4C7UA

Crystal structure of manganese superoxide dismutase from arabidopsis thaliana
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
203
structure length
203
Chain Sequence
MTFTLPDLPYDYGALEPAISGEIMQIHHQKHHQAYVTNYNNALEQLDQAVNKGDASTVVKLQSAIKFNGGGHVNHSIFWKNLAPSSEGGGEPPKGSLGSAIDAHFGSLEGLVKKMSAEGAAVQGSGWVWLGLDKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEKENN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Arabidopsis Thaliana Manganese Superoxide Dismutase at 1.95 A Resolution
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [MN] 1, MITOCHONDRIAL
total genus 75
structure length 203
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4c7uA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4c7uA02
1AR5A 4GUNA 1I0HA 3DC5A 1BSMA 1XDCA 4E4EA 3OT7A 2ADPA 1N0NA 3C3TA 1MNGA 3BFRA 4YIPA 3QVNA 1PM9A 1XREA 1JR9A 3C3SA 3DC6A 4C7UA 1B06A 1EN4A 4F6EA 1GN3A 1IX9A 3RN4A 1MMMA 1LUWA 3K9SA 4BR6A 1I08A 1EN6A 4JZGA 1GN6A 4X9QA 1EM1A 3LSUA 1AR4A 1SZXA 5AG2A 1KKCA 1XUQA 1IDSA 1P7GA 1QNMA 1VARA 1MA1A 1D5NA 1VEWA 1AVMA 3KKYA 3CEIA 1ZTEA 2RCVA 3EVKA 1IXBA 1JA8A 1ZUQA 4JZ2A 1MSDA 2CE4A 2QKAA 1AP6A 1N0JA 4FFKA 1GN2A 3TJTA 3AK1A 1WB7A 2GDSA 3MDSA 3AK3A 1EN5A 1PL4A 1XILA 4YIOA 4JYYA 2AW9A 1GN4A 1WB8A 1LUVA 2CDYA 1BT8A 2ADQB 5A9GA 1ZLZA 3AK2A 2P4KA 1BS3A 1AP5A 1ZSPA 2QKCA 1Y67A 3IC9A
chains in the Genus database with same CATH superfamily
2XAHA 1YF2A 2ZXWB 5B1BB 1V54B 4ZIBA 1SERA 2P5OA 1BGYH 2UUCO 1RM1B 5JQGB 4UCOA 3CXHF 1KP2A 4B3MO 2GHYA 4IHJB 5EIBC 1FJGB 2NNUA 4NKGB 3DC6A 4LF4B 2W6JG 2CAZC 1Y74B 3JARB 4I5SA 1WP8A 1IX9A 3GVMA 1LUWA 1SQPH 4TT3G 4MVUA 4GLXA 1Z2GA 4KFMA 1XL4A 4DV2B 4WFEA 1NT2B 4LF8B 1NZ6A 2JDIG 1KU9A 3VBBA 5JCOC 2B1IA 3THOA 1BZKA 4JI0O 1EM1A 3ZN1A 4JI8B 4JI4O 1M4UA 2AZ0A 4BW5A 4ZI7A 3OW2U 1EZJA 4DUZO 2RCVA 1SQFA 4Z1VA 1OZ0A 1VQLV 3B8MA 3C90A 3A8TA 4NTXA 2LW7A 2R72A 4GKJO 4DR5O 1S5LZ 4O4IB 2WLJA 3UT5A 2JIZG 3HKDB 1CPYA 3FYEB 4EB6A 1GH6A 4FLXA 2ZQMA 5LYJA 3H1KH 4B3TB 4PJ0Z 5EK0A 1YTFD 4JI6B 3UKMA 1HNXB 4A5UB 2EULA 2ITDC 4WFBV 2P4KA 4UCVA 2PI5A 1SZTA 1Q7YW 1VQ8V 2ILMA 3DGEA 1K34A 4FZ1A 4DYLA 4DV4O 3OEHG 4FPPA 3ZHVA 4CS4A 4RQEA 3ZRWA 1GAXA 2JS5A 2BTOA 2YXHA 3J7AU 1NU1H 2AZ2A 2P67A 5IWAO 4O4JA 4LFAB 3G6BA 1XMQB 5IDJA 1VQ7V 1NI8A 1N0NA 4BIUA 1DF4A 1I5YA 1BHBA 5K1PA 5B1AB 2YDEA 2EX3A 5B1AC 2WLMA 1Q81W 1VP7A 3GWKC 1VQPV 5FNVA 4EEQA 1OCZB 1PNKA 4RO2A 4PA3A 3CRCA 1Q8IA 1GKFA 1HNWO 4O4HB 4I50B 1NH2B 3VQXA 2YI9A 3E8FA 3T1HB 1IJGA 1SQQH 1QR8A 5LP6B 3OAAG 4K0KB 3KCYA 4DK1A 2OCCC 5JWPA 4J11A 3JAKA 3SR2C 3AG2C 2VQFB 4JYBA 4CC5A 3ETEA 2UXCO 4QE9A 3IGAC 3FYIB 4OXSA 2LFSA 2P7TC 2HKOA 2Z3YA 2YS8A 3AK3A 2YIDA 1KBHA 3A0HZ 3ZN0A 3OUSA 2YI8A 3MHSC 1GK9A 1I94O 2IJJA 4HBNA 5LXTB 2JGDA 5ITZA 2R70A 1FFTB 3M8AA 3E83A 3M7MX 1X59A 1ZAUA 1BS3A 4KHPO 2FYUH 1UPGA 2Y4UA 1TUBB 2HG5C 1HDJA 3W7UA 1OCOB 1PNLA 2Y0PA 3DC5A 4JI0B 4JI2O 4QPKA 5EC1C 1Y6XA 2EIKB 2WWWA 4UV9A 3ZHQA 1AJQA 4JI7B 5LYJB 3G80A 2QJ1A 3BFRA 5KMGA 3RFRA 4N21A 2IJHA 4DO2A 1VQOV 4YJ2A 4AQYB 5L3CA 4NXMB 3K9SA 5KUMA 1J5EO 2VS0A 4DR3B 4GZRB 1Z5VA 5B1BC 1KECA 3FB7C 3QO8A 2FB5A 4I7ZB 1EN6A 4DUYO 3K5MA 4B3TO 4AQYO 1GN6A 3WFVA 4ZOLB 3CSXA 3SYOA 1R1BA 3CMEV 3CPWU 3CMAV 4O4LB 3R65A 2OTLV 2ZE8A 4X1IA 4DV3B 3QNEA 1ZUQA 3P3PA 5LP6A 3ZS8C 1OHHG 5B1NA 3K03A 4MSWC 3VOUA 2CTWA 2K9PA 3K5LA 4IT5A 3HKCA 4WF9V 3TJTA 2WPDG 2WA3A 2F4VO 1MSWD 2XHBA 4FLWA 4LF7B 4DR1B 1AILA 2E75B 4KHPB 1Q5OA 1MABG 5B66Z 5HFMA 3UQ8A 3CWBH 2E3CA 2QWQB 2IH3C 3TGUH 3W7TA 4CZZA 2VQEO 4LH6A 3OR7C 3ZRXA 3N2GA 3EHBB 3QG5A 2Q5ZA 1R3LC 1JJ2U 1JOYA 5LGNA 1S76D 2A7WA 4DV6O 3S3WA 4GUNA 2HVJC 5E1AC 1H38A 5KAFZ 3ABLB 3W7XA 1G8MA 1B04A 1WLEA 1VF5B 4YHHO 3K5NA 2EIMB 5H5NA 1XHZA 4J80A 4ICGA 2ODMA 4X1KB 1FPOA 2JVDA 2WLIB 3F7YC 2FKXA 3HKBA 1MMMA 2ETNA 3JALB 5EYPB 3PJSK 4BR6A 1CEZA 4PV1B 3VQWA 2L35A 2V4DA 4XDKA 2LFRA 3K06A 2AXTZ 2F93B 4L8JA 4TUYA 5CBFA 4R6ZA 4JI1O 1RPOA 1M1KW 1LR1A 3NXSA 1YIJV 2GV9A 1KKCA 3W7WA 1RPRA 3H1HH 1N4CA 4IYHA 2FTKA 3KKYA 4X1IB 1COWG 4TV9B 1FFXB 5B5EZ 2IM9A 4OPAA 4YJ3A 3CD6V 4JI7O 3LSSA 1N33B 3W7SA 1H2GA 4RUFA 2AHZA 3MDSA 3LDDA 1JFFA 1SKVA 1PNMA 1BCCH 1OV9A 1DTOA 2B5UA 1RFYA 