4C89A

Crystal structure of carboxylesterase lpest1 from lactobacillus plantarum: high resolution model
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
341
Chain Sequence
YFQGMPTINSIQTTVNGVVKIVKPFNNDIAGEQFDPHVLQTLTAFKQPAILENDLAALRSGSLTPAIADPVGDAVTVQSRNITALNRTVSVEWLTPQNVINHTVLVYFHGGAFYGGVPGNNTVLLKLVAAKSHCEILNVDYSLAPEAPAPAGILDGLAIFQYLEQRDAETMITVAGDSAGANVIMAATNLNQQLGSNRINQQLLLYPVTAPNADHAGPLWDLAAFPIIDSQRAILTNYHDLFRQLDSIMTDYYVPENFDSHSPLISPLHQENFTMTPPTTIMVGEFDPFRPQAWAYAQRLAAADTATTFIQYQGLNHAFAPLVDQYWQSQDVAQVMAAALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Esterase Lpest1 from Lactobacillus Plantarum: A Novel and Atypical Member of the Alpha Beta Hydrolase Superfamily of Enzymes
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
molecule keywords ESTERASE
total genus 107
structure length 341
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c89A00
4J03A 4DIUA 3O4IA 2PVSA 3C6ZA 5HK9A 1F0NA 5EHQA 4AO6A 5IKXA 5BWBA 4BCBA 1LPNA 1QIDA 2Z8XA 1K63A 4PNZA 5DNUA 3UMJA 5HCUA 2XLBA 1IMJA 1HBJA 3H2KA 1CUSA 3O9VA 4BAUA 4QDZA 5DTJA 3IVMA 1CQWA 1ZJ4A 3WKDA 3HACA 3LS2A 5DYYA 3ZPXA 4J0JA 1IUPA 2Y2VA 3IDAA 2HL6A 3M3DA 3U0VA 4NMWA 5K3AA 2WJ3A 5ALZA 3ILSA 1J2EA 4H7JA 2VEOA 5FKJA 1O6GA 4FHZA 3CCBA 2VQ6A 3C8HA 2RIPA 1DX4A 3I28A 2ZVDA 1ACJA 3KSRA 3UUEA 5E4TA 5CXXA 4UBLA 4PSDA 4C01A 1JMYA 3HZOA 1CUHA 3E4DA 4M0MA 2RHWA 3FNBA 4H77A 5DLPA 3QBJA 4ZRDA 3DYIA 1JU3A 4CG2A 2OLEA 4RPCA 1CUYA 4DNQA 4BBZA 4AXBA 1QIGA 4C88A 4QDTA 3KXPA 2HM7A 5FP0A 1UZAA 5I8PA 5AOBA 4PSCA 2DQZA 3NGMA 1BCSA 4M0FA 2XQKA 1AMNA 4X93A 1MNAA 4K6GA 4HXGA 5ALJA 2JF0A 5ALLA 3JYHA 1R50A 3R3YA 1VJ5A 4FLMA 5D7BA 4W1QA 4K6HA 1BROA 3BDIA 3D2BA 4K5QA 1TRHA 1VA5A 1VZ2A 4B9AA 2ROQA 1K4YA 5AKHA 4ZREA 3DS8A 4W63A 1U65A 1CVLA 3C5WP 5CT9A 3WL7A 3C8DA 5LLSA 2WG2A 4B80A 1E5TA 3MVEA 1CV2A 4W1RA 2XQFA 4BDSA 1VLQA 3GZJA 1XZBA 1QFSA 4DMFA 1WHSA 2P8SA 4X3CA 1F6WA 4KRXA 5ALRA 4JYMA 2RONA 2ZSIA 4E15A 4IH4A 5KWIA 3H1AA 4EB0A 3FLAA 1BEZA 2C5FA 5AIBA 2GYVA 2H7CA 2WFLB 5AKKA 2WTMA 1WPRA 4FBLA 4ZI5A 5HF8A 1LPMA 1ODCA 4MQLA 3YASA 4PQEA 3R3ZA 2DHDA 3N2ZB 3H19A 2PU7A 3T4UA 1TAHA 4FFWA 4L72A 3S2ZA 5HF5A 3AZOA 1UK7A 4CI9A 5CBKA 2OGZA 1E8MA 2BKLA 5AKIA 1FSSA 2D0DA 3STWA 1XQVA 4EY8A 3OG9A 1E8NA 4AX4A 2WFZA 3TRDA 3HRHA 1AQLA 2ZSHA 1QFMA 1YA4A 2OQVA 2PX6A 1MT3A 3QH4A 3VDXA 2Y6VA 1R88A 3WWPA 4O08A 4BCDA 7YASA 2XUJA 4BCCA 5FLKA 1ZD2P 2ZYIA 5CT4A 3WYNA 3QITA 3DL4A 1KU0A 2H9YA 1T4MA 3OURA 2VT6A 3G0BA 4QDUA 1U4NA 3AFIA 4MWSA 2OCKA 5AM2A 5AK5A 1UOQA 2JGLA 1HL7A 1BRTA 3SC2A 2XMSA 5ALMA 4E11A 4EY5A 3SK0A 2AJBA 1M33A 3I2GA 3V1MA 4WY8A 2JBWA 2IX9A 5H3HA 5ALUA 4B84A 2Y2UA 4BZWA 1QLWA 3BDVA 1A8SA 5CT8A 1F0PA 4BVJA 2IITA 5F4ZA 3VVMA 4WJLA 1QIHA 4RGYA 1LBSA 2I03A 1T2NA 1UKBA 3VJLA 2PSFA 3WK9A 4AO8A 2WJ4A 1XQXA 3IULA 2WHPA 3PF8A 1DWOA 3U1TA 1SFRA 3R3WA 4LKOA 5KWJA 3EQ8A 4E14A 2WTNA 1MAAA 4K6KA 3FBWA 1YASA 3FYUC 4Y2YA 1TK3A 2HU5A 3L1IA 4EUSA 3BIWA 4ITVA 2B20A 1MU0A 4OPMA 2HFKA 1W52X 5LZ2A 1XROA 2QMQA 2DQYA 4DMHA 4JH0A 2QOEA 2HHAA 1U8EA 2Z8ZA 5EI5A 2ZJFA 4MEBA 1MX5A 4Z49A 1RWQA 4PV7A 2HA4A 3WZLA 4KJXA 4EY7A 1CFJA 3ICVA 4EHBA 4BB0A 5AM5A 4LYEA 1UKCA 1XZHA 1ETHA 1Y7IA 5DWDA 3STYA 3I6ZA 3G0GA 4H7FA 2XUDA 5FDFA 1GQRA 4CCYA 4EA6A 1LPPA 3ANSA 4ARAA 3HABA 2FX5A 2WG0A 2CB9A 5AKZA 4HAIA 4YPVA 3IURA 2ECFA 5CW2A 2O7RA 1XLVA 4IHAA 1QTIA 3W05A 2YH2A 2CKMA 4FNGA 2WUFA 5AP9A 2ACKA 3QPCA 4HS9A 1XQWA 4H7KA 2DSNA 3R40A 4P9NA 1YS1X 1DX6A 2WIJA 2B4KA 1EDEA 5YASA 3MGAA 4MEAA 3Q0TA 5CH3A 1RYYA 3ESBA 5LKRA 3VKFA 1Q0RA 5AIAA 1HKHA 4L9AA 5JALA 5AM0A 2QJRA 2VA9A 3C6XA 1G66A 4U2BA 3MUOA 4YK7A 4LXIA 2VSQA 4IH9A 1HPLA 2EEPA 2ORYA 1H22A 1C4XA 2R8BA 4Q3OA 4XX1A 2QKYA 5AOCA 4U2DA 3QPAA 3LLCA 1BEEA 4U2EA 3O95A 1DU4A 5AI9A 2OG1A 4GWLA 3WWEA 2PUJA 1EHYA 3I2FA 4INZA 4KAAA 2HADA 3NUZA 1IZ8A 1LZLA 5D6OA 3R3XA 1TQHA 4QA9A 2XLCA 4GW3A 2OAGA 5LKAA 5DNVA 2AJCA 4ETWA 4FBMA 3B5EA 3ESDA 4MJ3A 5BOVA 2VTVA 2WLSA 3BXPA 1Z68A 1JJFA 4ROTA 2I3ZA 5D3KA 3F67A 1JMKC 5ALDA 1N5RA 1SCQA 2WUEA 4N8DA 1ORWA 5ALOA 1MN6A 4X85A 1WCYA 4UHCA 3M82A 3DDUA 5ALGA 3I2KA 3L1JA 5CRIA 5CH5A 3PUIA 4BRSA 4DMKA 3WA7A 4Y9SA 3V9AA 2JEYA 1N8SA 1EVQA 5CMLA 3GA7A 5C8VA 4WFJA 3D5EA 1THGA 5ALWA 1AUOA 3QPDA 1KEZA 4Q34A 5AI5A 2YYSA 1XRNA 2V96A 1XZLA 3DL7A 5A7HA 1XRPA 4AZ0A 2QJWA 3HXKA 3FYUB 5ALYA 4OB8A 5FOQA 2X8BA 1G5FA 2JGKA 4OSEA 3WMRA 3D0KA 4MYSA 2V97A 4CIBA 3EIOA 4FLFA 1YB7A 1D07A 2VJAA 2XE4A 2YXPX 3G0CA 1LLFA 2RGUA 2J3DA 4UBMA 1AC5A 1IZ7A 1YS2X 2XUHA 4U2GA 4TPKA 2XUQA 4C87A 4BP8A 1ZI9A 1H2YA 1QONA 1ACLA 4ZWNA 3H2JA 1EX9A 5LZ4A 4AZ3A 3NOXA 3KD2A 2X5XA 4G9EA 3ESCA 2XUAA 4Q82A 1UK6A 2ZJ6A 4UFPA 2ONCA 2XUKA 1XRQA 5EHXA 4PF1A 1UOOA 3BWXA 2I78A 5IH7A 3STVA 3HSSA 4B83A 3PDCA 3OM8A 4AN0A 1Q83A 2C4HA 4DTCA 3ZI7A 3VJMA 3O4GA 3H04A 3F98A 3IA2A 4X97A 4G4GA 2HA2A 5LZ7A 2BUAA 1AX9A 4Y7DA 5K3BA 4UBIA 2I3DA 1R9MA 2C0QA 4JYPA 4BE4A 3HEAA 4GEGA 4CIAA 5EIAA 2HA7A 2XMGA 1K5PA 3P2MA 2XUGA 4XIIA 2WHQA 5ALXA 2Z5GA 2WFLA 4D9JA 4YX9A 5J3JA 1IVYA 2DR0A 4J3JA 3BF8A 3W04A 2XMRA 2WIDA 1MPXA 4EY4A 4KEAA 3C70A 5DTIA 1XFDA 1ZI6A 5I7UA 5JANA 4Y2PA 2VT7A 3D2CA 1CRLA 1ZIXA 4FNMA 