4C7MA

The crystal structure of tcpb or btpa tir domain
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
134
structure length
132
Chain Sequence
b'SNADFFISHASEDKEAFVQDLVAALRDLGAKIFYDAYTLKVGDSLRRKIDQGLANSKFGIVVLSEHFFSKQARELDGLTAMEIGGQTRILPIWHKVSYDEVRRFSPSLADKVALNTSLKSVEEIAKELHSLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TIR DOMAIN-CONTAINING PROTEIN
publication title Mechanism of Bacterial Interference with Tlr4 Signaling by Brucella Tir-Domain-Containing Protein Tcpb
pubmed doi rcsb
source organism Brucella melitensis
molecule tags Signaling protein
total genus 46
structure length 132
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4c7mA00
2JS7A 3OZIA 1T3GA 1O77A 2Y92A 4LQCA 5FORA 3UB3A 3JRNA 4C6RA 1FYXA 4DOMA 4W8GA 4EO7A 2J67A 3UB4A 2M1XA 4C7MA 3H16A 5H3CA 5KU7A 4LZPA 1FYVA 4W8HA 4LQDA 4C6TA 3UB2A 4C6SA 4C6TB 4OM7A 4FZ5A 2Z5VA 1FYWA
chains in the Genus database with same CATH superfamily
2FOLA 4RS4A 5D5QA 1SCBA 4IRMA 4R1OA 3G8BA 4UNSA 3UK0A 3TRDA 4TKMA 2F62A 1II9A 3BH0A 4FHDA 1M74A 1PR6A 2JBAB 3ZHXA 4C20A 4ALLA 4ZDJA 1USUA 4EPWA 2Z6AA 2GX6A 3QWHA 2PX4A 1M1ZA 2WAMA 3CEPB 4IDCA 4ZCMA 3QYPA 1W94A 2JLZA 4QPDA 4IYRA 1BXRB 2EC5A 4J43A 3V2GA 5TMDA 1DXHA 2GHRA 1SBTA 2TMDA 1M34B 3HY3A 1Z9BA 1SBYA 1Y81A 4TKZA 1ECBA 1TCAA 2O7NA 5CK4A 3L6DA 3X3HA 1IBKB 5T7BA 4CNQA 1EUCA 3LA8A 3JX9A 3OAAD 1N78A 1O94A 1SOAA 3DE0X 1Q83A 4BGDA 3ADOA 1N5JA 4WESA 1NSFA 2QYTA 1K6IA 1DMSA 1J6UA 5G4LA 4I99A 5FR1A 3HJHA 2PYZA 3Q6NA 1J00A 2D7CA 2DECA 3HVKA 4EATA 1XTRA 2H5EA 3HU3A 3MCTA 5H80A 3TTTA 4CM6A 5L8VA 3VGJA 5I8PA 3VZDA 9MHTA 2H3HA 3HXTA 4RQUA 2BI8A 5JVDA 4UM9D 1LY1A 4KQXA 4J90A 4CMIB 4HRVA 5LZ7A 2IBTA 1P5FA 5BV8A 5AK3A 3PUWA 4N39A 3WIDA 5LFAA 3DD5A 1D4FA 3KVNA 3BD6A 1J25A 3T38A 3GVHA 3ASYA 2QF7A 1NJ1A 2IDMA 2YDYA 4FLMA 4P22A 2XF2A 3CH7A 5LZ4A 2BFDB 4PEVA 4WDQA 3RYIA 3VR4D 1T9GS 3NC1C 1QNFA 4NBTA 2FUG1 4RXMA 5J23A 3GFGA 2W0MA 4JHXA 1BA3A 2ZSBA 3E5NA 1E89A 4L8YA 5DBOA 4J3NA 2KW5A 3TM4A 2WE7A 5L6LB 2H4HA 1IQRA 5I47A 1H1TA 3KZNA 4X41A 4QBKA 4CRWB 4MQMA 1DQSA 5C8DA 3DCNA 4PZUA 1RYDA 4GL4A 1DJNA 1LI5A 1E1LA 2J5KA 2GEVA 3G7UA 3GBPA 3Q1KA 4JP8A 4K8RB 4TZKA 3B3JA 1QC5B 3K2IA 4K9OA 1VSUA 4U7PB 4B47A 4DREA 4E0BA 4EUSA 2A35A 3CBQA 2PMBA 4Y2JA 4YDHB 5E8JA 3VPCA 2GK7A 3AF3A 4ESOA 4ZI2A 4FMPA 4FFPA 4K03A 1R9MA 1SRRA 3A3PA 4ZAVA 5IH7A 1C0IA 2QG4A 1C4XA 4QO7A 3V8QA 2C4MA 5ALGA 4CT5A 1QFYA 1QRRA 5C1IA 4FHFA 3VSAA 4LY6A 4UPEA 1QF7A 2G0AA 4GM0A 3NT2A 4B45A 1QMGA 3ITDA 1QUEA 3MXTA 4XKJA 2X14A 1ZQ1A 2GJ8A 2O3UA 4HLNA 4XM1A 2CJYA 2FSUA 4N8SA 1SIWA 3AJRA 3GAMA 5ILGA 5AKLA 4EX7A 5IJ0B 1Z6YA 2C78A 4GQBA 5F12A 5C81A 1WSAA 3UV7A 4ILEA 1CE8A 3BE5A 5CGQB 3R5KA 2HA6A 2Z0MA 1M6VA 3LDHA 5TQJA 1DHRA 1QIKA 4UZFA 4F72A 4N01A 3P26A 1JDVA 1SBCA 2C9DA 2R8EA 3LT4A 1FJHA 1HI9A 3E18A 4YECA 4PGAA 4Y9TA 4HLUA 3C8ZA 3K9LA 1X7WB 4GX5A 4HDNA 1YHZA 2AYYA 4MEJA 1T13A 5CLJA 4KPGA 3ZHOA 4KO2S 4OKIA 3QE2A 4PFSA 4PLZA 4G37A 1XCBA 3WB2A 2UUCB 3CLSC 1J8VA 1J9EA 4J0IA 1JWLA 1ORWA 2WF8A 1RP7A 2OCGA 3QWFA 4B0OA 3GQBB 1GT6A 1U2SA 3EXFB 1DCMA 1DV1A 4WNAA 2OGUA 4X44A 4XRRA 4XYBA 3TSCA 4D3ZA 2FSVA 4KI7A 4TMFA 3TCKA 4F6RA 1NVWQ 1XU7A 1VSTA 2OHXA 2DFLA 5A3VA 3E3LA 5AKXA 3HKCA 1KQNA 2FF5A 1BROA 1WMAA 2MMGA 5I8ZA 2AXEA 2FWBA 1BOOA 1HDXA 3ZY3A 1DGQA 1XMPA 4Q15A 4NHOA 2IU4A 2P67A 2IH4A 4BKMA 4ESVA 1B6TA 3C3EA 5KYXB 4MS4A 2FUG6 4U1RA 1CUJA 4KK4A 3KQUA 5IBRA 3X2FA 4YRSA 4GC9A 4WOPA 3MWGA 3EGOA 3RBXA 1KJ8A 1U3GA 3OKCA 3QVGA 2GKGA 4KBGA 3KTAB 1MUUA 1R27A 2WHQA 3LHDA 5DTEA 4PQYA 4CN8A 4ZPJA 4DCJA 3DP7A 2CY0A 1G7SA 1UEXC 4WLNA 1NN0A 4FZ5A 4WXMA 3SK0A 4EB6B 3CLUC 3T99A 4JC4A 1MC8A 1UK8A 4F1WA 2CMDA 4L4RA 4V39A 4KJXA 4NXNB 2MSDB 4XWKA 1JECA 3HL4A 3ZJTA 1NNSA 1RRGA 2CE2X 2G1PA 1QE0A 2P0AA 4WDRA 4NIMA 5C8XA 1ZMXA 4BNKA 4P36A 4X61A 1CRQA 2G6TA 3HN7A 4WUVA 1YTLA 5L53A 1H2WA 3KB1A 3W1WA 4LRWA 3E0QA 3PHHA 1NASA 2BVNA 1WCXA 2ATIA 2XGGA 3ESZA 3TQFA 3WFIA 3DEZA 3K8QA 4D9IA 2G25A 1JIIA 1AM4D 4FOSA 4NJEA 3QFTA 5AJZA 4KFSA 1OR8A 3GLHA 3AERA 4I1VA 3K2QA 4MVJG 4JI1B 1EQ2A 2MSWA 4R1NA 2Z2JA 1G5RA 1HETA 1KDYA 1H5QA 3AESB 3GZNA 4KTTE 2R96A 2GILA 4IHJF 2EZ4A 3N2KA 5FORA 2OAGA 3HPRA 2D5BA 2AWNA 4D0NA 2WSBA 4QLAA 1GCOA 4V0MA 4X5OA 4YRJA 2XA9A 4M8LA 4BMDA 2IS6A 4O2AA 2Z3WA 3OEED 3JVDA 5INTA 3K6JA 3M6WA 2RKBA 2QRQA 4R1SA 2XBUA 5JAMA 4U0JA 1Q0RA 1VL1A 4LC1A 1XO1A 4PHFA 2GFQA 3E9ZA 1X1RA 4OP3A 4EY5A 4RD2A 2JZNA 2MSEB 3I6IA 3L8GA 4PYRA 3Q2OA 3ZLVA 3P0JA 3R9XB 1H93A 1KI3A 4LNHA 3DHEA 3V5NA 4CKEB 2BMJA 1YONA 2V45A 4JP2A 4NFHA 4Y2RA 3QOYA 1N1MA 2ADMA 4UBNA 4QUGA 1KMHB 1KOFA 1M3SA 2C07A 2RGUA 3KHKA 2OM6A 5FTKA 3SXUB 3T7DA 1FW6A 1E2MA 1KTVA 3U19A 4EW2A 3M1AA 5F78A 3NRJA 1N3IA 2SHKA 4U7GA 3CUVA 1XZDA 2XQVA 1HEIA 4FC7A 4JZYA 2VOEA 4L0CA 3RSQA 5LZ9A 4L5JA 1A04A 2I8AA 3S28A 5C5DA 2VH5R 1TW3A 2DUJA 2MU1A 3TLYA 1NP3A 1IU9A 3SFZA 3JSAA 4X8HA 5HE8A 3WYCA 2BC9A 3LWZA 2R2AA 3IBFA 4QULA 1ISHA 4EG5A 1R66A 4U2FA 3T4PA 2YNMC 1TAQA 3PQ4A 4Y1RB 3IIIA 2CXTA 4LYFA 5LMZA 4DLAA 5AJTA 4YJ2F 4FHEA 2ZR9A 5KJCA 3PUJA 3EJWA 1JLRA 5HJ5A 2WPNA 1NN5A 4BC0A 2IEDA 3MXOA 2WJIA 4D9GA 3UYKA 1A9ZA 