4C7UA

Crystal structure of manganese superoxide dismutase from arabidopsis thaliana
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
203
structure length
203
Chain Sequence
MTFTLPDLPYDYGALEPAISGEIMQIHHQKHHQAYVTNYNNALEQLDQAVNKGDASTVVKLQSAIKFNGGGHVNHSIFWKNLAPSSEGGGEPPKGSLGSAIDAHFGSLEGLVKKMSAEGAAVQGSGWVWLGLDKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEKENN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [MN] 1, MITOCHONDRIAL
publication title Crystal Structure of the Arabidopsis Thaliana Manganese Superoxide Dismutase at 1.95 A Resolution
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 75
structure length 203
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4c7uA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4c7uA02
1N0NA 2ADPA 2QKCA 1EN5A 3QVNA 1QNMA 1XUQA 1VARA 1XDCA 1N0JA 2RCVA 3AK3A 3AK2A 1BS3A 1AP5A 3OT7A 1GN4A 1ZSPA 2QKAA 1PM9A 1GN6A 1AVMA 1JA8A 1EN6A 4GUNA 1MSDA 1WB7A 1ZTEA 4FFKA 4JZGA 3C3TA 1XREA 1BSMA 1I0HA 2AW9A 4E4EA 3LSUA 3MDSA 5A9GA 1MA1A 1D5NA 1LUWA 2CDYA 4YIPA 1EM1A 4JZ2A 4JYYA 1BT8A 1ZUQA 1VEWA 1MNGA 2CE4A 3IC9A 4X9QA 1B06A 4C7UA 1KKCA 1SZXA 1JR9A 3K9SA 4F6EA 3BFRA 1GN3A 3TJTA 3AK1A 2ADQB 1AR4A 1LUVA 3DC5A 1I08A 1IX9A 3DC6A 3EVKA 1IXBA 1P7GA 3RN4A 1Y67A 2GDSA 1WB8A 1GN2A 1EN4A 1AR5A 1MMMA 1ZLZA 3KKYA 1AP6A 1IDSA 4BR6A 5AG2A 3CEIA 2P4KA 3C3SA 1PL4A 4YIOA 1XILA
chains in the Genus database with same CATH superfamily
5J2TB 2FL4A 2ADPA 1Q81W 3WB2A 3K79A 1EN5A 3IJ4A 2OTJV 3SPIA 2Q0OC 3LUTB 3CPWU 4X62B 3AK3A 1SC5B 4O2AA 1Y4MA 4UCOA 1FYJA 1R6KA 1I5YA 4DXWA 2AZ2A 5EBMC 1QVGU 4JV5B 5IYBO 1S5JA 4LH7A 2ZR2A 5LHHA 3K06A 2VQFB 4FK5C 1IZ3A 1KB9F 1NS1A 4RQFA 2OTLV 4FFBA 3ZMUA 4DR5B 4IHJB 4JYCA 2EBOA 1K4CC 4CC5A 2BOCC 2XUMA 1AJNA 4R7CA 3MDSA 5HFLA 1TVKA 5IWAO 1H2MA 1Z2GA 3BCCH 4BW9A 2QE7G 3JCUZ 3CMAV 2HVKC 1QCEA 3JARB 1KU9A 4OPAA 4GKKB 1Y76B 2PUSA 3JSLA 4GX0A 1JOYA 3JAWA 2EINC 1NTKH 1AJQA 1NT2B 1Y66A 2XTAA 2DWEC 3SR2C 2EZOA 1WAZA 4LC1A 1Q6IA 3S3WA 1VQLV 2Q6AA 1YTFD 1M4UA 3OTOO 1ZL8A 4LF4B 3F5TA 2WLIA 2WLJA 1BHAA 3ZMTA 2CGNA 3E8HA 3RFRA 1OV9A 4TV8B 3OR7C 3CEIA 4HNAB 4X62O 2Q69A 3UQ8A 1KD1W 1N0NA 3CCVV 1WA8A 1CXZB 4FLZA 2EIKC 4BW5A 1SQGA 4JV5O 4PA9A 2QWRB 2UUBB 3CYOA 1IURA 1VARA 2A0LA 2VQFO 5JJEB 4RQEA 4IYIA 4JTAB 4DV4B 2LP7A 1K73W 4MVMA 1XBLA 1SKVA 4DR5O 1Q86W 5GTHZ 4XDLA 3JD0A 3HKCA 5GTIZ 3KDRA 4B08A 2XASA 1YVWA 1Q43A 2DWDC 4K3AA 1L1FA 2OYQA 3CCEV 2ZXWB 1R6NA 2ZE6A 1ZTEA 3CCRV 1SRYA 2WLLA 1G8MA 4LNUA 3DTUB 2R9RB 4CS2A 5LBQA 4QPKA 1MA1A 4I50A 4GKKO 1RSOA 1QQCA 1YJ9V 3UM7A 5GONA 3X2QC 2JRIA 3UT5A 1P4RA 5IJ0B 2QM8A 1AJPA 3N2KB 5LYJA 4QE7A 3K9SA 3SJCC 1K34A 3LNMB 1O9HA 4UCVA 4QE9A 2XOKG 3EXAA 1K5QA 3ZMZA 3DC5A 3Q4HA 4ABMA 2ZNIA 4LF4O 4DR4B 1KP3A 2IJJA 2L35A 2JGUA 2V1DA 5KUKA 2XAJA 2VRZA 4O2BA 1NVPD 3ETGA 3CWBH 1JVMA 3BHPA 5L3EA 4JYBA 4BR6A 2UUBO 2XAHA 3QTCA 3ASNB 4JI4B 5LMNB 5J9PC 4DV4O 5B3SC 3FAVA 3H1JH 3I56V 5JJJB 4U3FH 3K5NA 3SJBC 3ZN1A 1M57C 1NQTA 2IH1C 5LXTA 5KLVH 5A2QN 1AI7A 1NH2D 1FAFA 3ZHQA 2WLHA 2JVDA 1F51A 2RMKB 5KHIA 1TUBA 2K9PA 2Q7EA 4NXMB 4MTOA 3CHXA 3ASOB 5CA1A 3K3WA 1LNQA 1KECA 1L8DA 2OIGA 2GV9A 5DM6V 3OE7G 4X1KA 2ZQMA 5CB4A 3B4SA 1VP7A 1YEWA 1QR8A 2QKSA 4DW0A 3MHSC 1BQZA 1H2SB 2CH7B 4DR4O 5LHGA 2IM9A 2NR5A 3O65A 2ZIMA 3DC6A 3VBBA 4ZIBA 3OR6C 3G4SV 1FXKC 1Q3EA 4FLYA 4O4LA 4LCUC 4MTFA 2Y48A 3HKDB 3T1HB 4JI4O 4LH6A 5LMNO 4BIOA 4EEQA 2E5LO 2L6LA 2Y69C 1AP6A 1MABG 4I9QA 3GVMA 5KA6A 1XQ8A 4B7KA 3TXSA 3E8GA 1YI2V 4FZ0A 3MD0A 2BOBC 3WB0A 3WG7B 4PA7A 5LA6A 4NXNB 2GUZB 2LFSA 3OGIB 4GX1A 2JGDA 3D36A 1NJIW 1RFYA 4IIJB 4MVRA 2YC0A 4NTXA 1OCZB 4NXMO 1N4CA 1M56B 4JI5B 4FLVA 4GLXA 2QSAA 5LMUB 3ZEDA 3N27A 3DGEA 4YJ3B 2QGNA 3AG1C 4J80A 5JWPA 1NBMG 1S5LZ 2IU0A 4JASA 1CEZA 2WAMA 1M93A 3HR0A 4J7ZA 4UB6Z 2W0XA 3E22A 1I0HA 2F4VB 2IBZH 2NLJC 4NTYA 3JASB 2OCCB 4O4IB 3CS5A 5B1AC 1M9NA 3F7VC 4GCZA 5JQGB 1FFXA 1ZUQA 1ZAUA 3CMEV 1L0NH 3CCUV 2CE4A 3ETEA 1OCRB 4YXWG 3MHHC 1OCOC 2EIJB 2JS3A 4I4TB 1ZX3A 2W6IG 4I0XA 1G4YB 3OD4A 2GBOA 1GN3A 3TJTA 4ZBMA 3CXCU 1YJWV 4KL1A 1SF9A 5LOVA 3U0ZA 2HFEC 4XDJA 3TGUH 4X1YB 3T1HO 3ZHRA 1F7YA 2FMLA 3JAKA 3LDDA 4FLTA 2CTQA 4X66B 