4C89A

Crystal structure of carboxylesterase lpest1 from lactobacillus plantarum: high resolution model
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
341
Chain Sequence
YFQGMPTINSIQTTVNGVVKIVKPFNNDIAGEQFDPHVLQTLTAFKQPAILENDLAALRSGSLTPAIADPVGDAVTVQSRNITALNRTVSVEWLTPQNVINHTVLVYFHGGAFYGGVPGNNTVLLKLVAAKSHCEILNVDYSLAPEAPAPAGILDGLAIFQYLEQRDAETMITVAGDSAGANVIMAATNLNQQLGSNRINQQLLLYPVTAPNADHAGPLWDLAAFPIIDSQRAILTNYHDLFRQLDSIMTDYYVPENFDSHSPLISPLHQENFTMTPPTTIMVGEFDPFRPQAWAYAQRLAAADTATTFIQYQGLNHAFAPLVDQYWQSQDVAQVMAAALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Esterase Lpest1 from Lactobacillus Plantarum: A Novel and Atypical Member of the Alpha Beta Hydrolase Superfamily of Enzymes
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
molecule keywords ESTERASE
total genus 107
structure length 341
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c89A00
2ROQA 1Y37A 5LZ2A 3F96A 4QWMA 1DWQA 1BS9A 5C8VA 5EIHA 1XRMA 3WK9A 4J7AA 4BAUA 2WIFA 5FPPA 5AOBA 5A62A 4BAZA 1CUFA 1HBJA 1CUDA 1LLFA 2WUFA 1WB6A 4HRYA 1DU4A 5D3KA 3KD2A 1QE3A 4N5HX 4ETWA 3PF9A 3N2ZB 1XZDA 1XQVA 1H23A 4ZREA 3ZPXA 2DSNA 4C89A 4E11A 4H18A 4GHWA 3RKSA 5AICA 4DNQA 5HK8A 4XVCA 1GGVA 3AJAA 1IZ8A 4Y2YA 1JT2A 4DSZA 5AKHA 2Y1KA 4S0XA 5F4ZA 4YX9A 2XUIA 5K3EA 3E3AA 4IH9A 3GUUA 3LIIA 2ACKA 4H77A 1EK1A 4QLAA 2XMGA 3FSGA 1VXRA 2G5PA 4LIPD 5CXXA 4K6KA 4X85A 1C4XA 2XI4A 4M0FA 2WFLA 4C87A 3NOXA 4EY6A 1XRQA 3FVTA 3WJ2A 5KBYA 4RE5A 4JNCA 5EFZA 4OU4A 4FBMA 5CTAA 5J3JA 3V1MA 3DJYA 2J3QA 4ROTA 4BCCA 5SYNA 1CVLA 4MYDA 3WLAA 1EVQA 4YK7A 3JW8A 1HPLA 3A6ZA 3DOIA 3O95A 3R41A 2XMQA 1MU0A 5H3HA 2WIJA 5CT9A 4HRXA 2OLEA 4IQ4A 3VKFA 5C81A 4P9NA 1EDEA 2AJCA 3C45A 4B85A 4KRYA 1VKHA 1YASA 5JASA 3D2CA 1J2EA 5BV7A 2CEKA 3A2MA 4ZXFA 5DTJA 5DYWA 2B20A 4EBBA 5JALA 4KJXA 3IB3A 4OCZA 1MAAA 5AM2A 2YH2A 5CH8A 1IUNA 3W9BA 2O2HA 1WHSA 2WG2A 3NWOA 3V48A 5ALYA 4UBOA 3IA2A 5E4TA 2PU5A 2Y2VA 2VJAA 3H1AA 3HRHA 5AO9A 4RE6A 4U2FA 2WFMA 3LP5A 4PF1A 1R1DA 1QIMA 1O6GA 2PX6A 3SWWA 5HK9A 1CUHA 2DHEA 4TGLA 3UMJA 2CJPA 2C58A 2QOEA 2HU7A 5K3FB 4PSDA 5CBKA 5BOVA 1UOPA 3GBSA 4X97A 3GELA 3R40A 4WFKA 1W75A 5AKXA 4BZWA 2V96A 4I4CA 5DNWA 3U1TA 4FLEA 1IVYA 3ICVA 3WZMA 5IVHA 3I1IA 5AIBA 5CXUA 5HQ3A 3HXKA 4X95A 2IX9A 1IZ7A 2HU8A 3CN7A 3WK4A 5E4JA 4LKOA 5ALLA 1BRTA 5AKYA 4UPDA 2PPLA 2HFJA 4L3WA 5EHZA 5DLPA 1W52X 3WA6A 3BXPA 2QS9A 3QBJA 2WG0A 1UK6A 2HIHA 1ZD2P 3FLAA 5A7GA 4GECA 4X6UA 1JKMA 1YS1X 5JATA 2XUQA 1GPNA 1Z68A 4AO7A 4CG3A 3OC0A 3G9ZA 1MT3A 1ZICA 1L7AA 2XMBA 5T4EA 1CLEA 2XUKA 4K2AA 2Z5GA 2PM8A 1SCKA 4BTVA 1MX9A 2WJ6A 1X70A 1QIGA 4DMCA 3TEJA 4B82A 1THTA 4H7KA 3IBTA 5ALRA 3IURA 1UK9A 4Q1VA 3KWJA 5K3CA 2VEOA 1WB4A 1K63A 1U65A 3DD5A 1ZD5A 3YASA 1R50A 4NVRA 4ZWNA 3C43A 1XZIA 4KAAA 2HA5A 5KWJA 5LKAA 4XIIA 3O4JA 4E15A 5HKAA 1HQDA 2DR0A 5CRIA 4L72A 4AX4A 4K6HA 4M0EA 2OG1A 