4C89A

Crystal structure of carboxylesterase lpest1 from lactobacillus plantarum: high resolution model
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
341
Chain Sequence
b'YFQGMPTINSIQTTVNGVVKIVKPFNNDIAGEQFDPHVLQTLTAFKQPAILENDLAALRSGSLTPAIADPVGDAVTVQSRNITALNRTVSVEWLTPQNVINHTVLVYFHGGAFYGGVPGNNTVLLKLVAAKSHCEILNVDYSLAPEAPAPAGILDGLAIFQYLEQRDAETMITVAGDSAGANVIMAATNLNQQLGSNRINQQLLLYPVTAPNADHAGPLWDLAAFPIIDSQRAILTNYHDLFRQLDSIMTDYYVPENFDSHSPLISPLHQENFTMTPPTTIMVGEFDPFRPQAWAYAQRLAAADTATTFIQYQGLNHAFAPLVDQYWQSQDVAQVMAAALI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
publication title Esterase Lpest1 from Lactobacillus Plantarum: A Novel and Atypical Member of the Alpha Beta Hydrolase Superfamily of Enzymes
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 107
structure length 341
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c89A00
4BDTA 3IA2A 5E4YA 4FKBA 4H7EA 1E3QA 3WWEA 2AJBA 5ALWA 3KD2A 3C5VA 3H2HA 3MGAA 3ED1A 3KWFA 3CCBA 1CV2A 4UBIA 1XQWA 3AINA 1XZIA 1EDBA 1ZD4A 4BAUA 4S0XA 1YS1X 4BYMA 5KWJA 3KSRA 5A7HA 4B6GA 5CXUA 5BWCA 4B80A 5AKXA 4HRYA 2JEZA 5AIAA 4GEGA 4GW3A 4W63A 1JU3A 1GKLA 2ZJ7A 4Q3LA 1CR6A 4Q3KA 4DTCA 1ZIXA 3WK7A 1EX9A 2WJ3A 4MWTA 1ZGCA 3QMWA 1XZBA 1B41A 4IO0A 1QIIA 5ALMA 1VOTA 3H2GA 4FFVA 2HA0A 3SX4A 4MQMA 4DNPA 1TQHA 4BE4A 2G63A 4JNCA 4AMZA 1R88A 2VSQA 1DQZA 5A2GA 3H2JA 4QDUA 3WJ1A 1Z68A 4ZI5A 2JGJA 3MUNA 5LIPA 1BROA 1K6EA 1IUPA 4Q3OA 3IBTA 3WK9A 3FLEA 2VTVA 3C45A 2VAXA 3Q0TA 4LHEA 3JW8A 1N5RA 1D07A 4OPMA 4UHCA 1UK7A 1FJ2A 1QE3A 3V1MA 1IZ8A 2WQZA 2CMFA 3WL5A 4X71A 4Y2QA 4FWBA 1XZHA 2QXTA 3ESDA 2J3QA 4AN0A 2WM2A 2B20A 1RYYA 3DKKA 5DNUA 2O2HA 1L7QA 2PM8A 4TGLA 5AKGA 5JAOA 3GBSA 5KREA 3H18A 3IUNA 2DQZA 5ALRA 1XFDA 2WTMA 3ICVA 4X94A 4NVRA 4G4GA 2H7YA 5AI9A 4X6YA 3QH4A 1UXOA 5AKEA 5FOQA 4U2EA 4AMYA 2WHRA 1XQYA 4IH9A 3G9TA 4H7IA 4OSEA 4QDTA 2OGSA 2PSFA 1WHSA 1F6WA 4N5HX 3ZV7A 3AIOA 1EXWA 4W9RA 3QYJA 1LZLA 4B81A 5AH0A 1IUOA 4WCVA 3G7NA 4I3FA 5D3ZA 4OB8A 4BATA 2VF2A 3CN7A 3F96A 5AP9A 2R11A 5T4EA 3E4DA 4QWMA 2OCGA 3ICWA 3O4JA 4W1RA 5JADA 1XZJA 1X70A 4H7HA 1ZJ4A 1UOPA 1G66A 3NWOA 1YA8A 2Z8ZA 3BF8A 4DMFA 2ZJ6A 1YAHA 3V1NA 3GELA 3O9VA 3EF3A 4J03A 4AZ0A 2C4HA 3V48A 3R3XA 5FV4A 1W76A 2GBCA 3D2CA 1CUFA 1XRQA 1CUJA 5EI5A 1HDEA 4UBOA 5ALKA 4QEKA 4BC1A 5HF9A 1TCCA 2GBFA 4WFKA 1A8UA 2HA6A 3MUOA 3PFCA 6YASA 5C81A 1CUIA 5HKBA 2JGLA 4OYLA 1T4MA 2X76A 5JAUA 2XLBA 3BWXA 3GZJA 4OYYA 1JT2A 1R4ZA 3FLBA 5HK8A 4UBKA 3U1TA 4H77A 4PSCA 5SYMA 1E66A 4BVKA 2V9ZA 1BE0A 5CMLA 4I4CA 1U65A 2XMRA 1HKHA 2DCMA 4B85A 5FUMA 3G0IA 4DNOA 4F0JA 5HF5A 2PSHA 4MXDA 1MO2A 1BCSA 3ZWQA 1AKNA 1KU0A 2RI6A 5D3KA 5ALFA 5I9IA 5ALXA 2O7RA 3WYDA 1T2NA 3R3ZA 3I1YA 5ALLA 2O2GA 4J0CA 5LZ8A 3GROA 2XI4A 3AZPA 3KWJA 4NZZA 2RHWA 3HACA 2Z8XA 1EB8A 4GDMA 2OAGA 5CTAA 2HL6A 5LZ4A 1XZMA 4HTAA 1LZKA 2OLEA 1VXRA 4X90A 1ACJA 2W6CX 3A2NA 1JKMA 1SCKA 3C87A 4DSAA 2I03A 1P0QA 3D3NA 2QVBA 3KDAA 3WLAA 1R50A 5AM0A 1VXOA 1MX1A 5FPQA 1CUEA 4JYMA 1J2EA 4K6KA 5CURA 4O08A 2QRUA 4K2AA 2XQGA 5ALHA 2BFNA 3QPDA 4YX9A 5CT6A 2I78A 3FSGA 5AOBA 1CUVA 5HF6A 4C01A 5T4HA 1DINA 4MWSA 5AOCA 3EIOA 3RKSA 4Q34A 3HABA 3AFIA 4LYEA 1XROA 3NGMA 5K3FB 2WUGA 4J0GA 1QFMA 4FDMA 1XRMA 4PW0A 2VEOA 5DTJA 3I28A 2WHPB 1MNQA 4OUKX 5DYTA 3VISA 4F5ZA 2FUKA 5JAHA 1QZ3A 2E3JA 2I3DA 4M0EA 5FRDA 1BN7A 2GYWA 1XZKA 1YASA 3HLKA 5KBYA 3RARA 1WM1A 1S8OA 1UKBA 1EDDA 3ESAA 4X85A 4PNZA 5CRIA 1USWA 1VA4A 4BC0A 5HQ3B 5CT5A 5I7UA 2VJCA 4ZGBA 4EZIA 4X00A 4HXEB 4HZGA 1WB6A 3BIWA 4U2GA 1QIDA 1CUHA 3VJKA 2G4LA 1AUOA 4C4XA 1GT6A 3QM1A 1Q84A 1LGYA 1QO7A 4KR0A 2ZYRA 4UBMA 4U2DA 1XQXA 5ALOA 2XB6A 4XWGA 1HPLA 5T4FA 2PKYX 1MT3A 3I6YA 4FMPA 3RLIA 2QKYA 1VE7A 4G4JA 4V2IA 4BBZA 3BE8A 1KU6A 4C89A 1CFJA 1WPRA 2JGIA 4MJ3A 3WWCA 1CUXA 2XUKA 2D0DA 3H1BA 1N5MA 1QIJA 3N0TA 1CUSA 4G8DA 2Y2UA 2QOEA 4N5IX 1EDEA 3BXPA 2ZVDA 3W05A 1EHYA 4EHBA 4WY5A 1Y37A 4YK7A 2HU7A 1AZWA 3HSSA 3ILSA 3F8SA 1QGED 3F67A 3F9CA 2WUFA 3C6ZA 4WFJA 4HRXA 3R40A 4GBGA 2XMDA 3IVMA 3WL6A 3SC2A 4QDXA 4B0PA 4AB1A 4TVKA 2ZYIA 4AN1A 1HQDA 4BCBA 5AM5A 2J4FA 5AKLA 5CBKA 2ORYA 4KRYA 1I6WA 3C6YA 3WKCA 2B61A 3Q8WA 4FLEA 3DL7A 1VE6A 5E4JA 3BF7A 5EIHA 1LPMA 2DSNA 4BTLA 1MU0A 3L1IA 1XKTA 1ORVA 4CI9A 1XLWA 2PL5A 3WKDA 3WL7A 3H1AA 2Z5GA 1CVLA 2WU4A 3VVLA 1YAJA 3O9MA 4K5QA 1N8SA 1XRPA 5JIBA 5FKJA 5LKRA 4U2BA 1AQLA 1CQWA 4XIIA 1XZDA 4EY4A 5JD6A 1VKHA 4Q82A 1BCRA 3QZUA 4KE9A 1DWQA 1OCEA 2WG2A 4J0KA 1W4LA 4X92A 5ALEA 1LPBB 2ZYHA 3PICA 5ALUA 2VT6A 4DM7A 1ZD5A 5AK5A 3LS2A 3W9UA 3QBJA 1F8UA 5K3FA 2BJHA 1LPPA 2GZRA 5A62A 4CG3A 2QTBA 3QMVA 2VAVA 4CCYB 2HRRA 3PI6A 2HFKA 2XDWA 3G0GA 1E8MA 2WHPA 4PO3X 2WIKA 3WWOA 5BOVA 3DJYA 5DJ5A 3KOOA 4H35A 1TIBA 4Q1VA 1CEXA 4WDQA 2XLCA 3EQ8A 1A7UA 3O4GA 4FHZA 2OCKA 4QA9A 1EVEA 5JZBA 2C5FA 2QXUA 4ARBA 1CUYA 5YASA 5DNWA 2WILA 3K9BA 1MJ5A 4AXBA 2WKWA 4DIUA 1XZAA 5CW2A 1QIFA 4P92A 4IH1A 2GYUA 2XMZA 4GWLA 2UZ0A 2HA4A 4AO6A 3HXKA 5C8ZA 3OG9A 1ZI6A 5HQ3A 3X3HA 3KXPA 2VT7A 3RK4A 5AK6A 2PSJA 3C5WP 2WUDA 4BCCA 3R3YA 1DX6A 1LLFA 3GFFA 2H7CA 3W9BA 2Z3ZA 2OAEA 2ZSHA 4DSZA 3P2MA 5AI8A 4FLFA 1SFRA 2Q0XA 3R3UA 4E15A 1Y7HA 