2VATA 4MQMA 2VAVA 1AZWA 4Y2XA 5DJ5A 5T4BA 5JAHA 2BAGA 1R4ZA 2BJHA 4N5HX 4KRYA 5I9IA 3CN7A 4DGQA 1PJAA 4X90A 3A70A 1GXSA 1P0QA 4JUIA 3WIOA 3VJKA 4U2FA 2XMQA 3G9XA 1JI3A 4CFSA 1UWCA 2JGFA 3FVRA 3HJUA 1EB8A 2GZRA 2PSEA 4KE8A 5BV7A 3PF9A 4F0JA 3N0TA 1CUEA 5T4EA 5EIEA 3WKCA 2O2HA 3FVTA 2K2QB 2HFJA 4TVKA 1UXOA 2WSLA 4UBOA 4EBBA 3IUNA 1CEXA 3LCRA 3WJ1A 2W22A 1VXOA 1BN6A 3AILA 3R41A 4FWBA 1BE0A 3ZWQA 1VE6A 1ZGBA 1VOTA 4UHBA 3WKEA 4U2CA 4B6GA 3KDAA 4WFKA 2BGNA 1J07A 1OCEA 3WWOA 5ALPA 1ODSA 1CLEA 1BCRA 1A8QA 1DT3A 3FAKA 5AK4A 1B41A 5ALSA 2XQIA 4OUKX 3M83A 1AKNA 3AUKA 5EIHA 1XKLA 2WHPB 1KU6A 1XZEA 1HQDA 4MXDA 3FLEA 1FFAA 3WL6A 4IO0A 1L7QA 5C8ZA 4G8BA 4W9RA 3QMMA 3GROA 4QWWA 1UFOA 5JZ9A 2PSHA 5CTAA 3G0DA 2BUCA 4QWMA 1GQSA 4DNFA 1XZGA 3DQZA 4AMZA 4E46A 5JZBA 1LPOA 1BU8A 4DMCA 1GKKA 3DLTA 5K5EA 3F97A 3D7RA 5JASA 1EI9A 5LZ9A 1XZMA 2JGEA 1H2XA 4TGLA 1P0MA 2FJ0A 3PE6A 3G9TA 3WA6A 1EINA 3W9BA 4FDMA 3B3QA 3I6MA 5A7GA 1W75A 4CG3A 2QR5A 3D4LA 2PKYX 1ZI8A 2XI4A 4S0XA 2OXEA 1CUBA 1JU4A 4B81A 2QT9A 3K6KA 2C7BA 3STTA 2HIHA 3STXA 1FFCA 5EHZA 4X00A 5AHXA 4FMPA 1UT6A 5T4HA 1E3QA 5E2IA 5HF6A 5K3FA 4HZGA 1J1IA 1GPLA 5LP1A 3A2NA 4H18A 5HQ3A 1XZFA 2XUFA 2RHTA 4C4XA 1RP1A 1GZ7A 3VISA 3WK4A 4BTLA 4HVTA 3ESAA 1TKRA 2AJDA 3IB3A 5CH8A 1XZDA 5CURA 1NX9A 5AO9A 3WWCA 1BS9A 3V48A 2R11A 2WU3A 1U2EA 2XMCA 2WIKA 4HRXA 4X7BA 1UK8A 5CXUA 1N1MA 1YAHA 1EK1A 5IVHA 5JD5A 4AQDA 3MUNA 4UHDA 4X6XA 1N5MA 5LYYA 3DD5A 1R3DA 5SYMA 4ZV9A 5AI8A 1UOPA 1Q84A 4G9GA 2HA3A 3GUUA 4XJVA 4G8DA 4QLOA 4DNPA 3FYTA 1XRLA 5HZGA 4BVKA 1J06A 2GYWA 2HU7A 2PUHA 3WJ2A 3DKKA 2G63A 4Y2QA 3FSGA 3AJAA 3V1LA 4G4IA 5K3EA 3FYUA 4Y2JA 3AZQA 1QGED 1QE3A 3BF7A 1NU6A 1HLGA 5A7FA 1CR6A 1MAHA 1E8DA 4RE6A 5ALKA 2CBGA 5JYCA 2ACEA 1QZ3A 3O4HA 3G02A 2FJPA 1WB4A 2NW6A 1QIMA 3CN9A 1GPKA 4DLNA 2PSJA 2GBGA 1TCCA 2BFNA 2H1IA 3O9MA 1WPXA 5IVIA 4RE5A 3I6YA 1ZD5A 3FCYA 5T4FA 3WK6A 2ES4A 1QTRA 2WFMA 5JAUA 5AM1A 2B61A 1P0PA 1USWA 4NVRA 2QXTA 2OCIA 2Q0XA 2WG1A 2C5GA 1NU8A 2GBFA 2LIPA 1ZOIA 6YASA 5AI0A 3H2IA 1EDDA 4Q3LA 3E0XA 1XZCA 1FFDA 3TGLA 4LIPD 3C87A 3I1IA 3FWHA 3AZPA 5AM4A 3G8YA 3PICA 5D3ZA 5AK3A 1AGYA 3EF3A 3RLIA 1LBTA 3F96A 4Q3KA 2E3JA 5FXMA 2CUTA 1YAJA 3JWEA 5JD6A 2VJCA 3WIBA 3K9BA 5HF9A 4Y2RA 2G5TA 2AJLI 3H1BA 3STUA 2WIGA 1MTZA 4DM7A 4FLEA 5DYTA 3IBTA 5LIPA 3G7NA 5C8XA 1X2BA 4FTWA 5AK6A 4A23A 3WK7A 5AKEA 5HK8A 4W1SA 1QIJA 4ZGBA 4QLAA 1K6EA 3JW8A 1XRRA 4C89A 3R0VA 2PPLA 1XZJA 2QS9A 1G4HA 3HI4A 2WUGA 1LPSA 5ALTA 5JD4A 1XZAA 4G1FA 4YASA 3BL8A 1CIJA 2RI6A 3HLKA 4OB7A 3BJRA 4XWGA 4OB6A 1PFQA 4J0CA 2EDAA 3T52A 4G8CA 1C7JA 4X94A 3FSGD 1QOZA 4BRZA 2DCMA 1CUVA 1CUIA 2Z3WA 1DWQA 3CCCA 3RARA 1JT2A 1Y7HA 3WKAA 3ICWA 4GI1A 3DCNA 2XQGA 1FFBA 2XT0A 4LXGA 4J0DA 4QDOA 2OQIA 1XKTA 5DYWA 2ZYRA 2WILA 4OU4A 3K2IA 4BVLA 2QXUA 1XRMA 1AURA 4G5XA 5C81A 4BE9A 2H7XA 2CJPA 4PO3X 1VZ3A 4X6UA 1Y37A 4OYLA 5AJHA 4J0KA 2AJ8A 3D3NA 4EY6A 3HC7A 4HTAA 4H0CA 5AH0A 5FV4A 2HDWA 4AN1A 2JGJA 1QO7A 3A2MA 2GZSA 2ZYHA 3R3UA 2BCEA 1CQZA 3EBLA 1CUGA 4ZV7A 2VJDA 4GECA 4DSZA 3G9UA 2OGSA 3FCXA 2YASA 4H7DA 1MJ5A 1DT5A 2XMDA 1XZKA 5AICA 3F9CA 4HXEB 1XLUA 1FFEA 2CZQA 3WYDA 4Q1VA 4GBGA 1YSCA 5JIBA 2J4FA 4G4JA 1CUAA 3DJYA 2JGIA 2Y6UA 5ALHA 1ZICA 5BWCA 4F5ZA 1GT6A 2PU5A 3S8YA 3GBSA 2XUOA 2XUPA 4UHHA 4Y2SA 4BTVA 4NZZA 2CEKA 1OILA 4QNNA 5JZSA 1ZD3A 4KYVA 4N8SA 4GHWA 4KAJA 1L7AA 2QRUA 1WB6A 2UZ0A 4C4YA 5AKJA 2GYUA 1Q0ZA 1TIBA 3W06A 3WQHA 2O2IA 3OTQA 1A88A 4GLBA 3RM3A 4BYMA 1VKHA 3RK4A 2QZPA 3G9ZA 4WDQA 4P08A 1GGVA 3CXUA 3B12A 3A6ZA 3IUQA 3WK5A 3ED1A 5FPQA 1O6FA 4UUQA 1ODTC 5SYNA 1JJIA 1F8UA 2OAEA 3C45A 4GDMA 3L1HA 1UKAA 5HQ3B 2VAXA 2QTBA 2D5LA 4UHFA 4BZZA 3I2IA 2QVBA 1LPBB 1W6RA 4BAZA 3C43A 4X91A 1X70A 4DYHA 3G0IA 5ALNA 2PM8A 1MX1A 4JNCA 3QMWA 3V1NA 4NS4A 4ARBA 3DYVA 3SWWA 3ZLUA 4N8EA 1E66A 5HKBA 1H23A 1YA8A 4WDRA 4AMYA 1CUJA 4OYYA 4WCVA 1HDEA 5AKXA 4K2AA 5AI6A 4JEIA 3FLBA 1K8QA 3WL8A 4HXFB 3H2HA 4X95A 5C7YA 5KBYA 4DNOA 3OC0A 2XDWA 1B6GA 3HYSA 5E4JA 2Y1KA 3D59A 4WFIA 2XB6A 4KE6A 1H2WA 3ANTA 4P92A 5FUMA 5JADA 4B85A 2QUBA 3R3VA 3IUJA 5A71A 3WLAA 4N5IX 3QYJA 3DEAA 4FKBA 5AI4A 1DWPA 2ZJ7A 4M0EA 2QM0A 1W1IA 2BGRA 1MO2A 3I2HA 3BIXA 3EQ7A 3KOOA 1JKMA 4UFOA 5K3FB 1QO9A 1CUDA 5LZ8A 5JARA 2JIDA 3DOHA 4B0PA 4WY5A 2C0PA 1CUXA 1W76A 4OU5A 1YR2A 2WJ6A 5A6VA 3LIPA 3LIIA 4EZIA 1UK9A 3WKBA 2ZYSA 4QZVA 3D2AA 5AKYA 2PBLA 1WOMA 2XMBA 4W1PA 1ZIYA 3C5VA 1SCIA 2CMFA 2O2GA 4OD0A 1E89A 3AIMA 2J4CA 2BUBA 1GPNA 2HU8A 4HRYA 1EVEA 4GXNA 1XQYA 2XUIA 1WB5A 4J0HA 1IUNA 2J3QA 4Y2UA 1DQYA 2VJBA 2WM2A 1FJ2A 1OXMA 2W6CX 3Q8WA 3X3HA 2XMZA 3ZLTA 1THTA 3SX4A 4AO7A 1YB6A 3QVMA 4I19A 4Y2TA 3A2LA 2WUDA 3V1KA 1W4LA 1LZKA 1QIKA 2Z3ZA 3NWOA 2FUKA 4C4ZA 3W9UA 4J7AA 2V9ZA 5ALFA 4LXHA 2HA5A 4A5SA 1ZD4A 1LNSA 5AM3A 1YCDA 2G4LA 5EGNA 3TJMA 4UBJA 4B7ZA 3GELA 1BN7A 4BC0A 3PFBA 4L0CA 2JGMA 4KR0A 3QZUA 2WQZA 4CCYB 2B9VA 2DHEA 1EB9A 2HRRA 1IUOA 1A7UA 5EFZA 4PSUA 1VE7A 2HA0A 1EDBA 1I6WA 1EXWA 4H7EA 3WK8A 1EA5A 1QIIA 4QEKA 3VVLA 3IIIA 5AOAA 3TEJA 3WI7A 4J0IA 3DKRA 3M81A 4BAGA 3OOSA 4H35A 1X2EA 4KAFA 3PI6A 4AB1A 1G42A 2OGTA 1A8UA 4QDXA 2EDCA 4FOLA 5K3CA 2QUAA 1GKLA 4F60A 