1TIBA 4N8EA 1W4LA 5AJHA 4E14A 3M81A 4A23A 4D9JA 4C4YA 4RGYA 2BUBA 3WI7A 3OURA 2WU3A 1SC9A 2HA7A 3DKKA 1GQSA 2WHPA 1Q0ZA 1DWOA 5IH7A 5HFAA 3IVMA 5LZ4A 3I6ZA 2QR5A 4X00A 4F0JA 4WJLA 4UHCA 1QIEA 2IIVA 3FWHA 2XQIA 3O4IA 2X8BA 4F5ZA 1WCYA 3SX4A 5AM1A 2VAXA 3IUQA 4X93A 2PVSA 3KSRA 3OG9A 1QGED 2O2GA 5LZ9A 1EK2A 5A7HA 3BF8A 5AI9A 3AUKA 4OB7A 2QT9A 5CT6A 3VVMA 3WIBA 1XZMA 2AJBA 5JZSA 3WKBA 1E8MA 2XUOA 3V9AA 4UHDA 4AN1A 4MXDA 4LXHA 4U2GA 3BL8A 1UK7A 2EEPA 1CUWA 3F98A 1BCRA 2BUCA 4Y2VA 3BWXA 1MNQA 4Q3OA 2XUGA 2JGIA 2XLCA 4G9EA 4KYVA 3AFIA 2C4HA 2ZYSA 2RI6A 5AK5A 4PV7A 4AO8A 3GROA 2FX5A 3WQHA 1K6EA 1AKNA 3OPMA 3PE6A 1UWCA 1VZ2A 1FFCA 3PFBA 5JARA 3S8YA 2OCKA 4X90A 4HXEB 2QJWA 1VXOA 1BEEA 2XUPA 3WWPA 2ECFA 1CQWA 3K6KA 4FFWA 1F6WA 4X91A 4C01A 2XUHA 3F67A 4CCYB 1RP1A 4AN0A 1SOMA 1AMNA 3LLCA 1XROA 4PSCA 2BGNA 3DKRA 4FBLA 4KE8A 4J0HA 2H7YA 1YS2X 1MO2A 5JZBA 1K5PA 2GBFA 2VATA 3IUMA 1EHYA 3NGMA 3FNBA 1XQWA 2RHTA 4N8DA 4W1PA 4I19A 4EY4A 1ETHA 4DMHA 4BTLA 2WILA 2PU7A 2DHDA 4CIAA 2JIDA 3RARA 5ALUA 1YAHA 3H2JA 2XUFA 3WL6A 3DNMA 1WM1A 4PNZA 3B3QA 4QWWA 4B0PA 2HU5A 3F9CA 5LZ7A 4RNCA 3W2TA 1IUOA 5LZ5A 5AP9A 4F21A 4QNNA 1BEZA 1CR6A 3R3YA 2Z8XA 2VTVA 4BCBA 3N0TA 3DS8A 2XMDA 5FKJA 1P0MA 5BWCA 1KEZA 3W06A 2PSJA 5HFNA 2OPHA 3I2IA 2FJ0A 4BATA 2V98A 2YYSA 3VJLA 4BAGA 1XZJA 2HA0A 3W04A 2Y6UA 2OAGA 3FCXA 5FXMA 3GZJA 2JEZA 5ISMA 1HKHA 3EIOA 4G8DA 4X6XA 2G4LA 4AMYA 4B7ZA 2GYUA 1SCQA 1ZGCA 3AINA 3WWEA 1QIKA 3I6MA 4W9RA 1QONA 3T4UA 4QDTA 3G9TA 3IIIA 5FLKA 4Y2QA 5JADA 5IVIA 1NU8A 2PKYX 5CMLA 2IITA 4U2BA 2GBGA 3FYTA 2P8SA 1CFJA 4OB6A 1XZFA 1YB6A 4WDQA 2JGFA 4AMZA 2V97A 2I78A 4H7JA 4HZGA 3DYVA 3BF7A 4X92A 2HA4A 3OTQA 3E1GA 1UXOA 2JBWA 1GKLA 4Y2RA 6YASA 2ZSIA 2HA2A 4BRSA 2H7CA 1XZHA 4QZVA 3R3UA 2DCMA 2WTMA 3AZOA 1VE7A 3H2IA 4Q3KA 4Y2UA 3UUFA 3H04A 1CV2A 1ZGBA 3NUZA 1T4MA 3ESDA 5FPQA 1XRRA 2WTNA 3I1YA 1ORVA 4MQLA 4Q05A 5CH3A 4WFIA 3G7NA 3STVA 2G63A 2RHWA 5ALKA 5EGNA 4KAJA 2GBCA 3IUJA 1XRLA 1G42A 3QMVA 3MGAA 2XQJA 5LLSA 2HRRA 1FFBA 1CEXA 1FFDA 4X3CA 3FYUA 2VF2A 4HS9A 2XMSA 3UUEA 2VJBA 1D07A 3G0GA 4LXIA 5C7YA 3O4HA 4OYLA 3BE8A 4GWLA 3HABA 4ITVA 5EHQA 3BDIA 3GFFA 2QM0A 2WIGA 5DYTA 3QPDA 5HZGA 3FYUC 1GZ7A 1R4ZA 4FHZA 4QEKA 1AZWA 2R11A 2XUAA 5JAOA 1E8DA 3O9MA 4NS4A 3U0VA 1CUSA 2I03A 4A16A 1BE0A 1CUGA 1LBTA 2QXTA 3C6YA 3PFCA 4LXGA 4DGQA 5JAHA 1QO9A 4BE9A 4UBKA 1XLUA 2HDWA 3B12A 1ZOIA 1ZD3A 4Q82A 3I2JA 5T4FA 4DNOA 5ALHA 5AM3A 2PSFA 5JIBA 3FCYA 2FJPA 4OUKX 4DLNA 1CUCA 3C6ZA 1DT3A 1LNSA 2QKYA 5C8XA 4LYDA 1VE6A 1QIFA 5JD5A 3CCBA 3FBWA 3G02A 3MUNA 3FVRA 2ZJ7A 4J03A 3S2ZA 2C5GA 1L7RA 3DLTA 3F97A 1E66A 4TVKA 2Y6VA 4OSEA 3EQ7A 4J0DA 2XMRA 3HEAA 4Y2PA 2X5XA 4G5XA 1H2ZA 2JGKA 4L9AA 3WWOA 1EXWA 1VLQA 4ARBA 1H2WA 1Q0RA 5AKIA 3D4LA 1CUBA 1DWPA 1A88A 1H2YA 2QMQA 3CCCA 5CW2A 3QM1A 3G9UA 1P0IA 3FAKA 1UKBA 1EB8A 4ZGBA 1PFQA 2WJ4A 1P0QA 