1FFCA 4QLAA 4Y2VA 1QJ4A 3DCNA 5ESRA 2JGMA 4A23A 3HI4A 1JI3A 5ALTA 1H2WA 1MPXA 1XZCA 1DX4A 1A88A 3IUMA 4DMHA 5EHZA 2ZSIA 2XQJA 2OGTA 2YASA 2QZPA 3DYVA 4UUQA 2CUTA 1THGA 3L1JA 2GBGA 2X8BA 3WI7A 1OILA 3G9XA 4OB6A 4HS9A 5ALGA 1P0MA 1BEEA 4X97A 1ZGBA 3R3VA 5EGNA 4HAIA 3PE6A 3H2IA 4W1QA 1FSSA 4G9GA 4MYDA 3SK0A 5LZ2A 2XQIA 1YB6A 3H04A 3QMMA 1BRTA 4IHAA 2DFPA 5IVKA 1NU8A 3DOHA 1G42A 5ALNA 2OQVA 4B84A 3TEJA 4DYHA 4XVCA 1TKRA 1HL7A 3G0DA 5A6VA 1QLWA 4QDOA 2ROQA 4QLOA 4WJLA 3DNMA 4HVTA 2RAUA 3V9AA 2OCLA 3ZI7A 4J0HA 1MAHA 3WIBA 4AQDA 3TGLA 1QO9A 2OG1A 4G9EA 4C6HA 5D7BA 2WJ4A 3W04A 4BZZA 3D7RA 5HK9A 4CFSA 3A2MA 2XUDA 3WK4A 1AURA 2FJ0A 3AZQA 2OQIA 5K3AA 2HIHA 3LCRA 4YASA 3B3QA 1XZLA 3FYUC 1CUBA 4ZV9A 2XUIA 4EY5A 5JD4A 4DMKA 1JJIA 4BAGA 1CRLA 1XZGA 3D59A 5T4BA 5A7FA 1C7IA 5AI5A 2XUQA 3FVTA 1PV1A 4W1PA 3G8YA 2O7VA 4ITVA 5ALJA 5JAPA 4K6HA 5LYYA 2LIPA 1RP1A 4OD0A 1K63A 1VJ5A 4X6XA 1ISPA 1WB5A 3FAKA 4P08A 3GUUA 1CUGA 3ZPXA 2WFLB 2Y6UA 3BIXA 5DYWA 3FYUB 3DEAA 4CCYA 3WK5A 1CQZA 3LIPA 2X5XA 5DYYA 2HRQA 5ALPA 4UBJA 1CLEA 1PJAA 4EA6A 4G8BA 4PSDA 3D2AA 3BL8A 4GI1A 3DOIA 5K3CA 3CCCA 4A16A 3BJRA 3E1GA 3QPCA 1BN6A 1Y7IA 3CXUA 4AZ3A 1E8DA 5LLSA 1LBTA 1ZD3A 3STYA 5AHXA 1DTEA 1CUWA 5DNVA 4L72A 5ALSA 3S2ZA 4B7ZA 2QUBA 4QZVA 3H0CA 4ZWNA 4QNNA 1N1MA 4FLMA 3WKAA 3B12A 2HA7A 1E8NA 2ZJFA 3AJAA 5FDFA 4BVLA 1XRLA 4BDSA 3FOBA 1UKAA 1AC5A 4HXFB 4H7KA 5IVIA 4I19A 2HU8A 4Y2JA 2BGRA 2PU7A 4E46A 1CUAA 4X7BA 2PUJA 4AX4A 2YYSA 2BUCA 5KWIA 4Y2UA 1TAHA 4UFPA 1W52X 3WWPA 4UBLA 3WZMA 2HADA 4J0DA 4Y9SA 5JZSA 1IMJA 3JWEA 4X3CA 1ODCA 5AM3A 1P0IA 5HCUA 2RIPA 5A7GA 1CPYA 4E11A 1E5TA 1ZI9A 3WL8A 3WYNA 4UHEA 3WZLA 5JANA 1UK8A 1H2YA 3GA7A 3PF9A 1ZJ5A 3D2BA 4PSUA 1KEZA 1L7AA 3T4UA 2XMBA 3FNBA 4ROTA 5AKHA 3DD5A 2XMCA 4OU5A 1AMNA 2EDAA 4G8CA 3HJUA 2NW6A 1ODSA 1UZAA 2IIVA 7YASA 4IQ4A 2GYVA 5LZ5A 2WIFA 4B0OA 4EBBA 4MYSA 2B9VA 1EK2A 4F60A 3IUQA 2HA2A 1U2EA 4KRXA 5AM4A 3STXA 3HEAA 1VZ2A 4N8SA 3D5EA 3V1KA 4PF1A 3MVEA 4X95A 5HF8A 4IH4A 4LXGA 4PV7A 1H2ZA 2XUAA 5AKYA 1XZFA 5K5EA 3DKRA 4KAFA 2G5PA 2XT0A 4MQLA 2PSDA 2YH2A 3R3WA 1QFSA 4WDRA 4FBLA 4H7DA 2WSLA 2V96A 3OM8A 4Y2RA 4BAZA 3IURA 2OGZA 2PU5A 3I1IA 1YCDA 2HM7A 2H1IA 2DQYA 4D9JA 1SCQA 1FFDA 4LIPD 2Y6VA 4ARAA 3I2IA 4WFIA 4JUIA 4Y2TA 2H7XA 3BJMA 5JZ9A 3CN9A 4H7FA 4L3WA 4BZWA 4Y2YA 3WKEA 3VKFA 1CIJA 1XLUA 1AGYA 4JEIA 4KACA 5AOAA 1WHTA 2WLSA 2CBGA 4DNQA 3FYUA 2OPHA 4B9EA 2AJCA 5C8XA 5AK3A 4KE8A 2I3ZA 4C87A 3OOSA 5CT9A 1UT6A 3A6ZA 4JH0A 3DS8A 5CH8A 2PVSA 4LXHA 1XLVA 4MEAA 3BDVA 3K6KA 3WWDA 2WFMA 2RGUA 2PX6A 3VDXA 5JALA 5FXMA 1QIHA 2XUGA 4RE5A 2HDWA 4CIBA 3DLTA 5H3HA 5IKXA 1Q0ZA 2DHCA 5AI4A 3WKBA 4ETWA 4DGQA 3IDAA 2WU3A 2PSEA 5EIEA 3ESCA 4P9NA 3FYTA 4HXGA 4U2CA 2P8SA 3FWHA 1BU8A 1TK3A 4C4ZA 4ZXFA 1IVYA 1VA5A 3G9UA 4TPKA 1GQSA 1H2XA 4KEAA 2IITA 3M82A 1B6GA 3AIKA 1TCBA 1GXSA 4EY8A 4UHBA 5C7YA 3AUKA 3G0BA 4X6UA 3W2TA 3F98A 4C88A 1EK1A 3IIIA 2EEPA 1J06A 4H0CA 3QPAA 1UKCA 1J07A 5AIBA 1CUZA 2CB9A 1MN6A 3NOXA 3SWWA 2C7BA 3EBLA 3I2FA 2Z3WA 3E0XA 4PQEA 5AI0A 4DLNA 1EH5A 5DWDA 2WTNA 4N8DA 3WQHA 3OPMA 4C4YA 2DHEA 3ZLTA 5FPPA 2HA5A 2Y1KA 1DWOA 2RHTA 1F0NA 1XRNA 2G5TA 2DR0A 1EVQA 3QVMA 1A8SA 4EB0A 4UPDA 1WOMA 3B5EA 2C0QA 5K3EA 1FFBA 4CG1A 1CUDA 3FCYA 2V97A 5AO9A 4G4IA 3H19A 2K2QB 1LPAB 1UK9A 2ZYSA 5IH7A 4BRZA 3ANTA 2CZQA 5AK4A 2FX5A 1BS9A 4BE9A 3HRHA 1GPKA 1GGVA 2FJPA 4Y2SA 5A71A 5CH5A 4NMWA 4EUSA 3WJ2A 3A2LA 1XKLA 5BWBA 5D6OA 5EHNA 1LPSA 3WA6A 1X2EA 2H9YA 2PUHA 1L7RA 1X2BA 1F0PA 1Q83A 1GQRA 3D4LA 1MX9A 5JD5A 5LKAA 3IUJA 4F21A 4ZRDA 4J0IA 2JF0A 2BAGA 2PBLA 5JYCA 4ZREA 4WY8A 4ZV7A 4J7AA 3FSGD 3C6XA 5FLKA 1LNSA 2IX9A 1JMKC 3M3DA 4QDZA 2C0PA 2VA9A 1P0PA 2BGNA 1W6RA 1IUNA 1VLQA 1HBJA 2W22A 5LZ7A 4N8EA 1MX5A 4E14A 2EDCA 1ETHA 1TCAA 2VQ6A 3WA7A 2XUHA 4KE6A 5ALVA 1DQYA 1G5FA 4UFOA 3PUHA 1MTZA 2VJAA 4UHDA 3UUEA 5ALIA 1W1IA 3C8DA 3UUFA 4W1SA 1DU4A 1SCIA 3DL4A 3UMJA 1LPNA 3ESBA 5AKZA 2BUAA 5HZGA 1R1DA 5EFZA 4CG2A 1ORWA 2CJPA 4KYVA 3WMRA 2R8BA 3YASA 4K6GA 2JBWA 4B83A 1LPOA 2HU5A 2XQFA 5I8PA 2WFZA 2HHAA 1W75A 2CEKA 3O95A 5J3JA 1ZI8A 1UFOA 5ALDA 3OURA 1RWQA 4RPCA 4BB0A 4INZA 3VJMA 2BCEA 4X93A 4UHFA 2VJBA 4UBNA 2XUFA 2PPLA 4FBMA 3D0KA 4BTVA 5K3DA 2YXPX 3C6BA 5AKIA 1QIMA 2JEYA 4EY6A 2ACEA 1OXMA 4AO7A 3DQZA 3LIIA 4QE3A 4QWWA 1R3DA 1QIKA 3ZLUA 1EI9A 4OU4A 4DNFA 3H17A 3M81A 2CKMA 5CT8A 3NUZA 2C5GA 2ACKA 3EQ9A 5C8VA 5IVHA 1YA4A 5E2IA 1A8QA 4JYPA 1AX9A 2QR5A 1XZEA 1ZOIA 2XE4A 1CUCA 3R0VA 2QMQA 2V98A 3O4IA 5CT4A 3V1LA 4P93A 4AO8A 1MNAA 4GLBA 1O6FA 5E4TA 1WCYA 1BEZA 1K4YA 3OC0A 3G0CA 1R9MA 4BRSA 1GPNA 1YB7A 4RE6A 5LP1A 3L1HA 4KJXA 4A5SA 4B9AA 1U4NA 3F97A 5AI6A 3FCXA 3PUIA 1MAAA 1UK6A 4G5XA 1ZD2P 4BP8A 3DYIA 2WG1A 3T52A 1IZ7A 1QONA 5AM2A 2HA3A 4CIAA 3BDIA 2D5LA 2XUJA 2JGFA 2WG0A 1JJBA 3OTQA 5CXXA 4GXNA 5BV7A 1H23A 2AJDA 3I2GA 3HZOA 1HLGA 5JATA 1CUUA 5CH3A 3I2JA 3O4HA 2OXEA 3G02A 4BCDA 1THTA 4Y2XA 1R9NA 4KAAA 3C70A 4CCWA 4M0MA 2OCIA 4DMCA 2RONA 1K8QA 4J3JA 4FOLA 4LKOA 4MEBA 4YPVA 1UOOA 4J0JA 1ZICA 2WIJA 2QT9A 2BUBA 1Q0RA 2ECFA 3C43A 3HYSA 3WIOA 3I6ZA 1DWPA 2XMGA 4LYDA 4KAJA 3IB3A 3WK8A 1XQVA 1FFAA 2HFJA 4RGYA 2Y2VA 1JJFA 3LLCA 