4C3VA 1RABA 1JMVA 2D00A 4BNMA 3U5TA 1EG2A 4H18A 4PZ0A 3ZXUB 5F1KA 1GO2A 5C51B 1Y1TA 1UXHA 4HDKA 3GA0A 1J21A 1KO8A 4DA4A 4QDUA 2UZ0A 1R5NA 3I6YA 1XXHA 1F8YA 1MXHA 5C8YA 3TZQA 3KCNA 5K0GA 5JARA 5KDOA 1N2JA 4YJGB 2RCNA 5DWVA 2KWIA 5IAKA 4BAGA 2HNKA 5ARBA 3THWA 3QVOA 4OLFA 4Q05A 2C7QA 1J22A 3AHDA 3V8RA 2J0SA 3VV3A 4EHLA 1Y7IA 1L2TA 2P7HA 3DVRX 3PVZA 2JHCA 4GOJA 2X9GA 3JQFC 4NABA 3UWPA 5CXXA 2HX1A 5ELXA 1IRIA 2VTKA 2IYOA 3EDRA 4FK8A 4YONB 2QY6A 3CZCA 3KHSA 3ZLBA 3A4VA 3UWOA 5D7NA 1GNSA 1ENYA 2PZGA 3JY6A 1KGDA 3LW7A 3FHLA 2FSGA 4NEQA 1UXJA 5HGXA 1DINA 1DI0A 4GF5A 4CGYA 3ZHVA 1UKVY 3EBPA 3G9ZA 1XVVA 3ABOB 4C3UA 5HPYB 2L2QA 3PENA 4R1UA 2VUHB 3A37A 3CTMA 2B9EA 3AF0A 1FXUA 2H1VA 1L5QA 3OZTA 1NY6A 4PAOA 5B4TA 4URWR 3AUAA 4D8XA 5LB4A 4C9BA 3MOSA 4I81A 2B83A 3RS8A 4RULA 4BFTA 1SHJA 5IC4A 1RQGA 3HUTA 5DGCA 3RUPA 1SY7A 1DAMA 4HMQA 1HRKA 1B42A 3FBTA 2K7ZA 1K0FA 2BKXA 1TKRA 4LTDA 2GXUA 4FUTA 4DC0A 1RADA 4J0GA 1JG7A 2D6FA 1P7YA 1QK5A 5CW1A 2CZCA 3ICVA 3JYOA 4D02A 4B4KA 5FADA 1VJTA 3FWHA 4ALJA 4Z3DA 4DDTA 2D2FA 3QBJA 2AE2A 1CS0A 4ALKA 4LNAA 3OMXA 1YE3A 5I7UA 3FHTA 5IU6A 1NJGA 3BMOB 4AJPA 3PWZA 2HSDA 5BN3A 2X1HA 3PQFA 1TYDE 3PUXA 1EFRA 4JR1A 3L84A 1M7GA 2KS6A 1QV9A 1HFWA 1C3OA 1IHYA 3M3HA 3O38A 4P7JA 1WAMA 4FOPA 1KR5A 1V96A 3AETB 2GKOA 4FKMA 4PS0A 5JAQA 4HBZA 4BFVA 1U63A 2Z30A 3TECE 2FQWA 1YVPA 1VL2A 1JPJA 1WOYA 3ID6C 4LA4A 4YREA 3AHEA 5MHTA 2I54A 3IEXA 1AA6A 1A9QA 1X7YA 3ZPXA 1Z2AA 2XMQA 3S2IA 3ZKWA 3VU9A 4EHDA 5EJAA 5AT1A 1K6JA 1OLUA 4Z1MD 5DLQC 2XKJE 1W35A 4OQFA 3CX8A 1G2PA 2YN2A 1SUSA 3EFBA 3G0DA 4A6DA 1N8SA 3AUTA 1PJQA 2Y67A 3PC4A 3I9KA 3H8WA 4F84A 5KVVA 3TJMA 2O0HA 3C45A 5DM0A 4TTQA 3C3PA 4BMXA 2IWRA 4ZYYA 4QM6A 2AJ8A 3PGKA 1LV8A 2WU0A 3ZVLA 1FFGA 4P4UA 4R0NA 5D51S 2ODTX 2W98A 2JFQA 2XKAA 3PE4A 4ZTBA 2VEDA 4EDHA 3VR3D 4KUEA 5IZ4A 4GUAA 4FSXA 3FUUA 4Z8YA 1O9BA 4QHYA 1JLHA 1UBOS 3UK2A 2W9XA 1GZUA 4MR9B 4ZCTA 2CN1A 1E5VA 3I42A 1CX9B 3I53A 4ZAGA 1BFDA 1FMFA 2ZATA 3W06A 3PI6A 3Q9SA 3QXSA 3U3JA 4KGVA 5H59A 3JQRA 4J8PA 3E9DA 1AQIA 1G5QA 1MABA 1KI9A 3H97A 4FZRA 4RMJA 2W2LA 4XB6B 3RUIA 3NDJA 1R6UA 4H0FA 2JFOA 5KHOC 3JQCA 2BAGA 2WF9A 4EH1A 1P60A 2FW9A 3VXKA 4ARCA 4H7IA 2J5QA 1Y6FA 2H29A 2J41A 1TM4E 4IG9A 5NLLA 3LBIA 4BNVA 5A1JA 2NV6A 1ENZA 2IZZA 3B2EA 1GNPA 3RF7A 1BRTA 2XY4A 1DCFA 4X1KB 4C21A 1MTOA 4FKBA 1BSVA 2CYCA 2QMQA 2IYPA 3MVEA 1QO0D 4MV8A 1HE5A 2WA1A 2WHPA 4ZWNA 1WXDA 3KAJA 5JV5A 1AKRA 2HY7A 4Z7JA 1GZ5A 3BQNB 1T1EA 5LD2C 1TPYA 4B48A 2WMNB 2JLQA 1FC0A 2QL6A 3CZQA 3FUWA 3IMGA 4HH0A 2AZDA 4KQ9A 3CIOA 5DX1A 3VTAA 4F8YA 4MUIA 4W5HA 4G9EA 1P9RA 3IL2A 5BVGB 2P2ZA 1OVGA 3KRTA 1W4RA 2GAIA 3EDOA 2W22A 3QMVA 3KLPX 4KLNA 4YWHA 4BO3A 1E0JA 5EJ9A 4U6NA 1G8GA 2IZ7A 2FZCA 2C31A 4HXEB 1E58A 5DDIP 5L7YA 2BFCA 1QO7A 3KJEA 2FMFA 2GF0A 4XFJA 3AF4A 1ODKA 4IOJA 5K8IA 1NVTA 1RXSA 2F3SA 3PP8A 1YQTA 4DLZA 5J2TF 4GKBA 3DHWC 4OQNA 4D9FA 3DMNA 2SECE 1NYRA 4JL6A 3PWKA 1GFIA 1ESZA 1W36B 1DJMA 4JBLA 2PKQP 4UJ3A 3ELDA 1HQYE 1AO3A 2FH5B 3QYJA 3MAAC 2VK8A 2KI5A 4RQBA 1TO1E 2IS1A 1J2TA 4Z4HA 1TZ2A 1XRJA 3VDXA 2I2BA 2FYTA 1A88A 3WBKA 4BC1A 1O58A 2R86A 5DNAA 1R4NB 5F51A 4B87A 5IWAB 1I94B 1LQ2A 5DISB 3A36A 4QU9A 4N5IX 3R0ZA 5A7HA 1SVSA 1IG0A 3IEPA 3JQ8B 1LPSA 4RSRA 2N1BA 2C9CA 3GWZA 4E5MA 4MUFA 5BT9A 3H2YA 4CUZA 1MD9A 3PHGA 4MWGA 2GFIA 5F73A 4DQDA 5F3RA 4MW9A 3UAVA 4PO1A 1DAHA 3B13B 2D06A 1G5TA 4MPTA 4ZU3A 5FTNA 4ERNA 1I7NA 2JIQA 2FGKA 2XQGA 3IHWA 4HGPA 2B82A 3IIEA 4LMAA 1RAGA 5FUXA 4E2YA 4C4PA 1HLDA 1AC5A 1YR7A 2VDNB 3DO5A 3E9RA 4YCAA 3TLEA 4AQDA 5T3UA 2VHXA 4MUHA 4NBRA 3KTFA 5AW2A 3K6RA 3RARA 1NONA 1PG0A 1WHSA 2P4UA 3FKQA 5HS6A 3WRXC 1B0PA 5D85A 4BNGA 3GRVA 4JYZA 1SBZA 1YQUA 1PSWA 2PZ8A 2I03A 1T4CB 1B93A 1GGHA 3BCSA 3CLRD 1TYBE 1ZUNA 3I5MA 4FGJA 4WE3A 3TQOA 3USES 3UUGA 1B6GA 2UXBB 3LU1A 4M6WA 3UJAA 4N3AA 2IYRA 5EVJA 1YACA 3TGWA 1G4UR 2DCMA 3HJGA 3KWFA 3LD9A 3N87A 4UMVA 1RAHA 3VKVA 1SXJD 3TG8A 3BKWA 3TUJC 4FFMA 2BHNA 3LHIA 4KHZA 4JJ8A 1OPRA 1EG7A 4BTVA 3ZDFA 1NMYA 1NBMD 4Z0TA 1XLWA 4NBUA 4OI1A 1ZJ5A 3WWOA 1MMFB 1YCDA 4L57A 4TMXA 3TWOA 5DCLA 5C46F 3RG8A 3EF0A 3HFSA 3QXJA 5ALOA 3TQIA 4XWWA 3DTVD 4Y2XA 2DU8A 1NLZA 1WCYA 5B37A 1CEYA 3HCEA 2AA3A 3H2BA 4FINA 3CZPA 2GJ9A 4GAEA 4ADSG 4BGIA 3A3YA 4HPWA 3G17A 3HS3A 4AKGA 1SXIA 3P45A 1IHPA 1N6OA 2QYHA 1U9CA 1JQJC 2A5LA 4V0NA 4TS4A 4LV8B 2Z6QA 3CNOA 1DEXA 3I5AA 2W4IA 4JELA 4JNCA 1KH3A 1Z3CA 2C42A 3C4JA 1E0AA 3AJ8A 1UP7A 3OAAA 2V6BA 2CNBA 4LE1A 3MIZA 1F51E 1YS2X 3L0ZA 4XD7D 4UDXX 3B3FA 4XTCS 4C2UA 3WNDA 1TYAE 3HUFA 3AR3A 3G2NA 3L1HA 2FG6C 4KX5A 1EJ2A 2Y05A 2F1OA 1Z06A 3P94A 5EAIA 5C53B 1KZ7B 2IUYA 2I67A 2W2PA 1SKUA 3BB4A 1PL8A 5DBIA 4TUYB 4JI0B 1DRJA 2QTZA 1DTSA 1VKZA 1CHNA 2FLWA 2OSVA 3EG5A 3GCXA 3N58A 3OQJA 4MIYA 3B38A 4F85A 3GMDA 1LB1B 4QGBA 3H2JA 4XSHA 2M6LA 4L4ZA 4XVUA 3L7NA 1MENA 4TV9F 1F4VA 2FRVA 2ZIZA 4WFJA 2R48A 3UENA 1EGHA 5LQUA 5AI0A 1M2VA 4JT9A 1UZMA 3FR7A 4DXHA 3M4YA 2V7EA 3HYSA 1HT0A 3F5DA 4W99A 1R4MB 3RCBA 2UUOA 3UVEA 4E5VA 4K0RA 4RPHA 7AT1A 5LYJA 1H9AA 1P1FA 1TZMA 1YDMA 2C9YA 3B7GA 4L07A 4NBSA 2J9FB 2CHVA 1RCTE 2WQZA 2BFAA 6ADHA 2C92A 1M8JA 5TPZD 