4C88A

Esterase lpest1 from lactobacillus plantarum: native structure
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
338
structure length
338
Chain Sequence
GMPTINSIQTTVNGVVKIVKPFNNDIAGEQFDPHVLQTLTAFKQPAILENDLAALRSGSLTPAIADPVGDAVTVQSRNITALNRTVSVEWLTPQNVINHTVLVYFHGGAFYGGVPGNNTVLLKLVAAKSHCEILNVDYSLAPEAPAPAGILDGLAIFQYLEQRDAETMITVAGDSAGANVIMAATNLNQQLGSNRINQQLLLYPVTAPNADHAGPLWDLAAFPIIDSQRAILTNYHDLFRQLDSIMTDYYVPENFDSHSPLISPLHQENFTMTPPTTIMVGEFDPFRPQAWAYAQRLAAADTATTFIQYQGLNHAFAPLVDQYWQSQDVAQVMAAALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
publication title Esterase Lpest1 from Lactobacillus Plantarum: A Novel and Atypical Member of the Alpha Beta Hydrolase Superfamily of Enzymes
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 111
structure length 338
sequence length 338
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c88A00
1L7RA 2HU7A 3WL8A 3BIWA 4D9JA 5K3BA 2QTBA 3WMRA 5J3JA 4HVTA 1R9NA 3O4GA 1CUDA 1YCDA 4CCYA 3V1KA 1C7IA 5AO9A 2WU4A 2D0DA 1YB7A 3VXKA 2CB9A 2WIDA 3V1LA 3AIKA 3D2AA 2PUJA 4WFIA 4ZXFA 1OILA 4Q05A 3S8YA 3I28A 1LBSA 1UK7A 1W4LA 3WL6A 5ALVA 2JF0A 4GEGA 5A7GA 4AO8A 2DFPA 5LP1A 3QM1A 2JGLA 4FBMA 3R41A 2XUGA 1CUHA 1X2EA 1MAHA 4LYDA 1GT6A 4G9GA 2O7VA 2WIGA 3ZLVA 4OSEA 1EHYA 1FFDA 2EEPA 4DNOA 2I3DA 5FV4A 1R88A 1ZOIA 2QMQA 2XUQA 3KXPA 2XUIA 1N8SA 2CBGA 3STXA 1YASA 4LKOA 4XVCA 1A8SA 5FPPA 3W9UA 4HXGA 3CCBA 3I6ZA 4P93A 1ZI6A 3PUIA 1QE3A 4L9AA 4IHAA 1LPPA 5K3EA 4U2FA 3KWJA 5BWCA 5F4ZA 5CMLA 3I6YA 3PF9A 3KDAA 4DLNA 4U2GA 1BRTA 2HIHA 4BAZA 1WB5A 1XRRA 4L3WA 1U4NA 4C4ZA 3A2MA 1E8MA 5EI5A 5IVKA 1E8DA 4CG3A 2OCGA 1XRPA 3WK5A 3WL7A 5HF9A 1XRNA 5LZ2A 4ZV9A 5CXUA 2AJLI 2UZ0A 5AICA 3V9AA 1AURA 2WUEA 3RLIA 4W1SA 2HA0A 1WOMA 4OPMA 1F6WA 2I78A 2G63A 1T4MA 4K6HA 2HRRA 2H7CA 2BGRA 1CUGA 1CUAA 2DCMA 5EIEA 1ORWA 4M0MA 1WB6A 5HFNA 2V97A 4J03A 3R0VA 2WHPB 4HTAA 3T4UA 5K3FB 3S2ZA 4X90A 4AO7A 2VEOA 1WCYA 2HL6A 2G5PA 4KYVA 3ZV7A 3WK7A 4U2DA 1QIMA 2RIPA 5HZGA 1UZAA 3IA2A 1U8EA 5DLPA 3UMJA 3Q0TA 1FJ2A 5JADA 3STVA 1XZGA 4DMFA 4H35A 5AI6A 3G7NA 5HK8A 3AFIA 4LXHA 4BATA 3UUEA 2WM2A 3NGMA 4UBOA 3B3QA 4FLFA 3QVMA 3STYA 2XQJA 2VAXA 1Q84A 1HQDA 1GQRA 2H7YA 1EVEA 4AO6A 4GXNA 4CG1A 1LGYA 1K63A 1P0PA 2AXEA 2O2GA 5CH3A 1CUWA 4FFWA 2B4KA 4H7HA 1BS9A 3I2KA 4OU5A 1QIDA 3D5EA 2NW6A 3WIOA 1E66A 2JGEA 1R1DA 5T4BA 3ZI7A 1W76A 4B6GA 3GA7A 1XKLA 5IVIA 3FCXA 3EIOA 4RPCA 5H3HA 3D4LA 4Y7DA 5JARA 5AI8A 5ALDA 4CIAA 1TIBA 4A23A 3FLAA 1R9MA 2WLSA 4H7KA 3BJRA 5AIBA 3QPAA 4K2AA 5IVHA 1CUEA 2OCIA 4PO3X 4J0GA 1N1MA 1DWPA 1DU4A 4N8EA 3KWFA 3P2MA 3DYIA 1GKLA 2WU3A 2XB6A 3WJ2A 4UHHA 2BJHA 1FFBA 5JANA 5CT5A 2X76A 3D0KA 3ESDA 3WK9A 4BVJA 2PX6A 4C01A 5LZ4A 2EDAA 2BUBA 1U2EA 2VQ6A 5AKKA 5KBYA 3H0CA 2WTNA 3RKSA 1IUOA 4GBGA 1QLWA 4DNPA 2FUKA 3G0CA 5I8PA 4Y2TA 1ACJA 3WQHA 3DDUA 4YK7A 2RHWA 5LKAA 2GBIA 4P9NA 2HA5A 2VAVA 3WWDA 2HA3A 3F98A 3IUJA 3H04A 3LLCA 5DYWA 3LIPA 4JEIA 1IZ7A 2C58A 3M3DA 4BZZA 1LLFA 5C81A 4K6GA 1AZWA 4KE8A 4J0KA 5D6OA 1MPXA 2HM7A 1LBTA 1ETHA 5AM4A 2XMDA 2HA7A 3C8DA 1BCRA 1LPSA 2AJDA 3AJAA 5AP9A 2QOEA 1YB6A 3H2JA 5LZ7A 4FLMA 1QZ3A 1XZBA 3D2CA 3FSGD 3PUHA 1ZJ5A 3RK4A 5CT4A 2WTMA 5E4YA 3QYJA 4E11A 1CUVA 5AH0A 1WPRA 2XUFA 3F67A 2HU5A 3WZLA 4GWLA 3WWOA 4N8DA 2PUHA 3A2LA 4EUSA 3K2IA 5JZ9A 3U0VA 4B7ZA 4JH0A 2WFMA 2JGJA 4YX9A 1G5FA 1QIIA 3IUQA 4MEAA 4AMZA 1GKKA 1TQHA 5ALHA 5DTIA 2WUDA 4N8SA 4B9EA 5LZ9A 3HRHA 5AK3A 2XMBA 3M83A 3O0DA 2DR0A 4LIPD 4BRSA 4Y2YA 1DINA 5DNWA 1JMYA 4IH4A 4K6KA 1RYYA 1EDDA 1AX9A 3PFCA 4UPDA 1AQLA 5DNUA 4UBIA 2Y1KA 4RNCA 2OG1A 4ZWNA 4CIBA 1GXSA 1VKHA 1VZ2A 2PSJA 4J0CA 3ESCA 3G9TA 4I3FA 1JJIA 2PSHA 4H0CA 4OCZA 5SYNA 4WDRA 2HA6A 1QO9A 4YASA 1L7QA 4QA9A 3G02A 2QT9A 3QPDA 1JMKC 4EHBA 5EIHA 3O4JA 1WHSA 2QS9A 4OYYA 2FJ0A 1P0QA 4QWMA 4AMYA 4U2CA 3FNBA 4FOLA 1H2XA 3WA6A 4QZVA 2C5FA 2IX9A 4CCYB 2RI6A 4F0JA 2PM8A 3RM3A 1FFAA 1CQWA 2OGSA 2HADA 2JGIA 2V98A 4WY8A 2V9ZA 2OAGA 2JEYA 1D07A 4UFPA 4OU4A 4KACA 1H2ZA 5JD5A 3C70A 3PICA 2BKLA 5FUMA 4J0HA 4QDTA 5C8ZA 3H2KA 3WKEA 1YS1X 3TJMA 4ITVA 2Q0XA 1R4ZA 2ZVDA 3ILSA 4KE6A 4F60A 4AXBA 1DWQA 3H1BA 1ODCA 2H1IA 3L1IA 4BP8A 1ZI8A 5AI9A 3QITA 2VA9A 3VDXA 4L72A 5ALKA 1J07A 1EA5A 2QR5A 1YAHA 4J0JA 3W04A 2BCEA 2GZRA 4Y2XA 3FCYA 4E14A 1ZJ4A 1WM1A 1SCIA 2WFLA 4BB0A 3VKFA 3F8SA 2B20A 1RWQA 2R8BA 4J7AA 1ZD4A 3JYHA 3T52A 1A88A 5K5EA 2VTVA 5JD6A 2K2QB 4A5SA 4RE6A 4X97A 1LPNA 1H22A 2QJWA 1ZICA 5E2IA 4DSAA 4AN1A 1BU8A 4GDMA 4Z49A 1CR6A 3WKAA 3B5EA 2PBLA 1CUYA 5DNVA 3QMWA 1XZHA 3G8YA 1OCEA 3A70A 3R3WA 1DQZA 2C5GA 1JFRA 4CFSA 1JI3A 4KRXA 1Y37A 4FTWA 2GZSA 3C6ZA 3MGAA 1JJBA 4B82A 2W22A 4G5XA 2YXPX 2AJBA 5DWDA 1G66A 1VJ5A 1L7AA 5ALYA 2HFJA 2ROQA 2HA4A 4UBJA 5FXMA 4INZA 4UBNA 1CFJA 1FSSA 4B85A 4B9AA 2WIFA 4KE7A 1MO2A 4XJVA 3EF3A 5K3DA 2JEZA 4L0CA 3ICWA 4B80A 5K3AA 1YAJA 1CLEA 3H17A 4QDXA 2FJPA 5ALFA 4LXIA 4X6UA 4EY7A 3M81A 1EI9A 5ALRA 1A7UA 1SCQA 2PSDA 3AZQA 1QIJA 3OM8A 1VXOA 1I6WA 1IZ8A 3IB3A 4J3JA 3WKDA 4EBBA 4BZWA 1QIGA 1C4XA 3VVMA 4CCWA 2X5XA 4X85A 2P8SA 2OXEA 1R3DA 2E3JA 1UXOA 1IVYA 4NMWA 4HRXA 1LPOA 1P0MA 1MX5A 2ZJ6A 3WZMA 3I1YA 3KD2A 1BN6A 4U2BA 3HJUA 