4UBMA 3VDXA 4QA9A 5FRDA 3Q0TA 5ALEA 4N8SA 3V1LA 2XDWA 2Z3WA 5HF5A 3WIOA 5AKJA 3PI6A 2ZSHA 3HACA 3JWEA 1UK8A 1B6GA 1GPKA 3ZI7A 4G9GA 1DTEA 4OPMA 4AZ3A 3C8HA 5AM0A 4KAFA 2BJHA 3D3NA 3STXA 2EDCA 5AI6A 5JZ9A 1TCCA 2WJ3A 1VJ5A 1XZAA 2JGEA 4EY8A 3I28A 3ANSA 3F8SA 2JGJA 1LZLA 1SFRA 1AC5A 3KWFA 2C5FA 4FMPA 3CN9A 4A5SA 1E89A 3TGLA 5CH5A 4F60A 5DNVA 1MJ5A 2YXPX 2OAEA 1GT6A 5ALPA 4QLOA 5LYYA 4INZA 2VA9A 1WB5A 4V2IA 5AHXA 5ALMA 2W22A 4H35A 1R9MA 3D5EA 2OGSA 2V9ZA 3DDUA 4UBIA 4FDMA 4HTAA 1H2XA 4NMWA 4FWBA 3V1KA 2CMFA 1ZIYA 1IMJA 3L1HA 4E46A 3ESBA 3DCNA 1XZEA 1MN6A 2RAUA 4CFSA 3V1NA 1OCEA 1X2EA 5AOCA 1N5MA 2QRUA 3ICWA 4BYMA 2WFZA 2VJCA 3LCRA 1LZKA 3STUA 3QPCA 5AKGA 3QVMA 5JD4A 4IH4A 3C5WP 5AI4A 1OXMA 1U2EA 4KR0A 4UFOA 1NX9A 4KE9A 1A8QA 4LYEA 1TKRA 3E4DA 2WUGA 3DYIA 2B4KA 1RWQA 4CG2A 3H2KA 3C6BA 2O7RA 4N5IX 3C87A 2HL6A 4QDOA 1HDEA 2LIPA 1F0NA 4DYHA 2I3DA 2BUAA 1F8UA 1A7UA 3QMWA 1JJBA 3M82A 1EVEA 1AQLA 2XUDA 4OYYA 4GEGA 3FLBA 4ZRDA 1WHTA 3AZQA 2ZYRA 2C0PA 3A2NA 5LKRA 5FDFA 3ILSA 3R3XA 2OXEA 1UT6A 4DNFA 2H9YA 3STWA 4CIBA 3ESCA 3H2GA 5IKXA 3JYHA 1KU0A 2YASA 4UBJA 1YB7A 5K3BA 1THGA 2WU4A 2J4CA 4KACA 2VT7A 1DT5A 1FFAA 1CPYA 1QOZA 5JANA 2E3JA 1XZGA 5HCUA 3R0VA 3TJMA 3BDVA 3MUOA 3DL7A 3R3VA 3GA7A 5DYYA 2QTBA 5KWIA 5I8PA 2AJLI 5AM5A 1XRNA 2JGMA 1A8SA 3L1JA 5AK4A 1HL7A 3QITA 4ZV9A 1XZCA 5AKEA 1TK3A 3R3ZA 3A70A 1XQXA 1ZIXA 1S8OA 3DQZA 2GZRA 2D5LA 4FNGA 5DWDA 5AH0A 4UHHA 4B81A 1XLVA 1MPXA 1GKKA 4I3FA 2O7VA 2AJ8A 2C0QA 2HRQA 4UBNA 4C4XA 2GYWA 4B0OA 4UHBA 5FUMA 4W63A 1YR2A 5FP0A 1R88A 2AXEA 1EA5A 2OGTA 4J0JA 2D0DA 4OD0A 4MEAA 3ZV7A 1TQHA 1JJIA 4PSUA 1U4NA 1G66A 3D59A 1EINA 3WK6A 3OM8A 3BIXA 3R3WA 1UOOA 5AKKA 5AI0A 1CUEA 1FFEA 1K8QA 3WL5A 2VQ6A 1MX1A 2WG1A 2QZPA 3HZOA 3EQ8A 5ALWA 4MYSA 3VJKA 2CZQA 4ARAA 2WIKA 4BDSA 2HADA 4P08A 1ACJA 3CXUA 2XMCA 1CUAA 3PF8A 1AURA 2WFLB 1YCDA 3FLEA 1LPOA 2WKWA 2DQYA 2OQIA 2RGUA 1WPRA 4QDZA 1CUVA 3AIOA 2H1IA 4FNMA 1U8EA 4DMKA 5AK3A 2HFKA 1XLWA 1ODTC 5ALSA 3G0DA 2J4FA 2QVBA 3FYUB 1LGYA 2ORYA 4GW3A 3T52A 2BFNA 1USWA 1RYYA 1CIJA 1BN7A 5JAUA 4JEIA 4Y2TA 1UOQA 1ZI8A 4UUQA 5ALOA 3STTA 3EBLA 1QIDA 3Q8WA 4XJVA 4KRXA 2RONA 1JU3A 2XE4A 3L1IA 2OCLA 5A7FA 2B61A 4K6GA 3D7RA 3B5EA 2OGZA 5EIAA 4FLFA 4FLMA 3AIKA 1L7QA 1EI9A 4BRZA 4HXFB 2J3DA 3DL4A 3ZLTA 4B6GA 4GDMA 2CB9A 4IH1A 4Y9SA 4GXNA 3RK4A 4JYPA 2BKLA 1QLWA 2XT0A 1ODCA 2OCGA 1C7JA 1QIJA 3G0CA 2Y2UA 1C7IA 4TPKA 1G4HA 1LPSA 3VVLA 1XZLA 5ESRA 1AGYA 1JU4A 1N5RA 4G4JA 3HYSA 1ZJ4A 3BJRA 5K3FA 1N1MA 1W1IA 2Q0XA 5HF8A 1MX5A 2BGRA 3KDAA 5ALZA 2HA3A 5LZ8A 3PUIA 1F0PA 1TCBA 2H7XA 2ZYIA 3O9VA 4EUSA 1GXSA 4HVTA 4BE4A 3H18A 1QFMA 1ZI6A 4OU5A 2I3ZA 2B9VA 4CG1A 1AX9A 4Y2JA 4KEAA 4W1SA 1CUYA 3E0XA 4PW0A 2OQVA 1ZI9A 3A2LA 5D6OA 3H2HA 1UKAA 2BCEA 3HI4A 4PO3X 4WDRA 3TRDA 5K5EA 1W6RA 4G4GA 2WHQA 3EF3A 5EHXA 4P92A 5DTIA 1ODSA 2QJRA 1EDBA 4YPVA 5EIEA 