4DUYB 4H37A 3CD6V 3IAYA 2QTOA 3ETQA 3DSQA 1Y74B 3KCYA 3VQVA 4HBNA 3ZBHA 4JI8B 3CC2V 4NXNO 1YITV 3AG3C 1GM9A 4LFAB 4DV3B 2EIMB 3FB5C 1ENVA 4LWSB 5IE9A 4O4JB 1XILA 3AG2B 3KZIZ 4I5SA 3RYHA 3BY6A 3K5LA 4JI5O 1Z5VA 1SA0B 5LMUO 2YIDA 1W2BU 3STZC 3L70H 3QG5A 1G6UA 2R9IA 3L71H 2DYRC 1WLEA 2QDOA 4TSFG 4K8XA 4JTDB 3PJSK 2XHBA 1ZSPA 2EJ7A 4U3JA 1JJOA 2F4VO 2Q8VA 3GWKC 5B66Z 2WSSG 3B77A 3RT3C 4N21A 1V55C 1S72V 2W0FC 1NR1A 1WB7A 2UU9B 2P5OA 2Q67A 3B2EE 3T4DA 2MW2B 4E2LA 1OHHG 2AHZA 5A9GA 5IYDO 1N33B 5BXZA 1W0KG 4J9ZB 4KUMA 1JQ0A 4H44B 2QM7A 1K97A 4LF6B 4IGGA 4J11A 2HVJC 1BCCH 4AHCA 1VEWA 2BSKA 5FNVB 4J10A 1V9PA 2RQ6A 5KX5A 4J7JA 5LGNA 4X66O 2Q7HA 5C93A 4DUYO 1XL4A 2ADQB 1UFIA 3QO8A 3HKEA 5EZYA 5E79Z 4XBFA 2UXNA 3MAQA 3JALB 4JI7B 3ZHSA 3LNNA 4JI8O 4LF7B 3J7AU 1NI8A 1GN2A 3D3QA 2WA4A 4LFAO 4DV3O 4YJ2B 2EX3A 4MS2A 5D5PA 3ABKC 2F43G 2ZR3A 4EB6B 1B3QA 1N32B 4DR6B 1NTMH 4EKWA 4UV9A 2P4KA 2Q7GA 2ZE5A 2GHYA 4R50A 1QNMA 4FLWA 3PN1A 5L3BA 4FIPC 1IVSA 4ASUG 3CRRA 2HJDA 4EFEA 2LFRA 1Q7YW 3LDCA 1WNSA 1RPOA 3F5WC 3ZMSA 2UU9O 1H8HG 5IYZA 3CJHB 3L74H 3G71V 3ABTA 4FM2A 1QHTA 2X0LA 4GUNA 3JATA 5ITZA 4CC6A 1N33O 1WPBA 1J5EB 3C3TA 3FB6C 4NR1A 3T4ZA 1HNZB 2CAZC 4PELA 4LF6O 4MVSA 1FFTB 3K5MA 1BE3H 2QM4A 3K0DA 2CDYA 2PGGA 2LJ2A 2QEXV 2D3OW 2ZXWC 5D5QA 4RUFA 4MTGA 4Z1VA 2P4VA 4WFHA 4FLXA 4O4HA 4JI0B 1KKCA 4JI7O 1HW7A 4FM0A 4LF7O 4DK1A 5CN0A 1LUVA 1P84F 5J2TA 2AZ0A 2PI5A 1YIJV 4HAMA 1Q82W 1MZEA 4CH3A 1YF2A 4CH5A 1VQ7V 1N32O 1Y67A 3K9AA 2GDSA 4DR6O 1R3KC 4DO2A 1NTZH 4JTCB 2JJ2G 3D3IA 4TV9B 3H9VA 1YXBA 4PJ0Z 4DV0B 2LW1A 3P32A 4IHJA 4Q20A 3SPGA 1VQ6V 1U97A 1Q8IA 2KB1A 3C3SA 3ZRSA 4YIOA 5CBGA 4H33A 2QR4A 2QKCA 2DQ0A 3A8TA 1HNXB 2RCVA 4RAIA 1KP2A 5H6RA 4MVUA 1WN7A 2PI4A 5IT9N 1PL0A 4R8CA 4NB5A 1J5EO 2JDIG 3JARA 4LBEC 4WCEV 1HNZO 2QKAA 3H1KH 3N2GB 2CTPA 4X8AA 4FMTA 3K0GA 3BRCA 2YIBA 3JD1A 1Y76A 4UCSA 1PKXA 4ZI7B 2ITDC 1BSMA 4DR2B 1G1XB 1R3IC 2FB5A 4B3MB 1H38A 1PD3A 1S76D 4D7SA 5C8YB 5BY1A 4CH6A 4JI0O 4NVPA 3K59A 2FYUH 4J41A 1VQOV 1K8AW 4JZ2A 1VQMV 2YS8A 2ZDIC 2B1GA 3CSXA 3M8AA 2Y4UA 4RO2A 1VMGA 2P22C 4TV8A 1HR0B 2UXCB 2X6CA 4HNAA 3P3NA 3CC4V 2DQ3A 4A5UB 2PF4E 1IX9A 1HP8A 2QWNB 5IJ9B 3L9DA 4AILC 4DV0O 4AQYB 2Z3YA 2A9HA 2O57A 3CE2A 1N8RW 1QU7A 3CB2A 2YICA 3D36C 4B7EA 2YI9A 3ZCCA 3OW2U 1U96A 3FB8C 3FB7C 4BIUA 1P49A 2EJRA 1OCCC 2KSDA 2WPDG 1JPXA 1HNXO 2GTSA 3ZRXA 1F23A 4JGSA 3E8FA 1GRJA 3GWOA 4DRXB 5BMVB 2LGQA 1GMGA 2EILC 2PTMA 4PHZA 4PV1B 1BHBA 3HKBB 4X1IB 2KG7B 2EULA 4UFZA 5LP6B 2P7TC 3J81N 4B3SB 2WLMA 1V54C 5E1AC 2X6BA 1WP8A 3WG7C 4JI3B 5IJ0A 3CCMV 3N2KA 3TK1A 2HP8A 3ZRWB 2FTKA 4DR2O 3JYCA 1GH6A 1IBKB 1QLNA 4B3MO 1GK9A 2G38A 4ZKIA 1EN6A 4DR7B 2YI8A 1OCZC 1RP3B 1XNQB 3SYOA 1GM8A 3ICXA 3T1CA 4DR1B 3BVOA 2UUAB 5KA5A 1T5EA 1N34B 5BR8B 2IU3A 3SPCA 4F6RB 1HR0O 2UXCO 1FS0G 2DW4A 1URFA 2W6JG 4PDLA 4KP4A 2HJFC 2GSMB 2QWOB 4UVCA 5B5EZ 2EIKB 2Q5ZA 1JR9A 1SQFA 1VIBA 5B1BC 1VQKV 1Z5WA 3K58A 4X89A 4X20B 1JNBA 4JI6B 3TETA 3ABMB 3NR7A 4Z2WA 5L3CA 4AQYO 2N04A 3IFXA 1UJWB 1YJNV 2ARHA 1IXBA 3RN4A 1O9GA 2CUGA 1OCRC 4L8JA 2EIJC 2AGAA 3FYEB 1EBOA 3WFVA 5CA0B 1GAXA 3E86A 1AI6A 1ZLZA 4UB8Z 1RM1C 1M1KW 1M90W 2LGWA 5FLXN 4NKGB 5LL6Y 4K8ZA 1FPOA 3TXQA 2WA3A 4IYHA 1NKDA 2ZDIA 4YY3B 2ZM6B 1DF4A 2YIAA 2ZT9B 4B3SO 4JI3O 5JH7B 1OZ0A 1N0JA 1AI5A 1IBKO 4ZOLB 2E76B 3K5OA 4DR7O 3CP1A 1XNQO 2CH7A 1FD9A 1ORQC 4DR1O 1EZVH 3G67A 2UUAO 4LF5B 1Y6XA 1PNMA 5IY5B 2ZD9A 3CCSV 1N34O 5BR8O 4ZHQB 2ZE7A 2HLDG 1CPYA 3ETDA 4GX2A 1WJZA 5H2FZ 3T1YB 3OFNG 3GB7C 5FPOA 2YXYA 2XNDG 3R65A 4LP8A 5JCOC 3M7MX 2Q0AA 2X7RB 2HG5C 3HKDA 4X88A 3UO2A 3ZS8C 4FM1A 1EM1A 3KG2A 3I55V 1XOUA 4JI6O 1K33A 5LGUA 5B1OA 4QNHB 1VQ4V 1SZXA 2QA4V 1M57B 3LSQA 2E3CA 2YXLA 1AR4A 2GUZA 4CBCA 3CC7V 4PI0A 2P67A 1IJGA 4L87A 1X4TA 2YSUB 4IIJA 1YTFB 3JCZA 3QO5A 4YY3O 2ZM6O 5JJNB 3ZIAG 3RGBA 2M7WA 3RYFB 1AR1B 1QBZA 3SJAC 5AG2A 4I55B 3CRCA 2A06H 2Y4TA 2VWKA 4WFAV 1JFFB 1K5SA 2WLNA 2IJHA 5KAIZ 1COWG 3DXRB 3JASA 4WBNB 4O4IA 1KMIZ 3RVZA 4LF5O 5JQGA 1AP5A 2BTQB 4K35A 1QLEC 3H01A 2ZKOA 1WP7A 1R1BA 1VQNV 4DV2B 3T1YO 1SQPH 3ZN0A 4TWKA 4I4TA 5L3DA 4N23A 5EK0A 1JA8A 4JAUA 1FXKB 2UXDB 3FFQA 1MSDA 4PA6A 2XAFA 4X1YA 1SQQH 