3R3XA 1EK2A 2XI4A 4LHEA 5CURA 5JAHA 5EHZA 3DOIA 2Z5GA 5A62A 3HYSA 3BIXA 4ROTA 5FDFA 1MTZA 1IUNA 5D3ZA 5EIAA 3V1NA 3WI7A 3I2IA 5SYMA 4OUKX 1VOTA 2H7XA 3FLBA 2ONCA 1FFCA 3D3NA 4KR0A 2VJBA 4BCBA 5HF6A 3CCCA 4FLEA 3HC7A 3ANSA 2ACKA 2XUDA 2J4CA 3WL5A 1XROA 3W9BA 5A6VA 1JJFA 3DYVA 4G8CA 3O9MA 5IVDA 2JGFA 1ZGCA 1H23A 1VXRA 3ED1A 3IUNA 4KAJA 1S8OA 3H18A 1VZ3A 2O7RA 5CT8A 1EX9A 3WA7A 3F97A 5AKHA 4G8BA 1CRLA 3LP5A 4V2IA 1UWCA 3JWEA 1WB4A 4H7FA 3PI6A 3HEAA 2AJCA 1CVLA 3LCRA 4ZRDA 5JAPA 3OOSA 4JYMA 2GBGA 1ZD3A 2ZJ7A 3GZJA 2XE4A 1TCAA 2WIKA 1EVQA 2C0PA 2ES4A 3X3HA 5AKXA 2BUAA 4EY5A 1EINA 4BC0A 2GYWA 1NU6A 1HLGA 4K5QA 2ZYHA 3OTQA 2ZYIA 4EA6A 1GPLA 3NOXA 4NVRA 5KWJA 4EZIA 3DOHA 5E4TA 2VJAA 5JIBA 5EHQA 5A7HA 4DM7A 1XLUA 5ALWA 1MT3A 3BE8A 3MVEA 2JIDA 5FP0A 3DEAA 1LZLA 3LIIA 2WQZA 3BF8A 5EFZA 3RARA 2V96A 1LPMA 3H1AA 5T4HA 4BTLA 4OD0A 1LZKA 4X6YA 1QOZA 4C4XA 3E0XA 4HS9A 4BCDA 5LYYA 1EH5A 2AJ8A 4AQDA 5YASA 1CUCA 4BBZA 4B84A 2ZSIA 5AM0A 1AGYA 3HI4A 4H7DA 4ZREA 2CKMA 5E4JA 2G5TA 1Q83A 3E3AA 1K6EA 2RONA 3PF8A 4XX1A 1QIKA 1QTRA 1RP1A 3L1HA 5C8VA 3SWWA 4ZGBA 4WFJA 1EB9A 3KOOA 3IVMA 2H9YA 5JALA 5AI5A 3EBLA 4HZGA 4MXDA 3R3UA 1XZEA 3WYNA 5FPQA 3VVLA 2XMZA 1YA4A 2XQGA 3L1JA 1XLVA 5AK5A 1TCBA 1XZIA 5T4FA 5JASA 2C0QA 5CT6A 3FVTA 3H2IA 5CXXA 4UHCA 1MU0A 3NWOA 3B12A 5JYCA 1VA5A 1QIFA 4M0EA 1A8QA 3GELA 5AM2A 2OGTA 2HU8A 5ESRA 1EK1A 5CW2A 2Y6VA 4PNZA 4Q34A 3SC2A 3R3ZA 3DS8A 5T4EA 1XLWA 1W75A 4FHZA 5AI0A 3DL4A 1XRMA 4BE4A 2QM0A 1AC5A 4DNFA 3STWA 1UKBA 1ZGBA 2WG2A 1WPXA 5ALLA 3I2HA 2XT0A 1P0IA 1XFDA 3V1MA 4HAIA 3W2TA 2I3ZA 4UFOA 4PW0A 1TRHA 5ALIA 5FOQA 2Z8XA 2YASA 1XRLA 4X3CA 1LPBB 4UHDA 2OQIA 2ZYRA 3FYUA 3I1IA 5ALMA 1DT3A 1JT2A 2Y6UA 2HDWA 5ALGA 1JU4A 3MUOA 5HF8A 2OPHA 3DKRA 1XQVA 4ARAA 3IURA 3UUFA 4W1PA 1YR2A 4PSUA 1PV1A 4H7IA 1DX6A 2RAUA 5I9IA 3H2GA 4Y2PA 5ALQA 2WJ6A 4Y2VA 2XMGA 4XIIA 4J0IA 4DMCA 5LIPA 4EY6A 2X8BA 2WFLB 4DMKA 1CUUA 5AKIA 5DJ5A 3ZWQA 1T2NA 1CQZA 1QO7A 2GBFA 3R3VA 3C6YA 5BOVA 4UBKA 4AB1A 5C8XA 1GZ7A 1CUXA 4U2EA 3FLEA 5IKXA 5HQ3A 3FAKA 4TVKA 3GUUA 4B81A 1UT6A 4W63A 4DMHA 1MX1A 2DHEA 3OPMA 5AKZA 1G4HA 2DHDA 5AI4A 5HCUA 2RGUA 3E4DA 4EY8A 2XUKA 3WKBA 4BVLA 4FFVA 3GFFA 1TCCA 4MQMA 3AZOA 3ANTA 1LPAB 5I7UA 3O4HA 1KU6A 1MNAA 5ALPA 1B6GA 3O4IA 3R40A 5AM5A 1GPNA 1KU0A 1ACLA 2DQYA 2IITA 3HZOA 4FWBA 4MYSA 2CUTA 2WKWA 5ALNA 4JYPA 1UK8A 2QVBA 2B9VA 5AKEA 1BE0A 4KRYA 2ZYSA 5JAUA 4Q1VA 3IUMA 1N5RA 3WWPA 1BCSA 3FOBA 5FKJA 4EB0A 1ZD5A 2JGKA 1F0NA 1XZLA 2OLEA 2J3DA 2WJ4A 2WHQA 2HFKA 2WIJA 1CUIA 2QXTA 4X95A 1MJ5A 1Q0ZA 2J3QA 4WJLA 4Q3KA 2VF2A 4J0DA 3DL7A 5DYYA 5AKJA 4MYDA 1K8QA 2R11A 3WK6A 1XZCA 4CG2A 5D7BA 2Z3WA 5AK6A 4AZ0A 4N5HX 4WFKA 4G8DA 4MEBA 3H2HA 5C7YA 4NZZA 4UUQA 4OB8A 2WG0A 1H2WA 3MUNA 2JBWA 2O2IA 1IUPA 4MWTA 2WILA 4G1FA 4PF1A 4KE9A 7YASA 2PVSA 5AKYA 3FYTA 3WJ1A 2ZJFA 1X70A 3GROA 4P92A 1WHTA 1Y7IA 1O6FA 4E15A 3IBTA 1EXWA 5EHXA 4IH9A 1ODTC 2XQKA 5HF5A 1XZDA 2PPLA 3WWCA 2PKYX 1XZFA 1H2YA 4X7BA 1QJ4A 3BJMA 2PL5A 1B41A 3C5VA 5A71A 4X6XA 1MN6A 1X2BA 4ZI5A 4TPKA 3W06A 2QRUA 4H77A 2G4LA 1N5MA 2CJPA 1CUSA 2GYVA 4N5IX 3STUA 2VT7A 5AIAA 2BAGA 3FWHA 3VJMA 2DHCA 2OCLA 4H7JA 3FSGA 4FNMA 5ALOA 3BL8A 3D59A 3TEJA 1W52X 2PSFA 1SFRA 4DYHA 4X71A 1GQSA 4RGYA 1UK6A 3LS2A 2BGNA 2QJRA 3IIIA 2OAEA 1XZMA 1IMJA 4IH1A 4DIUA 1GPKA 2WFZA 5KREA 2VJDA 1CEXA 1U65A 4Y2QA 1F0PA 5FLKA 5CH5A 3I2FA 5JAOA 3CN7A 5DTJA 4GLBA 5AOAA 5ALTA 4UHEA 2VSQA 1TK3A 4YPVA 1YA8A 5BWBA 1J2EA 3WKCA 4LYEA 3Q8WA 1QONA 1HPLA 1XZJA 3FYUC 5EHNA 2XUJA 1MX9A 5A2GA 2VJCA 3W05A 4BAUA 1UKAA 2XQFA 3I2JA 3ESBA 4FKBA 3R3YA 1CUZA 3WWEA 3AILA 3QMVA 3DQZA 5CBKA 5KWIA 1AUOA 3DCNA 3N2ZB 4P08A 4WDQA 1MAAA 1OXMA 1VLQA 3ESAA 3PFBA 4DTCA 4QLAA 4UHFA 4O08A 3A2NA 4UFNA 4GW3A 2WSLA 4E46A 3ZLTA 1VE7A 1UKCA 5HK9A 5HKAA 4H18A 2ORYA 2XMSA 1BN7A 5BV7A 5AKLA 4KAAA 2OGZA 1E8NA 4G4JA 4BDTA 3G0IA 4EY4A 3GBSA 3G0GA 3HSSA 3ZLUA 1THTA 1ZIYA 1ODSA 3HACA 3AZPA 1EDBA 5AOCA 4JUIA 1ISPA 2PU5A 4QE3A 4BYMA 1DQYA 3TGLA 1SOMA 1UK9A 4QDZA 4IQ4A 1LNSA 3M82A 4QDUA 2PU7A 4KAFA 3E1GA 3I6MA 2OCKA 3O9VA 4HXFB 3CN9A 1QFMA 3V48A 4C89A 3QZUA 1Q0RA 2WHRA 3DJYA 4UHBA 5AM1A 1E89A 4F5ZA 2QUBA 4FBLA 3BDVA 3BF7A 3C8HA 4FDMA 3N0TA 2WJ3A 1W6RA 3U1TA 1HL7A 2JGMA 3ICVA 1BROA 1C7JA 5AJHA 1G42A 4Y2RA 3PE6A 1W1IA 1BEZA 2XQIA 1E5TA 5LLSA 4H7EA 4MQLA 3D2BA 3OURA 5ALSA 4B0PA 5AKGA 3K9BA 2XUHA 1HDEA 5LZ8A 1K5PA 3BDIA 3F9CA 1QGED 2CEKA 4Y2UA 4UBLA 4AZ3A 3FYUB 2EDCA 4QNNA 1R50A 2QXUA 3H19A 1SCKA 2Y2VA 2I03A 2VT6A 2RHTA 3DKKA 5AM3A 4WCVA 1XQXA 5HFAA 1JU3A 1UOOA 4Y2JA 3WK4A 4X92A 2XMQA 4C88A 1DTEA 2WHPA 1E3QA 2Y2UA 2C7BA 1Y7HA 5K3FA 4GECA 3I2GA 3AIMA 4TGLA 5CRIA 1TAHA 1PFQA 4BP9A 5IH7A 1Z68A 1USWA 2HRQA 4WY5A 3F96A 4X00A 5JZBA 1F8UA 1DX4A 5JATA 5HQ3B 3TRDA 2FX5A 4C6HA 3BXPA 3G9ZA 2WUFA 1QIEA 1FFEA 4M0FA 4PQEA 5CT9A 4OB6A 1EDEA 5AK4A 4KJXA 1NX9A 2GYUA 1M33A 2ACEA 4X91A 3YASA 4AX4A 4QLOA 2XLCA 3WLAA 4BE9A 4C87A 4Q82A 3HXKA 5ISMA 4GHWA 2IIVA 1HBJA 1TKRA 4PSDA 5CTAA 4ARBA 1DWOA 6YASA 5FRDA 1K4YA 4QWWA 2XLBA 3AINA 2YYSA 4S0XA 1UFOA 3QMMA 2Z8ZA 3STTA 2WUGA 4LXGA 2XMRA 1A8UA 5CH8A 1QTIA 4OB7A 1XQWA 4HRYA 5AOBA 1CIJA 1J1IA 1THGA 