2WIDA 3AZPA 4FOLA 4EB0A 3WYDA 3WWCA 4KE6A 1QTRA 2CBGA 4DMFA 4JUIA 4UFNA 1QIHA 3I2GA 3AIMA 4EHBA 5KREA 4J3JA 1OILA 1ACLA 1SCIA 5ALXA 2FUKA 4C4ZA 4K5QA 3H0CA 4MJ3A 2HM7A 1LPNA 4C6HA 2XLBA 1LPPA 4DIUA 2ACEA 4NZZA 4WCVA 4UHEA 7YASA 2JGLA 2PSHA 4G8BA 2VT6A 1I6WA 3WL7A 1EX9A 3IULA 3HSSA 3WKEA 3QPAA 3HLKA 3BIWA 3M83A 1QJ4A 5AOAA 1JMYA 4EZIA 4X71A 5BWBA 4U2CA 1MAHA 1JI3A 4FFVA 3WK7A 1N8SA 1A8UA 1TAHA 4UHFA 4GBGA 1CUIA 1G5FA 1DQZA 2WUEA 5AK6A 4CCWA 3O4GA 1K4YA 2PUJA 1PV1A 5IVDA 5FV4A 4J0KA 3AILA 4AQDA 5LP1A 3G0IA 4AZ0A 3C70A 3KXPA 4B9EA 3MVEA 1FJ2A 1R3DA 1QFSA 4X94A 2WHPB 1XFDA 5T4BA 1PJAA 3KOOA 1CUZA 4YASA 2DQZA 2PUHA 1QTIA 1Q84A 5ALVA 1XZBA 1YAJA 3IUNA 5AKZA 2EDAA 4B9AA 3QH4A 1XQYA 1ISPA 1BU8A 5HF9A 3ZWQA 4WY8A 5AM4A 1UZAA 4G8CA 1VOTA 2BAGA 2XB6A 3HC7A 4QE3A 3W9UA 5K3DA 1Q83A 2NW6A 4O08A 4BVLA 1VZ3A 3WMRA 3BJMA 1LBSA 1BROA 5ALDA 3VISA 4H7FA 5ALGA 1ORWA 1CUJA 2PSDA 3I2KA 1XRPA 2XQGA 4H0CA 1CRLA 1BCSA 1UFOA 4XWGA 4FKBA 4FTWA 2UZ0A 5I9IA 5AKLA 4AXBA 4BDTA 3M3DA 1DX4A 2VAVA 1J06A 3C5VA 1E5TA 4Y2SA 5DNUA 3DOHA 2WSLA 4IHAA 2QUBA 1YA8A 3DEAA 4QDXA 3G8YA 4W1RA 2ONCA 4ZV7A 5YASA 3H1BA 2GBIA 4EY5A 4U2DA 4DM7A 3C8DA 4B83A 4JYMA 3STYA 1LPMA 3OOSA 5E2IA 2X76A 3H17A 4H7HA 1J07A 4GLBA 4XX1A 1T2NA 2O2IA 3VJMA 4M0MA 4MWTA 3P2MA 1CUUA 2ZJ6A 5EHNA 4G1FA 4QDUA 2PL5A 4BB0A 2C7BA 4BP9A 5HF6A 5ALFA 1YA4A 2JEYA 2ZYHA 4UFPA 1DX6A 2XUJA 3QYJA 4BVJA 4BCDA 2XQFA 1JJFA 4Y7DA 5E4YA 5ALTA 1LPBB 1LPAB 2WM2A 1XZKA 4H7DA 3K9BA 2Z8ZA 4BC0A 3O0DA 5AI8A 2JF0A 4CI9A 4C88A 2QXUA 1CUXA 3WWDA 2WUDA 1E8NA 4MEBA 4MQMA 2R8BA 3ANTA 1DINA 4DSAA 4ZI5A 1E3QA 5HKBA 1TCAA 1WOMA 3W05A 2PBLA 1W76A 2RIPA 2ES4A 4BP8A 2GYVA 1J1IA 3I2HA 5C8ZA 2OCIA 3D2BA 3ZLVA 2DFPA 5JAPA 3C6XA 4IO0A 4H7EA 4AO6A 5A2GA 2ZJFA 3WKAA 2G5TA 1H22A 3WZLA 1AUOA 4J0IA 3K2IA 5D3ZA 1YSCA 5IVKA 1IUPA 4HAIA 3ESAA 4RPCA 5JYCA 4BZZA 3G9XA 3H19A 5A6VA 3D2AA 3RLIA 1R9NA 2HHAA 3WL8A 5ALIA 5HQ3B 3VXKA 2WQZA 2VJDA 4DTCA 3PICA 3WK5A 2K2QB 2WLSA 4BC1A 4X6YA 4DNPA 4EY7A 5CT8A 3LIPA 4KE7A 1Y7IA 3SC2A 1P0PA 5JD6A 1QO7A 1XKTA 4UBLA 4WY5A 2CKMA 2GZSA 5CURA 1FSSA 5AIAA 2QUAA 4Q3LA 4HXGA 5FOQA 3PDCA 2XQKA 4Y2XA 5A71A 1BN6A 4J0GA 4OB8A 3SK0A 1B41A 3WA7A 3I6YA 4AB1A 1M33A 1JMKC 4H7IA 3WKCA 3IDAA 1GQRA 4Q34A 4EA6A 4JH0A 4LHEA 1KU6A 5ALJA 2HA6A 1UKCA 2DHCA 2Z3ZA 4PQEA 3PUHA 3I2FA 3HJUA 2PSEA 1MNAA 3WYNA 1TRHA 2VSQA 4P93A 3X3HA 3QMMA 3QZUA 5D7BA 4Z49A 5LIPA 4J0CA 3D0KA 4BBZA 1HLGA 4WFJA 1X2BA 3ZLUA 1EH5A 1QZ3A 4B84A 4X7BA 2XMZA 1ZD4A 5ALQA 1VA5A 5I7UA 1VA4A 1NU6A 5CT4A 2WHRA 3EQ9A 4GI1A 5CT5A 1EB9A 1QIIA 3ED1A 4BVKA 1ZJ5A 5T4HA 3RM3A 4L0CA 4U2EA 5EI5A 5DJ5A 3G0BA 2ZVDA 3FOBA 3FSGD 1CQZA 1DQYA 2AJDA 3WKDA 1JFRA 1EDDA 5ALNA 4G4IA 3WK8A 4MWSA 1WPXA 1Y7HA 5AI5A 1MTZA 4B80A 2CUTA 5SYMA 1GPLA 1XKLA 5K3AA 3WJ1A 4CCYA 1O6FA 3LS2A 2W6CX 4W1QA
chains in the Genus database with same CATH superfamily
