4C7UA

Crystal structure of manganese superoxide dismutase from arabidopsis thaliana
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
203
structure length
203
Chain Sequence
b'MTFTLPDLPYDYGALEPAISGEIMQIHHQKHHQAYVTNYNNALEQLDQAVNKGDASTVVKLQSAIKFNGGGHVNHSIFWKNLAPSSEGGGEPPKGSLGSAIDAHFGSLEGLVKKMSAEGAAVQGSGWVWLGLDKELKKLVVDTTANQDPLVTKGGSLVPLVGIDVWEHAYYLQYKNVRPEYLKNVWKVINWKYASEVYEKENN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [MN] 1, MITOCHONDRIAL
publication title Crystal Structure of the Arabidopsis Thaliana Manganese Superoxide Dismutase at 1.95 A Resolution
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 75
structure length 203
sequence length 203
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4c7uA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4c7uA02
1VARA 1GN6A 3AK1A 1BSMA 1QNMA 1KKCA 1VEWA 1EM1A 4E4EA 1BS3A 3AK2A 2QKCA 1GN4A 4YIPA 2RCVA 1AR5A 2ADQB 3KKYA 1MNGA 3CEIA 1GN2A 1EN4A 1XUQA 3AK3A 4YIOA 1IXBA 2GDSA 1MA1A 1JR9A 1Y67A 4C7UA 4F6EA 1N0NA 3EVKA 2CE4A 3RN4A 2P4KA 3OT7A 2QKAA 1PL4A 1XILA 1LUWA 1XDCA 4GUNA 1PM9A 1B06A 1LUVA 1MSDA 5A9GA 1EN5A 3C3TA 1AP6A 1IDSA 1EN6A 3DC6A 2AW9A 3DC5A 3C3SA 4JZGA 1D5NA 3LSUA 5AG2A 1WB7A 1ZSPA 4X9QA 3K9SA 4JZ2A 4JYYA 1I0HA 3BFRA 1AP5A 1N0JA 1ZLZA 1ZUQA 1IX9A 4BR6A 1P7GA 1I08A 1SZXA 1GN3A 3QVNA 3TJTA 2CDYA 1MMMA 1WB8A 1XREA 3MDSA 1ZTEA 4FFKA 3IC9A 1AR4A 1JA8A 1BT8A 1AVMA 2ADPA
chains in the Genus database with same CATH superfamily
4X1KB 2O57A 3ZRWB 3K5NA 1XOUA 1X59A 4J80A 1M56C 2JVDA 3CCEV 3CRMA 4J7KA 3JYCA 4LFAO 1N8RW 3H1LH 4WBNB 1M5IA 4N21A 4DV5O 4DV3B 3SYAA 3JAMN 3L75H 3AEIA 2GDSA 2Q0OC 1BHAA 2YDEA 4CC6A 4CH3A 1Y76A 1N0NA 3A0BZ 1SZTA 4FLYA 4W4LA 4IL6Z 5LHHA 4JF3A 2ZNJA 4GUNA 2IBZH 4B7KA 1KC8W 3S3WA 3H1JH 3N2KA 3TK1A 4B3RO 1V55B 1DF5A 5BXZA 2OYQA 4U3JA 4MSWC 3E86A 2ZIMA 4LNUB 1VF6A 2HKOA 2XAJA 1HWYA 4LF4O 1HR0B 2A7WA 1XI1A 2L6LA 3OEHG 4WCEV 4Z1VA 1I0HA 2F1MA 4CS4A 5CBGA 4O4HB 3JD3A 2IJIA 2QE7G 4LP8A 1SZXA 1ZAUA 5EZYA 4TSFG 2XTAA 3HKEA 5J2TB 4K8XA 1MMMA 4LWSA 2QR4A 2BTQB 3ABUA 4WFAV 4FFKA 1WP8A 3CCRV 3ZMTA 2DYRC 3E83A 2WLIA 2HHHB 4UCRA 3ZMUA 4KL1A 3WG7B 1F4NA 1I7FA 1JA8A 3K5MA 3HPLC 2VWJA 1B04A 2LW1A 1SF9A 1G8MA 1QNMA 5GONA 1MSWD 1KYOF 3E8BA 4FMTA 1PV0A 4TQFA 3OM3B 1VEWA 2UXDO 1Y66A 2QJ1A 4I7ZB 3SYQA 1YCIA 3K79A 1S5HC 2Y48A 2YS8A 3CE2A 5L3BA 1GK9A 3F5TA 2JJ1G 3TETA 4YIOA 4JI1B 4MVRA 1J5EO 1UPGA 4LF8O 3BHPA 2PYJA 4C7UA 4Z1MG 3G71V 5A2QN 1IZ3A 4I0XB 1I94B 3LDEA 4X66B 3CB2A 1FXHA 2JGUA 2P6JA 1EFRG 3SJAC 1PNLA 1PD3A 4XDJA 1SRYA 1YVWA 3W7UA 2ZDIC 4YJ3A 1R6KA 3JAWB 5KMGA 3FB8C 4PV1B 3OTFA 1OCCB 3LUTB 1N33B 5KUMA 4FLTA 1JPXA 1VP7A 1VQ5V 4J41A 3AG1B 1S77D 4EB6A 2NLJC 2PYLA 1WAZA 1G4YB 4JI1O 1SQXH 1UJWB 4O2BA 2PUSA 2UUCO 2RNBA 4TUYA 1YDXA 5CA0B 3CCVV 5BMVB 3CX5F 4NTXA 3FB6C 1XMQO 1MZEA 2H94A 3CSXA 1XHXA 3R66A 1N34B 4YHHB 3IC9A 2IW5A 3Q4HB 5LBQA 4CC5A 1AR4A 4GCZA 4DV1O 1WA8A 4PHZA 1VQ4V 4BIUA 3STZC 1TAEA 2W6JG 1H2NA 2B5UA 4QJFB 5GTHZ 2RJZA 2DMXA 3QG5A 4LH7A 4NR1A 2WLLB 1FS0G 3ZHUA 2F4VO 1YXBA 2VRZA 4YIPA 1OCRB 2Q9LA 3SYOA 4XBFA 1LNQA 4J9YB 4UXNA 5IDJA 1OCCC 1MNGA 4DV2B 3C90A 1YSCA 3CS5A 4ZI7A 2WWWA 3DTUB 1NTZH 3IFXA 3AG1C 4O4JA 4DV6O 2MW2B 5LMUB 4UCVA 3ZJZA 3JALA 2UXCO 2FYUH 4H33A 3BEHA 1N36O 3OUSA 3ASOB 4O2AB 1NR7A 1GM8A 4MTFA 4H0LB 4MTGA 1VQ6V 1PM9A 5TISZ 4TT3G 4TOIA 2PGGA 2Z3YA 1VQNV 1MSDA 1RPRA 1AP6A 4GX2A 3CCUV 3ZIAG 2GUZA 1SQQH 2XAFA 2ZINA 2Y0IA 2ILMA 3ABMB 3JD1A 3ZMVA 4X65B 5EIBD 4DV0O 3LSSA 4QNHB 2V7QG 3RYCA 1NVPD 4MVZA 2JS3A 1K7DA 1Y76B 2Q67A 3UT5A 1VQPV 5LMUO 3SPHA 4DW1A 3QVNA 1NI8A 1OCRC 1M57C 3TJTA 2EIMC 5FNVA 3N2KB 3SJQC 1ZTEA 4DXWA 4FM2A 1QU7A 5IE9A 2CTWA 3RYIA 4U3JB 1Q5OA 4U7OA 1HNWO 2ZM6O 4DR3O 3W7TA 4P2ZA 4Z2WA 3IJ4A 3G6EV 5LMNB 1OCOB 5E1AC 2DWDC 1YIJV 5EZYB 2LFSA 1AJQA 3HKEB 3TGUH 1XBLA 2B9ZA 4HZ3A 4RO2A 3KKYA 4LWSB 4RAIA 1XL6A 3PN1A 4NTWA 3F7VC 4J10A 2RMKB 1F7YA 1S5JA 2WLIB 4J42A 2LJ2A 5LL6Y 3OTOO 2Y4TA 1K92A 1MZFA 5IJ0A 1BL8A 1PL4A 2DE0X 1XNRB 2EIJB 4IGGA 5B1OA 3OFNG 4EEQA 1KMIZ 5L3DA 2IJJA 4LF9O 1EN5A 4AQYB 4LF5O 3E8GA 4B3TB 3CCMV 3DC6A 1SS3A 1VF6C 3J80N 2WAMA 2ZCEA 1ZSPA 1JVMA 1OCOC 1AI4A 3K5OA 1PP9H 