4BDSA 2J4FA 2BFNA 1CUJA 4JNCA 2HA2A 2CMFA 4PV7A 4BCCA 5ALXA 3AIOA 4B83A 4GI1A 4I4CA 1CV2A 4BC1A 4G4GA 3HABA 4BTVA 3IULA 4QDOA 3EQ7A 1VA4A 1ORVA 3OC0A 1MNQA 2ECFA 2YH2A 5ALEA 2D5LA 3VJKA 2GBCA 1ZI9A 2PSEA 1CPYA 3BWXA 2BUCA 5JZSA 2XUPA 2DSNA 1ZD2P 3O95A 5A7FA 1PJAA 5ALZA 3VJLA 3G9UA 3FBWA 3ZPXA 5LKRA 3G0BA 1UOQA 4Y9SA 3D7RA 3WK8A 5K3CA 3IDAA 1QIHA 2LIPA 4BAGA 3AUKA 1CUBA 1GGVA 2VATA 3WYDA 1XRQA 3C5WP 4B0OA 4FMPA 4OYLA 1AMNA 2B61A 5EGNA 3EQ9A 1YSCA 2WG1A 2QUAA 1VE6A 3QPCA 3PDCA 3C6XA 1CUFA 2QKYA 1EB8A 1AKNA 1BEEA 1JKMA 3K6KA 3G9XA 2DQZA 4HXEB 2C4HA 4W1QA 3EQ8A 3KSRA 2XUOA 3DNMA 1NU8A 4KEAA 4G9EA 3OG9A 1XZAA 4G4IA 2HHAA 4XWGA 4ZV7A 3VISA 3QH4A 5D3KA 3C45A 4NS4A 4MJ3A 2Z3ZA 2O2HA 1KEZA 3SX4A 2OQVA 4BRZA 4IO0A 1UOPA 5ALUA 1XZKA 3FVRA 1ZIXA 3HLKA 4AN0A 2XDWA 2XUAA 5DYTA 3G0DA 1J06A 4W1RA 3A6ZA 4X94A 4Q3OA 4QEKA 3SK0A 4C4YA 4DSZA 4X93A 4W9RA 1SC9A 4F21A 3CXUA 4I19A 4BVKA 4CI9A 4DGQA 3C87A 2XMCA 2W6CX 1HKHA 2CZQA 3JW8A 3C43A 5AHXA 1YS2X 4FNGA 1DT5A 4DNQA 5JD4A 1QFSA 3DLTA 2ZSHA 5ALJA 2QZPA 5HKBA 3NUZA 4PSCA 1XKTA 1O6GA 3DD5A 1XQYA 4ETWA 4UBMA 3C6BA 4Y2SA 3WIBA 4Q3LA 4A16A 3QBJA 4RE5A 4MWSA 5LZ5A
chains in the Genus database with same CATH superfamily
1KAGA 1BHO1 3GLGE 1VGQA 2ZE5A 1U2GC 3EGEA 3IAS1 2F67A 3CH4B 4CM8B 4CV3A 4MKRA 5IDYA 1A9QA 2W71A 4LWQA 2GAIA 2Q28A 4GYKA 4NCJA 2YXLA 4Z9XA 2WJYA 3WL8A 3BD8A 3SNKA 2QAIA 1BG6A 3BIWA 3EW7A 4LZNA 4D9JA 1U2PA 2XDQB 2IIQA 2HSWA 2QTBA 1EQUA 5FPHA 1K8RA 3WMRA 4Z53A 1W85B 5J3JA 3HCAA 1UJNA 3CJQA 5I7SA 3U5TA 2TMYA 2CZGA 4IVQA 4LE2A 4AY2A 2J3MA 3T7CA 1I2AA 4H6XA 4JGBA 3OEWA 3V1KA 4OBWA 1C7IA 2PXXA 4YUWA 4EA7A 2G82A 2WU4A 1PGQA 1YB7A 4WW0A 1GNRA 2DJIA 2IGBA 2OHIA 3AI2A 3M9WA 5C4GB 2YZNA 4DA0A 2EU8A 4XGKA 5JHGB 1IN5A 2YW2A 3V1LA 1TZ2A 4TV8F 3AIKA 3P9IA 1HF3A 1E2LA 1BVYF 1G0NA 1OILA 4P31A 3TAHA 1G0OA 3NAMA 2A2ZA 4R8RA 3OLYA 3LD9A 3ADKA 1WEHA 3LA6A 4G0QA 3MC1A 3MGKA 3L40A 1YK1A 2VHXA 4BIMA 1HZZC 5D85A 3ZV6A 2FSGA 1NI3A 4QT4A 1NJ1A 4GEGA 5A7GA 1M76A 2ASVA 2DFPA 4WZAA 1JMVA 1YB4A 5LP1A 1JYEA 1Z4PX 3PZBA 3AM1A 1OXKB 3MA0A 2UZIR 3QM1A 5A02A 1OXBB 3LC0A 1MXFA 4BO4A 3CF2A 4DRZA 2V9PA 2V54A 3ORQA 4HUTA 1MABB 4D56A 1ESCA 1OHHD 1E4VA 4HBGA 3R7NA 3R41A 2BY4A 3IMFA 5CB4F 2R00A 2VDQB 3E2IA 1X2EA 1OKKD 2RHOA 2HGZA 1GT6A 4K6OA 4G9GA 3P2EA 5J40A 2K7FA 3OHMA 2E4UA 1YI1A 3W1WA 1OWOA 3C98A 3KEQA 3TZLA 3DE4X 1OU0A 3BHNA 7GPBA 5I7WA 4GLFA 1OB2A 1GRRA 1U9JA 3SBDA 2FSSA 2ZTVA 2EEPA 3G89A 3K0BA 2HYIC 1HYBA 4PS1A 2FLWA 3PL1A 3RS4A 3WYEA 5FV4A 2JGNA 3GA5A 4V3CA 1W94A 2F6RA 4KVAA 2XUQA 2NXCA 1GFWA 3KXPA 4P38A 5GVRA 2AA3A 2C5LA 4Q7LA 5BORA 2NPFA 1NBAA 1AKMA 2QQGA 1FK8A 3NU1A 4N12A 3V8EA 4CKEA 4RIEA 5IK2D 2XXAB 3STXA 2YUIA 1QK5A 4II2A 4BFYA 5H3CA 5FPPA 2VHJA 3W9UA 1KO8A 4Q6WA 2HO4A 4KYUA 1EWRA 2F00A 3IEPA 4TM7A 3PUIA 1NXXA 4Y2HA 4EMBA 1HNWB 3C3KA 1M8PA 4BKUA 3L41A 3AF4A 4YMLA 1D1TA 3KWJA 1Z29A 2VYCA 3D0QA 1Z4JA 1YO6A 1W2WB 3H3JA 2QLMA 3NJ8A 3O94A 3SEZA 1KWKA 2OC4A 3I6YA 3I0NA 1TDJA 3QWIA 4ENSA 4ZMSA 5LDGA 2I1VB 4LNUB 3LWDA 1DOAA 1STOA 2H2WA 1J2RA 3UV3A 2XXBA 3O3MB 3RQIA 2NNLD 4BMVA 3A2MA 1H42A 3A32A 4DILA 5F7JA 4ARSA 4UTRA 3DLHA 4Q7EA 1E8DA 4IV8A 3CF4A 2C5BA 1P2VA 2OCGA 1PUIA 5KVAA 3AEYA 3CRRA 3DLPX 1FC0A 4JJFA 1RWVA 4D9CA 2QVLA 2B2NA 4FQ8A 3ZDYB 1CY1A 3OEYA 4Z3KA 3BSSA 1DKRA 3BZWA 4RXUA 5CXUA 1Y1LA 2JK1A 5H4GA 1V5IA 3HZZA 4JJ8A 1HV8A 4IJWA 1QPZA 5AICA 2O3QA 2UZ0A 4ZEXA 5CYPA 4MUGA 5E9AA 1QRUA 4A8PA 3VTAA 5KHLB 1FJGB 1BA3A 2WUEA 3GU3A 5I45A 3O8LA 5F1PA 1WOMA 3DOFA 1K6IA 3LT4A 1F6WA 4R9RA 1RYHA 2DTDA 4II3A 3FETA 1L7NA 3KKNA 1NXSA 3ZBQA 1ZK1A 2G6BA 1M75A 2Q0SA 1J24A 2FN7A 3BS4A 3HO8A 4I50F 2PL1A 4LZZA 4EJSA 3TS1A 4TKMA 2Z09A 3NFYA 4N54A 1A9XA 3N3AC 1H2HA 1P7PA 4OREX 2H7CA 2PLAA 4FDUA 1DCMA 4L07A 2FY8A 4J7XA 2WWGA 3ZCRA 4B76A 3ZIDA 3BHJA 3MT7A 4TYPA 2DCMA 3ZWDA 5CVTA 1L5OA 4G5YA 1LC0A 3ASVA 3OY7A 5T6BA 3P2KA 2Z95A 2GFHA 1MW9X 2J9RA 3KLPX 1OX4A 2GTIA 4FFBA 2RB5A 5JRDS 4HTAA 4NABA 2EQBA 1SUEA 2C3UA 3UQZA 2IXTA 3JZAA 2FUCA 2OD9A 4F4JA 2HV8A 4V0SA 1YZYA 2VEOA 2P6MA 1ZVVA 4B44A 3UW1A 4YCCA 1JHYA 1O94D 3OFVA 2AW3A 3DHYA 1NKSA 3OEEA 4WVLA 5HMLA 5GAJA 4EBFA 4UAVA 2KI5A 1ZVQA 2QX9A 3BDAA 4KSBA 1WPQA 1UZAA 4J4BA 1E1YA 3OQPA 3LK7A 5K03A 1NP7A 4P82A 4Q3NA 3N2LA 3ONFA 4TYQA 4C07A 3RRBA 4D3YA 2OYRA 1QE0A 3SVZA 1PJBA 1H8HD 1KJIA 1R0SA 1XMIA 3K0FA 2HJWA 2YRWA 4J1SA 4YNBA 4YI5A 1IFXA 1TU3A 5B12A 1LC3A 1SU7A 2HSJA 3DEHA 3HY3A 4RY2A 3U81A 4DXHA 2IHVA 5HK8A 4HUQB 3AFIA 1LVUA 2VWGA 1C14A 1KSFX 2IUSA 4Z9FA 3T0IA 3EFOB 3KZXA 1F7UA 2XBLA 4BATA 3EISA 4TWBA 1NLFA 3M4YA 1OZGA 1G8AA 1KC1A 2WMNB 3QVMA 3LX5A 4ZIRB 3IE0A 1IBKB 1JR4A 1Q84A 3H9GA 2H7YA 1B8VA 3BMNA 4ZK6A 4AO6A 3ZW7A 4GXNA 3VBCA 2B7CA 2ORED 3SP1A 4HQRA 1T2FA 3K4QA 3W2HA 1EP2B 3FGZA 2HQRA 3S28A 1N7GA 1OI4A 1TLFA 2ZAOA 4FXPA 4HMPA 4ARZB 4WBXC 3TL2A 1KJZA 1JEQA 1M6WA 5DF1A 1RLUA 1P0PA 4IUBS 2FXVA 1FTNA 1IPFA 3OWOA 1MAWA 3JQGB 2A7XA 3MB8A 4RFVA 4N5NA 3T5TA 2WQ7A 2LR0A 3JYLA 4G0VA 3VSCA 2IOYA 1PK9A 4KIWA 1UDBA 3SMVA 1Z5OA 4OU5A 4F92B 4REQA 3WIOA 2VN8A 1E66A 4Z1OA 2FWMX 1VKOA 3RVJA 5CIYA 1W4CA 1PNTA 2Q1UA 3DW3X 4U7DA 4BUZA 1R1DA 4L3VA 4R1SA 5T4BA 