19A 5IG2A 5U1PA 3NBUA 3N0XA 3PC4A 1GG2A 4JXZA 3AP1A 1VBNA 5EWJB 4LVUA 4URUR 2ZZNA 3PJFA 3HU3A 4DA9A 5B1YA 2JD1A 3QU4A 1HE4A 1ZEMA 2WFLB 4R3NA 1R0WA 2BTQB 5EJAA 1Q19A 1T3HA 1DWQA 1ULUA 3A11A 3CJQA 3M49A 4MV9A 3SNHA 3ZHSA 2ACKA 3UXMA 2VK2A 3KSUA 3UAYA 1VTKA 1ZM9A 4WUTA 5HR5A 3FHOA 3D2BA 4D0GA 1JAZA 5F5XA 3HCDA 2A5FA 2PGAA 2GQ0A 1JQDA 3F46A 4B33A 1YJAA 1DUSA 3TR0A 2VN8A 1SA0B 2HUPA 4HVLA 1XNRB 4I81A 4B3BA 3MHTA 3NPMA 1GPNA 2P8SA 4FFLA 4J91A 3OCXA 5AVVA 2QVGA 1WPXA 2OORA 2WWGA 3AF5A 3SZGA 2ZJ6A 3GJSA 1Z68A 3WQQA 1GPAA 2DHQA 3LZCA 2EX1A 1PFGA 3LX5A 4O3MA 1Z29A 2X0IA 4OX9B 3L6BA 1YQDA 1ID8A 1AHIA 1OLXB 3FHJA 1Z56C 5A6SA 1R2QA 4G6ZA 5E3HA 4RORA 4PHCA 4FZ5A 1BHQ1 2H1HA 3GPBA 3PHJA 4C22A 4JEIA 2FMKA 3LT2A 1V5EA 4BNNA 3P9XA 2TYSB 1ULSA 2JRCA 3A10A 1SC6A 4Q7LA 1PKEA 4MRRA 1NX6A 1EDZA 3TRJA 1KIAA 1W5FA 4K5QA 4AZ0B 1FP1D 1CXZA 4ZVLA 3U7JA 4IGEA 2QTNA 4AMYA 3B7GA 3QBDA 1ZJ4A 1XVIA 1JN0A 3DZDA 3VR5H 5FLXA 1QHFA 4OB6A 3SXUB 3FNGA 1ZEJA 4C4RA 4DMKA 3FRIA 1WHTB 1DBSA 3S81A 3KTOA 4Q19A 2B5OA 1U9JA 3B20A 2Q45A 1OWLA 4MQUA 3AVTA 1FS6A 4IO1A 1XCMA 2Z5VA 5CA0A 1D6MA 2VPZA 2OXEA 4LYFA 4J1TA 3BBPA 4FGZA 4INZA 3D8UA 2VF5X 3B6JA 4YRGA 2JDIA 1X8LA 3NDIA 1RW4A 1U3WA 4MI1A 3O2QB 4EBFA 4LJ4A 4UTVA 4OJQA 4RMNA 3DWIA 3P9CA 3P9QA 5DHQA 4Y1RB 1E3DA 4Y2RA 4B5KA 3GT4A 3TO5A 3SX2A 2WYIA 2XVAA 2Z2IA 3KLMX 4CKWB 4LOJA 1ISIA 4CM9A 4JQSA 2HM7A 3FUTA 3DEFA 1MOZA 3ZWAA 3WKAA 2CYCA 3WWYA 1MGPA 5A7GA 2C4TA 4D3FA 3B6EA 1H2EA 2ZBQA 1HUQA 3G59A 2OD7A 3JRXA 1FL9A 4GU5A 4Q3DA 5IU6A 2I4LA 3OMWA 1RM4A 4IGAA 4ZCTA 1HNZB 3UMMA 3EW9A 1M5RA 3TRIA 4G0NA 2JGMA 4ARAA 1YRWA 3OQMA 2BBWA 2YWEA 3BWDD 3DTVD 2B21A 4JMLA 1TJYA 3EPKA 5FL7A 4P80A 3JD2A 4A26A 1VIAA 2J46A 1RLMA 2ATXA 4MR9B 1E3JA 4A6XA 1OXVA 1OXXK 4RFSA 2JEYA 4I5DA 5JRZA 2EIHA 4OXXA 3UHAA 2XV1A 4D82A 2GBGA 4QGSA 3O8RA 4KN5A 5E1BA 1M1UA 2DH6A 1J8VA 4DZRA 4YA6A 1PR5A 1KY2A 3QBTA 1RPTA 1JJ7A 4HRXA 3UT5B 1KYXA 2YOGA 2ZE6A 3JARA 3D6UA 1ZK1A 3QH4A 2W4IA 5I7VA 4AKIA 2OV4A 5CLQA 1NMYA 2C20A 3BJIC 3DEHA 3OM9A 3ZHYA 5H83A 1HYEA 3CPJB 4E09A 1BYUA 3GLRA 1HFKA 2JW5A 4EYEA 1D0SA 2CWWA 3TAHA 5JZBA 2QTMA 4RLSA 1I5RA 4QOIA 1ZO8A 3OJCA 1CNEA 1X19A 4D02A 2JKVA 2FDCA 1VBKA 3AINA 1QGDA 4ZI7F 1KOJA 5LMCA 3DHVA 1AZTA 4R9VA 5C8XA 1BXRB 1E6EA 1KPGA 1FNSA 3T9EA 4GYJA 4JB2A 5AXBA 4JA0A 1Q11A 4QFBA 5J47A 1RPAA 2NO0A 2PGJA 3I52A 5T8KA 1BCRA 3S2GA 3KLOA 4PZ9A 2EYQA 1E2LA 2AKYA 2PKQP 3RRMA 1PJ4A 3E61A 3THRA 3R7NA 1OYVA 4QJIA 2J32A 1W73A 1X1EA 2I7VA 3MOSA 4Q9KA 2Q2VA 1A4XA 4EHFA 1G7CA 3IO3A 3JSXA 5EL0A 4L28A 2GCOA 1PGJA 3R23A 4X66B 5KYVA 3PF8A 4FP9A 2F3PA 5THXA 1SOVA 5EA2A 2KI5A 4ZHQB 1E6LA 3L7OA 1FNMA 2YXEA 1CF2O 4YYZA 4MHTA 2DU8A 4YACA 2EOAA 1RQPA 5G3YA 3BJZA 4ZYZA 2O3UA 1CUDA 3KKMA 4FDAA 4AJJA 3LLSA 1Y6FA 1S2IA 4PRKA 1RWPA 3ESDA 2QSUA 2CJWA 3HEMA 5FPPA 2PWYA 5BV2P 3LRTA 4E0BA 2WD8A 3FPKA 2V7UA 3T0GA 3EYWA 1P1JA 2YR0A 4RDXA 1H0HA 5J4YA 2KLHA 1Q1BA 3CE6A 3F5SA 4JJFA 2G80A 1K6EA 2EKDA 4U5XA 4F9TA 5J4HA 3R8FA 1FFYA 4KIJA 2VAXA 3MK31 3RIYA 4QE3A 1E3WA 3F6CA 1L4HA 5AJZA 1AXGA 1SVKA 4KDCA 3SU8A 3M6XA 4C1NA 2O8FB 3WK8A 1G5TA 2WSMA 1EGVB 1Q17A 1AZSC 1OFVA 2YHIB 4HQKA 4Q9IA 4Z4HA 2ZJFA 2CL0X 3CGGA 2PSEA 3OCCA 4R7GA 4EPRA 1UKEA 2C7GA 4YMGA 4DWWA 1HORA 2NXJA 3ED5A 2X3YA 1PR9A 5I9TA 1ZQ1A 3KX2A 3U3XA 1TEZA 4BMVA 4RHCA 3B1KA 