5HKAA 2WIFA 3RKSA 3UUFA 5DNWA 2DFPA 1H2ZA 4V2IA 4P93A 5EHNA 5ALVA 4UHEA 3DNMA 1LPAB 3EQ9A 3WWDA 2WHRA 1SC9A 5CT6A 3W2TA 1ORVA 3PUHA 1S8OA 1XZIA 3VXKA 1R9NA 1ISPA 1LGYA 4BC1A 3ZLVA 5JAOA 4BATA 1CUUA 1WM1A 3BE8A 2XQJA 3KWFA 3H0CA 2GBCA 3C6YA 4L3WA 1JJBA 5HFNA 4XVCA 2DHCA 2PL5A 3E3AA 4H7IA 3AIKA 3OPMA 5ALIA 4OCZA 3WZMA 3AIOA 4CG1A 5A2GA 4A16A 4KE7A 3H18A 3F8SA 3I2JA 2O7VA 4LHEA 3QM1A 4MYDA 1R1DA 1ZJ5A 4KACA 4I4CA 5ESRA 2C58A 1EK2A 3QMVA 1JFRA 4IH1A 2HA6A 2GBIA 3C6BA 4QE3A 1TCBA 2PSDA 4CCWA 1VA4A 5E4YA 3LP5A 1CUZA 5AKLA 3WL5A 4KE9A 1P0IA 4X92A 2VF2A 4Y2VA 1TCAA 1VXRA 5KREA 5JAPA 3DOIA 3AINA 1QIFA 4DSAA 4MWTA 3GFFA 4FFVA 2H7YA 3I1YA 3FOBA 2WKWA 1DTEA 5A62A 5FRDA 5IVDA 5K3DA 5AKGA 4RNCA 4UBKA 2OPHA 2JEZA 4UPDA 1C7IA 3KWJA 1DINA 2X76A 3PFCA 4F21A 2V98A 4PW0A 2G5PA 1MNQA 3BJMA 5ISMA 1QJ4A 4I3FA 5JATA 4X6YA 1CUFA 1DQZA 4BDTA 2OCGA 5ALQA 1CUCA 4LYDA 1WHTA 3E1GA 2HRQA 1MX9A 5LZ5A 5CT5A 2IIVA 5IVKA 2OCLA 4IQ4A 4Q05A 4ZXFA 4C6HA 4BP9A 2WU4A 1SOMA 4UFNA 2RAUA 4B82A 1PV1A 4B9EA 3ZV7A 1SCKA 4J0GA 5FPPA 4UBNA 4X71A 1XLWA 2AXEA 1EH5A 3H2GA 3O0DA 5HFAA 1QIEA 3O4JA 5ALEA 3IUMA 1ZGCA 4B0OA 1CUWA 1L7RA 3H17A 1CPYA 4H7HA
chains in the Genus database with same CATH superfamily
3GNQA 4RV4A 5CBPB 1Z2DA 2D2EA 4AWBA 4BNDA 3A3NA 4CGZA 4NAHA 3CVYA 3TCKA 1TTHA 4IINA 4B3RB 4AO6A 1U1CA 5EHQA 4TZ0A 3CE6A 4PO8A 1LPNA 3ML1A 4PNZA 2YWCA 4D1YA 2QRQA 3Q8LA 3WLHA 4ER7A 2Q49A 4Q3BA 5CG1A 1JHZA 2D06A 1FDTA 2CDCA 3LRTA 4JEHA 1M1YA 2FQ1A 2IEYA 4MVJG 4YWJA 3VR6A 4D8YA 4BMCA 1X1EA 5IMSA 1DIOB 4Q66C 1ZRNA 3RC3A 3H2KA 1CUSA 4BAUA 4ZQFA 2JFBA 3L9WA 1O89A 2JJMA 3QEAZ 1QOPB 1IXRC 1GLGA 2NZ8A 2BEJA 4ZVQA 3HB1A 3VR5A 4H1UA 2OUIA 2V7WA 1ZJ4A 4QT0A 1L8LA 5K0NA 2ZJOA 3WKDA 3O9ZA 2PCLA 4C7KA 2Y1GA 3FNFA 5JXWA 1UAAA 4PFQA 5LN1A 2Z6UA 1BH2A 1NBHA 2BP7B 3JVEA 4MVJM 5T3UA 3ZWMA 3EFHA 4GGPA 3ZPXA 4BBAA 5LJIA 4E13A 2WZDA 5FO0A 3NHJA 1M73E 3PA8A 1AKUA 2F17A 4GM1A 1TKCA 2YCLA 2HL6A 1XCBA 2RDMA 3DTTA 1X7ZB 4M7RA 4LVCA 1T1EA 1YRBA 4MR9A 3WICA 4B7XA 3BQ9A 4ZANA 4K7JA 4UEQA 3LX5A 4WZAA 1PVVA 4URWR 4NMWA 1Y8CA 2ZB3A 1QQ7A 2WJ3A 4S1VA 4XW2A 1M0TA 3ECAA 1P2GA 4RD1A 2YWHA 2PA0A 3ILSA 1RHMA 1O94C 3O0TA 4H7JA 4KFTA 5B4VA 2X8JB 4OLFA 4OG2A 4I5IA 4QOSA 4D9IA 1O6GA 1KARA 3GFGA 4BECA 1U0HC 2HT6A 3U3JA 3WHPA 2EKDA 1Y8QA 2VF5X 2OYSA 1YRWA 4HLCA 4RA6B 5CVCA 4BVEA 1K88A 3WNZA 4DCJA 3K16A 1U5BA 3IR5A 4Z1MA 3W8DA 1TTPB 5DDIP 1YZKA 1XRJA 2X42A 4GL2A 4PQYA 4NH4A 4U3JB 2QE7A 1L5SA 2NXJA 4YBRA 1CULC 3ZOKA 2IA5A 4AZVA 4EENA 3ZJ4A 4Q4CA 1W93A 4JQZA 2RIPA 4NBVA 1G20E 4WXYB 1U8CB 1F2VA 3DLPX 1Y3IA 4ZO4A 4CL2A 4OO3A 3RI3A 3HJBA 3KSRA 3IEVA 3UUEA 1TVMA 2WZBA 5E4TA 3GCZA 2ACVA 4J43A 1I4OA 3QYFA 4IIVA 3B6MA 4PSDA 1GZDA 3ZHZA 2YV4A 3ILVA 4NCAA 1C30B 1UDBA 1CJVC 2VT2A 4HN4B 4HUQA 4M83A 3EVEA 2P3OA 3NHZA 4M0MA 3WMWA 4H77A 5DM0A 2J33A 5ADVA 3C98A 1HOTA 1Z6PA 3KQWA 4RJJA 4ZRDA 2YY6A 2GBLA 3TRJA 3CX7A 2FW7A 3UJAA 2PXXA 3OTGA 5LMNB 2J85A 4D4KA 2WZQA 2OK7A 3GJ0A 1J2TA 2OLEA 2PT6A 4RPCA 4YRGA 5CM9C 4JGIA 5JCOA 3V1TC 2DECA 3FUVA 1H0KA 2P79A 5K8TA 3OM0A 2FV8A 2R7KA 4EHJA 1GG9A 2C8KA 3RIEA 1II0A 5HIAA 2BTQA 1BS2A 4Z4QA 4EHAA 2H48A 3KXPA 2RHRA 1PQWA 3I0MA 4GF5A 4YXWA 3QLEA 1T8WA 1OREA 1YGYA 1OXUA 2HM7A 1KZ7B 4IIYA 3ONEA 5FP0A 4D80A 1F4VA 1DBIA 5REQB 3WBBA 1FMJA 1XPOA 4D0LB 5I8PA 4ENRA 1MZVA 2WWTA 4II2A 3X1KA 3H87A 3K5HA 2VPIA 3ORFA 2DQZA 2XQVA 2FPKA 2JK1A 4J4TA 4TMYA 3NGMA 1BCSA 5JSYA 3ZDYB 3M6WA 4YAEA 4D9CA 1Y1KE 4N3BA 1KTIA 1PFYA 1SURA 1APBA 2XGJA 2H5LA 3L0OA 2H08A 1NZFA 3MMNA 4HGPA 4X20B 3U39A 4EVQA 1ZW1A 4WNIA 2ZWPA 3CR7A 1I4EB 4RAOA 1HT0A 3GDGA 3BIJA 4GM4A 3QUSA 4DMLA 2V7BA 3B2NA 4PPGA 4RV5A 1T5DX 4HXGA 1NUHA 1E1KA 1TKBA 4M2LA 5ALJA 4ASUA 5ALLA 1PJTA 4MGZR 4FU0A 1V43A 3IE0A 1BQ4A 3D3JA 1GFWA 4FLMA 5D7BA 3V1UA 2NZXA 1RRCA 4K6HA 1JAZA 1A82A 4N9WA 1BROA 3BDIA 3OZAA 3ZV5A 4NH0A 3P8ZA 3WGTA 3IQDB 3C6QA 3MD0A 3BCRA 1P4HA 1DC6A 1PTJA 3QKUA 3SBDA 3IT0A 2JAXA 4TTPA 2VXYA 3HYCA 3P4YA 1SHZA 3AVXA 3BDAA 3QFFA 5M29A 3A9TA 4JYCA 4NJEA 4EF4A 4LHYA 1WBDA 2X0IA 1WVGA 4IX9A 4CYMA 1HETA 2IEGA 2ZE7A 4WKGA 1U65A 4FXOA 3VX4A 1IPEA 5CT9A 3WL7A 3OZFA 5EE9A 1Y1TA 3G68A 1ZFNA 1J8DA 1NRXA 2V5VA 4L0MA 4FN5A 3ROGA 1Y1PA 4IBOA 3F8WA 1RCFA 1SVIA 4OKNA 4U3JA 3ZU2A 1GNTA 4ZOLB 3ESQA 4GBMA 3O5AA 4LOHA 1L5GB 3BREA 3PX7A 1WCIB 2CXRA 1P0FA 3MVEA 4NKRA 2XDYA 1OXKB 4KQHA 5EMJA 3QK7A 4RX1A 3RF7A 1BWSA 2BF4A 4R81A 2Y66A 4BDSA 3LPNA 4G23A 1MW9X 1VKZA 1OAOA 1VLQA 2JJ1A 3MMPA 3B51X 3DXFA 3H9GA 1D9XA 1QFSA 4O2RA 1F2TB 2NXCA 1SKYE 2GK6A 4G4SP 1L4LA 3VR5D 1H6DA 2I54A 3AI3A 2Q41A 3AY3A 4GR5A 2C84A 4I08A 4EX7A 3BB4A 3H5WA 1U4SA 4UNQA 2FG7C 2Z57A 1PNQA 1YXMA 4KRXA 1R7RA 1NMZA 3NDRA 5FR1A 4BQFA 2VTBB 4P98A 4JYMA 2EYQA 3F3YA 5F5LA 1VG1A 2O8VA 1RLUA 2OZLB 2VSOA 4IH4A 3AGQA 5DFAA 3ENQA 4DVGA 2IS6A 1QQBA 2X2PA 3ROMA 3H1AA 3MWFA 3IQZA 1M34E 4ZOCA 5CB4F 1Z16A 4F7DA 3ITEA 3P9PA 3FLAA 1BEZA 4TMWA 2ONKA 3DWEX 5GWXA 4JJAA 1OAAA 3AY6A 4OQXA 5AIBA 3K92A 1Z2EA 1DCTA 3CRW1 5JJIA 1SIUA 2KMLA 5K4HA 3KV3O 2HQRA 4PLHA 1XQ1A 1AVTA 4MUHA 4QAJA 1BWPA 4Y6LA 5FOWA 4K0RA 3KZ1E 5EJ9A 2WTMA 4PS0A 4IDGA 5IJWA 1IG0A 2EFYA 4FBLA 3LFTA 3X2SA 4R41A 3PUKA 