4B32A 3MCWA 1AKYA 3CVXA 1NONA 2FLVA 1KJNA 4RZ2A 4DSOA 5BV2P 2C94A 5JC8A 3KQLA 1XD8A 3BIJA 4CETA 3OJLA 1IXZA 1CY6A 2R62A 2BFDA 2HCFA 3EIOA 4RPCA 3IJRA 3NIFB 1JLSA 4AWAA 3OO0A 2AHOA 4IOMA 2J45A 1JDNA 2D8MA 2V7QD 3WRXA 4IEFB 1K89A 1GU1A 4HFNA 1BD3A 4EB6A 4JMLA 5LWQA 1NULA 3Q8KA 1GA4A 3TUIC 1TEVA 2CXXA 3D0OA 2DYKA 1MV5A 2XOXA 3KFLA 3X2EA 5EIWA 3PQDA 2E37A 1U4SA 3KYCA 4CLOB 5J2UF 2Q5OA 2X7XA 4H7KA 2ZM6B 2EZTA 1KJYA 4IIVA 4CVNA 2VBFA 1H2RS 3W9YA 1SA0A 1NJ6A 5DM60 1F6DA 5FLYA 5LXTF 1JSCA 2GAJA 5AW2A 4FXOA 4R7TA 3DUFA 1CUEA 5TMPA 1XDDA 4RULA 5KYYB 1KYWA 2Q3DA 3CF4G 4U6SA 4IIDA 2YRXA 1DWPA 1S7GA 2OENG 4WKGA 1C0KA 1NPDA 2UUOA 3RFUA 2R2AA 4R2KA 1J39A 1VJ1A 2NAPA 3KWFA 4JI5B 3T4EA 4EKGA 5KZMB 2QTNA 1GSOA 2WA2A 5LR6A 1FU7A 2X0JA 3RSLA 2FR8C 4XQ0A 2XB6A 2W4QA 3QOFA 1Q91A 4NU0A 1ZM4A 5K4AA 4ZOEA 2YY6A 1JSZA 3WJ2A 4JXKA 2OXCA 1FFBA 3E5MA 4B8WA 5JANA 2IP2A 3EDCA 1L5NA 3T3DA 1O54A 4K1XA 1XO1A 1XAIA 1E2GA 5FBRB 4BVJA 2MDTA 4DY6A 2H63A 4L1KA 2J46A 2PX6A 2SCUA 4JIGA 5LZ4A 3CR7A 1O0BA 5HKKA 4QQNA 2ERXA 2OOSA 2EKZA 4GOND 5HW0A 4ZYYA 1QYIA 4W5RA 3QLUA 1Y3DE 4R31A 4TTVA 3NEPX 2E48A 1PG0A 2FVYA 1BKSB 1TIPA 2P4QA 1J0XO 1X19A 3H0CA 3T54A 5F9MA 2WTNA 3BGIA 2FWPA 2C2HA 3EARA 1UBSB 3LCMA 4G1CA 3KT8A 4URUR 4J3NA 2V1XA 4CJXA 2W42A 1Q6ZA 1RQRA 4TSKA 4X61A 1N2JA 3W5VA 3ACCA 1CSEE 1QLWA 2B9EA 2G09A 3O21A 3KPYA 4JI4B 3G0CA 4ZQGA 2GXQA 5E7JA 4X1OA 1WE2A 4MJ7A 1D6NA 3A0RB 2UAGA 3U4AA 5AXAA 1HUQA 2ZANA 1XCOA 3WQHA 4HN2A 4OXKA 1RAHA 3ENKA 4OHUA 4TMKA 4TLEA 2ZR0A 3W3AA 2VAVA 4ID9A 3HKBB 1KDVA 2DCUA 2Y0BA 1P72A 3H04A 3IUJA 3FDIA 3QPVA 1JEOA 4BV9A 4JEIA 3DOJA 1TECE 1JW9B 1QF7A 3ANYB 4C0SA 5BR8B 5EUCA 1EUYA 2E21A 3KUCA 1LLFA 1G3QA 2ZSEA 1APBA 2AN5A 2QTCA 1B0UA 3N59A 4PAGA 3VKWA 3AXTA 3HSKA 4A0HA 5C8DA 1QNLA 1MPXA 2GLUA 2GN0A 3LQQA 2J9ZB 3RHSA 3AUXA 4KLCA 2OCBA 2W9XA 5AM4A 5KTMA 2HA7A 3P9SA 4X64B 2VYVA 3EGXA 1IB6A 1EWYA 1CERA 5AXBA 1RJWA 4XI9A 3ID6C 4O5AA 3WGJA 4BMYA 3QLJA 4FCWA 3FRHA 3L9WA 3GVXA 4MP3A 5DFAA 5CCXA 1N6LA 4EYSA 1A9TA 4BE7B 2IWRA 4TKUB 1KH3A 5EWMA 5IUNC 3D7KA 2R00C 1KYZA 4Y1GA 1YIDA 4I08A 4TTIA 4AS1A 3LNTA 1YU6A 4FYIA 3ZU6A 4RCYA 1P1BA 4IHJB 1LRJA 3T3OA 3TMKA 1GN8A 1XEFA 4F4FA 1J1ZA 4KPEC 3CA8A 3QYJA 4LOIA 3UGTA 1TQDA 3ZI4A 1Q0TA 1YFKA 2XUFA 3F78A 2VSOA 1OBOA 2RHDA 2YWGA 1RI3A 3F67A 3GCWA 4WOJA 4N39A 1HNNA 4R8SA 1MKYA 4XX0A 5AVOA 5CCBA 2VTEA 1E1KA 1LDYA 1Y8CA 2I7CA 1XC7A 5IF9A 3Q9UA 3WWOA 1HE8B 3EMVA 2MSDB 4LRUA 2IPLA 4A1FA 5C8YF 5CLJA 4Z5XA 2PUEA 1DC3A 1WXGA 13PKA 4GMDA 4B40A 4B7ZA 4TVSA 3MQFA 3NNSA 1QRRA 3VZQA 4YX9A 3DTVD 4RDIA 1RPTA 2GWHA 3IUQA 4BNYA 1Z0KA 3Q9LA 4MEAA 2IL1A 4DREA 5B1YA 4GVPA 4JLJA 2OLJA 2BFPA 2EFGA 4N8SA 4CKCA 1DJQA 3LO5A 1G5HA 3OX4A 3ZQKA 4RORA 1P9OA 4PLHA 5E7IA 5I8WA 3CW9A 3ZVNA 4YT4A 5T3YA 1I80A 2A5LA 3KOUA 1YA6A 3NUGA 5AK3A 3D31A 3M83A 3WS7A 1PDOA 1QH8B 2NXNA 4OXRA 4EHKA 1BE6A 3IQXA 3W5DA 3RSGA 5BNZA 1NN0A 3NH9A 5CLLA 5JR3A 5IS2A 3NHPA 2JLAA 2Z3VA 1EG2A 2C9BA 3M4XA 4WLOA 3IQWA 5KYXA 3CEAA 3A7EA 3MINB 4BRWA 1R4MB 2IYYA 4K6KA 1II8B 5MHTA 1RYYA 4KO1S 3TAUA 1S0UA 1U11A 1GL6A 3LFHA 1AQIA 3SU8A 4EW2A 5FX2A 3DOCA 1N6RA 1SOVA 1JYSA 1U81A 2EBUA 3EFEA 4LA4A 5E3JA 3EOZA 4WN9B 5CVDA 2O3TA 1D2HA 2Y76A 5EWJA 2BEKA 1VE1A 1TNDA 3WDLA 2P1RA 3VAZA 2ZZKA 2C2GA 4KOAA 2EGUA 2QNIA 1LDEA 4BOYA 1A95A 1PL6A 1GNLA 4X62B 3ESCA 3G59A 1V0JA 3AKZA 4HQ0A 4G0PA 1U3DA 2C9DA 4CM9A 1TF2A 3HS3A 4G5OA 4U63A 1QHEA 2WTEA 3T5DA 3QVWA 1RWBA 3P9CA 3E48A 4KXLA 1B23P 2EEZA 2WSSA 2QPTA 4EJSC 2Z4SA 1JJIA 3D8SA 3P0EA 5LP6B 4FYPA 1IQUA 3OECA 5A6SB 3VSAA 4BV2A 4YPOA 2WTAA 4LOKA 1CTQA 3U1BA 1KQNA 4R41A 3FR8A 3KAQA 2X19A 2J5BA 2GZ1A 2G70A 1RFLA 1DLIA 4H0CA 3ICQB 1QYDA 2RH8A 1K3UB 2IELA 4BO8A 5KVCA 1DI0A 3P52A 2GXAA 1RWNA 2O0JA 4UD2A 5C1BA 2NP6A 1KFKB 4PYJA 1AN0A 1YS6A 3KVVA 4YASA 2I1WA 1OYWA 2YZMA 3G02A 2VL7A 4Z1MD 1HYHA 3TSAA 1KY3A 1YS4A 3DHVA 4FI3F 1PEAA 4BMXA 1JB9A 3O4JA 1QH1A 1UAYA 2QS9A 3R6GA 5F1KA 4PO9A 3OIUA 4BB5A 1TTTA 2D0IA 1FMCA 5LBIA 2F9MA 5JBIA 2QW1A 4OJKA 1UBKS 1P0QA 2NO7A 3KB6A 1UT8A 2WZCA 3FMOB 2NYRA 1XXHA 2F3PA 1ZGAA 4MITA 5DHTA 1Y42X 4IO1A 1WXWA 4J2OA 4LVNA 3FOAA 3AF0A 4FOLA 1XZ8A 4MH0R 4A8JC 2F90A 2ZWVA 2ZUTA 2IX9A 1VL5A 2VXCA 1SVNA 1SVIA 1L4YA 4XVHA 5IABA 3QX3A 3DMHA 3G85A 1O57A 4F0JA 2PM8A 3RM3A 1Z7EA 2HDOA 2FN4A 4CM4A 2XE6A 5AVKA 2ZGVA 4ALJA 1CQWA 4TVBA 1GTJ1 2NGRA 3U31A 3PXAA 2FSUA 4LZJA 4NKRA 4NMLA 4WY8A 4C08A 4RZSA 1DHTA 2V9ZA 2XB8A 4ZD6A 2JEYA 3MAAC 4D0RA 4LYGA 9LDBA 5KOJA 2VHCA 4LXUA 3K0EA 5CCDA 3JVVA 3SHVA 1RVV1 2XW6A 4OU4A 4DABA 1NZDA 3I8XA 5DHRA 3I39X 3EZ6A 4E2WA 5AVYA 3H9EO 3PICA 1K75A 1NXPA 3AX6A 4J0HA 5GIOE 1EFRD 1T9HA 4QDTA 3OP1A 4WZAB 4E4TA 1CRZA 2QGFA 1V5FA 2NQTA 1XB2A 4Y9TA 4NNOA 1A9ZA 4AW9A 2LTAA 2JHPA 2W2LA 1MEOA 4RD2A 4L75A 2JLUA 2IBSA 1Y3CE 4MW6A 1A98A 3UOGA 2OKGA 3TJMA 1ELOA 5A2QA 1LJ8A 4JX9A 3H86A 4BLSA 1BVHA 3RNOA 1E3IA 2CHUA 1E6EA 2H2DA 3ND5A 1D3AA 2VPTA 3R3JA 2BP7A 3AL0C 3OT4A 2IQ5A 1U80A 3NASA 3P0FA 3WISA 4QJ4A 3P0RA 1IXRC 2NADA 1DWQA 1W0JA 1KZYC 2FH5B 2GVDC 2X41A 3CKLA 4FGKA 2W6JD 5FNVA 4AZVA 2R97A 4B6EA 1C3JA 3WMWA 4KX5A 5IDXA 1P29A 3QWHA 3A8TA 1YB2A 3VZPA 4HCJA 3TZ6A 5K3SA 