1SU7A 3O8QA 5HE9A 3N75A 4A5SA 5CFQA 1MFZA 4LW8A 4MVJE 4WXPA 1MO6A 5B6IA 4LXQA 5DBHX 2DKOA 3UFBA 2OGSA 4OUKX 4LK2A 1C0EA 1DAEA 1JEOA 1P81A 1FVXA 3MB8A 4MAMA 1XOIA 3HRKA 4AN1A 1OWNA 2GAAA 4LZZA 3RG8A 3W2FA 4MNTA 5JYBA 1TO2E 2CUNA 2C9OA 3FCUB 3MWGA 1JEYA 4EYKA 5K3FB 3F90A 3BSFA 1JDUA 1RBZA 3K70D 1JA1A 1JG3A 1SH7A 4CLRB 4ZYVA 2YWRA 4U0JA 5ICMA 3UV6A 1EGMB 4M0CA 1Z25A 1UIMA 3SQMA 1DWOA 2HHJA 1USKA 1X9GA 3QVXA 4JVOA 4WWHA 3V80A 4MS4B 2BHRA 4XW2A 1ZAYA 2KYRA 1QLJA 1HSOA 5IM4A 5AH0A 1IXKA 1G2OA 1V9LA 1ZCBA 1EINA 3QEAZ 1NBMD 4UVEA 2A5JA 2WVJA 1NBWB 4EHLA 4O4JF 2XUAA 1CQIB 3D8NA 1E2FA 3QVGB 1F38A 5C5DA 1NLUA 4H4CA 5AHXA 4CFYA 5KYYB 3W78A 2WILA 3ZV7A 4XIYA 4DIKA 3OFND 3GJRA 3OD1A 1XWIA 3LA6A 4RFVA 4LRTB 3SQDA 1HG1A 3NAZA 2PQMA 4GUAA 3FYUC 4IEFB 3R3VA 4OHOA 2I7DA 1XA4A 3AFIA 3LQ4A 3WWCA 4JBIA 3BILA 3HNRA 4HX9A 3I45A 4PRZA 4CG3A 3TX2A 2PUCA 4RIGA 2QYTA 4A27A 1HO3A 1GGNA 1Q1ZA 2NVBA 3U17A 3P5BA 5BWMA 1UBMS 2HV8A 2P8JA 6AT1A 4QXOA 1V16A 4WINA 2AG5A 4W5TA 3ICOA 1AQIA 4P22A 5FR1A 4Q4HB 1CR2A 1SCUA 3U44A 3NFRA 3C7AA 4LQLA 4TUYA 1X9HA 2OFOA 3RIGA 3V1UA 2FFHA 4CKXA 1GRRA 4FN5A 4UTPA 4UOZA 2GJ8A 3SFZA 4XA8A 2OLKA 2O5EA 2P2DA 2A9QA 2WG1A 3HDGA 4RDCA 4KWCA 1KFKB 2P62A 2VRCD 4B2PA 2ZBVA 2B30A 4GOMD 3TEMA 2X6RA 2Y0EA 1CR1A 1VRCA 2EJCA 2CHUA 3B2EA 3GUVA 1EB9A 3PFGA 3V8NA 1C7FA 4I55A 5FULA 2RGYA 2XQIA 1NOKA 3WHPA 3BVPA 4GGOA 1IEQA 4IINA 5LB4A 2OWDA 3M4NA 1TOAA 1M0EA 1C5KA 4GSLA 4OOFA 9ATCA 4YHBA 3OFVA 3L1IA 2X41A 3FFBA 2IYOA 1RRMA 1H8HD 1Y6JA 2A2ZA 2W2LD 3GT3A 1PGNA 3I9FA 1PUXA 4YJHB 3A1WA 4IHAA 2VUSA 4PCLA 1YBHA 3LG2A 3CZCA 1DQRA 1KFEB 4KQJA 1KY4A 2PMKA 3ZD6A 1PSWA 3REQA 1JKIA 1O58A 1GPJA 5IVKA 1G5IA 1Y7PA 1XDDA 3HVIA 3A26A 3M1IA 4HADA 3BRQA 1YJXA 1XD2B 5HJ2A 3HGQA 2GSWA 2HIAA 4QUAA 3ZDFA 2DX7A 2IPOA 4NPCA 1KETA 2FW7A 4KSBA 1Q44A 5JMPA 1XTKA 2DC1A 3N2LA 2Z2XA 1DC8A 1IOWA 2ZYSA 1B26A 1MNAA 2GH1A 3DO6A 3IHWA 3LY8A 1O4WA 3QVWA 3E1KA 4PPNA 1YL7A 1MEOA 2IITA 4PQFA 2XT0A 5DBEX 1V5GA 1D4OA 2YV4A 1J2UA 2F64A 2YX1A 3OIFA 3ZYCA 4MKRA 1L5MA 4LBYA 1AJEA 1IE3A 1Z83A 3OBIA 4Q3BA 4ZTBA 1TD9A 4BVKA 1BH6A 3KG2A 2EARA 2FPXA 4B48A 4KU4A 3N8GA 2Q8QA 2F8TA 1RWQA 2FUKA 5KSYA 4JJZA 2YDYA 1EK5A 3DZJA 4YT5A 1OOEA 2E3JA 3RSCA 3S55A 4A03A 4UFPA 4L8VA 1CRWG 3MYYA 4N7MA 4IW3B 3CH4B 2HD4A 2GUWA 1HYQA 1N25A 2AFIB 2RIRA 3MJFA 3UV3A 3PLAE 2WV9A 2MSLA 3EK2A 2O8DA 1T9ZA 5IH7A 2BJWA 3MAJA 2D0OB 4ZK6A 4G1BA 5CA0F 4DRZA 3L40A 1XYYA 1MIHA 3ROZA 2P1DA 1BJRE 1WSWA 2ZRLA 3OM1A 1GDDA 1ECFA 5FHRA 4EABA 1OA1A 1YXMA 4HJRA 5LIRA 4LXUA 4M1EA 5DI3B 3RRBA 2DBRA 2Z2ZA 4V0RA 3N3AC 1E66A 4DN6A 3HRIA 4PYQA 4JC8A 4BKUA 3JWIA 4MUFA 3G8YA 3M5PA 2Z9BA 5EJ2A 2EZ8A 5K99A 1EVYA 4GQIA 4GKVA 1DDOA 1LSOA 3GLGA 1M0SA 1PFKA 2UYGA 2C5HA 4H18A 4I50A 3TI7A 2FZCA 2Q62A 4E5SA 2O3RA 1O96B 2O7SA 3RS7A 4QLBA 1QK3A 2Q9BA 3ZUGA 3CUEF 1ONSA 4IH1A 3ZY2A 4BYGA 2XCTB 3HB4X 5GZ6A 3C4VA 4E07A 3VPHA 3O03A 3N8IA 4RPCA 2WJYA 2WBLC 2LV8A 4Y1GA 1QCDA 4BKRA 3BH0A 4KP7A 2C95A 1IY0A 3L92A 4GR9A 3RS8A 3DO8A 1KK0A 1NSTA 1X1TA 3UAVA 3OLXA 3LNTA 1QHHB 1X74A 1VXRA 2ZANA 4PRLA 5ARCA 3UMGA 3K8ZA 1NNEA 1MQ8B 1SNYA 1DCMA 3S27A 1U6JA 4FGLA 4I5EA 5AI0A 4OJTA 2HSJA 2VHEA 3UWSA 1SUCA 6PFKA 4L6IA 1KP2A 3N58A 3PQFA 1VDMA 3HPQA 2W93A 4R0NA 1C3EA 1GPLA 3MRXA 3ZWKA 2IGBA 4HL6A 4LYEA 4DLSA 1WZNA 1UMCA 5KHLB 4Z4FA 