4C88A

Esterase lpest1 from lactobacillus plantarum: native structure
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
338
structure length
338
Chain Sequence
GMPTINSIQTTVNGVVKIVKPFNNDIAGEQFDPHVLQTLTAFKQPAILENDLAALRSGSLTPAIADPVGDAVTVQSRNITALNRTVSVEWLTPQNVINHTVLVYFHGGAFYGGVPGNNTVLLKLVAAKSHCEILNVDYSLAPEAPAPAGILDGLAIFQYLEQRDAETMITVAGDSAGANVIMAATNLNQQLGSNRINQQLLLYPVTAPNADHAGPLWDLAAFPIIDSQRAILTNYHDLFRQLDSIMTDYYVPENFDSHSPLISPLHQENFTMTPPTTIMVGEFDPFRPQAWAYAQRLAAADTATTFIQYQGLNHAFAPLVDQYWQSQDVAQVMAAALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
publication title Esterase Lpest1 from Lactobacillus Plantarum: A Novel and Atypical Member of the Alpha Beta Hydrolase Superfamily of Enzymes
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 111
structure length 338
sequence length 338
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c88A00
4LYEA 4G4IA 2BUBA 3KD2A 4JYMA 1QIDA 5EIEA 1EVQA 2YXPX 4QLAA 4HZGA 3O4HA 4Y9SA 1B6GA 4J0GA 3PFBA 2XUJA 4HXFB 5HKAA 2WFMA 4PSDA 1MT3A 2XMCA 4GXNA 3FVRA 4X90A 4IH4A 4ZI5A 1JKMA 1ODTC 1Z68A 2BCEA 5AI9A 2XUQA 2G63A 4H35A 1J06A 1QFSA 3RM3A 1L7RA 4Q82A 4G8CA 4F21A 4DSZA 3H19A 3OPMA 4H7HA 3CN9A 4UPDA 4UBIA 4M0EA 2P8SA 1PJAA 3HXKA 4G1FA 5CW2A 1XKTA 1R88A 1QGED 1Q84A 1CQZA 3WKBA 4EY5A 1G5FA 3PI6A 4X71A 5JD6A 2WIFA 3LCRA 4Q05A 5AKJA 4F5ZA 1QTRA 1Y37A 2QT9A 3EQ8A 1CRLA 4HAIA 3HABA 2QKYA 2CEKA 1TCAA 5LKRA 1QIEA 1VE6A 2C5FA 4Z49A 4XJVA 2XMQA 4UHHA 4CIAA 5LLSA 5YASA 3W06A 3D2CA 2JGEA 1A8SA 3FSGD 3FAKA 2GYUA 1AZWA 3NWOA 3C6YA 3WL6A 3X3HA 3WK5A 3TRDA 4Y2QA 3G9UA 3WWEA 1GKKA 1LGYA 3C5VA 3KDAA 4WFKA 3VISA 2DQYA 1LPSA 5A62A 1JT2A 1JJFA 4MQLA 3IVMA 2RAUA 3TGLA 2G5TA 4AB1A 5EIHA 1HL7A 2XDWA 3CXUA 3SX4A 1QO7A 2I3ZA 2QZPA 2PSDA 2CJPA 2JGMA 4NS4A 1UZAA 4DTCA 1ODSA 3R3UA 1K63A 4WDQA 4GDMA 3I1IA 2ZYRA 4OYYA 4W63A 5EIAA 1AKNA 1U8EA 3FBWA 3QPCA 2GBIA 2IIVA 4FNGA 1BU8A 1XQVA 1UT6A 1P0IA 1UWCA 2BAGA 5AI5A 3WMRA 2JGFA 2VJAA 1FFDA 3O0DA 1JJIA 3WWOA 5LZ5A 1EK1A 4HVTA 2WLSA 4ZXFA 1DT3A 3D4LA 4FLEA 2PSHA 2H7CA 4FBLA 4W1RA 3F67A 1VXOA 3BL8A 4WFJA 1XZEA 3L1IA 4U2DA 1H22A 4RPCA 1ZI9A 2WHPA 3K2IA 1ZI6A 4QWMA 5CT8A 1ZD5A 4FWBA 3WWPA 2GYVA 2XUAA 2QJRA 4AQDA 1W76A 2O7RA 4JH0A 4B9AA 2WKWA 5AO9A 3PF9A 4BATA 4UFPA 3WIOA 5JASA 1C4XA 5FXMA 5LZ7A 4BDTA 4CCYA 3F96A 3QH4A 4C4ZA 2DFPA 3SK0A 1QIJA 3WL8A 4RE6A 4QDZA 5IVHA 2WTNA 2C4HA 4UHFA 2WIKA 4NMWA 3AZQA 3ICWA 5AHXA 3EQ9A 1W52X 1E8DA 2OCLA 1N8SA 4BZWA 3BIWA 3V1LA 5K3CA 2FUKA 3WJ1A 4MJ3A 1WB4A 2WUFA 5JZBA 2GYWA 1XQWA 2BGNA 2WFLB 4X92A 3H2IA 3QYJA 4S0XA 1CUIA 1N1MA 2ZSHA 3DEAA 5CTAA 3FYUA 2WUDA 3NGMA 4EHBA 1DQZA 1WHTA 4U2CA 1QFMA 3BE8A 2XMRA 3ESCA 2Z3ZA 4PV7A 2WUGA 1QLWA 3R0VA 1XZGA 2RIPA 2H7XA 3MUOA 3ZPXA 4BC0A 2OG1A 4AN1A 3WKDA 5FPPA 2G4LA 4EY4A 5K3FB 7YASA 4O08A 5LZ2A 4KE9A 1GKLA 4U2GA 5LKAA 4D9JA 4U2EA 3ZLUA 1CLEA 3PFCA 1UOPA 2AJCA 3H1AA 1QIHA 1UKBA 3H2HA 4L9AA 1AGYA 1DT5A 4QZVA 3ZLVA 4ITVA 4FDMA 5A6VA 5CBKA 4IO0A 4YX9A 5AK6A 4CG2A 1HLGA 3PDCA 1MNAA 1QE3A 4Y2UA 5AOBA 3FLEA 4B9EA 3WI7A 4J0DA 3WK7A 5F4ZA 1IUOA 3B3QA 4DYHA 1CV2A 3IULA 1R3DA 1THGA 1LPMA 1NX9A 4RGYA 1MO2A 1VOTA 2B61A 3QITA 4GW3A 1F8UA 2X76A 4C4XA 3EF3A 1EDDA 2Z3WA 3F9CA 5CT9A 3ESAA 5FV4A 2HL6A 5SYNA 1W75A 2XLCA 2ORYA 3YASA 2XT0A 3DOHA 1CUBA 2OGZA 3E0XA 2C0PA 3ANTA 4ZRDA 4XIIA 3GA7A 5JAUA 2Z5GA 4C89A 3S2ZA 6YASA 4AO7A 5DJ5A 3V48A 4F60A 4BAUA 1UFOA 3O4GA 4BBZA 3LP5A 1EDEA 2WM2A 4G8DA 3Q0TA 2JF0A 4OCZA 2HM7A 3AUKA 5ALOA 2FJPA 3WLAA 4KAAA 3WK6A 1E89A 1CUSA 3ED1A 3SWWA 3N0TA 4QDXA 4BRSA 2OCKA 4J03A 2HU5A 5HK8A 3WYNA 5AKZA 1LPPA 4Q3KA 1A8UA 4BVKA 3WK8A 3SC2A 1CUUA 2BJHA 3ESBA 4FOLA 4KJXA 1P0PA 2WG1A 3HEAA 2WHRA 5ALQA 1QZ3A 4X00A 4CI9A 1YASA 4FMPA 3GFFA 3NUZA 5IVIA 5T4HA 4L3WA 3IUMA 4AO8A 5JALA 2HFJA 3HI4A 4DIUA 3DQZA 3ICVA 4UHCA 2ACKA 4M0FA 1WCYA 1FFEA 2CMFA 5T4BA 3F98A 3V1NA 2R8BA 1S8OA 4B83A 1BE0A 1KEZA 3V9AA 4K6HA 4LXIA 4UHBA 4WY8A 4PW0A 1USWA 1H2ZA 1KU0A 2XUKA 4NVRA 3MUNA 2V98A 3H2JA 4X97A 4ZWNA 3EQ7A 2WQZA 5ALGA 2PU5A 2ZJ6A 5ALRA 1UOQA 2PUHA 5CXUA 3STYA 3QVMA 1UKCA 2DQZA 5AOAA 1BN6A 1XZAA 1AQLA 4GBGA 5FKJA 2G5PA 4C6HA 4KYVA 3DJYA 4WY5A 1R9MA 2JGKA 4C88A 4X6UA 4U2FA 4ZREA 3C8DA 3GROA 1CUHA 1Q0ZA 4AMYA 3A2MA 5EHNA 3EBLA 4GLBA 1R9NA 3H0CA 1MX1A 5KWIA 1CUZA 3V1MA 4FKBA 5ALUA 2VAXA 4PSCA 3D59A 3DL4A 4IQ4A 3BF8A 1RWQA 2JGIA 2OLEA 3IA2A 2Y1KA 5CXXA 5AIBA 4H7JA 4C87A 5AM5A 2AJDA 4H18A 3DCNA 4YASA 3C70A 2XUGA 1CVLA 4GHWA 4Y2XA 2D0DA 2ZVDA 5JADA 2XQGA 4AMZA 3D7RA 2VEOA 5ALHA 1ACJA 1H2YA 1A88A 5EFZA 1C7IA 5AI6A 1HKHA 4EA6A 5AKKA 1EHYA 1YB7A 1TCBA 3WK4A 5D7BA 1K8QA 2QJWA 2O7VA 3DYVA 3E4DA 4E14A 1RP1A 2IX9A 2CBGA 4FHZA 3C6ZA 1ETHA 1BCRA 2BUCA 5E4YA 2JGJA 4CCWA 3R3VA 3BXPA 3AIKA 1QIGA 3W9BA 2AJ8A 1G66A 3E3AA 5DWDA 1WHSA 1XZIA 1IZ7A 3W04A 3E1GA 1H2WA 1LPOA 1T4MA 2VTVA 3I2HA 1VZ2A 4DNFA 3S8YA 4PO3X 4EBBA 5AM3A 3CN7A 3WZMA 3PE6A 2J3QA 3O9VA 3D5EA 4ZV9A 3QBJA 4KR0A 2QOEA 2C0QA 1C7JA 2PX6A 2PU7A 2XUPA 1LZKA 1U2EA 2JEZA 4IH1A 5AKGA 5AM2A 2V97A 4WCVA 4UBMA 1GZ7A 1ISPA 2R11A 1DWPA 3UUFA 2B9VA 4QE3A 3I6MA 3HLKA 2OQIA 4ETWA 2WILA 3GUUA 2XQKA 2PPLA 4EY7A 3C45A 4V2IA 1XRLA 1GT6A 2ZYHA 