4C7UA

Crystal structure of manganese superoxide dismutase from arabidopsis thaliana
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
203
structure length
203
Chain Sequence
MTFTLPDLPYDYGALEPAISGEIMQIHHQKHHQAYVTNYNNALEQLDQAVNKGDASTVVKLQSAIKFNGGGHVNHSIFWKNLAPSSEGGGEPPKGSLGSAIDAHFGSLEGLVKKMSAEGAAVQGSGWVWLGLDKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEKENN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Arabidopsis Thaliana Manganese Superoxide Dismutase at 1.95 A Resolution
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [MN] 1, MITOCHONDRIAL
total genus 75
structure length 203
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4c7uA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4c7uA02
1QNMA 3TJTA 1AP6A 1GN4A 1LUWA 1MA1A 1KKCA 1AR4A 4C7UA 3QVNA 1LUVA 1IX9A 2CE4A 1GN6A 3AK1A 1EN5A 4JYYA 3MDSA 1GN2A 1XUQA 4YIPA 3K9SA 4BR6A 3AK2A 1PM9A 1I0HA 1WB8A 3KKYA 1MSDA 2QKAA 1N0JA 3DC5A 1BT8A 1I08A 3LSUA 1ZLZA 2ADPA 4E4EA 3DC6A 1IXBA 2CDYA 2P4KA 1P7GA 1EM1A 2ADQB 1XILA 1ZTEA 1WB7A 1PL4A 1EN4A 4X9QA 3C3TA 1BSMA 3RN4A 4F6EA 1BS3A 4JZ2A 1VEWA 1MMMA 1JR9A 1N0NA 3IC9A 1VARA 2AW9A 5A9GA 1EN6A 1AR5A 1GN3A 1XREA 4JZGA 1D5NA 1IDSA 3C3SA 1Y67A 3OT7A 3CEIA 3EVKA 1ZSPA 3BFRA 1ZUQA 1XDCA 2GDSA 2RCVA 1MNGA 4YIOA 5AG2A 1JA8A 4FFKA 1B06A 4GUNA 3AK3A 1AP5A 1AVMA 2QKCA 1SZXA
chains in the Genus database with same CATH superfamily
2DOSA 3RYCB 2F95B 3B4SA 2NR5A 1THZA 1GRJA 3CMAV 1AR4A 4UCSA 3ABLB 4KP4A 4FFBA 2ZR2A 1V54B 1OCOC 3AG7A 3CC4V 1R3KC 4I0XA 1UFIA 1WN7A 2YDEA 3O65A 2P67A 1ZWIC 4DV0B 4YJ3B 4JI1B 4JYCA 1TAEA 2JDIG 4JI3O 1QR9A 4K0KB 3ZHVA 2WLLA 2Q68A 5L3BA 1I08A 4PDMA 4DR1B 1K4CC 3SJQC 5LP6B 4O4JB 1S72V 1CEZA 2B9ZA 3K5OA 3CRMA 2VRZA 4QIWF 2OIEA 3A8TA 4UB6Z 5HFLA 1SS3A 5J2TA 2RNBA 4Z2WA 4FZ0A 1OCRC 1RFYA 2QDOA 3C3TA 5K1XA 4JI2O 5LA6B 3JSNA 3BVOA 1U96A 4JPRA 1VIBA 1Q90D 3JD1A 4CS2A 5A9GA 4B3MB 4DUYO 4X64B 2ITCC 2VQFO 1WPBA 3K06A 3CB2A 4CH3A 5LBQA 2P6JA 3CEIA 4D7TA 3APOA 5KX5B 1ZSPA 1HP8A 3RYHB 4X62B 2X7RB 1QR8A 3CPWU 4MVOA 5C8YA 5LMUB 4U3JB 3F7YC 1B06A 1G8MA 5A2QN 3ZRXA 4B3SB 4UVBA 1AP5A 1AVMA 4RUFA 3SYCA 2IJKA 2W0FC 3JSLA 5FL7G 3S3WA 2ZE8A 1QU7A 1JQ0A 3ZRVA 1NH2D 3OAAG 2EINC 1Q82W 2Q6AA 5IT9N 2BCCH 3RBZA 2CGOA 1V9PA 1M1KW 4BR6A 1XBLA 2NLJC 3ABMB 1JFFB 4O2AB 2A9HA 4RAIA 2W0XA 1TVKA 1YSCA 3NR7A 1AI6A 3RYIB 3SJCC 1G6UA 1JOYA 3N2KA 1ORQC 4LF8B 4EB6A 4PD4F 4B3SO 4Z1VA 4PI0A 2N74A 4IIJA 4EFBA 4X65O 4B7KA 5B1BB 1TA8A 4DR1O 2K1EA 5LOVA 2EIJB 1Q6HA 1YZBA 4I4TB 1BS3A 4JZ2A 3AG2B 5GONB 1I94B 1JCHA 4DR4O 3EXAA 1XEQA 4ZIBA 4X65B 4JAUA 4UV8A 4X64O 2XAHA 3JASB 2QWPB 1XL6A 2FYUH 1HDJA 1NKDA 3SYPA 2EILB 5KHIA 3VQVA 3X2QB 4JI4O 3SPCA 4D6TH 4B7EA 1NR7A 1NTMH 4ZHQB 1XDCA 1CPYA 2YIBD 1VF6A 5LP6C 3ABUA 4WFBV 3UQ8A 2Q69A 3E22B 4TV8B 4AILC 3ZMZA 3AK3A 4H44B 4MS2A 5EC1C 5IJ0B 1N36B 1IJGA 1WLEA 3H1KH 2E76B 4LR3A 1YJWV 2IW5A 2ITDC 1SRYA 4JI0O 2E5LB 1AJNA 4JYBA 1F4MA 1K5QA 1R3IC 4GCZA 2LW7A 5B1AC 4DV0O 2PUSA 4O4JA 3QTCA 1HR0B 4KHPB 1Q7YW 1KBHA 2LO1A 1KKDA 4TV8A 3AK2A 1H8HG 1WB8A 4X62O 1SKVA 4FK5C 1XMOO 2WSSG 5CN0A 3QF7A 2YIBA 3G6EV 3DC6A 4BWAA 3I56V 1K33A 4IIJB 1Y76B 1M57C 1H2NA 2AZ2A 1S3JA 4BIOA 4WFAV 4F6EA 4DR7O 1Q6UA 3AG3C 4UVCA 4DR4B 1N33B 3IC7A 4ZOLA 3CRAA 5K1PA 3HKDB 5CA3A 1URFA 5C8YB 1GN3A 1KMIZ 1YTFD 3BA9A 1I7FA 1MG1A 2VS0A 1CXZB 3IJ4A 2KSDA 4FJCC 4N21A 1IBMB 2LGQA 2WWWA 3VBBA 1BL8A 1H2MA 4CBCA 5AG2A 1JA8A 1YJ9V 2OCHA 4R8CA 1V55C 4B3MO 4DR5B 4LFAB 2Q7GA 2N04A 3CXCU 1SQVH 3JCUZ 3GB7C 4JYAB 3JATA 4JTDB 5EIBD 1OZ0A 2PYLA 4JI8B 4NXMB 4OX9O 3THOA 2LGWA 4LFCB 4UB8Z 3MHHC 4JI5O 5H6QA 3CCSV 1F7YA 5BR8B 3RW0A 1B6QA 3LNNA 3CP1A 3S3XA 5IJ9B 3M99B 1K34A 4IHJA 1NZ6A 4LP8A 1IXBA 4LF7O 2GSMB 1GM8A 1M56B 3HPLC 1SQGA 1OJHA 4DV7O 1ZX3A 1ZTEA 5CBFA 1DF5A 3W7TA 4G2KA 3OE7G 3CYOA 3ZMTA 3BABA 4JTAB 1PL4A 4I9WA 3F5TA 4CH4A 2GUZA 5IYZA 3E8BA 1Q81W 2E5LO 2Y48A 2HHHB 3MAQA 1S5LZ 2QWQB 3FB6C 1YXBA 3L9DA 3Q4HB 1US6A 4TSFG 1D5NA 3K59A 4JF3A 1J95A 4LF6B 3FX7A 2OIGA 3KZIZ 5L3FA 4PDVA 2YI9A 3ZN0A 1FFTB 1E79G 4PA7A 4KFMA 2Y4TA 4DR7B 2A7WA 1GAXA 1KYOF 3ASNC 5KA6A 4PA6A 5KMGB 1M4UA 2YSUB 4NTXA 4XDLA 3D36C 2EJRA 2DYRC 2NN4A 