3G2OA 2EX1A 2RJOA 4QX6A 1E3TA 4MVCA 4BX9A 4N5HX 4MJLA 5IXYA 2HWKA 3QG5A 5K8JB 4HATA 4S12A 3S1LA 5CDTA 2VJQA 2J46A 4NECA 4EA6A 3T7SA 3BWVA 4AB1A 2X6RA 3KYBA 2F1JA 4PZCA 1OXMA 2PZBA 1XL0A 2OZLB 3ENZA 4WV3A 4AW9A 1SVOA 3GUYA 2ATVA 3WWPA 5K0JA 1AXEA 3CCCA 5WRFA 1SPBS 1Y7TA 1JQ3A 3IODA 3DOEA 4TLCA 1LBEA 2BEUA 2V4ZA 2UUPA 4QXRA 3T5DA 3S2ZA 3GJ5A 2Y66A 4FFSA 4O2BB 4N6GA 2IZOA 5HIMA 5FJIA 4L5CA 3PT9A 2PUWA 2ZYSA 3TLGA 1NC3A 1S2GA 1UPTA 3MWKA 5JCOC 2R1TA 1N0HA 1QP7A 2WM8A 1TYCA 3HBNA 2M32A 4I19A 3G23A 5LUBA 3IURA 4RY8A 4D9NA 3NEYA 4TQGA 1NR1A 1WUYA 1ECJA 2HRQA 1E4EA 2YRXA 3OLVA 5IVDA 1KQ3A 1XJ5A 4HDRB 4EECA 1PRYA 3GARA 3OD1A 5A02A 1NX9A 5AVTA 3KCQA 1FDUA 5AKGA 4K81B 1WX1A 4CLEA 4YUYA 2PJRA 1S2MA 1SU8A 2CVHA 4KXQA 3HP4A 3NT4A 4BMCA 1M6NA 2OXEA 3HB4X 3D4IA 1K06A 1W96A 4P4GA 1IBSA 4CQMD 5DGXA 3GFSA 1HSZA 1YI0A 2BF4A 2YS6A 4L6CA 4CDGA 3ZWKA 4PTZA 1EUQA 2YMLA 1ICEA 3BM5A 2J3DA 3CZRA 3GX1A 3Q7PA 4XIYA 1ONPA 4NX2A 1KERA 1SCAA 4B35A 4RELA 3VZCA 3ZWQA 2RMKA 3WWCA 3PC8A 1N9GB 3LXXA 5E4FA 4U2GA 5JADA 1AU9A 2VF4X 1AQUA 5U4QA 1C7JA 2JF0A 3UHFA 5ILOA 4HH4A 3ANLA 4G0MA 3WXBA 5FWNA 3BMQA 1HOXA 4QATA 1U0BB 2ORED 2Z98A 3UH0A 4LYEA 3JD4A 3HK2A 2R5NA 1K92A 1LCIA 2GF2A 2ORYA 3GPIA 1ISMA 2GCNA 4TV8B 1ESCA 4DZZA 5SZHB 3RROA 3WKEA 3GYGA 3IPYA 3O2SB 2NADA 2AGVA 1S1MA 4LY3A 4Q1EA 4YYEA 3WA7A 2PBLA 3ETJA 5LMUB 1NP6A 3C3XA 1NXWA 2Q1UA 1TA4A 3JRNA 2WD8A 1KBQA 1PI3A 4BJ1A 3PD1A 1HTWA 5HSGA 3ZCUA 4JI6B 4K86A 2V7VA 4DC1A 3HO1A 1HE3A 3WJ2A 1O4WA 3PNLA 2FP4A 2IEZA 1Q17A 1E9EA 2O3TA 2PZFA 3JAWA 2EKZA 3KYCB 2H2DA 3LQ2A 4K9LA 1AKMA 2YXNA 3IA2A 4X1OA 1X77A 5E7IA 4E94A 2XWJI 2GUWA 4WXHA 5K2MA 1XTUA 3U7JA 3PT5A 5FHRA 2PUCA 3U7FB 4F04A 5B2EA 4NYJQ 4PX2A 3EMBA 5HOQA 4G1FA 4US0R 2X3YA 5K3CA 1T6ZA 1UOEA 2HSEA 4X8OA 5DASA 3UAOA 1DEHA 4WBNB 2TSYB 3FFWA 1VLZA 4M3NA 4YHBA 3K30A 3ROTA 5LQCA 1UOOA 4ZK2A 3CXUA 5GTDA 1PT8A 2QUKA 1COWD 2XE4A 5IAGA 4Z4CA 3BXXA 4CEIB 3TKAA 2J09A 3L6UA 1FRZA 3Q6MA 3VBCA 1EM8A 4XA8A 3I30X 3ZGZA 5EIHA 1DKNA 1MH1A 2W8BB 1R5OA 1ZIOA 4LYDA 5CH5A 3A1VA 4M1YA 4BJHB 4L95C 1VA5A 2V9CA 3WLMA 5BV7A 1UFRA 4DCVA 4G4IA 2DKOA 3UT5A 1A2OA 3U0BA 3UWKA 1HDGO 1PS0A 4OHMA 5ALTA 2HHJA 3Q85A 2BBOA 5HWSA 1GT91 2O59A 1NF2A 3OEEA 2GBPA 4N0MA 4Y2SA 3OQHA 4L8FA 3HHPA 4V3CA 1E79D 4I5GA 1ZZGA 3K9BA 3KXIA 4OGFA 4C1BA 4G1UC 3RW9A 3SIWA 2A4KA 4RTSA 2OBBA 2Q4OA 2VPZA 5K3SA 1MJNA 4IKPA 4DANA 2OCLA 1PQ4A 2ZRDA 3L6BA 3LK6A 4L9RA 4TTPA 4B6OA 3W8FA 1OW3B 4BNIA 2REQA 3LKDA 1M2KA 3D59A 3DZGA 3RYCB 1QANA 1YJXA 2RKOA 3AR8A 4L76A 5BR8B 1DUVG 1T3HA 3ZK7A 4CM4A 3GY0A 4K2HA 3P27A 3SXJA 2JFWA 1ZHHA 1FL9A 3TRIA 1OX4A 1N4AA 2ZCJA 3PJDA 3TINA 3C6XA 1UBLS 4X7RA 1GDTA 3L7DA 4LJ7A 2QMHA 4Q9HA 2XYRA 3BIFA 5KQSA 3WYEA 4WK0B 5HQ3B 4BDSA 1HEUA 4DLUA 4E7OA 4ESEA 1YUNA 5BSFA 3UK1A 1ENPA 3DJFA 2Y2VA 4NBLA 3A4TA 5A6SB 5FNVB 1E92A 1YUBA 3V8VA 2DPYA 4CG1A 1UUFA 5BQPA 3VZBA 3P2IA 4EVIA 4ZHQB 4ENWA 3E2IA 2H8GA 4LE2A 1GL6A 4JLAA 3DW3X 1P75A 1K8YB 1YH3A 4I3HA 4M38A 4CFYA 2IXEA 3AFOA 2ZI5A 2HAEA 4O4IB 4DQKA 4QRHA 4GKVA 1AHPA 1YB2A 2YVAA 4WH0A 5ALHA 1BW9A 5IABA 1ORTA 2BSXA 5F3DA 2BTEA 1GCUA 4R0VA 2PG3A 3H0EA 3T8YA 3J81k 3GOQA 2Z04A 3DKIA 5C0OE 1EAYA 3CH6A 4ZO8A 1C1DB 3PPVA 3GJ6A 4NZPA 3MRSA 4BLRA 2CL7X 1NXPA 1PWEA 2IFTA 4GXNA 4IHKA 2H9YA 2BFBB 3CIFA 4LKRA 4S1WA 1JZSA 2NVWA 2CF6A 3QUQA 3E70C 1QNLA 1J0DA 3PQ3A 3ZGNA 3VPSA 5LLTA 1AH2A 1OAOA 2NWQA 1Y4DE 3M4XA 4UDYX 2MSLA 1C1XA 4LJRA 4JCCA 1EP2B 3JQBA 1HQCA 1Y4ZA 3NIWA 4BQSA 4LFBB 4IQ8A 5ALEA 3P19A 2O3JA 3IXQA 2O8FA 4B3BA 4ZCIA 2QB5A 2WIGA 2O4CA 1RI4A 4HB4A 4OK6A 3RSHA 4EHKA 4F56A 2XCRB 1YRBA 1OXUA 2B9VA 5I7FA 2AFHB 4EPXA 4JYBA 1WW3A 4RA6A 2XUAA 3RK4A 3TNFA 4UHCA 1JHZA 2YZKA 2AFIE 4L16A 1Z8HA 3OUZA 1NDHA 4ZRNA 3I2HA 4LHYA 4DFDA 2CXHA 3PUVA 3Q8KA 3G6KA 4P4SB 4Q1AA 3EWAA 2HSZA 3DDUA 3MIIA 1I7PA 3QK7A 2OLEA 4REMA 1W52X 2G1AA 4WZBA 1L8OA 4NYIQ 3IT0A 3FLAA 1H0HA 2QN2A 3HU2A 1GXSB 1A9PA 2A5DA 2CL0X 1KP3A 2ZPUA 5JMOA 3DXFA 3AVYA 1E1KA 4BKQA 2P9JA 5KWIA 4EY4A 2WWHA 1PQWA 4N76A 221PA 4LWPA 5D01A 2VDVE 1IEXA 2NT4A 4FYPA 2ORVA 1T43A 4AJJA 1F9EA 1H5NA 1WUTA 2FX5A 4EO9A 3KEMA 1E5DA 4BBJA 3ZV7A 4EFLA 1AUOA 4A6XA 3UKDA 5IXSA 2HIMA 4IO0A 2XLCA 5A4FS 1K7YA 2VJLA 1ZS9A 2YCLA 3DVAA 3K09A 2AXNA 4MDYA 3EGEA 2CUTA 3EVBA 1SEVA 4CMEC 4L75A 4HLDA 2VT7A 1CY8A 5BW4A 1NXQA 1PK9A 1LX7A 1ZM4A 5CUQA 2Z4SA 2Q5CA 1R6TA 1OYYA 1IN6A 1HG1A 5AM1A 5EZYF 4FE3A 5CITA 4MQFA 3IQDB 3ND6A 2H4FA 3R5JA 4HRAA 1UM9B 1YF3A 2QU7A 2EX0A 4BHTA 1OOEA 3H75A 3ZDDA 1Z83A 4X45A 3Q11A 2YMPA 3LKVA 4HGRA 1UT5A 2OEPA 1M1YA 4HN2A 3PX7A 3D8RA 1FYDA 3TB4A 3AXTA 2VNAA 3FF4A 4KR3A 2ZYDA 4MXDA 3ZWVA 4W9MC 1QPGA 3L6CA 1KJQA 1KRHA 4GOLD 4MS3B 1ZI6A 1HWYA 2LTAA 4IIHA 4R3UC 4Z1MA 3SZLA 1E3MA 1BGVA 2BMAA 3TUZC 1NQTA 3PD0A 2YICA 2VJMA 2XE7A 3CSDA 3IQGX 4RFSB 3V7UA 3VH3A 1KP9A 1KA9H 3PCXA 2IE0A 4KCGA 3VH2A 3OE5A 3W5CA 1NVAA 2OOKA 2GHIA 1KEVA 2FN8A 2VRWA 4ZARA 4H7EA 1HZZA 3ZWOA 2F9FA 2WHYA 4GI5A 5C1PA 2AOTA 1FRVA 3P9NA 4IEIA 4J29A 3F6PA 3UGTA 7YASA 3E8MA 5IVHA 3KJHA 1V26A 1G8PA 1V9SA 3H2GA 4FXPA 4RKQA 3ILSA 4LHXA 3VR3A 1VI6A 4U0KA 4ER3A 3F8TA 4LBYA 2Q5QA 3FVVA 3JR3A 1ZXLA 