5FOQA 1AX9A 2CUTA 3JW8A 1XRPA 2Y2VA 1SCQA 4JEIA 3W05A 1BRTA 4DNPA 2WJ6A 3G7NA 4X3CA 4BDSA 4UBJA 2DR0A 5AOCA 5EHZA 2WG2A 2VJBA 3VJKA 5DNWA 3JYHA 3AINA 1IMJA 4BB0A 3I6YA 1XZHA 5K3AA 4BAGA 2HADA 1QIIA 2NW6A 3CCBA 2XMZA 1LLFA 1ZD3A 3STXA 2ZJFA 4BC1A 5D6OA 1SCKA 1X2BA 1EVEA 4B82A 2QXUA 3VKFA 3D2AA 3G0DA 5ALSA 5AKXA 3ZV7A 1XRNA 1D07A 1IVYA 2VQ6A 4ARBA 1BEZA 3STUA 3T4UA 3I2GA 3G02A 4QDTA 1DWOA 5HKBA 2EDAA 5HF6A 5AICA 2H1IA 4OUKX 5AI0A 4PF1A 3FVTA 3FLBA 3B5EA 1QTIA 2ZYSA 5ESRA 3AFIA 4P93A 1WM1A 5LZ8A 4AXBA 1LPBB 2PM8A 2QM0A 4Y2JA 1XRQA 1T2NA 1A7UA 1J1IA 2QS9A 3QMVA 4B7ZA 2C5GA 4EZIA 3QM1A 1CPYA 3R3ZA 2GBCA 1JMYA 3D2BA 2FJ0A 1YS1X 1WB6A 4BP8A 4E46A 1K4YA 2I78A 3FLAA 4UHEA 3TJMA 1E5TA 2XUHA 4KE7A 3IURA 2VT7A 1FSSA 1YAJA 1CUVA 2WU3A 2JGLA 4W1QA 5ALKA 2XUIA 1U4NA 4J3JA 5FLKA 3RLIA 3IUNA 5C81A 4BE9A 1EX9A 4QEKA 2WTMA 1XFDA 3DOIA 1TQHA 4OD0A 4DLNA 5AK4A 5JD4A 4A5SA 3HACA 3I2IA 4B85A 2AJLI 3WJ2A 1ACLA 2K2QB 3VJMA 1GQSA 1BS9A 3BJMA 3EIOA 4LXHA 2J3DA 4C01A 1GPKA 5ALJA 3O9MA 1BROA 3A6ZA 3AZPA 4PSUA 3HJUA 3B12A 4RE5A 4WJLA 5BWCA 2Z8XA 1DX6A 2HA5A 3Q8WA 5ALEA 3VVLA 3ESDA 4PQEA 1GPLA 1AURA 1CUAA 2DHCA 2J4CA 3STWA 4G9GA 1EK2A 1CUEA 5ISMA 3C6XA 4GECA 2PKYX 1EDBA 3IB3A 3STVA 3LIPA 1HDEA 2YH2A 2OCGA 2UZ0A 2RI6A 2XUDA 2GZSA 4JUIA 3ZI7A 5JZSA 1I6WA 4G4GA 1N5RA 4K5QA 1K6EA 4L72A 5HFAA 3FCXA 5HQ3A 3I2JA 4CG3A 2YYSA 3O4IA 5IVDA 3A2LA 3C5WP 1E8MA 5K5EA 4W1PA 5AM0A 1WPXA 3LLCA 1ODCA 4J0JA 4EY6A 2ACEA 4DNQA 5ALWA 3STTA 4E15A 3HZOA 4HRYA 1ZJ4A 2Q0XA 5C7YA 1UK6A 4BCDA 1LBSA 2YASA 1R50A 2XB6A 4XVCA 5DTIA 3BIXA 5LZ4A 1QONA 1XZMA 2XLBA 5ALFA 3L1JA 1YS2X 4DGQA 1H2XA 1CIJA 3VDXA 1AMNA 1CFJA 3FCYA 1JU3A 1ZIXA 4Q34A 3R40A 1TCCA 3KXPA 3HRHA 2XI4A 5ALPA 3W2TA 5JAHA 5JZ9A 3HSSA 1OXMA 1XZFA 1W1IA 1RYYA 5FPQA 3HC7A 1BN7A 3G0GA 3P2MA 1FFAA 5CT5A 4A23A 5CRIA 1DWQA 1ORWA 1IZ8A 1IUNA 2PBLA 3DD5A 3H2KA 3R3XA 1XZJA 1QIKA 4P08A 5JATA 4KE8A 5HFNA 1XZBA 5LZ9A 1EA5A 3JWEA 3AIMA 5CT6A 2BFNA 1EB8A 2PL5A 1CUJA 4BTVA 3DKRA 2HA6A 2WFLA 5KBYA 4ARAA 2VAVA 4DMFA 1PFQA 5A7FA 3LS2A 5I9IA 1UXOA 2RHTA 3R41A 5AKLA 4ZV7A 3MGAA 4LIPD 1F6WA 3ZWQA 1ZIYA 5AM1A 5T4FA 4KAJA 1EH5A 4LKOA 5K3FA 3DS8A 1XKLA 1NU8A 4X6YA 2XQFA 3WK9A 2WJ4A 4FTWA 5H3HA 2WG0A 3K6KA 5AK5A 1G4HA 1XZDA 2JBWA 2HA3A 2WU4A 4I19A 1CUXA 5A2GA 1FFCA 2QRUA 4EB0A 4K6KA 3FYTA 1VA4A 5E4JA 2BKLA 1E66A 5DYTA 4WDRA 2XMGA 3BJRA 2EDCA 4OB6A 1VKHA 2HU7A 2I3DA 2VT6A 2WIJA 2BGRA 4FFVA 1XLVA 2AJBA 1MPXA 3R3YA 1KU6A 5AIAA 2ZJ7A 1QJ4A 4HS9A 5CT4A 3M82A 5BV7A 1SC9A 4AN0A 3WL5A 5ALZA 4BAZA 4MYSA 1SOMA 3GZJA 4E11A 2QTBA 5ALVA 2XMSA 4QDOA 2Z8ZA 5JAOA 4J0IA 5CH8A 3K9BA 1E3QA 4K6GA 1MU0A 4UFOA 2QVBA 2OPHA 2HIHA 5C8VA 4X95A 1YB6A 1X2EA 1GPNA 1YA8A 4FLMA 3BF7A 4J0HA 4MEBA 2AXEA 3UUEA 1EINA 4AZ0A 2DSNA 5E4TA 1XQXA 4N8EA 4QWWA 4UBNA 4Q1VA 3WKCA 1ZGCA 3M83A 5CURA 3WL7A 4HXGA 1XLWA 4MXDA 5T4EA 3UMJA 5CMLA 4BCBA 4X93A 1W6RA 5IVKA 3QMMA 1THTA 2HA2A 3G9XA 1E8NA 2RGUA 1CUDA 5FRDA 2C7BA 3U0VA 5AKHA 3PICA 2PVSA 1ZJ5A 3IUJA 3I2FA 2HDWA 1EI9A 2D5LA 3F8SA 3KSRA 2HRRA 4P92A 1UK7A 1QIFA 1FJ2A 2XQIA 1CUFA 4CIBA 1JJBA 2WHPB 2X5XA 1DX4A 2ONCA 2H9YA 1ZOIA 1CR6A 3KWJA 3QMWA 5JAPA 5J3JA 3G9ZA 4JYPA 1F0PA 5ALDA 1GGVA 2OAEA 3OURA 5KWJA 5AKIA 1O6FA 4CCYB 1VA5A 4KAFA 4N5IX 4HTAA 5EGNA 5HK9A 1J07A 2Y2UA 3DKKA 1AUOA 2W6CX 4DMHA 5K3EA 1QO9A 4YK7A 1BEEA 1JMKC 2GBGA 4G9EA 5I8PA 3DDUA 3QZUA 3WA7A 3PUHA 1NU6A 2XUOA 2BUAA 3WKEA 3N2ZB 1TRHA 1YA4A 2H7YA 4BTLA 3WWDA 5HZGA 2VJCA 1M33A 3FNBA 5AM4A 5LIPA 4XX1A 5EI5A 4ZGBA 1L7AA 3IDAA 2B20A 3FSGA 3QPAA 2HA0A 4BP9A 4MWTA 1ZICA 3H04A 3WA6A 5D3KA 5KREA 3F97A 3OOSA 3O4JA 3FYUB 1XLUA 1ZD4A 2GBFA 4Y7DA 4FNMA 1CUYA 1FFBA 4INZA 3DLTA 5A7HA 4EUSA 4Y2SA 4UBOA 3RKSA 4QDUA 1Y7HA 5LYYA 3G9TA 5AI4A 2ZYIA 4DM7A 4Y2TA 1CUWA 4UFNA 2ES4A 4IHAA 3I28A 4A16A 5A7GA 1R4ZA 5JIBA 3I6ZA 1MNQA 4H7FA 5SYMA 3AILA 2J4FA 2WSLA 2OQVA 5EHQA 2QUAA 3VVMA 5FUMA 1YAHA 2OCIA 4KE6A 5BOVA 3MVEA 2I03A 4G4JA 1HQDA 1XZLA 1LBTA 1WB5A 5JARA 3WIBA 2QMQA 1LNSA 4GI1A 4H77A 4Q3OA 5HQ3B 2VATA 4KRYA 3ILSA 2WUEA 2HU8A 1SFRA 3DNMA 1YR2A 4GEGA 4I3FA 3OM8A 3BWXA 3G0CA 4MWSA 4M0MA 2Y6UA 3H18A 4N8SA 4HRXA 4OSEA 1JI3A 2B4KA 1XRMA 4J0CA 1BCSA 1DTEA 1WPRA 2HRQA 2V96A 5ALIA 4FFWA 4JNCA 1ZI8A 1DQYA 4X85A 3RK4A 1Y7IA 1UKAA 5AH0A 3BDVA 2OAGA 4QA9A 3QPDA 2QXTA 4B0PA 4U2BA 1Q0RA 2XUFA 4AO6A 4Y2PA 4OYLA 2OXEA 1R1DA 5EHXA 3WYDA 4N8DA 3H17A 2LIPA 5DLPA 4OU5A 4BE4A 4L0CA 3C43A 3LIIA 5C8XA 5C8ZA 4XWGA 1TK3A 1MX9A 4X6XA 1DU4A 1MAHA 4H7DA 4ROTA 5AK3A 4CG1A 2GZRA 3D0KA 3PF8A 5AKYA 5DYYA 2XMBA 1F0NA 2V9ZA 1W4LA 3G8YA 4DMCA 5IKXA 1CUCA 1EB9A 5DNVA 2DCMA 1QIMA 3D3NA 4C4YA 1XQYA 3C6BA 1P0MA 2CKMA 3AZOA 5AP9A 2XQJA 2ZSIA 4J7AA 1P0QA 1YCDA 4KACA 5K3DA 1XROA 1AC5A 1UK8A 2CZQA 1QOZA 1VXRA 2FX5A 1B41A 3TEJA 3AIOA 1CUGA 5HF5A 1XZKA 3A2NA 3OTQA 3ANSA 4Y2RA 4OB7A 3VXKA 3BDIA 4TVKA 1VZ3A 1J2EA 2VJDA 3R3WA 4X94A 1ORVA 4J0KA 3M3DA 1CEXA 4G8BA 5DTJA 3WWCA 5HF8A 1X70A 3C8HA 5CH3A 5FP0A 4FBMA 4OU4A 1SCIA 5D3ZA 2VA9A 4UBLA 5HF9A 3FYUC 2WHQA 2JIDA 2PSFA 1MX5A 2DHDA 1UK9A 5HCUA 3A70A 3DL7A 2Y6VA 2QUBA 1Q83A 4B81A 1UOOA 4MEAA 4QLOA 4LHEA 3AJAA 5FDFA 1CQWA 3H1BA 1TAHA 5CH5A 5DYWA 