4DR5O 3K79A 5CA0A 4B3TO 2ETNA 2QM7A 1XNRB 2HHHO 2YXLA 3P32A 1VF6C 5LP6A 2W6IG 4ICGA 1EFRG 4DUZB 3U10A 4C7UA 1R3LC 3RGBA 1IX9A 2EIJC 3ZBHA 1XNQO 4WFGA 3G80A 1P4RA 3BY6A 2Q7EA 4EB6B 5JCOA 2GBOA 3GVMA 4YJ3A 2KB1A 4UV9A 2EX3A 3I5DA 1PM9A 1I0HA 2OCCB 5JVDB 4DRXB 3G71V 4DRXA 4DV6B 5EK0A 4EFEA 3D8CA 3OW2U 4GZRB 3H1HH 1Q86W 2ZXWB 4J7JA 1SQFA 4O4IA 3ZN1A 5C93A 2WLHA 1FXKB 5J2TB 3APQA 2DE0X 3VQWA 4DV2B 1WP7A 1S77D 1I5XA 1VEWA 4JI8O 4DV1O 1EZJA 3WB1A 3OM3B 4K35A 3H01A 5GW7A 5JWPA 4U3JA 4LFCO 4TQFA 2HKOA 1NTKH 3RWRD 1BHBA 2UXXA 4I9QA 2HG5C 4GKKO 4O4IB 4ASUG 5IE9A 1H5WA 1WPXA 2A3QA 3HKCA 4G27B 3UT5B 2PI4A 2CTRA 2DYSC 5FLXN 1HW7A 3RT3C 2X0LA 2ZT9B 3ZHQA 1XHXA 5LGTA 1QNMA 1NVPD 2IJIA 4MTXA 3ETEA 4O4LB 5BMVA 3CS5A 2CH7B 1MABG 4ZI7B 2GUZB 1KKCA 4FLTA 3K0GA 4JI7B 2JS3A 4I55A 2P5OA 2F4VB 1Z2GA 3MHSC 4OGQB 1BGYH 1ROPA 2CK3G 2W6JG 3UO2A 3J80N 3CCRV 1VQMV 4LF6O 4P9OA 2BTOA 2WA3A 1RSOB 1S0VA 2EZOA 2D2CB 3KKYA 5DM6V 1F4NA 1XNQB 1N8RW 2WLIB 1MOFA 3AG4B 1G4YB 3CCQV 4K0KO 4TUYA 4CC6A 4O4HA 4JGSA 3RFRA 2AHYA 2EILC 3K58A 3HKDA 3OGIB 5H6RA 3CJHA 5JH7A 4MTFA 5CB4A 1XI1A 4GT1A 4J42A 4PA4A 4CC5A 1SERA 3E86A 2HEPA 4TV9A 1L8DA 2QM8A 2ZE6A 2R70A 2ZINA 3T1YB 4B3RB 2ODMA 2EZPA 3HKBB 2BTQB 3ZRWA 1FYJA 3OR7C 2ZDIC 1J5EB 1DTOA 3STLC 5KUKA 3CHXA 4GX1A 3SJBC 5KX5A 1R6TA 3P3PA 5IJ9A 4TQDA 1M93A 2QA4V 2A79B 4IHJB 3SJAC 3HKEB 2Q9LA 4TV9B 1NVPB 1JJOA 3ZIAG 4QNHB 2GHYA 3ABKC 4Q20A 1SZTA 3BCCH 3CRRA 2PGGA 4FLXA 4BAYA 4UCVA 4LC1A 2HJDA 3CC7V 4Q6GA 4NTYA 1FXKA 1K8AW 3CXHF 1RM1C 1R3JC 3RVZA 1OCCB 4DR6B 2WA4A 1DGSA 5LGNA 1HNZO 1OCRB 3QVNA 1LUVA 4MVRA 4WBNB 1M9NA 4U3FH 1KQSU 3Q4HA 3STZC 2P7TC 3T4DA 5GTHZ 4KL1A 4X1IA 4AQYB 1GN2A 4JAVA 2JEUA 5LXTA 4YY3O 1MSDA 1GO3F 4MTGA 4LWSB 3BAAA 2B1GA 3X2QC 2VQEB 2ZD9A 5H2FZ 5LGUA 4IT5A 3UCSC 4LNUA 3I55V 2P90A 3G67A 4J11A 4DV4O 1SQBH 1PPJH 4ZKIA 4X88A 4X1IB 5GONA 2XAFA 3ZHRA 1AROP 4U7OA 5LXTB 2ZIMA 1VF5B 2OTLV 4DK1A 3ZHUA 5FPOA 1N34B 2AW9A 4NTWA 4DV4B 3UT5A 2WLNA 3RYHA 5J2UB 1J5EO 1KB9F 1XL4A 1LNQA 4JZGA 4X1YA 2DW4A 1RSOA 4TOIA 4LFBB 3OD4A 1VQPV 3QG5A 2HVKC 2PF4E 3JATB 4W4LA 5IDJA 1H38A 1PL0A 4K8ZA 1KECA 1Q43A 2XUMA 4O2AA 2DYSB 1Q3EA 1VMGA 4PDLA 5DEDA 1YI2V 5LHHA 5B1AB 4YHHB 2WLJA 4X20A 4NVPA 4DV1B 3O9OA 1PKXA 2Q8VA 2AHZA 3G6BA 1MNGA 4AHCA 4XBFA 4QE7A 4AQYO 3JAKB 3AG1C 3E2EA 2JS5A 1FKAO 2UUAB 1XHZA 4CS4A 4GYCB 2UUBB 2B1IA 4DR6O 1RP3B 1S5HC 1OCCC 4HNAA 4JI6B 4DV2O 1BQ0A 3ML0A 3E22A 2ZE7A 4FLYA 3JAWA 1TUBB 2PY5A 1FXHA 1K4DC 3LDCA 4QPKA 2HR3A 4NB5A 4J10A 2IH1C 4UVAA 4DYLA 2BOBC 4MSWC 3CCVV 1I94O 2OT5A 1HNZB 3FAVA 4O2BA 2CDYA 1ZL8B 3OEEG 1P84F 3KG2A 5EBLC 4JI1O 3K57A 4X1KA 2GTSA 4X1KB 4PJ0Z 4UFZA 3UKMA 1KP3A 2VWJA 2ZCEA 2X6CA 4TWKA 2DN9A 3K03A 3M7MX 2ZKOA 1GMGA 2UUCO 4B3TB 5B1NA 1N36O 3A0RA 3K9AA 3A0BZ 5B66Z 3W7XA 4CH6A 1ZL8A 4JI5B 1FS0G 3HR0A 4O2BB 1SQPH 2RDCA 3F5WC 1GTOA 1VF7A 4H33A 4YJ2A 2XAQA 4NXNO 2L35A 4PV1B 3RYIA 4LCUC 2ZE5A 4ZOLB 1ZUQA 1AB3A 2LJ2A 3JASA 3CE2A 4UCTA 4YIOA 2QM4A 1UJWB 4QJFB 4WFFA 5J9PC 1R6NA 1WA8B 1VQ5V 3SPGA 3AG1B 2M6YA 4I4TA 2V1DA 3LNMB 2X6BA 3L74H 1R1BA 2WLMA 2R72A 2UXBB 3AK1A 2IM9A 3OUFA 1DK1A 2FL4A 2MW2B 3ASOB 2UXCB 4DV7B 1Y74A 4DO2A 1SA0A 1E1RG 2DQ0A 4I50A 1XQ8A 4I7ZB 1VQ8V 3CX5F 4OXSA 4QE9A 1PNMA 1X59A 3FAVB 2YICA 2L6LA 3WFVA 3LSUA 4GX0A 1ZLZA 2ADPA 3BA8A 3CRQA 4JYAO 5ITZB 3BHPA 2QWNB 1FD9A 1GKFA 1PNLA 1PP9H 4J7ZA 4I0XB 4MVUA 1AI7A 1E1QG 2Y0IA 5D5PA 3N2GA 2F66C 1N33O 2PTMA 3RN4A 3KDRA 4LBEC 3K08A 1FXKC 1A32A 2YEVB 2YEVA 3SGIA 4HZ3A 2Y69C 3WG7B 1VARA 2Y69B 3EFFK 3M8AA 2FKXA 3DSQA 4J9YB 4CH5A 3OMIB 2H8PC 3IFXA 3OFNG 5CA1A 5HFMA 5IY5B 4ZBMA 3L70H 3QO7A 2F4VO 1KP2A 3C3SA 4PDRA 4LF4O 4MVQA 2Q73A 4R50A 3EVKA 4FLZA 3FB5C 4R7CA 3TK1A 3R66A 2QKSA 2RCVA 3OMNB 4WCEV 2JJ2G 3SPJA 1AI5A 3ZHTA 4JV5B 2ZM6B 5KA5A 1COWG 3AG4C 2LQTA 3K5LA 1W0JG 3CSXA 1U97A 4ZI7A 4Z1MG 3NXSA 3OR6C 2NNUA 2CE4A 3RYFB 2IBZH 3SPHA 4LH6A 1YVWA 3L71H 5IYCO 1K73W 4JYYA 1NH2B 2UXDB 4FM2A 2EBOA 4NYKA 1XUQA 1BE3H 1F23A 1GK9A 1O9GA 2Y4UA 3H1JH 4MVZA 3K9SA 3ZMUA 2FB5A 3FD9A 3ZMSA 4BW9A 3CD6V 2HP8A 3L75H 2XT9A 4MVSA 2LW1A 4UUJC 3SYAA 1VQNV 1X4TA 4MT8A 2JK5C 1YDXA 5L3GA 2R9IA 2YXYA 4I55B 3JAWB 2ZR3A 4JASA 4YXWG 