4C87A

Esterase lpest1 from lactobacillus plantarum wcfs1
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
341
structure length
341
Chain Sequence
YFQGMPTINSIQTTVNGVVKIVKPFNNDIAGEQFDPHVLQTLTAFKQPAILENDLAALRSGSLTPAIADPVGDAVTVQSRNITALNRTVSVEWLTPQNVINHTVLVYFHGGAFYGGVPGNNTVLLKLVAAKSHCEILNVDYSLAPEAPAPAGILDGLAIFQYLEQRDAETMITVAGDSAGANVIMAATNLNQQLGSNRINQQLLLYPVTAPNADHAGPLWDLAAFPIIDSQRAILTNYHDLFRQLDSIMTDYYVPENFDSHSPLISPLHQENFTMTPPTTIMVGEFDPFRPQAWAYAQRLAAADTATTFIQYQGLNHAFAPLVDQYWQSQDVAQVMAAALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Esterase Lpest1 from Lactobacillus Plantarum: A Novel and Atypical Member of the Alpha Beta Hydrolase Superfamily of Enzymes
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
molecule keywords ESTERASE
total genus 108
structure length 341
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c87A00
1QIHA 3F8SA 1D07A 4LYEA 3NOXA 4OB6A 4QZVA 5KREA 1XZKA 3O4HA 3FYTA 5DWDA 4UHDA 3WYDA 3HABA 1U2EA 3BJRA 1R4ZA 4W1QA 5LYYA 1CQZA 4UBKA 2HADA 1OCEA 1YAHA 1ZJ5A 2D0DA 2NW6A 1LGYA 3EQ9A 1R50A 3HSSA 5JADA 4UPDA 4N8SA 3M3DA 5IKXA 4QDTA 4FMPA 5D7BA 5LZ7A 2ZYRA 2W22A 5IVKA 3C43A 4ZREA 3PE6A 3LIPA 4EHBA 2UZ0A 3R3VA 5AOAA 2XQFA 4BC1A 2O2GA 1XZJA 4AZ0A 2V9ZA 4YX9A 2FJPA 4RE6A 4WDRA 4C4YA 3C6XA 4FBLA 1VKHA 4QDUA 3KWJA 4NVRA 1ODCA 4BVKA 4RE5A 1CUDA 5AK3A 1SCKA 1B41A 4H18A 4QDOA 1CR6A 1CUXA 4LXGA 4UFOA 4M0FA 3FLBA 4KAFA 1YCDA 1C4XA 2XQGA 3G9ZA 3WKBA 3LP5A 5JIBA 2WFLA 1XZHA 1XZGA 3ANTA 1XZEA 2ECFA 3QZUA 5C8ZA 3E3AA 4BAZA 2RI6A 3WI7A 4CG3A 3Q0TA 3C5WP 4EBBA 3WIOA 3IDAA 4DGQA 1E89A 4GBGA 4DIUA 3ESDA 5D6OA 3WL7A 3PFBA 2WFZA 4FFVA 2WIGA 1F0NA 5HQ3B 2XUJA 1HQDA 1XROA 2Y1KA 5ALRA 3CN9A 2OQIA 2H7XA 4QA9A 3JYHA 1EDBA 4AO6A 5AKHA 1HPLA 5C7YA 2Z8XA 6YASA 3K6KA 1G5FA 3G7NA 4FNMA 1EXWA 3G0CA 4BP9A 4X71A 3HEAA 4DMKA 3N0TA 1BEEA 3VDXA 5CBKA 5CT4A 5LLSA 4I4CA 3D59A 5ALDA 4EY6A 4KACA 4NS4A 3FSGA 5HF9A 1QIDA 3DQZA 2ZJFA 1QFMA 5AOBA 4K2AA 1TCCA 1XLVA 2CMFA 5JANA 1L7RA 2XMGA 5ALGA 4BVLA 5J3JA 1UK9A 4G1FA 3RARA 1CV2A 1JU3A 3GELA 2VAVA 2QT9A 4F60A 4Y2UA 1LPBB 1GKLA 1ZD4A 2YASA 2HU5A 1QZ3A 4XX1A 5AKIA 1O6GA 4AQDA 4PSUA 2QXTA 3W9BA 4FWBA 1CUJA 1O6FA 4BB0A 3AUKA 2BGRA 3U1TA 1UK7A 2VQ6A 4PO3X 3DLTA 3BIWA 1EA5A 3AJAA 5YASA 1XFDA 5LP1A 4BCCA 1X2BA 1K4YA 5AO9A 1HDEA 5AK4A 3LCRA 4CFSA 2Z8ZA 4GECA 3A70A 3AZPA 2JIDA 4LYDA 3TJMA 4BCDA 4AN1A 1MPXA 1QIGA 3STYA 5JARA 3C45A 5ALUA 5AH0A 3QMWA 2XQJA 4B0PA 2CB9A 3FYUC 4EY5A 4G4GA 4MQMA 5ALQA 5FPPA 5AKKA 4DNFA 4UHEA 2I78A 4DYHA 1DWQA 1XRRA 2OCGA 4CG2A 4U2CA 1DX4A 2XUHA 5SYNA 5AM3A 4Y2JA 1ZICA 4KEAA 2XMQA 1THTA 1A8QA 4H7JA 3BE8A 4Y2TA 4DNOA 1EDEA 2FJ0A 5EGNA 1GQSA 1VZ2A 1M33A 2EEPA 4EB0A 3WL6A 5JALA 1ZOIA 3ZWQA 3D4LA 4XWGA 3V1NA 1BEZA 4X94A 4J0GA 2AXEA 2VT6A 2GYWA 3KWFA 4ETWA 1GXSA 2GZRA 5T4BA 1AKNA 1YB6A 3NWOA 5EHNA 1QTRA 2OCLA 4IQ4A 1BCSA 3V9AA 1W76A 2XE4A 1UK6A 3WZLA 3F67A 1C7IA 1IUNA 1VXRA 4B7ZA 1JKMA 1CLEA 4J0KA 3SC2A 1U8EA 1UOQA 3ICVA 4XVCA 4CCYA 1EI9A 3L1JA 2J4FA 2HFJA 4X91A 4WJLA 1MX9A 3Q8WA 4NMWA 4OYYA 3WKCA 5KWJA 4G9GA 1XRMA 2HA6A 1YS1X 3C5VA 4JNCA 4ZV9A 4QLOA 4JYPA 2XUOA 1TRHA 1JJIA 4OYLA 5EHQA 4W1PA 5FXMA 3CN7A 2HU8A 3D7RA 3T4UA 3D2AA 3FOBA 2JGLA 3AINA 4IH4A 1N8SA 4HS9A 1LPPA 3C70A 1TKRA 5DTJA 1Y7IA 2PSHA 4FLEA 1QE3A 4XIIA 1SFRA 5D3ZA 1CUZA 4Y7DA 2C58A 1MTZA 2J4CA 2Z3WA 2RONA 3DL7A 2PM8A 1CPYA 5LZ2A 3L1IA 4F0JA 3IURA 4J7AA 1XZDA 3ESBA 4ZXFA 1BN6A 2HHAA 1R9MA 4OPMA 4H7HA 3BF8A 3CCCA 5K3FA 4AMZA 3IUMA 3AIOA 4J0DA 2PSJA 3FSGD 1W52X 1T4MA 4GI1A 3H0CA 3H1AA 4DSZA 2G5TA 4AO7A 3G9XA 4N8DA 4WFIA 1JFRA 1CUYA 1XLUA 3DOIA 3O9VA 4X6XA 2H7CA 3S8YA 1XRNA 1EVQA 2OPHA 4Y2QA 4B0OA 2WUDA 5ALLA 2WG0A 5HQ3A 2VA9A 4H7EA 3WKAA 3N2ZB 2WHQA 4FDMA 3EF3A 3IUNA 3G8YA 4ZV7A 4L9AA 3O95A 2VF2A 2WTNA 3H19A 2WG1A 1CFJA 3K2IA 3I1YA 1NU6A 4A5SA 1QLWA 3R3XA 5DNVA 2H1IA 1FSSA 1FFAA 2JGEA 1EHYA 1MU0A 4GDMA 2J3DA 4UHFA 3MUNA 4PF1A 1H2YA 5AIAA 1W1IA 1TCBA 3CCBA 1QIMA 4ZI5A 3SK0A 2PL5A 1XLWA 3IVMA 2QVBA 4I19A 3NGMA 5AM1A 5AP9A 2QJRA 3BF7A 5A2GA 5JZSA 3A2NA 2K2QB 3R3UA 3STXA 4CIBA 5BWBA 2XLBA 3RLIA 3QM1A 1QO9A 3I2GA 4QWMA 1QO7A 4CIAA 5ALVA 4CCYB 2WM2A 5E4JA 4A23A 5AHXA 3OURA 3VVLA 2V96A 1Y37A 3QITA 1C7JA 1AMNA 3DNMA 2PU5A 1BROA 2OGSA 4KJXA 4RNCA 2XUQA 4L72A 1L7QA 2ZJ6A 2BUBA 2H7YA 2B61A 5A7FA 3AIMA 4BATA 3VKFA 3HLKA 1R9NA 4BRSA 1UK8A 4U2EA 5K3DA 1UWCA 2RGUA 2WQZA 5FLKA 2DCMA 4KE7A 2YXPX 4MXDA 1XZIA 4AO8A 2ZJ7A 1CUCA 3G02A 4HZGA 4H7IA 3MUOA 1I6WA 4KRYA 5AI5A 3V1LA 3WLAA 1G4HA 3STTA 3WL5A 5T4HA 4X93A 3FAKA 3O9MA 1YB7A 3STVA 4Z49A 3R41A 4E15A 4WDQA 2XUPA 4GHWA 5ALXA 4LXIA 1VZ3A 4KAJA 1CQWA 1PV1A 2P8SA 4BP8A 1YSCA 1Q0ZA 3AZOA 1EINA 3MVEA 5HCUA 2OXEA 1TQHA 3IUJA 4J3JA 1DINA 4B84A 3FVRA 3BWXA 2H9YA 3R0VA 2WKWA 2Z5GA 1RWQA 3FCXA 3WKDA 2VTVA 4OU4A 3I6ZA 1GPKA 1R1DA 2ACEA 4MQLA 1THGA 5AM5A 1CUAA 2WG2A 5KWIA 5AKLA 5JYCA 4KE6A 1H2ZA 1XZMA 4GEGA 5DJ5A 3ZI7A 1H2XA 4OSEA 5HF6A 4N5HX 5HKAA 4FFWA 4V2IA 5JAUA 3UUEA 2PVSA 4EUSA 3WQHA 5A7GA 4C88A 4B80A 4M0EA 5LIPA 3G0GA 1UFOA 3A2MA 2BAGA 2GYUA 3QPCA 1UZAA 5AKYA 5ALNA 2XMSA 4W1SA 5AM0A 4MYDA 2VJCA 2BCEA 1QIIA 1XQYA 2OCIA 4OB8A 4MWSA 2XB6A 