3CMCO 1N2CB 3DFZA 3JYLA 1U8AA 1EUDA 3UK7A 2A86A 1IUOA 1MAHA 3HCPA 1CUBA 3KELA 3RKUA 4E1VA 3P9SA 3I32A 5JBNA 5F4BA 4TMWA 4WI1A 5B1EA 4FN5A 2EJTA 3NAMA 3AEZA 4B0PA 1SEPA 2PMEA 2YQ5A 1BX1A 1GFWA 4RETA 4B3CA 5ELMA 1YS1X 1YA4A 1YR2A 3IB3A 4JAVC 4L8WB 3TAXA 5IFKA 1T4GA 2JLVA 3ENKA 3P5SA 3Q7TA 1D5WA 4DIDA 5JCJD 1VKRA 2F3RA 5E9AA 1P74A 1YQQA 2RGXA 1GL9B 3ZCRA 4RV9A 4QQNA 5FAXA 3TN7A 1QO0A 3BDAA 1VBNA 4A6PA 2J3LA 4Y3UA 1BVYF 4AICA 4J91A 4TYYA 3DM5A 5IBQA 1GTG1 3D8SA 2GZ1A 2Y1LA 2LUOA 4H7JA 5FOXA 5TS2A 3WGVA 1CVIA 1FFDA 3WGMA 1RRVA 3GVPA 2PHZA 3ORYA 3W4JA 4DRZA 4CNBA 3CT4A 5D3MA 4MRPA 3ZH2A 1Z18A 4FM9A 1ST3A 4ARIA 4MUGA 4BWVA 3IDFA 3MFQA 3P2YA 3T9AA 3S1SA 2CXXA 3MJTA 5DF1A 5CM8B 3PC7A 3MT8A 4P7GA 4AZ3B 4BQOA 1SCUA 2HF2A 2PVPA 1OA1A 1T5BA 2AI3A 4D3FA 3IUSA 3BAZA 1IY1A 2J1LA 4GBJA 3VR6A 4P38A 1FJ2A 3SQDA 4EHJA 1ZW1A 1E20A 5LQAA 4YRLA 3LUGA 4ZVUA 5C1DA 1N5MA 1X7ZB 5BN4A 5JPIA 3OTIA 4ZVNA 5TMEA 1G21E 5BV1A 4IDPA 4LZWA 3LRXA 2IYSA 3ZYZA 2R11A 2VWHA 1C0LA 1K7EB 1PW5A 3KSAC 2IU0A 1LGYA 1GILA 1O5TA 2ECPA 3W6NA 4OXIA 2I99A 3W3ZB 2W48A 3GH3A 5GGYA 4XWTA 4O4HA 4HVLA 2PWPA 2WG2A 1ZCZA 3EZ7A 4MVYA 4UFNA 3B36A 1SWVA 1WZCA 3CUWA 2EIHA 3KWLA 4GI3A 3ZV5A 4MCHA 3PVCA 4R7TA 5ULLA 1RD4A 1AK2A 1QE5A 1UEJA 1ZJ4A 4YRRA 4GKAA 1I32A 2XAAA 4RFVA 3DMPA 4IDOA 1VMKA 4Q16A 2XYPA 2I1LA 3LA6A 4AK9A 4TZ0A 1B8VA 2W2KB 1QO9A 3AUUA 3BE4A 2YBEA 5DN6D 1L1RA 2H54A 1QF6A 4DGSA 1W85A 1SU7A 3A2LA 2LV8A 3OMLA 1JMYA 5LIPA 2EYUA 1GADO 2BEVB 4QAQA 1N75A 1E8MA 2D5CA 1VPVA 2QSYA 4JB8A 2GNOA 3TIXB 1H6DA 3OI7A 1GSIA 3KFXA 4B17A 3R9XA 2QRUA 5EVCA 5GV8A 5E95A 3TQQA 1IATA 3M3PA 2CNDA 5MN4A 3EFEA 2JFNA 1L3IA 2C83A 1VMEA 2RGGA 2WU4A 4J1SA 1GPNA 3O74A 4Z0PA 4BFLA 4P98A 1SXJA 4DV7B 1YTUA 2D2VA 2JGFA 4OJKA 4ZTUB 1Q7CA 1NBMA 3OEWA 1RPZA 1SWWA 4AUEA 1PWZA 4UHBA 3ZDYB 1ZD8A 2BFFA 2Z08A 5GIPE 2GAJA 4MGZR 3DTVA 4AY5A 3KDPA 2ID9A 4U3JA 2ZT8A 4YV1A 3WJ1A 1IFXA 2FA9A 4LX8A 4JDUA 1QFSA 5LQSA 4EY7A 1EMDA 1TD9A 1XHLA 4R3WA 1FP4A 1OGYA 1WP9A 1ZX1A 3F71A 3QW2A 4UCQA 4Y67A 3HJFA 4QECA 3RQIA 2NU9A 4IL5A 2XD4A 3TX6A 1EIZA 2RBEA 2X5NA 3DUWA 5EWMB 3UXHA 3WK4A 5C4MA 5E7MA 1P1RA 2HXGA 5BXYA 4JOQA 4ENVA 3AQ4A 2XX3A 4E6PA 3CH5A 4NATA 2FETA 2QORA 2H92A 4XD7A 4UXJA 1N0UA 2ZZNA 1JW9B 4MA5A 4OJNA 3LC2O 5IEJA 3ME5A 3ZUPA 1C8LA 4E1BA 4RJLA 2N1MA 1EUYA 2O7QA 3TKYA 1MH9A 3KKZA 1DE0A 1GSHA 2NGRA 1J07A 2F3TA 1O96B 4GDMA 4NMXB 4RE6A 3LOQA 4G97A 3UA3A 4NEHB 1NW7A 3MNFA 1V16B 4CEJA 3GP5A 4MUJA 2BCGY 1BU5A 4M7WA 1YR9A 4NBVA 1L7VC 3SC2A 5JNVA 4QFDA 1NUUA 4H3HB 1F1BA 2I78A 4IKOA 3V1KA 4Q4AB 1U0SY 2A9PA 1AKTA 1NBHA 3ETCA 4JLPA 2BHRA 4QYWA 4X6YA 3V7FA 5BURA 3IAHA 1DLIA 5EMNA 4ZVOA 4ARZB 1YMUA 1ULAA 1WRBA 3F6SA 2CHGA 3ZCXA 3JPWA 4OA5A 4ARVA 4AKIA 4UD6A 1OD6A 3FI0A 1J1IA 3K0AA 2GPWA 4OAOA 2ZUWA 1Z4OA 5TPZA 1I6WA 1Q2XA 1VDMA 3P52A 5HE9A 3ZWXA 1ODLA 2KMLA 5AUNB 4CMAA 4D97A 2FRDA 2FWRA 3LBYA 1V8PA 4UHDA 1LI7A 2QXUA 5CCBA 1C9KA 1TTQB 2NQ8A 2QPOA 2KLBA 3EQ9A 3IT1A 1L5KA 1XZGA 3R7AA 4RTPA 3UJHA 4JWKA 4IYJA 1LD3A 1JHPA 1AS0A 3F7OA 4MVJD 1U6JA 3I0MA 3LF2A 1NSTA 4P5EA 5TGDA 5ALDA 3WZLA 1C1HA 1VP9A 2E4ZA 4BVAA 4IUCS 4AJ2A 2J4CA 1HURA 1PJTA 4DF3A 1U0OC 2DT8A 1KY4A 3FMOB 4ZRMA 1F12A 3KSMA 5H4HA 5FA5A 2W70A 4ZMBA 5J4LA 2I9PA 1VP3A 1L4BA 2O1EA 3PKJA 2VL7A 3I05A 3LQYA 2RGWA 4B4DA 5ITWA 1WCIA 2Y0BA 3FPGA 1DWUA 2XJ9A 1MO5A 1QTNA 1DG3A 1ZA1A 3H4TA 3IAS6 4YVFA 2A0UA 4PWZA 3SHVA 1QPZA 4GR5A 2QV0A 1OBHA 1CZUA 1EE9A 3CY6A 4Q1CA 5D87A 3U17A 3U4GA 1RTTA 2ZTHA 1N5KA 1QOPB 2IJGX 5KYUB 3S8EA 4C07A 4P0QB 2Q4EA 3NTXA 3R76A 1PK8A 4DBLC 1UMBB 2CLSA 3M0EA 4QJIA 2NSHA 1OV4A 2QMZA 1QH0A 1XD2A 4WEOA 5E4JA 4R1QA 1E1QD 4U8HA 2ZQYA 3VOBA 1C30A 4PRKA 2JEYA 4LXYA 2IYWA 2NO0A 2YWBA 3E7WA 3K31A 1MPTA 2ZAIA 4Q4HB 5JZOA 1T2CA 3B82A 2I6XA 5L9AA 2CJWB 4RPIA 2P4QA 2COKA 3U2QA 3W5UA 1XMQB 3GD5A 3AVVA 2JFYA 4AVYA 1NZFA 1U3TA 1JEYA 1UJ2A 2R7MA 1RC8A 1SHUX 1CYEA 5JNRA 4CQMA 4UAUA 3INNA 1L7AA 4WCFC 3MA0A 5AKZA 5U9CA 4OX9B 2V5AA 1AN0A 2YZGA 3QPWA 2EG5A 3M6IA 1VHWA 4LWOA 2LIPA 5TQVA 2NUAB 4CLOB 4ETWA 4RYLA 4TT8A 2B37A 3BMXA 3LT1A 4L22A 3SC6A 4XWAA 4U7TB 2HCBA 4AJ9A 4IZHA 1CVRA 1V1JA 2JGRA 3BXGA 3U81A 2WK1A 4GM1A 1B0ZA 2KLHA 3QKUA 3RAPR 1NW9B 4QTXA 4A10A 4BRZA 2DAPA 1PR4A 3BC1A 3TJZA 5KHLB 3VJKA 4NCBA 2YV1A 5EP2A 3OE7D 3CO0S 5JD5A 1DDGA 4QOFA 5KOJA 1EJ6A 3HMQA 3NPAA 1A77A 3LFUA 2GSWA 2R47A 3C70A 3AZQA 1T0UA 4OJTA 3ILVA 2DRIA 4G09A 4K1XA 5H3CA 1PNVA 4EF4A 2DFDA 4MVJF 3E9NA 3I4FA 1J20A 3LGSA 1NHGA 2WUGA 3N2ZB 5AM5A 4UULA 3A26A 5FLKA 5JR3A 1VIAA 1LDNA 5I5EA 3ZLTA 3NV7A 1KEKA 4IIGA 3Q3JB 5KWVA 4X95A 5LCXA 1DAOA 5B2ZA 3M5WA 2EATA 1XBTA 5ECDA 2O05A 5FPQA 4AULA 2VYQA 4YQFA 3C3CA 5JHHB 3DL2A 4MUBA 3BPSA 13PKA 3K3PA 5JYCA 3UN1A 2NO9A 5CU7A 1IZZA 2VP5A 4HI0E 1XQXA 2LD4A 3DE2X 5JAUA 1ADJA 5ALYA 2W37A 3VPBA 2CFCA 2GN2A 3RYFA 2C4UA 4X24A 2TS1A 2VTEA 5TGZA 2O19A 3DT8A 1L4UA 5KC9A 3C3DA 4HEJA 5HRCA 1COWA 1G4AE 2XSZD 1NQUA 1XRSB 2XI4A 3K2EA 3R5FA 1KFBB 1PZNA 5EUCA 4PCLA 5LA6A 2A9JA 1VA4A 3WS7A 3MT0A 4OQLA 5A5VA 4P3PA 5AI4A 1QQBA 5FBHA 2YJGA 5HFJA 5FHQA 2H1OA 5JS7A 3F3MA 4WRRA 4O4JA 3ICCA 2IQIA 5DTRA 1YMVA 3SF0A 1KP2A 3AFHA 