2E74B 2M7WA 1R73A 2HJFC 2JGDA 3ABMC 4DR3O 3GWKC 2VQFB 1D2DA 2F1MA 2UXCO 3LDEA 2F23A 2QWRB 1BSMA 1YIJV 2YI8A 3F7VC 1N34O 3RYCA 1W0KG 3E8FA 5TISZ 3RVYA 2XOKG 1OCZC 3D3QA 1TUBA 3MD0A 4MW8A 3WG7C 2Z0AA 1JNBA 4NR1A 3TXQA 1SA0B 1HNXB 5EYPB 2QTSA 3OT7A 3SYOA 1GM7A 4X89A 1FAFA 5JVDA 4L87A 1H2GA 4MVMA 1B04A 3HKEA 4ZHQA 2P22C 2DQ3A 2GDSA 2ATKC 3LSQA 4GLXA 5LYJB 3DXRA 1FXVA 4PI2A 2UUAO 4FPPA 5DECA 1YJNV 3K04A 5H9CA 1SZXA 5IWAB 1SC5B 2OCCC 3TJTA 4X66O 3JD2A 5GTIZ 3N27A 3ZRSA 3IAYA 2PYJA 1LR1A 4G28B 1MA1A 1MZFA 5EBWC 2D3OW 5FNVA 4K8XA 2V7QG 3GWOA 2ZNIA 3DGEA 2QEXV 5JQGA 3CWBH 3SDLA 2BE3A 2LFRA 3BRCA 5KAFZ 2EIMC 4EKWA 4BW5A 4X66B 2YXHA 2CTPA 2IJJA 4YIPA 1D5AA 3K0DA 5EBMC 3A0HZ 2BOCC 2DWEC 5DN6G 1K5SA 2QGNA 2IJHA 1N0JA 3N2KB 5H5NA 1B3QA 4RQFA 4E4EA 1P7GA 1Y76A 4WBNA 1VQKV 2IU0A 3WB2A 5CA0B 2YIDA 1R6KA 2KG7A 1XOUA 3ABLC 1QCEA 5CA1B 2E3CA 2WLIA 4QGPA 5BMVB 4J41A 1IBLB 4F6RA 2CTQA 5IYZB 2DJVA 1GH6A 2XHBA 4DV6O 1W59A 3ETGA 1EN6A 3B40A 4A5UB 3CMEV 1IVSA 4DR3B 2QR4A 4DUYB 2CGNA 3KCYA 2VQEO 2PZSA 1EZVH 4IL6Z 4F4LA 2RJZA 4FM0A 3QO5A 4BIUA 1SQXH 4NKGB 4ABMA 4XDKA 4IYIA 4LFBO 2GV9A 3ZRWB 4LFAO 2MK3A 4JI2B 1HWYA 4PELA 3TGUH 3B77A 4P30A 1T5EA 2N05A 2UU9B 4I50B 3ETDA 1WJZA 2F93B 3VOUA 4LF9B 4OPAA 2QSAA 3QO8A 4OPHA 3JARB 4LF4B 4FIPC 1XMOB 5EZYA 5LHIA 1IXMA 1CP9A 1GN6A 2ZQMA 3HKBA 2FMLA 2EULA 1YTFB 4FZ1A 4OX9B 1SQQH 2HVJC 1M90W 1QLEB 1IURA 4JV5O 2OWOA 2KKWA 4U7NA 2HLDG 2QKAA 3LDDA 2ARHA 1OHHG 4N23A 3B8MA 3E8GA 4FVMA 1Q8IA 2HFEC 2KQXA 1YITV 1KD1W 1YCIA 3EHBB 3JD0A 4BIZA 3QNEA 4FLUA 1N32O 2JGUA 1NBMG 3FB8C 5L3DA 1H2SB 4PHZA 4E2LA 1N0NA 3IC9A 2ZIOA 2FTKA 4W4KA 2P06A 1RM1B 3G4SV 4GX2A 2Q4PA 1BQZA 4HAMA 5LYJA 4RO2A 4R6ZA 3AEIA 3L73H 1SESA 3P3NA 1AI4A 2H94A 4K3AA 1BMFG 4F6RB 1VQOV 1Y6XA 4O4LA 4LWSA 4FM1A 5D5QA 4JTCB 1IBKB 3D36A 1AR1B 2ZNJA 5JCOC 1NQTA 5EC2C 1KU9A 2EIKC 2YC0A 4TT3G 5LMNB 3CCEV 4GUNA 5LL6Y 1JPXA 3JALB 1NR1A 1AP6A 1H2LA 4JI7O 4DV5B 4YJ2B 5BY1A 3TETA 2AZ0A 2A0LA 3CCUV 3T1HO 1FOUA 2UU9O 1EN5A 2E75B 2QWOB 4WFEA 3C90A 4DK0A 4KUMA 3N2GB 3T1CA 1QVGU 4WFHA 5BR8O 4H0LB 2Y0PA 2EIKB 4CS3A 1VQ7V 4DXWA 2ILMA 3TCUA 1PD3A 3E35A 1P7BA 2JRIA 2K9PA 2BTQA 5JJJB 5IJ0A 3K3WA 5BXZA 4IYHA 1FJGB 3SPIA 1EN4A 1BCCH 4LF5B 1K9MW 3T1YO 1MMMA 1IBMO 2LFSA 2UXNA 2QTOA 1RPOA 1K3EA 3R65A 3OTOO 1OCZB 2UUBO 4GKKB 1XREA 4HYOA 5LMUO 1IDSA 3P30A 2Q7HA 5KUMA 4DW1A 1HNWO 3JYCA 4YHHO 1YHQV 4DR2O 2OTJV 2GTAA 3BFRA 5JJNB 3E83A 4YY3B 1MZEA 1IBLO 1DF4A 5B1OA 3K5NA 1AILA 2IU3A 4FFKA 1HNWB 1NI8A 5IY5C 2Z3YA 5B5EZ 1Q6IA 1QBZA 4J9ZB 2XASA 1M5IA 5BZBA 4JI0B 1LUWA 2CH7A 1ENVA 1XNRO 3JCZA 5KLVH 4J7KA 1JVMA 1GM9A 3VQXA 4NXNB 3CJHB 2X6AA 4UCUA 3ZHSA 1BZKA 3E8HA 5E79Z 4B08A 3FKSG 2AGAA 5LOVB 5B1BC 3CCLV 1TGOA 2OYQA 1IBKO 3OGCC 3LSSA 1BT8A 3J7AU 4UCRA 4O4HB 4MTOA 1O9HA 3UM7A 2P4KA 4JAAA 3PJSK 3ZCCA 3RYFA 5IWAO 3OEHG 1WB7A 4X1YB 1WA8A 1G1XB 2RMKB 3LUTB 4FMTA 3CRCA 2R9RB 2CAZC 1JR9A 2WLKA 3DXRB 5L3CA 4X20B 1K97A 4P2ZA 2A06H 1BHAA 3L72H 1AR5A 2BSKB 4AI8A 1Y66A 1VQ6V 2DYRB 3CCMV 5CB4B 4DV3B 2UXBO 1Y67A 2R9AA 3JAKA 5FNVB 5JH7B 2VWKA 3HKCB 3SYQA 5E1AC 1UPGA 5FPRA 5LHGA 4GKJO 4PA9A 4RUEA 5KAIZ 3D3IA 3FYIB 5JJEB 3SR2C 5KHGA 2H3OA 4FLVA 1WNSA 1YF2A 3CC2V 1RPRA 1HNXO 4JI3B 3ABTA 2Q67A 2Q5ZA 4RWUA 1I5YA 3E89A 2QKCA 1V54C 2EINB 1YEWA 2BSKA 1GN4A 1Z5WA 5CBGA 3DTUB 4DW0A 1QQCA 3JAMN 1XMQO 2Q0OC 3TXSA 4L8JA 4UCOA 2JEXA 2JIZG 1Z5VA 4I5SA 1OCOB 3OTFA 3ZEDA 3FB7C 3FYEB 1NJIW 1S5JA 3ETQA 1F51A 2AXTZ 3W7SA 4WF9V 2CTWA 3ZX6A 1KUQA 1M56C 2JVDA 3JD4A 5LMNO 1QVFU 1VQLV 4KXRA 4DUZO 4LF7B 3T2MA 3VQYA 3W7UA 1P49A 3BEHA 5JQGB 5B3SC 5IYBO 3ASOC 2XTAA 1QLEC 1QHTA 1EM1A 2G38A 1NS1A 3B8NA 1FPOA 5EIBC 3BPZA 1FJGO 3AG3B 2LP7A 5L3EA 2UXDO 4P9PA 4H37A 5CMUA 1SETA 2DWDC 4IGGA 1SF9A 1H8EG 4EEQA 3ZMVA 4RQEA 3ICXA 1L1FA 3OMAB 3H1IH 1Y74B 4D7SA 1S76D 5KMGA 3KCXA 2XAGA 1PV0A 5KHJA 3FFQA 3H1LH 2C2AA 2Z5UA 4CZZA 1JX9A 3JARA 5KHHA 4FLWA 4LF8O 2WLLB 1AJPA 2CUGA 2WPDG 4TUYB 4LH7A 4FFBB 2EIMB 1AJQA 4LF5O 1FFXA 1HR0O 4KHPO 1N32B 4GX5A 3U11A 3JD3A 1JMKC 1NTZH 1NT2B 5IYDO 3OTOB 1W2BU 1K7DA 2PI5A 2XNDG 1ZAUA 2QE7G 1VQ4V 1WAZA 3UO3A 1VQ9V 3A2FA 5LA6A 3B09A 4DR2B 1N4CA 3ABKB 4GKJB 3OUSA 1L0NH 1KC8W 2P4VA 2YS8A 3CCJV 4PA3A 4LF9O 3MDSA 1VP7A 5CBHA 4DV3O 3H9VA 3W7WA 4X8AA 2YIAA 4JI6O 3PN1A 2ZM6O 2EJ7A 2QJ1A 3U0ZA 4MW3A 1DLBA 1Y4MA 4B3RO 3DC5A 1JJ2U 3ASNB 5KHKA 1IZ3A 1NU1H 5EZYB 4HNAB 5F2VO 2ADQB 5ITZA 1XILA 2RN9A 2WAMA 3AG2C 1TUEB 4HBNA 1TVKB 4X9QA 2RQ6A 1QLNA 2DMXA 2XAJA 3T1HB 5EYPA 2Q0AA 3WB0A 2JJ1G 4DV5O 3HB3B 1Q5OA 4XDJA 4H13B 1MSWD 4J80A 2O57A 2KG7B 2YUAA 3WU2Z 2ZXWC 4UXNA 1L0LH 3ZJZA 2F43G 1V55B 2B5UA 1XMQB 3T4ZA 3J81N 4QPJA 1JFFA 4NXMO 4JI4B 2IH3C 2UUCB 1OV9A 1FFXB 1M57B 2ZDIA 3ZS8C 2V4DA 1K92A 3K5MA 5B3SB 5J2UA 1PNKA 1EBOA 2JGDB 3B2EE 1WP8A 4LNUB 1H2KA 3JALA 3IGAC