1DQPA 4TLAA 2OP1A 3CMMA 4MQLA 1BCSB 2B4YA 2Q4RA 3U3DA 4MUIA 4LF6B 3UUWA 4OOFA 5HCIA 3KU4A 4K3UA 3FKQA 4UATA 3GLSA 4RVGA 4IJ6A 1ZRMA 2V7XA 3W4KA 1TAHA 2QAGC 4RABA 5IU6A 5JS7A 4ISCA 5EJFA 2HCFA 3KPUA 4L72A 2NVUA 4S1OA 4HMPA 1VCNA 1O95D 4CI9A 2HD4A 5IP5A 2QAGA 3O8BA 5CBKA 3TK1A 3AL0C 1E8MA 2BKLA 3RR2A 3TIXB 2JI8A 3KBOA 1P2SA 2A0KA 3C8UA 3MB8A 1FP4B 3D4NA 3ENZA 3MGKA 3N70A 4QAQA 3STWA 4ARSA 4A36A 1UPAA 3AOEC 1PR1A 2CF5A 2FWAA 4YACA 5DRYA 1JW9B 2WFZA 4KTTE 2F6RA 4JBWA 3RC9A 1RQXA 3RVNA 5BWNA 1AQLA 1Z37A 2FZGA 4TV8A 2ATCA 4V24A 1MA3A 1G1AA 3PJFA 1F48A 2DPLA 3DMTA 3DVAA 4J29A 3TXYA 3ZLBA 1E99A 4DSNA 4HRVA 4QOJA 2OO5C 2XWSA 2CNWD 5BSGA 3ELBA 2BKUA 4CE6A 1LSJA 4G81A 2XUJA 7YASA 4F91B 5J58A 4NXNB 2NP6A 5DNEA 3HXPA 5CCXA 1KNXA 2IOFK 3A1UA 2WV7A 4MPDA 2EF1A 3Q2IA 2ZJ4A 1DC8A 5CT4A 1JDPA 3DL4A 3LZDA 2GN9A 1T4MA 2QDXA 2ZTVA 2QVZX 2OAQ1 3QITA 4JT8A 4MX8A 4Q24A 4EZEA 4UW9A 5AESA 2ZXUA 1PFGA 1IZ9A 1A95A 4ZT2A 4LWOA 2P2YA 3AFIA 5FUXA 4MWSA 2AV6A 2QRJA 3A0UA 3SS7X 2OCKA 4AS1A 1UOQA 3INGA 4II3A 2ZAYA 1PYDA 3HGTA 2VJQA 1OVMA 2QSJA 2XMSA 3IHTA 1ATIA 4YCNA 3Q5DA 2GEBA 5ECGC 2WSIA 1N4AA 4JKOA 2Q6VA 4M99A 3I9MA 4QQNA 4BMZA 5EIBC 3V1MA 2AG8A 2C2XA 2GM3A 1XDWA 2WJHA 3NBKA 3BWDD 4LYGA 2G70A 1JSLA 5C1DA 5DM70 4BFLA 1QRUA 5HJ2A 5F1OA 3SBEA 1RBQA 3L7LA 5K1ZA 2GPBA 5ALUA 4O29A 4RIHA 4AIIA 2C9DA 4BZWA 4FI3C 4GIBA 4MQFA 1QLWA 4TX1A 5CT8A 1PRYA 3HGQA 4P2GA 3NEPX 2H18A 5F4ZA 4K05A 4L8VA 4WJLA 4O02B 2VUTA 5I45A 1B1CA 4ZVMA 1C9YA 2E4UA 1LBSA 1OLXB 2Q5QA 2BJWA 3HXTA 2NUBA 2RMKA 2CWDA 3THXB 4HB3A 4G0VA 2PGLA 3E5NA 4ZMSA 1OWLA 2IOYA 3ZK7A 1NVTA 1UBOS 2EIXA 4J1QA 1O97C 2WHPA 5CIWA 4RVFA 3AEUA 4BEWA 5HJ7A 1CRPA 1PTJC 1DWOA 3FCUB 3IKJA 2YXNA 3RSCA 1SFRA 1BMDA 1AKMA 1SUBA 3EPHA 1QANA 3CZ5A 5EE1A 5KWJA 2V6JA 2JAPA 4YC7A 3W90A 4ZGGA 4K6KA 4NFYA 1TM3E 3BL6A 3LY5A 5BYBA 1C9DB 1YASA 2FPGB 2J3KA 1EWKA 3QF4A 4QUIA 2OO3A 3W78A 1YTUA 4PNHA 1JHPA 1PFWA 4Y2YA 3ROZA 1UODA 2VHWA 2HU5A 2DUMA 3QG5A 4QFMA 1K5HA 2ZRLA 2WWHA 3BWYA 2JIZD 3BIWA 2IWHA 2OCYC 4ITVA 3WR5A 4A6PA 4TRMA 4C2BA 5BNZA 5BOSB 2HFKA 4HAVA 2Z3VA 1U0TA 1XROA 4QECA 4TXHA 1QB8A 4ZOAA 1H8HA 4DMHA 2DPXA 2GNOA 1J0AA 1GSHA 1M2HA 3CMCO 3B3FA 4GOXA 5DHPA 1VSTA 1NPYA 1I1HA 2B5VA 3SC3A 1X92A 1MO3A 4PSVA 1UZUA 5EI5A 4U63A 3ETHA 3TOXA 3FPHA 4XQ0A 4E5MA 4DV0B 4FC6A 1RWQA 3ANLA 4PV7A 3IERA 5CNJA 4IQFA 4I4TA 2RC5A 3AUAA 1CFJA 1YRQA 4IUCS 2C3OA 3KYDA 1JAXA 4JFAA 4DVJA 3EHDA 4PS1A 2QD2A 3R6DA 4JHLA 3MJRA 4ZQIA 1SHKA 2W6PA 4KTVE 2LRHA 3D4PA 5AXCA 1ETHA 2C0CA 2CUKA 4NCJA 3TWOA 4QU8A 2QLMA 1N57A 3TO5A 3WLTA 4OK5A 2J5XA 1A7AA 3MGBA 5FBRB 3D6NB 3GFBA 1KI2A 2JI7A 2FB9A 3UO8B 4DCOA 1IZYA 2FMKA 3HY6A 3R3HA 2XZOA 4CLXA 1W4ZA 4QG3A 4NJMA 5AKZA 1IVSA 1RQGA 1QXSA 2Y1FA 2X6RA 2E48A 3DTVD 4HAIA 3IURA 4GPBA 4MDYA 3MCWA 2XPCA 1YHZA 2A1TS 3R5XA 1XLVA 2AFIB 4LS3A 3HNOA 2X3YA 4ZVPA 4ER0A 3TVTA 1QTIA 1UPBA 2JD0A 4KLRA 4QJBA 3MA0A 5A4JA 3W05A 5LQUA 2CKMA 2NU7A 2HEGA 1UOEA 4D0SA 4N3NA 1PAUA 4IS2A 5TMPA 1G63A 1OWPA 1P3DA 2WUFA 3ACBA 1CZUA 1L0BA 1M1XB 2FI1A 1GNVA 1IHOA 2ACKA 2R79A 3DV9A 1I2BA 3IP8A 2FFAA 1E9AA 4KUGA 4QRHA 4WCFB 2YXEA 4YUZA 4DMUB 2UZ1A 4HS9A 1XQWA 4WGGA 2DSNA 5DTEA 3UAXA 3TX2A 1NVWQ 1L3IA 1YUMA 4Q7QA 1NVBA 4XWOA 1PLJA 5TVKA 1Q22A 2HNBA 4RJTA 2V0NA 3S5UA 3EWIA 2HCTA 1PIWA 3NUGA 1JB1A 4Q18A 4NYMR 4QYMA 1ZUWA 1SXJE 2OGWA 4EOGA 3BD7A 2IYWA 3BWCA 1EUCB 1EDEA 1K7SN 2AEJA 3DKPA 1WZUA 1X7XA 4ZYTA 5LB2A 5HVNA 2CY0A 3H4IA 2CXNA 5CH3A 3UH0A 3GLIA 4S2EA 1RYYA 4PAQA 1OV4A 1T9ZA 1NV9A 1Q0RA 3TB6A 5FQNA 4O4HB 1A96A 4JLPA 1RYHA 1SXGA 4HB2A 1H3NA 4FW8A 4UU8A 2H5EA 3SS8A 1G6KA 1W48A 1XCJA 2Q3LA 3R0JA 3IVGA 5B57C 2QJRA 3PR3A 3WHIA 2C7QA 2CL6X 1RBYA 4I9NA 1FX0B 1Y5NA 2D2IA 2IHTA 1NM5C 3KSDO 1JFLA 4I1YA 4RDHA 3KB1A 1JPNA 3MYYA 4PM4A 5ENDA 1L4YA 2G9UA 5HS6A 1J2RA 4NNJA 4BY9E 3TYXA 4PWZA 2ZANA 1NJ1A 2QRLA 4O4IF 1M1NA 4NCBA 3N05A 1AHPA 4IFBA 2EEPA 1WMBA 2WHEA 3MWLA 1ZWKA 1J49A 3VFDA 1E92A 1UPCA 3RHSA 1N7GA 5LR6A 1DRWA 4XX0B 3NC1C 2EEZA 5AOCA 2AWNA 5FPHA 4U2DA 3TLZA 5LCXA 3L8HA 4QBGB 2EGUA 4ZCIA 3CKMA 1ZGAA 4UOQA 4NCHA 1TNDA 5I7VA 1WZ2A 1NP3A 5HJ5A 3IAM6 3KS9A 3DBHB 3B89A 3I2FA 2HY7A 3N53A 3NUZA 4B6QA 4P32A 4E2WA 2P6NA 2QLTA 1L4GA 1LZLA 2QRMA 1IOWA 3EEIA 2OVBA 3H8VA 1MC5A 3SIPA 3TZHA 3KJGA 3ZR4B 1A5AB 4EFNA 1KJ8A 3NFYA 2YJTD 3MERA 3I42A 3OX4A 2GQ0A 4TYYA 3EXEB 4H0FA 4RMJA 4B48A 3IIJA 2O2YA 1ZNZA 2J9XB 3E53A 3LC0A 5JMOA 4DEYA 1E96A 2R00C 3QOXA 4GW3A 3TUIC 1SQSA 1M7HA 2PZFA 4L4RA 4X7PA 1K8RA 4CTKA 1GVNB 2XGSA 1XTKA 1YZYA 3DBLA 4M7PA 4TS1A 3HS3A 2RHHA 1A69A 2X5JO 4BNZA 3BHIA 3K9WA 4QARA 1EM6A 4I14A 4TLEA 2X2OA 4FSXA 4DW8A 3EOBI 4OQ4A 5BOVA 1E9BA 2IY8A 2VTVA 2BEKA 2QMUA 2WYWA 3IPXA 2H59A 4UZSA 1U63A 1JJFA 1A8PA 1TEVA 1N2JA 1R0LA 3NTOA 5D3KA 1HF3A 2BMJA 2WA2A 4L57A 2GWHA 5C4IA 3JASA 4R0VA 2IWRA 2C2YA 4WCFA 2BR4A 1WY5A 2GT1A 2YZKA 3T7TA 1F17A 2A9VA 3JYNA 1DTSA 4BJHB 1NMQA 2CLIB 1VHQA 1M2GA 2H92A 4QL3A 1N6LA 1NJGA 1ORWA 2OBLA 3B38A 4YIKA 4CLOA 3P9CA 3GJ5A 1YIOA 3M82A 4DS3A 3M2PA 1HDZA 1JXQA 4TKUA 5CYOA 2PG3A 1G4AE 4PAGA 5FUVA 2OAP1 3IMEA 1UT8A 3DDOA 3QKWA 1ZSNA 3VH1A 5J5AA 2UYQA 4MRMA 5CH5A 4BRSA 4RQAA 5DHAA 4EJSA 