4UFZA 2EBOA 3F7VC 2UUBB 2A0LA 1FOUA 3S3XA 3RYCB 2B1GA 3CXCU 2Q69A 2GUZB 5F2VO 5IYBO 3U0ZA 1YVWA 1Z5WA 5BXZA 5IJ0B 4DUYB 1BHAA 5J9PC 3J80N 4JTAB 4H0LB 3OT7A 3SPGA 2ADPA 5L3EA 3ZHTA 4PI0A 5J2UA 1MZFA 1JJOA 3K9AA 3BY6A 1JR9A 4K0KO 1YTFB 3LNNA 2Q4PA 4FFBB 3HPLC 1GN3A 3BAAA 4U7NA 3FAVA 1XEQA 5IJ9A 2X6BA 2YSUB 1B6QA 1K5SA 1KC8W 4DR1O 2YIBA 5LOVB 2QTSA 2IBZH 4J7KA 1WPXA 4P9OA 2BOCC 3ZHRA 1M90W 3MHHC 2VQEB 3E22A 3IJ4A 4UVAA 5E79Z 1P7GA 4UB6Z 4O4JB 4X8AA 1WA8A 3ABMB 1YSCA 1U97A 1KMIZ 2Z0AA 3X2QC 2O57A 1QLEB 4K8ZA 1AI4A 1IURA 4JZ2A 2OCHA 3JD0A 4UCUA 4OX9O 4P2ZA 1NKDA 1HNWB 4JI2B 1WB7A 1G1XB 4I9WA 3IFXA 5B3SC 1PL4A 3OTOB 1JFFB 4JAAA 3KCXA 4DRXB 5JVDB 5KUKA 4UB8Z 4W4KA 5IYZB 4X65B 1JQ0A 5EBMC 1G4YB 1SS3A 4CH6A 5EIBD 2QR4A 5B3SB 3OMAB 3DSQA 1O9HA 1ZLZA 3RGBA 2GUZA 3SYCA 3AG3C 4IIJB 5JCOA 3IC9A 1HNZB 4FM2A 1W59A 3OTOO 5FPOA 2VWJA 5KAIZ 3CCQV 1V55B 2X6AA 1XMOB 5JH7B 3JD1A 3C3TA 1QHTA 2DE0X 5FLXN 3VQYA 4KUMA 3DXRB 1L0NH 1E1QG 1W0JG 1K9MW 4JASA 1YZBA 2ZDIC 3JATB 1K3EA 4LWSB 1IZ3A 1VMGA 2RQ6A 3ZEDA 3RN4A 1OCRB 5LP6C 2CGNA 1GM8A 2CH7B 2PI4A 1S3JA 4JYAB 1HNZO 2F43G 3AEIA 3RW0A 2X7RB 3LSUA 1SZXA 5EC2C 2EILB 4DXWA 5LXTA 3JARA 4WFAV 4QNHB 5JJJB 4JPRA 2DOSA 2WLLA 1D5NA 4P9PA 1NQTA 5D5QA 2YIAA 3EVKA 3B40A 2JK5C 4G28B 3CC4V 4E2LA 4WBNB 4FLVA 2Q73A 4J42A 4FM0A 2Q8VA 5LOVA 3E35A 4DW0A 3JCUZ 4FFKA 1WPBA 4JTDB 3G6EV 3CP1A 3G4SV 2P6JA 4HNAA 4DR7B 1SQXH 2DQ3A 4GX2A 2NLJC 3ML0A 2KQXA 4DR2B 2LJ2A 4PA7A 1ZSPA 3H9VA 4QGPA 2QGNA 4MVSA 3D3QA 2Q7HA 3RVYA 2ITCC 5H6RA 4U3JB 2XT9A 4HYOA 2YC0A 5KX5A 1XQ8A 4H33A 4MTGA 2ZM6B 4PA4A 1NR7A 1VQNV 4D7SA 3LDCA 1N32B 2EILC 1EBOA 2PGGA 1JCHA 4JV5B 1H8EG 5DN6G 1FKAO 5H9CA 4UVCA 1QCEA 4Z1MG 3CJHA 4UCRA 3APQA 1HR0B 4R7CA 3ABMC 3L70H 1NR1A 1R6TA 2A79B 1O9GA 4G2KA 5JH7A 4B3RB 4MT8A 5CBHA 1JNBA 4U3FH 4J41A 1Q82W 1H8HG 1VF6A 5KX5B 4X88A 2UU9O 2EINC 2HFEC 3K0DA 1OCCB 1I94B 4I4TA 2N05A 4XDLA 2EJRA 4J9ZB 3SJQC 3ZRVA 3CCUV 2H94A 3K04A 2ZR3A 1NJIW 5CA1B 1HR0O 1VQ5V 3JAWB 1ROPA 1H2MA 3JD3A 2KSDA 1YDXA 3QTCA 2QKAA 3LDEA 2DQ0A 3E8HA 1R3JC 3CB2A 1GMGA 3OFNG 2QDOA 1N36B 4EFEA 1ZWIC 4PHZA 2WAMA 2F95B 3RBZA 1XILA 4X64O 1QLNA 4LF5B 2Q6AA 1VQ4V 2BCCH 4UUJC 1M57B 1EZVH 1FYJA 1KP3A 4KP4A 4OX9B 4PDMA 3K58A 2HEPA 1Y67A 3BEHA 2H8PC 2R9IA 4X66B 1XNQB 1SF9A 4LFBB 1XDCA 4X65O 2Y48A 1AI5A 3FB6C 4DR5B 4J7ZA 2DW4A 4K8XA 1Q90D 3H1LH 3OUFA 4TUYB 1PM9A 4FIPC 5BMVB 1DGSA 1GM9A 3L74H 4YJ2B 1BL8A 1R73A 3SJCC 1U96A 1XNRB 2EIJC 2OT5A 2D3OW 4B3RO 4BIZA 1FFXA 2LO1A 3SPHA 1Q6HA 2DYSB 3CC7V 3APOA 2DYRB 2Q0AA 5LHGA 5GTHZ 3TETA 3T1YO 4GKKO 2X0LA 3CC2V 3P30A 4X62B 2LP7A 1XNQO 1QBZA 1R6KA 3RYHA 2YXYA 1KQSU 3E8GA 3SYAA 4I55A 4LFBO 2BSKB 4X20B 1YJ9V 2E5LB 4I4TB 3JAKB 1IDSA 1N34B 4LF9O 3T1CA 1VEWA 1KUQA 4EFBA 1YITV 4UVBA 1PL0A 3OMNB 5TISZ 4JYAO 1XNRO 4UCTA 4CH3A 2HHHB 3B09A 1KYOF 2Y69B 3BA9A 2MK3A 3CS5A 2QEXV 1F4MA 5HFLA 4DV0O 3ASOC 2A3QA 1FXVA 4GKKB 1SA0B 4O2BB 4LC1A 2D2CB 3SJBC 1WB8A 4O2AA 1H2KA 1UJWB 5A9GA 3G67A 2RDCA 1LNQA 2PYJA 3D3IA 3HR0A 3WU2Z 2JGUA 2IU3A 2WSSG 3FAVB 4DV3O 1K4DC 2CTQA 1X4TA 2DN9A 4LH7A 1XMOO 4JI3O 1KD1W 4FFBA 3JASB 3K79A 3SYQA 1I7FA 3WB0A 4GX5A 1N8RW 4ZI7B 1K5QA 2UU9B 3U10A 4E4EA 2L6LA 3AG1B 1NVPB 3UCSC 2ZINA 5CA0A 1D2DA 1WN7A 3CRAA 3GWOA 4KL1A 3I5DA 3QVNA 1WA8B 1AROP 2JS3A 2UXXA 3E2EA 3FX7A 3K3WA 3RT3C 3ABUA 5A2QN 3P32A 4QE7A 5IWAB 4U7OA 5H6QA 1P84F 4PDLA 4JI8O 3L72H 3WB1A 2FL4A 2EZPA 1TA8A 3UT5B 2E74B 2Q7GA 4X64B 2WLLB 1TGOA 5IE9A 4LR3A 1VQMV 4CS2A 1W0KG 4IL6Z 1M57C 1YJWV 4DR6B 5IYZA 2ZR2A 2HJFC 4MVQA 5CA0B 3QO7A 2MW2B 1HNXO 3AG7A 2N74A 4ASUG 1YEWA 2PTMA 4GX0A 1Y74A 4BWAA 1K97A 1NTZH 1FXKB 2ZKOA 1SRYA 1MSDA 1S5JA 2VWKA 5CBGA 2ZE6A 2B9ZA 1K73W 2W6IG 2K1EA 3JATA 1S0VA 2QWOB 1E79G 2OWOA 4NTYA 1YJNV 2RNBA 5C8YB 1XOUA 2ZM6O 1ORQC 3GB7C 1SQGA 1XBLA 1IXMA 1SQVH 1URFA 2EINB 1IBLB 1GTOA 1TAEA 1GN4A 3QO5A 2ATKC 5EBWC 3MD0A 3UM7A 4MTFA 2OYQA 1DK1A 3D8CA 2UXNA 4PELA 1V55C 4DV1B 3HKDA 3OR6C 1AR5A 3B2EE 2PUSA 1S77D 1N32O 5LHHA 5CA3A 2QWRB 3L9DA 3BPZA 1VF6C 4FK5C 1SA0A 4O2BA 3CJHB 4B7KA 2UXDO 3D36C 2F4VB 2Y0IA 3ABTA 4DV1O 4K3AA 4EKWA 4F6EA 1M93A 2KG7B 3H1JH 2ZNJA 4HNAB 2WLNA 3ICXA 4FM1A 3AG2B 5IJ9B 1VQ9V 2IH1C 