2WJ6A 5K3BA 2GBIA 1U8EA 1WPXA 1C4XA 2QM0A 2XMSA 4XJVA 4Y2PA 2JGKA 2GZSA 5HFNA 3ZLVA 4GHWA 3M83A 5ALZA 1UWCA 3STVA 2WHQA 5AM1A 1LBSA 4H18A 5SYNA 1EINA 1M33A 3C8HA 3DDUA 5DLPA 2QUAA 2QS9A 4Q05A 5HFAA 3QITA 4KE7A 1TRHA 1GZ7A 1C7JA 2AXEA 3STUA 1JFRA 1UOQA 4B82A 3W06A 2ES4A 3K2IA 3FVRA 1K5PA 2C58A 4X91A 1DT5A 2WUEA 2XUOA 3AILA 3AZOA 3FLAA 5JARA 4L0CA 1EA5A 3S8YA 3JYHA 4UFNA 1YS2X 1DT3A 4XX1A 5AJHA 1VZ3A 3EQ7A 1O6GA 3U0VA 3LP5A 1NX9A 2WIDA 3E3AA 3HC7A 1G4HA 2ONCA 3TRDA 3G9ZA 3N2ZB 2WFLA 2XQKA 3AIMA 5ALYA 5ISMA 4GECA 1QTIA 3VJLA 3STTA 3VVMA 1QIGA 1QTRA 4L9AA 2XUPA 2QJRA 2XMQA 3IULA 1FFEA 4EY7A 2BKLA 5FP0A 3TJMA 4BP9A 3PFBA 2VATA 5EHXA 1ACLA 1YR2A 5AKJA 1JMYA 2DHDA 2AJLI 2J4CA 4M0FA 2VJDA 2QJWA 5JASA 3I6MA 1JU4A 1H22A 1J1IA 3FBWA 5HKAA 1QIEA 2JGEA 2WIGA 3O0DA 3PF8A 2O2IA 3PDCA 4H7JA 5AICA 1XRRA 4Z49A 1NU6A 1WB4A 1EB9A 5IVDA 1PFQA 4RNCA 4Y7DA 3VXKA 2JIDA 1SOMA 3R41A 3ANSA 4FTWA 4LXIA 3A70A 1SC9A 3STWA 1E89A 4FNGA 5AKKA 4OB7A 5DTIA 5F4ZA 4UHHA 3WK6A 1ZIYA 1QOZA 4FFWA 1GKKA 4G1FA 1GPLA 5EHQA 3I2HA 3RM3A 4BVJA 2AJ8A 2B4KA 4FNMA 4OCZA 2J3DA 4U2FA 5ALQA 5EIAA 5LZ9A 4NS4A 1ODTC 1YSCA 3H2KA 3I2KA
chains in the Genus database with same CATH superfamily
1HA3A 4EJMA 5L7WA 1WBJB 3IA2A 5EZYB 1JAYA 1DQRA 4H7EA 4US1R 3DUFB 4QSMA 3RFUA 4IFEA 4CTNA 2OCBA 5BSHA 1YE3A 3BJZA 5C8YA 4C3ZA 1BOOA 2CV2A 3HHEA 4BO9A 5E3HA 1SQ5A 4IDQA 5F23A 2Q5CA 1FRNA 5DBOA 3TSYA 1G0NA 1QNFA 2F43A 2E4WA 3FNFA 1XZIA 4HPJB 2AFHE 3KYCB 4BFTA 3ZS8A 3FNRA 4O6VA 1GCUA 3ZOZA 3LBFA 2UUPA 1NR7A 3IXQA 2FW0A 4TV9F 1YS1X 1I4WA 2R8OA 4ZOCA 3IT1A 4YMGA 5HQTA 1C9DB 1Z83A 1G1MA 2AMVA 1KVTA 2OB2A 1Y8RB 4GPEA 4OUDA 4Q9HA 2QVGA 4WN3A 3UHAA 1E3WB 2OWEA 2VLIA 5GJCA 3SIWA 4Q1EA 4ZCTA 1P4JA 5LZ9A 2BFCB 3CR8A 1NQVA 1Q74A 4JL5A 3HE3A 4HEJA 4HRYA 4MVJD 1JHRA 4LZJA 1T2EA 1LW6E 4PLFA 2J0SA 5KHAA 5TEVA 3E0QA 2Q2QA 1CNMA 4R9SA 1T13A 4A5OA 1IY8A 3E8SA 1OYWA 1QO0D 1E2PA 1FFWA 3NKFA 4W8HA 1JQAA 3RPEA 2Q6VA 3CO0S 1Q1ZA 1WZCA 2ZJ7A 2Z0MA 3UAXA 2PH3A 3JVVA 3RVDA 2PGIA 1I7LA 2YZNA 4JP1A 4OHXA 3GLIA 3AVXA 1HRDA 4MUGA 9LDBA 1Y4SA 4DNXA 1EX9A 3EJWA 2YJTD 3OO1A 3IAXA 2RAPA 3E18A 5CLQA 4ZEXA 3EWSA 3L0DA 4W4TA 3AVUA 2C8VA 3D6VA 4IEIA 1NW5A 2PLFA 3N0WA 5HGJA 5ALMA 4Q4CA 2HA0A 3BH6A 3K1YA 4TWIA 4C5AA 1QG6A 4D79A 4WVLA 1M1NA 3LT0A 3EPPA 1L5RA 4GGMX 2NTVA 3SXJA 3BXHA 4FM9A 5J4KA 4RENA 1JAZA 4AICA 1DMRA 3HKBA 5KYYA 3ENKA 4BBAA 5K09A 4NJEB 5L3SA 4ER7A 5EIWA 3WJ1A 2GEFA 2NV6A 2PFGA 2ZROA 1QCZA 2IKQA 4ZI5A 2YMLA 3CUEF 1YR9A 3VDNB 1IK6A 3WLJA 1RFLA 1KI6B 1GUZA 3QWHA 4MV3A 1ZGJA 3TE6A 1QHXA 2JGJA 3T8YA 4BL5A 4G41A 4AZWA 4NE2A 1E61A 2FLWA 4E30A 3T1VA 2CEAA 1SU8A 1D2MA 2VYVA 4M60A 3B9BA 4IUYA 4ZT3A 1K6EA 1T9CA 3ZDRA 2KBEA 1OXSC 2C8LA 1GZSA 1MOZA 1GZHB 4QPCA 4F45A 5B3JC 3K0SA 1XTKA 2PX3A 4LRXA 1WBBA 1A7JA 1DJLA 1JH8A 1V6CA 3CLUC 1P4RA 3Q0TA 4RD2A 5FOXA 3CXRA 3S3TA 4W5OA 2DBQA 3T5CA 1INLA 2C4KA 2H16A 1B1CA 3WHPA 1N5RA 1D07A 3DDZX 3QVXA 5BV0A 1C7RA 4OPMA 4ZV4A 2EKLA 1YF3A 1C3LA 1EVKA 1UK7A 1FJ2A 3X2SA 3V1MA 3SHTA 1A9XA 1IZ8A 1NP7A 3RW9A 1WBDA 3JWPA 3RREA 1PSDA 3ZWXA 3MTDA 2B6HA 5EA2A 3TF5A 1FNSA 2VIIA 1HEUA 1DE0A 1NJSA 2FJUA 2NTEA 3C7DB 3KD3A 4DUPA 3ESDA 2J3QA 4AUKA 1PJCA 2AG6A 1E1CB 1EQUA 4XGKA 2Q6LA 4GLOA 4W5NA 3N2IA 1YMUA 3O1JC 1QHYA 4XTCS 2B20A 2ZXFA 3LWBA 4FXOA 1G6KA 1U8ZA 4EJ0A 5IEBA 4ZYUA 4UZFA 3DXZA 1K8RA 2I6FA 3QW2A 4EUEA 3A0RB 1LF0A 2G9QA 3BHIA 3D4NA 3EFEA 3NV7A 3QUBA 4FJ0A 2Q8NA 4DLVA 1RRFA 4M7OA 3MT8A 4OAOA 2XEXA 2F8TA 1STOA 1TJYA 3NHRA 4HDSA 4JJEA 5AKGA 4QFMA 5CG2A 4RXTA 4HDKB 3CVVA 3J81k 1W0KA 5KREA 1SGWA 3SZOA 2HWKA 3KT8A 4E7OA 4ND8A 3SSAA 5ALRA 1PWZA 3L4BC 4HUQA 1LA2A 1K5GA 2CKDA 4MCAA 3H9CA 1UBRS 4JGBA 4MR8B 4MWOA 2H7YA 5AI9A 4BPRA 3BD9A 3OTIA 5ENVA 2PD3A 1FX1A 3T9EA 1HWYA 1QX4A 4YO8A 3AUSA 4R01A 3TMAA 1R64A 4DHEA 5CA1F 1A95A 3WDKA 1S1CA 2WHRA 2HTEA 3Q2KA 4NG4A 2DT8A 3BTSA 5LVAA 4DCUA 3Q40A 4OSEA 4UXHA 1OFGA 4UJ5A 2FKAA 4HQ0A 5CNMA 4NPHA 2ZKIA 3OX1A 1RYBA 3WAKA 1Q22A 3DGFC 4PLWA 1NE7A 2YV4A 5BSTA 5C31A 2HSWA 4XPZA 2YNMA 4DSTA 4Z4QA 2NUAA 1KIFA 1S2GA 1NRIA 3ZTTA 4F2GA 4YAJA 4LSWA 3ZY6A 5TXGA 4B81A 1D2GA 3NTXA 4AG6A 2PXHA 5GV8A 4KTTE 2ZTLA 3EAQA 3EUWA 2YUTA 5TQ2A 5GM1A 3F7TA 4HQOA 4BP1A 4BJ1A 4UTVA 1ZS9A 3IODA 2PKRA 5HE9A 4BATA 3I34X 5JFTA 1IRIA 4OM7A 4R1PA 1BVRA 3RVLA 3NTRA 2VHJA 2B7CA 3ACCA 3R23A 4K86A 3ZBQA 1V48A 3HJHA 2GUWA 1PZHA 2FPIA 4Q9AA 2HJSA 3C6QA 3DWGA 4WBSA 3L7MA 3ZY5A 1DAGA 2VO1A 1QJCA 5T4EA 1NNLA 3KZKA 1UM9A 4QWMA 5BSGA 1NMXA 1Z4IA 3QQPA 1YVUA 2H4ZA 3IERA 3TVDA 5JADA 1SRQA 1IPFA 2WKRA 3FPLA 2ZWOA 1T10A 2AW5A 3E3NA 4NK4A 1CRPA 1G8JA 2VTBA 5EMKA 1X70A 4IDPA 3VR0A 1ZJ4A 3GRCA 4DJFC 4RLQA 3L0CA 2BMJA 5HIMA 3X1YA 4EHIA 1UQTA 3ZI0A 1KJIA 2ZJ6A 5JR3A 2ZRIA 3SC4A 2G1UA 3V1NA 2HX1A 4D9KA 3T6KA 1JA1A 2EFHB 4FZVA 5G53C 1VLHA 2V9PA 3WL4A 2REQA 4CLRB 4HWOA 2AT1A 3V48A 5FV4A 1T36A 2ZE7A 5BQOA 3D2CA 3IQEA 2LCQA 4PCAA 5J5VA 1QQBA 4EA8A 3V8BA 1Y7LA 4QASA 3F78A 3ZH9B 1XNHA 4Z6KA 1PT8A 1CUFA 3EK2A 3ZCRA 1M73E 1XRQA 1R9JA 3GJ5A 4M8SA 1U0JA 1LI5A 3FSJX 2OK7A 2QTHA 1U5CA 3G8CA 2LIVA 4BX0A 5JMOA 1DSSG 3FTCA 2VRWA 2FVXA 3WNZA 4KJZA 1LDYA 3GP8A 2ZAIA 3CVOA 3NHYA 