3W7SA 4OXSA 2Y0IA 2Y69B 2JJ1G 2ITCC 1LUWA 2XAGA 4WFBV 4IL6Z 2YEVB 3RYCB 1Y74A 2R72A 5H5NA 1XMQB 2QTSA 3I5DA 2CGOA 4P2ZA 1EFRG 5KMGA 2DJVA 4LWSA 4IT5A 4O4JA 4QJFB 4W4LA 1SA0A 3BA8A 3WU2Z 2DE0X 3QO7A 3AG1B 4KFMA 3E89A 1NVPB 1ZWIC 3ZRVA 3RYIB 3OEEG 2UXXA 2Q68A 2MK3A 4P9PA 4GT1A 1AI4A 4R6ZA 3CX5F 2DOSA 5JCOA 4PI2A 3OM3B 4GX5A 1IDSA 4FJCC 2VWJA 5JVDB 1TA8A 4WF9V 4J9YB 2RDCA 1SERA 1BZKA 2CTWA 3FX7A 1RPRA 5DECA 1NH2B 4DV2O 2A3QA 3SYAA 3O9OA 2RN9A 4TUYA 1FJGB 2IJKA 3BA9A 2UXDO 1HDJA 5FNVA 3ZMVA 5J2UB 2YXHA 2ODMA 5H9CA 5EYPB 3SYCA 4UV8A 5LGTA 1AVMA 1R3LC 4CS4A 1XNRB 3AEIA 3FKSG 4FFKA 4JZGA 1H2NA 2F23A 2X6AA 3ZHUA 3JALA 1XMQO 3S3XA 2GTAA 2JK5C 3ML0A 4TQFA 1E79G 3VQWA 4O2AB 4YJ2A 4PD4F 5EBLC 4U7OA 2F93B 4EB6A 4JAVA 4GZRB 1S77D 2LW7A 3TCUA 1TAEA 1H8EG 3CRAA 1M5IA 2QWPB 5KHHA 1W59A 3B8MA 1Q6HA 4FFBB 3BFRA 1S5HC 3THOA 3RVYA 1AROP 2DMXA 1DGSA 2ZNJA 3EFFK 1TVKB 3RW0A 1JJ2U 2F95B 4BWAA 1KBHA 1XEQA 3ZHVA 4GYCB 1V55B 5KHJA 5HFMA 3KKYA 3CJHA 5EIBC 2V4DA 5L3FA 2DN9A 1PNLA 5IDJA 1VF6C 3ABLB 1JX9A 1S0VA 2IW5A 2HEPA 1IBMB 4BAYA 4B3RB 1FJGO 2DYSB 3QVNA 2YUAA 3L72H 3JAWB 1XUQA 1D5AA 1EZJA 1XDCA 2RNBA 3W7UA 3AK2A 1K92A 2H3OA 2ETNA 1ZL8B 2UUCB 1XNRO 3CRQA 4HYOA 3H1LH 2WLIB 5KHGA 1D2DA 4GKJB 1N36B 4P30A 4FPPA 4JI1B 1PM9A 3SGIA 3OUSA 3E35A 3STLC 1F4NA 1P7BA 3UCSC 3U10A 4BIZA 5LP6C 2H94A 3ZX6A 3AG4B 1WA8B 3ABKB 3CRMA 3ASNC 3CCQV 4RWUA 3G6BA 4Q6GA 5F2VO 1IXMA 4U7NA 2JEUA 1QR9A 3OMNB 4JYYA 4G2KA 5H6QA 4FLUA 2K1EA 3HKCB 4TV9A 1B06A 2BTOA 4D7TA 3CCLV 4F6EA 3K03A 1NR7A 2WLLB 4LNUB 4I7ZB 1KQSU 3ASOC 1VF7A 2OT5A 1WB8A 1H5WA 1EN4A 1H2LA 4I50B 3L75H 2NN4A 1RSOB 5CA3A 3ABMC 4JAAA 5GONB 3IGAC 2CTRA 5GW7A 1IBMO 4K0KB 3N2GA 4B3RO 3UT5B 3B40A 1BL8A 5LYJB 2E75B 3CXHF 1DTOA 1THZA 2P90A 4OPHA 1AILA 4ZI7A 4FVMA 4QPJA 3WB1A 3W7TA 3OMIB 4X65B 3Q4HB 2UUCO 2Q73A 3D8CA 4CS3A 1R6TA 4JPRA 5C8YA 3CCJV 4GKJO 1N36O 4J42A 5KUMA 3OGCC 4JI1O 1SQVH 3LSSA 2ILMA 4O2BB 4OX9B 1GN4A 1VQ5V 4DV1B 4F4LA 2HR3A 4PDMA 1GN6A 1YDXA 4H13B 2H8PC 3E83A 1MOFA 4LF8B 1MSWD 1XREA 3FAVB 1R3JC 4JYAB 5IJ9A 3KCXA 2ATKC 2JS5A 4KXRA 5LHIA 4DV6B 2KKWA 1D5NA 1VF6A 3M99B 1W0JG 5LXTB 1X59A 3K04A 3W7XA 2A7WA 3A0HZ 1BMFG 2P6JA 5IY5C 4WFFA 3BPZA 2EINB 3JSNA 3P30A 4UXNA 1TUBB 3RBZA 3SYQA 4DUZB 3APQA 4C7UA 2B5UA 1M56C 4DV5B 5CA1B 2AXTZ 4DRXA 4PDRA 5BMVA 4LFCB 1KYOF 3E2EA 2E5LB 2E74B 4X1KB 4B3TB 1XHZA 3HKBA 4QIWF 4X1IA 5CB4B 4K0KO 3F7YC 2KG7A 1JMKC 1ROPA 1AB3A 1L0LH 4DW1A 2XAQA 5LP6A 1K9MW 1AR5A 1MMMA 1GO3F 4UVBA 3ZRWA 1KKDA 3FYIB 3JAMN 2OCCC 4X65O 5CMUA 2ZIOA 1VF5B 2VQEB 3E8BA 2A79B 2ZINA 3A2FA 4PDVA 4G27B 4OX9O 1I7FA 3UKMA 2XT9A 4DV1O 4O4LB 4F6RA 3HPLC 1UPGA 4MVOA 4CH4A 4X64B 3JD4A 2P06A 4WFEA 5KAFZ 4LF8O 2FKXA 2ZE8A 3G6EV 1YSCA 2F1MA 4JYAO 3OMAB 3L73H 4WFGA 2B1IA 4X20A 4DV6O 1XI1A 2PYLA 2Z0AA 1J95A 3X2QB 5LA6B 2V7QG 1SETA 2JGDB 4UCTA 4E4EA 5K1PA 4MTXA 2Q4PA 1I94B 2EIMC 1B04A 1KC8W 1XHXA 4DUZO 1OCCB 3AG2C 5CA0A 4DV5O 5KHKA 4DYLA 4LFCO 1GKFA 4UUJC 4D6TH 4X9QA 2QWQB 2EILB 1DF5A 4B3TO 1FKAO 3HB3B 4NTWA 3ZHTA 3H1IH 1IBLB 5DEDA 1I08A 1V54B 3E22B 2CK3G 5JH7A 1GM7A 5TISZ 4JF3A 2N74A 4ZOLA 1FXVA 1VQ8V 5EC1C 5B3SB 2VQEO 4LF9B 1YZBA 1YCIA 1HWYA 1FFXB 4I9WA 2LQTA 4HZ3A 4TOIA 1HNWB 1XL6A 2YIBD 2HKOA 4I0XB 1A32A 1PL4A 4ZHQA 1B6QA 3C90A 3NXSA 2WWWA 2OIEA 2Y0PA 5LOVB 4X64O 2OWOA 4MVQA 4MW8A 3JAKB 4KHPB 2IH3C 3ABUA 4Z1MG 4YJ3A 4DV7B 5B1BB 3APOA 1DK1A 2JIZG 3OT7A 1TUEB 4MT8A 4FZ1A 1SQXH 5DN6G 1PNKA 1F4MA 1I94O 2F66C 4CZZA 1FXHA 1BQ0A 2R9AA 3J80N 4JI2B 3JD2A 2RJZA 5EBWC 3RYHB 3W7WA 1WPXA 3SPJA 1RM1B 1NU1H 1R73A 1E1RG 3LSUA 4LR3A 1GTOA 1XMOB 2M6YA 3T2MA 4NYKA 1E1QG 2UXBB 4H0LB 1MZFA 3VQYA 2AHYA 4YHHB 2OCHA 1VQPV 2NNUA 1H2GA 1NZ6A 1MNGA 1IBLO 3IC9A 3RYFA 4U3JB 3B8NA 1DLBA 4I55A 3OTFA 1JFFA 3AK1A 2HHHB 1TGOA 1SQBH 5KMGB 3OAAG 3QNEA 4LFBB 4LF9O 3RWRD 1OJHA 3DXRA 1QVFU 4WBNA 1KUQA 1P7GA 5EIBD 3SJQC 3A0RA 4DR3B 2N05A 1HNWO 3SYPA 4PA3A 1Q90D 2BTQA 3SDLA 1JCHA 3ZJZA 2IJIA 4UCRA 2D2CB 2JEXA 2BE3A 4ICGA 2BSKB 4PA4A 5FPRA 4UVAA 3P3PA 5KX5B 4KHPO 1FXKA 1VQ9V 1CP9A 3FD9A 2R70A 5CBHA 3VOUA 1SZTA 4DV7O 2LO1A 1K3EA 1I5XA 3HKEB 5EZYB 2ZCEA 3A0BZ 5FL7G 3QF7A 1S3JA 1SS3A 4UCUA 2YEVA 3RYCA 3B09A 4MSWC 5B1NA 