4HV4A 1LBHA 2WTXA 1Q1GA 2D0PB 4MV6A 5DHQA 4AXBA 3FYUA 3M70A 5KSZA 4P3KA 2SCUA 2DLDA 5LD2B 3DEKA 3X1YA 4CMGA 2O7VA 4NKRA 3TTSA 3KZ1E 2IW3A 2VBFA 3T1QA 3P0EA 5CIWA 4D0GA 1E79A 1WB5A 1BD3A 4HQKA 2DWQA 2W2VA 4DTCA 5H16A 5C34B 2AG5A 1XEFA 3HR8A 2ZYTX 4BE9A 1EU1A 3UW1A 2MIIA 2QX6A 5B1SA 1UKBA 4RK5A 1JHXA 1EVKA 1C7RA 2X58A 1UMKA 4C6HA 3NBUA 1QWSA 5E3JA 2IEBA 2Q8QA 4DXDA 1TFUA 4UOEA 2C3UA 3AU8A 1Z75A 2ZRHA 2QVYX 5TJHA 3WRYC 2O0KA 1MAWA 1T29A 2AF4C 5JHGB 1F2TA 1XE3A 1EVIA 2E4WA 3CWCA 4GYJA 2QVGA 1SQSA 4XIGS 4EF5A 2X22A 5A4JA 2K2WA 3ANXA 1WD5A 4W4TA 4ZANA 5DLPA 3EQ2A 3HDJA 5FB3A 4JJGA 4IIJA 5T4BA 1V5IA 3FB1A 5T3YA 2JAQA 3ZXYA 2BP7B 3ENNA 2VH1A 3TOSA 1ZXXA 2AOXA 3AFMA 4BMOB 4C0QC 1SULA 5FO0A 4DDWA 4I36A 1Q50A 2LP4Y 3PEWA 1LDYA 3L5OA 3AM3A 3GW8A 1WZIA 1QIFA 1VLHA 2VP0A 3DBHA 4MOWA 4FEEA 3USZA 4GC5A 2NT3A 2N0SA 4TL9A 1G38A 3TZEA 1NX6A 1IK6A 5AP9A 4EO4A 1I3KA 3TTXA 2VHTA 3WADA 3DDHA 5AOBA 4FEYA 5GJCA 4DNPA 3BFKA 1OUMA 3DKVA 3S2UA 3E2PA 3QPDA 1RQ7A 4MQEB 2PT7A 3TIGA 2OMEA 4IGKA 1NI4B 4R8LA 5EZYA 5BO5A 2IUUA 1QG6A 4NP6A 4RS3A 2G9RA 5EHIA 3PQEA 1NUHA 2CE7A 3S8MA 5HYVA 3UMGA 3R0IA 4E5DA 3R3XA 3DEHA 1Q0UA 3LYHA 5T67A 4DUPA 1VLVA 3FPSA 3VUEA 3MD9A 3GCGA 4M1TA 1E7SA 4IV8A 4N7RA 2G17A 3IELA 4RMNA 3WGHA 3FMVA 2RHCA 3F3YA 3L7KA 4J3JA 4RABA 4XPIA 3VYWA 3MYRA 2ZUTA 2VCYA 4WXPA 3DL7A 2JI6A 3RWBA 3P2EA 1ND5A 1SZCA 4AYWA 4Y0VA 3RSGA 4BECA 2NAPA 3RNLA 2QTHA 4MWOA 4EEXA 3T3PB 3H5WA 8ADHA 1GFZA 2RI6A 3OHSX 3OP4A 4N3GA 4ZOEA 2RH4A 3ESCA 2JLWA 4HEA6 1AQNA 1JVSA 2M9MA 2WJVA 4GICA 3ZNOA 4D9EA 3T7EA 5M29A 3FVQA 4NBKA 4EHIA 3CR8A 2PGAA 4XWGA 2PUEA 4A0QA 4P2BA 3FNFA 2V7PA 5IZCC 5M2QA 3OETA 3TMKA 1R1DA 3K94A 4CKWA 4XGIA 3OHPA 2AQIA 1GSAA 1OZGA 2D4AA 5JT1A 4JI7B 5ALVA 1QCYA 2ZUUA 3M83A 3URMA 5K0SA 1YVRA 3D5TA 4P8RA 4DCMA 2G09A 4EKYA 1QIDA 5FTWA 5HFNA 1WABA 2DPMA 3NVDA 3SD7A 5MGBA 1CFZA 2ZRFA 1WB4A 2YZ2A 1IBRA 1FNNA 4NV0A 1KPIA 3JQEA 5E6UB 5I45A 4MKXA 4DYVA 4BRWA 4UEWA 4CUKA 4QO8A 3T1OA 4I6JA 4AX8A 1ZITA 4N7BA 1W46A 1S8OA 2CDAA 2EF0A 2KHZA 3KC2A 4KOAA 2VSNA 4PZYA 4NNPA 4PICA 4RH3A 3ZGLA 1WPGA 2BMWA 1T2NA 2YHUA 2HBZA 3A9CA 4OYLA 5CM2Z 3VM6A 5CAEA 1FZQA 4NVRA 4FI3C 2XDQB 5K6AC 1FBNA 2XGJA 1E0SA 2WVGA 4JB2A 2EV9A 4JI8B 4DIBA 3UT0A 1SUEA 2RK4A 3V7WA 4PG7A 1CUFA 4BFWA 2E85A 4UM5A 4NEGA 1NNI1 3K1AA 4MYSA 5C7LO 2ZRKA 1N1GA 1DWPA 2AF3C 4FD3A 2NVUB 4DWVA 1SOUA 3NVMB 3GGJA 2PU5A 1GDDA 4MVJP 1LDGA 2LDXA 3ABSB 1ZNZA 4Q1FA 1R6AA 4EJSA 2HUNA 5K6RA 4CF5A 1S3FA 4PM4A 2Q50A 2JI8A 1L5HA 1Y1QA 5B7NA 2IRWA 3A06A 4REOA 5FP0A 4CM7A 1JZQA 1U2PA 3B6ZA 1M1NB 4PLPA 1KVQA 2PRJA 2Q28A 1JP7A 3AC0A 2MR5A 3MK31 4JEMA 4EKGA 2B98A 4RVGA 4F4FA 1VL0A 4ITVA 3TZ6A 4EL0A 2G1UA 2AN1A 2QR3A 3RRYA 2FPIB 3AF2A 1N7JA 3OJWA 2C2XA 2VYFA 4FHGA 3DZKA 5BMOA 1O6FA 1BKDR 3O9MA 1DFIA 4ZYLA 5M04A 3UMJA 1R2QA 2XB4A 1F0KA 3ZKAA 4H1HA 2P6OA 3KJGA 3WQHA 4IY1A 3D81A 3NYQA 5ILQA 2VIIA 1QHYA 1JZTA 2CZQA 3SIPA 1P0CA 1NYTA 1TQ6A 3GT0A 1MFZA 4I5IA 3TFWA 3UJ7A 1CEEA 4Q1VA 5GADl 3QF4B 1KAQA 2WLTA 4JEIA 3DDNA 3KDAA 1SK9A 1OREA 2HQBA 1FFXB 4M54A 2QIPA 1IHDA 5I51A 1CNEA 3AH8A 2AX4A 1E96A 1YQWA 5ALZA 1IY2A 2BHLA 2R7KA 3DMHA 5EJ2A 3QOXA 3U4CA 1G291 3QTTA 1LWOA 1KIAA 2Q4DA 3ECCA 3NWPA 4F2DA 4CKBA 1M54A 5IHXA 1Q22A 2JCYA 2MSNA 5C80A 2MINB 4KAXA 4FPXA 3K72B 5HK8A 4ZVKA 4BEVA 2IP1A 2X4DA 4HNTA 1RYMA 3ES9A 3N0VA 5K8CA 3N1UA 4ZI7A 5CTJA 2GVZC 2HLNA 4Z9AA 5JCJA 2OQVA 5LOVB 4AQ7A 5G1PA 1ZL2A 4ZP1A 1PEDA 3GJXC 3H13A 4FYHA 4H3KB 3DE6X 2OT3B 3EMVA 5DNVA 2PZMA 1CLEA 4I4NA 5ENVA 3TSOA 4B33A 4BZZA 3NBYC 1XNHA 2PLFA 3GC6A 5CLLA 2FN7A 2J4FA 3Q3VA 1IN5A 1WEKA 4DV5B 1NIPA 3HMKA 3RHFA 3W8RA 2ON6A 1E1YA 1G8HA 1Z16A 5TDHA 4BB5A 2LZ0A 1M75A 3KJIA 4AZTA 4GYKA 5TF4A 2MYPA 3D6HA 2DQ4A 3QVXA 4FMDF 4H2DA 1LLCA 1YZLA 4J1TC 3ZC3A 2BBSA 1A7JA 5LJIA 4YCNA 4FONA 3DSRA 2FLKA 3O47A 1Z7YA 3N53A 4KR2A 1W4AA 1Z8FA 2YHIA 1GGVA 4G0OA 3F5FA 3KVYA 3R9KA 3KSRA 4AWXA 3GLGA 3UOGA 1TJYA 1I51A 1D8TA 1JJIA 1IAVA 3UY4A 4BNUA 2HF8A 3NJ4A 2QSZA 1YRHA 4JLSA 2QT9A 4DLSA 2HK9A 3AOEA 3SHTA 5DIZA 2EW2A 2C20A 4PVCA 3H4MA 4Z7OB 1FLVA 4ND8A 4XTRA 2O6LA 3RLFA 3D6JA 3WGQA 5H9WA 3PHJA 3B6JA 4DV6B 1JSXA 1TZKA 2IYQA 1DB3A 3FY4A 2ZBQA 4I55F 5SV2A 4DG8A 1GLGA 1QYRA 1YZFA 2QE7A 5JDCA 4XB2A 1IHOA 5L45A 2FHPA 3QITA 4W9NC 1V2HE 5IT9A 5KPJA 1GUZA 4PXSA 3C48A 6GPBA 4QBFA 4E03A 1JS1X 2B30A 1NHWA 1W87A 3FG9A 3GLIA 4PLTA 2BYTA 3NFYA 4DJJA 4IEEA 2R8PA 3MWYW 2PMKA 5AM4A 5DM60 4MW2A 3IT2A 1S3GA 2VA9A 2WJWA 1L7DA 1RRMA 2ONKA 3T94A 4AS1A 1CIJA 3BZBA 3DOOA 1USVA 2WFMA 4FWTA 1MKYA 2QXTA 1RLJA 1EDEA 1PGJA 1X74A 1X80A 2ES4A 2H85A 3CX7A 3CW9A 3DBRB 3GQVA 3PNMA 2OCKA 4JUBA 4KQ6A 4QU5A 3UK6A 1TTTA 5CFLA 4M1ZA 3WP1B 3ZOZA 1FB5A 4FYXA 3DV0B 4FNOA 4EVQA 3H9UA 4FYVA 4B32A 4PHHA 1LA2A 3AKCA 5DN6A 3DQQA 1XSEA 3HR7A 3O8LA 4B2IA 3TGLA 1KR2A 3QY9A 4J0HA 2XZOA 1O95C 1JDTA 5A2GA 1DAEA 1RRKA 1WVGA 3JU3A 2YQZA 2P3QA 4KLRA 4Y9SA 1QVZA 5FR2A 3CW8X 5AM2A 3D8BA 1RHQA 1Z8DA 2W11A 3DCIA 1H0KA 1KMMA 3ND8A 4GPAA 1E1CB 4M0PA 3UMVA 3PFIA 2AUMA 4B7CA 4BGUA 2K87A 1H3EA 2OAEA 2J9GA 3ZXXA 3RC8A 4DQ0A 3UM9A 5AW0A 3M8KA 1J8FA 1TM3E 2R79A 2WJZB 1WQ4A 3OPXA 4JQYA 3DTYA 