4BC1A 3B38A 2EATA 3FUXA 4KV9A 4CBVA 4F5WA 1OFUX 1QGAA 3GFPA 5JS8A 2UZIR 3PT5A 4KO8A 5F5XA 4F2WA 2R97A 4N0MA 4M8LA 5KNCD 3ETLA 2C3YA 3CEPB 5DGCA 1R16A 2HYDA 3DMTA 4MRVA 3MUOA 4I55F 3ZDQA 5IYZB 1V3QE 1YIAA 4DLBA 3C6MA 1A04A 4I7EA 2C95A 4QGGA 1VB3A 4ENQA 4MVJA 1XGKA 1FLVA 1QF7A 3IOCA 4XIYA 1IFXA 2BMAA 2V65A 1JKJB 3SHOA 3FRJA 1JILA 3BMOA 3FF4A 1UAYA 3HCWA 3INYA 5JXJA 2OP0A 3K6SB 1QO0A 2YWEA 5TPZD 5FADA 3KU4A 2D2FA 3RHZA 1GGNA 1XSEA 3UQYS 2VDKB 1RAFA 2AOWA 1LBIA 1R6DA 1ISJA 2R5FA 3NEAA 3PP8A 1JT2A 4Q6BA 3AQ4A 1RAEA 3M6WA 3TKLA 1WETA 3FLBA 2VI5A 2Z2YA 2WVJA 3C3WA 3IRVA 3PC8A 4PSCA 5I9BA 3R7DA 4GZ6A 4ZYTA 3H97A 1RRMA 3FKJA 2X3UA 3PE3A 4CT0A 1E66A 4BVKA 2ZB2A 2QMEA 2XWPA 1WP9A 4IV5A 1L7EA 3ROMA 2Z8YA 2EZ4A 3ZVNA 4L15A 5DISB 2PBRA 5FOSA 3GJ8A 2EFDB 3OPYA 2DCMA 1R7RA 4FVTA 4I5DA 2PEYA 5C4IA 3SY8A 4IIJF 4A26A 1B6TA 3G0IA 4MULA 1A9OA 2E0IA 3K5PA 1MOPA 3D8HA 2H8GA 3W3AD 3PEWA 3WNQA 2ZULA 2JKYA 5E1DA 4JT8A 2WMNB 2JHPA 4MTLA 1Q1EA 1R8YA 3DXFA 3UA4A 1SD1A 3EVAA 2DPYA 2LP4Y 3UJAA 1KO7A 2A57A 2JJ2D 3DEKA 4GQIA 2D1SA 5DM4A 3S68A 4E21A 5E9JA 5IFLA 1SPXA 3RYFB 3KQVA 1KU0A 4HNAA 5ADWA 1KR2A 2O4CA 5DSXA 4P2GA 3IVAA 1V26A 2Q9BA 3LECA 3TLGB 3HYCA 3JQFC 3OIUA 3UKDA 5BN4A 2PAAA 1TUBB 4HC4A 4YCLA 4CEIA 4I66A 4YCJA 1V6AA 1IZ0A 2RHWA 4PTZA 3VH3A 3HACA 3OOWA 4TRNA 2BELA 4DV1B 1IEWA 4X3PA 4UDXX 5CTAA 4HVLA 1PEAA 1PYOA 1TGYA 4Z9AA 1X3SA 2BZSA 3TGWA 1G8KA 3TPZA 2IUEA 4OXNA 2NQ8A 1OIWA 5KYGA 4YXFA 1G5IA 2G71A 4BFYA 2ZEJA 3BX1A 1PJ8A 4PC1A 2PGOA 4MW4A 5HP4A 4BVFA 1ACJA 2GM3A 4YYEA 4AMUA 2GCOA 1FQKA 3B13B 3MJFA 4I6JA 4FCWA 4OXRA 5EYPA 5J23A 3LT2A 1IY1A 2NG1A 4PHGA 3KOWA 1HNXB 3BH7A 3KDAA 5TGZA 1Y1LA 2AEJA 1BCRB 1PJTA 1U81A 3OX4A 5TS2A 4G67A 4O2BF 2P2SA 2R00C 2R96A 2QGNA 3LVBA 4JB2A 4CMJA 4NIMA 1MTOA 1CUEA 3VRHA 4B73A 2CFTA 3NBKA 2HV8A 1J2EA 2ZDHA 2ZWVA 3VMMA 2IW1A 4TTRA 1CZLA 2JAUA 1XUOA 3T34A 4K2AA 5KINB 2ZJ2A 4QJ4A 1LSUA 2IUYA 2QRQA 3RHFA 5CT6A 1K7XB 1W46A 3LKVA 4OLHA 3ZZ0A 3FSGA 1O77A 1IMOA 1L7MA 1MQ8B 2QU8A 3OCZA 2F1RA 4IP0A 4INAA 5ITVA 2DTEA 3GDGA 2ZIXB 1AQJA 2G7ZA 3TZQA 4V24A 2INGX 2XQVA 1E2BA 1U2PA 1PFWA 1A82A 1UBNA 3ZD9A 4F86A 1B0UA 3IO5A 2CDCA 4Q34A 3VTKA 4OF4A 3Q85A 5J4YA 3ZDXB 5K3FB 1Y1KE 1SPBS 1E0DA 1EX1A 5JXHA 3CF0A 2E5LB 4IIVA 2XCOA 4FDMA 2VEOA 5JCXA 5JDCC 1DIGA 4L22A 5GOZA 1HNWB 3I28A 1LF5A 1OLUB 2WHPB 3RSZA 3GGSA 3OTHA 5BP7A 3DBLA 5CDYA 1O95A 1MNQA 5JROA 4GRDA 1U2TA 1V1MA 2ZB4A 3EWAA 2VDNB 3SAJA 2EP8A 5JPDA 4OUKX 1I4EB 1YB5A 3D6TB 3O47A 1SXJE 1WD5A 4RIEA 1VBMA 1Q17A 3AR4A 5JAHA 4IZHA 1QZ3A 2C9MA 4JQOA 2QRJA 2P8JA 4JLBA 3SKVA 1VPWA 4D43A 3AL3A 4I8IA 2HK8A 4QJIA 1JLRA 3RU9A 5LUAA 2ORED 4QC2A 3A26A 5BNWA 3JQRA 4JKIA 1BN7A 4JXKA 4I14A 4RSHA 3C1UA 1JEQB 4ZVTA 1U3DA 1XZKA 1YASA 4MKRA 1UJCA 3TFOA 3KSDO 1N78A 4UPVA 4D9IA 3TQHA 3PD1A 3GFTA 3FUUA 3SJ7A 1F5NA 1T25A 1UKBA 2VZ8A 1X92A 3ZXIA 5JJBA 4GAEA 4FQ7A 3EA0A 2C07A 4MVJM 2AOTB 5FO0A 4X85A 5D1NA 2Q0QA 4PNZA 5CRIA 1I33A 1ZD8A 2H2FA 3S8EA 4AF8A 3ZV4A 3I8SA 5E0OA 4N4AA 3R7NA 2VJCA 1G8FA 3I52A 4M0DA 3RQIA 4EFDA 4ZGBA 5I7UA 4F38A 5IF9A 1T0JB 2PKEA 2K2WA 4X00A 1UDBA 4YGYA 1IBLB 2Y0CA 5GZ6A 2X2OA 2Y0BA 1DAKA 1G8MA 3IEKA 1Z0IA 3IDSA 2ARKA 2DFDA 1QIDA 2OGWA 2VJYA 1NYRA 2NVBA 3NHAA 3VJKA 5JISA 2YWXA 3TL6A 3ZWMA 1Q7RA 2RHHA 4O1MA 2VXOA 4ICIA 1W4AA 4FD3A 2HK6A 3I9FA 4M4SA 2Z8YM 1NGSA 4C4XA 2PDAA 4UASA 2ZUFA 4IV0A 5DASA 1GV0A 3BBPA 4XDGA 1BOFA 1LGYA 5SYAA 3O84A 4RTNA 4PPGA 2M32A 2AMYA 4PNPA 5TQ0B 1GZ4A 1VP9A 1T35A 1WQ1R 2QU7A 4U2DA 4BN0A 1WABA 2RFLA 4S12A 3SQXA 1V16A 5IT9A 1MENA 4DG9A 3WGIA 4O8ZA 3HDVA 1P4HA 2VQ3A 4D26A 2BFWA 1J21A 2I4OA 4K03A 4BNXA 3JQBC 3RLIA 4OVKA 2QKYA 4Q5IA 4AMBA 4C0SA 4G4JA 1NYTA 2QSJA 4A2WA 4MP3A 4UM9B 1ZMXA 3N74A 3BE8A 3UAGA 1ECLA 3CG0A 1YJ5A 1OLSA 3USES 1CFJA 1T4CB 4HD8A 4RESA 3RTDA 2DUJA 4X1KA 5KNCA 1CUXA 1NM5C 1KAEA 2EQ5A 3E53A 2I4IA 2OV2A 4G0YA 4DARA 1CUSA 4RF3A 2H85A 3N76A 2OOSA 3CF4G 3LD9A 3NUQA 4EFMA 3KJIA 5FBKA 1NUPA 2QOEA 3I12A 1E79D 1EDEA 4N5IX 4RSMA 1B8OA 2FSFA 3WWZA 4ZI7B 5M3BA 4BGVA 4EDHA 1KXZA 2OHXA 1C30B 4L0MA 5TPZA 1EUCA 2IXGA 1R3UA 1U9ZA 4ERNA 1KVSA 3W05A 3QIVA 4R2KA 4OHWA 2R4TA 4YK7A 1TL7C 3GF4A 5T5QA 1M66A 2HU7A 4REQB 5CA0B 4ZXPA 4YJ2B 1RCTE 2RC6A 1MF7A 1H5QA 4I46A 5BVGB 4HSGA 1AMOA 5FL7D 2D3WA 3LNCA 2VBIA 3TZBA 4B3RB 4DV7B 3I0ZA 1HNZB 3F9CA 1E5LA 3WRVA 2HIAA 2WUFA 1N0WA 4E5KA 2NVUB 5KVCA 1MIOA 4QHSA 4KMOA 3TTXA 3W5JA 3WQRA 2NO0A 4WFJA 3GPLA 4Z3DA 1L5FA 3DEYX 3SZMA 3ZVMA 3I01A 2HMTA 3MWGA 3MMNA 1KORA 2Z3VA 3AOEC 4Z86A 4BNDA 4LBZA 4YFVA 5HRCA 1X15A 5NULA 2XMDA 3IVMA 1LXCA 7MDHA 2EJVA 3SZGA 4ZP1A 2NU7B 3PGXA 1H2BA 2BD0A 4AN1A 4BCBA 4C1BA 2HXSA 1Y0BA 2I22A 5I51A 2J4FA 1TX4B 2MSKA 3ANYB 4AYXA 4BXOA 1KJQA 4WLNA 1YXMA 3CEMA 3WV4A 2CSXA 3F6EX 2EW8A 2V7TA 4WSOA 5FBQB 4Q47A 5BO5A 4L8VA 3C6YA 4J2OA 5FBLB 5GONB 5TJHA 3CTPA 3WKCA 2VK4A 4X8HA 4NBVA 4F11A 4FLEA 1TFUA 4LJKA 3RJ9A 4FYXA 3Q9NA 3B60A 2OC4A 3PEYA 3KCNA 4CKCB 4U7FA 1VE6A 3OJWA 1PL6A 2JLBA 2VWGA 1VIDA 3NOVA 5AVTA 1JF8A 4KXUA 2VUUA 4KYIB 3WGLA 1CP2A 4H3VA 3FZNA 3T5MA 4CEHA 4OIMA 3HXTA 3P9RA 4HFNA 4CMEA 5KYKA 4FSDA 5KYVA 3LHKA 1X87A 1VRVA 4UEOA 1H0SA 3UBMA 1E60A 3DZHA 