1BS3A 5CBFA 4W4KA 3H1HH 1YHQV 3ABLC 2BCCH 4XDKA 2WLKA 2PY5A 4JI2O 3K08A 4MVZA 4EFBA 3U11A 3BEHA 2DYSC 4TUYB 1Q6UA 3EHBB 3VQXA 1LR1A 3IC7A 5B1AB 1XMOO 1US6A 1FOUA 4AI8A 3OUFA 2UXBO 3BABA 2Z5UA 4QGPA 2AW9A 4YHHO 5L3GA 5K1XA 1OCOB 4TT3G 2PZSA 1Q5OA 2C2AA 4YIPA 4DK0A 3RYIA 2B9ZA 2EZPA 1PP9H 3SPHA 1BT8A 2HHHO 1SESA 5IWAB 3AG7A 5BZBA 3AG4C 4LFBO 5IYZB 2VS0A 4P9OA 5JVDA 3R66A 4DR3O 5EC2C 2QJ1A 3JATB 5ITZB 2PYJA 1PV0A 3LDEA 4OGQB 1MG1A 1QLEB 3EVKA 3AG3B 1H2KA 4J7KA 3JD3A 3G80A 3OEHG 1PPJH 1BGYH 1K4DC 3BAAA 4RUEA 5J2UA 2YDEA 5IYCO 5EYPA 4MW3A 2Q9LA 4O4HB 2DYRB 1K7DA 3OTOB 3K57A 2KQXA 3UO3A 4G28B 4TQDA
chains in the Genus database with same CATH topology
1N0NA 2ADPA 2QKCA 1EN5A 3QVNA 1QNMA 1XUQA 1VARA 1XDCA 1N0JA 2RCVA 3AK3A 3AK2A 1BS3A 1AP5A 3OT7A 1GN4A 1ZSPA 3KDRA 2QKAA 1PM9A 1GN6A 1AVMA 1JA8A 1EN6A 4GUNA 1MSDA 1WB7A 1ZTEA 4FFKA 4JZGA 3C3TA 1XREA 1BSMA 1I0HA 2AW9A 4E4EA 3LSUA 3MDSA 5A9GA 1MA1A 1D5NA 1LUWA 2CDYA 4YIPA 1EM1A 4JZ2A 4JYYA 1BT8A 1ZUQA 1VEWA 1MNGA 2CE4A 3IC9A 4X9QA 1B06A 4C7UA 1KKCA 1SZXA 1JR9A 3K9SA 4F6EA 3BFRA 1GN3A 3TJTA 3AK1A 2ADQB 1AR4A 1LUVA 3DC5A 1I08A 1IX9A 3DC6A 3EVKA 1IXBA 1P7GA 3RN4A 1Y67A 2GDSA 1WB8A 1GN2A 1EN4A 1AR5A 1MMMA 1ZLZA 3KKYA 1AP6A 1IDSA 4BR6A 5AG2A 3CEIA 2P4KA 3C3SA 1PL4A 4YIOA 1XILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0N A;  2ADP A;  2QKC A;  1EN5 A;  3QVN A;  1QNM A;  1XUQ A;  1VAR A;  1XDC A;  1N0J A;  2RCV A;  3AK3 A;  3AK2 A;  1BS3 A;  1AP5 A;  3OT7 A;  1GN4 A;  1ZSP A;  2QKA A;  1PM9 A;  1GN6 A;  1AVM A;  1JA8 A;  1EN6 A;  4GUN A;  1MSD A;  1WB7 A;  1ZTE A;  4FFK A;  4JZG A;  3C3T A;  1XRE A;  1BSM A;  1I0H A;  2AW9 A;  4E4E A;  3LSU A;  3MDS A;  5A9G A;  1MA1 A;  1D5N A;  1LUW A;  2CDY A;  4YIP A;  1EM1 A;  4JZ2 A;  4JYY A;  1BT8 A;  1ZUQ A;  1VEW A;  1MNG A;  2CE4 A;  3IC9 A;  4X9Q A;  1B06 A;  4C7U A;  1KKC A;  1SZX A;  1JR9 A;  3K9S A;  4F6E A;  3BFR A;  1GN3 A;  3TJT A;  3AK1 A;  2ADQ B;  1AR4 A;  1LUV A;  3DC5 A;  1I08 A;  1IX9 A;  3DC6 A;  3EVK A;  1IXB A;  1P7G A;  3RN4 A;  1Y67 A;  2GDS A;  1WB8 A;  1GN2 A;  1EN4 A;  1AR5 A;  1MMM A;  1ZLZ A;  3KKY A;  1AP6 A;  1IDS A;  4BR6 A;  5AG2 A;  3CEI A;  2P4K A;  3C3S A;  1PL4 A;  4YIO A;  1XIL A; 
#chains in the Genus database with same CATH topology
 5J2T B;  2FL4 A;  2ADP A;  1Q81 W;  3WB2 A;  3K79 A;  1EN5 A;  3IJ4 A;  2OTJ V;  3SPI A;  2Q0O C;  3LUT B;  3CPW U;  4X62 B;  3AK3 A;  1SC5 B;  4O2A A;  1Y4M A;  4UCO A;  1FYJ A;  1R6K A;  1I5Y A;  4DXW A;  2AZ2 A;  5EBM C;  1QVG U;  4JV5 B;  5IYB O;  1S5J A;  4LH7 A;  2ZR2 A;  5LHH A;  3K06 A;  2VQF B;  4FK5 C;  1IZ3 A;  1KB9 F;  1NS1 A;  4RQF A;  2OTL V;  4FFB A;  3ZMU A;  4DR5 B;  4IHJ B;  4JYC A;  2EBO A;  1K4C C;  4CC5 A;  2BOC C;  2XUM A;  1AJN A;  4R7C A;  3MDS A;  5HFL A;  1TVK A;  5IWA O;  1H2M A;  1Z2G A;  3BCC H;  4BW9 A;  2QE7 G;  3JCU Z;  3CMA V;  2HVK C;  1QCE A;  3JAR B;  1KU9 A;  4OPA A;  4GKK B;  1Y76 B;  2PUS A;  3JSL A;  4GX0 A;  1JOY A;  3JAW A;  2EIN C;  1NTK H;  1AJQ A;  1NT2 B;  1Y66 A;  2XTA A;  2DWE C;  3SR2 C;  2EZO A;  1WAZ A;  4LC1 A;  1Q6I A;  3S3W A;  1VQL V;  2Q6A A;  1YTF D;  1M4U A;  3OTO O;  1ZL8 A;  4LF4 B;  3F5T A;  2WLI A;  2WLJ A;  1BHA A;  3ZMT A;  2CGN A;  3E8H A;  3RFR A;  1OV9 A;  4TV8 B;  3OR7 C;  3CEI A;  4HNA B;  4X62 O;  2Q69 A;  3UQ8 A;  1KD1 W;  1N0N A;  3CCV V;  1WA8 A;  1CXZ B;  4FLZ A;  2EIK C;  4BW5 A;  1SQG A;  4JV5 O;  4PA9 A;  2QWR B;  2UUB B;  3CYO A;  1IUR A;  1VAR A;  2A0L A;  2VQF O;  5JJE B;  4RQE A;  4IYI A;  4JTA B;  4DV4 B;  2LP7 A;  1K73 W;  4MVM A;  1XBL A;  1SKV A;  4DR5 O;  1Q86 W;  5GTH Z;  4XDL A;  3JD0 A;  3HKC A;  5GTI Z;  3KDR A;  4B08 A;  2XAS A;  1YVW A;  1Q43 A;  2DWD C;  4K3A A;  1L1F A;  2OYQ A;  3CCE V;  2ZXW B;  1R6N A;  2ZE6 A;  1ZTE A;  3CCR V;  1SRY A;  2WLL A;  1G8M A;  4LNU A;  3DTU B;  2R9R B;  4CS2 A;  5LBQ A;  4QPK A;  1MA1 A;  4I50 A;  4GKK O;  1RSO A;  1QQC A;  1YJ9 V;  3UM7 A;  5GON A;  3X2Q C;  2JRI A;  3UT5 A;  1P4R A;  5IJ0 B;  2QM8 A;  1AJP A;  3N2K B;  5LYJ A;  4QE7 A;  3K9S A;  3SJC C;  1K34 A;  3LNM B;  1O9H A;  4UCV A;  4QE9 A;  2XOK G;  