1P8JA 4PAWA 2C9YA 4RACA 1OREA 2OM6A 3B3QA 5E9WA 1ZM2A 1MZPA 3NNDA 2O52A 4REQB 3U3DA 4B80A 1MLDA 5JAPA 3KQMA 2IJGX 1LPPA 4P3OA 1R27A 4WT7A 4ZODA 2H1OA 2G04A 1BX0A 4BMSA 3QYFA 4R2HA 3ISVA 4ED9A 1AO3A 1N2CE 1NL3A 3Q98A 4BFWA 4F2WA 4IV8A 5FPQA 1E79A 1SD1A 4NZZA 4FOOA 2D5LA 1B0ZA 1GA4A 3HCCA 2FEXA 2GN4A 1ZUNA 3PI6A 1UOPA 1PF7E 1TVKA 1VLLA 3KT0A 3L49A 4LZPA 1W1IA 2OUKA 1TNDA 1DG1G 2FFQA 3WYCA 1LPAB 1SQ6A 1US8B 1M2EA 1G3IA 5EWLA 2WTBA 1PD0A 4NC9A 1TCCA 1IY1A 5CG2A 3AR6A 4KTTE 2H4FA 3H5OA 4B6QA 1KI4A 1CYDA 1ZL2A 4EBBA 3VSBA 5B7NA 1FQKA 4IZHA 4AAYA 5HUQA 4KVFA 5HJEA 1L9KA 1KO5A 3GGOA 4KDRA 4BAUA 4ER5A 1YE8A 3O4HA 4MI9A 3QYAA 5K4HA 1SVMA 1HDOA 3DL4A 1UQRA 4Q3OA 3WGMA 1AUXA 1YNOA 1M2VA 1AVTA 5H7XA 4IUCS 3I0NA 4ETNA 1K63A 3HN7A 5HBGA 2C04A 2H9AA 2FFJA 3A4VA 4LJ6A 4NARA 3V2HA 4DT1A 4EGCB 4NOKA 3DDWA 2MJLA 3CCFA 3KXPA 2C4KA 3LUAA 4FR5A 4JLNA 5CAEB 1OPRA 3LHIA 4CM5A 4D74A 3RHSA 1YFJA 1XZHA 1UEIA 5C3UA 1BCSB 2Z8XA 3RTAA 2Q6VA 3E7WA 5JSFA 2PMWB 1XXHB 2OAQ1 2XF2A 4F5YA 3C85A 1IJEA 1JQAA 3HFRA 5AHKA 1KBQA 4OPMA 4AJ4A 4AWXA 4IIYA 5K3AA 4RZQA 3V2UA 3VAYA 4A82A 1T5TA 3A1VA 4DDMA 5A1JA 5K2OA 2G1PA 3D0QA 3EDRA 5IF3A 2ZJ1A 5JALA 1F2DA 3ONEA 4KVZA 5K0EA 2X8JB 4JH0A 1SCAA 3PYMA 3D3KA 2EG9A 4M7WA 1KFCB 3MVEA 4WKBA 4QAQA 16PKA 2CV1A 5DB4A 4QTZA 2P9HA 1HLPA 1IHUA 5FUVA 5DM2A 4MZDA 3IEPA 1YA6A 1DS6A 4LWOA 5BRNA 2YNMA 4D9KA 1OGJA 2VQSA 1E4YA 2XDAA 2IF0A 1G3QA 3ITNA 2PMDA 3N39C 4RIHA 4CKEB 1UFVA 1VYTA 2VYVA 4S04A 1P45A 1Q0UA 2O8CA 2ORED 2JHPA 4M9UA 3SN6A 4XDHA 1M8PA 1IONA 2P5UA 1JNYA 3KV3O 4KXXA 4M21A 4B4DA 3F73A 1QP4A 2I99A 3U1VA 1KYTA 4LUCA 5E7MA 1ZQ9A 2SKDA 4GQBA 1FX0B 1GUYA 3PD1A 1Z7BA 4MJXA 2XJ4A 3FNHA 2PWPA 1XP5A 3PHBE 5C51B 2PZGA 1PTKA 1R4MB 1MC1A 2OGUA 3HZHA 4HWKA 4N5LA 4R9UC 3ONDA 4W1RA 1W29A 1XVTA 3IAM1 4BUJA 3ROPA 2BF7A 1THGA 3H05A 3K9GA 1M6EX 3W06A 3MEQA 4UZSA 4X95A 5LP6B 5IM4F 5CCXA 1GJRA 2G9NA 2YN4A 2C5GA 5EXEA 5TVGA 1PT9A 1QH8A 3M6FA 3RABA 1XWFA 4X1IA 5DNWA 5D00A 2AG0A 2AMVA 2ZWPA 3I34X 3OO1A 4FHCA 1W76A 4WBXC 4PHGA 3UCFA 1A9SA 1TIBA 2DH5A 3O4FA 2DWCA 3O7WA 4CEHA 1ULBA 2NAFA 1MOPA 2R8ZA 4Y67A 1GARA 4BMOB 1XEXA 4D9HA 3K4HA 5AUNB 1F5NA 1KI6A 4P8RA 1GL7A 1FTWA 3D0KA 3TQCA 4B6OA 4EOGA 3I72A 1QQ6A 4EW2A 4KXWA 2FZGA 2O0HA 1WXIA 2X9GA 4L07A 5DOZA 1A9RA 4FVTA 4OHPA 4H7PA 4BB0A 3EVBA 4H16A 3CF0A 3GH3A 4RCYA 4AS2A 4ZV4A 4YMTA 4MUXA 1IUNA 4EATA 4MQMA 4A6PA 3EA0A 1ML4A 3LV8A 4ZQEA 4FNOA 1L3IA 4ARSA 4F8EA 4QDUA 2HLDA 2VFAA 1IAQA 3N3BC 5CHEA 3OLVA 3Q2KA 4ME6A 3U4MA 5DGCA 4P83A 3AIOA 4TUYF 4B1FA 2QRQA 4EKEA 1Z17A 5HVNA 1H6BA 1M2NA 1A8SA 3GFRA 5LOVB 3RBVA 1QHXA 2QX8A 3DZCA 4C7BA 3SQXA 5HRUA 4RJIA 1JVBA 1UANA 1AK2A 1PL6A 2FKAA 2J08A 3B48A 2QM3A 1Y1KE 2IU0A 4GM1A 4XJXA 4EW1A 2VP3A 4DLLA 1OZHA 4MYRA 2XYVA 3IJ5A 4RYDA 3OEED 2FOLA 4GWKA 1V3TA 2FV8A 4L72A 4RIIA 5TX7A 3CGWA 4HUQB 4W1SA 3VNBA 4K9PA 1QYIA 4GZ6A 1VHQA 3FN4A 5LQKA 5D5PA 5IDWA 4E33A 5HP4A 1KAHA 2P2ZA 3EAFA 4LDZA 1H4SA 3AQ4A 1Y8ZA 1QM5A 1G55A 4MYCA 1MQ9A 4RA6B 1WBJB 2O2ZA 4Q3CA 3SYNA 3H5VA 2VSYA 4MROA 1YMUA 2HMSA 2CHFA 3OZXA 3QOYA 4LGVA 4XQGA 3WYAA 4XVUA 4KV7A 3KAJA 3KEGA 1A2QA 1WM1A 1TI7A 2P9JA 4B7UA 2Q5CA 2EQBA 3MQFA 3K1AB 2GPAA 2Z4SA 1CB7A 4MR7A 3MELA 2FSGA 1ZVMA 1HTBA 1HDYA 4AJ1A 5EIEA 3IV9A 3GBVA 5IT4A 3H9EO 2DJIA 1DBIA 3QVSA 3TLJA 5JXWA 5JO9A 5JZSA 