3O95A 4G5XA 2WJ3A 5K3BA 2OGSA 4I4CA 2PSJA 1A8QA 3WZLA 2WIDA 4BYMA 4P9NA 4UHDA 5AI8A 1JU4A 1MAAA 4H7KA 4KEAA 4AX4A 1O6GA 5ALXA 2ECFA 5LP1A 5A71A 3H2GA 1LZLA 3G0BA 3OC0A 4TGLA 1N5MA 1U65A 4B80A 1HPLA 4N5HX 2CB9A 4OPMA 1GXSA 3FOBA 1LPAB 4B0OA 1JFRA 1MN6A 2WFZA 1G42A 2HA7A 5AKEA 5E2IA 1ZD2P 2HHAA 3WKAA 4WFIA 3M81A 3IIIA 2O2GA 3ZLTA 2XMDA 4KRXA 2O2HA 2PUJA 3L1HA 1L7QA 1H23A 3OG9A 4HXEB 4IH9A 4X91A 4DSAA 3CCCA 3WQHA 3PUIA 2OGTA 2EEPA 2JEYA 4W1SA 4F0JA 5DNUA 3GELA 2O2IA 3HYSA 1TIBA 3IUQA 5BWBA 5JYCA 1IUPA 4DMKA 5JANA 1WOMA 3V1KA 1MJ5A 1LPNA 4Q3LA 3KWFA 5ALMA 1HBJA 5ALYA 4Y2VA 2HFKA 5ALLA 4BVLA 4QNNA 3NOXA 1PV1A 3GBSA 2WIGA 2PSEA 3C87A 2W22A 3IBTA 4RNCA 3DYIA 2E3JA 3T52A 3FWHA 4AZ3A 2C58A 4Y2YA 2HA4A 4OB8A 2X8BA 1GQRA 5IH7A 4YPVA 1YSCA 2RHWA 1VLQA 4W9RA 4TPKA 5ALNA 1VJ5A 5ALTA 2IITA 1EXWA 1DINA 4LXGA 4H7EA 1ZGBA 4BVJA 4UBKA 3KOOA 2VSQA 3G0IA 4NZZA 4LYDA 4X7BA 4DNOA 4UUQA 4BZZA 3U1TA 1VE7A 1XRRA 4MYDA 2VF2A 3I1YA 3RARA 1TKRA 2XE4A 4BCCA 3VJLA 1OCEA 1OILA 2RONA 4FLFA 4K2AA 4CFSA 5JD5A 2QR5A 4MQMA 3I2KA 5I7UA 3W9UA 4B6GA 5AJHA 1MTZA 1XZCA 4B84A 4PNZA 4H0CA 4GWLA 2ROQA 4EY8A 4BRZA 1K5PA 4H7IA 2DHEA
chains in the Genus database with same CATH superfamily
1JI0A 2YVKA 4M1ZA 4LYEA 1GGKA 2BUBA 3ZE6A 1RRMA 3MSCA 2FF5A 5K3SA 2BTQA 3KYDA 5TEVA 4BFLA 4MWDA 1WG8A 4HZGA 3QF4B 5AJWA 2GZMA 3S6JA 3TIXB 2XGJA 1WX1A 2NXEA 4R1MA 2NAPA 3RVKA 3Q1KA 3M2TA 1PG0A 4N1AA 1JLSA 1TJYA 5REQA 1YZKA 4RA9B 1WSBA 1XE3A 2XUJA 5D5HA 1AZSC 4HXFB 4NEHB 4YAIA 1Q92A 4JOSA 5GJBA 4UQLA 3R6TA 1WNTA 1MT3A 1Y3BE 4N0MA 4PSDA 1UXJA 4DDTA 1F2TB 1TI7A 2IVFA 3FVRA 2EOAA 3UFBA 2C4MA 1QV7A 3OHMA 2WPNA 1JKMA 5E1DA 1BO6A 3A9CA 4RIEA 5EQFA 2ZUFA 3PJDA 4H35A 5E7MA 1QOQB 3COVA 3L7LA 2IOYA 1XTZA 2FOXA 3QG5A 2HMUA 1JFTA 4O1MA 1FOEB 2WF5A 2A7XA 2E48A 2AE1A 3ABRB 3HFJA 4F21A 5MGBA 1PUXA 1FFWA 1M2KA 1P81A 4M1OA 3ZWAA 1II8A 2DKOA 5JCXA 2WJGA 4EATA 2J9YB 4IY1A 2JA1A 1FFGA 4Z7JA 3TKYA 1DTWA 5G3YA 3ISVA 3H19A 1MEJA 1AXEA 2OP0A 3OPMA 1XOIA 5I01A 4BKMA 1QRRA 4G0VA 5F9MA 3LQQA 1EM8A 3D4OA 2PD6A 2VIIA 3GP3A 1PJAA 3B1ZA 4G1FA 4U7JA 4TZ0A 3W34A 2Z2ZA 1R88A 3TDNA 1QGED 4JBLA 1IHOA 1Q84A 5KQMA 3UJHA 1T91A 3HNOA 2GCOA 3WKBA 3JZAA 2AZXA 5IYZA 4EBFA 1M5RA 4KRGA 4MVJG 4WOCA 4F8JA 3QHAA 5CCXA 4EQZA 5ITZA 3U3DA 4RVOA 4Q05A 2O3QA 3UGTA 3ZW9A 4F5ZA 1VPDA 2HHLA 1MXFA 4H0NA 1ZBQA 1B16A 3EC2A 4JVOA 1T43A 1VRCA 3EQ8A 3QW4B 3CQ9A 1U63A 2GSWA 2A5FA 1LLCA 2I6GA 4RO0A 4ZMSA 3PBKA 1YI8A 1M3SA 1Y6QA 4E2WA 3GGCA 1EK5A 3DONA 1TCAA 3NRBA 1URPA 3M5DA 3OQPA 4XFJA 2C5FA 5JI3E 4O4HB 4DC9A 1IN4A 4CIAA 4N5LA 3LGXA 3AG5A 4JJEA 3CKMA 1THZA 1VLLA 2N75A 3UHPA 3THWB 5DWQA 3VVBA 4BPBA 3K73O 3O1JC 3UOGA 2XJ9A 3A10A 1HR0B 2JGEA 1UQRA 2VNHA 3AGQA 5EEGA 1MP0A 4FDLA 3DCIA 2JDIA 2JLRA 4WCDA 5KOYA 3W5VA 1PQUA 5HP4A 2LW7A 2UUBB 3UHJA 4XCQA 4NH4A 3DTYA 3MGCA 3L8FA 5C3UA 3I32A 1DNPA 3TRDA 1EX6A 1RXUA 1CJTC 4POOA 1Y89A 1WL8A 4GZ6A 2LD4A 5CYGA 1LGYA 1KI9A 1SUBA 1UBUS 1VHQA 3FUVA 3KTAB 4Q5IA 1QRDA 4OAOA 2JH9A 2CGEA 3D5QA 4NQZA 4WFKA 5K0JA 2IZ5A 3QEMB 1DIHA 1I30A 3F1LA 4L8WB 5EN4A 2Q6OA 4EA8A 2EKZA 6GPBA 1JEEA 1GPMA 5A62A 4MQLA 3LHFA 3LT4A 1Z25A 2I4LA 3E22A 3HYTA 3BWMA 2WVJA 1U2ZA 1DXQA 4BO8A 4ZKDA 3TGLA 1E0KA 1E77A 2BR5A 4TXMA 3SS7X 3BQNB 1FW8A 5LP6F 2ID9A 3HWSA 1PU2A 4YGYA 3O47A 2HD4A 2FWJA 1ZA1A 3A1DA 4B48A 3N8HA 5EIHA 4LJ7A 4MROA 3E3OA 3CRVA 2XDWA 1PRYA 2DBQA 3CXUA 2DC1A 3ND6A 1G8AA 1N9GB 2JIRA 3FYSA 3LQYA 4FGWA 3LZCA 1JSCA 2AXNA 3EH2A 3E70C 1DKMA 2QDXA 1YQ9A 4M1KA 2C2BA 4PHGA 1JW9B 1SEVA 2PLRA 3PNQA 1KIAA 1TEVA 4B4WA 1I94B 3D8TA 4U6SA 1IN8A 2QRNA 3KYBA 3LHDA 2CXTA 2AC2A 1MORA 1OI7A 2JGMA 1X0VA 3RYIB 3UB2A 1XA4A 2P1DA 4G2TA 4F1KA 5CXUA 1WLYA 1P9RA 1OIWA 3I1IA 3VFDA 4IJMA 2DVMA 3IP6A 3H9GA 4NU6A 1I7PA 2C4UA 3MWJA 4CM7A 1QX3A 3MOSA 1P74A 3FBWA 1OOEA 3QPCA 2UYHA 4XB6B 1GKYA 2PX4A 2YFHA 1R64A 4EK9A 1Q0UA 4MS3A 1I80A 4IINA 4ZQCB 2HJRA 4IDOA 5ICEA 4R41A 3WAGA 1UPCA 2DXIA 1JH8A 1AK2A 1CRWG 2PS3A 5EFOA 1J90A 2IZ6A 3T1OA 2QEQA 3WLJA 4CR7A 1UT6A 3AVVA 1P0IA 1UWCA 2RKWA 3DB2A 5AI5A 1N4DA 1P8AA 4ISBA 3WMRA 2QRQA 3TNJA 4YT8A 4WSOA 2NU8B 1TX4B 3AMVA 1DAMA 1P9NA 2IHUA 1OXBB 3A4LA 421PA 5F7XA 4ZI3A 4BN4A 4UDOA 3U37A 5HWSA 4BFZA 2RKBA 1HLFA 4HVTA 5FORA 5HZMA 4TTAA 2EARA 2PBFA 1J4AA 4JELA 2WLSA 1CD5A 1MV5A 1TJPB 4DQLA 1FTYA 1U3TA 3BXZA 4ZXFA 4FLEA 1W2GA 1WJGA 1X7WA 1XD2A 2PSHA 3FYCA 1F38A 3NOVA 4P8RA 1RXVA 3HB5X 2F1KA 1NP7A 3P27A 4II3A 2OGWA 3QNMA 4B6SA 4FB4A 5E6RA 9ABPA 2BFMA 2C07A 4XJTA 4R8VA 1YIAA 2V5AA 3LKVA 1J70A 5AJZA 2EQAA 3BL8A 3V7UA 3ZHTA 2FSHA 1WBBA 1QU3A 4U2DA 4Q9JA 4YH1A 2WHPA 3GRKA 1HYHA 4BLQA 1PV4A 1TVKB 2VRWA 3EIXA 3SQLA 3ZWXA 1Q16A 3V00A 1RIIA 3TVDA 1XRJA 4CV3A 2JI9A 4ZA2A 4HQ0A 3ZHUA 2XRYA 4LK2A 1ZD5A 4FWBA 4FX5A 1ABEA 2QY6A 4HNGA 4LYAA 3RRZA 2B7CA 4A0QA 5IM5A 1QTQA 3WWPA 2WFAA 3CSUA 1JDNA 1HZZA 1Q15A 4OLBA 2F48A 3RRNA 2BE9A 3D43A 3L4JA 1WXGA 3CNEA 5FNZA 4OOFA 9LDBA 1HT3A 5AO9A 5AVOA 3UJAA 1PLJA 5DHAA 5I9MA 3R7BA 3TE7A 3UMRA 4LCJA 4BVBA 1J09A 3VPFA 1O5IA 4UFPA 3WIOA 1C8LA 3RFFA 3EEYA 1YR1A 3RB8A 2WU1A 3N0XA 4BDTA 4E2FA 1R9JA 3FNGA 1PR6A 3GRRA 2HBZA 4PPFA 3VNRA 4JXZA 4CKWB 3PNLA 4KUEA 5FYQA 