5HFNA 3B3QA 3KOOA 1H23A 3WK4A 3WIBA 4B85A 3S2ZA 2OLEA 4H35A 3IB3A 2VJDA 5ALHA 1JI3A 3DYVA 5HF8A 1VA5A 4E14A 2AJ8A 4X3CA 4B82A 1CUEA 1J1IA 1VE7A 2HA5A 2ONCA 2HA0A 5DYWA 1DQZA 3F97A 1LBSA 2CZQA 3ICWA 3KSRA 2BUAA 2FX5A 1QTIA 3M82A 3VVMA 3WK9A 1SCIA 2O7VA 1ZI9A 2Y6VA 3OTQA 3HXKA 1LPOA 2Z3ZA 5AI8A 1BU8A 1CUUA 2XUIA 4G8DA 4WFJA 4FBMA 4QDXA 2WHPB 2ZSIA 1Y7HA 4KRXA 4G8BA 4C4ZA 2WTMA 3V1MA 4K6KA 3I6YA 1K5PA 1S8OA 5C81A 2WU3A 4OCZA 1XZLA 3FYUA 2DR0A 3VJMA 1UOPA 4UBLA 3P2MA 1LPSA 4H7DA 5LZ5A 1CRLA 1CUGA 1WCYA 5EIAA 2PKYX 1PJAA 2WIFA 4B9AA 3I6MA 1LPMA 5IVIA 1QIKA 3O0DA 4AZ3A 3DKRA 2HA7A 2VSQA 4H77A 4NZZA 2Y2UA 4EY4A 2QXUA 1XZFA 5HFAA 5AICA 2XDWA 2WUFA 5HF5A 3KD2A 2I03A 3ANSA 1IUPA 4DMHA 5CXUA 5SYMA 3ESAA 2VJBA 2QTBA 1HKHA 5JZ9A 4AMYA 4DTCA 5CW2A 1MX1A 3GROA 5K5EA 3UMJA 5ALIA 4Y9SA 3WZMA 3DEAA 3GBSA 1P0IA 4Y2RA 3F96A 3IA2A 1XRQA 5LKRA 4BDTA 1LZLA 1ORWA 4X00A 1ODTC 1F8UA 3RK4A 3B5EA 2ZYSA 5LZ9A 4GW3A 5LKAA 2I3DA 5FPQA 4HXEB 3I2JA 4IH1A 4JYMA 2WIKA 5K3EA 3HZOA 4Y2VA 3H17A 4FOLA 5CMLA 2GYVA 1ZI8A 3ED1A 4UHHA 2WFMA 2ACKA 3WJ1A 1UOOA 2QUBA 2QR5A 3AIKA 1ZJ4A 5FKJA 2IITA 3X3HA 2C5GA 2DFPA 1WB6A 1JMKC 1CUHA 2V98A 2CJPA 3WWCA 2Y6UA 1DT5A 1AUOA 2OG1A 1LZKA 1CUFA 4YASA 1W75A 3E4DA 1LBTA 5A6VA 1EDDA 3OM8A 5AK6A 4E46A 1P0PA 4KE9A 1YA4A 1R3DA 2G5PA 3KXPA 4FTWA 3M81A 1WOMA 1AZWA 1FFCA 4P08A 5JATA 2YH2A 1AC5A 5BWCA 3FNBA 3HRHA 1UT6A 3QVMA 1CVLA 1DU4A 5T4EA 3DD5A 2QOEA 2PSEA 3MGAA 3C87A 2RAUA 1CUVA 2JGIA 3VJLA 3G0DA 1Q83A 1E5TA 4UHCA 2QZPA 3HACA 2XMDA 1FFEA 5AI9A 1GPNA 3G9TA 3FYUB 5I9IA 4C4XA 2G4LA 1WHTA 5CURA 3QPDA 5AM4A 3VJKA 5ISMA 2JGFA 4MYSA 2XI4A 3WA6A 4BAGA 5HKBA 1J06A 1N1MA 1QONA 3YASA 4Q1VA 4ZGBA 4FLFA 3C8HA 4P93A 2QKYA 5ALJA 5DNUA 5I8PA 5LZ4A 4B9EA 1Q0RA 1ISPA 4D9JA 4BVJA 4PNZA 1BS9A 4C89A 4XJVA 3ZLUA 2PU7A 2VT7A 2XUGA 4K6GA 3OOSA 5CT5A 3UUFA 4G5XA 2HU7A 2W6CX 1J07A 3R3WA 2J3QA 4G4IA 1ZD5A 2XMRA 2QS9A 1SCQA 4OUKX 2C5FA 1CIJA 5JZBA 3TGLA 3O4IA 2C4HA 4X6UA 1B6GA 3OPMA 2ZYHA 4L3WA 2HIHA 1DWPA 3I2FA 4X90A 4Q34A 4UBIA 2R8BA 5E4TA 2ES4A 3WWEA 2WFLB 3VISA 3BIXA 4FLMA 2BUCA 5CT8A 2EDCA 4MJ3A 1QIEA 4F5ZA 2WJ3A 4KAAA 2ZVDA 1E8NA 1ZIXA 1GT6A 2JBWA 1JMYA 2C7BA 4S0XA 1F0PA 3NUZA 4AXBA 2X8BA 3FCYA 5AKEA 1HLGA 2RHWA 3D3NA 3K9BA 1TK3A 3H2GA 2Q0XA 4E11A 2WJ4A 2WUGA 1J2EA 5JD4A 1ETHA 4BE9A 4PSDA 4UBOA 1E8MA 1EH5A 1IZ8A 3OC0A 1TIBA 1DX6A 3BJMA 4JH0A 3U0VA 3SWWA 2PSDA 1ZIYA 1VJ5A 5A7HA 4AB1A 3PDCA 3I2HA 5I7UA 4C01A 2O2IA 1BN7A 1ODSA 1YA8A 1FJ2A 3O4GA 5A62A 5ALWA 4C87A 4GLBA 4PQEA 2XUFA 1GGVA 1OXMA 2QJWA 3FVTA 1U4NA 1HL7A 5AKZA 1DWOA 1AURA 4U2FA 2OGTA 3PFCA 1MAAA 4J03A 3ZLVA 5AI6A 1N5RA 1SC9A 1KU0A 1X2EA 5HK8A 4H0CA 3LS2A 3HC7A 4G9EA 4BYMA 4U2GA 2Y2VA 4UBMA 4OB7A 3V1KA 4IO0A 1IUOA 3H2HA 2B4KA 4A16A 5CRIA 1GQRA 5AM2A 2B9VA 1CUBA 5ALSA 2JGKA 1H2WA 4W1RA 2DHCA 3WWPA 2HM7A 2AJLI 4ITVA 5ALYA 5CTAA 3JWEA 1G66A 1EVEA 4ARAA 5ALZA 1U65A 3DDUA 1EB8A 4UHBA 1SOMA 2BKLA 2OAGA 3I2IA 5E4YA 2X5XA 1A88A 1QIJA 1ZGCA 1VA4A 1GZ7A 1K6EA 1EK1A 4HRXA 2ZSHA 3ZV7A 4HAIA 2AJBA 4HRYA 2BFNA 1KU6A 4QLAA 3QMVA 4DNQA 1ZD2P 2DQYA 2PUHA 4BCBA 4F21A 4X85A 5F4ZA 4G8CA 2PPLA 1VLQA 2HA4A 3C6BA 4LXHA 1A8UA 4H7FA 2WHRA 4FKBA 2BGNA 3SX4A 3G0IA 4Q3LA 2WIDA 4L0CA 5K3CA 4PW0A 1CEXA 3C8DA 1AX9A 1HBJA 4X97A 4OD0A 7YASA 4PSCA 3BXPA 2C0QA 1K63A 1E3QA 1GKKA 3WMRA 4DMCA 1YR2A 4QWWA 4IH9A 5ALMA 3RM3A 3LIIA 5JD6A 3W2TA 2XLCA 1IMJA 5EIHA 3DCNA 2CBGA 1A7UA 2WIJA 3BL8A 1XKTA 3A2LA 1LPAB 3GUUA 3ZLTA 4W9RA 4MEBA 3WKEA 5A71A 5ALOA 4Y2SA 3H04A 5JD5A 2LIPA 3C6ZA 4CG1A 1EK2A 4QNNA 1E66A 4B6GA 3STUA 4HTAA 3EQ7A 3HYSA 4BTVA 2RIPA 1JJFA 4U2DA 4WY5A 1NU8A 3H1BA 2DHDA 4AN0A 1MT3A 4BZZA 3WL8A 4TGLA 2XMCA 3F98A 4FHZA 3WWDA 1ZD3A 1WPRA 3QPAA 5ALPA 4J0JA 3HI4A 1QIFA 4LIPD 2IIVA 2X76A 4H7KA 2WUEA 1LNSA 2GBFA 4HVTA 3PICA 3GZJA 4JEIA 5CT6A 5C8XA 1XZAA 4BAUA 5EIEA 2XT0A 1JT2A 5JASA 2HRRA 1Q84A 4BBZA 2XUDA 1LLFA 1UKBA 4GXNA 4U2BA 1WHSA 1FFBA 5FRDA 5IVDA 3STWA 2CUTA 3O4JA 2PSFA 1Z68A 5C8VA 1R88A 1IVYA 3F9CA 4P92A 2HA2A 4FNGA 2OGZA 5T4FA 5FP0A 1A8SA 4EA6A 5DLPA 5JAOA 1L7AA 3V48A 4UBJA 1DQYA 1MO2A 5E2IA 5BV7A 2JEYA 1KEZA 2PX6A 4N5IX 5HK9A 5CH8A 5BOVA 2AJDA 2PBLA 1NX9A 3DJYA 5AJHA 2XQIA 2GBCA 2HL6A 3QYJA 1CUWA 2XMBA 4B81A 1MNAA 3PF9A 3PUIA 2WHPA 4N8EA 3B12A 3PI6A 3PUHA 1XRLA 2ORYA 3TEJA 4ROTA 1QGED 5AOCA 3AZQA 3EBLA 1TAHA 4B83A 4KR0A 1MX5A 4DNPA 4QEKA 5FOQA 2OAEA 2QMQA 1OILA 4J0CA 2XQKA 2XMZA 3ZPXA 5CH3A 1ORVA 5ALKA 3WYNA 3FWHA 1XZBA 3QBJA 2FUKA 1IZ7A 1MN6A 5K3AA 4RGYA 3H2KA 2WSLA 2HRQA 2IX9A 1VXOA 1WM1A 3DOHA 4BTLA 4OU5A 2ROQA 4WCVA 2WJ6A 3D2CA 1ZGBA 4MWTA 4DLNA 4YPVA 2O7RA 4IHAA 2EDAA 3W05A 3I28A 2D5LA 2I3ZA 4K6HA 4I3FA 5AIBA 4X6YA 1DTEA 5CXXA 1CUIA 1UKCA 1YAJA 3IUQA 1VE6A 1XRPA 5JAHA 5EFZA 5ALFA 1EX9A 2HA3A 2WILA 3H2JA 3DYIA 1T2NA 4HXFB 4Q05A 5CH5A 3GFFA 1DT3A 2WLSA 4LHEA 1EB9A 4QE3A 4EZIA 3EIOA 1MNQA 1LPNA 5IH7A 5EI5A 3OG9A 2JGMA 2JGJA 3HJUA 2R11A 2QRUA 3DS8A 3FLAA 5H3HA 4X95A 4G4JA 1YS2X 3DL4A 2V97A 3R3YA 5IVHA 4C6HA 1MJ5A 2QM0A 3C6YA 1W4LA 4DMFA 1XQWA 2E3JA 5D3KA 2DHEA 1TCAA 3WK6A 2VAXA 3I2KA 1F6WA 2VATA 4WY8A 2HFKA 1UXOA 3DKKA 2JEZA 3FLEA 4ARBA 5K3FB 5HZGA 3G0BA 2PUJA 3CXUA 