1Q6UA 1F23A 2Y4TA 4DV6B 4WBNA 4UXNA 3SPCA 4PI2A 2CK3G 3MAQA 3ZCCA 4ABMA 2UXDB 1QVGU 1MA1A 2M6YA 2VRZA 4QJFB 3FKSG 1V54C 4TV8A 4TWKA 3RWRD 2YXLA 4K35A 5KHJA 2G38A 2JEUA 4GX1A 3OM3B 2A9HA 1P7BA 2Q68A 1NS1A 3OGCC 1BE3H 3E8BA 1MZEA 4DV7O 4D7TA 1AI6A 2H3OA 3VQVA 1R6NA 4F6RA 3ZIAG 1UFIA 3ETGA 1TUEB 3HKEA 3OGIB 4RWUA 3B77A 2F23A 3JSNA 3X2QB 4PDRA 4LFAO 5BR8O 1K8AW 2ZE7A 4HZ3A 5EZYA 3ZRSA 5IYCO 2V1DA 3RYCA 2LW1A 5BMVA 3K08A 1M9NA 4J10A 3N27A 3I56V 2CGOA 5J2UB 2R9AA 5IY5B 2ZDIA 2JRIA 3L73H 1YXBA 1AB3A 2Q7EA 1SETA 1AR1B 2GSMB 4JAVA 4YIPA 5H2FZ 1QLEC 4DR4O 3CRRA 3E86A 1IBMO 4O4LA 1A32A 4JI3B 5LA6B 4LF6O 3O65A 3AG4C 4ZOLA 2JGDB 5ITZB 1K4CC 4X62O 3UO3A 2ZCEA 4YHHB 4X66O 1HW7A 5CA1A 2DYSC 3AG1C 3AG3B 3SYPA 1I08A 1WP7A 4IGGA 3FD9A 2RN9A 1KKDA 1Q3EA 4WFFA 3QF7A 4JI6O 1AJPA 2ZT9B 1XUQA 4X1YA 4JI5O 2IJKA 2XAFA 2F1MA 2ZD9A 1PD3A 4DV2O 3ABKB 2ARHA 1XL6A 1IBKB 1IBMB 3E22B 3ETQA 1R3KC 2CE4A 1PPJH 4R8CA 3IAYA 3N2GB 4DR6O 2WLIA 2P06A 2HP8A 1FS0G 3AK1A 1FAFA 2GDSA 2YUAA 5EYPA 4B3MB 1SESA 2CUGA 4YIOA 5FPRA 3BVOA 3WG7B 1JMKC 4FLTA 1LUVA 3ZMSA 2CDYA 4MW8A 3JD2A 2ADQB 4J9YB 5JVDA 4UCSA 2BSKA 5K1XA 5LMNO 2DJVA 4G27B 3KDRA 4BAYA 3DTUB 2OIEA 4LF8O 4CH5A 4RQFA 1L0LH 2NN4A 4DR2O 3FB5C 1GRJA 5FL7G 2UUAO 1MNGA 4NB5A 3ASOB 5L3BA 4XDJA 4LP8A 1OJHA 1R3IC 5LMNB 4W4LA 1J5EB 2KB1A 1BQZA 1G6UA 1EN4A 5KHGA 3LUTB 1P49A 1K92A 2QM8A 3OTFA 2CH7A 5GTIZ 4H13B 3TXQA 4IYIA 1PP9H 5LGTA 4I50A 1M5IA 3CYOA 4WFHA 4GKJB 2RJZA 4NXNO 3CRQA 2A06H 3A2FA 4O4IA 4YJ3B 2QKSA 4JZGA 4DUZB 1L8DA 5LMUB 2GTAA 2Q9LA 4CH4A 2QM4A 1KB9F 4CS3A 2XOKG 3F5TA 2E76B 5DEDA 3CCEV 2DWDC 1VQKV 3CCLV 2OTJV 3K0GA 1ZTEA 3TK1A 3CCVV 1AJNA 4Z2WA 3O9OA 1AP6A 2W0XA 5KHHA 4I0XB 3WG7C 1S5HC 2Q67A 4B3SO 3CX5F 4QIWF 3STLC 4B7EA 1K33A 1K7DA 5GONA 3AG4B 2ZNIA 3T4ZA 2AW9A 4MTOA 2GBOA 3ZHSA 5C93A 4NXMO 1BT8A 4QPJA 2BOBC 2F66C 1AI7A 4I9QA 2QKCA 1VIBA 2LGQA 1S72V 1JX9A 3ABKC 1ZL8B 4LCUC 3E89A 2ZIMA 1N36O 1H2LA 1BSMA 3BRCA 3BABA 3ZJZA 5KA6A 1TUBA 2BTQA 5IT9N 4J7JA 3SJAC 5BZBA 4FLUA 1W2BU 2E5LO 2QSAA 5BR8B 1CXZB 1DF5A 3JD4A 4ZHQA 3ABLC 3JCZA 5FNVB 3N2KB 1YI2V 3PN1A 2P90A 5LMUO 4R50A 2XAQA 3ASNC 3A0BZ 1F51A 2EZOA 4PA9A 3KG2A 1XMQO 5JQGA 4DRXA 4LF6B 2RMKB 5EBLC 5KA5A 5LL6Y 4L87A 2EJ7A 2YEVA 3EXAA 1WAZA 3ZHUA 4FZ0A 4H37A 3P3NA 1VARA 3RVZA 3CE2A 4B3SB 1IXBA 2N04A 5CMUA 1J95A 3T2MA 4AI8A 3ZMZA 3DXRA 4OGQB 1D5AA 3EFFK 2CTPA 2W0FC 3FB8C 2EIKC 1WJZA 1N0JA 2R9RB 5B1OA 5GW7A 1OCOC 3LNMB 4X20A 1EN5A 4PD4F 2WLKA 1IBKO 5EZYB 4LNUA 3ZX6A 2PY5A 3D36A 2JJ1G 5CB4B 1MOFA 2HR3A 1Q6IA 4DV0B 2Q0OC 1SQBH 4JGSA 1EFRG 1B3QA 2YICA 4DR7O 1GO3F 1NVPD 2P22C 1Y66A 5KHIA 1I0HA 3B4SA 1VQ6V 2OIGA 3J81N 1YCIA 3ZBHA 1RSOB 3K5OA 1Y4MA 4O2AB 3G71V 2QWNB 3SGIA 1PKXA 4FLYA 3C3SA 1B06A 2OCCB 1YHQV 1QVFU 3U11A 5IY5C 1FJGO 1IVSA 4FMTA 1V9PA 1FXHA 3ZMUA 3Q4HA 4JTCB 4F4LA 4LF4O 4IIJA 4X1YB 3OEEG 4X89A 4JI5B 1OCZC 1M56B 4FVMA 3CHXA 2Z5UA 2HHHO 2UXBO 2ZIOA 4DR4B 1RSOA 4LWSA 4ZHQB 1M56C 5AG2A 3M99B 2PF4E 4I55B 1TVKA 1H2NA 3ZMTA 2QM7A 1JA8A 1FXKA 3RYFA 4MVMA 5J2TA 1BMFG 4WFGA 5L3FA 3L75H 4JI4B 2DMXA 5CN0A 3HKEB 4O4HA 3WB2A 1NTMH 1VF7A 4DR3O 2AGAA 4RUEA 1GN2A 2V7QG 4LBEC 5JJEB 4P30A 5C8YA 1T5EA 3A0RA 1ENVA 2QE7G 4AHCA 2UUAB 2PYLA 3T4DA 3JSLA 2AHYA 4DW1A 3K59A 5CB4A 2ZE5A 4Q6GA 3CCRV 1F4NA 2P4VA 2HVKC 1FXKC 4LF5O 3KZIZ 1IBLO 3ZMVA 4FJCC 4MTXA 3OMIB 1FD9A 3STZC 2XASA 3ASNB 1ZX3A 4DV5B 3NR7A 3IC7A 1L1FA 3RYIB 1GM7A 2LGWA 4JI1B 5JJNB 3OD4A 4DV4B 2XUMA 4NYKA 3LSQA 3ZRWB 2GTSA 4MVZA 4MVOA 2WLHA 2LQTA 2XAGA 1HWYA 4YY3O 4GCZA 3B8NA 2IU0A 2Y69C 2UXCB 2JEXA 4U3JA 1OCRC 1F7YA 5KMGB 4UV8A 3HB3B 4NR1A 4JV5O 4X9QA 2KKWA 2EIMC 3SPJA 3Q4HB 2UUCB 4DV7B 2M7WA 3JAMN 1QNMA 5DECA 2XNDG 1TVKB 1SC5B 4H44B 4ZBMA 4MS2A 2XTAA 3CCJV 3T1HO 4HAMA 4WCEV 3RYFB 1QU7A 3SPIA 5GONB 2QWPB 3JYCA 4TQFA 4NXNB 4OPHA 1US6A 1H2SB 3K57A 5IJ0A 4NTWA 2HJDA 1NH2D 4NVPA 2ZXWC 5J2TB 4N23A 2EIJB 4D6TH 3R66A 1Y76A 4DK0A 3FFQA 2BE3A 1PV0A 3ETDA 1Q86W 2BTQB 4TQDA 4TV8B 1AP5A 2QTOA 4MW3A 3HKCB 1NTKH 4KXRA 1P4RA 1HP8A 1N33O 4PDVA 2UXBB 1DLBA 3UO2A 4ZKIA 5LHIA 5DM6V 4IHJA 3JAWA 4JF3A 4YY3B 4FLZA 2X6CA 4BW9A 1XREA 2NR5A 2UUBO 4CC6A 4C7UA 1Y76B 2DYRC 1E1RG 1RM1C 3RYIA 3H01A 3BA8A 2XAJA 4GT1A 5L3DA 5KHKA 4JYCA 4I0XA 2YEVB 2CTRA 2KG7A 4B08A 2FMLA 3OE7G 5LGUA 2HLDG 4CBCA 4GYCB 2VQFO 1I5XA 1BQ0A 2WA4A 3L71H 3F5WC 2PZSA 2QA4V 1AR4A 4TOIA 4YXWG 1THZA 3BHPA 5LA6A 1XHXA 3I55V 1XI1A 1OCCC 5LBQA 2YIBD 3TXSA 1JVMA 3CCSV 2C2AA 1AVMA 3CEIA 3BCCH 2IJIA 4AILC 4TSFG 3HKBB 1ZL8A 3SDLA 4DV5O 3JALA 1CP9A 4LFCO 1Q43A 1QQCA 4LNUB 5BY1A 5KLVH 3JASA 1N34O 4LF9B 3H1IH 3N2KA 3CCMV 4RAIA 4X1KA 4Q20A 1JPXA 4EB6B 3T1YB 4F6RB 3CRMA 1H5WA 1WNSA 4JYYA 5L3GA 5IYDO 4LFCB 4PA6A 5D5PA 2IW5A 4MVRA 3TCUA 4LF7O 3AK2A 4JAUA 1NBMG 1MG1A 1RP3B 2JJ2G 1QR9A 2DWEC 4XBFA 4BIOA 3RYHB 4TV9A