chains in the Genus database with same CATH topology
1QNMA 3TJTA 1AP6A 1GN4A 1LUWA 1MA1A 1KKCA 1AR4A 4C7UA 3QVNA 1LUVA 1IX9A 2CE4A 1GN6A 3AK1A 1EN5A 4JYYA 3MDSA 1GN2A 1XUQA 4YIPA 3K9SA 4BR6A 3AK2A 1PM9A 1I0HA 1WB8A 3KKYA 1MSDA 2QKAA 1N0JA 3DC5A 1BT8A 1I08A 3LSUA 1ZLZA 2ADPA 4E4EA 3DC6A 1IXBA 2CDYA 2P4KA 1P7GA 1EM1A 2ADQB 1XILA 1ZTEA 1WB7A 1PL4A 1EN4A 4X9QA 3C3TA 1BSMA 3RN4A 3KDRA 4F6EA 1BS3A 4JZ2A 1VEWA 1MMMA 1JR9A 1N0NA 3IC9A 1VARA 2AW9A 5A9GA 1EN6A 1AR5A 1GN3A 1XREA 4JZGA 1D5NA 1IDSA 3C3SA 1Y67A 3OT7A 3CEIA 3EVKA 1ZSPA 3BFRA 1ZUQA 1XDCA 2GDSA 2RCVA 1MNGA 4YIOA 5AG2A 1JA8A 4FFKA 1B06A 4GUNA 3AK3A 1AP5A 1AVMA 2QKCA 1SZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNM A;  3TJT A;  1AP6 A;  1GN4 A;  1LUW A;  1MA1 A;  1KKC A;  1AR4 A;  4C7U A;  3QVN A;  1LUV A;  1IX9 A;  2CE4 A;  1GN6 A;  3AK1 A;  1EN5 A;  4JYY A;  3MDS A;  1GN2 A;  1XUQ A;  4YIP A;  3K9S A;  4BR6 A;  3AK2 A;  1PM9 A;  1I0H A;  1WB8 A;  3KKY A;  1MSD A;  2QKA A;  1N0J A;  3DC5 A;  1BT8 A;  1I08 A;  3LSU A;  1ZLZ A;  2ADP A;  4E4E A;  3DC6 A;  1IXB A;  2CDY A;  2P4K A;  1P7G A;  1EM1 A;  2ADQ B;  1XIL A;  1ZTE A;  1WB7 A;  1PL4 A;  1EN4 A;  4X9Q A;  3C3T A;  1BSM A;  3RN4 A;  4F6E A;  1BS3 A;  4JZ2 A;  1VEW A;  1MMM A;  1JR9 A;  1N0N A;  3IC9 A;  1VAR A;  2AW9 A;  5A9G A;  1EN6 A;  1AR5 A;  1GN3 A;  1XRE A;  4JZG A;  1D5N A;  1IDS A;  3C3S A;  1Y67 A;  3OT7 A;  3CEI A;  3EVK A;  1ZSP A;  3BFR A;  1ZUQ A;  1XDC A;  2GDS A;  2RCV A;  1MNG A;  4YIO A;  5AG2 A;  1JA8 A;  4FFK A;  1B06 A;  4GUN A;  3AK3 A;  1AP5 A;  1AVM A;  2QKC A;  1SZX A; 
#chains in the Genus database with same CATH topology
 2DOS A;  3RYC B;  2F95 B;  3B4S A;  2NR5 A;  1THZ A;  1GRJ A;  3CMA V;  1AR4 A;  4UCS A;  3ABL B;  4KP4 A;  4FFB A;  2ZR2 A;  1V54 B;  1OCO C;  3AG7 A;  3CC4 V;  1R3K C;  4I0X A;  1UFI A;  1WN7 A;  2YDE A;  3O65 A;  2P67 A;  1ZWI C;  4DV0 B;  4YJ3 B;  4JI1 B;  4JYC A;  1TAE A;  2JDI G;  4JI3 O;  1QR9 A;  4K0K B;  3ZHV A;  2WLL A;  2Q68 A;  5L3B A;  1I08 A;  4PDM A;  4DR1 B;  1K4C C;  3SJQ C;  5LP6 B;  4O4J B;  1S72 V;  1CEZ A;  2B9Z A;  3K5O A;  3CRM A;  2VRZ A;  4QIW F;  2OIE A;  3A8T A;  4UB6 Z;  5HFL A;  1SS3 A;  5J2T A;  2RNB A;  4Z2W A;  4FZ0 A;  1OCR C;  1RFY A;  2QDO A;  3C3T A;  5K1X A;  4JI2 O;  5LA6 B;  3JSN A;  3BVO A;  1U96 A;  4JPR A;  1VIB A;  1Q90 D;  3JD1 A;  4CS2 A;  5A9G A;  4B3M B;  4DUY O;  4X64 B;  2ITC C;  2VQF O;  1WPB A;  3K06 A;  3CB2 A;  4CH3 A;  5LBQ A;  2P6J A;  3CEI A;  4D7T A;  3APO A;  5KX5 B;  1ZSP A;  1HP8 A;  3RYH B;  4X62 B;  2X7R B;  1QR8 A;  3CPW U;  4MVO A;  5C8Y A;  5LMU B;  4U3J B;  3F7Y C;  1B06 A;  1G8M A;  5A2Q N;  3ZRX A;  4B3S B;  4UVB A;  1AP5 A;  1AVM A;  4RUF A;  3SYC A;  2IJK A;  2W0F C;  3JSL A;  5FL7 G;  3S3W A;  2ZE8 A;  1QU7 A;  1JQ0 A;  3ZRV A;  1NH2 D;  3OAA G;  2EIN C;  1Q82 W;  2Q6A A;  5IT9 N;  2BCC H;  3RBZ A;  2CGO A;  1V9P A;  1M1K W;  4BR6 A;  1XBL A;  2NLJ C;  3ABM B;  1JFF B;  4O2A B;  2A9H A;  4RAI A;  2W0X A;  1TVK A;  1YSC A;  3NR7 A;  1AI6 A;  3RYI B;  3SJC C;  1G6U A;  1JOY A;  3N2K A;  1ORQ C;  4LF8 B;  4EB6 A;  4PD4 F;  4B3S O;  4Z1V A;  4PI0 A;  2N74 A;  4IIJ A;  4EFB A;  4X65 O;  4B7K A;  5B1B B;  1TA8 A;  4DR1 O;  2K1E A;  5LOV A;  2EIJ B;  1Q6H A;  1YZB A;  4I4T B;  1BS3 A;  4JZ2 A;  3AG2 B;  5GON B;  1I94 B;  1JCH A;  4DR4 O;  3EXA A;  1XEQ A;  4ZIB A;  4X65 B;  4JAU A;  4UV8 A;  4X64 O;  2XAH A;  3JAS B;  2QWP B;  1XL6 A;  2FYU H;  1HDJ A;  1NKD A;  3SYP A;  2EIL B;  5KHI