3N3AC 4EYGA 4RCVA 4Q12A 3AUXA 1U1GA 3SE7A 1E2UA 2ZS7A 4OQXA 5HCIA 1HTBA 1P3JA 4MINA 3FDIA 3SX2A 4FSDA 4LY9A 5G02A 5AUPB 3OIVA 2PS1A 1CY1A 1N8NA 3GG9A 1MT0A 2ZWOA 3H99A 3P1JA 1X1QA 5TT1A 1FDTA 4DDVA 5CFOA 5I7WA 2QP3A 1RAEA 4KE7A 5T6BA 5B30A 5BSWA 3VJRA 2XRYA 4EKNB 4L1KA 1OA0A 1U1FA 2X0KA 1QHGA 3B60A 2BL4A 5IJ9B 1YGPA 2GM9A 2CXPA 3INRA 3QHAA 1EFAA 4RADA 4GNRA 4QUEA 2FWPA 2PUVA 5JZBA 4ES6A 4D4HA 2PSEA 2JJYA 3CE9A 1DBVO 2PR7A 4J03A 2Q9AA 4TSRA 2JD2A 4L2IB 3V1NA 3AY0A 5ER6A 4TKVA 2ZZMA 3OOJA 4IICA 1ZICA 2GM3A 3C4QA 4WNCA 2HV9A 3RSZA 3RRFA 2C7RA 3AILA 2BJWA 4G89A 3DL0A 4YROA 2X4IA 5FFNA 2RGEA 4RDXA 5K7SA 3NETA 1EVEA 2YJZA 4DCNA 4CIWA 3N2IA 4HS9A 1Z22A 4K6CA 4QOEA 4XVQA 3VTKA 1W4BA 1CQJA 3I1FA 3LZ6A 5B2FA 1JDBC 2ZS9A 4PZZA 3O26A 5IJAA 4LX0A 3SBOA 3NBMA 1I80A 1T4BA 1M6EX 1K5PA 4IZIA 2AUNA 4RPLA 4XX1A 1O9HA 4CIDA 1UPXA 3BGDA 3A6JA 4OBBA 4LG1A 3IV7A 3RBVA 1U8EA 5AKYA 4XCVA 1YCGA 1Z2DA 4ZO9A 2ZYWX 3C15C 2GARA 4H0CA 1Y98A 2NW6A 3KR9A 5EHGA 2ENWA 3IBTA 5UKDA 3NHKA 2V0NA 1UBKS 1R15A 5ERXA 3VHLB 3EXEB 3PLRA 1TCUA 1FNMA 1T3LA 2WILA 2OV2A 1M0SA 4DM3A 3ORRA 5JSQA 2O8BB 5LM3A 1RWBA 2OV3A 5BW6B 2PO7A 1VG1A 2AG6A 3FB4A 3WLIA 4DJDC 4IPTA 4ENSA 2BF7A 4X6LA 3HJRA 1GA6A 3KSZO 2V9PA 5K0BA 3RASA 4PO8A 2OVFA 2QZZA 2HH9A 3QNMA 4TGLA 521PA 4YI3A 3IMCA 1QMPA 1GKYA 1ZPDA 4M9XA 2H1SA 3HM9A 1JDPA 3E81A 3ODPA 3C5EA 3N8DA 4MVJA 3WGTA 5GZ6A 1WUHS 3NHPA 1G8SA 4R51A 4F12A 2ZIVB 3JQ7A 5JBIA 3U7HB 1KNQA 3EBLA 1JPVA 1E3LA 1OJ7A 3HA2A 3UANA 5CA0B 4EB8A 1L7RA 3HB7A 3PV0A 4EJMA 1G60A 2ORWA 3KS9A 2R6GA 3GLFA 1W36D 3KG2A 4C0SA 2C1EA 3TD6A 5KSOA 2BISA 2PZJA 3PRYA 1ZJJA 3NVKI 1Y9ZA 1SR8A 2XUDA 4KGXA 2ZR0A 4JBXA 2DHRA 5CX1B 5AKJA 4B44A 4ZT2A 4ABYA 4IUBS 5B12A 3UJCA 4BZPA 3NUGA 1AN9A 2ICAA 5AVRA 1FDVA 2O8VA 2Q45A 3LTNC 2VQEB 3EDMA 1CRWG 2X9NA 5E7QA 4AKTA 1PNRA 1KMCA 1RJ9A 4OB6A 2VFAA 2PBZA 2FW7A 1E1QA 1GPYA 2EGUA 3P9CA 4NMLA 4PIVA 3LZDA 5FEMA 5CA1A 5ICSA 3G6WA 1SC9A 4AJNA 4YXFA 1ZBQA 3F7NA 4MLCA 3F1LA 5KU1A 3T1HB 2GEJA 4UM7A 2BSAA 2UYOA 4UVDA 5GONF 1Y1SA 1OU4A 1XP8A 2LNDA 2WJPA 3NV9A 2ZUBA 3D7KA 5EIFA 4UPVA 1R0LA 4PR0A 3WLRA 2RE8A 1YCHA 2QX7A 1BXGA 2QRNA 1WSWA 4PONA 3FCCA 2C04A 3V1LA 1T8WA 4B2YA 1KEPA 2HJHA 3ZG6A 3ZZTA 1P7WA 2CF5A 3WLNA 5CB4B 3MGBA 3Q8WA 3GZTB 4ZT5A 3DF9A 1Y6RA 1E3QA 4EFMA 2REBA 3K96A 4QUDA 5SY9A 2QM3A 2YY7A 4RGBA 3C7AA 3F7MA 3MLBA 2RG7A 4NPCA 1TVMA 3AIKA 2ASVA 4I4LA 1GGKA 2HIAA 3S2FA 3A8TA 1A9RA 1CTQA 4BO9A 3VVLA 2C4VA 1R4ZA 1T5LA 4D8VA 4OA8A 4AJHA 5DCWA 1D7AA 3OE7A 2IL1A 2V7TA 5CA0A 4AECA 2ZYAA 3OQIB 3JALB 3F8WA 1RXUA 1VL5A 2AKAB 3AY7A 3CZAA 4JCOA 4XIIA 1T3TA 3WQBA 3Q9NA 2AUTA 5AW3A 4L6AA 2FFQA 2JBAA 3A4NA 2I6FA 4CM8A 1LTKA 1MB2A 1PG5A 4ERXA 1YZYA 4DMKA 5K09A 4CM5A 2W42A 3OC0A 4P08A 1K9VF 3ICOA 5KSWB 2WJ3A 4WLUA 1E4VA 5EFOA 4AUKA 5K45A 1KQOA 1BXRA 3OESA 1JAXA 1S3IA 1Z5VA 3KKNA 3O95A 2GH1A 2AOUA 2LVBA 4QXQA 1M34A 9LDBA 3GFPA 2F55A 2GEFA 3WZ2A 1E6UA 2WAOA 2XITA 2Y99A 1Q1BA 2V8OA 1FUKA 2ZSEA 1O9GA 3DNFA 3GAZA 4O1HA 4BWYA 2MCFA 5K0TA 4V02A 1YIOA 5KUTA 1N7HA 5BW8A 5J1SB 1D09A 3RHSA 1FBTA 3IO5A 4OK5A 4YAFA 3MILA 1L5GB 2YJTD 2IYYA 4PO3X 3HA7A 3I2YX 3KKKA 1WWKA 2JGAA 4B5KA 2PGJA 2XSZA 2WRZA 1MVLA 3PPXA 3TD9A 4B80A 2Y0CA 2F4NA 2H1HA 4QREA 1ZMOA 4QVGA 2EW8A 3EC7A 4TMTA 4PU0A 4XDGA 1Y6JA 2OZVA 1YQXA 2HQSA 2Y1WA 3O3NB 2FCAA 3RTAA 4CMIA 1IJBA 3CZ4A 2A5YB 4QJ4A 1Z0ZA 4MWEA 2P5TB 4Q9LA 1P2TA 3DZJA 4M60A 2YWFA 2AHRA 2VSFA 2H6EA 3WSTA 1KJZA 3PHCA 4TYNA 1LSJA 2E9SA 3RWMB 4JKOA 1Z5ZA 2Z6VA 3EPJA 3Q7IA 5CLIA 2I9KA 1IUKA 3L79A 4DIUA 1P7VA 4JBWA 4LWQA 2X2EA 4MO9A 2XCUA 4RKYA 3PI7A 4HK4A 3A1NA 4TMZA 5C32A 3PNQA 1XDGA 1JDZA 2R4QA 2PH3A 4ZYZA 3JCZA 1G1AA 3DAYA 3OWXA 4EHNA 3JATB 4RO0A 3IQEA 2Q27A 2Y0EA 1DAGA 4XFKA 1MX3A 2WFZA 3UAWA 3ZY4A 4EDFA 1NOKA 2FB9A 3H1EA 4LHWA 3EVZA 1NU6A 4BQRA 2VKQA 1KQFA 1PNTA 1QC5A 2I7XA 5DLEA 4ACBA 3Q2IA 1A98A 1FX0A 5JMTA 1S0UA 4H4DA 4M9CA 5CJ2A 4YMGA 4DL9A 4WCVA 1GFSA 3ZCSA 1ODIA 3T7JA 4EG7A 2FKNA 1TLFA 3LBNA 4PO9A 1AMNA 1RAIA 2J48A 3D3QA 1CPYA 2W6PA 2BJVA 3D0OA 4WK6A 1P44A 3EY4A 2B99A 4ZT6A 1Y9EA 3PQ8A 2PMCA 2OSBA 4I8XA 3BTSA 4C7OB 2FK8A 2YUIA 5BWMA 1U2QA 1HH4A 3EISA 4FZJA 4MEAA 4R0MA 3COSA 3N07A 1MZPA 1IEWA 1LWNA 5FWYB 1VL6A 3Q8LA 4RZSA 3WX0A 2G36A 1E7RA 3E1GA 1QE3A 4AWBA 5AIBA 2I76A 2NZUG 2VHYA 4IIVA 3FSRA 5CFPA 5IJ0A 2XGMA 1U8CB 2XWBF 3SEAA 1OCEA 5FLEX 1P4JA 1BC5A 3LBAA 3TZKA 2WINI 2YY6A 1TUIA 2HPHA 4K7JA 2ZJOA 5F3WB 1N5DA 2QPTA 3I1JA 1EINA 3K73O 4JT8A 3T3GA 4L8GA 4A2CA 4AZSA 1K97A 4F5EA 1X7WA 4N6NA 1ADCA 2C03A 5CMLA 3ZVMA 4P54A 4WMLA 3QLEA 1POWA 2IZ0A 3FNGA 4G63A 4JLNA 4AF6A 1L4GA 4CT0A 3G5UA 3GQBA 3EXFA 5IMBA 5IH3A 1DC7A 1M1UA 3TW0A 1R5JA 2JK0A 2QSUA 4QPZA 2ONCA 2CDRA 1Z5NA 4XUCA 4HNHA 4DIEA 2YXLA 5MF6A 1WU7A 2BOVA 4QGFA 1OC2A 1ZUIA 3BSYA 3CZ9A 4B3MB 2O2IA 3GGSA 2FEWB 2P6PA 2ZB8A 3B7WA 4M1SA 1TIKA 2XV1A 3E7PA 1UMDB 2AEFA 3VTZA 2FWIA 1VYHA 1PN3A 3CNEA 5JMWA 3L05A 3LBFA 1YU6A 4QLOA 4DM7A 5KYXA 1B8UA 4MTLA 2JIPA 2HKIA 1NMZA 1WXXA 1QS0B 4HPXB 4QD3A 1R8XA 4WT7A 4YDSA 4ZVSA 5LWQA 1Z7WA 2DSNA 2VPXA 4OFWA 5I7AA 2QI9F 3AWIA 2YXPX 3NHUA 5EUBA 4BMPB 3DZHA 1OJLA 3U62A 3KTAA 5LU9A 