3EXA A;  1K5Q A;  3ZMZ A;  3DC5 A;  3Q4H A;  4ABM A;  2ZNI A;  4LF4 O;  4DR4 B;  1KP3 A;  2IJJ A;  2L35 A;  2JGU A;  2V1D A;  5KUK A;  2XAJ A;  2VRZ A;  4O2B A;  1NVP D;  3ETG A;  3CWB H;  1JVM A;  3BHP A;  5L3E A;  4JYB A;  4BR6 A;  2UUB O;  2XAH A;  3QTC A;  3ASN B;  4JI4 B;  5LMN B;  5J9P C;  4DV4 O;  5B3S C;  3FAV A;  3H1J H;  3I56 V;  5JJJ B;  4U3F H;  3K5N A;  3SJB C;  3ZN1 A;  1M57 C;  1NQT A;  2IH1 C;  5LXT A;  5KLV H;  5A2Q N;  1AI7 A;  1NH2 D;  1FAF A;  3ZHQ A;  2WLH A;  2JVD A;  1F51 A;  2RMK B;  5KHI A;  1TUB A;  2K9P A;  2Q7E A;  4NXM B;  4MTO A;  3CHX A;  3ASO B;  5CA1 A;  3K3W A;  1LNQ A;  1KEC A;  1L8D A;  2OIG A;  2GV9 A;  5DM6 V;  3OE7 G;  4X1K A;  2ZQM A;  5CB4 A;  3B4S A;  1VP7 A;  1YEW A;  1QR8 A;  2QKS A;  4DW0 A;  3MHS C;  1BQZ A;  1H2S B;  2CH7 B;  4DR4 O;  5LHG A;  2IM9 A;  2NR5 A;  3O65 A;  2ZIM A;  3DC6 A;  3VBB A;  4ZIB A;  3OR6 C;  3G4S V;  1FXK C;  1Q3E A;  4FLY A;  4O4L A;  4LCU C;  4MTF A;  2Y48 A;  3HKD B;  3T1H B;  4JI4 O;  4LH6 A;  5LMN O;  4BIO A;  4EEQ A;  2E5L O;  2L6L A;  2Y69 C;  1AP6 A;  1MAB G;  4I9Q A;  3GVM A;  5KA6 A;  1XQ8 A;  4B7K A;  3TXS A;  3E8G A;  1YI2 V;  4FZ0 A;  3MD0 A;  2BOB C;  3WB0 A;  3WG7 B;  4PA7 A;  5LA6 A;  4NXN B;  2GUZ B;  2LFS A;  3OGI B;  4GX1 A;  2JGD A;  3D36 A;  1NJI W;  1RFY A;  4IIJ B;  4MVR A;  2YC0 A;  4NTX A;  1OCZ B;  4NXM O;  1N4C A;  1M56 B;  4JI5 B;  4FLV A;  4GLX A;  2QSA A;  5LMU B;  3ZED A;  3N27 A;  3DGE A;  4YJ3 B;  2QGN A;  3AG1 C;  4J80 A;  5JWP A;  1NBM G;  1S5L Z;  2IU0 A;  4JAS A;  1CEZ A;  2WAM A;  1M93 A;  3HR0 A;  4J7Z A;  4UB6 Z;  2W0X A;  3E22 A;  1I0H A;  2F4V B;  2IBZ H;  2NLJ C;  4NTY A;  3JAS B;  2OCC B;  4O4I B;  3CS5 A;  5B1A C;  1M9N A;  3F7V C;  4GCZ A;  5JQG B;  1FFX A;  1ZUQ A;  1ZAU A;  3CME V;  1L0N H;  3CCU V;  2CE4 A;  3ETE A;  1OCR B;  4YXW G;  3MHH C;  1OCO C;  2EIJ B;  2JS3 A;  4I4T B;  1ZX3 A;  2W6I G;  4I0X A;  1G4Y B;  3OD4 A;  2GBO A;  1GN3 A;  3TJT A;  4ZBM A;  3CXC U;  1YJW V;  4KL1 A;  1SF9 A;  5LOV A;  3U0Z A;  2HFE C;  4XDJ A;  3TGU H;  4X1Y B;  3T1H O;  3ZHR A;  1F7Y A;  2FML A;  3JAK A;  3LDD A;  4FLT A;  2CTQ A;  4X66 B;  4DUY B;  4H37 A;  3CD6 V;  3IAY A;  2QTO A;  3ETQ A;  3DSQ A;  1Y74 B;  3KCY A;  3VQV A;  4HBN A;  3ZBH A;  4JI8 B;  3CC2 V;  4NXN O;  1YIT V;  3AG3 C;  1GM9 A;  4LFA B;  4DV3 B;  2EIM B;  3FB5 C;  1ENV A;  4LWS B;  5IE9 A;  4O4J B;  1XIL A;  3AG2 B;  3KZI Z;  4I5S A;  3RYH A;  3BY6 A;  3K5L A;  4JI5 O;  1Z5V A;  1SA0 B;  5LMU O;  2YID A;  1W2B U;  3STZ C;  3L70 H;  3QG5 A;  1G6U A;  2R9I A;  3L71 H;  2DYR C;  1WLE A;  2QDO A;  4TSF G;  4K8X A;  4JTD B;  3PJS K;  2XHB A;  1ZSP A;  2EJ7 A;  4U3J A;  1JJO A;  2F4V O;  2Q8V A;  3GWK C;  5B66 Z;  2WSS G;  3B77 A;  3RT3 C;  4N21 A;  1V55 C;  1S72 V;  2W0F C;  1NR1 A;  1WB7 A;  2UU9 B;  2P5O A;  2Q67 A;  3B2E E;  3T4D A;  2MW2 B;  4E2L A;  1OHH G;  2AHZ A;  5A9G A;  5IYD O;  1N33 B;  5BXZ A;  1W0K G;  4J9Z B;  4KUM A;  1JQ0 A;  4H44 B;  2QM7 A;  1K97 A;  4LF6 B;  4IGG A;  4J11 A;  2HVJ C;  1BCC H;  4AHC A;  1VEW A;  2BSK A;  5FNV B;  4J10 A;  1V9P A;  2RQ6 A;  5KX5 A;  4J7J A;  5LGN A;  4X66 O;  2Q7H A;  5C93 A;  4DUY O;  1XL4 A;  2ADQ B;  1UFI A;  3QO8 A;  3HKE A;  5EZY A;  5E79 Z;  4XBF A;  2UXN A;  3MAQ A;  3JAL B;  4JI7 B;  3ZHS A;  3LNN A;  4JI8 O;  4LF7 B;  3J7A U;  1NI8 A;  1GN2 A;  3D3Q A;  2WA4 A;  4LFA O;  4DV3 O;  4YJ2 B;  2EX3 A;  4MS2 A;  5D5P A;  3ABK C;  2F43 G;  2ZR3 A;  4EB6 B;  1B3Q A;  1N32 B;  4DR6 B;  1NTM H;  4EKW A;  4UV9 A;  2P4K A;  2Q7G A;  2ZE5 A;  2GHY A;  4R50 A;  1QNM A;  4FLW A;  3PN1 A;  5L3B A;  4FIP C;  1IVS A;  4ASU G;  3CRR A;  2HJD A;  4EFE A;  2LFR A;  1Q7Y W;  3LDC A;  1WNS A;  1RPO A;  3F5W C;  3ZMS A;  2UU9 O;  1H8H G;  5IYZ A;  3CJH B;  3L74 H;  3G71 V;  3ABT A;  4FM2 A;  1QHT A;  2X0L A;  4GUN A;  3JAT A;  5ITZ A;  4CC6 A;  1N33 O;  1WPB A;  1J5E B;  3C3T A;  3FB6 C;  4NR1 A;  3T4Z A;  1HNZ B;  2CAZ C;  4PEL A;  4LF6 O;  4MVS A;  1FFT B;  3K5M A;  1BE3 H;  2QM4 A;  3K0D A;  2CDY A;  2PGG A;  2LJ2 A;  2QEX V;  2D3O W;  2ZXW C;  5D5Q A;  4RUF A;  4MTG