A;  3VQV A;  3X2Q B;  4JI4 O;  3SPC A;  4D6T H;  4B7E A;  1NR7 A;  1NTM H;  4ZHQ B;  1XDC A;  1CPY A;  2YIB D;  1VF6 A;  5LP6 C;  3ABU A;  4WFB V;  3UQ8 A;  2Q69 A;  3E22 B;  4TV8 B;  4AIL C;  3ZMZ A;  3AK3 A;  4H44 B;  4MS2 A;  5EC1 C;  5IJ0 B;  1N36 B;  1IJG A;  1WLE A;  3H1K H;  2E76 B;  4LR3 A;  1YJW V;  2IW5 A;  2ITD C;  1SRY A;  4JI0 O;  2E5L B;  1AJN A;  4JYB A;  1F4M A;  1K5Q A;  1R3I C;  4GCZ A;  2LW7 A;  5B1A C;  4DV0 O;  2PUS A;  4O4J A;  3QTC A;  1HR0 B;  4KHP B;  1Q7Y W;  1KBH A;  2LO1 A;  1KKD A;  4TV8 A;  3AK2 A;  1H8H G;  1WB8 A;  4X62 O;  1SKV A;  4FK5 C;  1XMO O;  2WSS G;  5CN0 A;  3QF7 A;  2YIB A;  3G6E V;  3DC6 A;  4BWA A;  3I56 V;  1K33 A;  4IIJ B;  1Y76 B;  1M57 C;  1H2N A;  2AZ2 A;  1S3J A;  4BIO A;  4WFA V;  4F6E A;  4DR7 O;  1Q6U A;  3AG3 C;  4UVC A;  4DR4 B;  1N33 B;  3IC7 A;  4ZOL A;  3CRA A;  5K1P A;  3HKD B;  5CA3 A;  1URF A;  5C8Y B;  1GN3 A;  1KMI Z;  1YTF D;  3BA9 A;  1I7F A;  1MG1 A;  2VS0 A;  1CXZ B;  3IJ4 A;  2KSD A;  4FJC C;  4N21 A;  1IBM B;  2LGQ A;  2WWW A;  3VBB A;  1BL8 A;  1H2M A;  4CBC A;  5AG2 A;  1JA8 A;  1YJ9 V;  2OCH A;  4R8C A;  1V55 C;  4B3M O;  4DR5 B;  4LFA B;  2Q7G A;  2N04 A;  3CXC U;  1SQV H;  3JCU Z;  3GB7 C;  4JYA B;  3JAT A;  4JTD B;  5EIB D;  1OZ0 A;  2PYL A;  4JI8 B;  4NXM B;  4OX9 O;  3THO A;  2LGW A;  4LFC B;  4UB8 Z;  3MHH C;  4JI5 O;  5H6Q A;  3CCS V;  1F7Y A;  5BR8 B;  3RW0 A;  1B6Q A;  3LNN A;  3CP1 A;  3S3X A;  5IJ9 B;  3M99 B;  1K34 A;  4IHJ A;  1NZ6 A;  4LP8 A;  1IXB A;  4LF7 O;  2GSM B;  1GM8 A;  1M56 B;  3HPL C;  1SQG A;  1OJH A;  4DV7 O;  1ZX3 A;  1ZTE A;  5CBF A;  1DF5 A;  3W7T A;  4G2K A;  3OE7 G;  3CYO A;  3ZMT A;  3BAB A;  4JTA B;  1PL4 A;  4I9W A;  3F5T A;  4CH4 A;  2GUZ A;  5IYZ A;  3E8B A;  1Q81 W;  2E5L O;  2Y48 A;  2HHH B;  3MAQ A;  1S5L Z;  2QWQ B;  3FB6 C;  1YXB A;  3L9D A;  3Q4H B;  1US6 A;  4TSF G;  1D5N A;  3K59 A;  4JF3 A;  1J95 A;  4LF6 B;  3FX7 A;  2OIG A;  3KZI Z;  5L3F A;  4PDV A;  2YI9 A;  3ZN0 A;  1FFT B;  1E79 G;  4PA7 A;  4KFM A;  2Y4T A;  4DR7 B;  2A7W A;  1GAX A;  1KYO F;  3ASN C;  5KA6 A;  4PA6 A;  5KMG B;  1M4U A;  2YSU B;  4NTX A;  4XDL A;  3D36 C;  2EJR A;  2DYR C;  2NN4 A;  4DR5 O;  3K79 A;  5CA0 A;  4B3T O;  2ETN A;  2QM7 A;  1XNR B;  2HHH O;  2YXL A;  3P32 A;  1VF6 C;  5LP6 A;  2W6I G;  4ICG A;  1EFR G;  4DUZ B;  3U10 A;  4C7U A;  1R3L C;  3RGB A;  1IX9 A;  2EIJ C;  3ZBH A;  1XNQ O;  4WFG A;  3G80 A;  1P4R A;  3BY6 A;  2Q7E A;  4EB6 B;  5JCO A;  2GBO A;  3GVM A;  4YJ3 A;  2KB1 A;  4UV9 A;  2EX3 A;  3I5D A;  1PM9 A;  1I0H A;  2OCC B;  5JVD B;  4DRX B;  3G71 V;  4DRX A;  4DV6 B;  5EK0 A;  4EFE A;  3D8C A;  3OW2 U;  4GZR B;  3H1H H;  1Q86 W;  2ZXW B;  4J7J A;  1SQF A;  4O4I A;  3ZN1 A;  5C93 A;  2WLH A;  1FXK B;  5J2T B;  3APQ A;  2DE0 X;  3VQW A;  4DV2 B;  1WP7 A;  1S77 D;  1I5X A;  1VEW A;  4JI8 O;  4DV1 O;  1EZJ A;  3WB1 A;  3OM3 B;  4K35 A;  3H01 A;  5GW7 A;  5JWP A;  4U3J A;  4LFC O;  4TQF A;  2HKO A;  1NTK H;  3RWR D;  1BHB A;  2UXX A;  4I9Q A;  2HG5 C;  4GKK O;  4O4I B;  4ASU G;  5IE9 A;  1H5W A;  1WPX A;  2A3Q A;  3HKC A;  4G27 B;  3UT5 B;  2PI4 A;  2CTR A;  2DYS C;  5FLX N;  1HW7 A;  3RT3 C;  2X0L A;  2ZT9 B;  3ZHQ A;  1XHX A;  5LGT A;  1QNM A;  1NVP D;  2IJI A;  4MTX A;  3ETE A;  4O4L B;  5BMV A;  3CS5 A;  2CH7 B;  1MAB G;  4ZI7 B;  2GUZ B;  1KKC A;  4FLT A;  3K0G A;  4JI7 B;  2JS3 A;  4I55 A;  2P5O A;  2F4V B;  1Z2G A;  3MHS C;  4OGQ B;  1BGY H;  1ROP A;  2CK3 G;  2W6J G;  3UO2 A;  3J80 N;  3CCR V;  1VQM V;  4LF6 O;  4P9O A;  2BTO A;  2WA3 A;  1RSO B;  1S0V A;  2EZO A;  2D2C B;  3KKY A;  5DM6 V;  1F4N A;  1XNQ B;  1N8R W;  2WLI B;  1MOF A;  3AG4 B;  1G4Y B;  3CCQ V;  4K0K O;  4TUY A;  4CC6 A;  4O4H A;  4JGS A;  3RFR A;  2AHY A;  2EIL C;  3K58 A;  3HKD A;  3OGI B;  5H6R A;  3CJH A;  5JH7 A;  4MTF A;  5CB4 A;  1XI1 A;  4GT1 A;  4J42 A;  4PA4 A;  4CC5 A;  1SER A;  3E86 A;  2HEP A;  4TV9 A;  1L8D A;  2QM8 A;  2ZE6 A;  2R70 A;  2ZIN A;  3T1Y B;  4B3R B;  2ODM A;  2EZP A;  3HKB B;  2BTQ B;  3ZRW A;  1FYJ A;  3OR7 C;  2ZDI C;  1J5E B;  1DTO A;  3STL C;  5KUK A;  3CHX A;  