1DAEA 1RYZA 4L27A 2E5WA 5AI9A 2B83A 3D8NA 5GY7A 3ZIAD 4O4IA 1PJSA 1SNYA 2AFIE 3QITA 4IG9A 3OKPA 4Q9IA 3T7RA 3TQRA 3EQ6A 3K9LA 4CKEB 3K70C 2AW5A 4L72A 3TFQA 2OYSA 3USES 2VDJA 3R7AA 4TLAA 3IVAA 3W78A 3PC2A 2P2LA 3OQBA 3HGMA 1KP3A 3BTUA 3TQTA 1YAHA 3KHSA 4KVGA 2B4TO 3C41J 5GTDA 2DE0X 3OOJA 4OM8A 2Q4BA 2BR5A 2DWCA 2GF9A 3C7CB 3LRPA 2A3NA 1PRYA 1DEXA 2QQEA 4F12A 1WM1A 1GVNB 2FN3A 1R6XA 3OEHA 4QBIA 3J80A 2D2FA 3KAKA 1J22A 3IVRA 5DB4A 1E1LA 1ML3A 4UQLA 2Q5HA 2B20A 5TPWB 1RWQA 4E94A 1KMIY 2R8BA 1IEXA 1OB5A 4W5HA 1N25A 1VIVA 2JDIA 2ZBRA 1J09A 1T1EA 2J5RA 3CY6A 4J7AA 3ECSA 5JNLA 2ZRMA 3NVMB 1TU4A 3T52A 1YACA 5DEOA 1NURA 2HK9A 4IGKA 4B79A 1T3LA 3GNQA 1E5LA 3OJXA 5JD6A 1S5PA 2JLYA 4W5NA 4A5SA 1NI5A 3KG2A 3KVYA 4LQLA 2F17A 1JEJA 4RE6A 5HZHA 1YBMA 4HFMA 3H1EA 2P27A 5H68A 1LPNA 1N7IA 2VF7A 1IY1A 3BE5A 2D7CA 4DPKA 5FFFA 1T9GS 4OA5A 3IAM6 4DSAA 1EGAA 3WGTA 3VYVA 5ELXA 1A3CA 4C0BA 2YR0A 1RLIA 3K72B 3Q8XB 2OB2A 2F3UA 3SJUA 3WKAA 4BKQA 3AR7A 2DETA 1FJXA 1UADA 2PBLA 2VT3A 4HYTA 4U7FA 4RY0A 3RU2A 5KTRA 4P33A 1JDPA 1GRNA 3GEPA 4TL7A 2I29A 3FTQA 5BPFA 2WNHA 2GSDA 4MROA 4AJIA 4OGKA 4EJSB 3PEWA 4DR2B 1M66A 4JNKA 2JCYA 4PZZA 2DLCX 4H3VA 2YJTD 1AUPA 3Q5DA 5JEEA 3QLUC 1A9XB 3ABQB 3ONDA 5K8VA 4KRXA 2AWOA 2PR2A 1E6CA 2IRWA 3W6UA 5IZ4A 5KYTA 3JARA 4ZANA 2X0RA 2JB9A 4CGYA 3FLMA 5G41A 2QAJA 4NJMA 4V1CI 2WFAA 3L8EA 3BJZA 3MGAA 2DTEA 1T10A 2XOKA 2IOQA 2IH2A 3IEVA 2M32A 2JS7A 3E3LA 4CMCA 3C4VA 2VIIA 1QVRA 2ETVA 2XKBA 3C1TA 3TDNA 2QRGA 2YXPX 3Q7SA 5DWDA 5ESXA 1OX4B 5ICGA 4FFBB 3C16C 4R16A 5GV8A 3R5JA 3GFOA 2IV3A 3S2FA 1D7OA 1UIMA 1XK7A 4AQYB 1SVKA 2C1EA 2D1FA 2ROQA 4A6DA 3UF0A 3C7KA 3CS3A 1P3JA 3OAAA 5FXMA 5BR7A 2FZLA 1GZ6A 2IKSA 1UEIA 2H18A 3DGEC 3I83A 4D8YA 3QBDA 4QGGA 2BGUA 3E81A 1SQGA 3BIFA 4UBNA 1C1HA 3HJBA 2MSNA 2XX3A 3PYXA 3QELA 3IA2A 4B9AA 4B85A 3M2TA 1BH6A 5CITA 5K0SA 4HAWA 2IHUA 3UMYA 3QF7A 4DT1A 4A10A 1JFLA 3IJEB 2JEZA 5DX8A 4BNMA 2GEJA 3A9VA 4DDVA 1N7HA 5K3AA 4QSHA 4MV0A 1W29A 3K0FB 1T1RA 3FB1A 1ZIOA 1ND6A 3OO1A 5A05A 3RE1A 2PJZA 1OA1A 3UHAA 4LXIA 4X6UA 4EY7A 1EFCA 3M81A 4R9UC 5HP4A 1LKZA 2HU2A 3K8QA 4BVFA 2AXNA 2YX1A 3OFSA 3RT9A 1RZRD 3FKSD 3RC8A 1NF2A 5ALRA 4MGKR 1QZUA 4XWTA 4DQVA 4LMPA 1W8DA 2PZAA 1SCQA 3ZJTA 4TZ6A 3V4PB 1TAGA 2Z1MA 5DBGA 1J33A 2JA1A 3JD4A 4DR5B 1GUFA 3BMNB 3HKDA 1VXOA 2OO5A 3NETA 1I6WA 2IVZA 3KSBC 3B48A 4NAUA 1M2NA 4WRRA 3MILA 4KAXA 3IB3A 3WLMA 1T2UA 3V6MA 3N8GA 1GPH1 3MS4A 3U7RA 1JEQB 3VVMA 4CCWA 2C99A 3D02A 2M1XA 4QYSA 3KZNA 1EJBA 3GCGA 4X3OA 4AUNA 1K27A 2E3JA 3ZHTA 4J29A 5B30A 2V0CA 4M88A 4MWGA 1UBHS 3BK2A 3V32A 4MMZB 1UXOA 4RF4A 5KSZA 4DF3A 3AG6A 3HH8A 4R9NA 5HUJA 4F71A 1JFVA 4HRXA 1SUDA 1OFTA 4REQB 2DFVA 3VZBA 2FKAA 3WLIA 1UMDA 4Z4CA 4FKZA 3RAEC 3BRQA 1DAHA 3I1YA 1MJHA 4L5AA 4LI0A 1PWEA 5T57A 4KN6A 1BN6A 4GR4A 4U2BA 3HJUA 3K70B 5FPKA 1EK2A 4DV7B 2WD9A 2X6TA 3BTVA 3ZD8A 4LHEA 4IJMA 1HNXB 3A1DA 1E5QA 1G64A 2BFDB 3QI7A 1IWPB 4GP9A 4MGYR 3CG0A 4DLPA 3IGFA 3DVQX 5EMHA 4IFBA 2O06A 4ZCTA 4GGMX 5HVNA 3URKA 4MGZR 3IB6A 5EMMA 1N8TA 1ZKMA 3HYRA 3LTEA 4EB6B 3UANA 1CEEA 1G17A 3V1NA 1X6VA 1EQ2A 4QNMA 4B7AA 1TUIA 3GD7A 4JJKA 3JALA 3KYCB 3LW7A 4OUKX 1A96A 1VOTA 1JAYA 4LBWA 4MQBA 3FLBA 5CVJA 5KHOC 3RU3A 3ANLA 5A4AA 4XYLA 1JLLA 1SA0B 4KWIA 2VJBA 4BCBA 3L1KA 3R4CA 3A6KA 3U7IA 4ER7A 2R8PA 2IHYA 1JDBC 3DUFB 3B1XA 4X1IA 3VOBA 2IK8A 1IWBB 2NTYC 2VWPA 1QV7A 2AE1A 3ANSA 1IY2A 3OC6A 3TM4A 4ZGGA 2VH1A 1RIIA 4NYIQ 2ODPA 1TMYA 3HDYA 1R15A 2ZBUA 4BX8A 2FJUA 2ZSUA 3L06A 1QHIA 1N2BA 1R9JA 2GZHA 1EX6A 2J4CA 2XUDA 4JEMA 3WL5A 1L5WA 4GQBA 4R1UA 1PL7A 3DB2A 4ZV4A 1BMFA 2NU7A 3D3EA 4R7ZA 4PLTA 2XAUA 2KB0A 3ZI0A 2XCTB 3FOEC 1E3LA 4MYUA 3DYVA 4F91B 1PZHA 3QVKA 4IWYA 4G8CA 3Q8MA 4AKHA 3C74A 3ZXSA 4OLBA 1ZH4A 6ABPA 4LHSA 1MF7A 4B4KA 5KQMA 3FNQA 2GTPA 2I4TA 2PLRA 3AHGA 5C0OE 4ZEOA 1ISJA 3PQ6A 3ZHUA 1HSZA 4OHMA 3SEAA 3W7VA 2Y67A 5KQSA 1T26A 4OI2A 1XWWA 2HMVA 3QGMA 1C29B 2SCUB 4C0WA 2AWNA 3IP5A 4KO8A 4OOEA 3ZE6A 4JXXA 2IDZA 2Z9BA 2EFEB 1EBUA 3U09A 1VXRA 2GGSA 5DW0A 1NNUA 1CT9A 3KE9A 1S8OA 2ZPUA 5LIRA 3BXHA 4V0QA 1Z5ZA 3D5QA 2V7TA 4NECA 1L8OA 3N53A 1N0UA 2C5EA 5SZHB 3TW8A 2O5RA 2ID8A 3ZW8A 2P65A 3H87A 1VZ3A 5ERYA 1X38A 1KVQA 2O7RA 2IXGA 2BFBA 4ZQCB 2O6LA 3B3JA 3HLYA 3VR2D 1BYUA 3AVPA 1J8MF 1N5OX 4ARUA 4ZT7A 4BLTA 2VPZA 1VL8A 4HEJA 3W5CA 1CRLA 1M6NA 4DBLC 5FI5A 1E18A 5A06A 3VPGA 1QOQB 1UWCA 4CTJA 1VKJA 3MYYA 2ZQ5A 3JWEA 1BU5A 2AI3A 4H7FA 3OIWA 3PI6A 4XA8A 3TG2A 5AHOA 1Y6JA 1RWOA 1Z4OA 2ALJA 3ETLA 4C78A 4DC9A 1FP4A 2AG5A 2AG8A 2PPVA 5F33A 4JDPA 2IYEA 3TG8A 4INOA 1N6OA 3BRCA 3OOEA 3CUYA 3GPCA 1ZG3A 2QXYA 3NHSA 1O95D 1ULAA 1YVRA 3HVHA 1SBCA 4JYMA 1HTTA 4PBTA 1II0A 3DVLA 3ZJVA 3GZJA 1QORA 5IH3A 2XE4A 4U3JA 4NEGA 3CC8A 3UCFA 2P2DA 4DZTA 2XTNA 1JWBB 3GWGA 3PNMA 4QM7A 2O2ZA 2OMKA 2A0UA 3GCDA 4BO0A 2JIZA 1RDFA 4LBZA 2BUAA 1K08A 3EGXB 5DCLA 5AKXA 3LHKA 4JXJA 1TLTA 1BE1A 1D2NA 3PPXA 1EM6A 4KFRA 1M1XB 4GLJA 1URPA 4F9TA 3HI6A 5ENVA 2H2HA 3S2IA 5IC6A 5FA6A 3V46A 4EG1A 1YDFA 4IZHA 5EWMB 3TW4A 3UB4A 5L40A 4FHDA 4JI6B 1W46A 5DNEA 3NJRA 3C3MA 2ZYHA 3FGPA 4C0JA 3OTQA 2ZWMA 5BUZA 4MUJA 4XOUA 4K7JA 4PGAA 3PB3A 1GPLA 3P9QA 3TLEA 