4KXWA 3HE3A 4AFNA 2A7QA 2Z4SA 3SK0A 2F1OA 2ZBRA 2RD2A 5BV1A 2LCFA 1A04A 4RXMA 4BV2A 4I55F 1EUZA 3WL8A 2WYVA 5I7RA 1GUAA 1Q0QA 1O9GA 1VBFA 2YOGA 1G98A 2ADFA 3W5AA 5IVHA 2W00A 1YGPA 3NAMA 1R6TA 2OB2A 1W29A 1NMQA 1OUMA 1XHFA 3QU9A 3U9LA 1V5WA 3HCPA 1CQPA 2V0NA 5IT0A 3BMOB 2RGCA 4J4BA 3H0EA 4WBNB 4ALLA 4D57A 2ZIZA 5EYPA 3SR4A 5K45A 3VVCA 4WOJA 1NBEA 4S04A 2VS1A 1HFJA 4RTOA 3X1JA 3AZQA 1WY5A 1IEQA 4LJYA 3ISTA 3PDIA 4BVEA 4L08A 4IZ6A 1C50A 5KDOA 1P80A 3WFIA 1Y7LA 2XVAA 2IODA 5ICCA 2VBGA 3OIWA 2O8NA 1WNFA 2JG3A 1F5SA 1X7HA 1U9IA 4PZ0A 1PCXA 4MJ3A 4DE5A 3FWPA 3TFWA 1TLLA 2PL3A 3OAAA 3TTXA 1OXVA 4L2IB 1VHJA 1UXIA 3H2IA 4B31A 4M4SA 1IOZA 1Q57A 2H00A 2VP4A 4CU5A 1Z26A 4ACBA 3FYUA 3L7OA 1JTEA 1UKZA 3FMFA 4N3NA 5BRNA 1TU0A 1AT1A 2XMRA 5KPDA 1KMCA 1A5ZA 4R7ZA 2YJTD 3UANA 4NCIA 2EF1A 1NXSA 3PWKA 2PQ2A 1PYOA 3CNHA 2R6DA 3SSNA 3IEIA 1C14A 1G3MA 3DMDA 2V58A 1NJ6A 4JP3A 2IRWA 3JTEA 2IWRA 4DDUA 1KI6B 4GF5A 4K1XA 4EOGA 5B30A 2VK1A 4KNVA 3WKDA 4LY0A 4HLUC 1FYVA 3VPCA 3FR8A 2G28A 2F43B 1XJ5A 2H92A 2SECE 2FOIA 2QQGA 1L5WA 1IJBA 3NBMA 1MJHA 1Z8HA 2F1RA 1EQUA 4IEFB 4KVGA 4TWJA 3CURA 5T6BA 3FI0A 3D3WB 5JXWA 2JLYA 1EWQA 2QAGC 4U2GA 5F7JA 3TAUA 4DN6A 1VLZA 4X5OA 2WF7A 2YXLA 3OF2A 4MAFA 5EEHA 4D9JA 3ZLUA 3PQ3A 3ROGA 1IDN1 1G6KA 2JBAB 3AP2A 3S8EA 3U60B 3N7AA 4DBZA 1RSZA 5H81A 3RODA 1B2LA 1UOPA 1YE8A 4IVRA 1XPRA 3K2BA 1DRVA 3CE6A 4D43A 3FPCA 3P0JA 3ZBQA 1JRLA 1G20B 2O3RA 4FS3A 4ND6A 2CLLB 4F2PA 4X1KB 2OK7A 4M8SA 4OK6A 2AA3A 1AQUA 1GAEO 3E03A 3E9EA 4DIFA 1L7DA 1GCOA 4OIFA 4Q9AA 1UDRA 3JD1A 1H94A 4TKVB 2BFDA 3KIPA 4RF3A 1N78A 2F9FA 3KFXA 2JGRA 1WZNA 5EE5B 4WESB 1W4ZA 1YKFA 5A6VA 2XKJE 4YMUA 2ZJYA 2O5CA 4IO0A 4YX9A 5DM60 3DBHA 5BQPA 4QGFA 3KD3A 4CG2A 1HLGA 4YRAA 1XTQA 4O4LA 5EP2A 5C8YA 1KZGB 1R6BX 1ZC3A 2JHFA 2J3LA 2ZI9A 3PDCA 4LOLA 1MNAA 2YYYA 4RDXA 4GIBA 1YRBA 3IR7A 5D3QA 2CSXA 3B1WA 1RHJA 1GZUA 3I9MA 3KTFA 1WZIA 3BFKA 4PIPA 1M5TA 4BP3A 4MAAA 3OIFA 1YZQA 1JDZA 2C5EA 3ETDA 1F7VA 4C05A 3U4GA 5FWYA 1E2GA 2JJ8A 3T7TA 3HSYA 4QU9A 1SCBA 4RMGA 1LSOA 2FMUA 1VMDA 1THGA 4EJSB 1ECLA 2H4JA 4MR8B 1D1SA 1A8PA 1MO2A 2WOOA 3ORQA 4B8YA 3QITA 1YUMA 1E9VA 1ELOA 3GGOA 1WMFA 2JJMA 1M7BA 3M34A 2PUFA 3UK7A 1R4MA 1MFZA 2OCAA 3V1YA 4CLRB 3SHTA 4IQ0A 5DRTA 5E6UB 4MLZA 3COSA 1ZUIA 2AXQA 3PHLA 5FI1B 2Q7OE 2GMWA 2ZLBA 3W5SA 4GM0A 4NZYA 3LUJA 3A6KA 3GMIA 3L82B 1PQWA 4UAVA 3HU2A 1BRMA 2YZGA 2Y1GA 2DPHA 4WLNA 2FR8C 4KPUB 3LO8A 2E7ZA 2PS1A 4QUEA 3AEQB 3RYHB 2Q5QA 4CWAA 1K86A 5DI9A 1MA0A 2ZRPA 4JCOA 4CRWB 3DOHA 3ZXIA 2I9PA 2PT7A 2OGZA 4IWNA 1Y6FA 1ZXLA 5U9CA 3KSZO 4AYXA 2FE4A 2ZUVA 5IEJA 3A1FA 3DVAA 3ETJA 3QUTA 2JARA 1IWPB 1Z8NA 2J6BA 1D4FA 2Z56A 4QU5A 2VSFA 2ZANA 3DWGA 3GA7A 3QTBA 1KI3A 1LJUA 4MUFA 4NF2A 3VO2A 4WKNA 3S2ZA 6YASA 4AO7A 3BMNA 3I23A 1IAQA 2BMVA 4G5HA 5DEIA 5AVYA 1Z4IA 4RENA 3H2BA 3IVAA 1E20A 2DUWA 1RLJA 2YMPA 3QK7A 4F60A 4X20A 1KVTA 1Z5WA 3CC8A 3GJSA 3H2ZA 4TZTA 3BTVA 1TIPA 3VR6D 4AS3A 4BBZA 1YRHA 1Q17A 3KKLA 3T5GA 3GFQA 4RTQA 3HUFA 3EBOA 4JL6A 4AJ4A 3JQ7B 2G25A 1YXMA 1SUFA 4JDPA 1UP7A 2Q29A 2CXOA 3Q0TA 4OCZA 4Z54A 2HM7A 3AUKA 4FU0A 4MV9A 1IJFA 3WLAA 4B7UA 3A1UA 3DOUA 5KI6A 2QR3A 4E08A 1SC4A 5KOJA 3AP1A 4DIEA 2BGMA 2ZFUA 3L0SA 2ASVA 5CJPA 2DFDA 1Y4UA 2AK3A 2QVXX 3BXEA 4M60A 4PTZA 3S2GA 3JQ8B 1E89A 1S4QA 4TRMA 4LJAA 4RVGA 4WT7A 1OR8A 3ED1A 4HX2A 2FNAA 1NY6A 2COUA 3TCXB 1KRWA 1FUKA 3GUCA 4TYQA 3TPFA 1Y3FE 5JAMA 3O7WA 3CWZA 4EGQA 1YZLA 3CF2A 3N0TA 4PAWA 5IU6A 1USIA 2BKAA 3J80A 1T3HA 2OCKA 3MGBA 4OXQA 4QBHA 1Q50A 4M8IA 5FI3A 1XYGA 2JFVA 3VNQA 2CV0A 2FR0A 1ODFA 2HGZA 2JHAA 3HP7A 3K0AA 4J16C 4MP8A 3KSBC 4YIKA 3B8HA 5LBTA 5B6JA 1KH2A 1JEQA 3H86A 1E2UA 2WPDA 3WB0A 4CBVA 4EG3A 5IDXA 4F85A 1SAYA 3IMCA 1F14A 1UZUA 5ED0A 4L9WA 3JWJA 2D54A 4JLVA 4R1OA 1ADCA 3OCYA 3ZLBA 2GN0A 4AJIA 8ADHA 3HEAA 5HSGA 2PGDA 3I39X 5KJEA 1QZ3A 3RG2A 1SBTA 2GPWA 3SZRA 2KHZA 3O21A 4MGKR 3EG9B 3NJRA 1OBOA 3LM8A 1QCZA 2GAFA 4JLPA 2P2LA 3SBOA 4J1NA 5FAKA 1Y80A 1IBMB 4CKZA 1TE2A 1J2YA 3C24A 3E35A 4G1EB 2NO6A 5IVIA 5LNK6 3A9SA 3WL4A 5HKLA 3GWGA 4US2R 4GMDA 2ISSD 1RQLA 5TS2A 3KBBA 4AO8A 1ZFNA 1ZMXA 2GD2A 3E9YA 4R7TA 4G84A 3NPMA 2VDWA 3H13A 4F38A 1X8JA 3BJEA 1TPZA 2QJTA 4TSFD 4ND8B 4BNZA 1DB3A 2ACKA 2Q45A 3ROKA 4UVHA 2G0AA 1LF0A 3OFNA 4F4CA 5JXJA 2CMFA 1UT8A 5T4BA 4Q4LA 3VYTB 2NO5A 1N0WA 5CAEB 4B6JA 1LVGA 2Y99A 1NF8A 2DBZA 1S6YA 4DV3B 3U4IA 4IRXA 4LDNA 4MW0A 1OGYA 1M6VB 2ZXEA 4Q21A 1SWVA 1GTL1 4GKBA 3OTOB 4QGAA 1FRFS 3H5WA 2ZJ1A 1MG0A 5KVCA 3FKSA 3FZYA 1S2DA 1KVUA 1KU0A 1U8AA 3A6JA 4I5EA 5CK5A 3R2JA 2V98A 1Z0DA 4G97A 4X97A 3UWSA 2X0NA 4RZQA 4ZWNA 4YLYA 3EQ7A 1XCBA 2IGBA 3UPDA 3T6KA 4OKNA 5LB2A 1AN0A 3SHQA 2PH5A 3MJ4A 4DCNA 2PU5A 3BWCA 3EVGA 4KGVA 4KO2S 2ZJ6A 2NUTB 2XA1A 1GUFA 1C3OB 1NW7A 3CUVA 1UUFA 4C7VA 3ENKA 3RQIA 4E70A 3DWEX 3STYA 4ZT2A 3SQMA 3ZWDA 3VH4A 1E3DA 1A3CA 1SKYE 3EISA 4IYRA 1L8OA 4KLAA 1W2WB 2PXAA 3Q0EA 4R0VA 4AD8A 3NO4A 1YOVA 4DDVA 5GVSA 1SO8A 3C3MA 4IKEA 4FGZA 5DRYA 3CKKA 2Y05A 4LY3A 3L1UA 4GM1A 5IT4A 4DKJA 1RWPA 3ZCQA 1C9DB 2CFRA 2J87A 1KPGA 3WQRA 4ND5A 3KKMA 1DJOA 2IYSA 5J2TF 1KE1A 1OYWA 3U3RA 3GQVA 2AFIB 3QKSA 4MWEA 3TLCA 4C6HA 1BHQ1 1XDUA 