4GX1 A;  3SJB C;  5KX5 A;  1R6T A;  3P3P A;  5IJ9 A;  4TQD A;  1M93 A;  2QA4 V;  2A79 B;  4IHJ B;  3SJA C;  3HKE B;  2Q9L A;  4TV9 B;  1NVP B;  1JJO A;  3ZIA G;  4QNH B;  2GHY A;  3ABK C;  4Q20 A;  1SZT A;  3BCC H;  3CRR A;  2PGG A;  4FLX A;  4BAY A;  4UCV A;  4LC1 A;  2HJD A;  3CC7 V;  4Q6G A;  4NTY A;  1FXK A;  1K8A W;  3CXH F;  1RM1 C;  1R3J C;  3RVZ A;  1OCC B;  4DR6 B;  2WA4 A;  1DGS A;  5LGN A;  1HNZ O;  1OCR B;  3QVN A;  1LUV A;  4MVR A;  4WBN B;  1M9N A;  4U3F H;  1KQS U;  3Q4H A;  3STZ C;  2P7T C;  3T4D A;  5GTH Z;  4KL1 A;  4X1I A;  4AQY B;  1GN2 A;  4JAV A;  2JEU A;  5LXT A;  4YY3 O;  1MSD A;  1GO3 F;  4MTG A;  4LWS B;  3BAA A;  2B1G A;  3X2Q C;  2VQE B;  2ZD9 A;  5H2F Z;  5LGU A;  4IT5 A;  3UCS C;  4LNU A;  3I55 V;  2P90 A;  3G67 A;  4J11 A;  4DV4 O;  1SQB H;  1PPJ H;  4ZKI A;  4X88 A;  4X1I B;  5GON A;  2XAF A;  3ZHR A;  1ARO P;  4U7O A;  5LXT B;  2ZIM A;  1VF5 B;  2OTL V;  4DK1 A;  3ZHU A;  5FPO A;  1N34 B;  2AW9 A;  4NTW A;  4DV4 B;  3UT5 A;  2WLN A;  3RYH A;  5J2U B;  1J5E O;  1KB9 F;  1XL4 A;  1LNQ A;  4JZG A;  4X1Y A;  2DW4 A;  1RSO A;  4TOI A;  4LFB B;  3OD4 A;  1VQP V;  3QG5 A;  2HVK C;  2PF4 E;  3JAT B;  4W4L A;  5IDJ A;  1H38 A;  1PL0 A;  4K8Z A;  1KEC A;  1Q43 A;  2XUM A;  4O2A A;  2DYS B;  1Q3E A;  1VMG A;  4PDL A;  5DED A;  1YI2 V;  5LHH A;  5B1A B;  4YHH B;  2WLJ A;  4X20 A;  4NVP A;  4DV1 B;  3O9O A;  1PKX A;  2Q8V A;  2AHZ A;  3G6B A;  1MNG A;  4AHC A;  4XBF A;  4QE7 A;  4AQY O;  3JAK B;  3AG1 C;  3E2E A;  2JS5 A;  1FKA O;  2UUA B;  1XHZ A;  4CS4 A;  4GYC B;  2UUB B;  2B1I A;  4DR6 O;  1RP3 B;  1S5H C;  1OCC C;  4HNA A;  4JI6 B;  4DV2 O;  1BQ0 A;  3ML0 A;  3E22 A;  2ZE7 A;  4FLY A;  3JAW A;  1TUB B;  2PY5 A;  1FXH A;  1K4D C;  3LDC A;  4QPK A;  2HR3 A;  4NB5 A;  4J10 A;  2IH1 C;  4UVA A;  4DYL A;  2BOB C;  4MSW C;  3CCV V;  1I94 O;  2OT5 A;  1HNZ B;  3FAV A;  4O2B A;  2CDY A;  1ZL8 B;  3OEE G;  1P84 F;  3KG2 A;  5EBL C;  4JI1 O;  3K57 A;  4X1K A;  2GTS A;  4X1K B;  4PJ0 Z;  4UFZ A;  3UKM A;  1KP3 A;  2VWJ A;  2ZCE A;  2X6C A;  4TWK A;  2DN9 A;  3K03 A;  3M7M X;  2ZKO A;  1GMG A;  2UUC O;  4B3T B;  5B1N A;  1N36 O;  3A0R A;  3K9A A;  3A0B Z;  5B66 Z;  3W7X A;  4CH6 A;  1ZL8 A;  4JI5 B;  1FS0 G;  3HR0 A;  4O2B B;  1SQP H;  2RDC A;  3F5W C;  1GTO A;  1VF7 A;  4H33 A;  4YJ2 A;  2XAQ A;  4NXN O;  2L35 A;  4PV1 B;  3RYI A;  4LCU C;  2ZE5 A;  4ZOL B;  1ZUQ A;  1AB3 A;  2LJ2 A;  3JAS A;  3CE2 A;  4UCT A;  4YIO A;  2QM4 A;  1UJW B;  4QJF B;  4WFF A;  5J9P C;  1R6N A;  1WA8 B;  1VQ5 V;  3SPG A;  3AG1 B;  2M6Y A;  4I4T A;  2V1D A;  3LNM B;  2X6B A;  3L74 H;  1R1B A;  2WLM A;  2R72 A;  2UXB B;  3AK1 A;  2IM9 A;  3OUF A;  1DK1 A;  2FL4 A;  2MW2 B;  3ASO B;  2UXC B;  4DV7 B;  1Y74 A;  4DO2 A;  1SA0 A;  1E1R G;  2DQ0 A;  4I50 A;  1XQ8 A;  4I7Z B;  1VQ8 V;  3CX5 F;  4OXS A;  4QE9 A;  1PNM A;  1X59 A;  3FAV B;  2YIC A;  2L6L A;  3WFV A;  3LSU A;  4GX0 A;  1ZLZ A;  2ADP A;  3BA8 A;  3CRQ A;  4JYA O;  5ITZ B;  3BHP A;  2QWN B;  1FD9 A;  1GKF A;  1PNL A;  1PP9 H;  4J7Z A;  4I0X B;  4MVU A;  1AI7 A;  1E1Q G;  2Y0I A;  5D5P A;  3N2G A;  2F66 C;  1N33 O;  2PTM A;  3RN4 A;  3KDR A;  4LBE C;  3K08 A;  1FXK C;  1A32 A;  2YEV B;  2YEV A;  3SGI A;  4HZ3 A;  2Y69 C;  3WG7 B;  1VAR A;  2Y69 B;  3EFF K;  3M8A A;  2FKX A;  3DSQ A;  4J9Y B;  4CH5 A;  3OMI B;  2H8P C;  3IFX A;  3OFN G;  5CA1 A;  5HFM A;  5IY5 B;  4ZBM A;  3L70 H;  3QO7 A;  2F4V O;  1KP2 A;  3C3S A;  4PDR A;  4LF4 O;  4MVQ A;  2Q73 A;  4R50 A;  3EVK A;  4FLZ A;  3FB5 C;  4R7C A;  3TK1 A;  3R66 A;  2QKS A;  2RCV A;  3OMN B;  4WCE V;  2JJ2 G;  3SPJ A;  1AI5 A;  3ZHT A;  4JV5 B;  2ZM6 B;  5KA5 A;  1COW G;  3AG4 C;  2LQT A;  3K5L A;  1W0J G;  3CSX A;  1U97 A;  4ZI7 A;  4Z1M G;  3NXS A;  3OR6 C;  2NNU A;  2CE4 A;  3RYF B;  2IBZ H;  3SPH A;  4LH6 A;  1YVW A;  3L71 H;  5IYC O;  1K73 W;  4JYY A;  1NH2 B;  2UXD B;  4FM2 A;  2EBO A;  4NYK A;  1XUQ A;  1BE3 H;  1F23 A;  1GK9 A;  1O9G A;  2Y4U A;  3H1J H;  4MVZ A;  3K9S A;  3ZMU A;  2FB5 A;  3FD9 A;  3ZMS A;  4BW9 A;  3CD6 V;  2HP8 A;  3L75 H;  2XT9 A;  4MVS A;  2LW1 A;  