2GERA 2ROQA 1E77A 1E7MA 4OK3A 5JMOA 1OD6A 3NOOA 4IILA 3WGIA 4YR9A 5IXJA 3MCWA 1XMJA 5HE8A 4Z7JA 1U7UA 4TM7A 3IAHA 1JG2A 1GUYA 4DZRA 2VF5X 3OWXA 1U0TA 1YDHA 3PIIA 1X6VA 3WK9A 4ASUD 1GTRA 5JECA 2MT9A 5T8KA 4J7AA 3S44A 3TR0A 1H2RS 1UPFA 4KOAA 5JLAA 2HQOA 2ZTLA 2B4AA 5D5QA 2WIFA 4F96A 1ZKMA 3T61A 5AOBA 4MQ4A 3BRSA 1QYIA 1PFKA 4BNTA 1ATIA 2O4UX 3PRKE 4U0JA 1YZHA 2JAQA 3OH8A 4IWXA 4ETNA 3FPHA 5DXFA 1UXIA 3WYAA 2XA2A 2D2EA 5BRAA 3FZYA 1M2VB 5IAOA 3X1XA 2I67A 2JFQA 4EG7A 4JN6B 4AY6A 1T8TA 2BPOA 2CWWA 3K09A 1MD9A 3K9HA 5AVOA 3TLCA 4CTJA 1P5FA 1RQ2A 3ECSA 2CDAA 1XT6A 2QAGC 3BMQB 5EN4A 1RYBA 4ETWA 1EXNA 1P7VA 2EIXA 3NEJA 4H2DA 4Q9NA 3SVLA 2QQGA 1H23A 4ZREA 3TS1A 3FYHA 3ZPXA 4C89A 1OH8A 2IBTA 5C34B 4E11A 2CGEA 2QUKA 4H18A 3I92A 4GHWA 1L7DA 4ZO7A 3M6XA 5FX2A 3RKSA 5AICA 5J59A 1QLHA 5HK8A 2WJJA 1FFYA 1J9ZA 1R4AA 5DWVA 4ZCPA 1JT2A 2SBTA 3IUPA 4GGPA 1ZNYA 3IKVA 4L8VA 1OH7A 4WK4B 1SIOA 1NM5C 2E4VA 1R12A 2RGEA 2V59A 2WZBA 2XTNA 4AIIA 1BMQA 5A9SB 5M2QA 3L1UA 3IILA 4S0XA 4YX9A 2XUIA 2PH1A 3DWEX 1PNVA 3AFHA 3BB4A 3DYBA 3E3AA 4PPQA 5KDLA 4M7PA 4IH9A 5CVCA 3GUUA 2I2WA 4XGIA 4BFTA 4LNAA 3MOIA 1J0BA 3VOTA 1T3GA 4FEEA 4TTRA 1OZFA 2I55A 3RIGA 2XMGA 3GEEA 1U9JA 3PA8A 2FUCA 4UEWA 1XF9A 5FBZA 4X45A 4YAWA 1NVKA 3PQ8A 2XD4A 3KBOA 4YCLA 2PZKA 2DEUA 4L3OA 3OO0A 3H99A 3LW8A 3QEJA 1NY6A 4YRPA 5C9ZA 5FL7D 4EO7A 2Y1WA 4LIPD 4QKQA 1ZLXA 4WZBA 3V00A 3WAKA 1QVVA 5CXXA 4B46A 3IEVA 1RRCA 4JJ7A 4DLWA 1Z12A 2ISSD 2QAGA 3U26A 5AHKA 4D3SA 2WFLA 1F48A 3I09A 3GJ6A 3NOXA 1ZRNA 2A4KA 2K5UA 4RMGA 3NNNA 1SC6A 4ZN6A 4JNCA 4HQOA 1OIVA 2E7ZA 1XUOA 1Q3TA 5EFZA 3GZNB 5JAIA 4OU4A 2EFHB 5HE9A 1G63A 3ERCA 1V4VA 3V1MA 1RMYA 1JIXA 4J7CA 4FYJA 1L4NA 2UVQA 1G60A 5ES3A 2ZT6A 3O5AA 1U6KA 4HZIA 4O4LB 3RBZA 2I4IA 2NAPA 1LTHR 3OTIA 4XM1A 1REQA 1KR2A 5I7FA 4YHHB 2R6FA 2LW7A 4XGQA 2NT3A 1NUUA 2PGJA 4IGIA 1M1NA 5F4BA 4UM9B 1RU3A 3ESRA 5K3OA 2OL4A 5K0TA 5CW1A 4NENA 3WLAA 2GETA 1UMCB 4G97A 4OFZA 3P8ZA 5JJLA 4OMUA 1QGOA 4RF5A 1JDPA 2QLFA 3FIJA 2LGJA 2OHHA 3IT0A 3ZV4A 3U7EB 1FDTA 2FN9A 4U7TB 4ARCA 1EZZA 1V3VA 1MU0A 3F4KA 3HY3A 1SD1A 4DIFA 4P7FA 4CMGA 2G9UA 2X8LA 3WMGA 4M1OA 3U4MA 1YB5A 3RFTA 3NT2A 3OZBA 1J42A 5C81A 1V8DA 3ADDA 1Q0SA 1D5CA 1T8UA 4MQEA 2GBPA 4JBIA 2HSGA 3KX2A 2A84A 4U5XA 2XWSA 3CZPA 5CX4A 1B8OA 1XU4A 1L5YA 2AJCA 3CX6A 4Q66C 5EE9A 1BDMA 2H4ZA 4QOEA 4KRYA 2J0SA 2JASA 1ISRA 2OZEA 1KE1A 2ZSKA 3HG7A 1J2EA 3AOEC 3TQOA 2JLUA 4MVCA 5CVJA 1GZ3A 5DTJA 2AE1A 5L51A 1PHRA 3TEFA 1FDRA 1Z2PX 4II2A 4N3GA 5DYWA 4PHHA 4D3YA 4H6PA 3QOWA 4N49A 5KOYA 4Q3BA 2X6RA 1T6XA 2X4GA 1QVAA 2YMLA 4FS3A 1QVZA 1JEYA 3LDGA 3LUPA 3GRVA 2P5UA 3MGKA 1CT9A 1DTSA 1FU7A 1R15A 2F3PA 2EKPA 2LCIA 3CG4A 4HF7A 2Q50A 4TMWA 2O2HA 4YALA 2VP4A 3PQ7A 1XWWA 3WX0A 3QFRA 4L50A 1TIKA 1NQTA 5D8DA 3D8UA 2H1WA 4HLUC 5ALYA 3IA2A 2QYSA 4XJSA 2NIPA 3Q5GA 4F4IA 5E4TA 1P5JA 2PU5A 2ZBDA 4QFDA 