2G9ZA 3PDHA 4EW3A 1ZINA 5A04A 1YVPA 4ZKDA 2YFYA 3V9AA 3N5CA 4AG5A 3AY0A 1TYZA 2JEYA 1DOAA 5F2KA 1JB9A 1IEXA 4C4AA 3AQ4A 4IICA 1RPZA 5LVAA 4B3MB 3CJTA 4WFJA 4RMNA 3EODA 3TIIA 1G8FA 2Y1XA 4JFRA 5H81A 3HLYA 1DKPA 1EGVB 3PXXA 4EUFA 5KNCH 2I8AA 1KO1A 1UKZA 3QPDA 4MB2A 4RMHA 2QAIA 4YY3B 1HNZB 1D8AA 2PGJA 3H16A 3L6BA 3SFVA 2FR0A 8OHMA 1RYBA 1CS4C 1SM4A 3F5FA 3DL7A 1AUQA 5A7HA 4BGVA 4FDTA 4QXPA 3WDMA 4NZ9A 4WPGA 4XKJA 1IWBB 2QJWA 4AY4A 4C6TB 4PCLA 2FP3A 1U5AA 3IQHX 1TXGA 5CLHA 1FFSA 4GFDA 3AVOA 3NT2A 4M8KA 2HF9A 3D4OA 4ZICA 5A4AA 1CF4A 1TOAA 2QRKA 1NUAA 1G5FA 3TUJC 4PYKA 4DJJA 3D0KA 3HDVA 4MO2A 2NP7A 3E7WA 2W2XA 1EFAA 2PHZA 1EHCA 1NQTA 1R8SA 1NG9A 1NY6A 3SIWA 3WYBA 3OX1A 3FJ1A 4RFLA 5EINA 2RB5A 2IV7A 4L8LA 4FLFA 4DC9A 3TIGA 4FDUA 1SZDA 3JYOA 1ZUNA 1ZNXA 1CD5A 2FG5A 5K03A 2Q9BA 2FF5A 1D3AA 2B3DA 3A1NA 1JL3A 3LQ1A 1GUYA 5IZ4A 1JR2A 1UBRS 1ORDA 2QVGA 3M6UA 1ULBA 4R01A 4WUTA 4UBMA 2WWWA 1AC5A 4IMRA 4NE9A 2VF4X 2XUHA 1UF9A 3IJ5A 1GU0A 1UQRA 3MJFA 3GUZA 1GU1A 3QMPA 3E61A 4PTZA 4TPKA 3QW2A 5AVUA 4EA9A 1JLHA 1UANA 3SEZA 2DX7A 1BX3A 3I2YX 1NGSA 1RPTA 4UAUA 3GT7A 5JWRA 2BF7A 2MJLA 3AK4A 4MR8B 1Z8DA 2ZUDA 2IY7A 4ZWNA 5IPFA 2H29A 2ZI9A 5ERXA 1F8FA 1ZH6A 3BAFA 2Y4OA 3GRAA 2ATXA 1F2TA 4WK4B 3TMYA 1O1YA 2ZIAA 3KD2A 4G9EA 4B2LA 1N0HA 2EJWA 4J7CA 3BORA 3ZDAA 1U7OA 4EJFA 3LNCA 1WV1A 2Y9MB 3ZWWA 2R7AA 3CO5A 3SF8A 5EJ6A 5CNIA 1QWSA 2JJ2A 2ZSBA 4UFPA 2ONCA 2AFIE 1UPXA 2FR8A 1JXOA 5EHXA 3Q3VA 2BGWA 1EP2B 1E1NA 1Y48E 2CLCX 3AGPA 3UANA 2I87A 4QX6A 4ZCMA 2PLAA 1EQ2A 3D6TB 4KP7A 2AX4A 3EARA 5ITZB 1ZLYA 3BWXA 3TAHA 4IJQA 1DKOA 5GJVC 3STVA 3HSSA 3KYCA 5C46F 2D0IA 2XVZA 4KXYA 4WBSA 5DNCA 5F7OA 1JAHA 3E15A 3UA3A 5CYGA 3OM8A 5DEOA 1SXPA 4WV3A 3R5TA 4PCAA 2NM0A 3VJMA 4BMVA 2OZPA 2QRZA 5E7QA 4R0MA 3QNMA 4G4GA 2UUBB 4NK4A 3ZD9A 1KK1A 5LZ7A 5AW0A 4B3GA 5B1EA 3KQMA 1HO3A 4ZVVA 4ZT3A 4DC1A 5I7RA 1AX9A 3PU6A 4QPZA 1OE0A 4TVOA 1N2GA 3IC5A 1R9MA 2C0QA 2D8MA 3M7IA 4JYPA 4BJ3A 5IUNC 1PKXA 4LCEA 1EM8B 4J1TA 1VPWA 1M5TA 3U7FB 3K1ZA 2W2KA 1TT5B 5E9AA 3RSZA 1K5PA 3P2MA 4Q1CA 1YF3A 2WHQA 1FK8A 4K03A 5ALXA 4D6XA 2DGDA 4JA2A 3U2QA 1R8JA 5EZ5A 4OP2A 2GPJA 1HTWA 1RYDA 4I9UA 3MILA 3AVPA 4E1VA 1ZM2A 3VJRA 4GRIA 1CRQA 1EZZA 1VSQA 2VRCD 3IAEA 4PLZA 4EJMA 4HGNA 3V2UA 3N2GB 1FC0A 2FW6A 2FOLA 4EMBA 2DR0A 3FI0A 1ZXLA 1GZ3A 4IIFA 4TV8B 3FOEC 2E18A 2PTGA 3K1TA 3KKQA 3N07A 3X2FA 1CDOA 3BF8A 2PZBA 1LB1B 1W581 1IIBA 3A14A 3D3WA 3HLTA 2BM0A 3OIUA 1FS4A 5C3UA 2DFDA 3WO0A 4PO9A 1TF7A 3A04A 2I6TA 3PHGA 2XECA 1P72A 3C70A 3A3PA 2IW1A 4KEAA 5INTA 3IR7A 4Q7JB 1Z08A 5L3QB 1PR9A 2OGUA 4XVUA 2B0CA 1J6UA 2PUTA 3KLBA 3OKAA 4RVSA 5B30A 2NWQA 2C3MA 3KJHA 4MCHA 4GKVA 5I7UA 5JSQA 4MJXA 5J47A 2B78A 4EHKA 4Q4AA 3G79A 1C41A 2W6ID 2QG4A 4MS1A 5EP4A 4DYDA 1LK7A 3B20A 1IU9A 1ZIXA 4YT2A 4UTVA 1E2MA 3KQSA 4YO8A 4IVPA 4TT3A 5BQ5A 2GAJA 4WEOA 1KP9A 4MV3A 4WACA 3J81A 2CW5A 3L02A 3M4JA 3H75A 1RMYA 1WZEA 2CNBA 4JBHA 3BZWA 1KY3A 3HQ4O 1RZUA 2ODAA 5COAA 2MT9A 2D1RA 3IT3A 4BLWA 1V6SA 5D3QA 1ISGA 3MK31 3R5SA 4W8GA 5EQDA 5JAHA 3IEMA 1R4ZA 2NSHA 3ZCVA 1CRWG 4M86A 5HIMA 5K8IA 3OCJA 4JK3A 4WVLA 3ZD6A 1WPQA 1Z4OA 1M75A 3PCXA 1H05A 1COZA 3LOQA 3RYFA 4DJ5X 2DFVA 1H9BA 1AXEA 1V11A 3L7KA 5HDBB 3RS0A 1L7DA 1E2QA 3P4XA 1ZESA 3O2JA 3PDIA 4E31A 2BFEA 4G0QA 1NZJA 3DEFA 4ENWA 4AROA 2ST1A 4K9NA 5BSVA 1QORA 2X5KO 1SMKA 4LYHA 1DLJA 2C2MA 1JS1X 4CFSA 5COBA 2EG5A 3OQVA 4L28A 4ESEA 1OIVA 2NU7B 3EDMA 3OIGA 2EZ4A 1T36B 3U3XA 2C3PA 3N0TA 1CUEA 1XG5A 1ZMXA 4L76A 3LPMA 5B2ZA 4AJIA 1CE8A 5A02A 3OP1A 2IV2X 3GFRA 1FB5A 4INPA 2IYNA 3DT8A 5G4KA 1FZQA 5EIEA 2FX2A 3VSBA 3QBEA 4IRMA 4CKWB 4EO9A 5EY5B 3FVWA 2K2QB 3GJZA 1DJQA 3D6VA 4XYMA 3KOWA 1JNYA 2Q5HA 4LF5B 4Q3DA 4R3UC 1D0IA 4FR2A 3TINA 5KB3A 3HCOA 1ISSA 2W22A 2ZPAA 5DCLA 4HQRA 3BSWA 9LDTA 3NCHA 1GCGA 5DASA 3AILA 3W6PA 3R41A 1JQJC 1PUJA 2AMYA 3WNVA 2QB5A 4TTSA 4LPKA 3V8QA 1Z4MA 4W6QA 3FZEA 3BSFA 1JAIA 3KB6A 4M7OA 4R2MA 1W0CA 4C2TA 1BE1A 4A3SA 1RADA 2HX1A 2NIPA 4BLRA 3S3TA 4YP5A 1VOTA 2ZIUB 3GVXA 1OVGA 2R9VA 3PR1A 3BAZA 3FHJA 1GYPA 4AJJA 3KC2A 1WTAA 4JJ8A 2ADOA 5KHAA 1YR1A 2YMLA 2IUUA 1EK6A 4V0MA 4D6PA 4OQZA 1DXYA 2AR0A 3O74A 4YTEA 5JH7F 2CN1A 3O82A 5IT9A 1J07A 1OHHD 2PH1A 1OCEA 4EYOA 1LY1A 3WWOA 3DV0B 1F9AA 1XDUA 3AP2A 4DWVA 3ZD7A 1U2GA 2F43A 3EY4A 2HO4A 4HRAA 4LTDA 4XGQA 3SE7A 1BCRA 3OJWA 4UVGA 1A8QA 1TK2A 5TMEA 3IUEA 1ORTA 4LOKA 4QNMA 3BA1A 4INJA 4AICA 3WYEA 4QVKA 1XAGA 1X0VA 1XMXA 2WAOA 1AKNA 3M83A 4ER3A 1IY0A 2CJFA 5IRCD 5LPNA 1XKLA 1JUDA 1QMGA 3JQEA 4MS4B 3EOZA 2A6PA 4HXYA 4KG7A 5ED0A 3ZWKA 4QYIB 1XZEA 2J9FA 1EE1A 4F3NA 4RY0A 3DTVA 3SPXA 4EQZA 3PVSA 2ZTUA 3WL6A 2KWIA 3SSOA 4UM7A 3TMAA 4Z9FA 1R64A 2CLMB 7MDHA 3CVWA 4Z4GA 3VZPA 2FQXA 3WL4A 1IHUA 2GA9A 2L42A 1VTKA 3COZA 1UMBB 4J7XA 4KFSA 4QWWA 4HLQB 5CTAA 1TC1A 3M4NA 1STOA 2VDUE 3VGPA 1EIZA 4HY3A 2BUCA 2KB0A 3RIGA 2YYZA 3V8PA 2PFKA 4F06A 5KJEA 2GXSA 2GAAA 3DQZA 5AW8A 5I4KA 4LVNA 1NNEA 2O23A 1GL6A 1L7MA 1GKKA 3DVLA 3U17A 1LS6A 1N6OA 2HHCA 5K5EA 1QKIA 3D7RA 1EI9A 2VDWB 5ITSA 2RHDA 4DKXA 1KMHA 3C1UA 4BVBA 1JHRA 2IF2A 3KOUA 3H8JA 3CY6A 3DNFA 4L22A 4TGLA 3ETNA 3GUYA 3SYKA 1UXGA 2QR2A 1H1LB 1P31A 4DIMA 