2JIPA 1CJMA 4ACBA 4R2KA 1M10A 3ESAA 2WYOA 3KWLA 2ZETA 2PSDA 3U5ZB 1RWVA 5ICFA 5CH3A 2JI4A 2ZEJA 4JWKA 4OXQA 2H1CA 3H99A 4K9SA 2FDXA 4P08A 3X43A 2ZI9A 4ND2A 4KREA 3W5HA 4C30A 5BYAA 3DBRA 3W34A 3AHDA 3H7IA 4ZT7A 3WA6A 1YC2A 2GN2A 5B4TA 2ZSAA 1JALA 1O5TA 2VJDA 4H6WA 4N0MA 4A8JA 3H65A 5DOVA 5I3CA 4BTEA 4WGGA 4F0JA 1C1DA 1WY5A 1Q15A 2G28A 4MRNA 4DRXB 2BELA 1CJKC 3KRTA 4Y2SA 1D4AA 2G4LA 4GPBA 3QENA 5B58C 1L4KA 1UQTA 2VSOA 4H1UA 4MB0A 4BMNA 2NMVA 1IULA 2CK3D 1L1QA 2GDZA 5GVSA 3EG9B 3R9IA 1GKKA 1K5HA 1EP1B 3KO8A 4DSAA 4D3DA 4QDZA 4XQEA 4EKNB 4XEHA 1A2BA 4CT5A 1EE9A 3ZBUA 5E6SB 4N0QA 2HQRA 1YZNA 4U7TB 1INLA 1YVPA 3TS1A 3RRZA 2F48A 4JWTA 2HQSA 5JG7A 3ZXYA 4LTNA 1UXGA 3UOWA 3IT3A 2B61A 2F43A 3ZWYA 5IZCC 1V5FA 4YP1A 1NZDA 3ID6C 1UPUA 3H4MA 3N2KA 2WIAA 4L5IA 2NVOA 3KKOA 4QPJC 1R0XA 3E7DA 3K30A 4CKCA 2QM8A 2B1IA 3NB0A 3UKOA 4FDUA 1SQFA 1BW9A 2RK3A 1VBFA 4JLBA 4XJVA 5GY7A 4C6TB 1RJWA 4PO8A 3ZDDA 1NOJA 1GUFA 2BM9A 1Z7EA 3DDCA 3PQ4A 3PQ5A 3UOGA 4ZOQI 3P71T 3L6OO 1X42A 3CC8A 4PXAA 3PUKA 2C9MA 2PZMA 3QGMA 3A9SA 1JXMA 1WV1A 2X58A 3SMVA 3PENA 4R6WA 5CDFA 2HJSA 2D0DA 3IUJA 2OYRA 1BQ3A 2WSSA 3V2IA 4F6RA 3GPLA 4AQ7A 5E3JA 5EKXA 3FPGA 3V4VB 1H3FA 2JGDA 4I1UA 3D4IA 4FKMA 2WE8A 1FDVA 3I9V6 5KNCA 3G8BA 3GT7A 2DXIA 1XPUA 2JA1A 1HE8B 2P0EA 2IYAA 3WRYA 2COEA 2AN1A 5E2IA 3KOUA 2VG8A 2X5JO 2JBAA 4TLCA 4D3ZA 3SVZA 2I5PO 5LDDC 1XCBA 4N8SA 3OKPA 3LNCA 1XP8A 3PZRA 5AK0A 5B58T 1E5LA 3GLSA 3MMPA 1J2RA 4LJYA 4N3GA 4ENPA 1TKBA 5B1IA 3H5WA 4KZPA 3RUCA 2JAXA 4BNMA 3NHYA 4YJ3A 4LOLA 5DLPA 5KREA 5CB4F 3MMSA 1AUQA 3A37A 1HMPA 3Q7TA 1ELOA 3PBKA 1MVOA 1IPFA 1K2VN 3U4QB 3JASA 4OMFG 3X2FA 5IC6A 4CETA 1VE6A 4QUGA 3F8TA 2N9UA 5LU8A 4HN4B 5G40A 3C24A 3GPCA 1ZJZA 1F14A 4HN2A 5KJEA 4EG0A 5CJPA 4QGAA 3URMA 4BLWA 2FB9A 3ADCA 1E6WA 5CUQA 2X8BA 3COWA 4MITA 4QHSA 2GPBA 2W2PA 3EHDA 4EO7A 4JBNA 2RAPA 1AKMA 4O4HA 5K3BA 2VHCA 4JI2B 2XBMA 3LQKA 1M7BA 5DISB 4MAFA 5EPEA 5B2ZA 2HSDA 2IW3A 2RARA 1XL0A 3UICA 4HXGA 1BE8A 4IYRA 1II8A 1C8VB 2MCFA 1MFPA 5F9FA 4F3YA 3DDSA 1C3XA 1HYGA 3DBIA 3UMFA 3EZGA 2HTEA 4HP8A 1VJDA 1KOGA 4BAZA 4NMWA 1UXJA 1KKMA 2A4MA 5HKOA 2PVPA 1OZAA 2FPLA 3E8XA 2JL1A 1KFJB 4RZUA 1VYVA 4FILA 3AY0A 4GPIB 4EO9A 2FSUA 4J0HA 3L04A 3CO5A 1BU8A 3MPUA 3S2ZA 5AW5A 5F2OA 3EGCA 1ML3A 2FPPB 4NK4A 4A8TA 1YR1A 3BTOA 5L7YA 2Q3CA 1YAJA 1CEXA 2QZ9A 1N2ZA 2W6JD 5F76A 2CCGA 4QUEA 3CSDA 3I62A 4GICA 4KXMA 4YLGA 5K3SA 4X94A 1N0VC 2COKA 3RBXA 3C98A 5FL3A 3RWMB 3UMYA 1P4RA 4PO1A 2CBXA 4GRAA 3U56A 4TV9A 4DLPA 3AT1A 2ECKA 2ZSFA 3UJ7A 1XEFA 1JG6A 5FHQA 3VH1A 3Q8KA 3C15C 2CUZA 2MYTA 3K31A 1E1QD 1BMFA 3O8OB 1OFIA 3KVOA 1P80A 4MYUA 1G20B 1ODIA 1ZI9A 2WIDA 3CH6A 4UBNA 4DLNA 4EI9A 5AVKA 2QVCA 1KA9H 3LOUA 3IXMA 3W8DA 3FXAA 1JR6A 4KX3A 2W6IA 3PCXA 2UZ3A 4KO4S 4C0JA 4L5YA 2WEKA 2CVHA 4YIKA 1X92A 2VLIA 3EEYA 4DLKA 3EPHA 2X7JA 3AFNA 1UMBA 2FFRA 3D7LA 2IS2A 5ED4A 1QB8A 3KDAA 1OIVA 4UNRA 4ZT3A 4ER3A 3G85A 2FX3A 3IKJA 2HRRA 2QN2A 1KF0A 1C8BA 1SHUX 2AZDA 2GZ1A 3L0CA 4GQAA 4H6XA 4XX0A 3M5DA 2HHCA 4E5VA 2GLUA 4KR6A 1PG0A 3K16A 2VNJA 3EFEA 1OIWA 1V71A 3ICEA 5DHPA 4K8RB 4ZAVA 1VHLA 4MKXA 4R40A 2PMFA 2QMZA 4DJTA 3IPRA 3PRHA 3SZRA 1O3YA 2OTCA 3QA9A 3LUJA 2P1ZA 5MGNA 3IQHX 1A4IA 3DSRA 4JI8B 1CIVA 1N7GA 1OXSC 3I2GA 4ZC1A 2JANA 3BZBA 4YT4A 1TT5A 5AK4A 4KRXA 4X90A 1U5AA 1ULHA 4J3NA 