3BFRA 4UB8Z 2KG7B 4GKKB 2GSMB 1Y6XA 2JGDA 2ZDIA 1YI2V 1QR8A 2X0LA 4MVSA 2CK3G 4ICGA 5JVDA 2HR3A 1YJWV 3SPGA 2V1DA 3FB5C 1NKDA 4YXWG 1SESA 1Q6IA 1AJPA 2YXYA 3CMAV 5KAIZ 3ETDA 4X89A 4YJ3B 1IBKB 5DECA 3BVOA 4A5UB 5KMGB 1G1XB 1ROPA 4BIOA 3FAVA 2EBOA 4D7SA 2CAZC 4UVCA 4KP4A 1JX9A 1O9HA 4I50A 1JFFA 3LNMB 1ZWIC 5J2UA 1BSMA 1SQVH 4DR7B 4O2BB 5ITZB 1E1RG 4AHCA 1NR1A 2YIBD 1Q6HA 3T1CA 4R50A 5KHGA 4TUYB 3WFVA 3ZN1A 4KHPO 2BOBC 3I55V 3JD4A 4FZ1A 4GX5A 3OR6C 5KHIA 2BE3A 3CHXA 1K8AW 1GKFA 4MT8A 4DR6B 4NKGB 1IBLO 4BAYA 4JI8B 3EVKA 1URFA 1I5YA 1R3LC 1WA8B 3K0DA 3B8MA 5B5EZ 1ENVA 1JMKC 3JD2A 3D36C 4GLXA 3AG3C 4JYAB 2Q7GA 4P9OA 2ZXWB 5LP6A 1AR1B 4DUYB 4JGSA 3T4ZA 3SJBC 2VQEO 4N23A 4IIJA 5JQGA 5C93A 5LGNA 3UO3A 5L3CA 3CXHF 3S3XA 1H2GA 3ZMSA 2UUAO 1PPJH 4ZI7B 1WB7A 1E79G 3LDCA 4O4JB 5BR8O 1QVGU 1ZUQA 1ZLZA 5L3GA 3JALB 4BR6A 2GBOA 2JRIA 1H2MA 3JAKA 1GN3A 2VS0A 1R3KC 2PI5A 2CUGA 2YXLA 1US6A 1D2DA 4WFBV 1TUEB 2QWPB 3ZX6A 2ZE7A 4QE9A 1NH2B 3JSLA 2GUZB 1L0NH 1S5LZ 4XDKA 4J9ZB 4UVAA 4DR5O 4LFAB 4FIPC 4PA9A 4MW3A 4PA4A 2P5OA 4NXNO 3DSQA 2YXHA 3RYCB 4JYBA 4DV5B 1V9PA 2ZXWC 3E2EA 3UT5B 4OPHA 2EILC 1SQPH 2LO1A 4DR1O 5BZBA 3NR7A 1FD9A 3U0ZA 2RCVA 5JJJB 5FNVB 2UXNA 2KB1A 1R6TA 3APQA 4FPPA 1EN4A 4UCTA 2WLKA 3K04A 1BQ0A 4JI7O 3RYIB 3SPIA 4AILC 4B3RB 3KCXA 2Q6AA 4HYOA 1NU1H 1VQOV 4R7CA 2YC0A 4E2LA 5GW7A 3JSNA 1Q81W 2LW7A 2ZE5A 1YTFB 1JJOA 4PA7A 4LF4B 2ZQMA 3FB7C 2CH7B 2E5LO 4IYIA 4QIWF 5LXTA 4TWKA 1WPXA 3CJHA 4BWAA 3UO2A 2Q4PA 1EN6A 1K97A 4NVPA 2OTJV 2DYRB 2FKXA 1DF4A 2QTOA 2QWRB 3BY6A 1FXVA 1Q90D 1IXMA 2VQFO 1H2KA 3N27A 2EINB 5LHGA 4MVQA 4X9QA 2A06H 3UCSC 3GB7C 4JTAB 2QDOA 2A9HA 2PY5A 1BQZA 5IJ0B 3SPJA 3RT3C 3G6BA 3CYOA 1VQKV 1B3QA 2HP8A 3X2QB 4QPJA 4I5SA 4B08A 5KX5A 2UXDB 3FYEB 3ETQA 3K08A 5IJ9A 5JH7A 4K0KO 2XAQA 1YEWA 5LOVA 3LDDA 4TV9A 3K0GA 3OGIB 2E76B 4E4EA 1J5EB 3AK2A 2JGDB 5LA6A 5B1AB 4LF8B 4PDRA 3OEEG 1BHBA 3B4SA 2QSAA 2YIAA 5JJNB 5JVDB 2PI4A 4CBCA 3H1IH 2EINC 1JR9A 1T5EA 4EKWA 4JI3O 2QGNA 2Y0PA 5CA1B 2K9PA 3FAVB 1XMOO 1K4DC 4JI5O 1S0VA 2ZR3A 3OMIB 2Q68A 4UFZA 4JTDB 3FYIB 5IYZA 1CEZA 4BW5A 4I50B 2QKSA 1JFFB 2HLDG 5J2UB 3GVMA 4JI6O 1FXKC 3X2QC 3SDLA 4G28B 4HBNA 1N4CA 3C3TA 1FKAO 1KECA 1AI6A 4DUZO 1P7BA 3BABA 1NTKH 3UQ8A 4JZGA 4PJ0Z 1HNXO 2L35A 2W0FC 1OCZC 2UUCB 2KG7A 1W59A 5AG2A 4YJ2B 3D36A 3THOA 3ZHTA 2BCCH 2DQ0A 4X8AA 2UUBO 2KSDA 1Q43A 3CPWU 4NTYA 1XMQB 3GWKC 1P7GA 4JI4O 5KHHA 5B1AC 1KBHA 3P3PA 4DV1B 4ZIBA 3ETEA 5LP6B 1S3JA 1SC5B 4IIJB 5JQGB 3W7WA 1OJHA 2P67A 3AG4B 4H37A 2UU9O 2F4VB 5DEDA 3P30A 4UVBA 5ITZA 4MS2A 1JNBA 1AVMA 2LGWA 3ZHQA 3H01A 4X88A 1K73W 1SKVA 1Y74B 3CRQA 2D3OW 4B3MB 4DR2O 4U3FH 1KKDA 2JIZG 4DV6B 3JAKB 2UXCB 1SETA 2XUMA 4WFEA 1N36B 1GN2A 4RQFA 2MK3A 4NB5A 4B3SO 1VQLV 4CS2A 1M4UA 1H8HG 1Y4MA 3H1KH 1FFTB 2UXXA 1DGSA 5D5PA 3VOUA 3OT7A 4XDLA 4G2KA 2HJDA 1G6UA 4FFBA 1WN7A 4PD4F 1F23A 4LF7O 1M57B 4DV0B 2EIMB 3OGCC 5LP6C 1VIBA 1GM7A 3BCCH 4B3MO 2XT9A 3BPZA 1P4RA 5B1NA 3AG4C 3C3SA 1XNQO 1X4TA 4MVMA 1A32A 2KKWA 1VMGA 4UB6Z 4PI2A 3W7XA 4P30A 3QO7A 4JI2O 4I4TA 3A0RA 3CRCA 1AP5A 2F93B 3T2MA 1IX9A 3JASA 4I9QA 3RWRD 2FTKA 2DYSC 2WLJA 1HNWB 2D2CB 3F5WC 2ZM6B 4DR3B 4KUMA 3L71H 2AGAA 3L70H 3K06A 2BOCC 4KXRA 5LXTB 3MDSA 4YY3O 3CJHB 1QQCA 3ABTA 3RFRA 1GAXA 2YIDA 4ZHQA 4UV9A 5KUKA 1FAFA 2N74A 1IVSA 1VQ7V 4FM1A 4ABMA 2JEUA 2ZIOA 3M8AA 1J95A 1IBMO 1YITV 3AK1A 3SGIA 2NR5A 3VQXA 3OD4A 2A3QA 3OTOB 1MABG 2A0LA 4QGPA 2QEXV 4X62O 2FB5A 3CC2V 3L73H 2X6AA 2HG5C 5L3EA 4X1YB 4PDVA 3WB2A 2ZNIA 1HW7A 2CTPA 3B77A 1CP9A 5KX5B 1O9GA 2R72A 3CP1A 2Q73A 4G27B 4LF9B 5EBMC 2CH7A 5IJ9B 4LF5B 5JH7B 1K34A 2IJHA 2QKAA 4NYKA 3M7MX 1S76D 2OIGA 4BIZA 4H44B 3MHSC 5LOVB 2N05A 4TV9B 5DM6V 2BSKA 5IYBO 5H5NA 5LHIA 3RYHA 5LA6B 1AI5A 4LF6O 5KAFZ 3B2EE 2Z5UA 1N32O 4F4LA 2KQXA 1Q3EA 5LYJA 1TVKA 1MG1A 4FM0A 2PF4E 4LH6A 2AXTZ 1JOYA 3J81N 3T1HO 3OMAB 1FXKA 2XAGA 2XNDG 4FLUA 1HNZO 1I08A 1K5QA 5IYZB 1V54B 4JV5B 3BAAA 4HNAA 4TV8A 3K57A 1W0KG 4D7TA 3RVYA 3VBBA 3QF7A 2EZOA 4K8ZA 1QVFU 3G4SV 5IYCO 2OIEA 4J11A 1GH6A 4MTXA 1NH2D 3CWBH 1BT8A 1WP7A 2H8PC 3ABKC 4KHPB 1M93A 3AG3B 2QM7A 1RM1B 2G38A 1THZA 1UFIA 3NXSA 4DO2A 1BS3A 1PNKA 3O9OA 3CCSV 1IBLB 1RSOA 3A0HZ 