A;  4Z1V A;  2P4V A;  4WFH A;  4FLX A;  4O4H A;  4JI0 B;  1KKC A;  4JI7 O;  1HW7 A;  4FM0 A;  4LF7 O;  4DK1 A;  5CN0 A;  1LUV A;  1P84 F;  5J2T A;  2AZ0 A;  2PI5 A;  1YIJ V;  4HAM A;  1Q82 W;  1MZE A;  4CH3 A;  1YF2 A;  4CH5 A;  1VQ7 V;  1N32 O;  1Y67 A;  3K9A A;  2GDS A;  4DR6 O;  1R3K C;  4DO2 A;  1NTZ H;  4JTC B;  2JJ2 G;  3D3I A;  4TV9 B;  3H9V A;  1YXB A;  4PJ0 Z;  4DV0 B;  2LW1 A;  3P32 A;  4IHJ A;  4Q20 A;  3SPG A;  1VQ6 V;  1U97 A;  1Q8I A;  2KB1 A;  3C3S A;  3ZRS A;  4YIO A;  5CBG A;  4H33 A;  2QR4 A;  2QKC A;  2DQ0 A;  3A8T A;  1HNX B;  2RCV A;  4RAI A;  1KP2 A;  5H6R A;  4MVU A;  1WN7 A;  2PI4 A;  5IT9 N;  1PL0 A;  4R8C A;  4NB5 A;  1J5E O;  2JDI G;  3JAR A;  4LBE C;  4WCE V;  1HNZ O;  2QKA A;  3H1K H;  3N2G B;  2CTP A;  4X8A A;  4FMT A;  3K0G A;  3BRC A;  2YIB A;  3JD1 A;  1Y76 A;  4UCS A;  1PKX A;  4ZI7 B;  2ITD C;  1BSM A;  4DR2 B;  1G1X B;  1R3I C;  2FB5 A;  4B3M B;  1H38 A;  1PD3 A;  1S76 D;  4D7S A;  5C8Y B;  5BY1 A;  4CH6 A;  4JI0 O;  4NVP A;  3K59 A;  2FYU H;  4J41 A;  1VQO V;  1K8A W;  4JZ2 A;  1VQM V;  2YS8 A;  2ZDI C;  2B1G A;  3CSX A;  3M8A A;  2Y4U A;  4RO2 A;  1VMG A;  2P22 C;  4TV8 A;  1HR0 B;  2UXC B;  2X6C A;  4HNA A;  3P3N A;  3CC4 V;  2DQ3 A;  4A5U B;  2PF4 E;  1IX9 A;  1HP8 A;  2QWN B;  5IJ9 B;  3L9D A;  4AIL C;  4DV0 O;  4AQY B;  2Z3Y A;  2A9H A;  2O57 A;  3CE2 A;  1N8R W;  1QU7 A;  3CB2 A;  2YIC A;  3D36 C;  4B7E A;  2YI9 A;  3ZCC A;  3OW2 U;  1U96 A;  3FB8 C;  3FB7 C;  4BIU A;  1P49 A;  2EJR A;  1OCC C;  2KSD A;  2WPD G;  1JPX A;  1HNX O;  2GTS A;  3ZRX A;  1F23 A;  4JGS A;  3E8F A;  1GRJ A;  3GWO A;  4DRX B;  5BMV B;  2LGQ A;  1GMG A;  2EIL C;  2PTM A;  4PHZ A;  4PV1 B;  1BHB A;  3HKB B;  4X1I B;  2KG7 B;  2EUL A;  4UFZ A;  5LP6 B;  2P7T C;  3J81 N;  4B3S B;  2WLM A;  1V54 C;  5E1A C;  2X6B A;  1WP8 A;  3WG7 C;  4JI3 B;  5IJ0 A;  3CCM V;  3N2K A;  3TK1 A;  2HP8 A;  3ZRW B;  2FTK A;  4DR2 O;  3JYC A;  1GH6 A;  1IBK B;  1QLN A;  4B3M O;  1GK9 A;  2G38 A;  4ZKI A;  1EN6 A;  4DR7 B;  2YI8 A;  1OCZ C;  1RP3 B;  1XNQ B;  3SYO A;  1GM8 A;  3ICX A;  3T1C A;  4DR1 B;  3BVO A;  2UUA B;  5KA5 A;  1T5E A;  1N34 B;  5BR8 B;  2IU3 A;  3SPC A;  4F6R B;  1HR0 O;  2UXC O;  1FS0 G;  2DW4 A;  1URF A;  2W6J G;  4PDL A;  4KP4 A;  2HJF C;  2GSM B;  2QWO B;  4UVC A;  5B5E Z;  2EIK B;  2Q5Z A;  1JR9 A;  1SQF A;  1VIB A;  5B1B C;  1VQK V;  1Z5W A;  3K58 A;  4X89 A;  4X20 B;  1JNB A;  4JI6 B;  3TET A;  3ABM B;  3NR7 A;  4Z2W A;  5L3C A;  4AQY O;  2N04 A;  3IFX A;  1UJW B;  1YJN V;  2ARH A;  1IXB A;  3RN4 A;  1O9G A;  2CUG A;  1OCR C;  4L8J A;  2EIJ C;  2AGA A;  3FYE B;  1EBO A;  3WFV A;  5CA0 B;  1GAX A;  3E86 A;  1AI6 A;  1ZLZ A;  4UB8 Z;  1RM1 C;  1M1K W;  1M90 W;  2LGW A;  5FLX N;  4NKG B;  5LL6 Y;  4K8Z A;  1FPO A;  3TXQ A;  2WA3 A;  4IYH A;  1NKD A;  2ZDI A;  4YY3 B;  2ZM6 B;  1DF4 A;  2YIA A;  2ZT9 B;  4B3S O;  4JI3 O;  5JH7 B;  1OZ0 A;  1N0J A;  1AI5 A;  1IBK O;  4ZOL B;  2E76 B;  3K5O A;  4DR7 O;  3CP1 A;  1XNQ O;  2CH7 A;  1FD9 A;  1ORQ C;  4DR1 O;  1EZV H;  3G67 A;  2UUA O;  4LF5 B;  1Y6X A;  1PNM A;  5IY5 B;  2ZD9 A;  3CCS V;  1N34 O;  5BR8 O;  4ZHQ B;  2ZE7 A;  2HLD G;  1CPY A;  3ETD A;  4GX2 A;  1WJZ A;  5H2F Z;  3T1Y B;  3OFN G;  3GB7 C;  5FPO A;  2YXY A;  2XND G;  3R65 A;  4LP8 A;  5JCO C;  3M7M X;  2Q0A A;  2X7R B;  2HG5 C;  3HKD A;  4X88 A;  3UO2 A;  3ZS8 C;  4FM1 A;  1EM1 A;  3KG2 A;  3I55 V;  1XOU A;  4JI6 O;  1K33 A;  5LGU A;  5B1O A;  4QNH B;  1VQ4 V;  1SZX A;  2QA4 V;  1M57 B;  3LSQ A;  2E3C A;  2YXL A;  1AR4 A;  2GUZ A;  4CBC A;  3CC7 V;  4PI0 A;  2P67 A;  1IJG A;  4L87 A;  1X4T A;  2YSU B;  4IIJ A;  1YTF B;  3JCZ A;  3QO5 A;  4YY3 O;  2ZM6 O;  5JJN B;  3ZIA G;  3RGB A;  2M7W A;  3RYF B;  1AR1 B;  1QBZ A;  3SJA C;  5AG2 A;  4I55 B;  3CRC A;  2A06 H;  2Y4T A;  2VWK A;  4WFA V;  1JFF B;  1K5S A;  2WLN A;  2IJH A;  5KAI Z;  1COW G;  3DXR B;  3JAS A;  4WBN B;  4O4I A;  1KMI Z;  3RVZ A;  4LF5 O;  5JQG A;  1AP5 A;  2BTQ B;  4K35 A;  1QLE C;  3H01 A;  2ZKO A;  1WP7 A;  1R1B A;  1VQN V;  4DV2 B;  3T1Y O;  1SQP H;  3ZN0 A;  4TWK A;  4I4T A;  5L3D A;  