3T5TA 4M9CA 4BMZA 3H05A 3H1AA 2WPDD 3DVAA 2HWKA 2H17A 3FDFA 3VU3A 3CNEA 3C3BA 4ZVSA 1A1VA 4B1FA 1KQGA 1WEHA 4QUBA 1QC5B 1CRPA 4Y0NA 5FFNA 1A97A 5C80A 2IUEA 3WBJA 2H29A 1QIMA 1YU6A 1O6GA 2H5JA 3L9XA 2QRKA 3SJUA 2BKAA 2LD4A 1CUHA 1RPAA 4EQZA 3ICQB 4RQAA 4G5OA 3JD2A 4R2WA 3A58B 2CJPA 4B3XA 4MWBA 5EWLB 1ZMOA 3ONFA 2HGZA 5EQDA 1UADA 2B8JA 1XNJA 2QTFA 3CNLA 3RVMA 2J3MA 1QQ7A 3TK1A 4YAGA 5CBKA 2AOWA 3EAGA 1UOPA 4L6CA 3BGWA 5IP5A 4IXWA 4KLZA 4BMSA 2C7OA 5CB6A 4GL2A 1RABA 3FN4A 5A4MS 1MC4A 1QDUA 3KYCA 3UN1A 4ZOEA 3CNHA 2VQ3A 4BB6A 1HTBA 3PWZA 2IYAA 1DI0A 1WXDA 2ZI3A 5ILOA 1P2TA 4XI9A 3AU9A 3HHEA 2ZROA 3ENVA 1Y8RA 5AKXA 4RQBA 3RYTC 3S7ZA 4BZWA 2VTBA 1P1JA 1LCIA 2VJPA 1N2IA 2Q1YA 1IZYA 5F23A 2B25A 4RXUA 1MEEA 2Q5OA 4C1BA 1OBFO 3D3KA 3H9GA 4KB5A 4A1OA 3IUBA 3NYWA 2GTPA 1G3RA 4E12A 4ZK2A 2P77A 3CTMA 4MI1A 3O8QB 1IVYA 3I62A 4JOSA 3SKXA 1BWQA 3I1IA 2QLBA 4A26A 3FYCA 2VQDA 4TVSA 3NU1A 2YWDA 5CXUA 3EDQA 1M0SA 2HXSA 4EPVA 3HXKA 3BXOA 1Z3IX 2FHSA 4WNCA 4BZQA 3Q7SA 1ISMA 1GA6A 2IEDA 4I6JA 5F5XA 1TFRA 1IZ7A 2XYRA 2KBEA 3CB4A 1JHUA 4MJLA 4EFDA 3MB5A 5BMOA 4B5LA 4E70A 3PFIA 1IPHA 3RUEA 1LB1B 4LZJA 4J1TA 5CFMA 3F1LA 2BYTA 1M1YB 2IW3A 1N7HA 3DZIA 3M6FA 4G09A 3U13A 4RTKA 5ALLA 3O8QA 1P62B 2XX3A 3U4QA 3KT6A 4ZCRA 4KUHA 3H7AA 4L3WA 1EDZA 3LQ1A 3FUUA 5KSWB 4AYXA 1ACMA 2EZ8A 5EHZA 1Y3HA 2B6HA 3HS3A 1W52X 2NO7A 4OHZA 1A9ZA 3DUFA 3EEFA 4XX0A 3AF4A 1W4CA 1Z83A 2KYRA 2UZ1B 3BXPA 1WW8A 3VDNB 3ZY6A 1VI5A 2H8GA 3L8CA 2WG0A 1VHWA 4JVOA 1UK6A 3UHAA 2BV3A 5HDQA 3I9OA 4Y1EA 3CRMA 5BT8A 4Q19A 3S1SA 4G4SP 4KLCA 5CPFA 1TEHA 3GAAA 2BR5A 2W4IA 1NW7A 4M9QA 5BRNA 4QEDA 1N6KA 1YE8A 5KYTA 1RWBA 4X6UA 3MNFA 1O54A 1YZUA 3PNQA 4NZOA 3L6UA 5JATA 1GPNA 2D2FA 4G1UC 1Z68A 4G5YA 3KB1A 3I04A 2HHJA 4RL4A 3VAYA 4Q93A 1D03A 3MHTA 4YRAA 3DZBA 1CB7A 4PZAA 4URVR 5GP1A 2XUKA 4K2AA 3FUTA 1HG0A 2CLKB 2CVOA 3HWX1 2ZIXB 3O74A 1SCKA 1F51E 1SZDA 2PNJA 4KQJA 3UCXA 2WJ6A 3QF4B 4B32A 1QIGA 4DCUA 4AN4A 3PSHA 4KGXA 1MV5A 1U8FO 3FNFA 4FX2A 4H7KA 3EVDA 4RAOA 1XB2A 3MW8A 3V8RA 1VFNA 2ZSJA 4U8HA 3IURA 3KLMX 4WKBA 1IHDA 4JA0A 1NR7A 4Q7KA 1XMSA 3P9NA 2A35A 2IJGX 3CHYA 4B47A 2COUA 3MJFA 5EZSA 4JR0A 2PQMA 1C0PA 2NQ8A 1AVTA 1GYPA 2IC5A 2VEOA 3LXXA 1VHLA 4MUBA 4C0WA 2ZRFA 3H0KA 3EXG1 2NGRA 4BNGA 1U65A 3DD5A 1BDBA 3Q87B 4JOQA 4O02B 4L0QA 3VR4H 4BMDA 4DLRA 2YRFA 1B23P 3CZRA 4P4GA 1XHEA 5JS6A 1M2GA 1Z4IA 2PZFA 3CINA 4TLDA 4ZWNA 3PUYA 1XZIA 4UEJA 4KQ6A 2GX6A 1ARZA 4BGDA 1VL2A 4A8PA 1SVNA 2ANCA 4N7BA 2VNSA 3FCCA 3WB9A 3R6GA 1FPQA 2D06A 3IAM1 5IDVA 1HQDA 3VH2A 4E2ZA 5KNBD 2W2TA 2EW8A 1EXVA 3DKVA 4H3VA 1V8ZA 4K6HA 1Y6JA 2IPNA 3VKWA 4WKOA 3JU3A 2FPPA 2PLNA 4LVUA 4ZPXA 3L0CA 4N8EA 1W4LA 5FR2A 4JKYA 4E14A 1FSPA 3EA0A 4TLBA 1PJZA 3VU8A 4MUIA 3NCHA 1Z33A 4Q21A 1JTFA 4XWAA 1F9AA 3VSCA 5JU6A 5FH9A 2IUFA 3TQIA 3HCDA 3GA0A 4HY3A 4EI9A 3LDFA 2WV7A 2QY9A 2JCXA 5F77A 4Z0TA 