5F2VO 1AR5A 4DRXA 4U7NA 4JV5O 1PL0A 5CA1A 1KP2A 4MVUA 2RQ6A 4PELA 2UXBO 2YEVA 3ZN0A 2VQEB 3PJSK 3T1YO 1JCHA 1L1FA 2XASA 1NQTA 1TA8A 4QE7A 4JI0O 2ARHA 2UUAB 1V54C 1S72V 4JAAA 4NXMO 5BR8B 2QWQB 4FJCC 3K5LA 4YJ2A 1YTFD 3STLC 1VQ9V 1GMGA 2AW9A 3ZRVA 2P90A 1AILA 1TUBA 2JS5A 4H13B 2HVKC 2VWKA 3TXQA 1YF2A 1K4CC 3WB0A 3H1HH 1RM1C 2Q8VA 2Q7EA 1XQ8A 4DK1A 2EILB 1CPYA 4K35A 2OCCB 4LFBO 4FFBB 2HVJC 4DR5B 5KHJA 4GKJO 4QPKA 1AJNA 1SA0A 4PDMA 4NXNB 1E1QG 3CCLV 4LC1A 4WFFA 3F7YC 4EFEA 1RFYA 2JK5C 5B3SC 5FPOA 4DR1B 1K9MW 1NZ6A 1ZL8B 1Y74A 2DWEC 2XOKG 4FZ0A 1VARA 3VQWA 4I4TB 3MAQA 5H9CA 3JASB 4PA3A 2CTQA 4JI7B 2QKCA 1XL4A 4DR4O 1WNSA 1DLBA 2RDCA 5EC1C 1W2BU 1L8DA 3CEIA 1YJNV 3CRRA 3KCYA 1I5XA 3OR7C 2ITCC 2E5LB 1Q8IA 2F43G 5CA3A 4ZHQB 5KA5A 2Q7HA 4WF9V 2OCCC 2E75B 1XILA 3L72H 1OHHG 4ZKIA 4X64O 1K3EA 3CC7V 1AB3A 2VQFB 1M9NA 1LR1A 2BTOA 3ZRXA 3JARA 5A9GA 4LCUC 3OW2U 4WFHA 2PTMA 4FVMA 1YHQV 2N04A 1D5NA 1HDJA 1H8EG 2QTSA 5LGTA 4JZ2A 1GRJA 3ML0A 4DV4O 2FL4A 3LSQA 4R8CA 3ZMZA 3OUFA 2EJRA 4RWUA 2X7RB 4DV7O 4K0KB 1H38A 2BSKB 4LFCO 4EFBA 3RYHB 3K59A 1B6QA 2PZSA 2WLMA 3ETGA 1FJGO 1U96A 4UCUA 2QWOB 1R1BA 3CCQV 3ZRSA 5LYJB 1TVKB 5H6RA 4X1IB 4OX9O 5B66Z 1JQ0A 5BY1A 2FMLA 1FXKB 3ZCCA 2IH3C 3B40A 4X1YA 1KUQA 4F6RA 4JI3B 4CH6A 4I55A 1XMOB 4HNAB 3OMNB 4JI5B 5JCOA 2DN9A 4TV8B 1NS1A 1OCZB 2EIKB 4GT1A 3I56V 4JI6B 1XUQA 3AK3A 2JJ2G 1Z2GA 3AG2C 2ODMA 3I5DA 1XHZA 2GHYA 3RN4A 1AROP 4DUZB 2ITDC 3IGAC 1LUWA 1HNXB 4DV3O 2W6IG 1SQGA 2HEPA 3SYCA 3KZIZ 1ORQC 3D3QA 1B06A 2UUBB 1WLEA 4UV8A 4FLZA 1RSOB 2WLNA 1IDSA 5FLXN 4PA6A 3UKMA 4JI4B 4DRXB 4JYCA 3UM7A 2IU3A 3K9SA 2YEVB 3U11A 2ZE6A 4L8JA 1EZJA 3SPCA 5CB4A 3EHBB 3K3WA 2UU9B 2Q0AA 1HR0O 2XAHA 2A79B 2EIKC 3QTCA 1V55C 3BRCA 1KQSU 3JCUZ 3TCUA 4PI0A 4KFMA 4MTOA 4DR2B 1TUBB 3FKSG 1QR9A 4P9PA 1HP8A 5EBLC 2ADPA 2DJVA 1BMFG 5EBWC 4B3SB 4BW9A 1KKCA 2HHHO 2DW4A 5FL7G 2OT5A 2IH1C 1P49A 4Q20A 1SA0B 2ATKC 4J7ZA 5EC2C 5K1PA 4LF7B 1MOFA 3DGEA 1WPBA 1NT2B 3E22A 4UCSA 5B1BB 1DK1A 3KDRA 3W7SA 1VQMV 1Q6UA 4PDLA 2ZR2A 1VF5B 4JASA 2QM8A 3WG7C 3ABLB 2ZD9A 1BCCH 2DYSB 2K1EA 4OPAA 3CCJV 1XEQA 1XNQB 2X6BA 3SR2C 3ZS8C 1L0LH 3CRAA 3RYFB 4JI2B 1Q82W 1FYJA 4GX1A 3GWOA 4RUFA 2CGNA 2B1GA 3R65A 2E74B 1I94O 4X66O 3HKBA 2C2AA 4TQDA 1COWG 5EYPA 4WFGA 3LSUA 2JDIG 3BA8A 4UCOA 1QCEA 2EJ7A 4L87A 4JYYA 1ZX3A 1H2SB 4YY3B 3MHHC 2R9RB 1R3JC 4IHJA 3JD0A 3ZEDA 1N33O 2AZ0A 4O4IA 3LNNA 4O4LA 5FPRA 2F95B 3J7AU 3E89A 5KA6A 1ZL8A 1IBMB 4MW8A 3FD9A 2QM4A 3JARB 4LBEC 5B1BC 2Z0AA 1FFXA 3EFFK 4JTCB 4W4KA 3ABLC 3CMEV 4X62B 3HR0A 1K33A 2M7WA 5C8YB 5HFLA 4IT5A 1GN6A 3U10A 5HFMA 2P4VA 3FX7A 3CD6V 1N34O 4X20B 4YHHO 3JATA 3MD0A 3IAYA 5CN0A 3QNEA 2JEXA 4JPRA 2F23A 5L3FA 1P84F 3BA9A 3CXCU 2RN9A 3N2GA 3VQVA 3ZHRA 5GTIZ 2Y4UA 1GM9A 2Q69A 2P06A 2GV9A 4OGQB 1IXBA 5IWAB 3HKDA 2CTRA 3K58A 2CE4A 2P4KA 3HKCA 4LF6B 4DYLA 4DV2O 1Z5VA 1VQ8V 3O65A 3RBZA 1N32B 5E79Z 1QHTA 3VQYA 5LGUA 4CH5A 1OV9A 4AI8A 3P3NA 1SQFA 1LUVA 4F6RB 2Y69B 3E35A 2GTAA 3T1HB 1R3IC 2AHZA 2R9AA 4I55B 5K1XA 2YI8A 1HNZB 3DC5A 3G67A 1JJ2U 2P22C 4ZOLA 3OAAG 3ABKB 3DXRA 2YIBA 2OWOA 4X1KA 3ZRWA 5IWAO 2ETNA 1RPOA 2WLHA 4ZBMA 4X65O 3ASOC 5EK0A 4WBNA 2DOSA 1Q86W 2HJFC 1W0JG 4K3AA 2YI9A 1XREA 2V4DA 4GX0A 3RGBA 2OCHA 1NJIW 4LR3A 5H6QA 3SYPA 4X1IA 1WJZA 1KU9A 5IT9N 3ABMC 3CC4V 4GZRB 2WA3A 1EZVH 3SJCC 3RW0A 1GO3F 1F51A 2GTSA 5CBHA 2UXBB 2IJKA 1EM1A 5CBFA 3ASNB 3H9VA 5CB4B 5IY5B 2Y69C 4CS3A 3G80A 5GONB 3T1YB 1FPOA 5LMNO 5JCOC 4LNUA 2ADQB 2ZE8A 4R6ZA 4JI0B 3IC7A 5CMUA 1R73A 2ZT9B 1M1KW 4NXMB 5JJEB 3HB3B 1DTOA 4CH4A 1IJGA 4O4HA 4IYHA 2X6CA 1YJ9V 2OTLV 1M90W 3QO8A 2W0XA 1QLNA 1XDCA 5J2TA 2NN4A 4CZZA 1KP3A 2DQ3A 2AZ2A 1QBZA 2LGQA 1K5SA 3M99B 2BTQA 3E8HA 2EULA 3RVZA 5B3SB 1F4MA 1NVPB 3D8CA 1GTOA 1Q7YW 1XNRO 4LFBB 3B8NA 2WSSG 2B1IA 3EXAA 4GKJB 5J9PC 3E22B 1H2LA 2LP7A 4JAVA 2CGOA 3A8TA 3D3IA 5DN6G 4AQYO 1KD1W 4B3TO 4RUEA 3KG2A 2EZPA 3ASNC 5IY5C 4EB6B 2EIJC 4UUJC 3APOA 5IYDO 4I9WA 4DW0A 2CDYA 2F66C 5D5QA 1SQBH 2E3CA 4GKKO 3WB1A 2ZKOA 3HKBB 1NBMG 5EYPB 3E8FA 1YZBA 4B7EA 4I0XA 1H5WA 4DR4B 1KB9F 2XHBA 1IBKO 3L9DA 2WPDG 4GYCB 3ZBHA 4IHJB 5EIBC 3JCZA 2YICA 1R6NA 1GN4A 4O4LB 4O4IB 1TGOA 3JAWA 2HFEC 4DK0A 2M6YA 