1QGUA 5H82A 5A6VA 3VKHA 2WWXA 4M9ZA 1ACMA 4ZCRA 1U11A 4P4TA 1SXJA 4EPVA 3R0QA 2X2FA 1VBMA 3ZIDA 1UZUA 3KCNA 1C9DB 1OXUA 3DAOA 2ZRKA 4QSHA 3NAQA 5LQUA 2D54A 2FX5A 3K0AB 3R7WA 1T26A 4MEAA 2RCNA 3RROA 1ZSVA 2X0NA 4ZYWA 4IJ6A 4KMSA 3RGWS 1WXDA 1X7YA 1K6IA 3HY3A 3SFTA 3L7BA 4AJNA 4ZK2A 5F7OA 2BRUA 2HW8A 1HRKA 3O9MA 3K6SA 4CL0A 2C2XA 5JAQA 2ODWA 5I8PA 4ESOA 2O2JA 4PZ0A 4N40A 2WJVA 2I4NA 3E8SA 1WZEA 1UBLS 3TXXA 1TK2A 1VG9B 4DDHA 4X7PA 4G1FA 2FTKE 4DZTA 1FUYB 1R66A 3WHLA 3VGJA 3F7OA 4QXQA 4YJDA 4N48A 4LY3A 4GSKA 5EIAA 4DV6B 1U1EA 1V2GA 2NU8B 3C6MA 2Q07A 1OIXA 1VGVA 4BN5A 2R00A 4MQ6A 2QRUA 1PZGA 1ZJWA 2EHJA 5KC9A 4D4IA 1BVYF 3TZCA 1WWKA 1R0LA 2IUTA 2C5EA 2BUCA 2L82A 4RPGA 1EXVA 1H2RS 3GCZA 1U2DA 1UK9A 2QSJA 3L02A 4QQRA 1P0IA 2X42A 2R6R1 3DOCA 3QKWA 4N5HX 4PTLA 1P7CA 3ECCA 5EHZA 2JEOA 4BE4A 2H5JA 5ITSA 1U2PA 4KR2A 1M6VA 3IQWA 2VHYA 3EZYA 3DFIA 1EJ0A 4JCOA 1QWOA 2D0IA 1NVEA 4ILEA 3VV3A 3LPMA 4R8KA 3ZGXA 2DPMA 1XEWY 1X7GA 3T9FA 1VIDA 5SZJA 4UQLA 4UPEA 1ZNZA 2DUUA 4BNFA 2JCVA 2Y2UA 1H2AS 2YFYA 4FINA 1OA0A 2AN5A 5K01A 1R6UA 4P4UA 5I7AA 2A35A 5EIFA 4F1JA 3HDHA 1S2MA 2XITA 4ZFNA 1RP1A 4J7XA 2FP4A 4FZRA 1JFVA 1KDOA 2LP4Y 1DOHA 5CR9A 1MT3A 2WUWE 3UFXB 2CD7A 4BVFA 1ADFA 4XGIA 4BRSA 4D0NA 3EPLA 1IBSA 4YRFA 2BOVA 4JY7A 1CUYA 2QUKA 4B4WA 2Q50A 1CERA 4G4SO 3OIVA 1ZU4A 1X2EA 3FDJA 5TPZA 1RXVA 3EXEA 1H42A 3SHQA 2FWPA 1DJOA 3OFJA 2UU9B 4S1TA 3MJVA 1VFPA 2R68A 4MGIR 3T7SA 1ZOPA 3JD4A 4QATA 1SKYB 4DPLA 1XMOB 3E9YA 1YO6A 2I9KA 1WXWA 1P7YA 1G66A 3E9QA 4EGSA 4YI3A 1WUYA 4O4LA 2XUDA 3Q9SA 1LSUA 2F9FA 3IEXA 3GARA 2FSFA 2ILVA 2OO5A 2V5AA 1OILA 2YIVX 4Q3EA 3T5BA 3ZUPA 2WTEA 4DXHA 1BQ4A 5EXTA 1IN4A 3SKVA 2IU4A 2Y2VA 5TPWA 1E5DA 2JRLA 4RJLA 3U9LA 3QEJA 3FUUA 4Z51A 4ESEA 2JFZA 5EUBA 2JGRA 4CXMA 1OZGA 3VZSA 1U2GC 5FJJA 1UDBA 3C6KA 3AEYA 4NECA 3HLTA 1U0OC 3IBSA 4TWRA 3WMEA 3KB6A 1D2NA 1AMNA 2VDWA 3NVAA 4GD3Q 1Z6XA 1P5FA 5C35A 4UHCA 1BMQA 4E70A 2OGZA 3SWWA 2WHEA 4D9EA 3G1WA 5A3VA 3IT1A 2ZUSA 3K0KA 2VSQA 5AVTA 3I3OA 3ZU5A 2FAXA 4M7OA 1SK9A 4JLUA 4H7DA 2VPYA 4FU0A 1Z47A 4IG9A 2AG1A 4CCYB 3PWSA 2CLHB 2MMCA 3B9PA 2XOEA 2H2HA 3T4UA 3JAWA 3GY0A 4GVXA 4X1YA 3DG9A 2A86A 1EGQA 3KIPA 3K94A 4R2IA 1PUIA 4KQCA 3ECAA 5BURA 2QI9C 2ZTSA 4GMHA 3RJZA 3HNPA 3BXFA 3V5NA 3ZGYA 2BKEA 4XGNA 3UPDA 1YRHA 1W2HA 2P65A 3BHNA 4TKMA 4AMUA 1AMUA 4PG7A 5CD1A 3B9QA 5F7XA 1AG9A 3WMGA 1G6KA 4MW7A 3F4BA 3FYUA 1FFHA 1VCIA 2ENWA 2GZ3A 3BMNB 3BICA 2NU6B 1VECA 3ELDA 3GDHA 3GUCA 5FF9A 4M0UA 3TPZA 3D0RA 2FEAA 2D06A 3PHLA 1Y6ZA 1L8XA 1GG5A 2GO7A 2WIBA 3LK7A 2PL5A 4AKEA 3AFOA 4F2PA 1ZVQA 4EGAA 3GRKA 2P6RA 5EWMB 2VRNA 1TM5E 2A14A 3FOCA 5CNJA 1AU9A 4B9AA 3ZWNA 4YB8A 3Q2IA 5B57C 3RSHA 2EX0A 3AY6A 3K92A 5JNVA 1DTEA 1GNSA 2QTTA 3Q1KA 1H05A 1SCIA 5E6UB 5I3ZA 4NYJR 4X1KB 1RI3A 4BNLA 5I47A 1OVMA 1ZCFA 3C5EA 4HGOA 1EVLA 4JB8A 5C7IO 3CEAA 3IESA 3FRJA 4OXRA 4E4YA 3NEPX 5LQDA 5LXTA 3MSXA 3QFHA 2GAIA 3AV3A 2XDQA 2FVXA 2R1TB 2MYPA 3BDVA 3C7TA 4F56A 4XYMA 4AZVA 2RGRA 1V25A 4R1QA 5ALDA 1FSGA 2ZIEA 3M4ZA 4BPRA 1T2AA 3A06A 3OZFA 2ZXUA 2CMHA 3KB2A 3KEQA 3C3JA 3G79A 4YXFA 3CVXA 5HNKA 2A0FA 1IQ0A 3ICCA 1NF2A 1FVFA 1G8FA 3M5WA 4MQ5A 3TH5A 1EQUA 3ZD8A 2A30A 3AERB 1ABEA 3ZQJA 1U7HA 1Z0ZA 1ODCA 1TB4A 2O7NA 4K86A 2TMDA 1H9BA 1AGNA 1BU5A 1R3DA 1MZVA 3BRWD 3ZNOA 4Z6KA 1YIDA 4DWVA 3R6TA 2B6NA 