3QMMA 2CEKA 3W04A 4J0HA 2BJHA 3IULA 3GA7A 3WJ2A 2OCKA 5DYYA 5K3BA 1G42A 5AI0A 3L1HA 1N5MA 2WU4A 5EHZA 2GZSA 3KDAA 3WWOA 4ZRDA 4RPCA 3RKSA 4LKOA 1CUSA 5JAPA 4CCWA 5AKJA 5AI4A 5DYTA 2VEOA 3D2BA 2QUAA 1JJBA 5DNWA 3JW8A 1X70A 3G9UA 4BDSA 5LZ8A 1PFQA 1YASA 2VJAA 3BDVA 3ILSA 3R40A 2O2HA 4EY8A 4UBNA 3D0KA 4Q3OA 5FV4A 5FUMA 4QDZA 3T52A 3W06A 3QH4A 4BRZA 3IBTA 4KYVA 1QOZA 3VXKA 3TRDA 4UFPA 4Q82A 4INZA 4Y2XA 4HXGA 1USWA 3PF8A 4M0MA 3WK7A 4P9NA 3H18A 3E0XA 4X92A 1RP1A 1ACLA 3I1IA 5KBYA 4PV7A 2XUKA 4O08A 3FBWA 2HDWA 2RHTA 3D5EA 3LLCA 1RYYA 3ESCA 1XQXA 1VOTA 4JUIA 1W6RA 5AK5A 5ESRA 5EHXA 4TVKA 4Y2YA 5AKGA 1GPLA 1QJ4A 1XZCA 2XUAA 1AQLA 4CI9A 1UKAA 2YYSA 1K8QA 2DSNA 1WPXA 4UUQA 4J0IA 4GWLA 5ALTA 4Q3KA 4BZWA 4Y2PA 4BC0A 1WB4A 4KE8A 3M83A 5FDFA 5DTIA 1P0QA 4ZWNA 1BCRA 3AFIA 1ZI6A 4K5QA 3WK5A 2DQZA 3H2IA 4DSAA 2B20A 3BDIA 3A6ZA 1BE0A 1FFDA 2JF0A 1XQVA 2ZYIA 3EQ8A 1AGYA 3E1GA 1BRTA 1XKLA 1WB5A 5ALEA 4X7BA 4DM7A 3W9UA 3WA7A 1E8DA 1QFSA 2GBIA 2OQVA 2GBGA 3IIIA 3R3ZA 3WK8A 1ACJA 5CT9A 4AX4A 1H22A 4W63A 4BE4A 2G63A 3AILA 4TPKA 4UFNA 5AKXA 4WFKA 1P0MA 2C0PA 1MAHA 4MEAA 4EY7A 2AJCA 4YK7A 1JU4A 2CKMA
chains in the Genus database with same CATH superfamily
2DU8A 2EQBA 2R7NA 3G68A 2KI5A 3NH9A 3NOXA 5CBPB 4OB6A 3GRUA 1RTTA 3H6GA 5AK0A 4UNIA 1MDFA 3K8YA 4NOKA 3A1UA 1T9BA 1YE3A 2BW0A 1EP3B 5HGJA 3UMFA 3PK0A 4EUFA 5KIAA 1H6CA 3FYTA 4H3VA 5DWDA 2CVOA 1UDWA 2BGIA 3SICE 1AUVA 4C0JA 3RHZA 1SPXA 3ONFA 4J2TA 4YI3A 3WYDA 1AK2A 2Q28A 5FL3A 4EYOA 4DUPA 2QRPA 1QQTA 2WJHA 3FCOA 3VYRB 5BORA 1I30A 1T2VA 1U2ZA 4GVXA 1JQKA 1V71A 4TUYB 4GL4A 1JSCA 4OVKA 1P4SA 4IOMA 2B6HA 3R5TA 3EPJA 4XSHA 2JZNA 5DM0A 1TE2A 2D0DA 1XJCA 1F17A 1J8FA 1R6VA 2AN1A 2XKJE 3GP8A 1JDTA 4BGIA 1LGYA 3BMOA 3CLSC 4X3PA 3EQ9A 3W78A 2TSYB 3F6EX 5JADA 1Y3FE 4PS0A 2H2HA 2WOOA 2G40A 1WU8A 1GYPA 1T9GS 3EB9A 3CQ9A 2BZ1A 1XYVA 1KQOA 3GEDA 4JBXA 2PD3A 1QRUA 1RRGA 1H6DA 1PD0A 3EMBA 2PS0A 3PZBA 4MVJE 1UDRA 1IBSA 1ZJ6A 4RK0A 1PTKA 5LZ7A 3KX2A 3W77A 1JHQA 2E4WA 3CINA 3V7NA 4OJTA 1ZHOA 1K7YA 4NCIA 1RM0A 1Y42X 5A9TA 2AG8A 1ZEJA 2P9JA 1YNSA 5KJ1A 2AFHB 1IRIA 5CX4A 3IALA 2ASVA 1T1IA 4MGHA 2XQFA 3FDIA 1E1CA 4QSMA 4BC1A 5HX7A 2Q5OA 3AP1A 2ZM5A 1NOJA 2I4RA 1Y6RA 2ADMA 1VHTA 1YKFA 5LXTB 5IMSA 4YX9A 3RWBA 4AROA 2PGIA 2GUGA 3NIWA 1G59A 9LDTA 4FBLA 4MVJF 5CFMA 3K9HA 4NVRA 4ESHA 4ZJYA 4N1AA 4OFZA 4YS6A 1O95D 4CV0A 2P4QA 2HUNA 4F6CA 5A6SB 2JPDA 2EP8A 2YHSA 4EHIA 1N77A 1SBTA 1ESCA 3EAQA 3LUAA 4ENVA 4PY2A 1B41A 3GCDA 4UJ5A 4D4HA 1CR6A 4CF7A 5E38A 1CUXA 2IYEA 2HCJB 3KJXA 3PPIA 2V7GA 4I1VA 2GDJA 1P0CA 1T1RA 3E23A 2K7FA 1Q1AA 3I2YX 2I29A 3F3MA 5FADA 3FLBA 3SOZA 1YCDA 2R65A 2EATA 1H69A 4TRJA 4JLBA 3SJBA 4MRPA 2XQGA 3G9ZA 5F7ZA 4DTIA 1INLA 4M87A 4F5YA 2QAGC 4HDSB 4D7AA 2HPZA 3TPFA 1EWQA 1TA0A 2CF6A 4CDNA 5KNCD 4LOLA 1J70A 4WVLA 4YMIA 2WFLA 3UM9A 4B3IA 2R48A 5C2JB 4CTJA 4BNDA 4RNDB 1YL5A 3G5TA 2VPPA 3OFSA 3E3AA 3QBDA 5LYJA 2RI6A 1K7FB 1KDPA 1U3WA 1UMBA 1NMQA 2GD6A 2GFHA 2R9VA 3P9PA 4O4HB 5C34B 3W6UA 1NXOA 5ANRB 5CB4F 4QFDA 1QP4A 1MGPA 1NIJA 2HF2A 4AWBA 1PL0A 3C5WP 3DTVB 4WKGA 4CG3A 4EBBA 2XXAB 4UAJA 3WIOA 5B7QA 5JHHB 4KRFA 4RULA 1YCGA 5CFPA 3SJAA 4TYMA 3GAFA 2PZJA 3LOQA 3O6VA 1L4HA 2O23A 3GWGA 3PFBA 4YMGA 3MJRA 2H4FA 1W59A 2LP4Y 3UOWA 3L7NA 3TXYA 2WIGA 4JSTA 2HNKA 1F0NA 2D7DA 5FJIA 2XUJA 4YA6A 1KI1A 5AW3A 4EA9A 1K7CA 3TZEA 2YW9A 5JYEA 3VC3A 5ALRA 4Q12A 5CCBA 2ZCJA 2C2ZA 2CE7A 2H7XA 1VSTA 2H4ZA 4O4JF 4BMZA 3S8EA 1YZYA 4QA9A 3WDLA 3NDIA 3ZI4A 4CR6A 5IRCD 2ZSDA 1V1MB 4DCSA 1ES9A 4QYIB 1I6LA 1ZNXA 1DRWA 1HPLA 2Z8XA 1U8AA 1WBJB 2W6ZA 3IDQA 2OOKA 5GJVC 5B6JA 2DZDA 4MV5A 3L6UA 4X71A 3HEAA 4MS1B 3WB9A 2DY0A 5I4BA 1DDOA 1V45E 3DBLB 2ESRA 5F35A 2OBYA 4FFNA 1BEEA 3VDXA 3D64A 3OZCA 1KO8A 2B0JA 1NASA 2IIQA 4JUBA 1G55A 2MYPA 4HDQB 3KR2A 4MO2A 3C41J 1PLKA 5T5QA 3DAGA 3OTIA 5LLSA 5SYAA 2DMRA 1OV4A 2Q4TA 1YUBA 3M1YA 4WK4B 3QY9A 3ZLBA 5JY1A 1H05A 5EXTA 4GKKB 4WQMA 3KWLA 3QHAA 1HTTA 3FSGA 5BT9A 3RSZA 3GIWA 2O1SA 1E1KA 1QS0B 3JVIA 3R0XA 3AVYA 4FYVA 2DERA 3IT3A 1QFMA 2I71A 2AFIB 3KYIB 1XLVA 1VI6A 2P75A 3L8CA 3G88A 1L5QA 4AY2A 2H1FA 1P4AA 2A58A 2ZXEA 1BVUA 4WECA 4E94A 5DMHA 4KNWA 1JR2A 1W36B 3DHVA 3C5CA 4NENA 1S02A 1L7RA 5EIWA 2IPNA 4Z4CA 1DUIA 1RQLA 2V7EA 4BVLA 3KNZA 3WAJA 5J3JA 1UK9A 4RJTA 5A3QA 3ONNA 4FS3A 4HH1A 1IXYA 2IDKA 2Q3LA 1Y9DA 4MJ7A 3AEQB 3X1KA 2YWDA 2GOYA 5DNCA 1CRWG 4CEHA 2DE0X 1WF6A 3K16A 3AX6A 2JGDB 4YLYA 1K6JA 1WQ4A 4N54A 4B6RA 5IFKA 1E3LA 1ABBA 2Y0DA 1W47A 1BJRE 2VIIA 3D43A 4ZRMA 5A4FS 2IZ5A 2XB8A 2ZUUA 3EVZA 5FUXA 1HXHA 3C3AA 4URFA 2PVPA 3IT1A 4NFLA 4W99A 1PR0A 4W8HA 4XX1A 5AKIA 4D46A 2AR0A 2EBFX 4M1YA 2Z6AA 2I2BA 5JNSA 1KP9A 4M1EA 5T3UA 3KKOA 1WCV1 2HO4A 2N3ZA 4Z86A 5K6AC 4KH0A 2AF3C 5DYIA 1ZJZA 1WQ1R 4L0DA 3WGMA 3ZQ6A 3ZWYA 4HNVA 5TMPA 1NF9A 2YXBA 1VM6A 2XV1A 4J9UE 1DG9A 1CUJA 5DGIA 1L3BA 5LMZA 1J2UA 1K98A 1LJ8A 1QH1A 3MD0A 4PNEA 2O8BA 4BB0A 2CMKA 3MIIA 3LZ6A 3TDNA 3BMQB 5B2ZA 2Z08A 3B20A 2O7SA 4PO3X 1C41A 1GJRA 1HNZB 2OOSA 3ZUPA 3BJZA 3CZPA 3RRYA 3ZTWA 2IFTA 3GXBA 3AJAA 3U4HA 3UGKA 3ZS8A 2PS3A 1BJTA 3KYDA 1T8RA 4G0VA 2ZRQA 2VBGA 5LP1A 5DHQA 1DLJA 1B76A 2O8DB 1RCUA 4GFDA 