2IU0A 4FLXA 1CXZB 1PKXA 4Q6GA 1PNMA 3ZHVA 4DR7O 4MVOA 3T4DA 1MA1A 4X64B 1Y67A 3B09A 4F6EA 1FFXB 3OE7G 5KHKA 1SERA 3RYFA 3ZHSA 1EBOA 3FFQA 1BE3H 1QLEB 2R70A 5CA0A 4DR6O 3QO5A 1IURA 5BMVA 3ICXA 3JATB 1M56B 4D6TH 1BZKA 2QA4V 4JI8O 2NNUA 2QWNB 4DV4B 2H3OA 1RP3B 4JYAO 3N2GB 3Q4HA 4JAUA 3K03A 2P7TC 1FOUA 4DV7B 1Z5WA 4DUYO 2LQTA 3WU2Z 1NTMH 4FK5C 3HKDB 1U97A 4OXSA 1BGYH 1N0JA 4LFCB 1D5AA 5JWPA 2EX3A 4FLVA 4RQEA 3HKCB 2WLLA 2WA4A 3TXSA 1VF7A 3K9AA 1FJGB 2YUAA 2LFRA 2R9IA 5KLVH 2YSUB 4J7JA 3L74H 1WB8A 3AG7A 4OX9B 4HAMA 3P32A 4FLWA 1AI7A 2IM9A 3AG2B 2Q5ZA 5C8YA 4ASUG 3A2FA 2AHYA 4X20A 1OZ0A 4ZOLB 1QLEC 3DXRB 4O2AA 5H2FZ
chains in the Genus database with same CATH topology
1VARA 1GN6A 3AK1A 1BSMA 1QNMA 1KKCA 1VEWA 1EM1A 4E4EA 1BS3A 3AK2A 2QKCA 1GN4A 4YIPA 2RCVA 1AR5A 2ADQB 3KKYA 1MNGA 3CEIA 1GN2A 1EN4A 1XUQA 3AK3A 4YIOA 1IXBA 2GDSA 1MA1A 1JR9A 3KDRA 1Y67A 4C7UA 4F6EA 1N0NA 3EVKA 2CE4A 3RN4A 2P4KA 3OT7A 2QKAA 1PL4A 1XILA 1LUWA 1XDCA 4GUNA 1PM9A 1B06A 1LUVA 1MSDA 5A9GA 1EN5A 3C3TA 1AP6A 1IDSA 1EN6A 3DC6A 2AW9A 3DC5A 3C3SA 4JZGA 1D5NA 3LSUA 5AG2A 1WB7A 1ZSPA 4X9QA 3K9SA 4JZ2A 4JYYA 1I0HA 3BFRA 1AP5A 1N0JA 1ZLZA 1ZUQA 1IX9A 4BR6A 1P7GA 1I08A 1SZXA 1GN3A 3QVNA 3TJTA 2CDYA 1MMMA 1WB8A 1XREA 3MDSA 1ZTEA 4FFKA 3IC9A 1AR4A 1JA8A 1BT8A 1AVMA 2ADPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAR A;  1GN6 A;  3AK1 A;  1BSM A;  1QNM A;  1KKC A;  1VEW A;  1EM1 A;  4E4E A;  1BS3 A;  3AK2 A;  2QKC A;  1GN4 A;  4YIP A;  2RCV A;  1AR5 A;  2ADQ B;  3KKY A;  1MNG A;  3CEI A;  1GN2 A;  1EN4 A;  1XUQ A;  3AK3 A;  4YIO A;  1IXB A;  2GDS A;  1MA1 A;  1JR9 A;  1Y67 A;  4C7U A;  4F6E A;  1N0N A;  3EVK A;  2CE4 A;  3RN4 A;  2P4K A;  3OT7 A;  2QKA A;  1PL4 A;  1XIL A;  1LUW A;  1XDC A;  4GUN A;  1PM9 A;  1B06 A;  1LUV A;  1MSD A;  5A9G A;  1EN5 A;  3C3T A;  1AP6 A;  1IDS A;  1EN6 A;  3DC6 A;  2AW9 A;  3DC5 A;  3C3S A;  4JZG A;  1D5N A;  3LSU A;  5AG2 A;  1WB7 A;  1ZSP A;  4X9Q A;  3K9S A;  4JZ2 A;  4JYY A;  1I0H A;  3BFR A;  1AP5 A;  1N0J A;  1ZLZ A;  1ZUQ A;  1IX9 A;  4BR6 A;  1P7G A;  1I08 A;  1SZX A;  1GN3 A;  3QVN A;  3TJT A;  2CDY A;  1MMM A;  1WB8 A;  1XRE A;  3MDS A;  1ZTE A;  4FFK A;  3IC9 A;  1AR4 A;  1JA8 A;  1BT8 A;  1AVM A;  2ADP A; 
#chains in the Genus database with same CATH topology
 4X1K B;  2O57 A;  3ZRW B;  3K5N A;  1XOU A;  1X59 A;  4J80 A;  1M56 C;  2JVD A;  3CCE V;  3CRM A;  4J7K A;  3JYC A;  4LFA O;  1N8R W;  3H1L H;  4WBN B;  1M5I A;  4N21 A;  4DV5 O;  4DV3 B;  3SYA A;  3JAM N;  3L75 H;  3AEI A;  2GDS A;  2Q0O C;  1BHA A;  2YDE A;  4CC6 A;  4CH3 A;  1Y76 A;  1N0N A;  3A0B Z;  1SZT A;  4FLY A;  4W4L A;  4IL6 Z;  5LHH A;  4JF3 A;  2ZNJ A;  4GUN A;  2IBZ H;  4B7K A;  1KC8 W;  3S3W A;  3H1J H;  3N2K A;  3TK1 A;  4B3R O;  1V55 B;  1DF5 A;  5BXZ A;  2OYQ A;  4U3J A;  4MSW C;  3E86 A;  2ZIM A;  4LNU B;  1VF6 A;  2HKO A;  2XAJ A;  1HWY A;  4LF4 O;  1HR0 B;  2A7W A;  1XI1 A;  2L6L A;  3OEH G;  4WCE V;  4Z1V A;  1I0H A;  2F1M A;  4CS4 A;  5CBG A;  4O4H B;  3JD3 A;  2IJI A;  2QE7 G;  4LP8 A;  1SZX A;  1ZAU A;  5EZY A;  4TSF G;  2XTA A;  3HKE A;  5J2T B;  4K8X A;  1MMM A;  4LWS A;  2QR4 A;  2BTQ B;  3ABU A;  4WFA V;  4FFK A;  1WP8 A;  3CCR V;  3ZMT A;  2DYR C;  3E83 A;  2WLI A;  2HHH B;  4UCR A;  3ZMU A;  4KL1 A;  3WG7 B;  1F4N A;  1I7F A;  1JA8 A;  3K5M A;  3HPL C;  2VWJ A;  1B04 A;  2LW1 A;  1SF9 A;  1G8M A;  1QNM A;  5GON A;  1MSW D;  1KYO F;  3E8B A;  4FMT A;  1PV0 A;  4TQF A;  3OM3 B;  1VEW A;  2UXD O;  1Y66 A;  2QJ1 A;  4I7Z B;  3SYQ A;  1YCI A;  3K79 A;  1S5H C;  2Y48 A;  2YS8 A;  3CE2 A;  5L3B A;  1GK9 A;  3F5T A;  2JJ1 G;  3TET A;  4YIO A;  4JI1 B;  4MVR A;  1J5E O;  1UPG A;  4LF8 O;  3BHP A;  2PYJ A;  4C7U A;  4Z1M G;  3G71 V;  5A2Q N;  1IZ3 A;  4I0X B;  1I94 B;  3LDE A;  4X66 B;  3CB2 A;  1FXH A;  2JGU A;  2P6J A;  1EFR G;  3SJA C;  1PNL A;  1PD3 A;  4XDJ A;  1SRY A;  1YVW A;  3W7U A;  2ZDI C;  4YJ3 A;  1R6K A;  3JAW B;  5KMG A;  3FB8 C;  4PV1 B;  3OTF A;  1OCC B;  3LUT B;  1N33 B;  5KUM A;  4FLT A;  1JPX A;  1VP7 A;  1VQ5 V;  4J41 A;  3AG1 B;  1S77 D;  4EB6 A;  2NLJ C;  2PYL A;  1WAZ A;  