2WABA 4G0WA 4RZQA 2FZCA 3QXHA 1J8DA 3DOHA 1PR4A 5HCIA 2VH5R 1HO3A 1KEVA 3H5AA 4MKZA 5B64A 1EP3B 3RYCA 2OBLA 4XX0B 4PX3A 3WICA 3QU2A 3PEVA 1NG9A 3NEYA 4IG4A 4RMJA 1S9DA 4L7VA 4UM8B 1DE0A 1X3SA 1MIHA 3TVYA 4CTNA 5LMCA 1JDSA 3ZH2A 3CO5A 3R0QA 1NL3A 4B4WA 2I3BA 4LDNA 3BE8A 2DLNA 1QPBA 5LMNB 4EKNB 2I8LA 5DLDA 3U44A 1LZLA 1T5TA 3RVSA 1RQGA 1T34A 2TECE 1CHDA 3JAWA 4PG5A 3SOPA 2WQZA 1UCFA 1W35A 2O54A 1PNQA 4CQMA 2EQ5A 3P1JA 3O8OA 5ILGA 1H2FA 1EFUA 3C6KA 4YHBA 2DQKA 3VPCA 4CKCB 1G6Q1 1I1NA 5JE8A 5BSUA 3AC0A 1QOZA 1KPIA 1DUSA 4Q93A 1CJTC 1ABBA 4W5TA 3A9RA 3H4IA 3E0XA 2HO5A 1LDNA 5LP6C 4ONEA 2AJ8A 2HCJB 4ZVLA 3TOZA 4DB4A 5YASA 1T3HA 2XGMA 4BFXA 3JQQA 3FPJA 4AECA 4B84A 2O7NA 1F5SA 1RU3A 3I8SA 1MZVA 1BRMA 2WSBA 1J7KA 3NM6B 4H7DA 3FCEA 1XN1A 2CKMA 1GV0A 4J75A 5KYXB 4YONB 1QF9A 3KEMA 1QTRA 1ZVKA 4J6EA 1JJAA 3QQPA 4MDEA 5C1OA 1M1ZA 1QAMA 1TQ4A 4XYBA 2X8LA 3LK6A 3T7TA 2JIQA 3DAPA 3HJGA 1JDBB 3IVMA 3KKPA 4L9RA 1NUPA 5EWJB 1HETA 4CF7A 4UTOA 5B37A 2BM1A 1HE3A 2P1DA 2Q4TA 3IOBA 5AI5A 3DOUA 3GBPA 3C5HA 4RLFA 3TQOA 4HOYA 4DJTA 4I1IA 4IDDA 3KNZA 2ZBFA 4HZGA 1SBYA 2GZDA 1EAYA 1YZTA 4E2FA 3WLJA 2XZPA 4JK3A 3WYNA 5JO0A 3EVNA 4I1YA 4JC4A 1TADA 1JBEA 5CA1A 4OJQA 5BR4A 5I7HA 1JRLA 3CZAA 4MS1A 4TZTA 5IAJA 4ERXA 4UUAA 4EZEA 1QCYA 1JXAA 1KAMA 1C7FA 2Y68A 2AOTA 4GM4A 4RGBA 2C00A 1LS6A 4UVGA 4Q9HA 2BEVA 1IIBA 2IKQA 1OHHA 2P9BA 3PQFA 4HEQA 4XVRA 3UJHA 4EJFA 1G3UA 5I9NA 1FXWA 3W8FA 5T4FA 3WQSB 2UV8A 2VRNA 1RI4A 1ODIA 2H17A 4XUCA 5LWHA 2Q0QA 5FQOA 1Q3KA 4EKEA 3HZHA 3H2IA 2FN8A 3MT8A 4KSYA 1UM9A 5FBZA 4AD8A 1M5UA 3U4GA 2L0XA 5IM4F 4ZVRA 2ZR8A 5GV7A 3S6JA 4RHEA 1Z7YA 2PKCA 3GJYA 1QH1B 3EGCA 1ZJZA 2YOFA 4N76A 1YRQA 5GOZA 4Z2YA 2GR9A 2AG1A 4TS1A 1VMEA 1AF7A 3GELA 3Q1KA 4K9DA 3AF3A 4Q48A 4EB3A 4PLVA 2OGTA 4Q4HA 5HGXA 5ESRA 3E9NA 4QUEA 3R8XA 3AWDA 4MVJA 2GZ3A 4HRVA 4LHZA 2Y6VA 3OMLA 3L79A 1XXHB 2AE2A 1V1JA 3RK1A 5IK2A 4I3HA 4QFMA 1I4TD 1PUXA 1G291 1GL7A 3CBQA 2GZMA 3IBCA 3VYTB 4BP1A 3K0HA 2OK7A 3R3ZA 3WMGA 4ECAA 2QPOA 2C95A 2I6QA 2Q45A 3A7DA 1E2FA 3CZ5A 3H97A 3QOYA 4LDAA 3LWBA 5DVZA 4EVIA 3AL3A 1XDBA 3PA8A 2QWXA 4QG7A 5TMEA 2IHJA 4CM4B 2WR8A 1P4AA 5EXDA 5LL6P 4DIBA 3PITA 5AI0A 3DL4A 3HFJA 2VH2A 3AF1A 2NTVA 4EPTA 2QM0A 3LUPA 4CN9A 5BVGB 5TEWA 2DWOA 4JITA 2ZRHA 4YGXB 3RU9A 2J59A 3I4LA 2JZCA 1T9KA 1L8QA 3H7AA 1MX3A 3NHFA 2CL0X 2A9KA 4RF5A 2PD4A 1WMSA 3RYTC 4C3UA 1K9VF 2MCFA 5KOJB 2OUKA 4G8JA 3OOWA 1N2HA 4XCQA 2L19A 4QECA 1TB4A 3QA3E 3Q11A 1RRCA 4RL6A 2HIMA 1WPXA 3AJ9A 3E3OA 4QATA 2AQ8A 1P0IA 3NM4A 1XF1A 1WJGA 4IXNA 1WKCA 5E6SA 3K0CA 3K2BA 4ASUA 4PPQA 6Q21A 1H0SA 4IIUA 2WMOB 4D9GA 3G8CA 4PW0A 3RTCA 5C1IA 4MOWA 2HMWA 4XEUA 3OIYA 4PWYA 3A4IA 3VUEA 5CDFE 3M6LA 1ECJA 1JKIA 4X3CA 3O1IC 1PGPA 5J1TB 1IE3A 2GS9A 4YI3A 2BP7B 4YJ2A 1E2NA 4G07A 4PSAA 5GOTA 4I9GA 1V48A 3ZHVA 5FNVB 2AG0A 4B3FX 3MUOA 3NHKA 1UQUA 2FX2A 1JG6A 1N34B 1FZTA 2CD7A 4I9HA 3DKRA 3EY9A 1KGSA 3JQEA 4NZNA 2V7EA 1HT2E 1TKBA 2D3WA 4AJKA 4RJJA 4O4IB 1ZSYA 3RS9A 2OGWA 1YR2A 3HL0A 2BE7A 1QHFA 2OXTA 1DX6A 2NXEA 3NTVA 3WLSA 3H2GA 4Y2PA 4KCGA 2WJ6A 1YZNA 2ZI9A 2ZSAA 3NCHA 3WV5A 4CF4A 4FYMA 4DLLA 5BVHA 1PG5A 4CLHA 4GXRA 2XMGA 3S40A 1HE2A 5ERGB 5G1NA 1W6UA 3HCEA 4BVGA 4DBVO 1P5HA 4KQEA 5LJLA 3KSDO 5LIPA 2BH2A 3DMDA 1JIIA 2SKDA 3AK4A 4C0QC 2ZJAA 2WP8J 2QTFA 1DC6A 3DWIA 5DHPA 2DWUA 1L5HA 2MR5A 4QJ3A 3IXLA 2B1GA 2IZ1A 1CUUA 2OPBA 4L7QA 5AKIA 5K0ZA 2BBSA 2YXBA 5L9AA 1KRXA 5EXEA 3L43A 2QYOA 3IKTA 4JP2A 3LYLA 3GHYA 1X7DA 2GBFA 2VDKB 4D82A 3F9IA 1I2MA 4YP7A 1EBBA 1Q1AA 1ZGHA 4IFTA 3EHDA 4TLMB 4ZGWA 3REGA 2FMFA 2ZS8A 4B4UA 1SEPA 1QDLB 1Z0UA 4M1WA 5C8XA 1CUXA 3EXHC 4MUHA 4UCXA 1ZWKA 4U2EA 5NLLA 3SS7X 2EP5A 1H8HA 1Q7EA 3L7BA 4CMJA 4DWOA 5KOYA 1T1IA 1O2DA 2H4ZA 2P9JA 3WDSA 1AIPA 3CUSA 4EX6A 3O4FA 1QFXA 1QGZA 3GUUA 5T41A 1L6IA 3U9LA 5IJWA 4B81A 3QVUA 1V26A 1JG2A 1EVJA 3QHQA 4RK4A 5F3DA 1EUZA 3VYUB 3Q5EA 4H1HA 1S1CA 2C9YA 4LVOA 5DXFA 4MMXB 1CDEA 1I1OA 1EFLA 2W6MA 5BMVA 3DE1X 1FFYA 3FFBA 4EY8A 4CEHA 2PBZA 2XUKA 4BVLA 4XVUA 4XASA 2OM2A 4FFVA 1FMLA 3GFFA 4UNPA 5JNSA 3WYFA 1AXGA 1FYDA 4MQMA 4DV3B 2RGNA 3AZOA 2PX0A 3ANTA 1QHSA 2BD0A 2GNPA 4H6PA 4XM0A 1XD9A 3MJDA 3NANA 3DAFA 2FSIA 4KJZA 3VA7A 1NG1A 3MWGA 2D1QA 1ORHA 3EZXA 1BQ4A 4NJMB 5ES3A 1LF5A 5SY9A 3K96A 2WWVD 5FH9A 1U3GA 2FLKA 2N42A 1B6GA 2JRLA 3PD7A 3R40A 4L0DA 4RHTA 5CJPA 5AM5A 2KX7A 1O03A 3AETA 3FZGA 1XA4A 1WUIS 1ZK4A 2O20A 3C3BA 4OKIA 1VHJA 1M2HA 3AFHA 2ZLBA 5BYAA 4NC9A 3OZGA 4E7OA 3U5ZB 1E1NA 1UBJS 2E89A 3HZOA 1Y8RA 2LNDA 2PLFA 4C0XA 3MOGA 4MVJG 2Z0MA 4FEGA 4H3HB 5B3AA 1NJ5A 1IQ0A 3R77A 5ALNA 4JYPA 1UK8A 5MN6A 1WZEA 1DRKA 4BU1A 3QELB 1Z17A 3C15C 4HB4A 4OHZA 1BE0A 2ZBEA 3ZH9B 4CMIA 1EX7A 4DWWA 2NO1A 1I7LA 1K5GA 4DT1B 1C8KA 2LPMA 4ODIA 4Q1VA 4Q9KA 1UPUA 4QTUB 2RKWA 2IU3A 1CP3A 1N5RA 1ZD9A 3QKUA 2C2KA 1CRWG 1I51A 5B2ZA 2R1ZA 1SIBE 4HDCA 2V6JA 2HB6A 3M5WA 4MAAA 3FOBA 3LFTA 5FKJA 1UKYA 3A1SA 5C5IA 4EB0A 2JGKA 2R25B 3ICPA 5ECYA 4J2TA 1F0NA 4MW5A 2JLQA 6CHYA 3QNMA 3N5KA 1KZ7B 2WIJA 4MV4A 5BSMA 1CUIA 2PXHA 2FSVA 4ZO9A 1Z56C 3OTGA 4FZJA 1GZ4A 4WJLA 4EJ6A 3FDZA 3BEDA 2VAPA 4OIMA 2QROA 4LJ6A 4D9KA 1UJBA 2ADMA 3VTFA 2COEA 3DE3X 4BO1A 3HKDB 