1PDOA 1SK8A 3OLXA 4WA7A 1QFJA 3LWNA 1IZYA 1GN8A 3TLGA 3UAOA 2AN4A 2I2CA 2ODEA 2QTZA 1YOVA 1FYEA 3KUKA 4KB5A 3HDYA 4NBKA 4ZVRA 5BV2P 5IM4F 3VMFA 1A0OA 1XVIA 4XR4A 4KXLA 2ZYUX 2VDOB 4K05A 4E5YA 4LYDA 1GYQA 4BCDA 5F12A 4P98A 1QGZA 2AWNA 3JD1A 2R6AA 1YO6A 1NXVA 1XMXA 4L95C 4C7VA 5CM2Z 1BS1A 1RE1A 1BVYF 3JVEA 3I01M 4FFLA 4IIXA 3CYFA 1KKLA 5ALUA 3RIYA 4PZPA 3UC9A 5A4IS 3RANA 4HN2A 1Z5OA 1U8FO 1IAVA 1WRBA 2FW9A 3A31A 2OENG 4G1VA 2WJZB 1SUSA 4MW7A 2PR7A 4G4GA 1J8VA 4MQMA 4NDZA 4DPKA 3TRHA 4G0QA 1QYVA 1S96A 2VF7A 1Z18A 4Q4CA 1GHTA 2VDRB 3WGYA 3PGXA 4DPMA 1VSQA 1PGNA 1EFUA 3L7MA 3T7EA 2VQEB 2YFKA 3CS3A 2OWEA 3T9CA 3LF1A 4BV9A 1QV9A 2I78A 1L5OA 1G21A 1U9IA 2C96A 2GAFA 1Z0JA 2OVFA 5EJ8A 2ZZMA 2VT3A 4CLOB 5EJMA 2A2ZA 1TK9A 1VPVA 3AUAA 1LF0A 1U7ZA 5LD2B 3THXA 2REQA 1LJUA 3F71A 1NY6A 4KEAA 1Z16A 3OY7A 1VPLA 3KEGA 4KQ1A 4E21A 4IILA 3IP1A 4RGVA 2OHIA 1NJ5A 2QTCA 1THTA 4H7JA 2C97A 2Y27A 2WZQA 4RTQA 4Y2TA 1XL1A 4KDCA 1HWYA 4HC4A 3PGVA 5JFGA 3B52X 3LVBA 4ZO7A 1D8AA 2NQ2C 4WY2A 4LF9B 1KDVA 1R6TA 3CX7A 4N03A 4YQZA 4WN9B 1I3LA 4PXSA 3DMTC 1DUSA 5KNCH 4ILEA 2NQTA 2O0JA 1YK1A 3HVUA 4J6FA 2ZSBA 1OIVA 4K40A 4IIFA 4R9RA 4E13A 4II2A 3HJCA 5B1IA 1ZOIA 4B71A 3QUSA 4H4DA 2JI9A 3OLVA 3FOCA 4TKUB 4UU8A 4I1IA 1DUVG 3UHFA 1IY0A 4WGGA 4G0ZA 4A0RA 5LBTA 2BE9A 3RSSA 2ZWOA 3E0QA 3ROPA 2WU8A 2JFVA 4AECA 3MJVA 1G7TA 2ECKA 4LRTB 4ETWA 1NN1A 2GZRA 4GC5A 5C52B 2G17A 5IP5A 1QV7A 4XRRA 3NNSA 3K70D 3HXMA 4GS5A 1KYXA 1UUFA 5AQEA 1H8HA 5GZ1A 1Z08A 1PW7A 3IQXA 3CNOA 4H1WA 1YRBA 3WZLA 3T5AA 1YHYA 4WI1A 5I9SA 3C3YA 1C7IA 1M34E 3W1EA 5JVDB 4RHCA 5FWDA 3GYGA 5KTMA 3EIUA 2NUBA 1JU9A 4LMRA 2X3UA 4Q15A 4XVCA 1FXWA 1EI9A 2I4IA 4B8WA 1VPDA 4PLHA 4D79A 3QKRB 3IP7A 3P9CA 4ALLA 3ACDA 4IMRA 3ETHA 5C53B 4QARA 5KSYA 3B1WA 1FFSA 2EAUA 4BFLA 3ZVKA 2XIJA 3OE1A 3EZ6A 2POQX 2HFJA 4P7FA 2FEMA 4RJJA 1MB4A 4X91A 3CVYA 4ZCQA 4WJLA 3FUTA 1BE6A 3MRXA 3LDHA 4NMWA 1IAQA 4A9AA 5FNVB 3GLUA 1GPUA 1KZGB 2ZBPA 3E1SA 4J2HA 4MUFA 5FBLB 5F1KA 2CFIA 1FRZA 1FK8A 3RDPA 2A7XA 2JFBA 3CH6A 4G9GA 1W1WA 1EWTA 2PZGA 2QUIA 4GZ5A 4LYAA 4YRMA 1XRMA 5JLAA 2SCUB 5CEFA 1OBOA 1RHQA 3UT5B 4DCMA 5JXGA 1W4ZA 4QIHA 1YS1X 2FGKA 3I23A 3PDWA 5DF1A 3UENA 1XAGA 2W93A 1SIWA 2QLNA 5SZHB 1Z7WA 1CY2A 1Y63A 3KXLA 2H5IA 2NV2B 4YROA 5JSYA 4CL8A 4DN6A 5A1JA 2DETA 3MHTA 1XZPA 2CGEA 2QR2A 4OYLA 1D2RA 4OJNA 3CW8X 4LJKA 2IUSA 4W1PA 1NMYA 4W7IA 1SCJA 4IX1A 2ZANA 2G7MC 3D7RA 2QR3A 5ESXA 2ZUFA 1IB6A 4LMBA 2CSXA 2Q2WA 3CWCA 3QELB 3VV3A 2B30A 1I2MA 3OX1A 3AINA 2B83A 3D3WB 2WWIA 2UV8A 3RFXA 3NKFA 5B64A 4JBIA 1FJHA 3IQHX 4OHPA 1NVMB 1ZCZA 4FJ2A 2XBUA 3OQVA 2BHLA 2A8YA 3VR4D 4EDHA 3IP3A 1CT9A 3K2EA 3ZDQA 4M7OA 2A0WA 5EJFA 3BMCA 2QVYX 3FG9A 4KVAA 2J4DA 2NUAA 1D4FA 1TYCA 2PJRA 3FTEA 1Z9BA 3GH3A 3PNBA 2BI4A 1KWGA 1CBUA 3FB4A 4L50A 1XEXB 4ZOLF 4FD3A 4YH1A 3PJEA 1GNVA 3ANYB 1XCGB 3NG1A 2IEGA 1DTWB 3ND5A 3OX2A 4D0NA 1QE3A 2FU5C 4NLLA 4V03A 1G19A 1QANA 5CUQA 5D3ZA 4TS4A 5I9TA 4CM9A 4Y7DA 3CF4A 1Z5ZA 5IUJC 3JZAA 4H4EA 1VJDA 5JAIA 3TKYA 1A2QA 2XX3A 3U3ZA 1DZ3A 3GUHA 1PGQA 3DL7A 4C3ZA 3AR3A 2DR3A 2HWYA 2R1VB 4PSKA 2VL7A 3WHKA 1DQRA 3EFEA 4F6LA 4CGYA 5ICFA 3U09A 3GLGE 2FN3A 3HO8A 2O52A 4EECA 4F0JA 1E2GA 1XZDA 4TLDA 2ZJ5A 1W85A 2FV8A 3HR4A 3ORYA 2HHAA 3N1UA 1WV1A 4WMLA 2HK6A 2PAAA 5CDYA 3O8OA 3PC4A 4CIWA 2CLIB 1VJ1A 5ER9A 4AMZA 2FR0A 3I01A 1ZVJA 4C2TA 2FZLA 3IUMA 3JATA 5FLEX 4E5NA 1F9EA 1NKVA 3FSEA 1SUEA 5L3SB 2QZSA 3AI2A 1XIVA 1W52X 1P81A 4MVYA 2D5BA 1IU9A 3KQVA 1YKGA 1PV2A 1T4MA 2XGSA 4GI1A 4I9FA 5D00A 2WTUA 3H0CA 3H1AA 1A9RA 4URZR 5KSWB 1FY2A 4ER5A 1LFDB 1PWZA 2C07A 1YJAA 4TKVA 4MZXA 4I66A 4X63A 1ISJA 3OESA 4I4TB 1UDBA 2FEXA 4K9RA 4QG7A 4WFIA 3ZDZB 1CUYA 2JVKA 1M6VA 3HSYA 4YRTA 4G24A 3AXTA 2XOXA 4M6WA 1D1PA 3RS5A 3DVAA 4X6XA 5AMXA 3W9SA 3LFHA 2H7CA 3GLFB 3VR3D 4D4IA 1GL7A 2X6RA 1B6RA 3ADPA 1XWWA 3KKQA 4UKDA 5HQ3A 5BPFA 4H7EA 1GEEA 2WVGA 2B98A 1J0XO 4OYHA 1B3BA 2O2ZA 3P96A 3K2QA 1EDOA 1Y4UA 3G8YA 3E3OA 1OFHA 1ZH4A 4P4UA 4U9IS 5EHIA 4ZV7A 1U4OA 3EXAA 3LX4A 1ARZA 1X7WA 3K2IA 3I1YA 3TOXA 2WQ6A 4Y1RA 3T3EA 1RZRD 1JSXA 4D56A 4ETNA 5JOQA 1G5PA 1A77A 3QPWA 1KI6B 4J1TC 1KJIA 1NU6A 3JS5A 2XTJA 1PQYA 2FN9A 1DIRA 1T6BY 2XYQA 2H9IA 4QL3A 3SXUB 2OV3A 3MT7A 4NNJA 1G98A 2A35A 4CE6A 4E5DA 5J4VA 2JGEA 4UTRA 3N53A 3B1KA 4GDMA 4TL6A 5EJ9A 2JKZA 3OO0A 4N39A 3WBFA 4PYIA 4ZAFA 3MUNA 3LPDA 1II8A 2G1AA 2YNMD 4ALMA 4JT9A 3AI1A 4N6OA 1W1IA 2B25A 4GLLA 2OCBA 4G9BA 2FPSA 2FSFA 1QZXA 1PQUA 3CXRA 1FLVA 2MSWA 4JBLA 4TXHA 1DXQA 3AKDA 4CTNA 4EHJA 3VHLB 3O94A 5FUYA 1NZJA 1P7WA 2RGDA 3IKVA 5DTRA 2V6JA 1SXPA 1JS1X 2ZU0C 4O2RA 1L6RA 4CMHA 1RPTA 3ML1A 3ZOZA 5LYJB 1ODJA 3UJPA 3AOEA 3L04A 3GARA 3IDZA 3VPCA 2G70A 2HY7A 4NG4A 5J4HA 4MR8B 3CVOA 4DIDA 1VJGA 5A2GA 3JARA 1S2OA 3C7KA 1UH5A 4G0OA 4AP6A 5F78A 4M46A 4OHZA 2FEWB 4KQEA 2WKQA 3OBIA 3EYWA 3Q3EA 2NU7B 3MGBA 4HWOA 3BREA 1WOYA 4U6NA 5BWBA 1EK6A 2DPMA 5HDQA 1J8QA 3NHAA 2CHVA 2Y4NA 3NWEA 1M2EA 3I2GA 4QTXA 4QWMA 4KHZA 4TV8B 5CCDA 2QLMA 2ZQ5A 3D6NB 1ISIA 3KLBA 3DMYA 3WHLA 2X1VA 4KLCA 4B4VA 3CZ9A 5AHXA 5H1YA 2NPIA 1PX0A 2ZBDA 3HSKA 1PX2A 4B4KA 5GJCA 1CF2O 1PG0A 1YZTA 4M8LA 4AS2A 2I8CA 3KV1A 4R1MA 