1G4Y B;  4JI1 O;  1SQX H;  1UJW B;  4O2B A;  2PUS A;  2UUC O;  2RNB A;  4TUY A;  1YDX A;  5CA0 B;  3CCV V;  5BMV B;  3CX5 F;  4NTX A;  3FB6 C;  1XMQ O;  1MZE A;  2H94 A;  3CSX A;  1XHX A;  3R66 A;  1N34 B;  4YHH B;  3IC9 A;  2IW5 A;  3Q4H B;  5LBQ A;  4CC5 A;  1AR4 A;  4GCZ A;  4DV1 O;  1WA8 A;  4PHZ A;  1VQ4 V;  4BIU A;  3STZ C;  1TAE A;  2W6J G;  1H2N A;  2B5U A;  4QJF B;  5GTH Z;  2RJZ A;  2DMX A;  3QG5 A;  4LH7 A;  4NR1 A;  2WLL B;  1FS0 G;  3ZHU A;  2F4V O;  1YXB A;  2VRZ A;  4YIP A;  1OCR B;  2Q9L A;  3SYO A;  4XBF A;  1LNQ A;  4J9Y B;  4UXN A;  5IDJ A;  1OCC C;  1MNG A;  4DV2 B;  3C90 A;  1YSC A;  3CS5 A;  4ZI7 A;  2WWW A;  3DTU B;  1NTZ H;  3IFX A;  3AG1 C;  4O4J A;  4DV6 O;  2MW2 B;  5LMU B;  4UCV A;  3ZJZ A;  3JAL A;  2UXC O;  2FYU H;  4H33 A;  3BEH A;  1N36 O;  3OUS A;  3ASO B;  4O2A B;  1NR7 A;  1GM8 A;  4MTF A;  4H0L B;  4MTG A;  1VQ6 V;  1PM9 A;  5TIS Z;  4TT3 G;  4TOI A;  2PGG A;  2Z3Y A;  1VQN V;  1MSD A;  1RPR A;  1AP6 A;  4GX2 A;  3CCU V;  3ZIA G;  2GUZ A;  1SQQ H;  2XAF A;  2ZIN A;  2Y0I A;  2ILM A;  3ABM B;  3JD1 A;  3ZMV A;  4X65 B;  5EIB D;  4DV0 O;  3LSS A;  4QNH B;  2V7Q G;  3RYC A;  1NVP D;  4MVZ A;  2JS3 A;  1K7D A;  1Y76 B;  2Q67 A;  3UT5 A;  1VQP V;  5LMU O;  3SPH A;  4DW1 A;  3QVN A;  1NI8 A;  1OCR C;  1M57 C;  3TJT A;  2EIM C;  5FNV A;  3N2K B;  3SJQ C;  1ZTE A;  4DXW A;  4FM2 A;  1QU7 A;  5IE9 A;  2CTW A;  3RYI A;  4U3J B;  1Q5O A;  4U7O A;  1HNW O;  2ZM6 O;  4DR3 O;  3W7T A;  4P2Z A;  4Z2W A;  3IJ4 A;  3G6E V;  5LMN B;  1OCO B;  5E1A C;  2DWD C;  1YIJ V;  5EZY B;  2LFS A;  1AJQ A;  3HKE B;  3TGU H;  1XBL A;  2B9Z A;  4HZ3 A;  4RO2 A;  3KKY A;  4LWS B;  4RAI A;  1XL6 A;  3PN1 A;  4NTW A;  3F7V C;  4J10 A;  2RMK B;  1F7Y A;  1S5J A;  2WLI B;  4J42 A;  2LJ2 A;  5LL6 Y;  3OTO O;  2Y4T A;  1K92 A;  1MZF A;  5IJ0 A;  1BL8 A;  1PL4 A;  2DE0 X;  1XNR B;  2EIJ B;  4IGG A;  5B1O A;  3OFN G;  4EEQ A;  1KMI Z;  5L3D A;  2IJJ A;  4LF9 O;  1EN5 A;  4AQY B;  4LF5 O;  3E8G A;  4B3T B;  3CCM V;  3DC6 A;  1SS3 A;  1VF6 C;  3J80 N;  2WAM A;  2ZCE A;  1ZSP A;  1JVM A;  1OCO C;  1AI4 A;  3K5O A;  1PP9 H;  3BFR A;  4UB8 Z;  2KG7 B;  4GKK B;  2GSM B;  1Y6X A;  2JGD A;  2ZDI A;  1YI2 V;  1QR8 A;  2X0L A;  4MVS A;  2CK3 G;  4ICG A;  5JVD A;  2HR3 A;  1YJW V;  3SPG A;  2V1D A;  3FB5 C;  1NKD A;  4YXW G;  1SES A;  1Q6I A;  1AJP A;  2YXY A;  3CMA V;  5KAI Z;  3ETD A;  4X89 A;  4YJ3 B;  1IBK B;  5DEC A;  3BVO A;  4A5U B;  5KMG B;  1G1X B;  1ROP A;  4BIO A;  3FAV A;  2EBO A;  4D7S A;  2CAZ C;  4UVC A;  4KP4 A;  1JX9 A;  1O9H A;  4I50 A;  1JFF A;  3LNM B;  1ZWI C;  5J2U A;  1BSM A;  1SQV H;  4DR7 B;  4O2B B;  5ITZ B;  1E1R G;  4AHC A;  1NR1 A;  2YIB D;  1Q6H A;  3T1C A;  4R50 A;  5KHG A;  4TUY B;  3WFV A;  3ZN1 A;  4KHP O;  2BOB C;  3I55 V;  3JD4 A;  4FZ1 A;  4GX5 A;  3OR6 C;  5KHI A;  2BE3 A;  3CHX A;  1K8A W;  1GKF A;  4MT8 A;  4DR6 B;  4NKG B;  1IBL O;  4BAY A;  4JI8 B;  3EVK A;  1URF A;  1I5Y A;  1R3L C;  1WA8 B;  3K0D A;  3B8M A;  5B5E Z;  1ENV A;  1JMK C;  3JD2 A;  3D36 C;  4GLX A;  3AG3 C;  4JYA B;  2Q7G A;  4P9O A;  2ZXW B;  5LP6 A;  1AR1 B;  4DUY B;  4JGS A;  3T4Z A;  3SJB C;  2VQE O;  4N23 A;  4IIJ A;  5JQG A;  5C93 A;  5LGN A;  3UO3 A;  5L3C A;  3CXH F;  3S3X A;  1H2G A;  3ZMS A;  2UUA O;  1PPJ H;  4ZI7 B;  1WB7 A;  1E79 G;  3LDC A;  4O4J B;  5BR8 O;  1QVG U;  1ZUQ A;  1ZLZ A;  5L3G A;  3JAL B;  4BR6 A;  2GBO A;  2JRI A;  1H2M A;  3JAK A;  1GN3 A;  2VS0 A;  1R3K C;  2PI5 A;  2CUG A;  2YXL A;  1US6 A;  1D2D A;  4WFB V;  1TUE B;  2QWP B;  3ZX6 A;  2ZE7 A;  4QE9 A;  1NH2 B;  3JSL A;  2GUZ B;  1L0N H;  1S5L Z;  4XDK A;  4J9Z B;  4UVA A;  4DR5 O;  4LFA B;  4FIP C;  4PA9 A;  4MW3 A;  4PA4 A;  2P5O A;  4NXN O;  3DSQ A;  2YXH A;  3RYC B;  4JYB A;  4DV5 B;  1V9P A;  2ZXW C;  3E2E A;  3UT5 B;  4OPH A;  2EIL C;  1SQP H;  2LO1 A;  4DR1 O;  5BZB A;  3NR7 A;  1FD9 A;  3U0Z A;  2RCV A;  5JJJ B;  5FNV B;  2UXN A;  2KB1 A;  1R6T A;  3APQ A;  4FPP A;  1EN4 A;  4UCT A;  2WLK A;  3K04 A;  1BQ0 A;  4JI7 O;  3RYI B;  3SPI A;  4AIL C;  4B3R B;  3KCX A;  2Q6A A;  4HYO A;  1NU1 H;  1VQO V;  