chains in the Genus database with same CATH topology
1AR5A 4GUNA 1I0HA 3DC5A 1BSMA 1XDCA 4E4EA 3OT7A 2ADPA 1N0NA 3C3TA 1MNGA 3BFRA 4YIPA 3QVNA 1PM9A 1XREA 1JR9A 3C3SA 3DC6A 4C7UA 1B06A 1EN4A 4F6EA 1GN3A 1IX9A 3RN4A 1MMMA 1LUWA 3K9SA 4BR6A 1I08A 1EN6A 4JZGA 1GN6A 4X9QA 1EM1A 3LSUA 1AR4A 1SZXA 5AG2A 1KKCA 1XUQA 1IDSA 1P7GA 1QNMA 1VARA 1MA1A 1D5NA 1VEWA 1AVMA 3KKYA 3CEIA 1ZTEA 2RCVA 3EVKA 1IXBA 1JA8A 1ZUQA 4JZ2A 1MSDA 2CE4A 2QKAA 1AP6A 1N0JA 4FFKA 1GN2A 3TJTA 3AK1A 1WB7A 2GDSA 3MDSA 3AK3A 1EN5A 1PL4A 1XILA 4YIOA 4JYYA 2AW9A 1GN4A 1WB8A 1LUVA 2CDYA 1BT8A 2ADQB 5A9GA 1ZLZA 3AK2A 2P4KA 1BS3A 1AP5A 1ZSPA 2QKCA 1Y67A 3KDRA 3IC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AR5 A;  4GUN A;  1I0H A;  3DC5 A;  1BSM A;  1XDC A;  4E4E A;  3OT7 A;  2ADP A;  1N0N A;  3C3T A;  1MNG A;  3BFR A;  4YIP A;  3QVN A;  1PM9 A;  1XRE A;  1JR9 A;  3C3S A;  3DC6 A;  4C7U A;  1B06 A;  1EN4 A;  4F6E A;  1GN3 A;  1IX9 A;  3RN4 A;  1MMM A;  1LUW A;  3K9S A;  4BR6 A;  1I08 A;  1EN6 A;  4JZG A;  1GN6 A;  4X9Q A;  1EM1 A;  3LSU A;  1AR4 A;  1SZX A;  5AG2 A;  1KKC A;  1XUQ A;  1IDS A;  1P7G A;  1QNM A;  1VAR A;  1MA1 A;  1D5N A;  1VEW A;  1AVM A;  3KKY A;  3CEI A;  1ZTE A;  2RCV A;  3EVK A;  1IXB A;  1JA8 A;  1ZUQ A;  4JZ2 A;  1MSD A;  2CE4 A;  2QKA A;  1AP6 A;  1N0J A;  4FFK A;  1GN2 A;  3TJT A;  3AK1 A;  1WB7 A;  2GDS A;  3MDS A;  3AK3 A;  1EN5 A;  1PL4 A;  1XIL A;  4YIO A;  4JYY A;  2AW9 A;  1GN4 A;  1WB8 A;  1LUV A;  2CDY A;  1BT8 A;  2ADQ B;  5A9G A;  1ZLZ A;  3AK2 A;  2P4K A;  1BS3 A;  1AP5 A;  1ZSP A;  2QKC A;  1Y67 A;  3IC9 A; 
#chains in the Genus database with same CATH topology
 2XAH A;  1YF2 A;  2ZXW B;  5B1B B;  1V54 B;  4ZIB A;  1SER A;  2P5O A;  1BGY H;  2UUC O;  1RM1 B;  5JQG B;  4UCO A;  3CXH F;  1KP2 A;  4B3M O;  2GHY A;  4IHJ B;  5EIB C;  1FJG B;  2NNU A;  4NKG B;  3DC6 A;  4LF4 B;  2W6J G;  2CAZ C;  1Y74 B;  3JAR B;  4I5S A;  1WP8 A;  1IX9 A;  3GVM A;  1LUW A;  1SQP H;  4TT3 G;  4MVU A;  4GLX A;  1Z2G A;  4KFM A;  1XL4 A;  4DV2 B;  4WFE A;  1NT2 B;  4LF8 B;  1NZ6 A;  2JDI G;  1KU9 A;  3VBB A;  5JCO C;  2B1I A;  3THO A;  1BZK A;  4JI0 O;  1EM1 A;  3ZN1 A;  4JI8 B;  4JI4 O;  1M4U A;  2AZ0 A;  4BW5 A;  4ZI7 A;  3OW2 U;  1EZJ A;  4DUZ O;  2RCV A;  1SQF A;  4Z1V A;  1OZ0 A;  1VQL V;  3B8M A;  3C90 A;  3A8T A;  4NTX A;  2LW7 A;  2R72 A;  4GKJ O;  4DR5 O;  1S5L Z;  4O4I B;  2WLJ A;  3UT5 A;  2JIZ G;  3HKD B;  1CPY A;  3FYE B;  4EB6 A;  1GH6 A;  4FLX A;  2ZQM A;  5LYJ A;  3H1K H;  4B3T B;  4PJ0 Z;  5EK0 A;  1YTF D;  4JI6 B;  3UKM A;  1HNX B;  4A5U B;  2EUL A;  2ITD C;  4WFB V;  2P4K A;  4UCV A;  2PI5 A;  1SZT A;  1Q7Y W;  1VQ8 V;  2ILM A;  3DGE A;  1K34 A;  4FZ1 A;  4DYL A;  4DV4 O;  3OEH G;  4FPP A;  3ZHV A;  4CS4 A;  4RQE A;  3ZRW A;  1GAX A;  2JS5 A;  2BTO A;  2YXH A;  3J7A U;  1NU1 H;  2AZ2 A;  2P67 A;  5IWA O;  4O4J A;  4LFA B;  3G6B A;  1XMQ B;  5IDJ A;  1VQ7 V;  1NI8 A;  1N0N A;  4BIU A;  1DF4 A;  1I5Y A;  1BHB A;  5K1P A;  5B1A B;  2YDE A;  2EX3 A;  5B1A C;  2WLM A;  1Q81 W;  1VP7 A;  3GWK C;  1VQP V;  5FNV A;  4EEQ A;  1OCZ B;  1PNK A;  4RO2 A;  4PA3 A;  3CRC A;  1Q8I A;  1GKF A;  1HNW O;  4O4H B;  4I50 B;  1NH2 B;  3VQX A;  2YI9 A;  3E8F A;  3T1H B;  1IJG A;  1SQQ H;  1QR8 A;  5LP6 B;  3OAA G;  4K0K B;  3KCY A;  4DK1 A;  2OCC C;  5JWP A;  4J11 A;  3JAK A;  3SR2 C;  3AG2 C;  2VQF B;  4JYB A;  4CC5 A;  3ETE A;  2UXC O;  4QE9 A;  3IGA C;  3FYI B;  4OXS A;  2LFS A;  2P7T C;  2HKO A;  2Z3Y A;  2YS8 A;  3AK3 A;  2YID