4UNRA 1KJYA 4FHCA 2Z08A 4GX2A 3DV0A 5IN4A 4CI9A 3O90A 1XLWA 5HOEA 1VHWA 2J67A 3OSZA 4M55A 1V8OA 5K8JB 5KVVA 1PD0A 1K89A 1UFKA 3IFSA 1ECJA 2VPZA 3FDZB 2FSPA 3B82A 1YAJA 1H42A 3EFOB 1J20A 3GLHE 3LT1A 4XIJA 1H6AA 3VHRA 4A0RA 1ULHA 3HZRA 1M8JA 1N8SA 4JB8A 4JZYA 3WLKX 2FMXA 1EHIA 5LKRA 1KC1A 2JKVA 2ZUVA 3AWDA 4TT8A 4S35A 1E9AA 3COSA 1CQIA 1HE4A 1OROA 3PRKE 2XYHA 2I7XA 4MCIA 5JD6A 2O8FB 3URKA 3A1SA 4Q82A 1W19A 1VL8A 3F5DA 3RAPR 3W79A 1SOVA 4NQZA 3MGBA 1F4PA 1F6DA 3QZUA 5J2UB 1WSBA 1ZW1A 4UAGA 2HK9A 3D6HA 1WKBA 4JLUA 3T3OA 3E5HA 1XVTA 3G9QA 4RKWA 2OBBA 1CDOA 2E89A 4IFIA 4PGAA 2ZJ4A 5K9ZA 1XDDA 1N2BA 2QTWB 3LA8A 1P1FA 1EVIA 4BP3A 4C78A 1T6NA 1YQEA 1Q20A 1LPBB 1QE5A 4MQ5A 3W5DA 2C03A 3PICA 2CB0A 1M5RA 2PZLA 5E6SA 2M1ZA 4CT5A 4BO2A 3ZYCA 4TRJA 4PPYA 4LV5B 4YP9A 3H6KA 1W5BA 1E0JA 3CNEA 2MT9A 2Z56A 2VXBA 1K7CA 3EVFA 4UUAA 1ZD5A 4PHFA 5FUBA 5L3QA 4ALIA 4HGNA 1XALA 3QBJA 2C2BA 4UTPA 1PX0A 3RDPA 3RSFA 3L4SO 3NM5A 1UT8A 2OLKA 2OHVA 1MD9A 3EJ6A 1GG2A 1D1TA 2XJ4A 2E1PA 2ZSUA 2JD0A 2BL4A 3L7YA 5A62A 2RGWA 1O96B 2VHEA 4CLDA 2XOEA 2VAVA 2GLXA 3EH1A 4C6TB 1T0IA 3TNDA 1G55A 1Y80A 2GZAA 2HFKA 4PLGA 1YVRA 3TYXA 3EC1A 3S44A 4GYYA 5DLEA 1H4SA 1DQPA 3HU3A 1I6LA 1LTQA 1UIMA 3EXG2 4IIJA 3O3CA 1DKPA 4WZBB 5AWFC 1P1IA 3DJYA 1P73A 1WB9A 3B2EA 1JG7A 1TZCA 1NF8A 2FLKA 2I6QA 2PD4A 3RBZA 1EA7A 4FGWA 4D8XA 3QLUC 4KQ6A 4NS1A 1QRUA 1ZBDA 3L82B 4FP9A 1TYDE 4NSNA 2QGFA 4TKLA 4WDQA 5DNAA 3EQ8A 5F1YA 3U4QA 1PK8A 1LTHR 2HCRA 1I7NA 4FHZA 4KPUA 4KUHA 1Y8QA 3OMLA 5F76A 2C5FA 1MKYA 4MUHA 3ULKA 4L08A 4PCVA 3VKWA 4I4TB 2J3KA 4QQRA 5FI3A 1SKMA 3VKGA 2I8LA 3P19A 4NCIA 3M0EA 5SICE 2X8JA 1L4GA 2VH2A 3K9BA 4NEHB 4AXBA 5KMGA 4K9DA 3NHPA 3KQLA 2NX2A 2R48A 2WKWA 3MWFA 4A7PA 1Z6GA 1QIFA 3K5WA 1QWOA 2XMZA 3Q98A 2GM4A 1JX6A 2C5LA 2UZ0A 2HA4A 3NTLA 1LBHA 2CUKA 2H9IA 3GEGA 5GV7A 1R5NA 5AHOA 4JIGA 1BD4A 4AQYB 5GVRA 1VYVA 4KX3A 4M86A 5KQSA 3DFUA 2VUSA 1NF2A 2WABA 3CRZA 2WSIA 3N7TA 3PYXA 1XX6A 4G0MA 4MX8A 3PD0A 4EPRA 4FGZA 3Q6IA 3SDZA 1S7GA 3OFND 3H65A 3P9IA 2P27A 1ZH2A 3I6IA 3GLVA 3TD2A 2PSJA 3H4VA 2WB2A 3QVOA 4GX1A 1D4AA 2WUDA 2GDJA 5D7NA 2MHCA 3HJBA 4FYHA 1KETA 2DX7A 2GCNA 2CDAA 2MYNA 2I55A 4QPNA 3UXEA 2VRNA 3MNFA 4BCCA 4Z53A 2P1DA 3EYAA 2I6TA 2DULA 3GFFA 1PO7A 2H7CA 4BNYA 1RQLA 2Z3ZA 3GDHA 3UWMA 5DNDA 3G17A 4HYEA 1XEWX 1PNTA 2NUTA 4I1PA 2Q0XA 3EIQA 5IDYA 4ZDIA 4LA4A 4PZDA 5CM2Z 3UJ7A 3V4FA 4CDGA 2O20A 2AHOA 3KK0A 2CWDA 1FFCA 1KOJA 3LUCA 4IV8A 5GJWC 2NXEA 1YULA 1E79A 4FFMA 4ZZ0A 2WV9A 1JNXX 5TQVA 1RXIA 2XTJA 2JGMA 4A23A 3HI4A 5K0CA 2I1LA 3BXGA 3OECA 1JH9A 2AC7A 2FZWA 2R4UA 2R4QA 3CJRA 3EMDA 1C1DB 3PRHA 2G3YA 1UMDB 1PYGA 2RGNC 2W6ID 4BLPA 3R74A 3F71A 1DCFA 2BF4A 3Q72A 3DAPA 3EVBA 1XZCA 4EIWA 1BHJA 1TDJA 3M2PA 4DMHA 4E7PA 5CYGA 2CN1A 1WMDA 2A59A 1YGPA 3CLSD 4FYWA 1IONA 3W7BA 1XCPA 4GI2A 1J70A 3K6RA 1JN0A 1RHQA 1FJHA 3PITA 4ITUA 5E6UA 4E5DA 3Q9SA 2A9JA 5FJJA 4WBNA 5JYEA 4PG4A 2HBYA 2CUTA 1WDKA 4XVRA 3UA3A 1F1BA 4U39A 3TG2A 4DR6B 3K0FA 4YLEA 2F17A 1P17A 3L1JA 3FOAA 4A2PA 4OB6A 4B31A 4D74A 3BKWA 3O9ZA 2VLBA 3LC0A 4HS9A 2PFSA 1CZOA 4ZVQA 4ALLA 4F3NA 5AESA 5CDHA 4Q1CA 1BEEA 4LDQA 1ZGBA 2GO1A 2OUKA 3WIEA 5BR7A 5C8DA 4EARA 4IOMA 4YVFA 2DFVA 1E94E 3E70C 4HAIA 3NP7A 4IDGA 2V7WA 4DR7B 5C3UA 3N0RA 4HWKA 5K8VA 1KRWA 1QZXA 3QBEA 2GD0A 4TV8F 1YK0A 3UB3A 4G9GA 4MKGA 3NIFB 2VR1A 4BIMA 5I45A 3DVAA 2PZKA 3A37A 3P2IA 4K46A 1E4YA 1C7FA 1L4KA 3SK0A 5E9WA 5HZMA 1SEPA 3QFSA 3BL5A 1JWLA 4LOIA 3H04A 2AS0A 3QMMA 5JCOA 2HSDA 2QTZA 2ZBVA 2ZZKA 3MBKA 4IHAA 5JAZA 1DAMA 3BHMA 2ZE8A 3G1UA 2EFYA 3C7AA 2OORA 2E7ZA 3HNOA 4YRBA 2WNHA 5ALNA 2Z6VA 3FHLA 4LHVA 3O74A 2IW3A 1TO2E 3GP3A 1J22A 5CJJA 4FYVA 1CJBA 4HL6A 4OHKA 1ND6A 1AGRA 1THZA 3K6JA 4ILEA 3GRYA 5FWYB 4DYHA 2HT1A 4A1OA 2IOFA 1DJOA 4YMUA 4TMFA 3AF0A 4GI5A 4QTUB 1X7WA 5AT1A 1WCIB 2B78A 1HORA 1OPRA 1Z2NX 2JRLA 5B7GA 3GHYA 3TNFA 4KQIA 3DB2A 3WYAA 1QLWA 1X80B 2HXYA 2RBKA 3BXFA 4MB2A 2P91A 5AVUA 1Z12A 2A6PA 1H4QA 4UUNA 4X8LA 4WJLA 2WIBA 4DMMA 4R81A 1GNSA 2VDLB 4EHJA 2LNDA 2ORIA 3N05A 2VQFB 2HR1A 3CW9A 2BKXA 2OCLA 1J5PA 3GZNB 4J0HA 3HU2A 4U7JA 2COUA 1JL3A 1DBVO 1TLLA 4PS0A 3WIBA 1W93A 1D2RA 2YXLA 1MB3A 3ASVA 1JIUA 4BQFA 2QV7A 3ODGA 1VPEA 2WUWE 3KZCA 3SE0A 2ZPAA 1B2RA 4QYSA 4WGFA 4FWTA 4QEZA 4P34A 3OMXA 1W7AA 3A2MA 4DS3A 1Q19A 3ZE8A 1AURA 3H3JA 1K27A 3AZQA 2PUTA 3DF7A 4MJXA 2B25A 3IB6A 4RZQA 2UYHA 3E23A 4C6SA 1R9GA 1XZLA 2P2LA 2VDPB 4Q4JA 4EY5A 1U2RA 2EKZA 4MV4A 4KSBA 4BAGA 2BFEA 2E9SA 1XZGA 4C9BA 2XHEA 4EW2A 1EG2A 2XUQA 2FH5B 1LBEA 3FVTA 2G6BA 3DM5A 4H6PA 3G8YA 3O8BA 2VBCA 4QQNA 2RHRA 3O91A 3SM9A 3V7FA 1IM5A 3A9SA 2FRVA 4NYJR 1ZA2A 4ITVA 5JAPA 4B3SB 1A2BA 3H4TA 5JBNA 1GFSA 4E32A 2ZRDA 3MS7A 3EW7A 5JNTA 5JDIA 1S9DA 2HMWA 3MWDA 3UWOA 2LIPA 1RP1A 3ETJA 4JJGA 4DXHA 3H9BA 5B1YA 2HZBA 1K63A 4X45A 5SY6A 3RUFA 1NUTA 1R66A 3B53X 1CY0A 1QF6A 5BVHA 4M1EA 4QVKA 3NBAA 4Y7CA 2V4MA 2FZVA 3WLQA 2A7XA 1GR1A 5BR1A 3IAS1 4RKYA 3QXSA 5AQEA 4V0NA 2OZEA 1G2OA 1CUGA 5JPIA 2YV1A 4R31A 4TMYA 1WLSA 1QH0A 1RJFA 3TPCA 4FCVA 6ADHA 3NPAA 4LMBA 2IHUA 3P9YA 4WKBA 4DIFA 2Q1UA 5G0SA 3RS4A 2VNAA 1I2MA 1YZTA 3VOBA 5LU8A 2BE7A 2OCAA 2GEVA 3DDHA 3DEAA 4DT1B 