3ZNOA 4QUEA 3IE2A 4FSDA 4YBZA 3KZVA 1EVYA 3HB1A 2OQ2A 3EEBA 1OGJA 2ILTA 3NHFA 4XEUA 3ZTTA 1TLTA 3QITA 4P1ZA 2PWAA 1SKYB 5KYVA 2HCTA 3DNMA 4LXQA 4NAHA 4PBRA 3LRPA 1ZL2A 2IIBA 2VXOA 2XXJA 1M2OB 2QTHA 2H1HA 2I2FA 2Q1SA 3G89A 2VP2A 4RNCA 1ADJA 1NPTO 3W90A 5BMVB 4HNAA 2HWUA 1EUDA 1L7QA 3EA5A 4Y0NA 2B94A 4Y9UA 1IHPA 1R5OA 3LXXA 3AXSA 3KAKA 1MT0A 3AERA 3L41A 2AQHA 4FFBB 5FBRB 2H7YA 3IV7A 4FGWA 1VJCA 5A7FA 1G8PA 2YHIA 2ZWAA 2WU1A 1L7BA 1U28A 2GKSA 3VKFA 3O2QB 3ZIDA 1ZQ9A 4FE7A 3TQSA 1LDBA 3TM5A 1UWCA 2QN6A 4ARVA 1IDOA 1JTVA 3A4TA 3I12A 1JR3E 3WYAA 3G59A 2RGUA 1WMFA 3UY4A 1AQIA 2IWRA 4QT4A 2YHUA 5FLKA 3IB6A 2CMHA 1YR8A 3BRSA 3D1JA 4HEHA 4CMAA 2X19A 3OZUA 4CU5A 3QE4A 2FB9A 2JATA 3KBBA 1EEXB 5CW1A 3C6QA 3ETEA 3G02A 4NC9A 4HZGA 2GXQA 3KWMA 4LV5B 1UIMA 2CXTA 2FSVC 4H7IA 5JQWA 3MUOA 1U8YA 4JLVA 3LT4A 1D7OA 4I36A 3VR4H 1OV6A 2D1SA 2I62A 3PWSA 5CCXA 2WT4A 2NUPA 2ERYA 2SKDA 3GRPA 5CVJA 4LYFA 3FNRA 1D7AA 3N74A 3R5HA 4YP6A 3STTA 3VTZA 4GVPA 3ZTYA 4BKRA 4EABA 1ID8A 4GOKA 4NBLA 5CAEB 4CN9A 5CB4A 1UAAA 1OVMA 4PLWA 1V37A 4BNLA 1XVTA 2QLBA 4CMCA 1V0JA 1M10A 3FAKA 3BJIC 3VNBA 3RYIB 5ES4B 2CNOA 3F3YA 2ZJOA 3PHHA 3STVA 3RO7A 4P5EA 4Z49A 4MUAA 4WDQA 1EP1B 4FM9A 1MJHA 2XUPA 4GHWA 5ALXA 4BE7B 4XVUA 1GNTA 4LXIA 1E2BA 2MSNA 1GRNA 3EZ2A 5DHFA 5FOSA 4KAJA 2DPHA 1PV1A 1XZNA 2P8SA 2IT1A 2LVBA 4BP8A 4EB3A 5CBPA 2QTMA 1R3UA 3F3KA 1U7DA 4MMYB 1Q0ZA 5HCUA 1RYNA 4GPEA 1DCTA 3IUJA 1XLTA 1MFZA 1M8GA 5LOVF 3FVRA 1OWOA 3QKSA 4MUJA 4D3DA 5KQLA 1QTQA 1JDNA 3TIFA 4A0FA 4ENQA 1SELA 3I8SA 1HK7A 2H9YA 3R0VA 5C51B 3W5AA 3L01A 4XQCA 4PPNA 5IMBA 3AHIA 2Z5GA 1RWQA 1P2DA 1KO1A 4B3RB 5CPBA 1FTWA 1RXUA 2FN8A 4J0QA 4OU4A 3U4AA 2J7KA 1GPKA 2MHCA 2A30A 3UK6A 1Q7BA 4M9CA 1Y3IA 2P1RA 3EFOA 2QI9C 4W4TA 2XCRB 5IBPA 3RD5A 1NXPA 3DBVO 1JJVA 3Q4GA 3FTFA 1P1HA 4JJEA 5AKLA 4NONA 2AW5A 4QASA 3EVTA 3G8BA 4D41A 1DVRA 1UPXA 2CYAA 3AF3A 3U4QB 3M6WA 4IDCA 4Q4JB 3C6KA 1H2ZA 4P3OA 1LLDA 4IWXA 1U0EA 5FL7D 4RTSA 5ELXA 3NVKI 2EG9A 2IHUA 4IKEA 3D4OA 5K0FA 3U3MA 3ZI7A 3DE4X 3OP4A 5DE3A 4V2IA 1NVUQ 4BLUA 1F3LA 4QVIA 1IQRA 4EGFA 2UUBB 5EWJA 3X1XA 1DPGA 1LLQA 1RRPA 3L7YA 1OUMA 4GPIB 3TE6A 4R8SA 3SCZA 4KITB 5A7GA 3LG2A 3R0JA 1DEXA 3PD0A 3KB1A 3QA3E 2JFUA 1YJ5A 2WIBA 2VDLB 3RUAA 2RBKA 5D3MB 2V45A 4EA8A 3S68A 2L19A 4GPBA 2BAGA 4MUBA 4NV0A 5EY5B 4ENWA 2GYUA 4FYYA 2WINI 4WCFA 5GONA 4CDMA 4E7PA 5AUPB 1HSZA 5F21A 1IEVA 3AJ8A 4LX8A 5AM0A 4JVOA 3RAJA 2VZLA 2R6ZA 4BX0A 3ROZA 1WE2A 3BHIA 4BUZA 1HNXB 2B1JA 3N75A 5AHWA 4BO0A 2PX8A 4HH0A 1GPDG 3GLIB 4BUJA 2A5FA 2BRUA 3PNKA 4MWSA 4PC7A 2EKBA 3KOOA 5L6LB 1DP4A 2O0HA 4RIHA 2QQEA 5B7NA 2MWMA 2VDMB 3VOTA 1P1BA 1O6BA 5CG2A 1KI7A 3HCDA 1UC4B 3GEBA 4GYWA 5A02A 4OXIA 2XF8A 2OTCA 3NFRA 4TTQA 4FMBB 3WBJA 5CB0A 1E5DA 4FYHA 4DA8A 2VYNA 3AHCA 2JLYA 1EFPB 5HF8A 1BHJA 2XUZA 3V8PA 4DHWA 5IANA 2V9CA 2W2LD 3DE1X 4AUMA 2Q2NA 3OZGA 3UZUA 2FZCA 3HFSA 1VYHA 1ZGJA 2Q1XA 4X64B 2X1HA 4RV9A 3PHIA 4M2LA 4X3CA 1N8TA 2HA5A 1VE7A 1OF1A 1JZQA 2RGAA 4TRNA 4A10A 1Y0BA 2AYYA 1DQZA 2EKPA 1BQ4A 1MX3A 1VG9B 1OB5A 4UVGA 3G2PA 3GRKA 4R2WA 2D3TA 4BQRA 1A7KA 2WKRA 4J7UA 2K6GA 1SCIA 4ZI3A 4MS3A 2ZJ3A 3LY9A 5JVDA 2A5LA 4Q1DA 4PFJA 3HXKA 1PKEA 4QUBA 1AS3A 5IH3A 1OT5A 1J09A 3QW4B 3AR6A 5JUWA 1I7LA 4HDMB 4BNHA 3D1LA 3BXFA 3PRYA 5AI8A 2XNDD 3T06B 1IH8A 1BU8A 1CUUA 3TBHA 1W0JD 1G20E 3DONA 3WMWA 3M2TA 4FBMA 3O4FA 3JALA 4YLEA 2AFVA 2JCXA 3DV9A 1XDDA 3II6X 2BM1A 2ZSIA 3TLAA 5IM5A 4N12A 3EPLA 5K8IA 2QIOA 5K99A 3QVVA 5DHRA 2CCJA 4NBRA 1QVWA 5D1HA 2HQOA 3B9QA 4J1TA 4C4ZA 3RSLA 3R44A 1KEEA 3KVVA 3ANNA 3X1WA 3EGDA 1F8YA 2J07A 3I6YA 4F3KA 3NB0A 3SMQA 5C81A 1XZLA 4YXWD 2QD3A 1NVXQ 2I2AA 2LKDA 1VL8A 4HYEA 4XX0B 5JH7A 3MS4A 2ZIXA 2AUNA 1ISMA 4Y0VA 2YS6A 3S28A 5ABPA 3GJRA 3FPAA 2CL0X 1FPQA 1LPSA 3OCYA 4ABYA 2DR2A 2O50A 4FOOA 4N3GA 3TL6A 3K2BA 2ZM6B 3W2IA 2ZZKA 2BFPA 1X8KA 4LWOA 1CUGA 1L5WA 2WJAA 3EUAA 1PJCA 4JZYA 4PSVA 2VK1A 4LQCA 2YVQA 2NZUG 3U19A 4KSCA 1DV1A 2JB9A 1M1NA 4OQPA 1FQJA 3U4QA 1GKYA 2ZUWA 4WD3A 1C29B 4FOSA 4Y6PA 1VB3A 2GPJA 5KYWB 3OA2A 5IVIA 5TS3A 1QIKA 5FUWA 2CLSA 1Q0UA 3M49A 2OD9A 2UZ4A 3S2SA 2VK2A 1PP4A 3C1UA 2EJBA 3UHAA 1RYEA 2RCNA 4IDHA 2IE0A 4DBLE 4M49A 4MAAA 5HIMA 3T4XA 2Y1CA 4GX0A 3ECCA 2J41A 5T8KC 2UXBB 1IK6A 1Y34E 2A78A 4KQMA 4MUNA 4ZVQA 4EP1A 4YTEA 4EMSA 1VLZA 4GWGA 1NLUA 2PTHA 4EY4A 1X80B 1Z3IX 1KK3A 4IVPA 1W4RA 4S2EA 3WGHA 3ISVA 1NRIA 2OHOA 3P4UA 4BFSA 4Z7NB 5BWLA 1EUYA 1PWHA 3V8EA 4YI5A 4DMUB 1I6MA 3ZU5A 3WGUA 1S2GA 3D7NA 3P2EA 3AYXB 3QU2A 1XO1A 4FE4A 1ZIOA 2V4MA 1V7CA 2QN1A 2JFZA 3R6TA 4GIBA 3UWSA 4C4SA 3MA0A 4JZKA 5BSUA 1JG4A 1KPHA 3F74A 1YCFA 3KD2A 5BR8B 4EW6A 1L5KA 4LBZA 1Y5MA 3W2GA 4KYTA 2QGNA 3GEEA 1RACA 1PNOA 2P9TA 1HKHA 1KFEB 2B36A 3H3FA 4EA7A 1TZ2A 4N82A 2HQRA 1MX1A 1DKQA 4FDUA 4ZC8A 5JYBA 3HNRA 2BV3A 2UUOA 4YWHA 5TVKA 3RK1A 3T6KA 4C6TA 2UUAB 5TQJA 1FYFA 1E6EA 4Q4LA 3Q8LA 3GBSA 4CQMB 2J0SA 2ZSFA 4TMTA 1P0IA 2C5EA 2NXJA 1SU4A 2W2KB 2C42A 4N0DA 4W5TA 1GZDA 1E2DA 1IHUA 4XGNA 1D4ZA 2YWCA 5EEHA 2JANA 1TMGE 4RA9B 1BFDA 3Q7PA 1ZFNA 2FG6C 1L5FA 4BDTA 4Q6BA 3PFKA 1ODTC 2FLWA 2FZGA 4QHSA 1TTQB 5FCDA 3WLQA 1W36D 1ENOA 4B3CA 1Z2NX 4RD4A 3E9EA 2IHKA 