A;  1KBH A;  3A0H Z;  3ZN0 A;  3OUS A;  2YI8 A;  3MHS C;  1GK9 A;  1I94 O;  2IJJ A;  4HBN A;  5LXT B;  2JGD A;  5ITZ A;  2R70 A;  1FFT B;  3M8A A;  3E83 A;  3M7M X;  1X59 A;  1ZAU A;  1BS3 A;  4KHP O;  2FYU H;  1UPG A;  2Y4U A;  1TUB B;  2HG5 C;  1HDJ A;  3W7U A;  1OCO B;  1PNL A;  2Y0P A;  3DC5 A;  4JI0 B;  4JI2 O;  4QPK A;  5EC1 C;  1Y6X A;  2EIK B;  2WWW A;  4UV9 A;  3ZHQ A;  1AJQ A;  4JI7 B;  5LYJ B;  3G80 A;  2QJ1 A;  3BFR A;  5KMG A;  3RFR A;  4N21 A;  2IJH A;  4DO2 A;  1VQO V;  4YJ2 A;  4AQY B;  5L3C A;  4NXM B;  3K9S A;  5KUM A;  1J5E O;  2VS0 A;  4DR3 B;  4GZR B;  1Z5V A;  5B1B C;  1KEC A;  3FB7 C;  3QO8 A;  2FB5 A;  4I7Z B;  1EN6 A;  4DUY O;  3K5M A;  4B3T O;  4AQY O;  1GN6 A;  3WFV A;  4ZOL B;  3CSX A;  3SYO A;  1R1B A;  3CME V;  3CPW U;  3CMA V;  4O4L B;  3R65 A;  2OTL V;  2ZE8 A;  4X1I A;  4DV3 B;  3QNE A;  1ZUQ A;  3P3P A;  5LP6 A;  3ZS8 C;  1OHH G;  5B1N A;  3K03 A;  4MSW C;  3VOU A;  2CTW A;  2K9P A;  3K5L A;  4IT5 A;  3HKC A;  4WF9 V;  3TJT A;  2WPD G;  2WA3 A;  2F4V O;  1MSW D;  2XHB A;  4FLW A;  4LF7 B;  4DR1 B;  1AIL A;  2E75 B;  4KHP B;  1Q5O A;  1MAB G;  5B66 Z;  5HFM A;  3UQ8 A;  3CWB H;  2E3C A;  2QWQ B;  2IH3 C;  3TGU H;  3W7T A;  4CZZ A;  2VQE O;  4LH6 A;  3OR7 C;  3ZRX A;  3N2G A;  3EHB B;  3QG5 A;  2Q5Z A;  1R3L C;  1JJ2 U;  1JOY A;  5LGN A;  1S76 D;  2A7W A;  4DV6 O;  3S3W A;  4GUN A;  2HVJ C;  5E1A C;  1H38 A;  5KAF Z;  3ABL B;  3W7X A;  1G8M A;  1B04 A;  1WLE A;  1VF5 B;  4YHH O;  3K5N A;  2EIM B;  5H5N A;  1XHZ A;  4J80 A;  4ICG A;  2ODM A;  4X1K B;  1FPO A;  2JVD A;  2WLI B;  3F7Y C;  2FKX A;  3HKB A;  1MMM A;  2ETN A;  3JAL B;  5EYP B;  3PJS K;  4BR6 A;  1CEZ A;  4PV1 B;  3VQW A;  2L35 A;  2V4D A;  4XDK A;  2LFR A;  3K06 A;  2AXT Z;  2F93 B;  4L8J A;  4TUY A;  5CBF A;  4R6Z A;  4JI1 O;  1RPO A;  1M1K W;  1LR1 A;  3NXS A;  1YIJ V;  2GV9 A;  1KKC A;  3W7W A;  1RPR A;  3H1H H;  1N4C A;  4IYH A;  2FTK A;  3KKY A;  4X1I B;  1COW G;  4TV9 B;  1FFX B;  5B5E Z;  2IM9 A;  4OPA A;  4YJ3 A;  3CD6 V;  4JI7 O;  3LSS A;  1N33 B;  3W7S A;  1H2G A;  4RUF A;  2AHZ A;  3MDS A;  3LDD A;  1JFF A;  1SKV A;  1PNM A;  1BCC H;  1OV9 A;  1DTO A;  2B5U A;  1RFY A;  4UFZ A;  2EBO A;  3F7V C;  2UUB B;  2A0L A;  1FOU A;  3S3X A;  3RYC B;  2B1G A;  3CXC U;  2Q69 A;  2GUZ B;  5F2V O;  5IYB O;  3U0Z A;  1YVW A;  1Z5W A;  5BXZ A;  5IJ0 B;  4DUY B;  1BHA A;  5J9P C;  3J80 N;  4JTA B;  4H0L B;  3OT7 A;  3SPG A;  2ADP A;  5L3E A;  3ZHT A;  4PI0 A;  5J2U A;  1MZF A;  1JJO A;  3K9A A;  3BY6 A;  1JR9 A;  4K0K O;  1YTF B;  3LNN A;  2Q4P A;  4FFB B;  3HPL C;  1GN3 A;  3BAA A;  4U7N A;  3FAV A;  1XEQ A;  5IJ9 A;  2X6B A;  2YSU B;  1B6Q A;  1K5S A;  1KC8 W;  4DR1 O;  2YIB A;  5LOV B;  2QTS A;  2IBZ H;  4J7K A;  1WPX A;  4P9O A;  2BOC C;  3ZHR A;  1M90 W;  3MHH C;  2VQE B;  3E22 A;  3IJ4 A;  4UVA A;  5E79 Z;  1P7G A;  4UB6 Z;  4O4J B;  4X8A A;  1WA8 A;  3ABM B;  1YSC A;  1U97 A;  1KMI Z;  2Z0A A;  3X2Q C;  2O57 A;  1QLE B;  4K8Z A;  1AI4 A;  1IUR A;  4JZ2 A;  2OCH A;  3JD0 A;  4UCU A;  4OX9 O;  4P2Z A;  1NKD A;  1HNW B;  4JI2 B;  1WB7 A;  1G1X B;  4I9W A;  3IFX A;  5B3S C;  1PL4 A;  3OTO B;  1JFF B;  4JAA A;  3KCX A;  4DRX B;  5JVD B;  5KUK A;  4UB8 Z;  4W4K A;  5IYZ B;  4X65 B;  1JQ0 A;  5EBM C;  1G4Y B;  1SS3 A;  4CH6 A;  5EIB D;  2QR4 A;  5B3S B;  3OMA B;  3DSQ A;  1O9H A;  1ZLZ A;  3RGB A;  2GUZ A;  3SYC A;  3AG3 C;  4IIJ B;  5JCO A;  3IC9 A;  1HNZ B;  4FM2 A;  1W59 A;  3OTO O;  5FPO A;  2VWJ A;  5KAI Z;  3CCQ V;  1V55 B;  2X6A A;  1XMO B;  5JH7 B;  3JD1 A;  3C3T A;  1QHT A;  2DE0 X;  5FLX N;  3VQY A;  4KUM A;  3DXR B;  1L0N H;  1E1Q G;  1W0J G;  1K9M W;  4JAS A;  1YZB A;  2ZDI C;  3JAT B;  1K3E A;  4LWS B;  1IZ3 A;  1VMG A;  2RQ6 A;  3ZED A;  3RN4 A;  1OCR B;  5LP6 C;  2CGN A;  1GM8 A;  2CH7 B;  2PI4 A;  1S3J A;  4JYA B;  1HNZ O;  2F43 G;  3AEI A;  3RW0 A;  2X7R B;  3LSU A;  1SZX A;  5EC2 C;  2EIL B;  4DXW A;  5LXT A;  3JAR A;  4WFA V;  4QNH B;  5JJJ B;  4JPR A;  2DOS A;  2WLL A;  1D5N A;  4P9P A;  1NQT A;  5D5Q A;  2YIA A;  3EVK A;  3B40 A;  2JK5 C;  4G28 B;  3CC4 V;  4E2L A;  