4H9GA 4BNVA 4OLBA 2HA7A 2YXEA 2YY7A 4M89A 4PZPA 2I65A 1LLCA 5J1TB 3W7AA 1Q0ZA 1HLPA 5JLJA 4LOAA 3A3PA 1K89A 2X1MA 3OU2A 5IH7A 3AUJB 4ON9A 5TXGA 4TWAA 5KEIA 4NIMA 1WXGA 4H7PA 2W8BB 2J30A 2QR5A 4F0JA 3BQNB 3OKCA 4U6NA 1JG1A 4R7ZA 1EDOA 2NZ8A 5BQFA 2O54A 1UP6A 1E4EB 4OHCA 5FIUA 2C3UA 1MEOA 3AEQA 3D3QA 5EWJB 1FS4A 3AQIA 3N5CA 3RRZA 5JCOC 4MIYA 1Z4QA 2IIVA 3W0LB 2GAAA 1PR4A 3AKDA 1G8GA 3GHYA 3AHHA 3TBKA 3QJ5A 4EW6A 3O4IA 2A3RA 5LXTF 1KZ1A 3TR5A 1EU1A 4KFSA 16PKA 3DFUA 1T1JA 4WXPA 1W9HA 4DZTA 5AVTA 1YDWA 2A88A 3SX4A 1YL5A 2PLRA 3E4CA 1DC4A 2JAPA 2B1IA 3C98A 1Z4LA 3IUQA 4QTTB 3R6WA 3NC1C 3RSOA 3LPCA 1GU1A 3KSRA 4D0NA 3SJZA 4NOLA 2IEBA 4QXOA 4RBNA 4X62B 4IGAA 3ZJ4A 1OZ0A 3KJHA 1SK9A 4JELA 2ZYDA 1UQRA 3LY7A 5DEIA 1NP7A 2NX2A 1S4MA 4MYUA 3VBCA 1F6DA 1YJAA 2BGUA 3TL3A 1OWOA 4RKEA 2OYCA 3UT5B 3WRXC 3WQBA 4KQ1A 4PYLA 4YJGB 1NXXA 1HA3A 2H1FA 3L5OA 5COBA 1DG9A 4TLAA 3TQFA 1G55A 1WDKA 4U5QA 2XUOA 4MUKA 1NOKA 5LOVF 2X5JO 1ADGA 1ESCA 1ZRMA 1EXMA 3BCSA 2ZYUX 4G07A 4W9NA 1P45A 1XEXA 4MXDA 4OJYA 1EK5A 2IDJA 1A8PA 1BCRA 2NVBA 3LLMA 3VNVA 1QF7A 3B1FA 4UCXA 3BWXA 3K15A 1TZKA 3NRBA 3RGGA 1MNQA 2XUGA 5HIAA 2JGIA 1KIFA 1PSZA 3HKCA 2O7QA 4B4OA 3RNLA 5KB3A 1ZAKA 3ACCA 4WVLA 1WWKA 3WJ7A 4EECA 2Q3LA 2C4HA 3LWNA 1XDSA 2VCEA 4P1ZA 3EC2A 1DTWA 1W88A 3S2EA 1JR3A 4M1KA 3ZY5A 3W6ZA 4YA6A 2BSXA 2G4VA 3GROA 4I9GA 4F12A 3V4LA 3HSKA 4U9IS 2PJZA 3GAZA 1KI7A 4YRDA 1YRQA 2XXJA 4N3NA 1RR6A 1RZUA 1X1AA 2IUUA 1U90A 2PVPA 5EC8A 2JDIA 5LQCA 1Q95A 2AMVA 5E3HA 2MHCA 1Z2AA 1UWCA 2A33A 1ZK2A 4IIBA 3NVKI 2D0PB 4MLDA 1CWUA 3ZI4A 2X22A 1ZOOA 3PFBA 4FJ1A 4CFZA 3T1TA 5IWAB 4COKA 5AKGA 3IQFA 2A5LA 4TV9A 4UCQA 3O91A 3PUZA 5C4IA 3ZBUA 1I51A 1XWIA 1D5WA 1K97A 4AY4A 1YL7A 2CVPA 2FW0A 2ECFA 1L7MA 2GOYA 2XXBA 3BL6A 3K6KA 1ZNWA 3KKKA 4ARVA 3X43A 4LZAA 5LYJF 2FMTA 2ETXA 2A67A 2ZVQX 4MR8B 2J67A 5TPWB 5KQLA 4UUPA 4X91A 4MIEA 5DYIA 3GT7A 3PXCX 3CT4A 4MUNA 1RIFA 1Z17A 2NUTA 4AZ3B 2ZB4A 1NI4B 4Y8VA 1JA1A 4YT8A 3BD6A 1H3EA 1GPBA 3F67A 4NDNE 1PS9A 2ZAYA 1L7OA 1WF3A 1TM4E 1EP3B 2AC2A 3CVJA 4HWKA 4JYCA 3GFOA 1XROA 4KWIA 4CQLB 5CA1F 1LNQA 3OFJA 3RWBA 1GL6A 3DTVD 3FDIA 2QPOA 2BGNA 4L5BA 3DKRA 4MX8A 4S0ZA 4BVGA 4LWZA 2V9CA 5DGDA 5MN6A 1JHPA 4NCIA 3V8PA 3KR0A 3DW3X 3R8CA 4D3FA 4GPD1 2EW2A 3BTVA 1W36C 4TTQA 2SNIE 1IDOA 1IPEA 3FMPB 4MRNA 3THSA 4HV4A 2JPDA 3KQKA 2XRZA 3SVZA 5AVJA 1DFHA 4EO9A 3JALB 3SXUA 3LK6A 2JKYA 3OKPA 3BAZA 1JEJA 3MWEA 3RSZA 5FA5A 2XVMA 5H7XA 2GBFA 2JIBA 4OK5A 3M34A 4TQUS 3RC3A 3U3KA 4Q3DA 4DMRA 3E5NA 3GIDA 2ZE8A 5LBIA 3KYJB 3IUMA 2W6QA 1OX5A 4P7JA 4Y1RA 1QE5A 1TVKA 2B8NA 1EHYA 1RXSA 2B37A 2JKVA 4JLAA 2W83A 2HSWA 1Y8AA 5ECGC 1ZYUA 1CCWA 1NVXQ 2BHRA 5HGXA 3NI2A 4W1PA 4I19A 2ZBGA 3LBFA 1A4RA 3ZGVA 4EY4A 4KTVE 3WP1B 1T43A 1GVHA 2I3AA 3RS2A 2WILA 4DMHA 1I2CA 5TMDA 3C4QA 3GXOA 3W3AA 1YQEA 3AVWA 3NHYA 3P20A 4AWBA 1UT5A 5LWQA 2BEJA 3H2JA 