1X7HA 1NMQA 3JV7A 3I5XA 4LDAA 3ROGA 2FMTA 3FROA 4XOIA 1XA4A 3OICA 4MZDA 4TSFA 5FLEX 4CCYA 4R1MA 1VFNA 3M4YA 2XE7A 2RB4A 3GLUA 3UXMA 1CQZA 1U5AA 1XTBA 3E3OA 3IV9A 2EBFX 3LIPA 4PGHA 3RASA 2Y76A 4H0FA 1BFDA 4GPZA 4I50B 4YV2A 4JJ8A 4LN1A 3QVKA 5ALPA 1V6SA 4Q1BA 2C83A 5D84A 3T7AA 3K9FC 4YJKA 1DG1G 2QN3A 3UAZA 4ZJYA 4AI6A 4D8WA 4DA0A 3HWWA 2AKEA 1M34E 5KO2A 2P7HA 1NW6A 4I9FA 2BTQA 2YJZA 3DZIA 4LXUA 4DEVA 4CI0B 2OC9A 3ELWA 2BFAA 3DOIA 4Z8YA 4A16A 1VGVA 1XU4A 2XZOA 5IJ9A 4JBWA 1NE2A 4YMVA 3BA6A 3IV6A 1JDSA 1FX0B 1Y7IA 1VJTA 2BFMA 2IYVA 2JZNA 3ABRB 4UKDA 4DR5B 3OFNA 4U2KA 4XWTA 3K2BA 2QPLA 1LBTA 2NPFA 1KTVA 3WRXC 1P18A 3STYA 4IOKA 1YQTA 2QRMA 4AG5A 3HZHA 3BJEA 3GFGA 1Z62A 3NT2A 1NF9A 3QKIA 1CUWA 3V7NA 4BNNA 1F8YA 2Q27A 5HEKA 4CR8A 3GLSA 4IGFA 3IBGA 2IHYA 4MS1A 3D6MA 3KOXA 3G5LA 4L72A 3KC2A 1O9GA 4MI1A 5ALSA 3S2ZA 1JVBA 4O4IF 3RSGA 1TEXA 2VSYA 5AW2A 3T3GA 4Z1MD 4QZVA 4TLLB 3LFUA 4KXNA 5BQPA 3WL3A 5DCLA 5DHSA 2XBUA 4RS3A 1ZCFA 5ABPA 1FS4A 1OY1A 3GFOA 4TUYB 2C3MA 4JROA 5I5EA 1RTTA 4DLUA 3EXAA 3LC1O 2G25A 2VP9A 1UBSB 2E55A 3RVBA 2HA7A 3WKAA 3WLHA 4AUEA 4HJRA 4TQAA 4ZVMA 1DBPA 1E1KA 1Y6ZA 3NYWA 1YB2A 3HKEB 4OLBA 1PJZA 1XRLA 2NPIA 3LZDA 4O02B 4YBRA 3NDIA 3RV3A 5GJBA 2YY6A 1KO5A 3FN4A 4MW1A 3RVSA 4C0WA 3QPVA 3TDMA 5FLYA 3CCFA 1Z2CA 1DKUA 1OBVA 2W6IA 3MJCA 2ZJ3A 2F1OA 4IVRA 4OHVA 3HVKA 5SZHB 3K71B 3HJNA 1GM5A 1UIRA 2AD5A 4GLJA 2V7QA 1UMKA 2BR5A 4TN1A 4EMSA 2IOFK 4HXFB 3PUZA 4QBHA 1I3CA 3HA7A 3IOBA 4MVJP 4UHJA 5I5GA 1M6VA 3A4VA 3JY6A 3NAGA 1DKNA 2PU7A 6AT1A 4BLWA 5ITZB 5BVGA 5DU2A 2QZ9A 1EX7A 3LBYA 4X7BA 2H08A 5AMXA 2A9RA 2AGVA 4J7UA 1A0OA 4F2PA 1R37A 2YYSA 4KFTA 4YRAA 4R1QA 3E9DA 1BQ3A 2WV7A 3OE7D 3EGXA 2PL3A 4LXTA 1W52X 5BNIA 3B1XA 3D8SA 1EUQA 3WZMA 3EG9A 3F6YA 3MRVA 5LOVA 4F6RA 4FYIA 3IHKA 4ENTA 2CLEB 4Y9SA 5JZSA 1R10A 4Y8VA 3ABZA 4KO4S 1DNPA 3HWSA 2D0IA 2WJYA 5IBRA 4X3CA 4YP5A 3ZC3A 1ODCA 5IM4F 5AM3A 1RWOA 3TZHA 3F6SA 1H5NA 4OQDA 1KZGB 1C4OA 1JHUA 4MR7B 3CC8A 2XXAA 1IN1A 1RXEA 1VYTA 3LLUA 3N6XA 4JJFA 4M37A 1E99A 2JLQA 4TLMB 4CTKA 4P31A 4Z4EA 3AY3A 3ZG6A 3FFBA 1NMSA 2UVPB 4PIVA 3OD5A 1E5TA 5LNK6 3O4RA 1W36C 3ZK7A 2D7DA 3HB5X 1M8PA 1S5PA 2WWTA 4IRMA 5BOSA 1IJBA 1P81A 1UBHS 3WL8A 3SLRA 4ENVA 3TDNA 3F49S 4UHEA 1XZQA 3EF1A 4MAFA 1XDZA 4AUMA 2XAAA 2WWIA 3C3EA 3WZLA 2YR0A 3AETA 1JIIA 4RMNA 5GINE 4LX0A 2DWQA 3L8ZA 1UK8A 1DC5A 1H6BA 5AW4A 1H2YA 3GA7A 4TLAA 3FKSD 5JH7B 3Q7EA 4W5TA 3RUPA 3LV8A 1G5PA 1Q7CA 2IHTA 4NZPA 3S99A 4UJ3A 2B83A 1RKVA 1WPQA 2PVPA 3GY0A 3L6RA 1VJGA 3I9OA 2YHAA 4D9CA 2I33A 1V5FA 3T4UA 1N5LA 3EDCA 3FNBA 4ROTA 2HQ1A 2IOHA 2UYGA 3H1GA 4L5BA 1B0AA 5F2KA 3IKTA 4TRRA 4G23A 1NASA 3VQTA 1AMNA 4GQBA 4G0XA 3U7JA 4DDWA 2EDAA 2UYCA 1CR0A 3HDQA 2E6KA 4Q3BA 4LVNA 2GFQA 1IN5A 1UWKA 1PLKA 2O2EA 3UXHA 2ZRKA 5F35A 4DCMA 1U0TA 3ZD8A 2AZXA 4BV2A 1XEXA 2ZVPX 2AI2A 3FLMA 4HDQB 4IQ4A 5FPHA 1ZINA 1M75A 4TROA 3S4YA 4B0OA 4EBBA 4P80A 3SMVA 5IAAA 2O8DB 4LOAA 2B9VA 2NACA 3AJ9A 3LM8A 3ST7A 2GWRA 2MDTA 4TT3A 3K8OE 4XCQA 3E1SA 4HI0E 2ZT7A 4YA6A 4ZTUB 4Z8XA 1EXDA 1XHFA 5IKEA 4GEKA 4JLJA 3O8OA 3STXA 3HEAA 2X42A 3DWEX 2CE2X 3AHHA 3IUYA 3MMSA 2VJMA 4IHJB 4O5OA 1A2QA 4YJFB 2B82A 2ZI5A 3SDBA 2C4NA 2I2BA 1TYZA 1E5QA 4JP5A 4X95A 3V1KA 2ZM6B 3I09A 4WN9B 3DCYA 5DGHA 4IVQA 4ZEMA 2DWPA 3B3GA 1FC0A 1JWAB 4PV7A 4JI3B 2XUAA 4AJJA 4B2IA 2A5YB 5IKMA 1XZFA 4RTLA 1FYXA 5EJGA 1L4FA 5H8WA 3FF1A 3IR5A 4CMBA 1GUBA 1P6UA 1UXHA 4E0BA 3K0BA 2XT0A 5JU6A 4EB3A 5E7JA 2PSDA 1MPTA 3R3WA 4FFBA 4GNKA 1UEXC 4KQXA 1U80A 2CLKB 2QL9A 2VAWA 2XNHA 3M5PA 4FBLA 4Q3EA 4US0R 2ILVA 3U17A 2QD5A 3EIHA 4DUYB 2AZDA 1X9GA 2GD1O 4XGRA 4RTKA 3JAMA 2OGZA 2PU5A 2XADA 3K9WA 2A1UA 4H9GA 4BQNA 2O1SA 4KW7A 3TQFA 2ZI6A 3VSDA 2H4HA 1J0CA 4JU9A 1FU8A 1SCAA 2H1IA 3BQNB 1SCQA 5C9ZA 4HNRA 5L95A 2OPBA 4ZDJA 1C41A 2QD3A 4JOQA 1TC1A 2L0XA 2BE9A 3I5UA 1E0KA 4X60A 1EFDN 2P1RA 4Z3OA 3SHWA 1Z4NA 2QY9A 3H4MA 2JVKA 1F2UB 4CODB 2R66A 1R15A 5BW5A 3HB1A 4RDHA 3LCMA 3A6JA 5JE8A 2GPJA 2H7XA 3PHJA 2J59A 4UCXA 4QOJA 3M7IA 4WJZA 2PMCA 4WK0B 3UMGA 2RG7A 3BT7A 1OU4A 3RUIA 2IPXA 3ND9A 1MVOA 2FMKA 2HQOA 3Q10A 2BKUA 1GCIA 2GXQA 1KZHA 3UKJA 5GZ1A 1AA6A 2A86A 4QYXA 3OZFA 2BCJQ 1JZTA 1Y42X 2I6GA 2J5KA 5K0EA 3VPDA 2Z57A 2CVZA 5AOAA 1WHTA 2WLSA 3D6JA 1K08A 5CX1A 1SBHA 3KELA 3M5WA 3PDIA 1JQBA 4JS0A 1EK5A 3FZEA 3KQNA 3N6VA 4JA2A 4IIFA 3ZV5A 2FUEA 2RKWA 5ES3A 3P9NA 4HSEA 3EXFA 4DQ0A 4KE8A 4LYAA 5EEHA 5LMNB 2I3ZA 3NEYA 1Q57A 1MXHA 1OW3B 1QYCA 4EZBA 1XWIA 4KDEA 1E64A 1JBKA 3T9DA 3CZ4A 1UT6A 3A6ZA 5TT0A 3WLFA 4FHDA 4RAOA 3ZKAA 1QLHA 3HA3A 1JXQA 2MSLA 4K81B 1GRVA 2EHJA 4O4JF 3TZCA 3BCUA 3VHXB 1F4LA 2IQIA 4MWZA 1X39A 2FG7C 3CRMA 1IBSA 3BDVA 3K6KA 4JL6A 4BPBA 2WFMA 3TW8B 4C0JA 3TECE 4PO9A 4Z1MA 4YAIA 1OV6A 4DQLA 4HDAA 3ZXXA 2PLAA 4P5EA 3VPBA 3WB0A 3L7AA 2WM9B 2YMQA 4RF2A 1HKUA 4JVMA 4OQYA 2NOAA 2QQ5A 1SAYA 2XUGA 1I3MA 3ECSA 5LA6B 5HRAA 2QQ0A 3DMYA 1PR6A 1GN8A 1QX3A 2Y9MB 3SMQA 5L6LB 2HDWA 2WYWA 4DLSA 5ADHA 3DLTA 2XVAA 5F52A 4BB9A 3DMTC 1SUPA 2FF7A 4P4UA 4XWYA 3DFZA 1Q0ZA 1DARA 1YR7A 2O6HA 3PNSA 2BRUA 4EKDA 3B2NA 3DWIA 4YIHA 3VZCA 1BFKA 1YL6A 4BB5A 3QF4B 5G0UA 1Z5VA 2JHCA 4ETWA 2CL0X 3WMWA 2ZREA 