4WBN B;  4FLV A;  2Q73 A;  4J42 A;  4FM0 A;  2Q8V A;  5LOV A;  3E35 A;  4DW0 A;  3JCU Z;  4FFK A;  1WPB A;  4JTD B;  3G6E V;  3CP1 A;  3G4S V;  2P6J A;  4HNA A;  4DR7 B;  1SQX H;  2DQ3 A;  4GX2 A;  2NLJ C;  3ML0 A;  2KQX A;  4DR2 B;  2LJ2 A;  4PA7 A;  1ZSP A;  3H9V A;  4QGP A;  2QGN A;  4MVS A;  3D3Q A;  2Q7H A;  3RVY A;  2ITC C;  5H6R A;  4U3J B;  2XT9 A;  4HYO A;  2YC0 A;  5KX5 A;  1XQ8 A;  4H33 A;  4MTG A;  2ZM6 B;  4PA4 A;  1NR7 A;  1VQN V;  4D7S A;  3LDC A;  1N32 B;  2EIL C;  1EBO A;  2PGG A;  1JCH A;  4JV5 B;  1H8E G;  5DN6 G;  1FKA O;  5H9C A;  4UVC A;  1QCE A;  4Z1M G;  3CJH A;  4UCR A;  3APQ A;  1HR0 B;  4R7C A;  3ABM C;  3L70 H;  1NR1 A;  1R6T A;  2A79 B;  1O9G A;  4G2K A;  5JH7 A;  4B3R B;  4MT8 A;  5CBH A;  1JNB A;  4U3F H;  4J41 A;  1Q82 W;  1H8H G;  1VF6 A;  5KX5 B;  4X88 A;  2UU9 O;  2EIN C;  2HFE C;  3K0D A;  1OCC B;  1I94 B;  4I4T A;  2N05 A;  4XDL A;  2EJR A;  4J9Z B;  3SJQ C;  3ZRV A;  3CCU V;  2H94 A;  3K04 A;  2ZR3 A;  1NJI W;  5CA1 B;  1HR0 O;  1VQ5 V;  3JAW B;  1ROP A;  1H2M A;  3JD3 A;  2KSD A;  1YDX A;  3QTC A;  2QKA A;  3LDE A;  2DQ0 A;  3E8H A;  1R3J C;  3CB2 A;  1GMG A;  3OFN G;  2QDO A;  1N36 B;  4EFE A;  1ZWI C;  4PHZ A;  2WAM A;  2F95 B;  3RBZ A;  1XIL A;  4X64 O;  1QLN A;  4LF5 B;  2Q6A A;  1VQ4 V;  2BCC H;  4UUJ C;  1M57 B;  1EZV H;  1FYJ A;  1KP3 A;  4KP4 A;  4OX9 B;  4PDM A;  3K58 A;  2HEP A;  1Y67 A;  3BEH A;  2H8P C;  2R9I A;  4X66 B;  1XNQ B;  1SF9 A;  4LFB B;  1XDC A;  4X65 O;  2Y48 A;  1AI5 A;  3FB6 C;  4DR5 B;  4J7Z A;  2DW4 A;  4K8X A;  1Q90 D;  3H1L H;  3OUF A;  4TUY B;  1PM9 A;  4FIP C;  5BMV B;  1DGS A;  1GM9 A;  3L74 H;  4YJ2 B;  1BL8 A;  1R73 A;  3SJC C;  1U96 A;  1XNR B;  2EIJ C;  2OT5 A;  2D3O W;  4B3R O;  4BIZ A;  1FFX A;  2LO1 A;  3SPH A;  1Q6H A;  2DYS B;  3CC7 V;  3APO A;  2DYR B;  2Q0A A;  5LHG A;  5GTH Z;  3TET A;  3T1Y O;  4GKK O;  2X0L A;  3CC2 V;  3P30 A;  4X62 B;  2LP7 A;  1XNQ O;  1QBZ A;  1R6K A;  3RYH A;  2YXY A;  1KQS U;  3E8G A;  3SYA A;  4I55 A;  4LFB O;  2BSK B;  4X20 B;  1YJ9 V;  2E5L B;  4I4T B;  3JAK B;  1IDS A;  1N34 B;  4LF9 O;  3T1C A;  1VEW A;  1KUQ A;  4EFB A;  1YIT V;  4UVB A;  1PL0 A;  3OMN B;  5TIS Z;  4JYA O;  1XNR O;  4UCT A;  4CH3 A;  2HHH B;  3B09 A;  1KYO F;  2Y69 B;  3BA9 A;  2MK3 A;  3CS5 A;  2QEX V;  1F4M A;  5HFL A;  4DV0 O;  3ASO C;  2A3Q A;  1FXV A;  4GKK B;  1SA0 B;  4O2B B;  4LC1 A;  2D2C B;  3SJB C;  1WB8 A;  4O2A A;  1H2K A;  1UJW B;  5A9G A;  3G67 A;  2RDC A;  1LNQ A;  2PYJ A;  3D3I A;  3HR0 A;  3WU2 Z;  2JGU A;  2IU3 A;  2WSS G;  3FAV B;  4DV3 O;  1K4D C;  2CTQ A;  1X4T A;  2DN9 A;  4LH7 A;  1XMO O;  4JI3 O;  1KD1 W;  4FFB A;  3JAS B;  3K79 A;  3SYQ A;  1I7F A;  3WB0 A;  4GX5 A;  1N8R W;  4ZI7 B;  1K5Q A;  2UU9 B;  3U10 A;  4E4E A;  2L6L A;  3AG1 B;  1NVP B;  3UCS C;  2ZIN A;  5CA0 A;  1D2D A;  1WN7 A;  3CRA A;  3GWO A;  4KL1 A;  3I5D A;  3QVN A;  1WA8 B;  1ARO P;  2JS3 A;  2UXX A;  3E2E A;  3FX7 A;  3K3W A;  3RT3 C;  3ABU A;  5A2Q N;  3P32 A;  4QE7 A;  5IWA B;  4U7O A;  5H6Q A;  1P84 F;  4PDL A;  4JI8 O;  3L72 H;  3WB1 A;  2FL4 A;  2EZP A;  1TA8 A;  3UT5 B;  2E74 B;  2Q7G A;  4X64 B;  2WLL B;  1TGO A;  5IE9 A;  4LR3 A;  1VQM V;  4CS2 A;  1W0K G;  4IL6 Z;  1M57 C;  1YJW V;  4DR6 B;  5IYZ A;  2ZR2 A;  2HJF C;  4MVQ A;  5CA0 B;  3QO7 A;  2MW2 B;  1HNX O;  3AG7 A;  2N74 A;  4ASU G;  1YEW A;  2PTM A;  4GX0 A;  1Y74 A;  4BWA A;  1K97 A;  1NTZ H;  1FXK B;  2ZKO A;  1SRY A;  1MSD A;  1S5J A;  2VWK A;  5CBG A;  2ZE6 A;  2B9Z A;  1K73 W;  2W6I G;  2K1E A;  3JAT A;  1S0V A;  2QWO B;  1E79 G;  2OWO A;  4NTY A;  1YJN V;  2RNB A;  5C8Y B;  1XOU A;  2ZM6 O;  1ORQ C;  3GB7 C;  1SQG A;  1XBL A;  1IXM A;  1SQV H;  1URF A;  2EIN B;  1IBL B;  1GTO A;  1TAE A;  1GN4 A;  3QO5 A;  2ATK C;  5EBW C;  3MD0 A;  3UM7 A;  4MTF A;  2OYQ A;  1DK1 A;  3D8C A;  2UXN A;  4PEL A;  1V55 C;  4DV1 B;  3HKD A;  3OR6 C;  1AR5 A;  3B2E E;  2PUS A;  1S77 D;  1N32 O;  5LHH A;  5CA3 A;  2QWR B;  3L9D A;  3BPZ A;  1VF6 C;  4FK5 C;  1SA0 A;  4O2B A;  3CJH B;  4B7K A;  2UXD O;  3D36 C;  2F4V B;  2Y0I A;  3ABT A;  4DV1 O;  