2VF4X 3PRKE 1FUUA 1OROA 4DT1A 1R0YA 1N6KA 2GZ1A 3TXXA 3RG2A 2AD1A 4BMCA 2V7TA 4G1CA 5G02A 1OH6A 5B1SA 4XZ3A 4S1TA 4Q48A 4GW3A 1DOAA 1U63A 1CU1A 1ZRNA 3KJEA 1V3VA 2CDRA 2QIPA 4HXEB 3EJ6A 3HN7A 4ZO8A 2QRJA 1J0CA 3I2JA 4DYDA 5AVOA 1YI1A 1SVNA 1T2EA 5BNZA 1FXWF 4OKSA 3OQJA 5J5VA 3RHFA 2WIKA 5BYBA 2Z83A 3ICQB 1Q6YA 5HKKD 2HWXA 1XC7A 1V47A 4Y2VA 3W1WA 4ICIA 4XM0A 4FOLA 4R68A 1XYGA 1EU1A 5JNVA 3QEAZ 1T8PA 3IKMB 4LV6A 5G3ZA 4ZI7F 1BX3A 1O96B 1PNTA 1KI6A 4K9MA 1QFZA 4B5LA 4WNYA 1Y80A 3B48A 4JY7A 4G5QA 1A5TA 1JSZA 3MRTA 4BEWA 6ADHA 1JDBC 3WJ1A 1TA4A 4YYZA 3HJBA 1C3EA 4GGPA 2E48A 2QR5A 3F73A 2G9ZA 1EZZA 1RLOA 2WM3A 3OT4A 1ZGAA 4UJ3A 2JFNA 3AP3A 4EEZA 2C1EA 1E7YA 3C4VA 3MLAA 2Y9MB 2W6MA 4MUIA 2RHRA 3RC9A 2C5GA 1AKMA 2V7XA 3AOGA 3T1QA 2DFPA 1P19A 3OU7A 4ME6A 4EHFA 1VBFA 3HXQA 2NMVA 2A0XA 4KMMA 4LA4A 4MUMA 1T3TA 2QZ4A 4QG3A 3HUTA 1ESEA 2IOHA 3T3IA 3ZG6A 4R81A 3L2OB 4YAKA 3P0JA 3GNSA 2NSDA 2OSBA 5HVNA 3HKBB 1AUOA 2BR4A 4DLSA 2HJSA 4O4JA 2QYOA 3HXTA 3FJOA 1U80A 3GJSA 5D6NA 3N2IA 3E4DA 4WEOA 3OMXA 1OLOA 4CM7A 1R64A 1U6KA 3PDIA 3TR0A 2KBEA 4XFKA 2CNBA 3JARB 2QLLA 4Q5IA 1Q22A 5FTNA 1IBCA 5DX1A 4PTZA 4BNMA 3BG5A 2P9EA 4N7JA 1YA4A 3Q2KA 2NU7A 2G4VA 2G5PA 4PLYA 2J33A 3PYLA 4NNPA 3NM6B 5F7JA 1NSYA 4NH4A 5KYTA 1XEWX 4FTWA 5LA6F 5EJEA 3M81A 1EPUA 2FP4A 4F2WA 3KB6A 3WRYC 3F7OA 1CRZA 1OMOA 1WOMA 1UBRS 1YMQA 1XK7A 3TTVA 2YJ5A 5JFOA 4OQXA 4MB6A 2GM5A 1VL0A 4JVLA 5KTSA 3COWA 4W7SA 1JQEA 1KR5A 4G0NA 5JXIA 1NDQA 4P34A 3FNBA 1UT6A 1PFKA 2OP1A 5DK6A 3DZ8A 2IBTA 2D62A 2PUVA 1MD9A 5ER6A 4KPFC 5K0ZA 4YRNA 1UKVY 4HGYA 4ZYUA 2BMEA 2YOFA 5KOYA 1TO1E 3BC1A 2F62A 1X8LA 1JYFA 1IK4A 1DADA 2Y0BA 2JGIA 4HOYA 3EVDA 4JR2A 4UCFA 5DHAA 4L16A 5FB3A 1REQB 1F06A 1P5RA 3GGOA 2NVBA 4F2DA 3ND8A 1E5TA 4HNAB 4LTDA 3SNKA 4J4BA 3HACA 1S7CA 1Z0FA 2JD0A 3BE5A 1YE5A 4UTNA 4QTZA 1TRKA 5AI9A 1Y5LA 3NHZA 4IS2A 4NBVA 1E20A 5GMOA 1W4BA 3SGLA 4AY5A 2ONYA 2QXYA 1VGVA 2AQ8A 2OZPA 1BWQA 3RSHA 3UYLA 2G25A 3LC7O 3LYAA 3K92A 4PS1A 1F0KA 4D6XA 4H6PA 1COWD 3H65A 3QPDA 1N3YA 1X7YB 3ISJA 2BRUC 2SKEA 3G5UA 5AJVB 5AM4A 5F3RA 4ZEXA 3TBFA 3L4JA 1I5OA 3ZWDA 3TW8A 5JS2A 5IWCA 3GC6A 4D57A 1JR4A 3GQBA 1L7OA 1HSOA 4TLLB 4C2UA 1FX0A 1LLCA 3MJEA 5HKBA 1CC1S 1NPYA 1X1RA 2JVJA 4DQVA 5HKOA 3A9VA 4FNAA 4GLOA 5I7FA 5KWVA 3ENVA 3FFTA 3WRXC 5LFAA 4ZQIA 5LYJF 1YJQA 4TV9A 2Z6UA 1PK8A 4ZGBA 1N5OX 2LDBA 4FLFA 4P93A 5BSHA 4JENA 4MHTA 1GV0A 3LQ4A 4BJ3A 1E9DA 2I34A 2OO3A 1K4MA 4HBZA 2NXNA 4OFXA 3DCYA 5KX5B 3PHLA 4ZTUB 1VIAA 1W8DA 3AETB 4X61A 2NWQA 4ZVVA 4B9EA 4RCVA 3B13B 3IUEA 4FQ8A 3PJFA 5JO9A 4D9JA 1AHPA 3OQHA 2YMPA 2Z2ZA 4EJ2A 1ESMA 3V5NA 3GCGA 1QKKA 3OQ1A 4C89A 2EFHB 4TS9A 2UU9B 4YAWA 3SVZA 4K6GA 2QW0X 2W6NA 4DDMA 1U31A 3ZCPA 2DUWA 2WNIA 3CZ5A 1JBEA 4AG3A 2W6CX 3MFYA 2IHZA 1LI5A 1Z4LA 2OXIA 3DDWA 4G1EB 1GTMA 2J3QA 3LQKA 5KOJA 4G4SP 4IIJA 4OLJA 3QX9A 2C5FA 2J9RA 2CZGA 3U4IA 4OUKX 1UPBA 2HBZA 3MCTA 3NORA 2I1QA 1JAXA 1E77A 1EZ4A 4RQAA 3UH1A 2BFDA 3O4IA 3SKXA 4DRXA 1HE1C 2ODTX 1YK0A 2VNSA 3IP8A 4KI0A 4UE3S 1JIJA 3HKCB 1AJEA 3AB3A 3MW8A 3A9WA 3THOA 1XMPA 1Y1LA 4BLRA 3BUSA 2ZRJA 4AKSA 4FGKA 1BXRB 3N9IA 4B7CA 4X90A 5JNTA 1QYDA 1IXKA 1OLUA 3BSFA 4O63O 2QE6A 2W2PA 3ILXA 4GE0A 5CFQA 5BNTA 2R8XA 1FU8A 4DFDA 2PGJA 5CDGA 1D03A 4UMEA 1NN0A 5EWLA 1STOA 1WHTB 4J29A 3PJRA 2BFMA 2EL7A 3BZWA 1QBGA 1XCPA 2IEDA 5DOZA 4XDYA 3VSDA 4YV0A 3JR3A 4A8JC 3D8TA 4IDFA 1WDLA 1UBUS 4GBMA 3PA8A 4MJ3A 2UYQA 1G8JA 2YUTA 3BEOA 2JCBA 4EI8A 2ZVDA 1HTWA 3RSGA 3ZNPA 1QVRA 8MHTA 3HCAA 4DQXA 1A3CA 5JI2E 2C78A 2D00A 3Q8KA 2UZAA 3NUZA 5GTDA 1G8YA 4IXDA 1QU3A 3NBUA 5DI9A 2CDCA 3FKSD 4BGUA 2NSJA 3L1KA 1KOFA 3CZ4A 1RQRA 1FMLA 1M67A 2G5CA 3W3AD 4V3BA 4Y2GA 4E11A 2FEAA 3IEIA 3HDHA 4YJ2F 4YP5A 2QRQA 1HA3A 4LOIA 2AG0A 4HFMA 5J2UB 3QFHA 5AVUA 2XRYA 3DVAB 3IOBA 3CKYA 3RVJA 1OXKB 5K51A 4C4PA 1ZP6A 2JAXA 3RYTC 3GZ4A 4ZIRB 5L3RA 4FN5A 1RQXA 4PSDA 2K2WA 4UBOA 5K8UA 1ADGA 3L05A 3OC0A 4HNHA 1PV4A 4MJXA 3PPVA 3EG5A 4EFDA 3AI3A 1DX6A 1U9YA 3KEMA 4Q6WA 4E88A 2JLBA 5B4TA 1ZIYA 2Z1DA 1X7GA 3FIUA 4M7WA 1XDGA 1GP2A 5BY2A 1D2CA 1EJ2A 3VYUB 2XTMA 5FBQB 1CVIA 1X7ZB 5I7UA 2COEA 1F38A 2IEZA 1BMFD 3DMHA 4B6PA 2AXPA 1N5DA 2GA8A 3LY5A 2O2IA 1HX7A 3GEIA 3GW8A 4LY0A 1GNPA 3IPCA 3PFNA 4YXWA 4MW4A 5A2QA 2Q41A 2B2CA 1YA8A 2JFQA 1S6YA 1PQPA 1TM2A 1SA0B 1X1DA 3B1ZA 3O4GA 3Q40A 5G41A 3TO5A 1UJ2A 4LXUA 2NZJA 2CWWA 2ZVPX 5ALWA 7REQB 1S2IA 2J67A 3GT7A 4PQEA 2XUFA 3L49A 4Y6GB 5HJ2A 4DRZA 5KYGA 4MGZR 4B43A 1E3WB 2H1LA 1U4NA 5F2OA 1H5UA 2WJPA 3DLHA 4RGQA 5KDOA 2HQ1A 1OH7A 4DILA 1ZEMA 1NL3A 1JHXA 4L02A 4AYTA 3L0PA 1AURA 4HH4A 3LBNA 4BFXA 4U2FA 3ECAA 3EDYA 1MAAA 1Q1ZA 4GMGA 4J03A 3RNLA 3M3PA 3P9RA 4XWAA 4LDNA 1BIFA 2KS6A 1G8KA 4PICA 1O6CA 4CCAA 3VR2D 4F06A 2CUKA 2AXQA 4E2YA 4AIRA 3FPJA 2QMUA 4JLDA 2VDJA 2WPNA 3OCXA 4I0WB 2XDQA 3KVNA 1X2EA 2IUYA 3DCIA 4KQFA 4C2AA 3ZCUA 1Y89A 4DA4A 4H60A 1TF2A 2YJGA 1B8OA 4MS3B 4FP9A 3RJ5A 4YT2A 1NHWA 4G9EA 4BYMA 2BD0A 4U2GA 2Y2VA 1V26A 4HNRA 4OB7A 3V1KA 3WO1A 1LK7A 5EUCA 1ZD1A 5KVSA 5CHYA 1HLPA 2W58A 4L5JA 5EA2A 2Q0HA 4L4XA 3TTWA 3N58A 5CRIA 1LDYA 3AKCA 1BKDR 4Z4IA 3TUJC 3ETJA 4F7DA 3A2KA 2WC1A 4RMHA 1GQRA 4BWFB 4KIFA 