2P9HA 4ZVRA 4DGQA 4DR1B 1VPVA 3IDAA 4WV3A 2WF8A 3PNBA 1BXRB 5B5SA 3FX2A 4G89A 3VPAA 4HVCA 4FMDB 1EP1B 5DFAA 4O2AB 2DYKA 3U09A 1TEZA 4QTZA 2XDQA 4CR7A 1KFJB 1Q0QA 2QXYA 3PC8C 4LJYA 1K8ZB 2WJIA 3FYTA 4P9NA 3LC2O 1ENZA 3C15C 3IQGX 3P52A 4HHEA 2ZANA 3U3ZA 1NSYA 2LVBA 2O3JA 4HXGA 3NCTA 4PEVA 5D85A 1SU6A 2QI9F 3ACDA 4EFNA 3R6LA 5G4KA 1ABBA 1SBIA 1U0NA 2H57A 3OE7A 4FDUA 2BGLA 4HVAA 3FWHA 3UYLA 3AHIA 1WXWA 1RYFA 4UVDA 3H87A 4QYIA 4ISBA 3V4PB 1ZUHA 4PGMA 4ZXFA 2JA1A 1B00A 1PI3A 2VL7A 1SXJA 4EKYA 1NUHA 4OHPA 1FIUA 4TPKA 4EGJA 1EDOA 1JYFA 3KJNA 4PQRA 3OO0A 1I4TD 4MIYA 4XXHA 1N9GA 3KB8A 3AIKA 4G2TA 1DV1A 3IOMA 1TCBA 4F04A 3MCUA 3W3AH 2QM8A 5MGNA 4EY8A 3U7RA 4C4SA 2J45A 1Q1QA 3LVFO 3K4QA 3KYIB 4EX6A 3PEFA 5HJEA 4DG8A 3KQUA 3CIFA 3W2TA 5EXSA 1OB2A 3Q3GE 2ZZNA 2QUIA 2YMPA 1UBOS 2CXTA 2HWUA 4KP7A 2HMAA 2XVYA 1RCFA 4N0EA 3KT0A 1DCMA 1EFVB 3LGSA 1JHYA 2HF9A 1KE1A 5DGXA 2H1SA 2TYSB 4NMLA 1LU9A 4QL3A 5F21A 5EY5B 1F06A 4BO7A 3CRVA 1W87A 3C5CA 2OV6A 2VBFA 4JBGA 5KQPA 2R6R1 3O7WA 3QJYA 1OLOA 4X5OA 1V3UA 4PQEA 2PA0A 2BP7B 4YJ3F 1DKRA 1HY3A 3UOGA 4DLNA 1E32A 1Z7YA 1EH5A 1NOJA 3H0EA 4Q4DA 3SIPA 2JI7A 3IIJA 3P4XA 5U9CA 1LQUA 4YRCA 2ODAA 2PD6A 4FFPA 3UJPA 5LN1A 2H0AA 1QRDA 3C2QA 5CPBA 3AVVA 1N75A 5EWLA 3PHBE 4BASA 4LF4B 1TJ5A 2UXBB 1K2VN 2DHEA 4CF6A 1T9ZA 4FX2A 5I8WA 3NBUA 1Y63A 1FUYB 2GXAA 5I01A 4BKRA 1DWOA 3TX6A 1PNQA 4TMVA 3UGJA 2G5TA 2DR0A 1RZRA 1XXHE 2PX4A 1EVQA 1KKMA 1A8SA 2FCRA 4KUGA 4O4IA 2W11A 3L4KA 2P90A 3CG4A 1DJNA 3A6PC 2NZ2A 1A9ZA 3ADKA 2VF8A 4HCJA 4B7XA 4DV6B 3MMPA 5K3EA 2ZRCA 3LW8A 1YU6A 2QDKA 3UCFA 5BMVF 5AW0A 3PNOA 1SK9A 2V1UA 4Y2HA 3ZHCA 1FXWA 2ZS9A 3T4XA 2V97A 3E2PA 2P2CA 2BBWA 2WEKA 4P81A 4G4IA 3UYKA 3I3SR 3H19A 2GD6A 2K2QB 4LHYA 2OV3A 5BV8A 1JDBC 5JSZA 3QTTA 1R6XA 3LGAA 1OC2A 5EZSA 1MHPA 2PGLA 2X22A 4Z7QB 1KMNA 2JJMA 4YI3A 4OHZA 4XYBA 4BFXA 5JS1A 4G2NA 2DFTA 3ZJ4A 1O1YA 1BS9A 3QXJA 4X61A 5LXTA 1VJDA 4RZHA 1CVRA 4MUXA 1ABFA 2QW0X 4R1LA 1JAIA 1PBNA 1CYDA 4LHZA 4LJ7A 1GV1A 1SCUA 4L8WB 2P9TA 4HQNA 2YKGA 3QYPA 1E98A 5KI6A 2DBVO 6YASA 3A2LA 1XKLA 5BWBA 1MEEA 1G1AA 4S1WA 4L4XA 5AVZA 5J5CA 3SNKA 4U7DA 1L0BA 2FG5A 4V0SA 1IY9A 3E5NA 4N18A 2AUNA 4FR2A 5FB3A 1QP0A 3OFVA 3U4AA 4F4HA 5H02A 3U4DA 3ZGZA 2CC2A 5REQB 1I13A 3Q7SA 1JFLA 4NU6A 5K8UA 1EX6A 3QE9Y 1X2BA 4LNAA 4PLCA 3UY4A 1F0PA 2FEKA 2PMBA 5K4GA 3D0OA 2Q1XA 3L7JA 1KP2A 2GN6A 1DJMA 1Q83A 2KSQA 2OUIA 1UJNA 2E4ZA 3CWCA 2ZIFA 2FB9A 1NNSA 2N3ZA 4PBTA 4R83A 5JD5A 1VL0A 5LKAA 4OX9Y 2H5JA 1EK0A 2YC4C 3WLMA 3CPHA 1BMQA 1XTPA 2GVZC 2YIMA 4L16A 4OBBA 2BAGA 1I94B 4RX1A 1PNRA 2W2OA 1VLVA 1YJXA 2PBLA 4W5QA 2NSLA 3BIFA 2PIAA 1OX6A 4ZREA 1X8LA 5HBGA 1VBKA 3HNPA 4GYWA 4ZV7A 2R62A 3B51X 3H8WA 5KJEA 2AE1A 1XIVA 4J7AA 5B3AA 3KEMA 1ULBA 1SKQA 1N2HA 4RCZA 2BONA 2I1QA 2G8LA 4OX9B 3CU5A 4IWYA 4BEJA 1AKVA 3LX6A 1QS0A 4BWYA 4MUNA 3RNLA 2PRZA 3F6BX 3GRZA 2XUZA 2UXDB 1FRZA 2XB4A 5J47A 4QO7A 2AMLA 1RKUA 2V45A 4O1IA 3QI7A 2AK2A 3M3DA 5AVVA 1AKQA 1OXTA 2GFHA 1J8MF 1O5IA 3MM4A 1FPMA 5I4CA 1JE1A 2YHIA 1LWOA 4P0PB 4DC9A 2BJWA 1QOQB 3UHFA 3E9YA 1ITZA 1XMQB 1J4AA 3F8TA 3S55A 1W35A 2BGNA 2QAGC 1W6RA 2P3QA 2QLBA 3DDWA 4QAJA 1FP4B 4MLPA 5D01A 4AKGA 4GMFA 3HDHA 3L4EA 3RK1A 4IDBA 3KPUA 1AVTA 4E14A 4G65A 4YJHA 1WR8A 3KAJA 3VU1A 1ETHA 1RLOA 2VQ6A 3GBPA 4YUXA 2P3SA 2V7PA 1FTWA 1NJ8A 5ALVA 2AQKA 4RL4A 4D9NA 3WVNA 3VTAA 2MINB 1G5FA 4ER0A 4M36A 5AW8A 4DMRA 3HM9A 2FQXA 4UVEA 4UHDA 2WWYA 3GLHA 4ID9A 3KPVA 3QWAA 4BIIA 1QQAA 1NOKA 2BGIA 3W7AA 3UUFA 4KZPA 1AUQA 4PXAA 4AU1A 4GOLD 2F3PA 1JAXA 3DE2X 4OQLA 3SFZA 2FNAA 4EJFA 3HZZA 2VPIA 1Q15A 1AKEA 2WD9A 4A1FA 1LPNA 1PWHA 1CF2O 2COKA 3ESBA 4U7WA 1SQFA 3OQNA 1D0VA 2VRCD 3V4RA 1AU9A 1H5UA 2BUAA 3ZJVA 3N2KA 2YIJA 2ZUUA 3PU6A 1KEEB 1JKIA 3P96A 4TWRA 4ZVKA 3TW0A 3BICA 4HAWA 1B76A 3OQJA 5LQAA 2VJOA 2Q2VA 3M6UA 4FGJA 3TLXA 3AH8A 4JOCA 4RCYA 3B36A 2VZ0A 3OJEA 1XA0A 1GLVA 1WCXA 4GOJA 4F4DA 3WRWA 2H07A 3IP7A 3U7EB 4BU1A 1BE1A 4NBSA 2XCLA 3T1QA 1RLMA 4RM3A 4JJ7A 4Q12A 4B4OA 3RSHA 4H1TA 1GVHA 2HSZA 4XOUA 3L0ZA 4UU0A 3VNVA 1WXFA 2LDXA 4K6GA 1HDRA 4FFDA 4OMCA 4TLCA 2B4AA 1CDDA 1T8TA 2JBWA 2OD9A 5I6DA 4B83A 4YJDA 2I71A 3O1IC 4EPTA 1J25A 2N46A 2XQFA 2ZYVX 4YB8A 2HHAA 3L0YA 2ALJA 3D6FA 3I04A 1RU3A 4LDZA 1J56A 4MPDA 1JPNA 1KOFA 1M2VB 5E8RA 1EQAA 1M74A 1QK3A 3P71T 1GNPA 1NFRA 1MR3F 2YIVX 3ADBA 1ZI8A 1NQ5A 1UFRA 2GA8A 2QMYA 3WJ7A 4GSYA 3WHKA 2BI4A 3N5KA 4A6EA 1V4VA 2VTKA 3M9XA 4CF3A 4II3A 1GTMA 4KV7A 4N1AA 4RPCA 1WMBA 2Y71A 3ZWWA 3KOZA 5C3MA 1IDN1 3ZCQA 3LKDA 5G02A 2VJBA 1DC4A 2ODWA 3L7KA 3W8DA 3OU2A 1JDZA 3QLVC 5TF0A 1R0BA 2ZR0A 3W90A 4ZI2A 4MWBA 1VJCA 2XUFA 3TR6A 2PQ0A 3FJ1A 1ZGZA 1ZHHA 2HIMA 4LF5B 4XSVA 3LDHA 2CNNA 3Q5GA 1N33B 3LKBA 1FRFS 1NMEA 4QQ8A 4GOKA 2X5OA 2YXPX 4PR0A 5K3DA 4B5LA 2FUCA 3E61A 4BQEA 4ENWA 4BEBA 5FWAA 5KTKA 1D2EA 2BY4A 2QN9A 4X8MA 5IBCA 3L84A 3WIUA 3MTBA 3A2KA 3THWB 5EUMA 2A78A 4YAUA 2HF2A 3OZGA 2NU6A 4JU8A 1XAHA 2EKQA 2ACEA 1OXMA 2VQSA 4JAVC 3UK2A 5IZCA 2Z2XA 5JNSA 2XA9A 1GNLA 3H6GA 2D5AA 4QE3A 5COBA 4HAZA 4IL5A 1NKSA 4ML3A 4E1VA 4EM6A 2OV1A 4LRUA 4RGVA 5DN9A 4F06A 1QIKA 2CJFA 2YZGA 4RJKA 1KQFA 2YVUA 4IICA 5CNIA 3L6UA 4ZPJA 4LOJA 