3SXJA 2QD2A 4EW2A 3MT7A 4I9FA 1CQJB 3DJYA 3HCNA 3CA8A 3A32A 1JPVA 1CFZA 2FPGB 2XAUA 2P4EA 3L0IB 2ON6A 2BY4A 3ZDZB 4R4JA 2JGKA 3G23A 1SD2A 4X6UA 4C88A 3D5TA 2X2FA 2A9QA 4U2FA 5LD2B 3GRYA 1L0BA 4WZBB 5E9WA 4MLPA 2FFJA 1NKVA 1CUHA 3QMPA 1R6VA 4C30A 4RIGA 4AMYA 1ZSYA 2PYZA 2C95A 3ORFA 2DG2A 1M2OA 3G7SA 3UKOA 1M7HA 2P4QA 5LR6A 2JJ2D 1MQAA 1YQWA 2WI8A 2RGAA 3L41A 1VSUA 4WK4B 5GQSA 4YCLA 4AMBA 3IILA 4M99A 4L4RA 1N7GA 5B12A 4OKSA 2C5BA 2HC9A 2D2EA 2HMYB 3BXOA 3FMIA 1E64A 1VDMA 3V4VB 2WWGA 5I47A 4JJ4A 1NJ8A 2UZ1A 3V1MA 3ASVA 3QU7A 4XPIB 4BQIA 5CDHA 4BEJA 3W8FA 1I7LA 5BO5A 4OHCA 1ZN8A 2OZPA 1S9HA 1ZH2A 3HCFA 4F56A 2Z9BA 2DEUA 4RKFA 1GZSA 3ACCA 1NIJA 1UJ5A 3UATA 4ZDIA 3D59A 2XWQA 4IQ4A 4QYIA 1MH9A 4BNJA 3QYFA 4BX3A 3ZCXA 2PMWB 2Z9DA 2ZBGA 5JFTA 2JGIA 3GJ5A 3O8OB 4WCFC 5DO9A 4O2AF 2ZUCA 4ZRMA 2BP7B 3EE6A 4HNTA 4X24A 4TYWA 1XTSA 2BFPA 1ZKDA 1JB1A 3HEMA 5D85A 4YMWA 3VPSA 2QE6A 4S1VA 1V9CA 2Y1KA 3PXDA 1YR7A 3HCDA 4FX2A 4Q1BA 5CXXA 4IIYA 4OQPA 5D84A 5IN4A 1XJCA 1XMOB 2HWUA 2ZRDA 3SDZA 5LOVF 4TZ6A 3JQGA 1Z6AA 1Q77A 1DJNA 2Q5JA 4H18A 4UNQA 1MENA 1E94E 4JGGA 5L3ZA 3QXHA 4JI5B 2XBMA 2QD5A 5EPUA 4AKHA 4O4JF 3C70A 3TTYA 1NR7A 3MLEA 1BJTA 2QUJA 2UZIR 4A9AA 3E9MA 2WAMA 4MGYR 4NOMA 4KR7A 5GV7A 2SBTA 1L4LA 2FQXA 3PZBA 3N2GA 5DI3B 4N0PA 3W2EA 2Q3JA 3EVNA 1ISGA 3QSGA 4RTLA 3DZIA 4ZO9A 4ZZ3A 1N33B 2GN6A 2HAEA 3JCZA 3L4BC 3F7TA 4JI1B 1C7IA 4LXQA 1HKHA 1RJFA 4EFMA 3ICEA 2FPXA 2VDOB 4HYEA 1X9HA 4R2JA 1ISHA 4KQXA 4IMIB 4IJWA 4LHWA 3HU5A 3RU2A 1YB7A 5DISB 1KSGA 2H16A 2AG0A 3KLMX 1ZN7A 4ZOLB 2DGDA 4INJA 4Z8XA 3QPVA 4IILA 1NXPA 3FW1A 4RMHA 3TGPA 4GKVA 4ZJZA 2Q3EA 3CEJA 4MDFA 1BCSB 1R00A 2JB9A 1SHJA 2PCLA 1RP1A 2Q1SA 3C4VA 2DZDA 3BK7A 3WZ2A 4E21A 3NHYA 2VRCD 5HE8A 1KP9A 2B36A 5J5CA 2ZT5A 2BFFB 3H9QA 4P7KA 4EPYA 2X1MA 5AK0A 3KPYA 2JVIA 3TVTA 5E4YA 3EF0A 3EWSA 1MB3A 1ND5A 3GNLA 3CX7A 3E84A 1GIAA 3BXPA 2REBA 1EJBA 4QLBA 1JPNA 1ZVJA 1QIGA 3V7WA 3E3AA 1IM5A 4ARUA 1I6MA 1P1JA 2V9CA 1CJKC 4MX8A 4XW2A 2GEVA 3NIDB 1FF9A 3E1GA 1H2WA 3MRXA 3ZW8A 1G5PA 5IAAA 1GNVA 5K0TA 2PRSA 4C4PA 1HEUA 4U9HS 4WXHA 4AUNA 4E4TA 2QBYB 2I2XB 2BEKA 2J0VA 2LXNA 2XNKA 1DRUA 2Y8EA 3PSHA 4WXEA 5BSHA 4ENVA 5CA1A 4WNAA 3RIYA 1VCIA 1AQIA 3L6BA 4AQ7A 3UEOA 1E32A 3N6VA 5EP4A 2AEMA 3BGOS 3L79A 1TJ5A 2QI9F 1VJTA 2ZRJA 3FUWA 4MV3A 4IS2A 4MYHA 4YBRA 4YJ2F 4B1FA 1OH7A 1Y8QB 4Z1MA 2YUIA 4ZPJA 2WNHA 4E5PA 3PE6A 3C48A 4C29A 3C3WA 2AN4A 4YAGA 1BEUB 4MS1B 5K6AA 2PFKA 4CMBA 4KSCA 3AH8A 3E6AA 3UF0A 1VI6A 3ME5A 1NN5A 3HYRA 3L7KA 1ETUA 4JP2A 4B5LA 3RUPA 1KWKA 4YPFA 3QBJA 3UAVA 3WGKA 3KP1A 2YWDA 3N6RA 4NCKA 4EB6B 3KU4A 16PKA 2PU7A 4ER7A 2IBSA 3VI3B 3GOQA 4C22A 2F4VB 1DAKA 4RK0A 1Z63A 4FYIA 4IH1A 2FSGA 3ENZA 5IHXA 1JBEA 1IC6A 1BD3A 2Q7DA 5KVAA 1LW6E 3MWLA 4WCVA 5IC6A 4EVRA 1CJMA 3IV9A 1QR2A 2R66A 4ODIA 3T12A 3VYUB 1J6UA 3G2HA 4PNPA 3EZXA 3UUFA 1JPJA 4IMPA 2Y0BA 1QF6A 1JALA 3U44B 3HJCA 4DLLA 2Y1XA 4UM8B 1AKRA 4DSUA 4ETWA 3ZDAA 2WILA 5BNFA 3R7LA 1HYGA 1NONA 1YZGA 3OWXA 1ABBA 1HTBA 2ZETA 3C45A 3H5NA 4FONA 4V2IA 2KX7A 4HMQA 3V8BA 5C3MA 2V6JA 2ZYHA 4XD7D 2HF8A 5ERYA 3TL2A 1S2NA 1XMPA 1CP3A 2ZI3A 3NT4A 2Y2VA 2ZWPA 3NLLA 4ALJA 3M4NA 2OR3A 1I9CA 4DCMA 3K9HA 2FEMA 4P3XA 2DSTA 4M0UA 4GLLA 4OO3A 5DHTA 1LK0A 3OEWA 4DNPA 1TO1E 3X1KA 4C14A 3FF4A 3LWBA 4LOHA 3QUSA 4X3CA 3A1WA 4QT4A 1VP9A 2DR0A 4JT2A 3G49A 3W3AH 4DR2B 3VKGA 5FO0A 3DUWA 3HP1A 2ORWA 4K9MA 5DSZA 3MG9A 1L5SA 2W2QA 1KY3A 2QL5A 3K0CC 3TMAA 4CNQA 2IOQA 5K3AA 2Y9MB 4FK8A 3ZE9A 3MFQA 3OQVA 4JX9A 4GE3A 3SF8A 5IKPA 3I3OA 2NW6A 4HOYA 2ZZKA 4OHUA 3R74A 1P3Y1 2ZTSA 3JQ9A 5IWCA 2ZJFA 1TEZA 2FZKA 1ZUWA 3SLKA 1GFSA 1ZD9A 2J0UA 2JFOA 1SUPA 3IRUA 4PYLA 1EVEA 4OSOA 1QNFA 2UVPB 4B82A 3TRKA 3VKFA 4MIYA 3AT1A 3I83A 5LJLA 3D0RA 5DX1A 4B33A 5CDUA 4G56A 1X7ZA 4RY8A 2JLCA 3QF4A 5CPBA 1P4JA 4LEIA 4YUZA 1WR8A 3VUFA 2R2GA 1E79D 3VH1A 1RYEA 5AHWA 2XXAB 3K8QA 3IMKA 3TG2A 4DAOA 5CA0F 1B43A 2DQKA 1IHYA 5AVQA 3R0ZA 4GPZA 3LBFA 2MOKA 3VDMA 2I7XA 3STUA 2CBZA 1LBIA 2ZTLA 4OJQA 4RW0A 2C9OA 4LI3X 1F2TA 4BX8A 2V6GA 5HJEA 4RGBA 4JR2A 5HJ2A 2HJ9A 3AWDA 3JQEA 3ONNA 5EJEA 5J4VA 4GOJA 5HKBA 1CJBA 1H2AS 1C4KA 2JFHA 4KMSA 1XPJA 1A2BA 4RGVA 5LWHA 5FL7D 2PL1A 5HF6A 4XZ3A 4TL6A 5JZVA 1Z74A 5AI0A 3N59A 3LX6A 4KMOA 2PO7A 4OP3A 5AWFC 1V26A 3NFRA 4QGHA 1KBQA 3SJ7A 4EITA 2QPAA 3B5EA 1JKIA 3UV6A 1V3UA 2IYYA 3FX2A 2OT3B 2TMKA 1H1TA 1GVNB 1N0VC 3AFIA 3HBAA 2ZBQA 4HNQA 4TM7A 2Q9AA 5L7YA 4BPRA 1NJ2A 5C1DA 4JV5B 2PIAA 1Z29A 4G1CA 1U8XX 4MKRA 2PM8A 4YUXA 4NONA 2QM0A 5L3VA 1ZJYA 3IBFA 4F8YA 4GZ5A 2FXVA 3NC4A 1A7UA 4GOLD 1C0EA 2ZYWX 4E33A 3G85A 3HKDB 4MKZA 5BRJA 3F49S 1XEWY 1ORTA 2P6NA 2PR7A 1P2GA 1IXKA 4CDGA 1P5JA 1VRVA 3EGVA 4U7DA 3ZQJA 3ZWMA 3MHTA 2N1MA 4X1OA 2GBCA 3OWOA 1E4YA 4R1NA 1K4KA 1CW2B 2ZSJA 1TYBE 1YS1X 5SY4A 1ZM4A 4E46A 3ZZ0A 4AKGA 5JNVA 3EIWA 5DGDA 3TJMA 2CJWB 2PMEA 3IO3A 3PXXA 1KNQA 2XUHA 3A0RB 4IVPA 4XUDA 4L3VA 2VJOA 4Y2GA 2WHYA 2DH5A 1PLKA 1Z8DA 1DAFA 1REQB 3K0FB 1FSSA 4HN4B 1CUVA 4DLRA 4D56A 1XMQB 4B2PA 1MCZA 1XV5A 2Z57A 3PA8A 4HMPA 5IVPA 2ONJA 1RXSA 4W99A 1B8PA 2JGLA 2O50A 5AVZA 2GN9A 1Y7TA 1AE1A 1U81A 5TIIA 2JFPA 5CG1A 1ONBA 3VZQA 5FLKA 1CSEE 2BBWA 