4MWBA 5FRDA 4YAKA 8AT1A 5M29A 5JSHA 3VGPA 3AL0C 4K8OA 1D1SA 2F9LA 2XHEA 2NV0A 3RJMA 2P4SA 4HWGA 3SIXA 4DDTA 5FUYA 4BCCA 4U6NA 1VFNA 4DR5B 3F5DA 1KI8A 3LH5A 4Z7QB 3LLUA 5DTJA 4NH4A 3PJRA 2BHNA 3GEPA 3U13A 3ZQ6A 2P9BA 4QVIA 3G7SA 5KJFA 3AEXA 2R48A 2PUHA 3BZWA 1BKYA 1Z18A 1JLRA 1LDBA 3V7NA 4XOUA 2WLTA 5ITZA 2HA7A 4ALNA 2YS7A 4HRVA 3F67A 5JSQA 3AQIA 1JR3E 4D3XA 1GFZA 4MWTA 4QYTA 1HYBA 2XNDA 4TTVA 5JEEA 1WB5A 5CDGA 2WIFA 4KJXA 5FNZA 2BC9A 5AVQA 3A31A 4NBNA 4DIBA 6YASA 4HWSA 3H2IA 3JQAA 4N3BA 3EFOB 1R6XA 3CBQA 3PCRB 5AW1A 1CQZA 1DJLA 1FNDA 3KEOA 1IOVA 3H86A 2C3MA 4EA8A 1GG8A 1P4JA 1VJGA 3ZK9A 3Q3EA 1ADBA 2LR0A 3BIFA 4IZIA 4QQ8A 1MV8A 2PTHA 1IBLB 5HM8A 3THYA 4G0WA 2EF1A 3OJLA 3U4CA 5HUHA 1KEZA 2YYAA 4MIKA 4PFSA 3LU1A 5I8WA 4ROTA 3PEVA 3VH2A 3QOFA 1LWOA 2XYHA 4IRXA 5L45A 1GCIA 1KHHA 5F2KA 2VBFA 4G5QA 4IIJA 4LKRA 3WQBA 3PEYA 3ZH2A 3GRCA 3RVNA 3EUFA 5LBUA 3G9UA 4GLOA 4DNOA 5C7OO 4FE3A 2Y1FA 3HP7A 2PG3A 3ANXA 1DC7A 4DPKA 1M73E 1LLQA 1MP0A 4BE7B 1WU8A 2CJFA 4TWZA 4OI1A 3BKXA 3BORA 4D9NA 3BXOA 3LUBA 4NJEB 3WIEA 2WHQA 4BFUA 1M34A 2FUNB 1HURA 4O2RA 3FYDA 4QUIA 4UNIA 4B8ZA 2Q0QA 1S9HA 5EI5A 3AOGA 3JWHA 4WDQA 3TNLA 1N2BA 5JYDA 1TJ5A 3LL4A 4MQBA 1WSBA 3VNUA 4DJFC 2AK2A 3H6HA 1B6TA 1WXFA 1V1RA 3ET4A 3ROEA 1SBIA 4M8KA 1EVQA 3CCBA 4AUEA 4FGUA 1A3CA 3B3GA 4UD2A 4E2ZA 4W1QA 3WNZA 4G0QA 1RKXA 1R9NA 1HZZA 3U40A 2I6XA 3W5DA 4BX2A 3F96A 4KGDA 1E98A 1W4RA 1Z0AA 2GPTA 1OLSB 3F6EX 1MX3A 3WL5A 5FNVA 1IHYA 1XMSA 3DWFA 1TRKA 2JI7A 4O33A 3R3XA 4BY9E 5SY6A 5L7TA 5CLFA 5ADHA 2OD9A 2X5NA 3M82A 4MMZB 3O2SB 1KBZA 2AKAB 1YS9A 4OK5A 2VHUA 4DCMA 5L8VA 3IO5A 3NS7A 3SCZA 1F2TA 4PLFA 1Z62A 5BWNA 1X0VA 4DR6B 1IBCA 5JISA 2R6ZA 4ZCIA 2PL3A 2R7KA 5IAKA 2YDXA 1X1BA 5L3SA 3FY4A 4IXNA 2JFWA 2O48X 4WE3A 2X0DA 3V4LA 4A8HA 5JV5A 3IHTA 4ZQIA 3HI4A 1M2FA 1R9JA 2A0UA 3KETA 1QYRA 1JIKA 5CT5A 3GP3A 3QUCA 1GKUB 5TQ0B 2WJ6A 3WMRA 2BFCB 2A0YA 3OESA 4HNUA 3AETB 1NBEA 4FCCA 2WJ3A 2X40A 3AF4A 1FZQA 3SD7A 2WF9A 2QJWA 3H9UA 3DLCA 3UJAA 1T3SA 2M98A 2W7TA 1VKRA 5G4KB 1AKTA 2XTNA 2H4JA 2QX4A 5K6AC 1BS2A 1NJFA 1RQ2A 3OCYA 1G41A 1FRNA 1E2HA 3MWDA 4BC0A 1QRSA 1BWSA 1YZHA 1FNNA 3L4SO 2EBWA 4Y6GB 4BZPA 3BGWA 1X3SA 2R1ZA 1YL6A 2XX3A 3L8DA 4BWYA 1Y4AE 3DGEC 3I2FA 3EY4A 3I6IA 4NXNB 1UP6A 2ESRA 3BE4A 1GYQA 3F9IA 3QBEA 1BE1A 2HBRA 4H59A 4ZYLA 3AWDA 4QTYA 4WGFA 2QW0X 1QCYA 5CDUA 2VRBA 1RZUA 4J75A 4UUBA 2R8PA 4CYMA 2JPDA 2Z5GA 3RHTA 5A1TA 2ZULA 3K70C 1XZMA 1SHZA 3O26A 1MABA 3ZG6A 1QK5A 3ZKWB 5I4BA 2WUVA 4X71A 1QRDA 2GEJA 1X80A 2IWRA 1LVGA 4IOKA 2LVBA 1CEQA 3I2YX 1LZLA 3L1UA 5DK4A 3OMLA 5L95A 4NQRA 4G5OA 1UBNA 3ILXA 1H2ZA 4K26A 1HDRA 2NSHA 3LVQE 3ICWA 3QKSA 2CSXA 1QVAA 2HJRA 2WU1A 3NBZC 1YCHA 2PAFA 5DW0A 2C2OA 3EIXA 4TKVA 4JB3A 2XOXA 4Z3OA 2E85A 5FA6A 5T4HA 1SBTA 3OQJA 4O4IF 3RK0A 3UMVA 4W5WA 1I14A 4D26A 4HDAA 1WXEA 3MRTA 2PGDA 5FOSA 2R7MA 2D3WA 2P9TA 4WPGA 5EZSA 2AZ4A 5HCNA 4IVRA 4DA8A 1SCNE 1DQPA 1EJ6A 3G49A 4B0PA 4AZWA 3HPRA 1WCXA 3LQRA 2V1UA 2RB5A 2WMOB 2C9ZA 4JKOA 4GXRA 2O6LA 1TQ8A 3TKYA 2IBTA 2Z09A 4N82A 2VCEA 3HU2A 4JYAB 1VRVA 4OYYA 3LE8A 2QTWB 4E5UA 1RRGA 1VCMA 2YUIA 2BFBA 1MC4A 2ACEA 3DV2A 4MUIA 4QXPA 3BD9A 3DE0X 2QYSA 3IP7A 4TZ6A 5LZ9A 3PX7A 1IY8A 3UMCA 2PJDA 4L5AA 1REQB 3ETNA 2D1SA 3L2OB 4G56A 3TD6A 4G37A 3T1OA 4PNPA 2JA2A 2P5YA 4ER6A 4OOEA 5HYVA 