4UUJ C;  3SYA A;  1VQN V;  1X4T A;  4MT8 A;  2JK5 C;  1YDX A;  5L3G A;  2R9I A;  2YXY A;  4I55 B;  3JAW B;  2ZR3 A;  4JAS A;  4YXW G;  2E74 B;  2M7W A;  1R73 A;  2HJF C;  2JGD A;  3ABM C;  4DR3 O;  3GWK C;  2VQF B;  1D2D A;  2F1M A;  2UXC O;  3LDE A;  2F23 A;  2QWR B;  1BSM A;  1YIJ V;  2YI8 A;  3F7V C;  1N34 O;  3RYC A;  1W0K G;  3E8F A;  5TIS Z;  3RVY A;  2XOK G;  1OCZ C;  3D3Q A;  1TUB A;  3MD0 A;  4MW8 A;  3WG7 C;  2Z0A A;  1JNB A;  4NR1 A;  3TXQ A;  1SA0 B;  1HNX B;  5EYP B;  2QTS A;  3OT7 A;  3SYO A;  1GM7 A;  4X89 A;  1FAF A;  5JVD A;  4L87 A;  1H2G A;  4MVM A;  1B04 A;  3HKE A;  4ZHQ A;  2P22 C;  2DQ3 A;  2GDS A;  2ATK C;  3LSQ A;  4GLX A;  5LYJ B;  3DXR A;  1FXV A;  4PI2 A;  2UUA O;  4FPP A;  5DEC A;  1YJN V;  3K04 A;  5H9C A;  1SZX A;  5IWA B;  1SC5 B;  2OCC C;  3TJT A;  4X66 O;  3JD2 A;  5GTI Z;  3N27 A;  3ZRS A;  3IAY A;  2PYJ A;  1LR1 A;  4G28 B;  1MA1 A;  1MZF A;  5EBW C;  2D3O W;  5FNV A;  4K8X A;  2V7Q G;  3GWO A;  2ZNI A;  3DGE A;  2QEX V;  5JQG A;  3CWB H;  3SDL A;  2BE3 A;  2LFR A;  3BRC A;  5KAF Z;  2EIM C;  4EKW A;  4BW5 A;  4X66 B;  2YXH A;  2CTP A;  2IJJ A;  4YIP A;  1D5A A;  3K0D A;  5EBM C;  3A0H Z;  2BOC C;  2DWE C;  5DN6 G;  1K5S A;  2QGN A;  2IJH A;  1N0J A;  3N2K B;  5H5N A;  1B3Q A;  4RQF A;  4E4E A;  1P7G A;  1Y76 A;  4WBN A;  1VQK V;  2IU0 A;  3WB2 A;  5CA0 B;  2YID A;  1R6K A;  2KG7 A;  1XOU A;  3ABL C;  1QCE A;  5CA1 B;  2E3C A;  2WLI A;  4QGP A;  5BMV B;  4J41 A;  1IBL B;  4F6R A;  2CTQ A;  5IYZ B;  2DJV A;  1GH6 A;  2XHB A;  4DV6 O;  1W59 A;  3ETG A;  1EN6 A;  3B40 A;  4A5U B;  3CME V;  1IVS A;  4DR3 B;  2QR4 A;  4DUY B;  2CGN A;  3KCY A;  2VQE O;  2PZS A;  1EZV H;  4IL6 Z;  4F4L A;  2RJZ A;  4FM0 A;  3QO5 A;  4BIU A;  1SQX H;  4NKG B;  4ABM A;  4XDK A;  4IYI A;  4LFB O;  2GV9 A;  3ZRW B;  4LFA O;  2MK3 A;  4JI2 B;  1HWY A;  4PEL A;  3TGU H;  3B77 A;  4P30 A;  1T5E A;  2N05 A;  2UU9 B;  4I50 B;  3ETD A;  1WJZ A;  2F93 B;  3VOU A;  4LF9 B;  4OPA A;  2QSA A;  3QO8 A;  4OPH A;  3JAR B;  4LF4 B;  4FIP C;  1XMO B;  5EZY A;  5LHI A;  1IXM A;  1CP9 A;  1GN6 A;  2ZQM A;  3HKB A;  2FML A;  2EUL A;  1YTF B;  4FZ1 A;  4OX9 B;  1SQQ H;  2HVJ C;  1M90 W;  1QLE B;  1IUR A;  4JV5 O;  2OWO A;  2KKW A;  4U7N A;  2HLD G;  2QKA A;  3LDD A;  2ARH A;  1OHH G;  4N23 A;  3B8M A;  3E8G A;  4FVM A;  1Q8I A;  2HFE C;  2KQX A;  1YIT V;  1KD1 W;  1YCI A;  3EHB B;  3JD0 A;  4BIZ A;  3QNE A;  4FLU A;  1N32 O;  2JGU A;  1NBM G;  3FB8 C;  5L3D A;  1H2S B;  4PHZ A;  4E2L A;  1N0N A;  3IC9 A;  2ZIO A;  2FTK A;  4W4K A;  2P06 A;  1RM1 B;  3G4S V;  4GX2 A;  2Q4P A;  1BQZ A;  4HAM A;  5LYJ A;  4RO2 A;  4R6Z A;  3AEI A;  3L73 H;  1SES A;  3P3N A;  1AI4 A;  2H94 A;  4K3A A;  1BMF G;  4F6R B;  1VQO V;  1Y6X A;  4O4L A;  4LWS A;  4FM1 A;  5D5Q A;  4JTC B;  1IBK B;  3D36 A;  1AR1 B;  2ZNJ A;  5JCO C;  1NQT A;  5EC2 C;  1KU9 A;  2EIK C;  2YC0 A;  4TT3 G;  5LMN B;  3CCE V;  4GUN A;  5LL6 Y;  1JPX A;  3JAL B;  1NR1 A;  1AP6 A;  1H2L A;  4JI7 O;  4DV5 B;  4YJ2 B;  5BY1 A;  3TET A;  2AZ0 A;  2A0L A;  3CCU V;  3T1H O;  1FOU A;  2UU9 O;  1EN5 A;  2E75 B;  2QWO B;  4WFE A;  3C90 A;  4DK0 A;  4KUM A;  3N2G B;  3T1C A;  1QVG U;  4WFH A;  5BR8 O;  4H0L B;  2Y0P A;  2EIK B;  4CS3 A;  1VQ7 V;  4DXW A;  2ILM A;  3TCU A;  1PD3 A;  3E35 A;  1P7B A;  2JRI A;  2K9P A;  2BTQ A;  5JJJ B;  5IJ0 A;  3K3W A;  5BXZ A;  4IYH A;  1FJG B;  3SPI A;  1EN4 A;  1BCC H;  4LF5 B;  1K9M W;  3T1Y O;  1MMM A;  1IBM O;  2LFS A;  2UXN A;  2QTO A;  1RPO A;  1K3E A;  3R65 A;  3OTO O;  1OCZ B;  2UUB O;  4GKK B;  1XRE A;  4HYO A;  5LMU O;  1IDS A;  3P30 A;  2Q7H A;  5KUM A;  4DW1 A;  1HNW O;  3JYC A;  4YHH O;  1YHQ V;  4DR2 O;  2OTJ V;  2GTA A;  3BFR A;  5JJN B;  3E83 A;  4YY3 B;  1MZE A;  1IBL O;  1DF4 A;  5B1O A;  3K5N A;  1AIL A;  2IU3 A;  4FFK A;  1HNW B;  1NI8 A;  5IY5 C;  2Z3Y A;  5B5E Z;  1Q6I A;  1QBZ A;  4J9Z B;  2XAS A;  1M5I A;  5BZB A;  4JI0 B;  1LUW A;  2CH7 A;  1ENV A;  1XNR O;  3JCZ A;  5KLV H;  4J7K A;  1JVM A;  1GM9 A;  3VQX A;  4NXN B;  3CJH B;  2X6A A;  4UCU A;  3ZHS A;  1BZK A;  3E8H A;  5E79 Z;  4B08 