1BDMA 3WRXC 1KGDA 3Q88A 4BE9A 1OFUA 3AUXA 5L45A 4QEKA 1FQKA 1VE1A 2XTAA 1FU4A 1XFDA 2AE2A 4KR3A 4PQGA 3F5DA 3V2GA 3KXLA 2XUZA 4H16A 2NUAB 4JBHA 1F51E 4RJIA 2W6JA 4I9UA 5THKA 2HV8A 3KQLA 3NWBA 5EHXA 4XM2A 2VNIA 1NI5A 3KQWA 2HNKA 1EWRA 2BZSA 1I7QB 2CLHB 2IUFA 4YMLA 3HUTA 3P9IA 4FZRA 3HACA 1BQ4A 5K6RA 1R0LA 2OC9A 2G1AA 5FBLB 4KQKA 4B85A 4U39A 3KTAA 3OVMA 3WHKA 1QG6A 4LISA 1QK3A 5CYPA 4ETMA 3A9UA 3V8PA 2EFCB 2PLFA 2WIBA 4F5EA 1OSNA 3QEMA 1GQSA 4GDFA 3IEUA 1EHCA 4OYHA 2LE0A 1QR6A 5DH9A 1RQPA 1QFJA 4LWOA 1Z7BA 3BJMA 2NZUG 3QLVA 1T1SA 4CMJA 2J3DA 3ZQ6A 1GPKA 3JQFC 1RAFA 2BR4A 1KBZA 1X94A 3HCOA 4KYTA 1XTTA 3UN1A 2A9OA 3G7UA 3JVEA 1PZEA 5FWAA 3D4IA 2HA5A 2Q5CA 3EDCA 3GJ6A 5BQOA 1H3EA 5ALEA 1KOFA 1YJQA 2FUNB 1SPXA 5T41A 2YY6A 1EA7A 1UKEA 2AV6A 4JOBA 3DHYA 2B69A 2HCRA 1G20E 1N9GA 3IO5A 4BO4A 1UIMA 1A9RA 1RCFA 3B1FA 5AUQA 2GEDA 4YRCA 3CSSA 3O94A 5DYGA 1A4XA 1OAOA 4NEGA 5LVAA 5ISMA 3H5LA 2M9MA 2DECA 4XAQA 5FULA 3ZH2A 3UYLA 1XCPA 3C6XA 2PKYX 3K09A 3R5TA 4MYCA 1L3BA 1P17A 3DAGA 2O8BB 2ZSFA 3HADA 4BKPA 1M8FA 1CRPA 4BGUA 2Z9CA 1AA9A 4DA4A 5EZYB 1AOXA 1IRIA 3RYIA 5AW9A 1E3IA 2FV8A 2UZ0A 1DOHA 3IC5A 4Z86A 3IMFA 2W6ID 4OXKA 3RVNA 4W8HA 1V16B 2XUDA 2ZCVA 4MLDA 1IB6A 4D81A 2X9VA 3PC8A 4Q4HB 1OXKB 4NAUA 2H1VA 4ZC8A 5A3VA 2VZEA 3DBOB 4QBKA 3TTWA 5JXGA 1Y1PA 2QLMA 1AHHA 5KC8A 4ZQHA 4TTRA 1E58A 1AO0A 3PRJA 2J30A 5A4JA 3FMVA 4HAZA 4L72A 1KMHB 3P45A 1U28A 2Z2XA 3G2MA 3EW7A 2SHKA 4CJXA 2AX4A 1Z4NA 5HQ3A 2QENA 3I2JA 4M6WB 2NU8A 4Q16A 5IC5A 4CG3A 3PKZA 4KR9A 4M49A 5IVDA 1JIUA 3E0QA 1AQ6A 1Z82A 2MSDB 2O3TA 3KM0A 4PYRA 1KDPA 2J5QA 3GXBA 4HQOA 1RWBA 2AS0A 4URUR 4W1PA 2O0HA 4GI7A 3JWHA 2XD9A 5FNVB 1HDOA 2VKQA 1R27A 1AY0A 3ILVA 1Z2DA 4J0JA 1RRFA 4OI2A 1S3IA 5JWOA 1OB2A 3D8SA 4DNQA 3TQOA 3STTA 2W70A 4E15A 3AQIA 2A9RA 4EYEA 1DO0A 4KPFC 1IY0A 4BFTA 1P7CA 1ZJ4A 1O6ZA 3TD2A 3N8DA 1U8UA 2AVDA 4YP0A 2BSXA 3PVSA 4XJXA 3LXUX 5TSDA 3NIFB 5CCBA 5C7YA 1TVKA 1NN1A 4TS4A 2JRLA 3DO5A 3EVBA 1EFPB 2HIAA 4JVMA 4R8SA 5SZIA 1USGA 2YASA 3SMVA 1G21B 1OROA 3VPXA 2BMDA 5IJ9B 5DTIA 1KR5A 1GCGA 2VYVD 1XCGB 3UT5B 5BR7A 5JJIA 1ZZGA 1HG1A 1GILA 3ZOKA 1JSLA 2V7UA 1FRQA 5F51A 1GZ4A 1XL0A 3NDIA 2RDMA 5EIBC 1SU6A 1JYSA 1C2YA 4OX9B 4UVGA 1KETA 1USKA 3R3JA 2FW6A 5T6MA 1N0IA 3BZWA 5IAKA 4MUJA 2FRDC 3Q87B 1CIJA 1IHDA 3LUBA 4EECA 1CFJA 2G9ZA 3HU3A 1XVLA 3FCYA 1MF7A 3HWWA 1O6CA 3SY8A 1OLUA 5JNSA 5IPFA 1ZIXA 3B6KA 2R6R1 1I4LD 3KQMA 4Q34A 2IUUA 3UCFA 4PNEA 3EEIA 4RC9A 4PO9A 4XR4A 4OF4A 5FIUA 4LY9A 1B73A 2RH5A 1LDNA 2FEKA 2XI4A 5ALPA 4CKWA 4Z3OA 4F12A 4FFOA 1K8ZB 1BU5A 2WWHA 4RX1A 2PMBA 4L3OA 5JZ9A 1LSUA 2HQBA 4E14A 4ZYZA 1E2BA 4B6OA 3UKDA 1R37A 4MIKA 5KYYB 3LVBA 2X4GA 4ARIA 1A97A 2R6FA 1RYYA 5TEWA 5JCJD 1J8FA 3E5RA 3BE4A 4E0BA 5J4YA 3CRQA 3KETA 3N2EA 4ZT3A 4KQEA 3KCQA 1JQLB 1U1GA 1BN7A 2VQDA 3C6MA 4Y6PA 3G0GA 3PG5A 1PNOA 2ETVA 3SE7A 4AUKA 4AZTA 4WZZA 3FVVA 4BNLA 1EUDB 3KHUA 3ZXYA 5JWHA 3RRFA 4RTKA 1TIKA 4M9UA 1HT2E 5IS2A 3R3XA 2SCUB 3MA0A 4V0ME 4L51A 5E7IA 4BNKA 5B55A 4PGGA 4BNDB 2J3KA 5JATA 3TKAA 4MB6A 4KKXB 1JXOA 3TIIA 4FMBB 5BYJA 2AWOA 1MJFA 1XZBA 3CMMA 2J7PD 1JR3E 2QMHA 2ATEA 5IRCD 4N0EA 4XOUA 1JLLB 1XVVA 1Z4OA 2H29A 1O4WA 4G0MA 4MDHA 1ZAKA 5I8ZA 1I2MA 2D2FA 1EPUA 1X92A 3LVFO 3W7BA 3WFZA 4DARA 5KOHB 2PL5A 4YT2A 1O96B 3ZOZA 4TXLA 4BTVA 2E6UX 4V3CA 5BN1A 4KQCA 1O95C 1JLKA 4L2IA 1EJ2A 5AJUA 1IIBA 2ZJAA 3HJBA 2CNDA 5SZHB 4XD2A 4LF9B 1CG6A 4FEGA 2WM8A 3JR3A 2OXFA 3MMSA 1JVBA 2HMSA 3MWDB 3R7AA 3W5JA 4GOXA 4YRFA 4CGZA 3K0EA 4QHSA 1XNRB 3RVQA 3ZWKA 4LF8B 4HT3B 3F9RA 1MEOA 4WX2B 4AWAA 4H17A 4EZBA 2I67A 3TZLA 2MINB 1NW5A 1S3GA 2CJFA 2HK9A 4CEJB 5JMOA 5HR5A 5AW0A 4KG7A 1A4RA 1UMCB 5LC1A 2I6TA 2EZ8A 4F5YA 1VYTA 5IARA 4FPXA 4DRYA 1FU8A 1PGQA 2Q9CA 2DHQA 3GT0A 3OA2A 1KI6A 4PSVA 5C8YB 1XBTA 4RH3A 2VA8A 1VKZA 4JJKA 3S1AB 1GA4A 4OBXA 5EXSA 1EH5A 2CSUA 4Q48A 2WE7A 1SQSA 1TMYA 4I8IA 3MWKA 4I5DA 1WTAA 4LKOA 3T34A 1WF6A 1H0SA 4HNVA 4OJMX 4AXXA 1OLOA 2YWRA 2F43A 3DPUA 3JRWA 3L1KA 1D8AA 3G5TA 1FE8A 4M89A 1I0LA 1I3NA 3I72A 2WM9B 1XKLA 1U8TA 3ZNNA 1R10A 3BSYA 3D3WA 3LBAA 4UTVA 2CVOA 5DKFA 5H3HA 1Z4PX 2DPGA 2OWEA 3B6EA 5AK5A 1G4HA 1L6RA 3BXXA 2ZRNA 3L7CA 4HXYA 2JBWA 2JBAA 4N39A 4R5MA 4P7JA 1T2UA 2IYUA 3LJKA 1WP4A 2R1UA 2WYWA 1K98A 2P0AA 1KSHA 1CUXA 1YBFA 3I52A 4NNPA 4TTJA 3SFVA 1FFCA 4F5WA 1AGNA 1G20A 1V7PC 4B76A 3IR6A 1ZSVA 3FYTA 3QFTA 1SUEA 4N49A 5KNCA 2FG7C 3D6NB 2BKLA 5JJ5A 4ZYXA 3P9QA 2J3HA 4C0LA 5GJWC 1P1BA 4G1MB 4QRIA 2EDCA 4MV6A 1IY1A 2R2AA 1NM5C 3O3NB 4MRMB 4ND4A 5ARDA 1OJ7A 3AUYA 2AFHB 3PLNA 4WESA 4BLOA 5HKKA 1NC1A 2C7OA 3E7PA 3G17A 1I32A 2VT6A 2WIJA 3Q9UA 5HW0A 2R7NA 2BGRA 3JU3A 3BK1A 3VZDA 2ODAA 4L1KA 2CFSA 2IKSA 3QVJA 1LV7A 4FFVA 5T3UA 3QI7A 3H75A 1LSJA 2BPOA 2ZUUA 4Q6BA 3URMA 3L0CA 4E4YA 1B23P 4OH1A 3ORYA 3R3YA 1DMSA 2AWNA 2MJLA 1KDVA 2GM3A 3RIHA 5BUCA 4FFSA 5L8VA 2CMDA 4G5OA 4EA7A 1JF8A 4XDYA 1ISMA 1NVWQ 1XDDA 5TGDA 2O5RA 2AF3C 1LD3A 4EDHA 3ZBUA 5KDLA 3FH0A 3DV2A 1J0AA 1RBZA 4JQYA 4WZBE 5CT4A 1SD1A 1W35A 2IXGA 2NU9A 3ZV6A 5SY9A 1SC9A 3HN6A 2HRZA 4M9QA 1LRJA 3CJTA 4MYSA 3ZCPA 4EJSA 2TSYB 4FC6A 2OV3A 4MR8A 1P45A 3WJAA 4UM5A 3V4FA 4E11A 1T2DA 2DR3A 4A5SA 