2PUFA 3AM5A 2HMYB 3KE8A 3QNUA 1X7WA 5T67A 3G23A 1RAEA 3ZLBA 4OQZA 4CDGA 2PRYA 5AI6A 2XWQA 2HSEA 4KV9A 2VDQB 5LBIA 3X1KA 3PDIA 4EUHA 5TT1A 3NV7A 4JSTA 2QZJA 1JPVA 2FEMA 3V3KA 1JHXA 2QMEA 1HKHA 1TYDE 3K09C 3SHWA 4B44A 3C3XA 1DE0A 1LRLA 4NHEA 3SI7A 3WJ7A 1RABA 3L0DA 2FF5A 2V3CC 3K6RA 4XEUA 3FTNA 4D79A 1QJ4A 4JBHA 5CFLA 1UZLA 2I2AA 2X5XA 3EZ2A 5GTDA 5ALVA 4O2LA 3DC7A 3EXG1 2MDTA 1ZDMA 5CPFA 4KPUA 3VUFA 1ATIA 4C3OB 1LNZA 1JW9B 3PUYA 4UU0A 2D2IA 4FFVA 3A6EA 1NUHA 3SJAA 2HPZA 2NGRA 4I36A 2J9XB 3M2TA 1NIPA 2VT6A 3DAGA 4RGYA 4KMMA 2A9RA 4E51A 2Z1MA 2WU0A 4C05A 4WEQA 1P1BA 4F8JA 3D5QA 1K1EA 1P6QA 2LW7A 4M46A 4TL9A 5DT2A 3K1YA 4YRDA 3HWSA 2OCPA 4MZXA 4RQTA 3HKBB 3THWA 4D0RA 1XKQA 2HK6A 4JD5A 5DYWA 1YK0A 4K3VA 1WA5A 3KYCA 3OKCA 3FF1A 1YJBA 4QBGB 4EF5A 5AJVB 3JAKA 2BI7A 2GPJA 2OXRA 3DNFA 1U2TA 3JYPA 4NMMA 3W9YA 1R0RE 3OC0A 1GZ4A 4R05A 4MUGA 4F6LA 3LC1O 2DMRA 1CNFA 4Z54A 1GUZA 1TJ4A 3UH0A 3PD7A 4YIHA 2Z8YA 1UPTA 2IE0A 1U4NA 3LPDA 3L8HA 2DFPA 2JJ1D 2X8AA 5CRIA 5BQPA 3D7RA 5K0BA 5IYZF 2X8LA 3MS4A 1T1JA 1S8AA 1XLWA 1LD3A 1TUBA 2INGX 3AR7A 1ODKA 4FOSA 4PAGA 1IUKA 3R6WA 2I7TA 5FV4A 4BMZA 3PNSA 4HR7A 1ZS9A 2WQ7A 1WPRA 3FAKA 3AGPA 4F06A 1FX1A 2XI4A 1DJMA 1I7LA 2CXPA 2VJPA 5IYZB 2Q1XA 1IEWA 5A62A 1GCGA 3K1JA 4DUGA 1AUPA 3BOSA 2JATA 1BXZA 4DSZA 1XI2A 3GMSA 1JJIA 1QO0D 5I7SA 1AA6A 2C3YA 1AKRA 1VKOA 1G8AA 4H3SA 1AY0A 3S1SA 1K8QA 3QJ5A 1NC3A 1WKVA 4RWZA 4JGIA 4J03A 3UJNA 2PMCA 2GM9A 2ZTVA 5DE3A 5EC8A 4UHJA 4ITRC 1AQLA 5ICCA 4UXIA 1K89A 4F85A 3WYFA 3KWJA 1MH9A 1WS6A 2D2FA 1XTTA 3EVGA 5TS2A 3AY7A 1ZGBA 2AD1A 4IJ5A 3STTA 3QX9A 3AESB 3S1AB 3PZBA 5GADl 1M2KA 4MPDA 2WJ4A 1X0XA 2FR1A 2QUZA 3PPWA 4RSMA 3WRXC 2VPXA 4JUCA 5FDFA 1U5BB 3ZCRA 3W6ZA 2ISCA 4E5MA 1SUIA 3A0UA 4D98A 2AOWA 5DDIP 3H5IA 5EG5A 4KQFA 4OFBA 4LCBA 2YHUA 1BHSA 4RANA 1RNLA 5G53C 4DC1A 3TPCA 2NUAA 3C8DA 5JMTA 2B1JA 2RJ3A 3WGQA 3A32A 3FR8A 3COYA 3CNEA 3DE6X 3SC4A 1PKXA 2B5WA 1Q95A 2M6RA 4KQWA 4XCXA 3WIBA 4YECA 1H5UA 2QPLA 1IM8A 4WL0A 3WAJA 2XR1A 2AX4A 3QU5A 4JASB 4J4TA 2OZPA 2PZJA 2CLCX 1X7ZA 1Z12A 2NUPB 3QEBZ 2EFEB 3WK6A 1KU6A 3QKUA 3TX6A 1K7FB 1HQDA 1LKZA 5TQ2A 2Q49A 2EL7A 4QO8A 5E1MA 3T7EA 3HJNA 3M5CA 4TTIA 1JJVA 2ZWOA 3AEZA 5ENVA 3TDKA 5I4KA 4LHXA 1ECBA 1YMVA 1QDUA 2IHZA 1LI7A 4CMCA 3C5VA 2BFNA 3UYLA 3EZNA 4HQRA 1MGOA 3BH7A 5CVCA 4UHDA 4P4SB 2PH3A 5TGZA 1EX7A 1MXFA 1PBTA 1SC9A 4YUXA 5JWOA 5KTMA 4BBZA 1D8AA 2XLCA 3EJ6A 4Y8VA 4EZIA 3D8TA 1E7WA 3E7XA 4DAEA 2FJ0A 2B8NA 1C14A 2FQ1A 2JNWA 3IQDB 1R8JA 2BVNA 2IUYA 4KQ2A 4E6PA 4G81A 1EGHA 4D8YA 1KTIA 3WLLA 1ZISA 4PX9A 3BJRA 1QV7A 2ZR8A 1MEJA 1JTEA 1DG9A 2VTDA 3AIMA 3K1TA 5DP2A 3ROGA 4DE5A 2XOKD 5JQWA 1SELA 1OY1A 4ER7A 3R44A 1A77A 1IZ0A 3K0CC 1W48A 3GFPA 1BVRA 4X20A 3Q3GE 1NVUQ 1E5TA 3CU5A 3WO1A 3F5FA 4FB5A 4EUSA 1PW5A 1FYVA 4LIPD 1H0KA 4ZANA 4UNNA 3ESXA 4RD2A 4S3MA 5JSUA 4IHJB 5F73A 4MVXA 4F3RA 3MILA 3NH6A 4PAMA 4JUAA 4X6LA 3HWWA 4MGEA 5CCEA 1K5DA 4INAA 5IP5A 3CRZA 5AKZA 3WIDA 1A1VA 3GLIA 1DGQA 5ESDA 1GFWA 4D9BA 1E77A 4RTLA 4N9WA 2O07A 5FBWB 4KAXA 1T36A 1YS1X 2YY5A 3HHPA 3M33A 4JOQA 2F3SA 3T1VA 4C76A 1XF1A 3HE3A 4Z2AA 3QX8A 1Y6RA 4CKZA 3Q72A 4JEUA 4ZXFA 1DDGA 1EWTA 2PAAA 2QRKA 3NU1A 4MW2A 5TY0A 3MN1A 4FE4A 3EVTA 4LQDA 1RYHA 1NU6A 1Q7GA 2HDNB 3F6SA 3VPDA 5IMSA 1RQ7A 2R87A 4TVKA 2IODA 1NY6A 4IOMA 4U1RA 2OB1A 