4AN4A 3TFOA 1Z5VA 3SE7A 3ORRA 5TIIA 1ORDA 1WUJS 3ESXA 4F93B 5KCZA 4XKJA 4IHJA 1IOWA 2XA2A 3RU7A 1H2WA 4AW9A 3FCEA 4W1RA 5GPBA 4GO1A 4GVLA 2GJ9A 1N78A 2JRCA 3ELUA 2HM7A 3G2LA 4K87A 3R2JA 4CF6A 1NZDA 2G0NA 1H8EA 1MAUA 2P30A 3ZCVA 3JWEA 2J9ZB 1GCOA 1JQ5A 3EGDB 3GPDG 3OEEA 2PSSA 1CD5A 3N70A 3LX5A 4NBSA 2QN7A 4KIGA 2HGSA 2R5NA 1FE8A 5KVAA 2TMKA 5IABA 3MLEA 5ALZA 3EGXB 2DWPA 1KYZA 2Z6QA 1KMQA 1U65A 3DDUA 3OZIA 2PD4A 4TWAA 1EESA 5TE9A 5KPDA 3UNXA 1SHTX 4X1KB 3ZU3A 3LVQE 5TLSA 3OEYA 2J3KA 1QO0D 2OAGA 4WN3A 3V3KA 1PR2A 5BQPA 3WXBA 2VJKA 2R60A 2RJ3A 3UICA 2OKCA 2BJWA 2CK3D 3FW1A 2PUTA 1K6EA 2QW8A 3EW7A 5FWYB 3TX6A 4QTYA 3FOWA 3OEHD 4MRAA 3VR6D 2A33A 3EXFA 3COYA 3K0AB 5FD8A 4DWJA 2Q99A 1VMEA 4HRXA 2C5SA 5B3KA 5HR5A 2DFLA 3H2ZA 4B09A 1RI5A 2AJBA 4TQUS 3TAUA 1VYTA 2I5PO 1OOEA 2C29D 2YV4A 1RYFA 3DWIA 1FMCA 3NFYA 3QMVA 1LXCA 5KAPA 2CNWA 2DPXA 2DPGA 4ZEWA 2FFHA 2Y3IA 1W5AA 4MQ6A 2BMVA 4RHXA 4BCBA 4R9VA 3U40A 3PITA 1G1AA 4X85A 3FI9A 1G16A 1YOBA 1KWKA 2X9VA 3QYFA 3AF6A 1LWNA 4C5CA 2FP3A 1X3LA 1DAKA 2I76A 4RF5A 1YVUA 4G84A 1FFXB 4G8CA 4BNWA 5CNIA 2PPLA 3OU2A 4DQUA 1ZUNB 4NPAA 4PYQA 1IOLA 2C4NA 4O25A 1VLQA 4IEEA 4JLWA 4F85A 3FOEC 1WB9A 2AF4C 1TGVA 3DO6A 3FWNA 3ZS9A 2PBRA 4H7FA 4BNIA 2PZMA 3H1PA 3QOFA 4MVJM 1LBHA 2F3PA 1OR8A 5H0IA 2YZKA 1SVIA 1PYDA 1FVXA 3HDGA 5TQ2B 4S2UA 1X77A 1AXGA 2CLFB 2RFLA 2ZITA 4QU0A 3SX4A 1Z45A 3T4PA 4CT4B 4L0CA 1Z2OX 4PE5B 1ISHA 3G2HA 3W8EA 4KXNA 5B58C 1YBHA 2GHRA 2ZAGA 3L7DA 3T3PB 3EAFA 3FZYA 3K0CC 1AX9A 2BR5A 2CFRA 5EXSA 2NU8A 4X97A 2DBQA 3CRW1 2EWWA 5KNBD 3V55A 1Z47A 3KDPA 4DDKA 4BQIA 3BIFA 3FWZA 4BX3A 7MHTA 3NIBA 1ODFA 4O1MA 1VB5A 4RA9A 4BXOB 1DAMA 1T2AA 4OHUA 4BNNA 1KY3A 1WW3A 3V8VA 1E1RD 2OZVA 2D1YA 3EZNA 2BEJA 4RPLA 2WWYA 1HYHA 1YS7A 5IBQA 4JOCA 1V5GA 3KUUA 5JBNA 3KQPA 4LGVA 3I0MA 1XX6A 4QYWA 1W1UA 1ZA1A 4J1SA 4GXTA 4V0QA 4CV3A 2XAUA 3MYYA 2X0JA 2ZIZA 4MV8A 1PE0A 4TWJA 3RM3A 3SKYA 4QGBA 3VC1A 4YB8A 5B7PA 2XW6A 1L4UA 2X1MA 1UJNA 1P9LA 5L53A 1NW6A 3PB3A 4S1WA 5L6MB 3M6AA 4WKBA 5EOVA 4YONB 1H2BA 3RR2A 1GUFA 2EV9A 4YAUA 2WIJA 3QUTA 3E9QA 3I9V6 3BL8A 3DDNA 2JIMA 3PNSA 4JX8A 3A2LA 3LUBA 4OK5A 5DTMA 2H92A 3BS4A 4EG0A 1H1DA 1ZOSA 3GUUA 4XOUA 2GILA 1KZ7B 2PRSA 4G41A 4GWKA 4ER3A 3B85A 2Z9BA 4P80A 4DR1B 1JXQA 2XEDA 4X0EA 1E0AA 4GR5A 3SQXA 3EDCA 3WLKX 5ARCA 3QG1A 3V32A 1KI9A 2DTEA 5E4FA 1Z0KA 2XKAA 2CYCA 1R8JA 1R0XA 4L8FA 3GFVA 3OJXA 1E58A 4MWGA 2LCQA 5EIXA 3P8ZA 3AV0B 4ZQFA 1I7QB 1ZISA 3FBGA 1N2CA 1PL7A 3GOQA 1MC4A 4WUVA 4UU0A 3VDMA 2BN4A 4KXQA 5BPHA 4JU9A 5SY9A 4JUDX 1POWA 4Z0NA 3EQ7A 3HYSA 3FVQA 4BTVA 5FQNA 5A03A 2RIPA 3FDXA 3A6PC 1R0KA 4ZT6A 1ZJYA 1ZMXA 3MQ4A 3TQTA 2YCLA 2OB1A 2AOUA 3SDSA 2BDTA 4U2DA 4WY5A 4E07A 5AVRA 5KB3A 4O4IF 3H1BA 3H5LA 4FYWA 4NXNB 3OD1A 4X60A 5MDHA 2WJJA 3PTAA 4XEHA 2E4AA 2FSVA 5BQOA 3SR0A 4RDIA 4AN0A 4JNKA 3ZV4A 1Z6XA 4KBYA 4JLAA 2HK7A 2I65A 4AUKA 2B3DA 2PH7A 4LJAA 4BZZA 5MHTA 2QX8A 4JT4A 1BKSB 4WK0B 3FDJA 3A26A 1EXVA 1GGJA 1O4VA 2DFVA 3F6YA 2XNSA 2XMCA 3I1JA 3WRVA 5EERA 2WT9A 1JDJA 4OQLA 1DI0A 1WPRA 2I1LA 3NVMB 4DR3B 3CVJA 3T5GA 3PC8A 1KK1A 1TDJA 1E63A 5JCJA 4J0JA 1OTYA 1U2DA 3H5VA 3LT2A 3RUHA 5DT9A 1U1GA 3TQOA 2O8EA 3NC4A 2H0RA 2O2SA 4ML3A 3OE5A 2O5VA 1U4SA 4LIPD 3ZHRA 5AESA 4WZAB 3HK2A 1AS0A 3TZ6A 3VYTB 3VZSA 1JGTA 2WW8A 1QHFA 2I2DA 5BXYA 2KQUA 2W2XA 1ONSA 2N75A 4OFWA 3UUWA 2NZYA 5A05A 4JEIA 1VLJA 3QXSA 5ILGA 4D9IA 2GTIA 2PT5A 2XT0A 3B6EA 4J4TA 1A9XB 3L02A 1MG0A 1N33B 4FQ7A 4DMLA 4IGAA 4IOJA 2G1PA 1T0BA 1Q84A 1VE1A 3L4BC 5IYZA 2J48A 1ZOOA 4BBZA 3LY8A 1GR0A 5JRDS 3AH8A 1SUIA 1UKBA 2XZPA 2J85A 5KI6A 3E53A 1QG6A 4M8SA 2RB4A 4ER0A 1G3MA 3H5RA 5FRDA 1CYDA 3ADOA 3OSUA 2CUTA 5EJ4A 3O4JA 2PSFA 4CEIA 1Z68A 2ZRDA 3VA7A 1BMFA 1M76A 1SOUA 3LGAA 1CP3A 4PPQA 1YMUA 4AS3A 2XD9A 4UEWA 2ZUEA 1JXMA 3ZR4B 1IVYA 1WLSA 2D2XA 4QUHA 2OM2A 1A4UA 1L4LA 1SD1A 2XE8A 3IR7A 4FOTA 3ROQA 1Y1KE 2CHEA 4PYKA 5EZYF 3RVMA 4H3KB 5JAMA 3NYWA 4ZANA 1IYZA 4HR7A 4R05A 5FP0A 1PZFA 3KZ1E 3VR6H 4QBGB 4XDGA 5JAOA 4TTAA 4X41A 5KNCA 5HE9A 4BFUA 3V48A 1P3JA 5DLDA 1VKJA 2QRLA 1P74A 1FP7A 2DLDA 2AR9A 4LFBB 1DRVA 5E2IA 4EH1A 3LLMA 2AJTA 4N5IX 3GNLA 2J6HA 4Q47A 1GQOA 1T34A 2Q6OA 3BAZA 3BICA 3L0DA 1RSZA 1T1JA 2FPGB 1R8SA 1KBQA 1L7PA 2CC2A 1M83A 4ARUA 2VSFA 4JXXA 1XI2A 2PRKA 2PUEA 2Q5CA 2CFTA 5CP8A 4XWWA 1MJNA 2O8CB 1YDMA 2PBLA 3ZWAA 4ZHQF 2LUOA 3ROMA 1N1EA 3QPBA 3ZJ4A 3W3AA 1GQQA 3AHFA 5C8YA 2B8EA 3LHIA 1HO3A 3KOMA 4GPZA 4WT7A 1YQQA 1X8XA 3AUFA 1XCOA 3EY4A 1T5OA 1WVMA 2M6KA 5CEJA 3P0IA 5KTYA 1CNFA 1G5IA 2GBCA 2J45A 1GFZA 1O7JA 2HL6A 3QYJA 4MW2A 3WFZA 5LJLA 3B1YA 1OSNA 4B32A 2ZJ8A 1XAHA 1G9SA 1A5ZA 4L27A 2GZ3A 3P20A 4BB9A 1FFHA 4N8EA 1WPQA 2FFBA 1VJTA 2BFDB 3Q3GE 3LDUA 2VZ9A 1C7QA 3PI6A 4MP3A 4RDCA 4WLFA 2QROA 4G2TA 4R8LA 4V39A 1U99A 1WVGA 1JFLA 4GC9A 5HNKA 1M3SA 2ZI6A 3T1HB 1DAEA 2X5KO 4E6PA 2JIRA 1SKMA 3ORHA 4OFBA 1OZFA 1U0FA 4C3OB 2H18A 4EITA 3GWZA 1YQWA 4ROTA 5IT4A 3AZQA 3EBLA 3PQFA 4OIFA 4Z2YA 4GXQA 4B83A 4GKBA 4X84A 1OYYA 4BNZA 1M1XB 4RTOA 4XYMA 2VDVE 4O2BF 1SD5A 1V2HE 4IDAA 5BYJA 1MX5A 3TX2A 3Q11A 4RESA 2IK8A 5CJJA 2IZ6A 2F7SA 1R5BA 2QF7A 5E0OA 1LDGA 2QMQA 3RV4A 2FQYA 5HFJA 4NXMB 