3QUBA 5ALVA 1C3LA 1EQAA 1FFSA 1EVJA 1PJ8A 1ZU5A 2PAFA 2FZCA 1QB7A 3CT6A 4PANA 4CLRA 3ER8A 3KVRA 4X60A 2D5CA 1KS2A 3RUDA 3VTZA 5JAOA 4E51A 3PYXA 1OHHA 1V8DA 4PY2A 5CH8A 2ZU6A 2Q6VA 1YQUA 3TLGB 1ENYA 3SDSA 2IUTA 4CKCB 1EP9A 4ZHQB 5DM1A 4QYTA 5DYNA 5J2UA 4L95C 4KPUA 1NR5A 1YB6A 2OHHA 1F6BA 2PXXA 3AEQA 4UVEA 3RYHA 5TARA 1GPNA 2AKEA 1HT0A 1PQ4A 3NTOA 2WSMA 4FLMA 4JSTA 1BFDA 1UAAA 3B82A 1IH8A 2NX2A 3NGXA 3ODPA 3O4FA 3O91A 1MMFB 1WBJB 3S40A 3GG9A 3ANMA 3S70A 1XQXA 3T3DA 4N8EA 1TW3A 5A1TA 2AMVA 1HMYA 1BMFD 1CCWA 4MV7A 4GWGA 4N9QA 4WW0A 2XF8A 2VUIB 1IQUA 1PKEA 4Q1VA 1KEPA 2ZITA 3DBVO 3WKCA 1G8PA 1S01A 3WL7A 4P3OA 5LQUA 5KNBD 3O38A 1DKRA 4X8HA 2P9QA 3JD2A 3R6WA 4UEOA 4LFAB 2D1FA 5HNKA 3TX2A 4KXVA 4D3ZA 2I5PO 2QGNA 1FTNA 3ER9A 1YB5A 3DVQX 5KQRA 1XALA 2YMMA 2JFWA 3JQ7A 3LX4A 4TLBA 5D1NA 2NXNA 3F1KA 5D1HA 4XX0B 1QTNA 4PLZA 1PL6A 2VHYA 5DCLA 4I9HA 2ZRFA 1X1BA 5GZ6A 1FTQA 2EV9A 1U7DA 3C98A 3NIWA 4KOEC 4POAA 1GJRA 3L7AA 2ZYUX 3EMKA 1VSQA 4KBGA 5EESA 2GPAA 3KG2A 4HDRA 5JS8A 2VSYA 1CUDA 4Q12A 1F1JA 4M7WA 3W5IA 5TE9A 1E1DA 1LLUA 1F06A 3JQ8A 5A5DA 1TCVA 1T29A 5KDDA 3CNOA 1N3YA 3K1JA 1L8AA 2HJVA 1SXGA 2A57A 2EC5A 2QNBA 5FBHA 3TNFA 2FEXA 2A4MA 3O03A 3A05A 2JC3A 2B21A 3I2FA 5IAEA 4C0WA 1JB9A 2ZUWA 1SWWA 3AEZA 5DW0A 4R68A 4EA9A 5A9SB 1ZS9A 2DLDA 4I1SA 3ZVKA 3MWFA 4RWZA 5H8WA 3R5KA 2QMEA 3ADBA 4V0MA 3FN4A 4P92A 1ZGJA 1UK7A 4AL4A 4EX6A 4Y6QA 1ZLXA 4WGFA 4AMUA 2JIZA 3FPHA 3KX2A 3MWEB 2XQIA 2HYIC 2H59A 2ZYVX 1CUFA 5GJCA 4CIBA 2J32A 1JR3A 3HMKA 3RS7A 2PL9A 3CUEF 3PFHA 5IAOA 4L8LA 1AS2A 2JFBA 2X5XA 4IS3A 1VSTA 2I4TA 2JI4A 4JI0B 4ZCSA 1PE0A 3LX5A 1FVOA 2O4CA 4F45A 1B8VA 1OFUX 3OQ6A 3EZLA 5DOVA 4K9LA 2PX2A 1XHLA 1R0WA 5EQDA 1ZIOA 2ONCA 1QF9A 2R6AA 4N5NA 5A04A 5LYJB 4V1CB 5EUQB 2BC9A 3OSUA 1Z34A 5HFJA 1KPHA 1ZOIA 2A1TS 3NNSA 4IIDA 1L3CA 4K6MA 1GN8A 5F7OA 4P3PA 4GC9A 3H5VA 4P35A 3SJBA 3WGGA 3SXUB 2H63A 4MWGA 3OZBA 4D9KA 5K05A 1I4TD 5IANA 3JV7A 2YHUA 3CNBA 3DMNA 3KJNA 1BX3A 2QK4A 2XDAA 4YAWA 2RHMA 3L4EA 5F3WB 2AKAB 2P6PA 1QP8A 1E2DA 2G70A 4ND8A 5E95A 5CFPA 7REQB 2ZXFA 1O6FA 4LDZA 2DFNA 4NATA 5EP1A 2FSVA 2HWKA 4HMOA 3LTEA 4GYJA 1J00A 4I2VA 4AKTA 1C1DB 3MBIA 4DCOA 3H5IA 3M3HA 5CAEA 5HK9A 5HX7A 5J58A 1SXJC 5B3AA 4DUZB 1KK3A 4LSWA 1W25A 3DAFA 3M6XA 1RU3A 4H6WA 1XP5A 3OJ0A 1JPUA 2YS6A 5ADVA 2Y1WA 1M6VA 1KHHA 3FSJX 2FPMA 2GBGA 1XZ8A 3ILYA 5FBKA 2F17A 3AHDA 1VFNA 1YK1A 2QX4A 3P0EA 3JAKB 1SKUA 1E3MA 1YOBA 3AG6A 3EYAA 2XEDA 1H6AA 1YCGA 5EMMA 2PZGA 4QRDA 3NAZA 3SSAA 4EHJA 4BFWA 3N8GA 4A8PA 1NU6A 1NVVR 2V74B 3WKEA 1NRJB 1TRHA 1I4DD 2XEXA 4CM6A 5JOQA 3GMTA 1NLMA 4TV9F 2NUTA 2QQ0A 4CMHA 4QSHA 1C3OA 4JP8A 3RS2A 1HOTA 3F4BA 4BIIA 1DEOA 3VO8A 4TTVA 3LCJA 4B4KA 2JIQA 1Q11A 3IVRA 1YDWA 3JQQA 1QWSA 3CG4A 5JVDB 3QOFA 1TZCA 5EI5A 2CMKA 2G67A 2IZ0A 5HRCA 1DP4A 4D02A 1RWKA 1DBVO 3NBQA 2IS4A 4GBJA 1I10A 5HUJA 3QPAA 5JAZA 5FQNA 2BI8A 2L82A 3RK1A 5JQGB 2D7JA 2QSUA 1AM4D 4LZZA 3WA6A 4QTUB 5D3KA 4Z53A 4IUDS 4JLWA 2X5JO 4DLTA 2IYAA 4KH1A 3OOSA 5KREA 3TAXA 2FZVA 2AFIA 2MSLA 5CM9C 3AOEC 4GU5A 4CMIB 1J5XA 1R2QA 1V7ZA 4YAOA 1ZD4A 3IT2A 3COWA 3NNDA 4FFBB 4NNOA 1CQJA 3K2QA 2UYGA 5GGYA 2CV1A 1BVHA 2DF8A 4IDQA 4KFSA 3CB2A 4FI3F 3GDOA 2OV6A 1SY7A 1BGWA 3HBMA 3KCNA 2CC2A 4RHYA 3AFGA 4WZBA 4JT9A 4X8MA 5JDCC 2IYXA 3AR2A 3MCTA 4M21A 4Y2SA 1V37A 3SIRA 2JGAA 4Q7QA 4UPEA 2H5EA 4LG1A 4FMDB 1SVNA 3A7EA 2ZJ5A 4HLQB 3OZUA 3IKJA 5CHEA 2VHVA 5JLJA 2HSDA 3BHJA 3ACBA 1BA2A 1RW4A 3JVUA 4OM8A 1TT5B 1LNZA 2ES4A 1ZISA 3ECCA 4HEA1 3GEPA 1KAMA 4A16A 3I9JA 3OIDA 1ARZA 2VTEA 3EAGA 2VPIA 3UVEA 4EHIA 5CFOA 5JIBA 2RHBA 4UARA 2Y92A 4XPIA 1FPQA 4LOJA 4EYGA 4H7FA 4GKKB 2NQ8A 3AILA 3BOSA 3JALB 5B1YA 1XMXA 2AZ4A 5KNDD 3GCXA 3L8MA 4N65A 4KXMA 4DTIA 5B37A 5D86A 3T9FA 1ZKMA 5L7TA 1COZA 1DADA 3EXEB 5BR1A 2OCIA 3B9BA 1K27A 4Q9NA 3O8OA 2Y1EA 2AMYA 2PZBA 5K4AA 3AKYA 2BP7A 4PAMA 2O6LA 3RKUA 4TMXA 4DLWA 4DV2B 1XKXA 4J3FA 4I1PA 5JDIA 2X19A 5DX0A 3D7SA 1RWMA 3SQDA 1ONSA 1T4GA 4L22A 3WMFA 1HQDA 2W37A 1N6RA 2GAIA 3UJ3X 5TJ9A 5BN4B 3G88A 4AT1A 5TXGA 5FOXA 1LNSA 3RABA 3TJRA 4A6XA 3GGGA 3QKUA 1YQXA 4NG4A 4Q3OA 1GPWB 2ZAGA 2C4NA 3AY3A 3ROXA 3C3PA 2H65A 4PRLA 4GSLA 4WKGA 4HI0E 5DI3A 1E7QA 2E85A 1I1NA 4OL0A 5LA6F 3TX6A 3ZK8A 3R7NA 3UUWA 4OQNA 2WT9A 4EARA 5DBEX 2P9GA 5JC8A 4A36A 3WHLA 4PR3A 4IOJA 2P8JA 1PR1A 3OM8A 2B92A 2J5XA 1K68A 1M1YE 1BIFA 1O4VA 2B5WA 4IICA 4RXTA 4E03A 2PR2A 3RIMA 2W71A 4LJKA 4IHJF 1I4OA 4UM7A 3H18A 1G291 5BORA 4V0RA 3SR0A 4HRXA 5CVVA 4M38A 1E2JA 4HFMA 4KZKA 2LVBA 4FN5A 5I3ZA 3OX2A 1XRMA 1VC2A 3WDSA 2IY9A 5DU2A 2RIRA 1YHNA 1BCSA 1EFCA 1KJZA 1ULHA 1BXRB 2B4RO 2HRQA 2OBFA 3HCEA 3HO8A 4HATA 3CY6A 2VOEA 2PCJA 3EAFA 4J4HA 1PFUA 3L8DA 3IHLA 3AONB 3G3EA 2BFFA 3O2SB 5DK6A 1P1HA 2BGTA 3PUJA 1C81A 4Q7KA 1DG9A 4HNUA 2VDUE 3RCBA 2NM0A 4B3XA 1RYFA 2OAGA 1RYNA 1Z9BA 2QG9A 3WLLA 5ELXA 3RTCA 1ND6A 2O8DB 2P9ZA 3D0OA 4MCHA 2EHDA 3EUFA 3ZU6A 5BMOA 4ILEA 4ARCA 1I5EA 4PWYA 2BFWA 4YAJA 2FE1A 4DC1A 1R1DA 1N6PA 4TYPA 3CZRA 3CS3A 3FM9A 2HXYA 2QGFA 2WWFA 2RK3A 3PHJA 4N8DA 2QBYA 3HB1A 3R76A 3ND9A 5JSHA 1N2CB 1G7CA 3NBUA 4FWTA 3GCWA 5LL6P 4BE4A 5DN6D 2RSLA 4XYEA 5A5GA 4YCAA 2FPPB 4G86A 3GT3A 