4R7C A;  2YC0 A;  4E2L A;  5GW7 A;  3JSN A;  1Q81 W;  2LW7 A;  2ZE5 A;  1YTF B;  1JJO A;  4PA7 A;  4LF4 B;  2ZQM A;  3FB7 C;  2CH7 B;  2E5L O;  4IYI A;  4QIW F;  5LXT A;  4TWK A;  1WPX A;  3CJH A;  4BWA A;  3UO2 A;  2Q4P A;  1EN6 A;  1K97 A;  4NVP A;  2OTJ V;  2DYR B;  2FKX A;  1DF4 A;  2QTO A;  2QWR B;  3BY6 A;  1FXV A;  1Q90 D;  1IXM A;  2VQF O;  1H2K A;  3N27 A;  2EIN B;  5LHG A;  4MVQ A;  4X9Q A;  2A06 H;  3UCS C;  3GB7 C;  4JTA B;  2QDO A;  2A9H A;  2PY5 A;  1BQZ A;  5IJ0 B;  3SPJ A;  3RT3 C;  3G6B A;  3CYO A;  1VQK V;  1B3Q A;  2HP8 A;  3X2Q B;  4QPJ A;  4I5S A;  4B08 A;  5KX5 A;  2UXD B;  3FYE B;  3ETQ A;  3K08 A;  5IJ9 A;  5JH7 A;  4K0K O;  2XAQ A;  1YEW A;  5LOV A;  3LDD A;  4TV9 A;  3K0G A;  3OGI B;  2E76 B;  4E4E A;  1J5E B;  3AK2 A;  2JGD B;  5LA6 A;  5B1A B;  4LF8 B;  4PDR A;  3OEE G;  1BHB A;  3B4S A;  2QSA A;  2YIA A;  5JJN B;  5JVD B;  2PI4 A;  4CBC A;  3H1I H;  2EIN C;  1JR9 A;  1T5E A;  4EKW A;  4JI3 O;  2QGN A;  2Y0P A;  5CA1 B;  2K9P A;  3FAV B;  1XMO O;  1K4D C;  4JI5 O;  1S0V A;  2ZR3 A;  3OMI B;  2Q68 A;  4UFZ A;  4JTD B;  3FYI B;  5IYZ A;  1CEZ A;  4BW5 A;  4I50 B;  2QKS A;  1JFF B;  2HLD G;  5J2U B;  3GVM A;  4JI6 O;  1FXK C;  3X2Q C;  3SDL A;  4G28 B;  4HBN A;  1N4C A;  3C3T A;  1FKA O;  1KEC A;  1AI6 A;  4DUZ O;  1P7B A;  3BAB A;  1NTK H;  3UQ8 A;  4JZG A;  4PJ0 Z;  1HNX O;  2L35 A;  2W0F C;  1OCZ C;  2UUC B;  2KG7 A;  1W59 A;  5AG2 A;  4YJ2 B;  3D36 A;  3THO A;  3ZHT A;  2BCC H;  2DQ0 A;  4X8A A;  2UUB O;  2KSD A;  1Q43 A;  3CPW U;  4NTY A;  1XMQ B;  3GWK C;  1P7G A;  4JI4 O;  5KHH A;  5B1A C;  1KBH A;  3P3P A;  4DV1 B;  4ZIB A;  3ETE A;  5LP6 B;  1S3J A;  1SC5 B;  4IIJ B;  5JQG B;  3W7W A;  1OJH A;  2P67 A;  3AG4 B;  4H37 A;  2UU9 O;  2F4V B;  5DED A;  3P30 A;  4UVB A;  5ITZ A;  4MS2 A;  1JNB A;  1AVM A;  2LGW A;  3ZHQ A;  3H01 A;  4X88 A;  1K73 W;  1SKV A;  1Y74 B;  3CRQ A;  2D3O W;  4B3M B;  4DR2 O;  4U3F H;  1KKD A;  2JIZ G;  4DV6 B;  3JAK B;  2UXC B;  1SET A;  2XUM A;  4WFE A;  1N36 B;  1GN2 A;  4RQF A;  2MK3 A;  4NB5 A;  4B3S O;  1VQL V;  4CS2 A;  1M4U A;  1H8H G;  1Y4M A;  3H1K H;  1FFT B;  2UXX A;  1DGS A;  5D5P A;  3VOU A;  3OT7 A;  4XDL A;  4G2K A;  2HJD A;  1G6U A;  4FFB A;  1WN7 A;  4PD4 F;  1F23 A;  4LF7 O;  1M57 B;  4DV0 B;  2EIM B;  3OGC C;  5LP6 C;  1VIB A;  1GM7 A;  3BCC H;  4B3M O;  2XT9 A;  3BPZ A;  1P4R A;  5B1N A;  3AG4 C;  3C3S A;  1XNQ O;  1X4T A;  4MVM A;  1A32 A;  2KKW A;  1VMG A;  4UB6 Z;  4PI2 A;  3W7X A;  4P30 A;  3QO7 A;  4JI2 O;  4I4T A;  3A0R A;  3CRC A;  1AP5 A;  2F93 B;  3T2M A;  1IX9 A;  3JAS A;  4I9Q A;  3RWR D;  2FTK A;  2DYS C;  2WLJ A;  1HNW B;  2D2C B;  3F5W C;  2ZM6 B;  4DR3 B;  4KUM A;  3L71 H;  2AGA A;  3L70 H;  3K06 A;  2BOC C;  4KXR A;  5LXT B;  3MDS A;  4YY3 O;  3CJH B;  1QQC A;  3ABT A;  3RFR A;  1GAX A;  2YID A;  4ZHQ A;  4UV9 A;  5KUK A;  1FAF A;  2N74 A;  1IVS A;  1VQ7 V;  4FM1 A;  4ABM A;  2JEU A;  2ZIO A;  3M8A A;  1J95 A;  1IBM O;  1YIT V;  3AK1 A;  3SGI A;  2NR5 A;  3VQX A;  3OD4 A;  2A3Q A;  3OTO B;  1MAB G;  2A0L A;  4QGP A;  2QEX V;  4X62 O;  2FB5 A;  3CC2 V;  3L73 H;  2X6A A;  2HG5 C;  5L3E A;  4X1Y B;  4PDV A;  3WB2 A;  2ZNI A;  1HW7 A;  2CTP A;  3B77 A;  1CP9 A;  5KX5 B;  1O9G A;  2R72 A;  3CP1 A;  2Q73 A;  4G27 B;  4LF9 B;  5EBM C;  2CH7 A;  5IJ9 B;  4LF5 B;  5JH7 B;  1K34 A;  2IJH A;  2QKA A;  4NYK A;  3M7M X;  1S76 D;  2OIG A;  4BIZ A;  4H44 B;  3MHS C;  5LOV B;  2N05 A;  4TV9 B;  5DM6 V;  2BSK A;  5IYB O;  5H5N A;  5LHI A;  3RYH A;  5LA6 B;  1AI5 A;  4LF6 O;  5KAF Z;  3B2E E;  2Z5U A;  1N32 O;  4F4L A;  2KQX A;  1Q3E A;  5LYJ A;  1TVK A;  1MG1 A;  4FM0 A;  2PF4 E;  4LH6 A;  2AXT Z;  1JOY A;  3J81 N;  3T1H O;  3OMA B;  1FXK A;  2XAG A;  2XND G;  4FLU A;  1HNZ O;  1I08 A;  1K5Q A;  5IYZ B;  1V54 B;  4JV5 B;  3BAA A;  4HNA A;  4TV8 A;  3K57 A;  1W0K G;  4D7T A;  3RVY A;  3VBB A;  3QF7 A;  2EZO A;  4K8Z A;  1QVF U;  3G4S V;  5IYC O;  2OIE A;  4J11 A;  1GH6 A;  4MTX A;  1NH2 D;  3CWB H;  1BT8 A;  1WP7 A;  2H8P C;  3ABK C;  4KHP B;  1M93 A;  3AG3 B;  2QM7 A;  1RM1 B;  2G38 A;  1THZ A;  1UFI A;  3NXS