1Q2UA 1PS9A 2YWXA 5JSFA 1JFSA 1H4QA 5KWSA 2C8KA 4AJ1A 2FZGA 1ESNA 3OT1B 1Z15A 3TW6A 3RO7A 1CZLA 4TTSA 4QGAA 4DEXA 1H3FA 2C0QA 4WK2B 3T3HA 1EWQA 1Y4AE 1Y9AA 1FMLA 2B35A 2JZCA 3THOA 4C3OB 4U7HA 3O0TA 5F33A 2HEGA 3CINA 3DT9A 2QD2A 5B3AA 1Y3AA 4F97A 1BXKA 3ECSA 1GZ3A 3PJGA 5CFZA 4QFBA 2E48A 5E3IA 1EE2A 4ID3A 4MYHA 3RJZA 1DRVA 3PEVA 1JQKA 2C2OA 3ELBA 4JB3A 2OHFA 5BN3B 3E3OA 2ODWA 1M2GA 1UXIA 1ACMA 4IP0A 4Q47A 2ZSIA 5LP6C 2H1CA 3FCUB 3T15A 3GYBA 4ENQA 3ND5A 1M8FA 4GWGA 3FSGD 2LCFA 4G0NA 4G8DA 1Z33A 5KREA 2NZWA 3U49A 5FLYA 1I10A 3V4FA 4DRYA 4XQ0A 3IIJA 3ONNA 1BCRB 1OXKB 2H1LA 3AUSA 4P3NA 2ZIAA 4ID9A 4JOBA 3MMSA 1TJ5A 4J7CA 4QIHA 4C2BA 4BO5A 1I6KA 2HZ7A 2YV4A 4G07A 2B0JA 5B5SA 4B76A 4NCKA 4B7XA 3NHJA 3D31A 3R20A 4P0PB 1N2GA 4L0MA 1RE1A 3FPKA 3NWOA 2XIQA 1MO4A 2IHJA 1FXWA 3INTA 1ZISA 4HNRA 1OLXB 2P9QA 3KOMA 3T4EA 3TQCA 4I55A 3AM4A 3TLGB 5DX0A 3RNOA 4ON9A 1EFPA 3H17A 2RG1A 2VDRB 3NTUA 3R24A 4KE8A 3H2IA 4PF1A 1YRYE 1Y8RB 1RFGE 2V7XA 1Z4JA 2XVAA 3D6UA 4O02B 3X1KA 3ZCVA 4CKEA 5FL7D 1L0BA 2R8OA 1ZM9A 1EI9A 4TV8F 1KMHA 3SXUA 1PDOA 1UPCA 4JR0A 1T1RA 3KOUA 1U4SA 5IM4F 2Z2ZA 3IULA 4JX8A 1KZ4A 1HBJA 3OE1A 4KI0A 5T57A 1Z5UA 4RX1A 4YXWA 3A9SA 3ZGOA 4ECEA 1F7VA 3K92A 3FDFA 3HYCA 4FWIB 4YALA 4BZXA 5JJLA 2E6UX 4AUNA 2WKSA 2R6FA 3GXOA 3DFFA 3KO8A 3WWZA 1CV2A 1XMSA 3BSSA 4EI7A 3I62A 3CG0A 4M98A 1PFYA 3IQWA 2R8YA 4P3OA 1Q1QA 1DG9A 3W5JA 3NBZC 4LRYA 4NE7A 2FR8C 4IH9A 1C9NA 1SUCA 3C1UA 3TDMA 4Y1RA 3QVMA 1JA1A 1WZ2A 1VPLA 1FP6A 1LSOA 2ET6A 3BXHA 4QLBA 3LKBA 1T0PA 4PZ9A 1ZN7A 2OCDA 5G40A 4MYUA 5JLJA 4YP9A 4FHCA 3PUKA 4MHOA 4RK6A 2VDWB 3B8EA 5EP3A 2PQ2A 3JQGB 2HDWA 1F20A 4JI5B 5JZ9A 3U3XA 3AM1A 4IX1A 1QCDA 2E3JA 1HFJA 4QHSA 4WCFB 2KB0A 3VO8A 2DWUA 2PA0A 4AO6A 4OQMA 4UBJA 1SCJA 1I5RA 5B4VA 5GIOE 3S7TA 1E8NA 4MUAA 3BIOA 1R9JA 4YJGA 4B46A 4QT0A 1QIHA 2H18A 1LDEA 3K4QA 3O03A 2A9FA 1FTNA 3IC5A 4JL5A 4YS6A 1V39A 4LHZA 1CR4A 4AM8A 4Y2YA 3M2TA 3CBGA 1VCMA 4M21A 1Z6AA 4WW0A 4AY2A 4R8MA 2FZ4A 4MGEA 1Z4LA 4IOKA 3HV2A 4R5MA 5CFMA 3O4HA 3C6KA 2OLKA 3EVTA 2QRJA 1M33A 2QL9A 4FGUA 3ZDEA 1KBZA 4ZYTA 4QASA 2E18A 3PICA 2ZUFA 1E6LA 2UV8A 1Q21A 2ZW9A 1VXRA 1GLVA 1CRLA 3LIIA 4JR2A 4ZCLA 4NONA 3CF6R 3GWGA 1GP2A 1FYVA 1C3XA 3ZDQA 4J0DA 3LGAA 1V35A 1CIVA 3HVUA 4P4LA 3B9BA 2AKYA 3ZHZA 5EC8A 2A1UB 4XLTA 3PZBA 2CD9A 3HUDA 2PJUA 2IVFA 2A4MA 2HWUA 4HJXA 3W1EA 3D3KA 3ML1A 4IFEA 4MUXA 4BNFA 5B55A 1GUFA 3NHFA 4Z0NA 3NH6A 4KQIA 3RV4A 4LRTB 1AZTA 4FB4A 5A9SB 3QLVC 2O2DA 4M7PA 1N6HA 2E1PA 2HMUA 2GYVA 2CEKA 3PWTA 4RVUA 3MCAA 4UXHA 5E1MA 4QTYA 1CU1A 1IBLB 3HXPA 1IOZA 4F0JA 3OT4A 4P6VF 2PN1A 1Q95A 1HYEA 2VJCA 1HO3A 3EZ2A 2JFUA 4A73A 1UR5A 1G8MA 3O93A 5J2UB 3T5BA 3C1AA 4UKDA 5KQRA 2QHXA 2DHCA 3UNXA 1WMSA 3V42A 2YJ6A 1XMXA 3EY9A 3NT5A 4Q24A 3WOVA 3ZE1B 4DV3B 3L4SO 4ND1A 2G82A 1TIPA 2J0UA 2J3MA 3FPEA 3S1AB 3BMOA 4N7MA 3EFOB 4JUDX 5IG2A 4CLDA 4MWTA 2YL2A 1VGRA 1U7PA 1DUIA 2ZBRA 2PKCA 3PFGA 5D6NA 4EHBA 3ILHA 4C43A 3B78A 3Q7RA 3ZJUA 4QXPA 1TRKA 2RFLA 1I4LD 5I01A 2CYAA 3DHVA 1ZD5A 1KJ9A 3KUKA 2HA2A 5DBHX 2I34A 4L27A 3G8AA 3N3BC 2C8LA 3SZUA 3HFGA 4P4NA 5CIQA 1W1WA 1UZAA 1ESDA 4AS2A 4NFSA 5HW0A 1YR6A 1ZM7A 3NBXX 4RWZA 3RYTC 3S55A 1R74A 4YI5A 4Q3OA 4AY6A 1YBVA 1E7YA 1X7GA 1YDWA 1T8RA 2V6MA 1CRZA 4DSUA 3GK3A 4KVFA 3FDXA 4S1TA 1XJCA 2Q3DA 1UBFA 2G70A 1WUIS 2BUAA 3WE7A 1LVHA 4XOIA 3DLBA 5EYPB 1I2ZA 2XGOA 5DEOA 3B9PA 3N05A 3V1YA 4NS4A 3EZYA 1EA5A 2IPLA 4BNXA 1U9ZA 1T91A 1VB5A 1NUSA 3MCWA 2J85A 3PSHA 1FDOA 1C50A 4QBHA 4UD2A 4BQNA 2WSYB 1SIOA 4LGYA 2P30A 3OPVA 3W5BA 3SDBA 2ZSDA 1NJ6A 3BJMA 3A3OA 4Q1DA 5CLHA 5ES3A 1XLTC 2IV3A 4C7VA 1U90A 1G1MA 1OWOA 3FE2A 3OQPA 1ISSA 5ALIA 3VO9A 1PEYA 4UNRA 4I1RA 2EP7A 3FDJA 4JJIA 2BFMA 1UAAA 2UZ4A 1M66A 3M6FA 3BSFA 1ZKDA 4TXMA 2XZPA 2H8KA 2H11A 3LXUX 4FMCF 3FPCA 1NBOA 4RUKA 4IFTA 2VLIA 5BMVB 4K8OA 4OI4A 3WL6A 3LE8A 1QAOA 1RI3A 1ECCA 1Z12A 3ODGA 3OY2A 2PXCA 3OQNA 1GG5A 1NVVR 1TADA 1OXXK 1SUFA 1QHEA 2H7YA 4DUYB 3GIWA 3AHFA 2YVUA 5LQDA 1MVOA 3LKZA 2ZXUA 3E3NA 4PIPA 1EFCA 2GK4A 3HJTA 2IYAA 1I6MA 3W2IA 1DO8A 1R6DA 2NSDA 3E61A 3QEJA 2M1XA 3A9UA 4TVKA 1IDN1 3MC1A 3V33A 4BJ6A 4DBVO 3DHNA 4BFZA 2BTQB 3ZGVA 2ARKA 2HLHA 2ZFUA 1SN7A 4KQHA 3RFTA 3KTDA 1LJUA 3D0KA 3EZ6A 2HBRA 3CLSD 3NIDB 3D02A 4GOMD 3WC4A 3AB3A 4Z9XA 4E2XA 5BVGA 2P3OA 3QLUC 1N6RA 1T3ZA 3ZWBA 1XA3A 2FXIA 2LXNA 5B7PA 1RWVA 4TLDA 3PFFA 5A06A 5CEFA 4CWAA 5KJFA 4R5HA 4ZU1X 3IP8A 4QEDA 4OAQA 3KVRA 4IINA 5IYZA 3IHKA 2PZEA 4RCZA 4GKJB 1F48A 2DFTA 3ONEA 3TLBA 4OD0A 3OFJA 2PH5A 4XLZA 4Z3KA 3RVKA 2NPOA 1ZJ6A 2NM0A 2PX3A 3FOEC 5K0EA 3QEOA 5LB2A 4F5DA 1ZSNA 3WNVA 1E6EA 1WXWA 3KQLA 1EK6A 2WHEA 2O5VA 1H69A 4YRBA 1CY4A 5I9NA 3GR6A 3LUAA 2PUGA 1AT1A 3KZMA 4Y2PA 2H07A 1XMJA 2FE1A 3NDIA 1EFTA 1R4NA 5A71A 4ZIRA 5CX4A 1T8TA 1J24A 2QMOA 2VPYA 4NH4A 3VOAA 5I9LA 2JFFA 2WV7A 3RVLA 1A8IA 4DR7B 3GCZA 3JQ8A 4GLLA 3CLUD 5CT8A 1AHNA 2V0GA 3LX5A 3L7IA 4LNUB 4NPHA 3I2IA 4JJKA 3RI3A 4PGGA 3IQHX 2G5TA 1E9RA 1B7GO 2X86A 1WKCA 4EUFA 5F98A 1YD7A 3PDJA 4F96A 1DQNA 5ARCA 2ID7A 3A10A 3ZI0A 3NEPX 4LVCA 2W2XA 2H5LA 4BB0A 3AVWA 1QUFA 1IY8A 5FA8A 3EEFA 3KSBC 2WICA 4IXTA 1GAQA 1PCXA 1G55A 2NZ2A 