3WSVA 4QJIA 4KREA 2REQB 3K9QO 1UXIA 1XPUA 4NMMA 3PE6A 4JB2A 4F45A 5C53B 3W9BA 4R6WA 3WP0A 4BN5A 3B3QA 5A7GA 3BBLA 4ND8B 3GNSA 2CXQA 2Z9CA 1W75A 2WYHA 4CG3A 1JIXA 4F71A 1ZI8A 2OBNA 3E9MA 4YCLA 1QO0A 4BMPB 4DIEA 3QWBA 3U60B 1QHFA 4S0XA 4YLGA 4Y1EA 1GKIA 1H66A 1TJ5A 4E09A 2Z6QA 2ECKA 3G5MA 5EMNA 1R8YA 3SSNA 3TKYA 2QL6A 5ERGB 1E2DA 4RHXA 3K6KA 5ELMA 1YT5A 2I8CA 4ZEXA 3STTA 1LI4A 1U6KA 1P81A 1U1IA 3HYNA 3LHDA 3FFBA 3MS4A 1I8TA 1M1UA 1JDBB 3OEHD 1IB0A 4ZOEA 4LY3A 1FFCA 5EHZA 1H4VB 4HTFB 2AQKA 2Z6VA 4G8JA 2G40A 3FIUA 4B34A 5FFMA 1MOPA 3PGA1 3UGJA 3U80A 1DRUA 3QX7A 1KEUA 5HF6A 2H4FA 2G08A 3LVRE 4E5VA 3AI1A 3I3OA 3F5MA 3GUVA 2VBGA 2FDRA 3LK7A 1GAXA 1ADJA 1U0BB 8MHTA 3LFHA 5IM4F 1VG8A 1G9XA 1II8A 1KP2A 4LJYA 4HPXB 4Z2YA 3K1YA 3JTMA 3ZU5A 4H18A 4QXRA 2APJA 4L5YA 4OH7A 1ABFA 4OLJA 1K06A 2QQ0A 4R8KA 5SYAA 5HQ3A 4TSKA 4P82A 5K01A 3NHWA 4DLYA 4MITA 5LYJF 1GZ7A 2FN9A 4PNEA 2PUCA 3F5QA 3W8RA 3WK4A 3HVRA 4RLHA 2I6XA 1SBTA 4MA0A 2VPWA 4CM3A 3KBBA 2BJVA 5KQRA 2R6CA 1V8OA 1EFVB 3D6MA 4P7JA 2VBCA 4WX2B 3RK0A 1C1DB 3ADOA 2ZBFA 4W5QA 4TVSA 3WDKA 4MYUA 1A2OA 4ARUA 1QS0A 4H31A 3SHFA 4QUBA 5AVQA 1JBKA 1DC3A 2EQ5A 3EFEA 1KK3A 2OO5A 2DRIA 3QLUA 3WYAA 2HR1A 4X6LA 3SVZA 1MV5A 2R1TA 2CVHA 3OTIA 4O33A 2WU3A 3T0IA 3ZXUB 2BYTA 1ZVJA 1V4BA 1SXJB 4HRXA 2HSEA 3CH7A 1UK8A 4RPLA 2DKOA 3LOPA 5CGZA 5EMHA 1YBVA 2PLNA 1V1MA 2WRZA 1ZKMA 3PGXA 4H4EA 3DHWC 1ZK2A 1YAHA 4PGAA 1ZH0A 1DJLA 5ITVA 4YYZA 1ECBA 3SF0A 4MRPA 2DH6A 1T5IA 3TAXA 2J09A 3OIDA 2FUG6 5E1OA 4K8OA 4BGUA 2R6ZA 2OCAA 3HB4X 1VP9A 5JMPA 4L9RA 121PA 1QUEA 4US0R 3L7CA 1BS1A 2AOVA 4R7GA 4AQDA 3MUNA 1KGDA 3BE4A 3PFNA 1NUPA 3V4PB 1N5MA 3L2OB 5LYYA 4Z9XA 1R3DA 2IHVA 1V7PC 1NXQA 1T3ZA 4OKIA 4UCXA 1QQTA 5ITZA 2WKSA 4MV7A 3Q40A 2PMWB 3QHPA 3SR3A 1X9GA 2JCBA 1IJBA 2NU9A 5DBGA 3RFTA 4YDQA 1IYZA 1QP7A 4TTTS 3O1JC 4GKAA 1I4TD 1NUUA 1Q84A 1TF2A 3FAZA 2LCIA 4FMDB 3PC2A 2VDOB 4RTPA 4CMIA 5LD2B 1KAHA 1E2LA 1TQDA 1Y0BA 2VC2B 3E9ZA 4G8DA 3ZDQA 5KMGA 3FF1A 3G2QA 2IEDA 1ZIOA 4TLCA 4CKBA 3HKEB 4YJ3B 2CJYA 1WG8A 2CHEA 3BXHA 4KXVA 4H4CA 3WZ2A 4CL8A 1VDZA 1YJ8A 4DQVA 1AO0A 3L1UA 3M6IA 3C5EA 1KC1A 2GYWA 2H1RA 1DUVG 2VYFA 4OM7A 4B8ZA 3PXDA 2PUHA 3VNUA 1PT8A 2OXIA 2HWYA 3EDOA 3T3EA 3CE9A 3WJ2A 1U0RA 4Y2QA 3N75A 3OUTA 5HDQA 4BFYA 2QEQA 1FXSA 1P1CA 3BRWA 3OMXA 2O6LA 3DOUA 1C7FA 4MJLA 3V1LA 3V7FA 1HEYA 5CB6A 3P9NA 1RQNA 3JAMA 4CEHB 1EFDN 3FFAA 4NK5A 3ZK8A 10MHA 2IYRA 5CIQA 2BTOA 1VHJA 4QUKA 1I3NA 3FG9A 2Z6AA 4WCDA 1KO5A 4LA4A 2GZDA 4Y2JA 4I5EA 4F4FA 4CQJA 3QNUA 3AZQA 1TZKA 3I39X 5FBVB 3VOBA 5K6AC 2P69A 4ZYYA 1GKYA 4IKPA 1L4FA 4XDYA 5B1YA 1XQ9A 5LQAA 2AYYA 1RC8A 5A7FA 1OH5A 2WTUA 1V7QA 1AUXA 3GLGA 1B2LA 3B1ZA 3HTXA 4G0XA 2J1LA 4CBVA 1NXSA 4DA7A 1BDJA 1T91A 1KHTA 1QZ3A 3O4HA 4PE5B 3G02A 5GAJA 5FAXA 1OY1A 1GJRA 4AZWA 4MV5A 3IVRA 2ID4A 1QIMA 2DT8A 2F90A 3V8MA 4U7FA 5DW3A 3KT8A 5BV8A 1N5DA 1ZL2A 5BW8A 1MRSA 1T0JB 4BB5A 2XCIA 4PIVA 3IALA 2VDQB 5K0JA 1Z36A 5KJCA 1X1AA 3CVVA 2XYPA 4CDGA 2JVKA 4ABYA 5L45A 1TCCA 3SHQA 1EUQA 1E3JA 2CNKA 2R1TB 3S81A 1NUSA 1RAEA 3LX8A 4KLCA 4J2TA 5BPFA 4ARZB 2EJTA 1XMIA 3VKHA 3KUXA 5TGTA 4CUKA 4F1JA 1M0EA 3HBMA 2A2ZA 3DTVB 1TB4A 3RSSA 2BPOA 5IVIA 1H42A 1ENPA 1BO6A 1TAQA 3IOEA 4EF5A 3AL2A 2O3SA 5CEJA 3SICE 1ZD5A 3WK6A 1OFIA 1QHHA 3LHFA 4TSFD 3CHYA 3P2EA 4QXMA 2VZ0A 4ZVKA 2FPPB 4I5DA 4HDKB 4UNIA 4C78A 1Y6RA 2PCJA 3BIFA 1U4OA 2WFMA 1CU1A 3E7PA 4LG1A 3F0TA 4NDAA 2YZGA 5DN9A 4OUDA 4PZZA 5AM1A 5JAUA 1DFGA 1USWA 1M9NA 1H1LA 2D2XA 3I52A 2QQFA 1BGVA 1NJ6A 1VHDA 2REQA 3UTCA 2QXTA 2C54A 2HDOA 1PFVA 2ZSFA 4G0NA 4BUJA 2HKIA 5LMCA 2OCIA 1VIMA 1TFRA 4G5HA 1E5DA 1Z5UA 3ON5A 4UXJA 4G2TA 3FA2A 4NYMQ 2OPBA 1FDUA 2WG1A 3E7XA 2W6JD 4L4XA 5BT9A 1FSZA 3GCWA 2CC2A 1IBSA 1UBCA 1ZOIA 4DANA 6YASA 3AEQB 1P75A 5B12A 1FLNA 3A31A 1KRHA 4WNAA 1UP4A 4TQAA 1T4GA 2XYQA 1P2VA 3I1IA 3I9V6 3ERCA 2RGNA 4S3MA 1CZHA 3DZDA 1SVOA 2GB4A 4QQKA 5AM4A 4HDSA 4M38A 4G0ZA 1OUMA 3EZXA 3OX3A 4I1RA 4R5HA 2PXAA 3FTQA 3IXMA 5AK3A 1QAMA 1KVTA 1T2VA 3QU5A 2B3TA 5GVSA 3ZU4A 2YRFA 4EDHA 2VP6A 1KSHA 3BGWA 1GPBA 4CN8A 5L3VA 2W0MA 3M5DA 5JC8A 3RLIA 2PUVA 2EX4A 1O2DA 1PQUA 4I66A 3T5AA 3F96A 2NO1A 3TTYA 4HQ0A 4XJXA 1PG2A 2D59A 1RJ9A 4J07A 3THYB 4GPZA 4LJ9A 3ZIAA 4F38A 1GZ6A 4ZA2A 2C4MA 5HF9A 2QV0A 2ZUSA 3ZCXA 4C43A 1SB9A 3FRHA 1XHFA 3H1BA 2B25A 3GU3A 3RS4A 1MDBA 5C7OO 5KZMB 1VRWA 1JWBB 3H6HA 2WIGA 3LC1O 2VHTA 3AERB 4FLEA 3N1UA 4GWGA 4JODA 4DM7A 1I7DA 2CZGA 3FJYA 1Z83A 2GZ1A 2IU6A 3IBTA 3T06B 5LIPA 3G7NA 2C5BA 4MZDA 1X2BA 5C8XA 3HSKA 1EIWA 2WI8A 5AK6A 4Q15A 1VBFA 2N9UA 3RRYA 4YMLA 3H1FA 1SBZA 3NI2A 5EZYA 3WK7A 4A23A 4A6EA 4EKGA 3X1XA 4U39A 3W5AA 4DLWA 5AVYA 3R24A 1MHTA 1D2NA 2PZMA 1M10A 4Q19A 1K6MA 1J9GA 4CKYA 2IC5A 4DJFC 1UL1X 2Y99A 1FP6A 2JJ1D 2PWAA 3UAZA 3DXZA 3UXEA 2WQ7A 3TGPA 2RH9B 2H16A 1J1ZA 2HRZA 1U3DA 3RSFA 1D4FA 3AFGA 4QLAA 3BFXA 4UQLA 3H1TA 4DUYB 4OX9Y 2NG1A 4HQKA 4AYXA 4PGGA 3BFVA 3RASA 1OIWA 3D1VA 3JW8A 3ZVNA 3FYSA 1L3BA 4MMZB 4O5OA 4EGSA 1T24A 2WABA 3GLVA 2HH9A 3NZEA 1MCZA 1C7QA 1FRQA 1GNQA 3CUEF 3LECA 5DM2A 1VCHA 2UYYA 5JO9A 1RLTA 4ZAWA 4F4JA 3PTAA 4DRXB 5DKFA 4MKGA 1GDHA 1KFBB 2I2BA 3HI4A 2GN6A 3U4HA 2Q5CA 2CXHA 