4N23 A;  5EK0 A;  1JA8 A;  4JAU A;  1FXK B;  2UXD B;  3FFQ A;  1MSD A;  4PA6 A;  2XAF A;  4X1Y A;  1SQQ H;  3W7S A;  4OXS A;  2Y0I A;  2Y69 B;  2JJ1 G;  2ITC C;  1LUW A;  2XAG A;  4WFB V;  4IL6 Z;  2YEV B;  3RYC B;  1Y74 A;  2R72 A;  5H5N A;  1XMQ B;  2QTS A;  3I5D A;  2CGO A;  4P2Z A;  1EFR G;  5KMG A;  2DJV A;  4LWS A;  4IT5 A;  4O4J A;  4QJF B;  4W4L A;  1SA0 A;  3BA8 A;  3WU2 Z;  2DE0 X;  3QO7 A;  3AG1 B;  4KFM A;  3E89 A;  1NVP B;  1ZWI C;  3ZRV A;  3RYI B;  3OEE G;  2UXX A;  2Q68 A;  2MK3 A;  4P9P A;  4GT1 A;  1AI4 A;  4R6Z A;  3CX5 F;  2DOS A;  5JCO A;  4PI2 A;  3OM3 B;  4GX5 A;  1IDS A;  4FJC C;  2VWJ A;  5JVD B;  1TA8 A;  4WF9 V;  4J9Y B;  2RDC A;  1SER A;  1BZK A;  2CTW A;  3FX7 A;  1RPR A;  5DEC A;  1NH2 B;  4DV2 O;  2A3Q A;  3SYA A;  3O9O A;  2RN9 A;  4TUY A;  1FJG B;  2IJK A;  3BA9 A;  2UXD O;  1HDJ A;  5FNV A;  3ZMV A;  5J2U B;  2YXH A;  2ODM A;  5H9C A;  5EYP B;  3SYC A;  4UV8 A;  5LGT A;  1AVM A;  1R3L C;  4CS4 A;  1XNR B;  3AEI A;  3FKS G;  4FFK A;  4JZG A;  1H2N A;  2F23 A;  2X6A A;  3ZHU A;  3JAL A;  1XMQ O;  3S3X A;  2GTA A;  2JK5 C;  3ML0 A;  4TQF A;  1E79 G;  3VQW A;  4O2A B;  4YJ2 A;  4PD4 F;  5EBL C;  4U7O A;  2F93 B;  4EB6 A;  4JAV A;  4GZR B;  1S77 D;  2LW7 A;  3TCU A;  1TAE A;  1H8E G;  3CRA A;  1M5I A;  2QWP B;  5KHH A;  1W59 A;  3B8M A;  1Q6H A;  4FFB B;  3BFR A;  1S5H C;  3THO A;  3RVY A;  1ARO P;  2DMX A;  1DGS A;  2ZNJ A;  3EFF K;  1TVK B;  3RW0 A;  1JJ2 U;  2F95 B;  4BWA A;  1KBH A;  1XEQ A;  3ZHV A;  4GYC B;  1V55 B;  5KHJ A;  5HFM A;  3KKY A;  3CJH A;  5EIB C;  2V4D A;  5L3F A;  2DN9 A;  1PNL A;  5IDJ A;  1VF6 C;  3ABL B;  1JX9 A;  1S0V A;  2IW5 A;  2HEP A;  1IBM B;  4BAY A;  4B3R B;  1FJG O;  2DYS B;  3QVN A;  2YUA A;  3L72 H;  3JAW B;  1XUQ A;  1D5A A;  1EZJ A;  1XDC A;  2RNB A;  3W7U A;  3AK2 A;  1K92 A;  2H3O A;  2ETN A;  1ZL8 B;  2UUC B;  1XNR O;  3CRQ A;  4HYO A;  3H1L H;  2WLI B;  5KHG A;  1D2D A;  4GKJ B;  1N36 B;  4P30 A;  4FPP A;  4JI1 B;  1PM9 A;  3SGI A;  3OUS A;  3E35 A;  3STL C;  1F4N A;  1P7B A;  3UCS C;  3U10 A;  4BIZ A;  5LP6 C;  2H94 A;  3ZX6 A;  3AG4 B;  1WA8 B;  3ABK B;  3CRM A;  3ASN C;  3CCQ V;  4RWU A;  3G6B A;  4Q6G A;  5F2V O;  1IXM A;  4U7N A;  2JEU A;  1QR9 A;  3OMN B;  4JYY A;  4G2K A;  5H6Q A;  4FLU A;  2K1E A;  3HKC B;  4TV9 A;  1B06 A;  2BTO A;  4D7T A;  3CCL V;  4F6E A;  3K03 A;  1NR7 A;  2WLL B;  4LNU B;  4I7Z B;  1KQS U;  3ASO C;  1VF7 A;  2OT5 A;  1WB8 A;  1H5W A;  1EN4 A;  1H2L A;  4I50 B;  3L75 H;  2NN4 A;  1RSO B;  5CA3 A;  3ABM C;  4JAA A;  5GON B;  3IGA C;  2CTR A;  5GW7 A;  1IBM O;  4K0K B;  3N2G A;  4B3R O;  3UT5 B;  3B40 A;  1BL8 A;  5LYJ B;  2E75 B;  3CXH F;  1DTO A;  1THZ A;  2P90 A;  4OPH A;  1AIL A;  4ZI7 A;  4FVM A;  4QPJ A;  3WB1 A;  3W7T A;  3OMI B;  4X65 B;  3Q4H B;  2UUC O;  2Q73 A;  3D8C A;  4CS3 A;  1R6T A;  4JPR A;  5C8Y A;  3CCJ V;  4GKJ O;  1N36 O;  4J42 A;  5KUM A;  3OGC C;  4JI1 O;  1SQV H;  3LSS A;  2ILM A;  4O2B B;  4OX9 B;  1GN4 A;  1VQ5 V;  4DV1 B;  4F4L A;  2HR3 A;  4PDM A;  1GN6 A;  1YDX A;  4H13 B;  2H8P C;  3E83 A;  1MOF A;  4LF8 B;  1MSW D;  1XRE A;  3FAV B;  1R3J C;  4JYA B;  5IJ9 A;  3KCX A;  2ATK C;  2JS5 A;  4KXR A;  5LHI A;  4DV6 B;  2KKW A;  1D5N A;  1VF6 A;  3M99 B;  1W0J G;  5LXT B;  1X59 A;  3K04 A;  3W7X A;  2A7W A;  3A0H Z;  1BMF G;  2P6J A;  5IY5 C;  4WFF A;  3BPZ A;  2EIN B;  3JSN A;  3P30 A;  4UXN A;  1TUB B;  3RBZ A;  3SYQ A;  4DUZ B;  3APQ A;  4C7U A;  2B5U A;  1M56 C;  4DV5 B;  5CA1 B;  2AXT Z;  4DRX A;  4PDR A;  5BMV A;  4LFC B;  1KYO F;  3E2E A;  2E5L B;  2E74 B;  4X1K B;  4B3T B;  1XHZ A;  3HKB A;  4QIW F;  4X1I A;  5CB4 B;  4K0K O;  3F7Y C;  2KG7 A;  1JMK C;  1ROP A;  1AB3 A;  1L0L H;  4DW1 A;  2XAQ A;  5LP6 A;  1K9M W;  1AR5 A;  1MMM A;  1GO3 F;  4UVB A;  3ZRW A;  1KKD A;  3FYI B;  3JAM N;  2OCC C;  4X65 O;  5CMU A;  2ZIO A;  1VF5 B;  2VQE B;  3E8B A;  2A79 B;  2ZIN A;  3A2F A;  4PDV A;  4G27 B;  4OX9 O;  1I7F A;  3UKM A;  2XT9 A;  4DV1 O;  4O4L B;  4F6R A;  3HPL C;  1UPG A;  4MVO A;  4CH4 A;  4X64 B;  3JD4 A;  2P06 A;  4WFE A;  5KAF Z;  4LF8 O;  2FKX A;  