4JJ6A 4JLKA 1PFVA 4GE3A 2GASA 3BMOB 4PWZA 3DZFA 2DT5A 2X0DA 1NSFA 2LWIA 4FSHA 3UK1A 4ZOBA 4YBRA 3OF2A 4DW8A 2ZRMA 4FFSA 2AH5A 1JKXA 3FWHA 4IF4A 5B2EA 2JHPA 3QBJA 2OT3B 1MN6A 1XHFA 3MINA 4FYKA 4M0LA 2QX9A 1G3RA 5SV2A 4RGYA 3WB2A 2B99A 4NARA 1YQXA 2AE2A 4U3JA 4D3FA 5IJZA 4KN5A 4HDRA 2E18A 1U90A 2WSLA 2VZ8A 2GKGA 2IX9A 1OFTA 2JBAA 5TXGA 4EQ6B 2BOVA 1K2WA 5AD1A 3SI7A 3DQQA 4B7AA 1HT2E 3TSCA 3K9LA 2ZB2A 1X92A 2P2NA 1PS9A 2IL1A 2NVUA 5DH9A 5AW9A 1MKYA 2AK2A 2PA3A 2VEDA 5HCNA 1QRRA 1T25A 4MYCA 3REQA 1BMDA 5TMEA 1SVWA 2IU6A 2HRZA 1QHSA 1SVLA 2JIZD 4FFPA 1QNFA 1GSIA 1M6HA 1X38A 5F7XA 3V2GA 1C8VB 4GOND 4NQZA 5JWOA 3B3AA 1OTHA 1I0IA 3D2CA 4GMXA 5T8KA 3PJDA 1H4QA 2O59A 4JXKA 1Z73A 1V35A 4RVNA 1SG6A 3OFKA 1MO4A 1LC0A 1L7XA 1YE8A 1YVDA 1Z3CA 3PR2B 3A6KA 1CNMA 1R7RA 1WCWA 5A6SA 3C48A 4FYXA 2WWFA 3C1AA 3JQBA 4LDJA 3P2IA 4PG4A 3HM9A 1AG9A 2NNLD 4D0LB 4TYNA 4I3FA 3V33A 1S01A 5DIFA 2WWVD 2HPVA 3JZIA 1UKCA 3QVTA 3GDOA 4O4LA 1R4MB 4BGEA 1J9EA 3IUQA 2GXAA 1KOGA 4HAVA 2GRAA 2ORED 1PCXA 2EJUA 3NDRA 3ZJ5A 1Q7RA 3ABIA 1O08A 2XYVA 1GQFA 2N1BA 1VE9A 1VPTA 3L0YA 9ATCA 1EX9A 4ZV4A 1H1LA 2HA3A 2KLHA 4DV3B 3ZX4A 3REGA 1LRLA 1B6TA 3Q41A 4I50F 3GZNA 2DPLA 3OA0A 1PGOA 2PS9A 5CH5A 3GFFA 4DEXA 1DJOA 1AKRA 2PX5A 2I3GA 2PLFA 2WLSA 1IY1A 1QB7A 2YZGA 3A37A 3L7BA 2C2BA 2Z4RA 3NO4A 4QE3A 1LBQA 4XSGA 2ZUDA 3WGQA 4EZIA 3IV6A 1IDN1 4BUCA 4EG3A 5IH7A 3FHTA 5EI5A 3Q9SA 5JT1A 2L0XA 1NVKA 1NBOA 2JGJA 4YJGA 2R11A 3GBVA 3AEKA 3VZQA 2HZ7A 3MQ2A 4DVGA 3FWPA 3DL2A 4D96A 3K5HA 4Z4FA 1BMTA 4KRGA 2GSDA 2Z43A 1L5SA 3L4SO 1ZVMA 4J16C 4ZQHA 4DNXA 1WXXA 2CJWB 1JQDA 3HYNA 3ESRA 5B5SA 4UPVA 1QMPA 5EP4A 3AB7A 3LQYA 2XJ9A 4DLRA 5BXQC 1U0SY 3AKEA 3WQQA 1N2JA 4OKNA 4HVCA 1V8BA 3QRWA 1UMDB 1XDBA 1XTRA 4UM5A 5JH7F 1E2KA 2FE4A 1P4GA 1XQWA 4Q21A 4MS1A 1KR2A 2E3JA 3GP5A 1JAIA 3NHWA 2X77A 3JAKB 3JQBC 2CLEB 1QHNA 3NZEA 4IINA 2DHEA 1SCAA 4J9VA 2ZVJA 4GRDA 2FE1A 2FRXA 3RU9A 2LPMA 1REQA 1XALA 4G6ZA 2WPDA 1F6WA 3GHHA 1RBMA 1UXKA 3M6LA 4ITRC 3OOEA 3JWGA 3RVBA 1GOTA 4WY8A 5F9HA 2HFKA 2OXCA 2KX7A 1OVGA 1T8TA 2IH5A 2QK4A 2QY9A 4B8ZA 4DSTA 3QFCA 3OUZA 4JBNA 1JAHA 2FYTA 3GUVA 3PNLA 1K27A 1WV0A 2QTAA 4H1UA 4L8GA 4OV6B 5K3FB 2R85A 3K0KA 3N5CA 1QNLA 2C61A 2QP3A 3CXUA 5FF9A 1FOEB 3QMMA 1NVAA 2CEKA 2QG4A 4X1KA 5A06A 1HRDA 5H4HA 3ZDFA 5E2BA 2BJHA 4C04A 1ZG3A 2LDXA 1YBAA 3GA7A 3UW1A 4CN8A 2XZTA 4IRXA 2CLCX 2EARA 4XARA 5DYYA 1T9AA 4ITUA 5LDDC 5K3BA 4WZBA 1RHJA 3I62A 4DCTA 3OZTA 3LUFA 1E9BA 2WR8A 1G42A 2ZYWX 3GIDA 5JMTA 2D8AA 4LK3A 1Q0SA 3QTTA 3VKUA 2FUNB 2QTFA 2WU4A 2HXYA 1XWIA 2JGDA 2ODNA 3I92A 1FU7A 2H7VA 2E5FA 2Y1OA 4HLUC 1DX9A 2IGBA 3WWOA 5CA0A 3ZHYA 3RRBA 5KC8A 4ZRDA 1H0KA 3ET4A 5KKNB 5KX5A 4EW3A 2C54A 4G5SA 2ZJ0A 5ICMA 4Q01A 2ID8A 2R7LA 3JTMA 5FO1A 1XD8A 2Y1DA 4LZNA 5DYTA 1PYOA 3D2BA 3TDMA 3FUXA 5DM60 4IZIA 3B9BA 1JJBA 3KTAA 2IF0A 2CL5A 2P2CA 8AT1A 4MUEA 5DNWA 3B3GA 3R9WA 2ZPTX 3G9UA 4GMFA 1X9GA 5LZ8A 3Q72A 2GN4A 1NBME 2ZIFA 3D6VA 4PR3A 4RA6A 1P17A 3VVBA 3X43A 1IOVA 2BCGY 2VJAA 4GUAA 4DLLA 4EFMA 2RKBA 1CCWA 4PEVA 2A9QA 1WD5A 4Q1EA 1V6AA 1P6XA 3R40A 3GVPA 4ALIA 5JXHA 2P69A 1RYMA 4KZKA 2DLCX 3IR6A 3LJKA 1C1HA 5TY0A 5FV4A 1NWCA 2P8JA 3EOAI 3K94A 1M2GA 3KK0A 5FUMA 2J3LA 4P5DA 5I4IA 2WV7A 1DKUA 2CHFA 4M1SA 2NP6A 4OH1A 3IODA 3NLLA 5ILOA 4KV9A 2BBOA 1PJBA 3FPEA 5IXSA 1R27A 2PEZA 2WA2A 5C8DA 3IBTA 4U9HS 3PPYA 3KQTA 4ATNA 4XPZA 5CITA 2I4NA 1SN7A 1QOZA 3LNCA 3K3PA 4K88A 2QX7A 5REQA 3RFVA 1RRMA 3N6VA 4RZ3A 4MRSA 2EJCA 4EY3A 3TMYA 3PF8A 4M0MA 4XTCS 1K1EA 4P9NA 3DLBA 4OLHA 3QKIA 2GWHA 1JQ3A 3RUDA 1I36A 4WXRA 2ZP1A 5IEJA 2C2MA 1QYXA 4JLJA 3K96A 1F3OA 3T5MA 3AFNA 1NBWB 2C9BA 5LQRA 3AG6A 2G83A 4TUYA 4GQAA 3M4YA 4TXMA 1M7GA 3IAAA 3UTCA 5C35A 1HR0B 2ONZA 1AH2A 2WTXA 1F51E 3D6JA 4J3NA 1EZ1A 4YRIA 1I2BA 3RBZA 4DGSA 3H4TA 1CIPA 1CJTC 2V65A 4NMLA 4QJIA 2XUKA 4X7RA 3HVKA 5F1PA 4URHA 4BNDB 4N0EA 2GLUA 2RHTA 3D6AA 1BTOA 2GPSA 4FZVA 2WHYA 4KOEC 2GCGA 3HUUA 3HCBA 3I1FA 4NQRA 3HM2A 3MCVA 3RYHA 4MP6A 4MV7A 5EKTA 2HIMA 3BGIA 1WTAA 4WBNF 1P44A 3UGQA 1IZ0A 2IZZA 5LQJA 1EE2A 1V48A 2AZMA 2DWQA 3JV7A 5DHSA 3SVLA 3H9UA 2W11A 5GJWC 2VUSA 1MA0A 4Y2YA 3E3LA 2JIQA 2XUAA 2PKWA 3N2NA 4JQYA 5HILA 4CI9A 1UKAA 2YVKA 3QUCA 4CR8A 2WSBA 2NTNA 4WKPA 1D09A 3FGOA 4UUQA 2PWPA 4DLVA 2ZIAA 1K7EB 2W4QA 2G07A 4J0IA 3CGGA 5AJUA 1HE5A 3EAGA 4GWLA 4OLAA 4TTJA 4Q3KA 4BZWA 1NDHA 4Q4AA 1JDBB 4KYUA 1E1YA 2ZTVA 2PCLA 4RAOA 1TUEA 3TI9A 3DLIA 2EGGA 1D5CA 1XLTC 5COQA 3ZHOA 3RYCA 1T3ZA 2FSUA 3P19A 1UBLS 1OKKD 4QTUB 1K3FA 1WSWA 4V02A 3UK2A 5U4QA 2B9EA 2DQZA 2IYLD 4BKMA 8ATCA 4OXNA 5I7HA 3QNWA 3H2IA 3JTEA 1P3DA 2B37A 4ZCMA 2VAPA 3H16A 3DW3X 2QORA 4MPRA 4KQGA 2ZVQX 2JLXA 1BE0A 3C8ZA 4MINA 2ZFUA 1GUZA 3ANLA 2P65A 3AR7A 1A1SA 4D98A 3AB8A 2IPAB 3INYA 3Q15C 2YN4A 3L9XA 4LYGA 1FFDA 2GF9A 1QXSA 1LRKA 1RAEA 3DL0A 1ECCA 4L5AA 4MPPA 4ZOLA 2I6SA 4WFQA 1YB2A 4FDVA 4EEXA 3T3NA 2AQIA 4JVNA 3WB0A 1RXCA 3DB2A 5MGBA 5L95A 1AGYA 5L9AA 2XYRA 3AHHA 1VMDA 3Q0IA 5JCOC 4IJWA 1J24A 2WTBA 5LWHA 1WB5A 3HHPA 3FZQA 5ALEA 3DNPA 3W9UA 1E8DA 3HYCA 1WSBA 1UXHA 2YNMC 4OKIA 2R1ZA 5F52A 2DTDA 4U2KA 4Z8XA 4YAGA 2DKFA 2GBGA 4ER6A 3IIIA 4N4AA 2OE2A 3WGOA