2FW7A 4R2WA 3TOZA 1TAQA 1YB2A 1WUIS 4ZYLA 3KOZA 5C4MA 2H48A 4QVGA 1FXWA 2SKEA 1Y8QA 4MZXA 5AK3A 4J29A 3B1XA 1T0PA 1TF2A 2BRUA 4KQ6A 1BX0A 4MS1A 4XM0A 5D01A 3RRXA 1W4BA 3KEOA 3SZUA 1ILWA 4MK4A 1S3FA 3HBJA 1XTBA 4JCCA 4K7JA 1E1LA 4B45A 1RE0A 2GZRA 2BZGA 3PF8A 4RVNA 3UFXB 1IOVA 1BFKA 2F00A 1G0OA 1MTOA 1W4LA 1QGZA 1K5DA 2O1EA 2QVGA 1E6KA 3GCDA 3G8YA 1T2AA 4JB2A 3PEEA 4ZOCA 1YZHA 1CUCA 2G80A 1EB9A 4LJ9A 3KZCA 4XI9A 3RH0A 3UT0A 1R0SA 5DM70 3NTQA 4MV0A 1F8YA 2JI8A 3L8CA 3DM5A 1YC5A 1TZKA 3DW1X 7MHTA 5KMGB 2EBUA 2P41A 5IT9A 3PNYA 2YZNA 4QUKA 4UXJA 1RNLA 2LRHA 1BKDR 3HJRA 5AP9A 3SI7A 1P0QA 2CYBA 1NBMD 1YHZA 1Z5OA 5GWXA 3WQBA 2JJ1A 4IDEA 1KYVA 3REQB 2IUSA 4MVJH 1QH9A 4DJAA 1HOXA 5C9ZA 1EXVA 4KLRA 1F0YA 5DULA 1QOPB 2IDKA 1S7GA 3B5IA 3H3FA 3KB2A 3UUGA 3KXKA 3ZR4B 2D2XA 1ZYUA 2ORIA 1B41A 1YJXA 1Z0JA 3PU6A 2GCPA 5UKDA 4M7RA 3TUIC 3VNUA 2PWBA 5B7PA 2JPDA 1AUXA 6LDHA 4PZAA 5HF5A 1P44A 3SC2B 3NGLA 3OOJA 1HRDA 2XNCA 4HWPA 3SBDA 3UV7A 4D9EA 2MSEB 2WNSA 3A2NA 4K9QA 4ERXA 5B64A 1XPOA 4CF3A 4XVRA 4J6EA 3WLFA 1HNZB 3O2QB 3ZVLA 2Y1OA 4HN2A 3R5JA 2GHIA 4F71A 5F23A 1T4CA 3J81A 1SBHA 1E99A 1JE1A 4L8VA 1FDUA 1K6MA 5DBFA 3EMVA 4IGKA 4DM4A 4CL2A 3ROMA 4DWOA 3QWIA 2WA2A 4TVKA 2NMVA 1C7ZA 1Z2OX 2IYPA 1UFVA 4QPDA 4AWXA 1V1MB 4D3DA 2CMHA 2XKAA 4UHKA 1IMOA 3OE4A 4PXAA 2XZOA 4X94A 1ORVA 1NUAA 3CTMA 1GOTA 2FG5A 1V5EA 1DCFA 1DLIA 2GR9A 2WYUA 4BOYA 2A9JA 1GNPA 3WGQA 1XEFA 1VGQA 1F8GA 4CM8B 4CQNA 4UEKA 4O2BB 1DELA 2ZR7A 3LQKA 1BMDA 3NBAA 3ZC3A 1S2MA 3PVCA 3WLTA 2UVPA 1WMAA 5HKKD 3O5AA 4ITUA 1X70A 1IPEA 1U1FA 2NU7A 3KFVA 3O0TA 3QV2A 1KOLA 4FBMA 3BHMA 3PUZA 3MOGA 3QA9A 4R71A 3PX2A 5HF9A 2NUPB 2R1VB 4HWTA 4DUPA 2IX3A 1TJ4A 1D03A 1KYWA 2F3TA 2I1QA 3GDWA 3H5RA 3IQHX 4JJ7A 2XNDD 3QF7A 1RMQA 1SQ5A 2XXAA 3X2SA 4UXIA 3BB4A 5JXHA 2UZ4A 4B3BA 2XKBA 3AERB 3AFNA 4QU0A 3AJEA 4TWZA 1OFTA 4XYMA 5HCUA 3SHOA 3V4PB 5K3OA 1P72A 3ZX5A 1UKVY 2JHPA 1NC3A 3GMSA 1KYIA 1TC1A 3A6GA 1J25A 3DC2A 1KORA 1LBEA 2NYUA 4GNKA 4RZIA 1HTTA 1NVDA 1AV7A 2GSDA 4BFYA 5ITVA 4NPAA 4Y67A 2OK8A 4YECA 1FUIA 2Y67A 3LAWA 2X8JB 3VYSB 1M1XB 3ZDCA 2FEPA 4BBAA 2EP8A 2ZP1A 3GIWA 1RKVA 1ZITA 2NU6B 1CQWA 2FKAA 2QMOA 3GK3A 2GO1A 1T0HB 5DYWA 3EIHA 4KO1S 5DM4A 1G2OA 1Z6GA 2V8BA 1RHMA 3K96A 2H0RA 1J0DA 4JBXA 4LE0A 1NHWA 5I3CA 1D8TA 4JJFA 3MD0A 3QPBA 4B3GA 4PAOA 4LAFA 4XPZA 1U3CA 2OGSA 2PUWA 3LE8A 4Y9DA 4CG1A 3GRZA 3JZFA 1E6MA 2WZQA 2PSJA 3B85A 3CKYA 2WIDA 3L6RA 3CH6A 1LEHA 4FUQA 4UHDA 3ZDQA 2Q27A 3USCS 4BNWA 3HKDA 4XJSA 1JU4A 1L6IA 3EZNA 1BSVA 4L5BA 3WNQA 4H7KA 2NG1A 4O8CA 2Q28A 1PL7A 4AX8A 1QUEA 2PZLA 2F3UA 4RF2A 3EZYA 1MZPA 2LZ0A 1YQQA 2HCTA 2IXEA 3VPBA 4BFXA 2C77A 1RACA 1RRCA 3M6AA 3H1PA 1GG2A 4Y0VA 3WLKX 2XXBA 5A71A 2IOFA 4G9BA 1LZLA 1TM1E 2HWXA 3A4YA 3OEHD 1BJKA 2WUWE 3IMEA 4EENA 2NXWA 1R0RE 2PZAA 5CYFA 1T10A 3WGNA 2CJWA 1X14A 3OIVA 3ZGXA 5JS7A 3G1TA 4I4IA 1U3WA 1T9GR 1JKJB 1YJCA 2IK8A 3B1VA 1N5MA 3LXMA 3OC0A 4TGLA 4IEEA 3UG6A 5IABA 4MRPA 5B2EA 1REQA 3K0FA 3TXYA 3CXRA 3FROA 5A5VA 1NQ5A 5ULLA 3U19A 3NTLA 1HPLA 4URYR 4OPMA 3M9LA 2RARA 3U5ZB 1P9LA 2G3YA 3FOBA 1Z4QA 1NDQA 1B76A 2PN1A 2VOJA 4IQFA 3ROQA 2WQ6A 2XSZD 3DE1X 1E1YA 1K3FA 3AEKA 4UAJA 2K7FA 4ESHA 4YRBA 3DBIA 2YN2A 2M2IA 5BWMA 1HSOA 3HM2A 5CGQB 3LK6A 2MCFA 2I0FA 2NUAA 1EBBA 1E2IA 1G42A 2NPIA 1RTTA 1WV1A 2ZIUB 3AI7A 3PKIA 1SBNE 3CW2A 4RDHA 3UJ6A 4EJMA 2C3PA 2AT1A 1V5IA 3DZCA 3CZQA 3NBXX 3NETA 1E0SA 1T9GS 2HA7A 2HLDA 3GJ3A 2D13A 1GCUA 2HHAA 4HO1X 3H1TA 1V43A 3HA3A 4ZMRA 4DZRA 3GOHA 2HN9A 3LFTA 4AKEA 1M2JA 1PFVA 1P29A 5GINE 1TM4E 2FWBA 5FPHA 1SXQA 1U7ZA 1L5KA 1XEAA 1VFPA 1LY1A 2DAPA 2ZSDA 3ZH9B 2FMFA 2FEAA 3ZLTA 4LS3A 5GZ3A 4RTNA 1QHHA 1U0TA 1DEAA 1ZVKA 1T5BA 3IELA 2CE2X 4GP6A 2O0JA 3UBMA 1GTRA 4QM7A 3RWMB 4E1VA 4JYBA 1NG1A 3V6LA 1EFVA 2V59A 4HXEB 4TYYA 4DSAA 3CCCA 5HHTA 4LJ5A 3WQHA 4D4MA 2OGTA 2EEPA 3FOWA 4X45A 2QE7D 3VNVA 3KT6A 3MJCA 2IFTA 1FDVA 4KH0A 1TB4A 4L5JA 4LDPA 4TMVA 5BY2A 4JFRA 1JIJA 3DDNA 1N25A 1CNEA 2B8NA 4RADA 1X1CA 3U81A 3HYSA 5IM4F 1TIBA 4NV1A 2V45A 3A14A 3I92A 3U7IA 4B3DA 4PGFA 3EK2A 3HXMA 3PQ5A 3MJFA 4RTMA 1N7IA 3TL3A 3BH7A 4E5VA 2GF9A 4D79A 1TF7A 2VTDA 4M7PA 5CIQA 3KWFA 1XAIA 3U7GA 1AF7A 1EG7A 4HPWA 1GU1A 1N5KA 1RRPA 4BNYA 4Y2VA 1DEKA 4JYCA 2AFHE 1WW3A 4ME6A 2G9VA 4OK5A 1IM2A 1AKQA 5E3JA 1R3UA 2GEFA 2O8BA 3MTBA 4C5CA 1C8KA 4FNAA 1YZTA 4EDFA 2PV7A 1FP4B 2DKNA 1QQTA 3QNUA 1SRQA 1BCRB 1PV1A 2QLNA 2PJRA 2QRPA 2J3EA 2PX0A 5CUQA 3NTVA 1JAHA 1W6UA 1NSFA 1K75A 2GERA 1V16A 2O2CA 4TL7A 2JFGA 5I4IA 2BDUA 3EPHA 4Q4HA 4RDIA 4S1WA 1CF4A 1K2VN 1M7GA 1WHSB 3IL2A 3KQUA 2P69A 5FPSA 3DYIA 3RFUA 1ZRNA 2I34A 2E3JA 3B13B 2IT1A 2Q62A 3O8NA 3T52A 5KC9A 2Y76A 1EWKA 2C1EA 2HA4A 2W2XA 1KMHA 2VYFA 3DEJA 1VBKA 4CZ2A 2HMWA 2P27A 2JK0A 3TAHA 5KYUB 1NOKA 2QUZA 4M6WA 2JLUA 4RCYA 2JAUA 4IG4A 5K03A 4P82A 1U2DC 3GGSA 3SP1A 4CG0A 5BMVF 3Q2OA 2IYOA 1YSCA 2GLXA 3EXHC 4IZIA 3T4PA 2JATA 4P4LA 4Z7NB 2M6KA 3Q8LA 5FNVA 5TT0A 2RHWA 4UQOA 5A3QA 5TNXA 3RC7A 2CLIB 4UUOA 3DLIA 5C37A 1V8PA 3P9CA 5JISA 3X1DA 5ALNA 1RADA 3F4LA 1CY7A 3LC0A 3ANYB 1IAVA 4EP1A 3X1XA 4A10A 3UMSA 3IUPA 1Z62A 2P30A 2PRJA 2ZKIA 2V3WA 1BVUA 4MCJA 2CXPA 4NFHA 1I2DA