2BEVA 2CW5A 3N1UA 2PPVA 3GQBA 4RHEA 4OU4A 2GOYA 2X1MA 3AEUA 1E9RA 1CS0B 4DNFA 1FMCA 5DHAA 1US8A 2Z1NA 1SCDA 3JSXA 3R2JA 3M81A 2Z2ZA 2W6PA 5CT8A 4CN8A 2XB8A 1YJ8A 1RXYA 4O4JA 3CIOA 4ETIA 2QVZX 5FHQA 2CLMB 5LL6P 3T1HB 2G1PA 1CSEE 4AP5A 1IN7A 4H16A 4DIKA 2IYOA 3KHUA 1GG8A 4OXYA 5IK2A 3ZEAA 2ID9A 2OXTA 1HTWA 2QRHA 3KKPA 1P9OA 3ETHA 3II6X 2R1UA 3FNGA 4QHYA 1BD3A 1E4VA 2QP4A 1AX9A 4OM8A 5MFPA 4TM8A 3TFWA 3K70B 3R0VA 2IV3A 4B3XA 1MA0A 4TKUB 4EYGA 4B3IA 1V45E 3TNJA 4N3BA 2WA2A 5HCNA 5E1BA 2Q1WA 2Q46A 3F6CA 5JG7A 1T29A 4V1CA 2OMKA 4G5OA 4HGQA 2JCGA 4GLBA 4I4IA 4YRPA 3DLBA 1O6FA 1Q1GA 4Z9BA 1IWPB 2KI5A 2NU9B 2R6GA 2C94A 1BMFD 4FZ5A 4CRWB 2QM3A 2WAYA 1P60A 2W2QA 1EM8A 3RC2A 3U1VA 1R9MA 3O3NB 3RSCA 4GR5A 3NDRA 5LJLA 3HUUA 4ZICA 4WLEA 1ZKDA 1IU9A 4A8HA 3A06A 1DRVA 1G2IA 3ETEA 1RI5A 3ZIDA 5JQGB 1GFWA 1J9EA 1U4NA 2W8BB 3QG5A 1NBIA 1U8XX 4NFLA 1AKYA 4KZKA 3PUIA 3LY5A 2VNHA 2ZBDA 5JTTA 3JD3A 3BMCA 4G5XA 2JS7A 4PS1A 2DVMA 4RVUA 3CEJA 1DO0A 3U9TA 4BP8A 1E3TA 2A0YA 4X63A 3FDXA 1PR4A 3TPFA 2J9FA 2IYNA 3P1JA 1UDCA 3D4IA 2AN5A 3ROQA 4E31A 4WIAA 3AFNA 1ZGGA 2HA3A 3EXEA 3QSGA 4PVCA 3VR5D 4EHNA 4EGCB 4CIAA 1I24A 1P7CA 1XD2A 2Y99A 2FZ4A 2FOLA 4MJLA 3ZGLA 1G2QA 2OR3A 2FQYA 4BUCA 1P1CA 3IDFA 4NBLA 3L06A 4XSHA 2QYTA 1T91A 1M8FA 2WG0A 4G4SO 3AEQA 2ZRHA 5K2OA 3VH4A 4WXYB 1NVVR 4GXNA 3TD6A 3R8FA 3Q7TA 5BV7A 1H23A 5C8YB 5CM9C 1T6XA 1GAWA 2HLHA 3L1VA 4KXQA 4QTXA 4BJHB 1NMZA 4D4GA 4B6RA 1BHSA 5IHXA 1JECA 4GRAA 5CVEA 4QBTA 3LLVA 4ZYWA 1FRQA 1XVLA 1YBFA 2F43B 2KMLA 3IEPA 4MRSA 1H0HA 4ESOA 2RAVA 3AUYA 1J0BA 1NI4A 4FZ3A 4WEOA 1AJEA 2D74A 3K1AA 3I2JA 1DIRA 2OXEA 2I3GA 4MQUA 1XCOA 4OI4A 1PJ3A 1THTA 2D8MA 3WFZA 5JV5A 4OUDB 4BNMA 3VC7A 2FI1A 1ZH6A 4GP6A 4LI3X 3WTBA 1R9NA 2ODEA 3KOMA 1RBQA 3PB3A 4J4BA 1OR8A 3VC2A 3C70A 2ADOA 4M7PA 4YJ3A 2OCIA 4DLTA 3JVEA 2EKDA 4YJGA 2ONJA 3K1ZA 1GKYA 5BXQC 4YMLA 1FDRA 1ETUA 1OQAA 5IG2A 5JW6A 1P75A 1RRGA 5BWNA 3GAAA 3TB6A 1OAAA 4J9UE 1KYTA 1ZICA 1F4VA 2ZQZA 4U02A 1O2DA 3T41A 1NP6A 4GBED 4AJNA 4CU5A 4D25A 3KSAC 4GOXA 3TIFA 1SOWA 4AS3A 3RBAA 5BQ3A 3HYSA 5K51A 3GLIB 4ZI7F 4AJ2A 5HA5A 2BFDA 5KYXA 4WNCA 4MR9A 4L5JA 3ENNA 3D43A 1DWPA 4LYDA 5EINA 1FFSA 5K8CA 2YVLA 1Y5IA 4AC9A 3CO5A 2ZSDA 4L5CA 4D5GA 4QYWA 3SDSA 1TXGA 2J5XA 1U2DC 1KHTA 3FDFA 4E2ZA 3VO8A 5JNRA 4HLUA 3R6DA 4BO6A 3JXEA 5JXGA 1ZD9A 2HFJA 3ME5A 3TR5A 1W5EA 5BMVA 1M1NB 4LDJA 5HNKA 1A5SB 2I6UA 2ET6A 3ADPA 4YV7A 1UT5A 2Y2VA 3JZFA 1ZSNA 3LLCA 2WJ6A 3A9UA 4LBYA 5IXJA 2QLTA 9GPBA 1KF0A 1PNVA 4HEHA 2OQ2A 4P53A 4RKRA 1IE3A 3E9NA 3HKBB 3A7EA 3QX7A 4ZRMA 5H3LA 1J2UA 1E2GA 2Y9PB 2EV9A 1WPXA 2A1TR 2GBIA 4ODIA 5K3BA 5LBIA 5L3SB 5IM5A 1C4XA 2XMSA 1KARA 1LC3A 4MAAA 2Z4RA 4LNUA 3CZAA 3L8DA 2JAHA 5CD9A 3U6KA 1SHUX 3TI7A 2G40A 3PEEA 4GLLA 4CVNA 3QXGA 2GZSA 2FN7A 5HFNA 3INNA 4R1UA 5C81A 3GRKA 3H99A 4FJ2A 5ALZA 3DE6X 5EP4A 4JX8A 3AIIA 5IJ0A 2F8SA 1YHZA 4IZIA 4IW3B 3ZK9A 4DUGD 5SYNA 3UICA 3VR2A 3QG1A 4GQAA 3C8HA 1PFKA 4S3MA 3L18A 4YUZA 1YR8A 4L4RA 3NKLA 5E1OA 5HIIA 5B7PA 3F3MA 1ZC3A 4PHHA 1G6OA 1UODA 5GONF 4EITA 4B3GA 1XPJA 1M7GA 4KE7A 1DEAA 1ZNYA 1HZZC 3AB3A 2P78A 2QTRA 3T7DA 5HJ5A 1F0KA 3R20A 2AD1A 1X14A 2AXEA 1PJRA 1A9XB 1JFRA 4NFYA 2FN4A 4NH4A 3STUA 2W4MA 1MOSA 2NU8A 3TJRA 1X9HA 3W06A 1UBJS 3JTEA 1UBGA 3K2IA 3FVRA 2C58A 4F7DA 3DE3X 3M2TA 5A4DA 5DE3A 5FNVF 1DBRA 5JNWA 3L3BA 3MT9A 3ZUGA 3I9MA 5DM60 5L40A 1YQ9A 4WLFA 2CUNA 2BM0A 3UJ6A 1W85A 3EDYA 1L4NA 4U1RA 1T1SA 2OENG 3LFTA 1P8JA 2X15A 4II7A 3VC1A 2BHLA 1XZPA 4EG7A 1UXIA 3S8YA 1VDMA 3PHIA 1BMTA 1LS6A 4FEEA 5JCOC 4YHHB 2FUNB 4DYVA 4IXWA 2IPOA 1U0SY 4PLHA 1DI0A 1DT3A 4IDFA 3UAWA 4EVRA 1SUSA 4H6XA 5AJHA 1VZ3A 2LDBA 4HDSB 3PGVA 4FOTA 2CJXA 4KFRA 1O6GA 4PC7A 1AS3A 1FYFA 1KI1A 2WB4A 1NWCA 4CTMA 5F7ZA 5BQFA 3FI9A 4ND8B 3GGDA 1GPBA 1M10A 1MC1A 2GYYA 4K1XA 2IZ7A 4RIHA 1NBME 3OUTA 4HUQB 4WUVA 3IQIX 1WXXA 3H8JA 3AM5A 1Z34A 2ONCA 5AXDA 4PN7A 2YS6A 3G9ZA 3FNQA 2WFLA 1PUJA 4NE9A 2GBLA 2ZIUB 3WGJA 1YQGA 1KSGA 3E7PA 4JYBA 4PC3A 1BRMA 1M34A 1II0A 1VIAA 2DTDA 3D3QA 3P4UA 4KI0A 2F3SA 1HFEL 4P4SA 5JWHA 2Q1TA 1QTRA 2Y1EA 4K9RA 3VVMA 4C7XA 4L9AA 1TE2A 2L2QA 1QUEA 2XUPA 5EJMA 4DCVA 3U4GA 4O2LA 1IIRA 2XMQA 4LRSB 4ND2A 1NYLA 2HDNB 1B23P 4DWJA 4GMGA 1IXRC 4C5CA 4C22A 3AOGA 1QHHA 4ER5A 3K31A 4J43A 5HDBB 3DBOB 2YYYA 2IIPA 3G7SA 1T0PA 3C4VA 4GICA 3SLKA 1HFWA 2NUAB 4CQMA 5IKOA 2C57A 4LQLA 5EHXA 1ACLA 4YCBA 1YR2A 4YRZA 3NHZA 1NJ5A 4HQLA 1KAGA 3FYHA 3JCZA 2NO9A 3P4YA 3RAEC 2OMEA 3PX2A 5TQ2B 4M0FA 1X6VA 3I9NA 3OJ0A 1V8ZA 2O7QA 2IPLA 4TSRA 3U3XA 1J1IA 5ER6A 1GTZA 2WTEA 2AUMA 3T5GA 4JNKA 2OSVA 3K32A 4LMRA 5HKAA 1L7BA 1SULA 2JGEA 2WIGA 4MWDA 1JHMA 3LOQA 3MAAC 3PDCA 2FPIB 3DFIA 1J99A 3G2MA 3ZHYA 5B64A 5ERGB 3IL2A 3LBNA 2JC3A 1UM9B 3CZ9A 1V35A 1V43A 3SVTA 4G1MB 2OGUA 2R8XA 4KGZA 1Q0LA 2IWRA 3VXKA 4IDNA 5CDTA 2YN4A 3SR3A 2AFRA 3RIGA 2XCSB 1TYEB 3LPCA 3DV2A 2IX3A 1EGHA 2AI3A 4WX2B 3PC6A 2AYXA 5KVSA 4MVWA 1G38A 3DLHA 1SC9A 2EG9A 1CU1A 4IEFB 4H3SA 3SOZA 4I4TF 3KFVA 1V3VA 2FZLA 3COZA 4PAOA 5B12A 1PDOA 3BGDA 4URHA 2REQB 5DTIA 3OY7A 4RVNA 1T36B 3K9LA 5F4ZA 2GN0A 4C3UA 4ZYXA 5CB6A 2C1XA 1GVNB 1OC4A 1Q6ZA 1GRQA 1GKKA 5AVKA 1RYDA 2YCBA