1ZXLA 4ZA2A 4BLRA 4E5KA 3C1OA 3FUCA 2G28A 4ZAGA 3W79A 1VRWA 4I4LA 3F6EX 1Q14A 2PYIA 3HNPA 3MFQA 4MYDA 4N1AA 1K8QA 3HG7A 4ML3A 2R11A 2G36A 2FG7C 4IIYA 3WK6A 2FNAA 3QWFA 4QG3A 3OF2A 2J8ZA 1WKBA 3IODA 4TQAA 4HR7A 1ZWLA 3IDFA 2B25A 3KV3O 3JVDA 2GVNA 2B5WA 4G56A 4BGUA 5AW1A 2LRHA 3QEAZ 4OIFA 3ZHRA 2CF5A 2POCA 2IZZA 1XMVA 2OG2A 3R7SA 3WYAA 1XZQA 4XXHA 2X9VA 1FDVA 3EN0A 4NPHA 1AMUA 1Y1QA 2J0VA 5ARCA 1NTOA 4KMRA 4OB8A 2PS0A 3DJFA 2UKDA 3JZIA 1H2WA 1PBTA 3MUNA 2J08A 2JBWA 3QRWA 5EMKA 2O6HA 3VVBA 4F72A 3RIGA 1JH9A 3VZRA 2X23A 4OHWA 4G1FA 4QPCA 4PC1A 3KFXA 5CCEA 1I2CA 4GOKA 3N2EA 5AKYA 3FYTA 4QOSA 2K7ZA 3GGSA 2TS1A 1E9EA 4CR6A 1C0EA 1PQUA 3DL0A 1J5PA 5A9RA 4E15A 5HHTA 4EOGA 4LCBA 4IIGA 5CB8A 4OG2A 3ZV5A 3JALB 1UMKA 2IYQA 2RGAA 5L4SA 1P2BA 1CR4A 1JZQA 1CYDA 4TKLA 2GUGA 3K9QO 1JLLB 3OVMA 4QTTB 1XZFA 1X15A 3PENA 1WMAA 1L7MA 1XRJA 2GN1A 3A26A 3SFVA 4MUEA 4X1IB 4QJBA 2NYVA 2BGTA 4N0PA 1BTOA 1K97A 1WNFA 2PL5A 1G20E 4EHLA 2UYHA 5A71A 1VQ1A 2DY0A 4OOFA 4YUYA 2BZ0A 2ZI4A 5J47A 5CFLA 2O8FA 4TXNA 2DX7A 3OIGA 3W06A 2HF7A 1S8AA 1J2TA 1X1RA 4X41A 3O38A 3R5HA 4TWIA 1UDAA 2NU7B 1KOJA 4O1IA 3RTBA 3VR5H 4L51A 5ETJA 1CUSA 1NPYA 3D3KA 5DDIP 3H1GA 2EHJA 4BNGA 5IUJC 3W4JA 3CJRA 3OUZA 2F8LA 2NYAA 2VT7A 3KQNA 1HEYA 2WU1A 2XF8A 2YWJA 3FF1A 4R2LA 5K8JB 3FUUA 5D00A 5T3UA 1WB9A 3SX0A 1E2QA 3MMPA 4BZPA 5IU6A 3KKQA 3TSYA 1A27A 5C1DA 2H6EA 3CZCA 3PXXA 3REQA 2UZAA 1KVUA 1WQ3A 2FA9A 4RVCA 1GRQA 3DO8A 1TJ3A 2QRQA 3BCRA 4M37A 4RHFA 2VP9A 3I05A 1CCWA 1Z36A 3ZVMA 5F76A 2Q3EA 4RKFA 4LDZA 2FGJA 3GD5A 3TW8B 1OOEA 1Y4AE 5CEFA 4BPRA 2F1HA 3TEJA 1Z2AA 1TX4B 3AEQB 2BFBB 4YRCA 1HYQA 4B43A 1MHPA 5IX8A 5JQWA 3OY2A 3L7IA 4D8TA 3IBGA 2RGGA 3W8RA 1XJ5A 2YJ5A 1CLUA 2HJHA 4DYHA 3FIUA 2BBOA 2HF8A 2ZSKA 5B1SA 1SC1A 3DTVA 3RUDA 3RWMB 2OA0A 5K6AA 1LBQA 1PQYA 1XTUA 3QPBA 3VPHA 2J0QA 2DGDA 2NVOA 1ES9A 4BUCA 1SU8A 3KX2A 2P3SA 3OJOA 1LB1B 4PZEA 3TW0A 3E9EA 2YL2A 5H81A 4EEKA 1FP4B 4MUXA 2VTDA 3FOCA 4KBFA 1ILWA 4ICIA 1HDCA 4BUJA 1RKXA 1RHUA 1REQA 3KLMX 1KRWA 4A15A 1Z5GA 3BMQA 4DIUA 4HBZA 1XI2A 1D2GA 2O9JA 4RKYA 4U3JB 4EKYA 1NVAA 3CXRA 3T06B 2WFZA 5F51A 2UUAB 4NFHA 3TLMA 1RZ3A 4AS3A 3AF6A 1UJ5A 1AU9A 3UJNA 1ZC3A 4IGFA 3RTEA 2FEPA 4Z3OA 3HVUA 3K0CC 3B6KA 2BZGA 1OJLA 1T0JB 1KO7A 1WCWA 5CX4A 4CM7A 1B8OA 3EVCA 3EUWA 4PG8A 2XYVA 5JNRA 2V65A 1TM5E 3LKZA 5AOAA 1H3EA 1RQPA 1E5DA 3KSZO 4D1YA 3L6DA 1SHZA 1WQ1R 3R8CA 1JPJA 2CHVA 2OBFA 4G2NA 4LYEA 3ROZA 4EFNA 3Q8WA 4PXYA 3UAYA 3ZGVA 2DT8A 1HPLA 1BYIA 2QR3A 4QUKA 2PH7A 3AVUA 1O87A 5G40A 3SI7A 5L4LA 3MWEA 5FQNA 1CIVA 1OY1A 1G6OA 2GEUA 2XCQA 3SJZA 3RBXA 3BRSA 4MI3A 4MDYA 1CHNA 4BAUA 2HDHA 1PP4A 3GUHA 1JHMA 1A50B 1JE0A 1QHGA 3P97A 2QTZA 5EXTA 3PVCA 2C97A 5DISB 4G5FA 4IAOA 4HWPA 2EYQA 3DMNA 4I9UA 1FDOA 3AILA 3TKYA 1PEDA 4TMYA 4EKDA 4POOA 5HBRA 4CLRA 1QPGA 1TA0A 2B6HA 3IT1A 1DUIA 3KQYA 4ZOAA 3U44B 1DB3A 5L3VA 2DU8A 3JAWB 3LYHA 4KNWA 4P5EA 3FVWA 4AKEA 3EWIA 5FBVB 1OXMA 4CQMB 4Z1MA 4LN1A 1GAJA 2QSUA 3O8OB 3JD0A 3MRSA 3MUEA 4MP6A 4YAJA 2QLJA 4HKTA 1U0LA 2PUVA 4FP9A 4DTCA 1IJKA 3D4OA 4QYMA 4QLAA 1Q44A 4UHFA 2QY6A 4KH1A 2AEJA 1XF9A 2GEVA 1UMCA 5JLAA 3UXHA 5DM2A 2I6FA 4M87A 2LP4Y 3KUKA 3A2NA 1E9VA 2D00A 2GCIA 3BK1A 4GW3A 4LZOA 4V0RA 3WFJA 1O5IA 1FUKA 3A6FA 4XEHA 3RSZA 3NR2A 4E46A 1VE7A 3ESRA 3CLSD 4LY6A 3H8WA 4YQYA 3VTZA 2X1VA 1VJGA 1KETA 5EYPA 3NPAA 1DRVA 1QK3A 3QHPA 2I4NA 4RWZA 4BWVA 5HK9A 1XPOA 3FJYA 2F48A 1Z5VA 3IAM1 1XT6A 5JI3E 5AMXA 3FCUB 3S99A 2ZRAA 1MAUA 1LCIA 1FSGA 2BMFA 4KQHA 4BYGA 4GRDA 1HT3A 2OGZA 4G4JA 4EM6A 5CPBA 4BDTA 1G9TA 3O2SB 1O97D 2ST1A 3L1UA 2ERYA 3G0GA 3HSSA 3ABOB 5I8ZA 3UYKA 3QIAA 2O7SA 1OIVA 4HEA1 3KR2A 1CY8A 1KI7A 1ODSA 4RVDA 1ZJJA 5KTNA 3RFFA 1DEKA 1DFGA 5AOCA 3SBOA 1OFUA 1EVYA 3AVQA 1O7JA 3EZLA 1Z4IA 1GZ3A 1DV1A 2PWPA 2CV2A 3TBKA 2Z2XA 3HHPA 3PCXA 4J16C 5CFNA 4BYMA 5CA1B 1N5LA 1EFRA 5JSZB 2AUMA 4EJ0A 5KNCH 4ESVA 4C4SA 1EEHA 1Y9DA 2HGSA 2QDXA 4YCBA 3S5JA 4KYTA 2RGNC 3TGLA 1SOMA 3NXSA 4F6LA 2XADA 3LC1O 2AOTB 2P2YA 3TBFA 2BEVB 1ENYA 2CD9A 1C3OA 4JN6B 2I91A 3WO1A 1ZOPA 3TD9A 2AG6A 2C5SA 2VK1A 4YXWA 2OK8A 1U2DA 3UHOA 1UM9B 2WP0A 3D4PA 4R5MA 4PBSA 1T25A 4IUDS 2EBHX 2FG6C 4PINA 4ZVOA 1YXMA 3LXXA 4UHKA 1QFMA 2R8EA 2W6JA 3E61A 3MJSA 3NOQA 5L3SB 1EE9A 1NR5A 4A7PA 4C89A 1Q0PA 2R68A 4Q4HB 1J1UA 3JVEA 4Q1AA 3QZUA 3GB9A 4XIFA 1IZ9A 3HV0A 4TXLA 4MZXA 4OBBA 1NBOA 3LP6A 1U5BA 2REBA 3ELBA 3KOYA 5E6UA 4OHYA 2BJVA 3OCJA 5JISA 4ZCSA 1HURA 1QGDA 4P0TA 1XWIA 4PZCA 4XD2A 1TEZA 1E89A 4BVHA 4F5ZA 1KI9A 3QJ5A 5CG1A 5HM6A 1NVBA 2QUBA 1MB2A 4GQIA 2ZUSA 5AVXA 4FBLA 1DKQA 4HQFA 5BPHA 2QVZX 3STHA 4OO3A 1VRCA 2Z5VA 3BF7A 3EY4A 5EMLA 4QU0A 2QN9A 3C8HA 1GTMA 3NCTA 2B7BA 4HQNA 3RRYA 2WJ3A 4RQBA 4TYYA 5F2OA 1JHUA 3JCZA 3DDZX 4NQRA 3TN7A 4BX2A 5KSYA 5HMMA 4LOJA 3KTDA 3KELA 2Q29A 5H5JA 1MH9A 4F5EA 3P0HA 4PIVA 2OD7A 5J63A 4HQ6A 4Y2RA 4YTEA 2GA9A 5MN5A 4KIJA 2W2VA 1VKRA 2FSVC 2ZATA 1KMQA 1BEZA 2JHGA 1W34A 5D01A 1E5TA 2D1YA 3OJFA 5THKA 1NBME 5LLSA 5E2BA 5DLQC 3AM4A 5E6SB 1H9AA 5AXCA 5DNCA 3GCZA 1ZCBA 4QUJA 3NHYA 2C4VA 2G1UA 2ZXEA 4EUEA 5KQGA 1NSTA 5LZ8A 1AGRA 3ESZA 3KT0A 4UDNA 4K9MA 4Y3UA 2G71A 3BDIA 1XR3A 2C59A 3RV4A 3ZNNA 