5G02A 5ARBA 4F3TA 1NXSA 4FHZA 3HA2A 1EE2A 3WBKA 1PCXA 3RAPR 1L6RA 3PXUA 3CHYA 1JMVA 1CZRA 4MW6A 1R0KA 9LDBA 1RBQA 1NVAA 5IT5A 3KSBC 1SHLA 3OH8A 4X63A 4ASUA 4RPHA 1OXMA 4H08A 2ZB8A 2PSFA 1ISGA 1RC1A 2A9JA 1QR2A 4KLZA 5D51S 1K68A 4EYQA 9ABPA 1ODSA 3F9RA 3EVCA 2FXVA 1ZNXA 3CR3C 2Z58A 3WB9A 3BX1A 1XNGA 1Y3AA 3EE6A 4BFCA 5A02A 1I33A 3U2QA 2PUVA 4C88A 2XSZD 2PUDA 4ZMSA 1FFXA 4RZ2A 1XMIA 4ARUA 3GDWA 3NHUA 1IZYA 1K7CA 3M1LA 4MRPA 5EXXA 4CN8A 2WU8A 1W5SA 3PDCA 4J1NA 4KPEC 3TVDA 5I7OA 2GPYA 2Y92A 1UJMA 4Z9BA 1BFDA 3WRWA 3UAWA 3NHRA 4ZT6A 4BOYA 5H68A 5C18A 1FE8A 1F1BA 2I3GA 2YY6A 2IDKA 2P91A 3L8FA 3AMVA 1SKBA 2V6FA 3VR3D 2ZJYA 1IOZA 2ZYRA 1QSGA 2C0CA 2F3QA 4V0KA 1V7CA 2Y67A 3QFTA 3IMCA 4ZOCA 1O08A 4FYHA 1BE6A 3SSMA 3PFBA 2PS0A 3H2GA 3HYCA 4JJKA 1T24A 4RVCA 1W88A 1Z4IA 2AJLI 2QL7A 2BEUB 1SBZA 4KYIB 1AMOA 2JLZA 2H00A 2HN9A 2OHVA 3C74A 3KYIB 4IOJA 4K9NA 5ED0A 4MI3A 4WCVA 2KSQA 1JS1X 3EGXB 4XQ9A 5DCLA 3R76A 4LDPA 5KQSA 3VYVA 3AONB 1KMNA 1O9HA 1M6WA 5EHQA 3RYIB 3V8QA 4UHHA 3WMXA 5HIJA 4OL0A 4IF4A 1Z5PA 2J9FA 1M0WA 2QB5A 4HH3C 4UMFA 4Z2YA 2AZXA 1SKYE 2AEMA 3CN9A 2IDZA 4PSUA 5GINE 2XA9A 3IDAA 2P6UA 2W11A 2Z9DA 3KXLA 4E08A 3USES 2EZ4A 4MVJH 3O9ZA 4KNVA 4GX0A 1J4AA 1OYWA 4NXMB 3LC2O 1F06A 3ZK7A 4Q6BA 4UUNA 1JQEA 1KP3A 1P6XA 1QHIA 1S3IA 3S2FA 1G38A 1TM4E 3LTEA 1EFRA 2JLAA 1RWWA 2G77B 5AJWA 4KLCA 5AD1A 2W9XA 5BSUA 3A3PA 1NQXA 4TV8B 4R1PA 5IN4A 3EQ2A 1OAAA 4LXIA 621PA 2PX8A 3GEBA 3HCFA 5J58A 2DE0X 1LEHA 3EGDB 2IHTA 3PJGA 3FFXA 2ZRBA 4RMJA 3V8BA 4ESHA 1A9ZA 1OZ0A 4HJXA 1F5SA 4QDJA 1DUVG 3OJXA 4K6OA 2OHGA 5HMLA 4DV0B 3OU2A 4BX0A 6LDHA 3NTOA 2GCIA 3G0GA 3BQNB 1A76A 1HLDA 1KZ9A 4JHXA 1G21B 4LYYA 1EDEA 4QU8A 1I9CA 3ESYA 4LDNA 3U7RA 4E12A 1N78A 2JJ2D 4UD6A 1AKQA 4C7VA 3W8EA 1FRFS 1NOIA 2BLNA 2IVZA 1N34B 3HABA 5I7FA 3H8VA 5EXPA 2YC4C 3P19A 2CZQA 1JSZA 1UQUA 3UAXA 2Z8ZA 5DXJA 2YXDA 3JD0A 1DKRA 3IULA 4IZOA 3WLTA 4DBVO 4DBLE 3TW8A 2BE9A 1VSTA 2IY8A 2ZATA 3MGGA 5J1TB 1Z39A 2O4UX 2CSUA 5EHIA 5A05A 1K97A 3VX3A 4CF3A 3ABRB 3FG9A 4QPDA 3GXBA 5K2MA 2BGNA 4ZYYA 1Z2OX 4OI0A 3WV4A 1V4BA 4I66A 3E2IA 3WLQA 2JLBA 4B31A 1OUMA 3IUYA 1XAIA 2FQXA 3ENQA 4X7BA 4LC0A 1X9IA 4DQVA 5C8ZA 1Z4MA 1M1YA 3HZOA 4ZQGA 3VR2D 2HMVA 3NUQA 3RODA 5A2GA 4H3KB 1EXWA 2GKSA 4IHKA 3IMFA 4KQEA 1LJ8A 1DRKA 3VR4A 2RK6A 2CBZA 1F9AA 4CNQA 4HBGA 3SEAA 1QVWA 4A3SA 2ZTLA 2ORYA 3QTBA 1MRNA 4CM8B 3O4IA 1L5HA 5IBQA 2G1UA 1Z2CA 2H4HA 3GH1A 2BKUA 3OP4A 1G5RA 3OSZA 3VV2A 5IF9A 4EKGA 1MJNA 3P4XA 1EHIA 2YMQA 3TW6A 5G1PA 1T4CB 1QVRA 3R9WA 2CE2X 2CHQA 1EGAA 2IIBA 4C2BA 4PYKA 3DE1X 5AVRA 2OPBA 2YY7A 3IPCA 4YAIA 4ND5A 4DQKA 1B7GO 5DX0A 1B74A 2FWBA 2QPTA 3Q8LA 3TTVA 4AN0A 3OICA 4EM6A 1RC0A 3KBOA 3EDCA 4O1HA 4GI5A 1RIIA 3M3HA 5JSZA 1W93A 5HMMA 3DOJA 2HK7A 1NI5A 2P9FA 3D59A 1N4AA 4EIWA 4ZYTA 2I0FA 1TZCA 3BSWA 1JFFA 4TXHA 3DE3X 4C3VA 1XQ1A 5TT0A 1C9YA 4UBIA 4AJEA 2AH5A 3TRDA 2CXHA 5BMVF 2B8TA 4FHFA 4ZVRA 2CL6X 4ISCA 3PNMA 3E7FA 3FYHA 5GM2A 4TLDA 5TC4A 1MEEA 3AJ9A 4EHAA 3AKZA 4BDTA 3PUXA 4FEGA 1GZ7A 5DM60 4RULA 3IBCA 3QI7A 5BMVB 3BJEA 3ELWA 4KG7A 3TPFA 2HNBA 1H0SA 2QQFA 4C14A 5HGJA 2H63A 1U3FA 5DWQA 2QY6A 2EJTA 3TBKA 1KZHA 4LDQA 2J07A 3RSQA 3IT2A 1EUCA 1HF3A 2LIVA 3MJRA 3QE4A 3STXA 4DJEC 3OTWA 3BK1A 3E82A 3UG7A 1LY1A 3PUIA 4KK3A 2CFCA 3OZCA 4P34A 3RV4A 4BFTA 2VYNA 4B71A 4B7AA