4K3A A;  4EKW A;  4F6E A;  1M93 A;  2KG7 B;  3H1J H;  2ZNJ A;  4HNA B;  2WLN A;  3ICX A;  4FM1 A;  3AG2 B;  5IJ9 B;  1VQ9 V;  2IH1 C;  1Q6U A;  1F23 A;  2Y4T A;  4DV6 B;  4WBN A;  4UXN A;  3SPC A;  4PI2 A;  2CK3 G;  3MAQ A;  3ZCC A;  4ABM A;  2UXD B;  1QVG U;  1MA1 A;  2M6Y A;  2VRZ A;  4QJF B;  3FKS G;  1V54 C;  4TV8 A;  4TWK A;  3RWR D;  2YXL A;  4K35 A;  5KHJ A;  2G38 A;  2JEU A;  4GX1 A;  3OM3 B;  2A9H A;  1P7B A;  2Q68 A;  1NS1 A;  3OGC C;  1BE3 H;  3E8B A;  1MZE A;  4DV7 O;  4D7T A;  1AI6 A;  2H3O A;  3VQV A;  1R6N A;  4F6R A;  3ZIA G;  1UFI A;  3ETG A;  1TUE B;  3HKE A;  3OGI B;  4RWU A;  3B77 A;  2F23 A;  3JSN A;  3X2Q B;  4PDR A;  4LFA O;  5BR8 O;  1K8A W;  2ZE7 A;  4HZ3 A;  5EZY A;  3ZRS A;  5IYC O;  2V1D A;  3RYC A;  2LW1 A;  5BMV A;  3K08 A;  1M9N A;  4J10 A;  3N27 A;  3I56 V;  2CGO A;  5J2U B;  2R9A A;  5IY5 B;  2ZDI A;  2JRI A;  3L73 H;  1YXB A;  1AB3 A;  2Q7E A;  1SET A;  1AR1 B;  2GSM B;  4JAV A;  4YIP A;  5H2F Z;  1QLE C;  4DR4 O;  3CRR A;  3E86 A;  1IBM O;  4O4L A;  1A32 A;  4JI3 B;  5LA6 B;  4LF6 O;  3O65 A;  3AG4 C;  4ZOL A;  2JGD B;  5ITZ B;  1K4C C;  4X62 O;  3UO3 A;  2ZCE A;  4YHH B;  4X66 O;  1HW7 A;  5CA1 A;  2DYS C;  3AG1 C;  3AG3 B;  3SYP A;  1I08 A;  1WP7 A;  4IGG A;  3FD9 A;  2RN9 A;  1KKD A;  1Q3E A;  4WFF A;  3QF7 A;  4JI6 O;  1AJP A;  2ZT9 B;  1XUQ A;  4X1Y A;  4JI5 O;  2IJK A;  2XAF A;  2F1M A;  2ZD9 A;  1PD3 A;  4DV2 O;  3ABK B;  2ARH A;  1XL6 A;  1IBK B;  1IBM B;  3E22 B;  3ETQ A;  1R3K C;  2CE4 A;  1PPJ H;  4R8C A;  3IAY A;  3N2G B;  4DR6 O;  2WLI A;  2P06 A;  2HP8 A;  1FS0 G;  3AK1 A;  1FAF A;  2GDS A;  2YUA A;  5EYP A;  4B3M B;  1SES A;  2CUG A;  4YIO A;  5FPR A;  3BVO A;  3WG7 B;  1JMK C;  4FLT A;  1LUV A;  3ZMS A;  2CDY A;  4MW8 A;  3JD2 A;  2ADQ B;  4J9Y B;  5JVD A;  4UCS A;  2BSK A;  5K1X A;  5LMN O;  2DJV A;  4G27 B;  3KDR A;  4BAY A;  3DTU B;  2OIE A;  4LF8 O;  4CH5 A;  4RQF A;  1L0L H;  2NN4 A;  4DR2 O;  3FB5 C;  1GRJ A;  5FL7 G;  2UUA O;  1MNG A;  4NB5 A;  3ASO B;  5L3B A;  4XDJ A;  4LP8 A;  1OJH A;  1R3I C;  5LMN B;  4W4L A;  1J5E B;  2KB1 A;  1BQZ A;  1G6U A;  1EN4 A;  5KHG A;  3LUT B;  1P49 A;  1K92 A;  2QM8 A;  3OTF A;  2CH7 A;  5GTI Z;  4H13 B;  3TXQ A;  4IYI A;  1PP9 H;  5LGT A;  4I50 A;  1M5I A;  3CYO A;  4WFH A;  4GKJ B;  2RJZ A;  4NXN O;  3CRQ A;  2A06 H;  3A2F A;  4O4I A;  4YJ3 B;  2QKS A;  4JZG A;  4DUZ B;  1L8D A;  5LMU B;  2GTA A;  2Q9L A;  4CH4 A;  2QM4 A;  1KB9 F;  4CS3 A;  2XOK G;  3F5T A;  2E76 B;  5DED A;  3CCE V;  2DWD C;  1VQK V;  3CCL V;  2OTJ V;  3K0G A;  1ZTE A;  3TK1 A;  3CCV V;  1AJN A;  4Z2W A;  3O9O A;  1AP6 A;  2W0X A;  5KHH A;  4I0X B;  3WG7 C;  1S5H C;  2Q67 A;  4B3S O;  3CX5 F;  4QIW F;  3STL C;  4B7E A;  1K33 A;  1K7D A;  5GON A;  3AG4 B;  2ZNI A;  3T4Z A;  2AW9 A;  4MTO A;  2GBO A;  3ZHS A;  5C93 A;  4NXM O;  1BT8 A;  4QPJ A;  2BOB C;  2F66 C;  1AI7 A;  4I9Q A;  2QKC A;  1VIB A;  2LGQ A;  1S72 V;  1JX9 A;  3ABK C;  1ZL8 B;  4LCU C;  3E89 A;  2ZIM A;  1N36 O;  1H2L A;  1BSM A;  3BRC A;  3BAB A;  3ZJZ A;  5KA6 A;  1TUB A;  2BTQ A;  5IT9 N;  4J7J A;  3SJA C;  5BZB A;  4FLU A;  1W2B U;  2E5L O;  2QSA A;  5BR8 B;  1CXZ B;  1DF5 A;  3JD4 A;  4ZHQ A;  3ABL C;  3JCZ A;  5FNV B;  3N2K B;  1YI2 V;  3PN1 A;  2P90 A;  5LMU O;  4R50 A;  2XAQ A;  3ASN C;  3A0B Z;  1F51 A;  2EZO A;  4PA9 A;  3KG2 A;  1XMQ O;  5JQG A;  4DRX A;  4LF6 B;  2RMK B;  5EBL C;  5KA5 A;  5LL6 Y;  4L87 A;  2EJ7 A;  2YEV A;  3EXA A;  1WAZ A;  3ZHU A;  4FZ0 A;  4H37 A;  3P3N A;  1VAR A;  3RVZ A;  3CE2 A;  4B3S B;  1IXB A;  2N04 A;  5CMU A;  1J95 A;  3T2M A;  4AI8 A;  3ZMZ A;  3DXR A;  4OGQ B;  1D5A A;  3EFF K;  2CTP A;  2W0F C;  3FB8 C;  2EIK C;  1WJZ A;  1N0J A;  2R9R B;  5B1O A;  5GW7 A;  1OCO C;  3LNM B;  4X20 A;  1EN5 A;  4PD4 F;  2WLK A;  1IBK O;  5EZY B;  4LNU A;  3ZX6 A;  2PY5 A;  3D36 A;  2JJ1 G;  5CB4 B;  1MOF A;  2HR3 A;  1Q6I A;  4DV0 B;  2Q0O C;  1SQB H;  4JGS A;  1EFR G;  1B3Q A;  2YIC A;  4DR7 O;  1GO3 F;  1NVP D;  2P22 C;  1Y66 A;  5KHI A;  1I0H A;  3B4S A;  1VQ6 V;  2OIG A;  3J81 N;  1YCI A;  3ZBH A;  1RSO B;  3K5O A;  1Y4M