A;  4DO2 A;  1BS3 A;  1PNK A;  3O9O A;  3CCS V;  1IBL B;  1RSO A;  3A0H Z;  5F2V O;  1AR5 A;  4DRX A;  4U7N A;  4JV5 O;  1PL0 A;  5CA1 A;  1KP2 A;  4MVU A;  2RQ6 A;  4PEL A;  2UXB O;  2YEV A;  3ZN0 A;  2VQE B;  3PJS K;  3T1Y O;  1JCH A;  1L1F A;  2XAS A;  1NQT A;  1TA8 A;  4QE7 A;  4JI0 O;  2ARH A;  2UUA B;  1V54 C;  1S72 V;  4JAA A;  4NXM O;  5BR8 B;  2QWQ B;  4FJC C;  3K5L A;  4YJ2 A;  1YTF D;  3STL C;  1VQ9 V;  1GMG A;  2AW9 A;  3ZRV A;  2P90 A;  1AIL A;  1TUB A;  2JS5 A;  4H13 B;  2HVK C;  2VWK A;  3TXQ A;  1YF2 A;  1K4C C;  3WB0 A;  3H1H H;  1RM1 C;  2Q8V A;  2Q7E A;  1XQ8 A;  4DK1 A;  2EIL B;  1CPY A;  4K35 A;  2OCC B;  4LFB O;  4FFB B;  2HVJ C;  4DR5 B;  5KHJ A;  4GKJ O;  4QPK A;  1AJN A;  1SA0 A;  4PDM A;  4NXN B;  1E1Q G;  3CCL V;  4LC1 A;  4WFF A;  3F7Y C;  4EFE A;  1RFY A;  2JK5 C;  5B3S C;  5FPO A;  4DR1 B;  1K9M W;  1NZ6 A;  1ZL8 B;  1Y74 A;  2DWE C;  2XOK G;  4FZ0 A;  1VAR A;  3VQW A;  4I4T B;  3MAQ A;  5H9C A;  3JAS B;  4PA3 A;  2CTQ A;  4JI7 B;  2QKC A;  1XL4 A;  4DR4 O;  1WNS A;  1DLB A;  2RDC A;  5EC1 C;  1W2B U;  1L8D A;  3CEI A;  1YJN V;  3CRR A;  3KCY A;  1I5X A;  3OR7 C;  2ITC C;  2E5L B;  1Q8I A;  2F43 G;  5CA3 A;  4ZHQ B;  5KA5 A;  2Q7H A;  4WF9 V;  2OCC C;  2E75 B;  1XIL A;  3L72 H;  1OHH G;  4ZKI A;  4X64 O;  1K3E A;  3CC7 V;  1AB3 A;  2VQF B;  1M9N A;  1LR1 A;  2BTO A;  3ZRX A;  3JAR A;  5A9G A;  4LCU C;  3OW2 U;  4WFH A;  2PTM A;  4FVM A;  1YHQ V;  2N04 A;  1D5N A;  1HDJ A;  1H8E G;  2QTS A;  5LGT A;  4JZ2 A;  1GRJ A;  3ML0 A;  4DV4 O;  2FL4 A;  3LSQ A;  4R8C A;  3ZMZ A;  3OUF A;  2EJR A;  4RWU A;  2X7R B;  4DV7 O;  4K0K B;  1H38 A;  2BSK B;  4LFC O;  4EFB A;  3RYH B;  3K59 A;  1B6Q A;  2PZS A;  2WLM A;  3ETG A;  1FJG O;  1U96 A;  4UCU A;  2QWO B;  1R1B A;  3CCQ V;  3ZRS A;  5LYJ B;  1TVK B;  5H6R A;  4X1I B;  4OX9 O;  5B66 Z;  1JQ0 A;  5BY1 A;  2FML A;  1FXK B;  3ZCC A;  2IH3 C;  3B40 A;  4X1Y A;  1KUQ A;  4F6R A;  4JI3 B;  4CH6 A;  4I55 A;  1XMO B;  4HNA B;  3OMN B;  4JI5 B;  5JCO A;  2DN9 A;  4TV8 B;  1NS1 A;  1OCZ B;  2EIK B;  4GT1 A;  3I56 V;  4JI6 B;  1XUQ A;  3AK3 A;  2JJ2 G;  1Z2G A;  3AG2 C;  2ODM A;  3I5D A;  1XHZ A;  2GHY A;  3RN4 A;  1ARO P;  4DUZ B;  2ITD C;  3IGA C;  1LUW A;  1HNX B;  4DV3 O;  2W6I G;  1SQG A;  2HEP A;  3SYC A;  3KZI Z;  1ORQ C;  3D3Q A;  1B06 A;  2UUB B;  1WLE A;  4UV8 A;  4FLZ A;  1RSO B;  2WLN A;  1IDS A;  5FLX N;  4PA6 A;  3UKM A;  4JI4 B;  4DRX B;  4JYC A;  3UM7 A;  2IU3 A;  3K9S A;  2YEV B;  3U11 A;  2ZE6 A;  4L8J A;  1EZJ A;  3SPC A;  5CB4 A;  3EHB B;  3K3W A;  2UU9 B;  2Q0A A;  1HR0 O;  2XAH A;  2A79 B;  2EIK C;  3QTC A;  1V55 C;  3BRC A;  1KQS U;  3JCU Z;  3TCU A;  4PI0 A;  4KFM A;  4MTO A;  4DR2 B;  1TUB B;  3FKS G;  1QR9 A;  4P9P A;  1HP8 A;  5EBL C;  2ADP A;  2DJV A;  1BMF G;  5EBW C;  4B3S B;  4BW9 A;  1KKC A;  2HHH O;  2DW4 A;  5FL7 G;  2OT5 A;  2IH1 C;  1P49 A;  4Q20 A;  1SA0 B;  2ATK C;  4J7Z A;  5EC2 C;  5K1P A;  4LF7 B;  1MOF A;  3DGE A;  1WPB A;  1NT2 B;  3E22 A;  4UCS A;  5B1B B;  1DK1 A;  3KDR A;  3W7S A;  1VQM V;  1Q6U A;  4PDL A;  2ZR2 A;  1VF5 B;  4JAS A;  2QM8 A;  3WG7 C;  3ABL B;  2ZD9 A;  1BCC H;  2DYS B;  2K1E A;  4OPA A;  3CCJ V;  1XEQ A;  1XNQ B;  2X6B A;  3SR2 C;  3ZS8 C;  1L0L H;  3CRA A;  3RYF B;  4JI2 B;  1Q82 W;  1FYJ A;  4GX1 A;  3GWO A;  4RUF A;  2CGN A;  2B1G A;  3R65 A;  2E74 B;  1I94 O;  4X66 O;  3HKB A;  2C2A A;  4TQD A;  1COW G;  5EYP A;  4WFG A;  3LSU A;  2JDI G;  3BA8 A;  4UCO A;  1QCE A;  2EJ7 A;  4L87 A;  4JYY A;  1ZX3 A;  1H2S B;  4YY3 B;  3MHH C;  2R9R B;  1R3J C;  4IHJ A;  3JD0 A;  3ZED A;  1N33 O;  2AZ0 A;  4O4I A;  3LNN A;  4O4L A;  5FPR A;  2F95 B;  3J7A U;  3E89 A;  5KA6 A;  1ZL8 A;  1IBM B;  4MW8 A;  3FD9 A;  2QM4 A;  3JAR B;  4LBE C;  5B1B C;  2Z0A A;  1FFX A;  3EFF K;  4JTC B;  4W4K A;  3ABL C;  3CME V;  4X62 B;  3HR0 A;  1K33 A;  2M7W A;  5C8Y B;  5HFL A;  4IT5 A;  1GN6 A;  3U10 A;  5HFM A;  2P4V A;  3FX7 A;  3CD6 V;  1N34 O;  4X20 B;  4YHH O;  3JAT A;  3MD0 A;  3IAY A;  5CN0 A;  3QNE A;  2JEX A;  4JPR A;  2F23 A;  5L3F A;  1P84 F;  3BA9 A;  3CXC U;  2RN9 A;  3N2G