1PKXA 4RU1A 1A69A 2QMZA 3GEEA 3GVHA 3L0YA 4JBHA 4L73A 4RWEA 1W2GA 4ZVTA 4UBLA 3UAOA 4MQFA 4RELA 4ZYWA 3GGOA 2C9ZA 4JQOA 3D6JA 4YJ2B 3E8XA 1XTIA 3H19A 5CM2Z 3JD3A 1SCKA 4K88A 3KZMA 5C46F 1Y9AA 3SLKA 3FDFA 4TTQA 5KCZA 2PWBA 5E0OA 5FO0A 3OLXA 3NHLA 3KXLA 3RB8A 2DUJA 4LC9A 1NSFA 1S7CA 4DLBA 1UJ6A 3AF2A 4BWFB 3KL4A 4R1MA 2DBZA 1QDUA 4JJGA 2FK8A 4M8NE 1V4NA 1Z6QA 2CHGA 3QXGA 1E7WA 2PL3A 2ZIWB 4ND6A 1CDZA 1JKXA 4Q1DA 1Q50A 4R2JA 3D7LA 3H5NA 2QL7A 1O6ZA 1OFUX 1DP4A 2WHPA 2X5JO 2ZRGA 2ISQA 3GRKA 2D5CA 2P6OA 4H1UA 5BVHB 4FFRA 4DLTA 1SB9A 1F1JA 3L49A 5IKMA 3SHOA 4OQFA 1KKMA 4H6WA 4JX8A 4C7BA 4D57A 1SULA 4UULA 2FGKA 4TRMA 1AKUA 4YRIA 5F7XA 3L0DA 2HYDA 1EQAA 1L5HB 3GDFA 1V9LA 4E5PA 4FWTA 2C3MA 3F90A 2P2ZA 1QG6A 3LECA 4U7WA 2Q3MA 1JNXX 3K05A 1K7XB 1S4MA 3PP8A 1L5SA 4LGCA 4TV9F 3P4UA 3R2JA 4V0ME 3OU7A 3EMBA 1O0CA 3K92A 2QRZA 2RHHA 1QP8A 1GG2A 3PR2B 2GX6A 5IH7A 5J23A 1CBUA 2C83A 3E58A 8LDHA 2HRQA 3PDHA 3U61B 2D62A 5E1DA 2XSZD 3C3EA 4JQSA 4HJXA 4OLFA 4ENVA 1W7AA 4X00A 5JZBA 4BV8A 1SZJG 1Y81A 1A9OA 2BONA 4J76A 3AHEA 1X7GA 1DX4A 1CQIA 2OHGA 2EFHB 3ON5A 3SYKA 3GJQA 4LYHA 5KYGA 1OUMA 5TQJA 2WJHA 3HP4A 1SHTX 1JB1A 3TRDA 3WOHA 3MLAA 4EPVA 2C61A 3OM1A 4C6HA 3BXPA 4TLBA 1YOVA 2WUFA 1QIEA 3V34A 4YV2A 3T1HB 1RZRA 4N9WA 3TOCA 1PR6A 1PW5A 1RM3A 1YR1A 1ORTA 2XH8A 3DT6A 3JASA 2WU8A 3QW4B 4UASA 5BSRA 2Z6UA 3RAFC 4GC9A 1MOZA 5BMVB 2WM8A 3FBGA 3G2PA 2B2XA 5B6IA 2FF7A 3PC6A 4HX2A 4US0R 2ENUA 2P3LA 5A3SA 4CEHB 4KJXA 1NX9A 3K1TA 3MLEA 4BNZA 4LUCA 4D4GA 1GOTA 3ZCPA 3SQNA 1Z4KA 4X91A 4MHTA 1P81A 4KQWA 1KQPA 1YQTA 5JMWA 2CJXA 4OYHA 1NW7A 1WUYA 4YT8A 4GDFA 1Q12A 4Q82A 1DG3A 3CW8X 3DEIA 3QVGA 4M4SA 2HPVA 3TE6A 2Z6AA 2EX0A 1R8SA 1YJQA 1V1MA 4BKPA 1TMGE 4GHWA 2BGLA 3AETB 1B8NA 2B94A 2MTBA 5ERXA 3FHCB 4ZHQA 2JCBA 3NVDA 4PSDA 3UNXA 4LCJA 2QI9F 2PWZA 5CTAA 4LOAA 4J7UA 5CJ2A 2X22A 3AHHA 1Y8RB 3ZHXA 3B53X 4C1NA 5FUYA 5BY2A 4EP1A 2PZGA 2CVOA 5FRDA 1K4YA 1KGDA 1GFZA 2XLBA 3KJQA 3OPYA 3FDXA 4LOHA 5CGZA 3SJ7A 2VTBA 3RJTA 1UFOA 2PE5A 3S7TA 5THXA 5H16A 3WBKA 3SX2A 2D06A 3QYFA 2LV8A 1C4KA 1K7FB 1XQWA 1YKGA 2HRCA 3EFHA 3GZNA 4MWDA 3NV9A 4R9SA 4DHEA 2YYZA 4RF3A 5KSWB 3VR4D 5CDSA 1J4AA 1ULTA 2ZKLA 1OBVA 2F2TA 2IGTA 4WZBE 4G9BA 2EKBA 3R7FA 4KLRA 1C50A 3ZHYA 4TTTS 1ZOOA 4FGJA 1PT5A 1PYDA 3W5SA 4WX2B 1H85A 4DCVA 1CUJA 4YDRA 4U6QA 4FCTA 3IA7A 1ONSA 1VBNA 1P9NA 4W5QA 1Z12A 1MHTA 3ETDA 2J3JA 3U4IA 4XGNA 5LLDA 5H9VA 2DBYA 1ORRA 3I6QA 2X3YA 4CKWA 3AIOA 4RMHA 1M6YA 3FDZB 4PQYA 4F5DA 4ZYVA 4JI2B 3QSGA 1CV2A 2ZSJA 4JP5A 4YWHA 1N78A 3TVDA 4G4GA 3FWPA 2FPLA 2IYNA 1NXOA 3IULA 4U02A 4QDOA 5F2EA 1H0KA 2DWPA 5FPSA 4BQNA 1ORVA 1KPHA 1NSYA 2MMCA 3OC0A 4RLHA 1MNQA 2CK3A 4DA9A 1L1FA 2ZVJA 1JECA 3R6TA 3CT6A 1BMDA 2D5LA 3RABA 3U2QA 1PFWA 2GBCA 1S3IA 2YN2A 3IQFA 2FMTA 1KJ9A 3V6LA 1NN1A 2JD0A 1RAIA 3MM4A 5DOZA 5BNFA 4CL0A 4DHWA 1H3NA 2AVNA 1O5TA 3GLIE 3SZRA 4QLBA 4DQ0A 2ZIAA 1ZGGA 3M4JA 3L7NA 3OUUA 5JZSA 4L6IA 4JCCA 1E4OA 1KI4A 1TIKA 2F8TA 1R27A 5A7FA 4ZHSA 5ALZA 2D0OB 3ANXA 3CX6A 3HB4X 1M0TA 2PX4A 2IEDA 4Q12A 1M34E 4A9AA 4DADA 2BE9A 2EARA 1EUCA 2OVBA 2JEOA 1ODKA 2JATA 2MIIA 2RJNA 3L5KA 4RHXA 2GMWA 1YVUA 1TMKA 2XZDA 4AJHA 1ID1A 3EEBA 4QODA 5GJBA 2B8EA 2WWRA 1ADCA 2IEAA 1RKVA 3D7RA 3VR5D 4ZTBA 2PH5A 4TKVA 3LUCA 2JCSA 3EXG2 3VR2A 3GLIA 4MYCA 3ZKAA 2LIPA 1U7DA 2RGYA 4L02A 4OLHA 3C8MA 5BSVA 1G8SA 1FU8A 3PFKA 4NCAA 1CUBA 1NBWB 1QK4A 4CNBA 1IZ0A 4TYNA 2H92A 1XMJA 2QTHA 4IIHA 5DCUA 2BKVA 1FRNA 1FLVA 4HGNA 5L95A 1XRQA 3GMTA 5F78A 1OH6A 1VMIA 4C2TA 1Z6AA 1ADBA 5JCJD 3NP9A 5D1NA 4M7RA 2PQ2A 3LSTA 4OKSA 4YP6A 3LGAA 2CLLB 2M98A 2Q21A 3WAJA 4OQDA 1NN5A 3ELDA 1O95A 4UMFA 2XITA 1G4AE 2FFHA 3Q1LA 4KIGA 4HDMA 1CZRA 1MDBA 2B61A 5IKPA 2GFIA 3QKRA 3OETA 4NL4H 4ZQHA 1T1GA 4KTVE 1YJ5A 2BSAA 3F7TA 3O8NA 4IIJA 3IE1A 5H70A 1FTQA 2O8FB 2BV3A 3GDGA 1XNQB 3C3PA 3L4EA 4Q21A 4DSNA 3HDVA 4RD6A 3QE9Y 4NDAA 3MRTA 4AIRA 1BGWA 1K6XA 1MEJA 5EKUA 1AQ6A 1JKMA 2BH9A 2NZVG 1M7HA 2DQZA 2CBXA 4DLWA 1B0PA 4MCHA 4MUKA 1XCLA 1O89A 3JPYA 1AKEA 4QD3A 1C9KA 5ITVA 1XALA 4JI7B 4TV8A 3DNMA 1NU8A 3RSSA 5DRTA 4KEAA 3U3KA 2Z1NA 1U2DC 8OHMA 1WXDA 1XZAA 1BXKA 5LUBA 3ZY4A 3REQB 3FH0A 4ZV7A 4HDAA 3LWNA 3VISA 1L4LA 2RE8A 1VPTA 3TECE 1N32B 1A7KA 3E23A 1I30A 3QFTA 2W43A 4DA7A 4AG6A 1JZSA 4XQ9A 4MJ3A 3P5BA 1J00A 3TR5A 5EJMA 1OWPA 3I42A 4F1KA 2E6UX 5KTSA 2Y4NA 4R2WA 5BQ3A 4ZEVA 4KX3A 4MICA 1KEZA 1E9CA 2GNAA 1DJOA 3E1SA 3OMWA 4BRZA 1G1AA 4IO0A 3OA0A 3W2IA 5JPCA 5ALUA 3CF0A 1SCAA 1MVNA 2ORVA 3DTVB 3HKEA 2YDYA 5D1HA 5CB4A 1WMBA 3EB9A 2QG6A 1L4BA 1NBEA 4MUNA 1ZIXA 2B82A 4MVYA 4YCAA 4M1OA 3K09A 1EJ6A 3L4BA 3M1YA 1L9XA 3SZUA 1IOLA 1F20A 3LKVA 5LOVF 2ABWA 2CE7A 1T13A 1N4DA 4JB3A 4JR1A 2NO9A 5TGDA 3B2QA 2HLDD 4H17A 4M1MA 5DYTA 1MO3A 3VKVA 1NBHA 5FR2A 1UF9A 3O1LA 3LHSA 1F8YA 1ZIDA 4JWTA 1WDTA 2IXAA 1REQB 4ZPJA 3H84A 1DXOA 4RVFA 3NH6A 3ZQ4A 1KP9A 3BMQB 2MINA 1VSBA 3U62A 4EKIA 3ZGYA 5TMDA 5IXJA 3E9YA 3QYPA 4C4YA 4X93A 4C7KA 2I4RA 1KMNA 3W5HA 2VPWA 3DLBA 4CT0A 1KAOA 2CXSA 2W8BA 5EIBD 1E2MA 1SXJE 3F2VA 2MJLA 2Q2VA 2G76A 3PFIA 2IBTA 1M10A 2AXPA 1W4BA 4Y0AA 3TSWA 3CBGA 2BMAA 4NY1A 1Y33E 3N7TA 2VNAA 5JY6A 1VHQA 1VM6A 3BWCA