2ZRIA 3VPGA 2F00A 3BB3A 2PBZA 4DBLC 2I7XA 3FRIA 1TM2A 2ZBEA 4OBWA 4YASA 3BL8A 1PZMA 3L7OA 4X7RA 5EFOA 1T4DA 2QD1A 3BJRA 1PFQA 3G7UA 1CR1A 2FLWA 1L4HA 1RW4A 4D0NA 1TYAE 3LBIA 4JJ4A 3T52A 3TI7A 3ZNQA 2QTCA 3LLUA 3PWKA 3SYMA 4G3XA 4EEZA 1FSPA 4CKBB 2P0EA 4LXQA 1VHTA 1YI1A 1B3RA 2EL7A 4PG7A 4WNAB 3E84A 2YWDA 3JZIA 5EC8A 4A9AA 3K53A 1YE8A 3MCTA 1L5RA 2DPHA 2O5VA 3KQQA 3WMFA 3U6KA 3EPJA 1AJEA 3K9CA 2Z3WA 3QPVA 4CRWB 5L3ZA 1SUIA 1BQEA 4CNBA 2Q2VA 3LYLA 1DMRA 3KTAA 3P96A 3QJGA 1A98A 2WNSA 4PRYA 1PLLA 3DTYA 4QTZA 5CAEA 5J4LA 2Z5VA 4M1MA 2CV0A 4GE0A 1XTZA 3WKAA 2H52A 4WZBB 2JH9A 4RK6A 2JBAB 2WJWA 1U6JA 3VR0A 3TLGA 2XT0A 1K9SA 2O5CA 4B6SA 4ETMA 4S0ZA 1PQYA 2ZROA 5BUZA 2MHCA 1AHHA 3DO5A 3NG1A 2X3UA 1QG0A 2G0TA 2OV4A 3DF7A 5EQFA 1DXQA 1Z2PX 1FDOA 1P6QA 5AMXA 3RGGA 3OFND 1XCMA 3R1IA 4KMSA 4RHCA 2ZXFA 2OHJA 2GO1A 2YR0A 2G76A 2RG7A 1TYEB 2RHGB 4J90A 1Y5LA 5KYTA 3ZE0B 2QTMA 4BVHA 1A4XA 2OHVA 1MV8A 2X9GA 2A1UA 3L0IB 2I2FA 4GLFA 4RMIA 5AJTA 3TZEA 1XRMA 3UAOA 2XCSB 3NRJA 4G5XA 3GPBA 3H7AA 2H7XA 1H3FA 1Y5MA 4N1AA 1I0LA 4YUAA 4FOPA 3MTAA 2FU5C 3FVVA 2FK8A 1R00A 2AVDA 4JJKA 2IYXA 4HDMA 4V0OA 2WE7A 2IZ0A 4K6FA 4NC9A 5AJHA 5LFAA 3MQFA 2RCYA 4MKIA 4B3IA 3C3DA 2BEWB 2EWVA 1DI0A 4YJ2F 3SDSA 2WPDA 4CDNA 1LJ8A 3ZHYA 3ETJA 2G06A 2VHQA 4HPWA 5KINB 2FQQA 4E6EA 3UMFA 2JA2A 3SYNA 1RKBA 4EBFA 1QO7A 3A2MA 3O26A 3ODPA 1NNUA 2ZYHA 2RAFA 3HP7A 3UMCA 1L4KA 1CQZA 3NDJA 3LUJA 4QDJA 3ACCA 4EB6B 3RIHA 3RT9A 2WAMA 1LLDA 4QJ4A 2VJDA 2C95A 2AMFA 2XADA 3REQB 2PUBA 4W7SA 4DSZA 4O8ZA 3EPKA 3MXTA 4U7TB 2QW8A 3RG2A 2HSZA 2Z2XA 4L08A 3CH6A 4F11A 5B1SA 2G9QA 2YASA 2BHRA 4H7DA 1MJ5A 5FBWB 4COKA 1XZKA 4KGDA 3A7EA 5EJEA 2VNJA 4PIMA 2HXSA 3U5TA 1I9CA 1YJCA 4R7ZA 3SLRA 1FFEA 2NUTA 2C2GA 3RC7A 2AX3A 5JIBA 2NVWA 2CEAA 2J3JA 4F6RB 3A1FA 4YAJA 4QYWA 1PWYE 3H8SA 4BGEA 4HEA1 2YDXA 2UAGA 1KXJA 3ABZA 2J0QA 1UIMA 4Q4LA 3L05A 4MOWA 1R10A 5AUNB 1QPBA 2PUGA 4W8OA 3O8RA 2IZ5A 3R2JA 3KZVA 4KFRA 3VC3A 3TSWA 3SBOA 4F5ZA 1L7OA 4KNWA 3GBSA 4GZ5A 2PKCA 5KTOA 4JWTA 1AA9A 4UHHA 4DAEA 4NYJR 1CP2A 1EFKA 3GEGA 1A9SA 1WMFA 2AFRA 2FG6C 4ND5A 1OZAA 2XGMA 4Y2SA 3KD3A 4NZZA 1OILA 3ZUPA 4E94A 5EHGA 4M1EA 4HWKA 1XGKA 2Q4OA 1ZD3A 4LXXA 4PHTA 5JI3E 2QVXX 3UBTA 5ILGA 1HG1A 1NVGA 1EQUA 2XNDD 1Z7GA 3JAKB 5T5QA 3H65A 4TT8A 2HJRA 4H59A 3RBVA 3K0HA 4CKWA 1S8FA 3KLNA 4JJGA 4RPJA 3EMKA 1QM5A 5AKJA 2WD7B 1OQAA 2GYUA 1Q0ZA 1ELOA 4EI7A 3NAMA 1Y1SA 2WA1A 3V7WA 3RC1A 2CXOA 3JPYA 2I1WA 3W06A 4POOA 4XLTA 3WQHA 2BFFB 4DILA 3VU3A 3K0SA 4PANA 1XBTA 3I76A 5ETJA 3JALB 4JP5A 1I7QB 3OTQA 1ZN2A 5DCWA 4WNCA 1EBFA 1YVEI 2ZTMA 3DULA 4BFCA 4REMA 3V46A 1PTKA 4UDOA 5KHLB 3MWYW 4WDQA 1SHJA 2PWBA 1OKKD 1AB6A 1GGVA 1KEPA 3B12A 3CXUA 1HSOA 1KETA 1QYCA 3A6ZA 3NTUA 5ESWA 3GEEA 4TYNA 3IUQA 3Q7RA 4UE3S 5BNWA 3ED1A 1AG9A 4KJZA 2JDID 1PR5A 2Y68A 5CB4B 2ONYA 3LHKA 4UUQA 4F46A 1C1DA 3EH1A 1PFUA 3AJRA 2FCRA 1UMDA 4ALKA 3ZZ1A 1WMDA 4Y8VA 1RZRD 3PEVA 4MGHA 1JJIA 4D9NA 2XA9A 4V1CI 2WTXA 3RS9A 4BNIA 2A1TR 3Q7PA 4ID3A 4OQMA 5C2JB 2JFFA 2YV2A 1NVEA 2OAEA 2QG9A 3PWSA 3SXUB 3AM1A 1SA0A 3DZFA 5LBIA 1WXWA 1JKJA 3NC0C 5TVGA 1O6BA 3LXMA 3ZVMA 3M6MD 2YC2C 3NP9A 1HX7A 4CM9D 3FSJX 6REQB 5CA0A 2OUKA 5A6SA 2VXOA 1CJTC 4IDEA 4FI3F 2ZS7A 5HIIA 2FZWA 1TGYA 1HT3A 1NYLA 1F7VA 2DPYA 1VBMA 1CDEA 2P41A 3I2IA 1N4DA 3L01A 1NV8A 5AXDA 5C80A 3HJGA 4DRYA 2PZKA 1RXVA 2P6OA 3DR3A 1KDOA 1W6RA 5DK6A 1FDWA 5B4UA 4HLUA 4BAZA 2C2ZA 1SBQA 4CV1A 3BFJA 3A4NA 1VI5A 2HQOA 2YXDA 3ABRB 3C43A 4ANFA 1Q7TA 1HFJA 2ERCA 2F9MA 2QL7A 1LV8A 2QHXA 1K7CA 3OJLA 5BNFA 1OXXK 5ALNA 3MBIA 4WOPA 1PVOA 3W9YA 1JQ5A 3D31A 2X6TA 2HDNB 3KLPX 1B4DA 3QMWA 4UTZA 2DBRA 6PFKA 2W2KB 4UUPA 3UIEA 1IOZA 4X1IA 1MBZA 4N8EA 3HKBB 1N2EA 3T5PA 5HKBA 1A4UA 3MSXA 4N48A 2GXUA 4C1BA 3D3QA 3RV4A 1ZX1A 3SZLA 4N7RA 2OHIA 2A88A 1F14A 1W25A 4IDCA 4NICA 2VT3A 1Z6YA 3L92A 3LBNA 2G82A 5EVCA 3FUWA 4AMYA 3MTEA 5BT8A 1CUJA 2I6QA 3HKEA 1UWVA 3E05A 4LGCA 2DWCA 5FA6A 4JJ7A 4ZCQA 2XXJA 5A0FA 5C1IA 3UV7A 3KM0A 3V5NA 5IAGA 1O5OA 2JFHA 2ZYAA 5AKXA 3SE0A 1FLVA 1KH2A 5CP8A 3VAAA 4DJEC 5KYYA 3VO2A 1XEFA 3FLBA 4HUJA 2GZMA 4RLSA 2E6KA 2ZBDA 1ISFA 1W36D 4XD7D 1PWZA 2AI3A 2FRXA 2IUEA 5HCNA 2Q4BA 4FHCA 1Y8QB 4X95A 4ZTUB 1ZO8A 3G9QA 4TXNA 5C7YA 3WB0A 4ZI2A 5KBYA 3IOCA 5LYJB 1EEXB 2EXXA 2GN1A 5JD3A 3FWNA 4IXMA 1UFKA 5H02A 3W8FA 3A36A 4JOCA 2W37A 5GPBA 2I2WA 5CAEB 2R62A 3MTIA 4C7XA 1R3UA 2XDWA 2Q1UA 3WY9A 3AM3A 3OJCA 3PVCA 3UM9A 2CFOA 1ABEA 1PBNA 2J6IA 1W85B 2XB6A 4WFIA 3WGJA 3OE5A 1CQIA 2HNKA 2GERA 5A9SA 3ANTA 1MQSA 2YZMA 1N0VC 5AHOA 3PQEA 5DXAA 5JADA 5JAIA 1ADCA 3IUJA 2IVZA 2RIRA 4YNBA 2BZGA 4ALMA 1G2IA 2V3VA 2R5FA 2C9OA 3DLBA 1HZZA 1ML3A 5I48A 4BX9A 4UXIA 4JC4A 4RULA 1BRMA 1BHSA 2G07A 4X44A 1DWPA 1LSOA 5TRTA 2ZJ7A 1QGDA 1BC5A 1R16A 1QZZA 1FOEB 3N8IA 4IMPA 4NZYA 4NV0A 1XTBA 3D8HA 3TLYA 3DE2X 2I65A 4JB0A 3OMLA 3BGDA 3DEIA 5LSAA 3KOOA 5EP3A 3I9JA 3TW4A 5HR5A 2XOXA 5CA1F 2IXFA 1DZ3A 3RIXA 4MVYA 3MFYA 5B5SA 3X2EA 3C39A 4R98A 5K3FB 3W5VA 1QO9A 4KR3A 1CUDA 1E5XA 5LZ8A 5F4BA 5EEGA 4D5EA 4GP9A 5B7PA 5KTTA 3RJ9A 5CDHA 2CMHA 3DAGA 1Y3HA 1MABB 2AZTA 2GCOA 2HSWA 1QQ6A 2JIDA 2XE6A 4PN3A 2VQDA 1N6IA 3V8BA 1JFTA 2GRJA 