A;  3VQV A;  3ZHR A;  5GTI Z;  2Y4U A;  1GM9 A;  2Q69 A;  2P06 A;  2GV9 A;  4OGQ B;  1IXB A;  5IWA B;  3HKD A;  2CTR A;  3K58 A;  2CE4 A;  2P4K A;  3HKC A;  4LF6 B;  4DYL A;  4DV2 O;  1Z5V A;  1VQ8 V;  3O65 A;  3RBZ A;  1N32 B;  5E79 Z;  1QHT A;  3VQY A;  5LGU A;  4CH5 A;  1OV9 A;  4AI8 A;  3P3N A;  1SQF A;  1LUV A;  4F6R B;  2Y69 B;  3E35 A;  2GTA A;  3T1H B;  1R3I C;  2AHZ A;  2R9A A;  4I55 B;  5K1X A;  2YI8 A;  1HNZ B;  3DC5 A;  3G67 A;  1JJ2 U;  2P22 C;  4ZOL A;  3OAA G;  3ABK B;  3DXR A;  2YIB A;  2OWO A;  4X1K A;  3ZRW A;  5IWA O;  2ETN A;  1RPO A;  2WLH A;  4ZBM A;  4X65 O;  3ASO C;  5EK0 A;  4WBN A;  2DOS A;  1Q86 W;  2HJF C;  1W0J G;  4K3A A;  2YI9 A;  1XRE A;  2V4D A;  4GX0 A;  3RGB A;  2OCH A;  1NJI W;  4LR3 A;  5H6Q A;  3SYP A;  4X1I A;  1WJZ A;  1KU9 A;  5IT9 N;  3ABM C;  3CC4 V;  4GZR B;  2WA3 A;  1EZV H;  3SJC C;  3RW0 A;  1GO3 F;  1F51 A;  2GTS A;  5CBH A;  2UXB B;  2IJK A;  1EM1 A;  5CBF A;  3ASN B;  3H9V A;  5CB4 B;  5IY5 B;  2Y69 C;  4CS3 A;  3G80 A;  5GON B;  3T1Y B;  1FPO A;  5LMN O;  5JCO C;  4LNU A;  2ADQ B;  2ZE8 A;  4R6Z A;  4JI0 B;  3IC7 A;  5CMU A;  1R73 A;  2ZT9 B;  1M1K W;  4NXM B;  5JJE B;  3HB3 B;  1DTO A;  4CH4 A;  1IJG A;  4O4H A;  4IYH A;  2X6C A;  1YJ9 V;  2OTL V;  1M90 W;  3QO8 A;  2W0X A;  1QLN A;  1XDC A;  5J2T A;  2NN4 A;  4CZZ A;  1KP3 A;  2DQ3 A;  2AZ2 A;  1QBZ A;  2LGQ A;  1K5S A;  3M99 B;  2BTQ A;  3E8H A;  2EUL A;  3RVZ A;  5B3S B;  1F4M A;  1NVP B;  3D8C A;  1GTO A;  1Q7Y W;  1XNR O;  4LFB B;  3B8N A;  2WSS G;  2B1I A;  3EXA A;  4GKJ B;  5J9P C;  3E22 B;  1H2L A;  2LP7 A;  4JAV A;  2CGO A;  3A8T A;  3D3I A;  5DN6 G;  4AQY O;  1KD1 W;  4B3T O;  4RUE A;  3KG2 A;  2EZP A;  3ASN C;  5IY5 C;  4EB6 B;  2EIJ C;  4UUJ C;  3APO A;  5IYD O;  4I9W A;  4DW0 A;  2CDY A;  2F66 C;  5D5Q A;  1SQB H;  2E3C A;  4GKK O;  3WB1 A;  2ZKO A;  3HKB B;  1NBM G;  5EYP B;  3E8F A;  1YZB A;  4B7E A;  4I0X A;  1H5W A;  4DR4 B;  1KB9 F;  2XHB A;  1IBK O;  3L9D A;  2WPD G;  4GYC B;  3ZBH A;  4IHJ B;  5EIB C;  3JCZ A;  2YIC A;  1R6N A;  1GN4 A;  4O4L B;  4O4I B;  1TGO A;  3JAW A;  2HFE C;  4DK0 A;  2M6Y A;  2IU0 A;  4FLX A;  1CXZ B;  1PKX A;  4Q6G A;  1PNM A;  3ZHV A;  4DR7 O;  4MVO A;  3T4D A;  1MA1 A;  4X64 B;  1Y67 A;  3B09 A;  4F6E A;  1FFX B;  3OE7 G;  5KHK A;  1SER A;  3RYF A;  3ZHS A;  1EBO A;  3FFQ A;  1BE3 H;  1QLE B;  2R70 A;  5CA0 A;  4DR6 O;  3QO5 A;  1IUR A;  5BMV A;  3ICX A;  3JAT B;  1M56 B;  4D6T H;  1BZK A;  2QA4 V;  4JI8 O;  2NNU A;  2QWN B;  4DV4 B;  2H3O A;  1RP3 B;  4JYA O;  3N2G B;  3Q4H A;  4JAU A;  3K03 A;  2P7T C;  1FOU A;  4DV7 B;  1Z5W A;  4DUY O;  2LQT A;  3WU2 Z;  1NTM H;  4FK5 C;  3HKD B;  1U97 A;  4OXS A;  1BGY H;  1N0J A;  4LFC B;  1D5A A;  5JWP A;  2EX3 A;  4FLV A;  4RQE A;  3HKC B;  2WLL A;  2WA4 A;  3TXS A;  1VF7 A;  3K9A A;  1FJG B;  2YUA A;  2LFR A;  2R9I A;  5KLV H;  2YSU B;  4J7J A;  3L74 H;  1WB8 A;  3AG7 A;  4OX9 B;  4HAM A;  3P32 A;  4FLW A;  1AI7 A;  2IM9 A;  3AG2 B;  2Q5Z A;  5C8Y A;  4ASU G;  3A2F A;  2AHY A;  4X20 A;  1OZ0 A;  4ZOL B;  1QLE C;  3DXR B;  4O2A A;  5H2F Z; 
#chains in the Genus database with same CATH homology
 1VAR A;  1GN6 A;  3AK1 A;  1BSM A;  1QNM A;  1KKC A;  1VEW A;  1EM1 A;  4E4E A;  1BS3 A;  3AK2 A;  2QKC A;  1GN4 A;  4YIP A;  2RCV A;  1AR5 A;  2ADQ B;  3KKY A;  1MNG A;  3CEI A;  1GN2 A;  1EN4 A;  1XUQ A;  3AK3 A;  4YIO A;  1IXB A;  2GDS A;  1MA1 A;  1JR9 A;  3KDR A;  1Y67 A;  4C7U A;  4F6E A;  1N0N A;  3EVK A;  2CE4 A;  3RN4 A;  2P4K A;  3OT7 A;  2QKA A;  1PL4 A;  1XIL A;  1LUW A;  1XDC A;  4GUN A;  1PM9 A;  1B06 A;  1LUV A;  1MSD A;  5A9G A;  1EN5 A;  3C3T A;  1AP6 A;  1IDS A;  1EN6 A;  3DC6 A;  2AW9 A;  3DC5 A;  3C3S A;  4JZG A;  1D5N A;  3LSU A;  5AG2 A;  1WB7 A;  1ZSP A;  4X9Q A;  3K9S A;  4JZ2 A;  4JYY A;  1I0H A;  3BFR A;  1AP5 A;  1N0J A;  1ZLZ A;  1ZUQ A;  1IX9 A;  4BR6 A;  1P7G A;  1I08 A;  1SZX A;  1GN3 A;  3QVN A;  3TJT A;  2CDY A;  1MMM A;  1WB8 A;  1XRE A;  3MDS A;  1ZTE A;  4FFK A;  3IC9 A;  1AR4 A;  1JA8 A;  1BT8 A;  1AVM A;  2ADP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...