A;  4O2A B;  3G71 V;  2QWN B;  3SGI A;  1PKX A;  4FLY A;  3C3S A;  1B06 A;  2OCC B;  1YHQ V;  1QVF U;  3U11 A;  5IY5 C;  1FJG O;  1IVS A;  4FMT A;  1V9P A;  1FXH A;  3ZMU A;  3Q4H A;  4JTC B;  4F4L A;  4LF4 O;  4IIJ A;  4X1Y B;  3OEE G;  4X89 A;  4JI5 B;  1OCZ C;  1M56 B;  4FVM A;  3CHX A;  2Z5U A;  2HHH O;  2UXB O;  2ZIO A;  4DR4 B;  1RSO A;  4LWS A;  4ZHQ B;  1M56 C;  5AG2 A;  3M99 B;  2PF4 E;  4I55 B;  1TVK A;  1H2N A;  3ZMT A;  2QM7 A;  1JA8 A;  1FXK A;  3RYF A;  4MVM A;  5J2T A;  1BMF G;  4WFG A;  5L3F A;  3L75 H;  4JI4 B;  2DMX A;  5CN0 A;  3HKE B;  4O4H A;  3WB2 A;  1NTM H;  1VF7 A;  4DR3 O;  2AGA A;  4RUE A;  1GN2 A;  2V7Q G;  4LBE C;  5JJE B;  4P30 A;  5C8Y A;  1T5E A;  3A0R A;  1ENV A;  2QE7 G;  4AHC A;  2UUA B;  2PYL A;  3T4D A;  3JSL A;  2AHY A;  4DW1 A;  3K59 A;  5CB4 A;  2ZE5 A;  4Q6G A;  3CCR V;  1F4N A;  2P4V A;  2HVK C;  1FXK C;  4LF5 O;  3KZI Z;  1IBL O;  3ZMV A;  4FJC C;  4MTX A;  3OMI B;  1FD9 A;  3STZ C;  2XAS A;  3ASN B;  1ZX3 A;  4DV5 B;  3NR7 A;  3IC7 A;  1L1F A;  3RYI B;  1GM7 A;  2LGW A;  4JI1 B;  5JJN B;  3OD4 A;  4DV4 B;  2XUM A;  4NYK A;  3LSQ A;  3ZRW B;  2GTS A;  4MVZ A;  4MVO A;  2WLH A;  2LQT A;  2XAG A;  1HWY A;  4YY3 O;  4GCZ A;  3B8N A;  2IU0 A;  2Y69 C;  2UXC B;  2JEX A;  4U3J A;  1OCR C;  1F7Y A;  5KMG B;  4UV8 A;  3HB3 B;  4NR1 A;  4JV5 O;  4X9Q A;  2KKW A;  2EIM C;  3SPJ A;  3Q4H B;  2UUC B;  4DV7 B;  2M7W A;  3JAM N;  1QNM A;  5DEC A;  2XND G;  1TVK B;  1SC5 B;  4H44 B;  4ZBM A;  4MS2 A;  2XTA A;  3CCJ V;  3T1H O;  4HAM A;  4WCE V;  3RYF B;  1QU7 A;  3SPI A;  5GON B;  2QWP B;  3JYC A;  4TQF A;  4NXN B;  4OPH A;  1US6 A;  1H2S B;  3K57 A;  5IJ0 A;  4NTW A;  2HJD A;  1NH2 D;  4NVP A;  2ZXW C;  5J2T B;  4N23 A;  2EIJ B;  4D6T H;  3R66 A;  1Y76 A;  4DK0 A;  3FFQ A;  2BE3 A;  1PV0 A;  3ETD A;  1Q86 W;  2BTQ B;  4TQD A;  4TV8 B;  1AP5 A;  2QTO A;  4MW3 A;  3HKC B;  1NTK H;  4KXR A;  1P4R A;  1HP8 A;  1N33 O;  4PDV A;  2UXB B;  1DLB A;  3UO2 A;  4ZKI A;  5LHI A;  5DM6 V;  4IHJ A;  3JAW A;  4JF3 A;  4YY3 B;  4FLZ A;  2X6C A;  4BW9 A;  1XRE A;  2NR5 A;  2UUB O;  4CC6 A;  4C7U A;  1Y76 B;  2DYR C;  1E1R G;  1RM1 C;  3RYI A;  3H01 A;  3BA8 A;  2XAJ A;  4GT1 A;  5L3D A;  5KHK A;  4JYC A;  4I0X A;  2YEV B;  2CTR A;  2KG7 A;  4B08 A;  2FML A;  3OE7 G;  5LGU A;  2HLD G;  4CBC A;  4GYC B;  2VQF O;  1I5X A;  1BQ0 A;  2WA4 A;  3L71 H;  3F5W C;  2PZS A;  2QA4 V;  1AR4 A;  4TOI A;  4YXW G;  1THZ A;  3BHP A;  5LA6 A;  1XHX A;  3I55 V;  1XI1 A;  1OCC C;  5LBQ A;  2YIB D;  3TXS A;  1JVM A;  3CCS V;  2C2A A;  1AVM A;  3CEI A;  3BCC H;  2IJI A;  4AIL C;  4TSF G;  3HKB B;  1ZL8 A;  3SDL A;  4DV5 O;  3JAL A;  1CP9 A;  4LFC O;  1Q43 A;  1QQC A;  4LNU B;  5BY1 A;  5KLV H;  3JAS A;  1N34 O;  4LF9 B;  3H1I H;  3N2K A;  3CCM V;  4RAI A;  4X1K A;  4Q20 A;  1JPX A;  4EB6 B;  3T1Y B;  4F6R B;  3CRM A;  1H5W A;  1WNS A;  4JYY A;  5L3G A;  5IYD O;  4LFC B;  4PA6 A;  5D5P A;  2IW5 A;  4MVR A;  3TCU A;  4LF7 O;  3AK2 A;  4JAU A;  1NBM G;  1MG1 A;  1RP3 B;  2JJ2 G;  1QR9 A;  2DWE C;  4XBF A;  4BIO A;  3RYH B;  4TV9 A; 
#chains in the Genus database with same CATH homology
 1AR5 A;  4GUN A;  1I0H A;  3DC5 A;  1BSM A;  1XDC A;  4E4E A;  3OT7 A;  2ADP A;  1N0N A;  3C3T A;  1MNG A;  3BFR A;  4YIP A;  3QVN A;  1PM9 A;  1XRE A;  1JR9 A;  3C3S A;  3DC6 A;  4C7U A;  1B06 A;  1EN4 A;  4F6E A;  1GN3 A;  1IX9 A;  3RN4 A;  1MMM A;  1LUW A;  3K9S A;  4BR6 A;  1I08 A;  1EN6 A;  4JZG A;  1GN6 A;  4X9Q A;  1EM1 A;  3LSU A;  1AR4 A;  1SZX A;  5AG2 A;  1KKC A;  1XUQ A;  1IDS A;  1P7G A;  1QNM A;  1VAR A;  1MA1 A;  1D5N A;  1VEW A;  1AVM A;  3KKY A;  3CEI A;  1ZTE A;  2RCV A;  3EVK A;  1IXB A;  1JA8 A;  1ZUQ A;  4JZ2 A;  1MSD A;  2CE4 A;  2QKA A;  1AP6 A;  1N0J A;  4FFK A;  1GN2 A;  3TJT A;  3AK1 A;  1WB7 A;  2GDS A;  3MDS A;  3AK3 A;  1EN5 A;  1PL4 A;  1XIL A;  4YIO A;  4JYY A;  2AW9 A;  1GN4 A;  1WB8 A;  1LUV A;  2CDY A;  1BT8 A;  2ADQ B;  5A9G A;  1ZLZ A;  3AK2 A;  2P4K A;  1BS3 A;  1AP5 A;  1ZSP A;  2QKC A;  1Y67 A;  3KDR A;  3IC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...