1M6VB 4OQLA 4RTJA 5TQJA 1USKA 4Y18A 2GAFA 1O94D 4O0MA 2C31A 2F1HA 4D42A 1KTVA 2ISCA 1SCUB 2L82A 4OGKA 4E08A 3HNRA 5KQMA 1I36A 2I76A 3ETEA 2UUOA 1WO8A 3EJ6A 2DP4E 1H85A 3VKWA 1BEUB 1Q7GA 4BKPA 1UK9A 4R54A 1OWMA 3WKBA 2NTEA 1OAKA 3R20A 1T9CA 1VMEA 4XSGA 2YNMA 5AKYA 2BC9A 3ZH9B 1GSOA 2WOJA 3GRKA 2XMBA 3L4EA 4UU7A 1XE3A 5EZYB 3UNXA 4B79A 2PX8A 2YVUA 3EGEA 3KQPA 4OD0A 4C03A 4BXOB 1OIXA 4FC7A 1FL9A 3CSDA 5HFJA 4ZVOA 3OETA 4YP9A 5E3IA 1JEYA 2YJ6A 4JX9A 1Y4UA 2G9NA 1Z4QA 1TCVA 1C0PA 2JFGA 1TD9A 2VDKB 4YAOA 1V8BA 4QQ8A 1JDUA 3RG8A 2C7VA 2QRGA 1FXWA 1GPNA 1HDGO 1YQEA 3P9KA 3U7EB 1KMIY 1R4NA 2R2AA 4LSZA 5C37A 4HRYA 1VPTA 4MWOA 1EU1A 4ACAA 3ZJYA 3FZQA 1EVEA 2V9PA 4GXNA 3OCWA 1RC1A 3P9YA 4XPIA 2O50A 4JGGA 4WWHA 2H2WA 1NBMA 1WB5A 3LD9A 3MMXA 4R2HA 4TTJA 4F6LA 1ZNYA 1YU9A 4HB4A 2X77A 2YICA 4PZAA 5FOTA 2J3QA 1CY2A 1DQYA 1G17A 2VYCA 4Y2UA 5EJ8A 1G38A 1P61B 4NBUA 4Y0AA 5FBZA 3DZGA 4YXFA 1AB5A 1OLSA 1X39A 2OZKA 4HZUA 1O0CA 4C3VA 3AUFA 1ZHFA 1XD9A 2F43B 4F5WA 3UEOA 2DBZA 1NMSA 4U6SA 4UDNA 2W6CX 3RVQA 5KOYA 1V2GA 3RUAA 1MEEA 1WCIA 1KGSA 1GL9B 1MHPA 1THTA 3OLQA 3U81A 1JDZA 1N3YA 4ZI7F 3T95A 2YNMD 4I19A 1YO6A 2QAJA 3KJNA 3PQ4A 3T3NA 1W4LA 4MRNA 4YMVA 5BVGA 1QIKA 3GEHA 4E5UA 4GSYA 1TCUA 2Q8PA 4C4ZA 2KX7A 4B3FX 4J7AA 3GLHE 1O95A 4X1KA 3HN7A 3GP8A 4NOKA 2IXTA 2X0KA 3EC1A 5F52A 4MWGA 3JQGA 4R2IA 1NQOA 3EUAA 3DO8A 1BE6A 2GCGA 2NYUA 1AOXA 2JIQA 5AM3A 2EG9A 3GH1A 1S4QA 1B6SA 4H15A 4NTZA 3ET5A 1Q14A 2JH8A 4MVXA 4FP9A 5I47A 2WMNB 4RH0A 1RACA 3JATA 1DPGA 4C0JA 2WU0A 4DXHA 4RK5A 3GELA 5KQSA 3GD5A 4HS4A 2FZ5A 4NI5A 1YZFA 1KOLA 3ZGOA 2H2GA 1MB3A 4KR0A 3UJPA 2BH2A 3CLRD 2JCSA 4BWGA 4DPMA 2XSZA 3FWZA 1OXSC 2GZAA 1LF0A 2FOIA 2ZRAA 3TNDA 2HMYB 1FUKA 3HR8A 4PBSA 3RJMA 1WX1A 4A5OA 3ZBPA 1EP1B 4NG5A 1SQ0A 2VAPA 1A7UA 3DAHA 1THZA 4ND2A 3SXPA 5EFZA 1CQJB 3G88A 1QRAA 4MWZA 2HA0A 4J76A 5ARBA 4L7QA 1I6WA 3SZMA 1DKRA 1Z4JA 3I45A 1Y5IA 3QXGA 3I6IA 2CDNA 3HDYA 3FPSA 3VVLA 1E3WA 3FR7A 1B0UA 3CNHA 3K1JA 3EVBA 1V1RB 1EAMA 5AOAA 3SEAA 4J1TC 3TEJA 3TFQA 3WI7A 2WD9A 3ZUGA 2D6FA 4J7UA 4IG9A 4BAGA 4YRQA 1G19A 2EKQA 3ZIDA 4YRBA 4NDNE 2FEAA 2YZ7A 1F8XA 2EFGA 5IDWA 4H35A 1X2EA 1A9QA 4IF4A 3TW0A 4LVOA 1UUFA 5EXEA 1HG0A 4JT2A 3NEYA 1PD0A 1WVIA 3K0BA 4RGBA 5JT1A 5GZ6A 1QVAA 5LM3A 4B3JA 4I55A 3BPSA 3TX6A 3GYBA 2WMOB 4R9SA 4ZCPA 2C88A 1A8UA 1SAYA 4A27A 1P1KA 2MR5A 4G1BA 3A27A 5JBQA 4RZ2A 2QUAA 3FYCA 3O6VA 4N0MA 1J8QA 2G88A 2EW2A 4CMJA 4F60A 4N01A 5HKAA 5GGXA 3T1NA 3UUFA 1T13A 1UP7A 2H2HA 4CF7A 3GO4A 2JKZA 1AZLA 3WLNA 1XK7A 4FMCB 5LQNA 1XWWA 3W2FA 1UZMA 1H2ZA 4UQOA 5EHNA 1UXHA 3V7NA 2CHQA 4UHEA 5IEJA 2C9CA 2Z1NA 4RXUA 1DDOA 4C07A 1W2HA 2O1EA 1I32A 1PR3A 1SC9A 4OUDB 1C8BA 1UINA 1LS1A 5CT6A 4B3HA 3CS3A 1C3JA 4GX1A 4RPKA 4LRUA 2Q4DA 3EJWA 1VC2A 3FLMA 2VRCA 3SX2A 1XZIA 3VTZA 4GKBA 4NBNA 1R9NA 2F8MA 3UMGA 4BC1A 3VTKA 4BATA 1JDSA 2SKEA 2WM9B 1NVVR 1NC1A 2N47A 3PPIA 2GPAA 3MRXA 3H9CA 3SM3A 1LKZA 4KU4A 1A9RA 3T3PB 2A3RA 5G3YA 1T25A 2HF8A 4MZXA 2NO9A 3B7PA 1XIVA 4YRJA 4UCWA 3KAQA 2WUVA 3O3CA 2WMDA 3V9PA 3C6YA 2HXYA 1JJBA 4L3WA 1LBIA 4HMOA 3LV8A 3EBOA 5FUWA 5HFNA 1YUNA 4D5GA 2QQ5A 1WXQA 3IODA 2GSDA 5E38A 1D5WA 4QU9A 4CR7A 3L93A 5LQCA 2WD7A 4PLCA 3C3MA 3ROEA 3WZMA 1V2HE 5IYZA 4CG1A 1GVHA 2CFRA 3OT1A 1NW7A 3R23A 3ME5A 3WSWA 4IZ6A 2H1FA 1L6RA 2P62A 2YJ4A 1I51A 2BDEA 4CMEC 3UFBA 3F8SA 4ZGWA 1C0IA 4DCUA 1QPGA 2GF2A 1P74A 2XYRA 5K0TA 2EF0A 4LDJA 4OQYA 5BVHA 3VC1A 4NHEA 3W2EA 2VHVA 4MYDA 2D1FA 1US8B 1DXOA 4LZWA 4MKXA 4R2JA 3JQFA 2PYZA 3TZKA 3RAFC 3UCFA 5E6RB 1E9RA 2MYUA 1ZJ5A 1Q92A 3FNIA 4KACA 5IKEA 5K0SA 3SC6A 3INTA 1XPRA 5ESRA 4URYR 2HSJA 4BLPA 5JNLA 1S01A 2Q3HA 3CXRA 3CPHA 3RYCA 1S9HA 5IUJC 3RYTC 3MCAA 4N3GA 1K4KA 2I4MA 1SU8A 5CJ2A 1Q7RA 2GBIA 5AJUA 4LV8B 4YONB 2Q7OE 3RIYA 3DM9B 4Q3AA 4EPXA 2Q1SA 2QVYX 3FJOA 3HY4A 3ORSA 4GZ3A 3C48A 5H68A 1MMFB 1V1RA 3TBKA 2XY4A 5EXSA 1VE3A 4QE3A 5FBKA 3W6UA 3K8ZA 1TC2A 3HPRA 2P2GA 1VA4A 3S2GA 4R1OA 2DPMA 5E4YA 4LF9B 1ZQ1A 3THWB 5BW6B 1K27A 3WL5A 2DWQA 2D3TA 3LTNC 5LBUA 2X1VA 1YFLA 1ISIA 1WJGA 2UZ3A 4MP6A 4X92A 1KEKA 4UHKA 1U7UA 3DUWA 4CVNA 3DV2A 3VTFA 2RB4A 1B0AA 1GTVA 2W90A 5E3HA 1T9HA 2Q1XA 4A82A 5HTOA 1KFEB 4QG7A 5CJJA 1Z39A 4BN0A 1EFPB 3UUGA 1JT9A 2EFCB 3ZWXA 2W6ZA 1VXRA 1CYDA 2H2AA 4AAYA 3LW8A 5AFSA 2ATIA 4LTMA 3SOPA 5J2TB 3BMNB 2ILVA 5KOHB 5H0IA 5HUJA 1V25A 2YXBA 4M0UA 3FWPA 1MQAA 4JBYA 2X41A 4KIGA 2XBUA 2A0UA 1UT5A 4LWPA 4RKRA 3VR4D 5GV7A 4I3GA 1DJOA 2BZ0A 1L3CA 1JFVA 1UEIA 3N6RA 5JPCA 3VHRA 5AKGA 4UBKA 3HO1A 1DE0A 2ERYA 3G49A 3LCMA 3AHIA 2JEZA 3EZ9A 4RTLA 4RQBA 1JP7A 2BFDB 1N32B 1DINA 2B6HA 1H2HA 1MO4A 4X9XA 3PX3A 5BSRA 4DCVA 4XDZA 3WFZA 4KCGA 3BJMA 5KKAA 3W79A 4Z51A 4RU1A 5IHPA 1GGFA 4IIUA 1N9GA 1M8PA 2B1JA 1C8VB 3VGJA 1VGRA 3OESA 1MVOA 2P9ZA 3ZHOA 2YUTA 1BVUA 4L0DA 4X6YA 3HK2A 3OIWA 2BD0A 3GRUA 4BVGA 1BXRB 2EYUA 3OHSX 3QEMB 3NP7A 3ZEIA 4CTMA 1JA0A 5LZ5A 4BKRA 4EMUA 4OQFA 4ATNA 2FTKE 3E9RA 3F5DA 3KTAB 4OHMA 4X1YB 3ENVA 4ZVRA 5CT5A 3LO8A 4RPHA 3IAUA 1QQ5A 1IHDA 2UV8A 1X8JA 3M6FA 3P4UA 5IDXA 1N0IA 1KR2A 2BBSA 3L5OA 2GUGA 1FUIA 3K9HA 1E3TA 2ZSUA 4WBNF 2J08A 3HUTA 1L1QA 2DLNA 2JGNA 3L6EA 4ZEWA 4Q03A 2WJPA 4QM6A