3CJRA 4KW7A 4X85A 2IWHA 3U48A 4YCLA 1PO7A 3I6MA 1ORVA 3QY0A 1Y3HA 2HQOA 3CUUA 3FBGA 5SICE 4MKRA 3T9FA 2C5BA 2O2SA 2VWPA 4ZC1A 1F06A 3BEOA 4RZQA 1N4DA 2QT1A 3LT0A 4OLHA 3D43A 1P0IA 1T4CA 2QW0X 3L9WA 4MWDA 2GM5A 3R3UA 4H16A 5I3ZA 2Z95A 5TS3A 1CR0A 3QPBA 1ATIA 1JNYA 3NEJA 1NDQA 4QPJC 3X0DA 4D81A 2XNJA 3A1CA 3H2KA 3RT7A 1XZLA 2DQYA 2IZ5A 4LJYA 3GJ7A 1A0OA 1UBUS 2Q5EA 3JRWA 4ICIA 1Z0DA 5DULA 3P9YA 1HR0B 1E64A 3PXEA 2EBFX 5JXGA 4MEBA 1MHPA 1C9JA 3BJIC 4KN9S 3VPAA 4EBFA 1M1XB 3EEOA 4CTNA 1ML3A 5CVUA 1H2AS 2AMFA 2CLFB 3FMPB 3PFBA 2NPFA 3CC8A 4FQ8A 4YMIA 3DTTA 3K7EA 3MSCA 3SOPA 5EN4A 2WTUA 3P9XA 2RGYA 1DC5A 3AXSA 2Q5LA 4EEKA 3R0JA 4LQLA 4PYMA 3HJCA 4Z86A 3U4DA 3HDVA 2RC5A 3K71B 2QMUA 2YH2A 3Q10A 1H2XA 1MVNA 2HREA 2I4IA 3F74A 4YO7A 1F6DA 2C2WA 2YOGA 3MWEB 3EIEA 1T25A 1W6UA 3BJRA 2XA1A 3G02A 4I5EA 4CU2A 1GTMA 1PJAA 4WVFA 2OHIA 4J07A 3STVA 3I4CA 3W7VA 2R751 4OFBA 2YV2A 4OMUA 4B3SB 4PX5A 4FLFA 5IXJA 5HCNA 1IC6A 1Y7PA 3F5QA 3DZIA 2A1TS 1XXLA 1JFFB 1NTRA 1XMIA 3WGUA 5K8VA 2ZJ4A 1KO5A 5ITVA 1EQUA 2CCKA 1CNMA 4FBGA 2I0FA 1NQWA 1A7KA 3A4MA 1FSPA 1TQHA 2OO5A 1Z5OA 2XKBA 1HFEL 1JHQA 1NOJA 5B3KA 2KSQA 2I3BA 2JK1A 4M8SA 2BGJA 5ARDA 2K7FA 2GJKA 2XNDD 4CL3A 2VJOA 1GTRA 1YQ9A 2HYIC 1M5UA 1VFNA 1Z34A 2ZWIA 3PRHA 1XQ6A 3F6RA 3PRKE 2VZLA 2E5FA 2ZSAA 2P68A 1F0NA 1MJ5A 3I9V1 4H6PA 4F45A 1YO6A 2WFAA 5J58A 1JTVA 1CFJA 2B4AA 2PM8A 3U39A 1D2MA 1GVHA 1R4MA 3CJQA 4MPJA 5BRNA 3V4OA 5SZIA 1KSJA 3VYRB 4Y2HA 2I6UA 3CN7A 2ZGVA 4KDEA 1C9MA 4X84A 4BN0A 4BVHA 2J9FA 2GD2A 4BBAA 3FHOA 3ORHA 3C7TA 4XPZA 3GHYA 4UMFA 3BXFA 4L78A 1AS2A 3ZW8A 2CNKA 3DFUA 1J8QA 1RJGA 1SB9A 3FH0A 3K9QO 3LJKA 5KKAA 5TPWB 4C7KA 1QFJA 2WB2A 3QUCA 2IP2A 4MYRA 3HEAA 4F9TA 3I39X 4ZEVA 3WFJA 1P2UA 1YU9A 3GL9A 5TC4A 3KQHA 4RPKA 3DZCA 2I3DA 2PFGA 1DRKA 3HFJA 1V47A 4GOXA 3IPAA 4LPSA 2FG5A 4M1MA 2XDAA 4B84A 2ZRQA 4UHEA 3ETDA 4Z6KA 1N5OX 1YGYA 2D0IA 3JD3A 4AP6A 3U3ZA 3I2GA 4KLZA 4YPVA 3TRKA 1SKYE 2CKDA 1XAIA 2NN3C 4XR4A 2A14A 1UPFA 1DTWA 2RSLA 3FMFA 4IDNA 4LUCA 4N7JA 3FPFA 5A4KA 3U1BA 1C9EA 4K46A 4MUNA 1W0JD 4IJ5A 4Y6GB 4XQEA 3I4LA 4LF8B 1VE9A 1U7XA 4K6OA 1JU3A 1D6SA 2YJ5A 2PRYA 2VK4A 2XXBA 2B34A 2QN8A 3PA6A 4JJZA 5IT4A 5BQOA 2P6RA 5AMXA 1UPAA 4ZQIA 2QQFA 1KI8A 1ZH0A 1Z35A 1B0AA 4LRSB 4K6GA 4FR5A 4PZEA 1GKUB 5KYKA 1FIUA 5BYBA 2K5UA 3OF3A 1E9FA 2IOQA 1AGPA 1ZC3A 4HDRA 4OUKX 5JPDA 3KVOA 2GFHA 3DDCA 1SAYA 5B53A 2J3JA 3WK6A 4IDBA 1CP2A 4IOMA 4DPLA 2X13A 1E18A 1P80A 1B16A 3IJRA 2JDID 4FXOA 4EVRA 4EGAA 2G7ZA 1G5HA 2HRRA 4HZUB 3GFVA 5CGZA 4PLVA 5KOIA 4HQFA 2Q2WA 2J9YB 4GIBA 1C7IA 3VRHA 4MQUA 2X2PA 3C3WA 3WHLA 3H5RA 5I9BA 2OOSA 5AUQA 3LPCA 5DYIA 1W19A 3BE8A 4D3DA 1N9GA 1ZEJA 3B89A 4L5BA 1TX4B 2XQFA 3I9V6 2CV1A 1FP7A 4JP3A 3RC9A 5GP1A 2CHUA 1IULA 4K28A 1SD5A 2YVKA 4K6FA 4NS1A 1A4UA 4AO7A 4I50F 1DCKA 5AVUA 3FGZA 2QZJA 4FGWA 1DQZA 2I1QA 2JCVA 1Z08A 5HFAA 1O0BA 4K40A 1D8AA 1JXAA 1K8XB 3KKLA 2P91A 4TV8A 3NNDA 2JNWA 3AEKB 721PA 3G2LA 3NP9A 4TMKA 5JH7B 4IQ0A 1DZIA 4ZOLB 4B71A 1EP1B 1XC7A 2UVPA 4MRSA 2HUPA 1XK7A 4XIJA 2B4RO 1D4ZA 4M1WA 1P9WA 1L5YA 1Q91A 2II6A 3KT0A 3RIMA 5C37A 1EKXA 4GWLA 5ICFA 3THYA 1CUIA 5JU6A 1P8JA 4NBNA 4M37A 5TNXA 3JYHA 2JGNA 1TQ2A 1I3LA 5DJ5A 3KYCA 4INAA 4RD6A 2FXVA 2IV7A 4YRTA 2FE4A 3AR5A 2H7CA 2FHSA 2C00A 1ZK0A 1KOJA 4G6ZA 1IIBA 4MAMA 2IF0A 3UFBA 4A0GA 4BYMA 3U31A 3OA2A 1RFLA 1XDSA 4N12A 2XRZA 4BCDA 1XLUA 2JG3A 2XUKA 5AVWA 1R64A 1QTQA 1WULS 2A59A 1L9XA 1JDBB 3ICPA 3KQTA 5K51A 4DDKA 2P6UA 1XZCA 1D3AA 2EXXA 2P9TA 4DLTA 1NJFA 1WPQA 3F9IA 3V4LA 2FPLA 1BYUA 3SQNA 5LWHA 3VMFA 4AUMA 3QELB 2CNOA 3KLBA 5H02A 5LSAA 1NPDA 4Q34A 2OWDA 2NUPA 3ISJA 3FSGA 4D9HA 1XPUA 3H9JA 4L02A 3QHQA 1JG3A 2QX8A 1I0LA 2DE0X 4M8KA 1NT2A 5H4GA 2ZXEA 3JWHA 1SHKA 2CLKB 3OX1A 3PYMA 4I4TB 5KZMB 4W82A 1U28A 1Z13A 1E77A 2QL7A 3U7GA 3M5PA 3COZA 2VK2A 4JVSB 3ZCPA 2CEAA 4FHZA 4CT4B 3K9WA 2IYFA 5CDUA 4TLAA 2FUKA 1GJRA 2IEIA 2JRLA 4I1IA 3OKFA 3K16A 1DL5A 2LIVA 4JXJA 2JVJA 4LK3A 4NOKA 4RWEA 3RDPA 4Y6QA 2G9UA 2AKEA 2APJA 1UFVA 2IYLD 2PL5A 2OV1A 4PYQA 1UJMA 5KCMA 1HNZB 1ADFA 5ESWA 4F46A 3HCNA 2HDHA 4HB2A 4LDJA 1JEQB 3NQ41 4RF5A 5EGNA 2FW0A 5FL7A 1IN4A 2NOAA 3R6WA 4BJ5A 2X0RA 3RYCA 1SFRA 1BE1A 1PAUA 3M49A 5EMJA 1IG3A 3LDGA 1SHZA 4RHEA 1TJNA 4TTAA 3I9JA 4S35A 4KRXA 4GE3A 4PSVA 4O4LF 4J3FA 5C7YA 2QN6A 1DBWA 1C3LA 1T2DA 2BGTA 3NANA 1G20E 4QWMA 1GKLA 4Z8XA 3UPDA 1JLKA 1FU8A 4C89A 3SS9X 1NM5A 2GDZA 3ETEA 3BT7A 5HQ3A 4H7FA 3PFWO 2JCXA 1CZKA 2I4NA 2NZVG 2W4QA 3G59A 4KXWA 1PTJC 1JTFA 3VJLA 5KNLA 3CR7A 5A6SA 4EMTA 5FNVA 2DY1A 3X43A 3C7CB 3HB1A 1XYGA 4E2FA 1NVXQ 2CFOA 2RH9B 4G25A 3VOTA 4LECA 1X7XB 4ZHQA 3IMEA 4DLWA 4DYDA 5SYAA 3OA0A 4B7ZA 1QCZA 3KQSA 4JJ7A 4MIOA 2I3ZA 1W581 3Q0IA 2GCOB 4HWRA 4ISBA 1ZVMA 4RIGA 5JYDA 4O4IA 4YAUA 2Q99A 4DQUA 1QV6A 1KXJA 1EZ4A 4LI3X 3IAAA 1CKEA 1J5XA 5E2AA 5M5BA 1PG2A 1PZGA 1PLJA 1U7DA 1WTCA 2ZJ7A 5LMCA 4OH7A 4KO8A 1DC3A 3S27A 1J2YA 1EBFA 1D0VA 1JQAA 3FIJA 3LLUA 2JATA 4O1IA 3ENVA 2QJTA 2PVSA 1N77A 2ZYGA 1U8TA 2FSHA 4D3XA 2NXCA 3I28A 5ALQA 2E6KA 3EDCA 2IA5A 2K2QB 4D1YA 4YMWA 1SKQA 1GOTA 1D07A 3HDTA 5C18A 3ROXA 3ZJYA 5IJXA 2JFXA 1PW7A 4GEKA 3G7NA