2ZE8 A;  3G6E V;  1YSC A;  2F1M A;  4JYA O;  3OMA B;  3L73 H;  4WFG A;  2B1I A;  4X20 A;  4DV6 O;  1XI1 A;  2PYL A;  2Z0A A;  1J95 A;  3X2Q B;  5LA6 B;  2V7Q G;  1SET A;  2JGD B;  4UCT A;  4E4E A;  5K1P A;  4MTX A;  2Q4P A;  1I94 B;  2EIM C;  1B04 A;  1KC8 W;  1XHX A;  4DUZ O;  1OCC B;  3AG2 C;  5CA0 A;  4DV5 O;  5KHK A;  4DYL A;  4LFC O;  1GKF A;  4UUJ C;  4D6T H;  4X9Q A;  2QWQ B;  2EIL B;  1DF5 A;  4B3T O;  1FKA O;  3HB3 B;  4NTW A;  3ZHT A;  3H1I H;  1IBL B;  5DED A;  1I08 A;  1V54 B;  3E22 B;  2CK3 G;  5JH7 A;  1GM7 A;  5TIS Z;  4JF3 A;  2N74 A;  4ZOL A;  1FXV A;  1VQ8 V;  5EC1 C;  5B3S B;  2VQE O;  4LF9 B;  1YZB A;  1YCI A;  1HWY A;  1FFX B;  4I9W A;  2LQT A;  4HZ3 A;  4TOI A;  1HNW B;  1XL6 A;  2YIB D;  2HKO A;  4I0X B;  1A32 A;  1PL4 A;  4ZHQ A;  1B6Q A;  3C90 A;  3NXS A;  2WWW A;  2OIE A;  2Y0P A;  5LOV B;  4X64 O;  2OWO A;  4MVQ A;  4MW8 A;  3JAK B;  4KHP B;  2IH3 C;  3ABU A;  4Z1M G;  4YJ3 A;  4DV7 B;  5B1B B;  3APO A;  1DK1 A;  2JIZ G;  3OT7 A;  1TUE B;  4MT8 A;  4FZ1 A;  1SQX H;  5DN6 G;  1PNK A;  1F4M A;  1I94 O;  2F66 C;  4CZZ A;  1FXH A;  1BQ0 A;  2R9A A;  3J80 N;  4JI2 B;  3JD2 A;  2RJZ A;  5EBW C;  3RYH B;  3W7W A;  1WPX A;  3SPJ A;  1RM1 B;  1NU1 H;  1R73 A;  1E1R G;  3LSU A;  4LR3 A;  1GTO A;  1XMO B;  2M6Y A;  3T2M A;  4NYK A;  1E1Q G;  2UXB B;  4H0L B;  1MZF A;  3VQY A;  2AHY A;  4YHH B;  2OCH A;  1VQP V;  2NNU A;  1H2G A;  1NZ6 A;  1MNG A;  1IBL O;  3IC9 A;  3RYF A;  4U3J B;  3B8N A;  1DLB A;  4I55 A;  3OTF A;  1JFF A;  3AK1 A;  2HHH B;  1TGO A;  1SQB H;  5KMG B;  3OAA G;  3QNE A;  4LFB B;  4LF9 O;  3RWR D;  1OJH A;  3DXR A;  1QVF U;  4WBN A;  1KUQ A;  1P7G A;  5EIB D;  3SJQ C;  3A0R A;  4DR3 B;  2N05 A;  1HNW O;  3SYP A;  4PA3 A;  1Q90 D;  2BTQ A;  3SDL A;  1JCH A;  3ZJZ A;  2IJI A;  4UCR A;  2D2C B;  2JEX A;  2BE3 A;  4ICG A;  2BSK B;  4PA4 A;  5FPR A;  4UVA A;  3P3P A;  5KX5 B;  4KHP O;  1FXK A;  1VQ9 V;  1CP9 A;  3FD9 A;  2R70 A;  5CBH A;  3VOU A;  1SZT A;  4DV7 O;  2LO1 A;  1K3E A;  1I5X A;  3HKE B;  5EZY B;  2ZCE A;  3A0B Z;  5FL7 G;  3QF7 A;  1S3J A;  1SS3 A;  4UCU A;  2YEV A;  3RYC A;  3B09 A;  4MSW C;  5B1N A;  1BS3 A;  5CBF A;  4W4K A;  3H1H H;  1YHQ V;  3ABL C;  2BCC H;  4XDK A;  2WLK A;  2PY5 A;  4JI2 O;  3K08 A;  4MVZ A;  4EFB A;  3U11 A;  3BEH A;  2DYS C;  4TUY B;  1Q6U A;  3EHB B;  3VQX A;  1LR1 A;  3IC7 A;  5B1A B;  1XMO O;  1US6 A;  1FOU A;  4AI8 A;  3OUF A;  2UXB O;  3BAB A;  2Z5U A;  4QGP A;  2AW9 A;  4YHH O;  5L3G A;  5K1X A;  1OCO B;  4TT3 G;  2PZS A;  1Q5O A;  2C2A A;  4YIP A;  4DK0 A;  3RYI A;  2B9Z A;  2EZP A;  1PP9 H;  3SPH A;  1BT8 A;  2HHH O;  1SES A;  5IWA B;  3AG7 A;  5BZB A;  3AG4 C;  4LFB O;  5IYZ B;  2VS0 A;  4P9O A;  5JVD A;  3R66 A;  4DR3 O;  5EC2 C;  2QJ1 A;  3JAT B;  5ITZ B;  2PYJ A;  1PV0 A;  3LDE A;  4OGQ B;  1MG1 A;  1QLE B;  3EVK A;  3AG3 B;  1H2K A;  4J7K A;  3JD3 A;  3G80 A;  3OEH G;  1PPJ H;  1BGY H;  1K4D C;  3BAA A;  4RUE A;  5J2U A;  2YDE A;  5IYC O;  5EYP A;  4MW3 A;  2Q9L A;  4O4H B;  2DYR B;  1K7D A;  3OTO B;  3K57 A;  2KQX A;  3UO3 A;  4G28 B;  4TQD A; 
#chains in the Genus database with same CATH homology
 1N0N A;  2ADP A;  2QKC A;  1EN5 A;  3QVN A;  1QNM A;  1XUQ A;  1VAR A;  1XDC A;  1N0J A;  2RCV A;  3AK3 A;  3AK2 A;  1BS3 A;  1AP5 A;  3OT7 A;  1GN4 A;  1ZSP A;  3KDR A;  2QKA A;  1PM9 A;  1GN6 A;  1AVM A;  1JA8 A;  1EN6 A;  4GUN A;  1MSD A;  1WB7 A;  1ZTE A;  4FFK A;  4JZG A;  3C3T A;  1XRE A;  1BSM A;  1I0H A;  2AW9 A;  4E4E A;  3LSU A;  3MDS A;  5A9G A;  1MA1 A;  1D5N A;  1LUW A;  2CDY A;  4YIP A;  1EM1 A;  4JZ2 A;  4JYY A;  1BT8 A;  1ZUQ A;  1VEW A;  1MNG A;  2CE4 A;  3IC9 A;  4X9Q A;  1B06 A;  4C7U A;  1KKC A;  1SZX A;  1JR9 A;  3K9S A;  4F6E A;  3BFR A;  1GN3 A;  3TJT A;  3AK1 A;  2ADQ B;  1AR4 A;  1LUV A;  3DC5 A;  1I08 A;  1IX9 A;  3DC6 A;  3EVK A;  1IXB A;  1P7G A;  3RN4 A;  1Y67 A;  2GDS A;  1WB8 A;  1GN2 A;  1EN4 A;  1AR5 A;  1MMM A;  1ZLZ A;  3KKY A;  1AP6 A;  1IDS A;  4BR6 A;  5AG2 A;  3CEI A;  2P4K A;  3C3S A;  1PL4 A;  4YIO A;  1XIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...