A;  3FKS G;  2AGA A;  5LOV B;  5B1B C;  3CCL V;  1TGO A;  2OYQ A;  1IBK O;  3OGC C;  3LSS A;  1BT8 A;  3J7A U;  4UCR A;  4O4H B;  4MTO A;  1O9H A;  3UM7 A;  2P4K A;  4JAA A;  3PJS K;  3ZCC A;  3RYF A;  5IWA O;  3OEH G;  1WB7 A;  4X1Y B;  1WA8 A;  1G1X B;  2RMK B;  3LUT B;  4FMT A;  3CRC A;  2R9R B;  2CAZ C;  1JR9 A;  2WLK A;  3DXR B;  5L3C A;  4X20 B;  1K97 A;  4P2Z A;  2A06 H;  1BHA A;  3L72 H;  1AR5 A;  2BSK B;  4AI8 A;  1Y66 A;  1VQ6 V;  2DYR B;  3CCM V;  5CB4 B;  4DV3 B;  2UXB O;  1Y67 A;  2R9A A;  3JAK A;  5FNV B;  5JH7 B;  2VWK A;  3HKC B;  3SYQ A;  5E1A C;  1UPG A;  5FPR A;  5LHG A;  4GKJ O;  4PA9 A;  4RUE A;  5KAI Z;  3D3I A;  3FYI B;  5JJE B;  3SR2 C;  5KHG A;  2H3O A;  4FLV A;  1WNS A;  1YF2 A;  3CC2 V;  1RPR A;  1HNX O;  4JI3 B;  3ABT A;  2Q67 A;  2Q5Z A;  4RWU A;  1I5Y A;  3E89 A;  2QKC A;  1V54 C;  2EIN B;  1YEW A;  2BSK A;  1GN4 A;  1Z5W A;  5CBG A;  3DTU B;  4DW0 A;  1QQC A;  3JAM N;  1XMQ O;  2Q0O C;  3TXS A;  4L8J A;  4UCO A;  2JEX A;  2JIZ G;  1Z5V A;  4I5S A;  1OCO B;  3OTF A;  3ZED A;  3FB7 C;  3FYE B;  1NJI W;  1S5J A;  3ETQ A;  1F51 A;  2AXT Z;  3W7S A;  4WF9 V;  2CTW A;  3ZX6 A;  1KUQ A;  1M56 C;  2JVD A;  3JD4 A;  5LMN O;  1QVF U;  1VQL V;  4KXR A;  4DUZ O;  4LF7 B;  3T2M A;  3VQY A;  3W7U A;  1P49 A;  3BEH A;  5JQG B;  5B3S C;  5IYB O;  3ASO C;  2XTA A;  1QLE C;  1QHT A;  1EM1 A;  2G38 A;  1NS1 A;  3B8N A;  1FPO A;  5EIB C;  3BPZ A;  1FJG O;  3AG3 B;  2LP7 A;  5L3E A;  2UXD O;  4P9P A;  4H37 A;  5CMU A;  1SET A;  2DWD C;  4IGG A;  1SF9 A;  1H8E G;  4EEQ A;  3ZMV A;  4RQE A;  3ICX A;  1L1F A;  3OMA B;  3H1I H;  1Y74 B;  4D7S A;  1S76 D;  5KMG A;  3KCX A;  2XAG A;  1PV0 A;  5KHJ A;  3FFQ A;  3H1L H;  2C2A A;  2Z5U A;  4CZZ A;  1JX9 A;  3JAR A;  5KHH A;  4FLW A;  4LF8 O;  2WLL B;  1AJP A;  2CUG A;  2WPD G;  4TUY B;  4LH7 A;  4FFB B;  2EIM B;  1AJQ A;  4LF5 O;  1FFX A;  1HR0 O;  4KHP O;  1N32 B;  4GX5 A;  3U11 A;  3JD3 A;  1JMK C;  1NTZ H;  1NT2 B;  5IYD O;  3OTO B;  1W2B U;  1K7D A;  2PI5 A;  2XND G;  1ZAU A;  2QE7 G;  1VQ4 V;  1WAZ A;  3UO3 A;  1VQ9 V;  3A2F A;  5LA6 A;  3B09 A;  4DR2 B;  1N4C A;  3ABK B;  4GKJ B;  3OUS A;  1L0N H;  1KC8 W;  2P4V A;  2YS8 A;  3CCJ V;  4PA3 A;  4LF9 O;  3MDS A;  1VP7 A;  5CBH A;  4DV3 O;  3H9V A;  3W7W A;  4X8A A;  2YIA A;  4JI6 O;  3PN1 A;  2ZM6 O;  2EJ7 A;  2QJ1 A;  3U0Z A;  4MW3 A;  1DLB A;  1Y4M A;  4B3R O;  3DC5 A;  1JJ2 U;  3ASN B;  5KHK A;  1IZ3 A;  1NU1 H;  5EZY B;  4HNA B;  5F2V O;  2ADQ B;  5ITZ A;  1XIL A;  2RN9 A;  2WAM A;  3AG2 C;  1TUE B;  4HBN A;  1TVK B;  4X9Q A;  2RQ6 A;  1QLN A;  2DMX A;  2XAJ A;  3T1H B;  5EYP A;  2Q0A A;  3WB0 A;  2JJ1 G;  4DV5 O;  3HB3 B;  1Q5O A;  4XDJ A;  4H13 B;  1MSW D;  4J80 A;  2O57 A;  2KG7 B;  2YUA A;  3WU2 Z;  2ZXW C;  4UXN A;  1L0L H;  3ZJZ A;  2F43 G;  1V55 B;  2B5U A;  1XMQ B;  3T4Z A;  3J81 N;  4QPJ A;  1JFF A;  4NXM O;  4JI4 B;  2IH3 C;  2UUC B;  1OV9 A;  1FFX B;  1M57 B;  2ZDI A;  3ZS8 C;  2V4D A;  1K92 A;  3K5M A;  5B3S B;  5J2U A;  1PNK A;  1EBO A;  2JGD B;  3B2E E;  1WP8 A;  4LNU B;  1H2K A;  3JAL A;  3IGA C; 
#chains in the Genus database with same CATH homology
 1QNM A;  3TJT A;  1AP6 A;  1GN4 A;  1LUW A;  1MA1 A;  1KKC A;  1AR4 A;  4C7U A;  3QVN A;  1LUV A;  1IX9 A;  2CE4 A;  1GN6 A;  3AK1 A;  1EN5 A;  4JYY A;  3MDS A;  1GN2 A;  1XUQ A;  4YIP A;  3K9S A;  4BR6 A;  3AK2 A;  1PM9 A;  1I0H A;  1WB8 A;  3KKY A;  1MSD A;  2QKA A;  1N0J A;  3DC5 A;  1BT8 A;  1I08 A;  3LSU A;  1ZLZ A;  2ADP A;  4E4E A;  3DC6 A;  1IXB A;  2CDY A;  2P4K A;  1P7G A;  1EM1 A;  2ADQ B;  1XIL A;  1ZTE A;  1WB7 A;  1PL4 A;  1EN4 A;  4X9Q A;  3C3T A;  1BSM A;  3RN4 A;  3KDR A;  4F6E A;  1BS3 A;  4JZ2 A;  1VEW A;  1MMM A;  1JR9 A;  1N0N A;  3IC9 A;  1VAR A;  2AW9 A;  5A9G A;  1EN6 A;  1AR5 A;  1GN3 A;  1XRE A;  4JZG A;  1D5N A;  1IDS A;  3C3S A;  1Y67 A;  3OT7 A;  3CEI A;  3EVK A;  1ZSP A;  3BFR A;  1ZUQ A;  1XDC A;  2GDS A;  2RCV A;  1MNG A;  4YIO A;  5AG2 A;  1JA8 A;  4FFK A;  1B06 A;  4GUN A;  3AK3 A;  1AP5 A;  1AVM A;  2QKC A;  1SZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...