4IKOA 3KTAB 3MAJA 2JH9A 3ROQA 4KRFA 4L4UA 1B76A 1BZYA 3ETGA 3AY6A 4F2DA 1Q7TA 4C7OB 1EK6A 1A9QA 2OCYC 3GCXA 2H4JA 3DBHA 4P3YA 4GFDA 3RODA 1C1DB 1YL6A 2QVZX 3P0EA 1IJBA 2PL1A 1NLFA 3ES9A 4REQB 1V8PA 1Z6TA 2RH5A 2Z4SA 2HI0A 1Z7EA 4UTZA 1E1NA 4POAA 4IQ8A 2W2QA 3QG5A 4GE3A 1B0AA 1NFQA 4RPIA 5H80A 1SVKA 1RMQA 3NKVA 2O1SA 3QE9Y 1EUYA 2JI7A 3VYVA 2C5BA 1CR6A 3NBZC 3OCYA 3X1KA 2Z83A 3X0DA 4B5KA 2Q5QA 2Z8XA 4PIPA 4PGMA 1W4BA 5HMLA 4KLAA 4ROSA 4CEHB 3K4HA 2AG1A 1K4KA 4MWZA 1XTRA 2I6QA 4JJ8A 1GPYA 4LJ7A 3SDZA 4DR2B 5ENDA 3CBQA 3WR5A 4MQBA 4MRRA 4UHJA 4L3VA 1C4KA 1QRRA 1X87A 3QFFA 4MUEA 4OAQA 3A4NA 4QYIA 4KOEC 4BATA 2LTAA 4RQUA 2P79A 4PFJA 3RS3A 2LKDA 4CIWA 3T7SA 1XTTA 5CLFA 1W19A 3KUXA 2JFPA 3BTOA 3VJLA 3REQB 4BAGA 1XZJA 2P69A 4JI8B 2C1EA 5JMTA 1VPTA 1N1DA 1NVFA 1DXYA 2F1KA 3KQSA 3L79A 2Y6UA 3V5NA 3PFNA 3A9TA 2PX2A 1JG3A 1RC1A 2WJGA 3LUKA 4FE3A 1TQ6A 4CKCB 2I54A 3NTUA 1RXEA 3HJTA 1VPWA 2B9EA 1KO1A 2R62A 1MPTA 4IKPA 5FXMA 4C78A 3RYIB 3O9ZA 7REQA 3ZGOA 3OX4A 3AUUA 5CX1B 3I01M 5HZMA 1HKHA 3M6AA 1EA7A 1WV1A 4RWZA 4JENA 1NURA 4YQYA 4G8DA 4X6XA 4YMLA 3IP9A 4PX9A 4IXMA 2G4LA 4FONA 3C5HA 3VU9B 3WBKA 4LJSA 1G8HA 2YQZA 3PGMA 4IV5A 4B7ZA 3EGWA 2EWMA 4NL4H 1WMAA 2GN4A 4DDMA 2CSXA 5DHFA 3MF4A 5GADl 4CHGA 3ZHOA 1SZPA 1P1BA 1DC3A 2WICA 3OT1B 4EW1A 1ABBA 3AR6A 3KZKA 2W2PA 5JXGA 2A5YB 1DB3A 3KC2A 4UJ3A 4V1CA 4KUGA 4DCPA 4P7KA 1DO8A 1TMKA 3H6KA 2XITA 1E1KA 4QDTA 2B7BA 3ANLA 1NSYA 3G2PA 4F8YA 3U1VA 3LC7O 3U37A 1DO0A 1FVOA 3KT0A 4OIFA 4X66B 1N3YA 2M9MA 2Q21A 4NNOA 4ZTBA 2HMYB 3TQSA 3OE1A 3VHLB 3IR5A 3RVLA 3EEIA 1ZC3A 4FQ5A 3DO6A 2CHGA 3WYBA 4KFCA 2Q3JA 4B73A 3GPIA 4S12A 3RPEA 3ZDRA 2BKEA 1RPJA 3EIWA 4F93B 1GKIA 2OORA 4OQLA 1P4GA 4G89A 3B36A 1CJUC 1U3VA 1G5QA 1VSQA 1XDWA 3FYTA 1OWLA 1XZ8A 3KUUA 3GEBA 4E07A 3IE1A 4J29A 1KY5A 1CFJA 5E6RB 3H1TA 5TQ0B 4OB6A 3K5IA 1GL9B 4LRQA 3QX9A 3VR6A 4AUEA 1BSVA 1YB6A 1DVRA 1GG5A 1W4RA 4FBGA 4E0BA 1V37A 2R8PA 3Q7PA 3RVBA 4F6RB 3B8EA 3PX3A 4MGKR 4D42A 4XD7A 2LCQA 4DBZA 5BN4A 1C8VB 1A1SA 1CY6A 2W6ID 4IBOA 4NJEB 1KFBB 2XOEA 3ONDA 5A5VA 3L0PA 4DSTA 1GV0A 2G71A 2X86A 4BNKA 5JHHB 4B4KA 4YMTA 2QL9A 4F7WA 1ABFA 2P9JA 3DYVA 4B6PA 4R68A 2BDEA 3AR7A 3KCNA 4Z9XA 3M4NA 2OQ2A 3OSZA 4RD2A 4XJXA 3UOGA 4G63A 5JVDA 2PLFA 3TSCA 3CRW1 3QPWA 2CHEA 3CGWA 2CNDA 1TVKB 4LSZA 2QGZA 2X42A 4EYEA 3R77A 5IM4A 2JBWA 3LUAA 1ADCA 3OCZA 3PVCA 3MT0A 6YASA 3JYNA 1J90A 3IAS6 4UVDA 1C3OB 1KBZA 1UAGA 4OIMA 3OPYI 1WCWA 2HA2A 2GMWA 2H7CA 4DJTA 1JB9A 1WKBA 3CEAA 3R3UA 1TAGA 1QDEA 3HWSA 4DEVA 5FL7A 4DLXA 4EB6B 1DEKA 4CLDA 2HAEA 4MHOA 2ZJ8A 2I5PO 4FNOA 3SZUA 3NXKA 1QYDA 1K98A 1CZKA 4GWGA 5H83A 3VZPA 1DQPA 4Y2UA 4CM7A 2VHTA 4ODIA 2BRUC 1MZPA 1LD3A 1RCTE 1T4MA 1PG5A 4TQGA 2OXTA 3SEQA 3VPGA 1A4UA 1SHZA 1RQNA 4QG3A 2WTNA 2I29A 3LLVA 4AK9A 4Q05A 3VR1A 4KYIB 5E1DA 1J2RA 3TECE 2HBRA 1RM3A 5F1YA 2D1SA 1JEDA 4CM4B 1GRCA 1NI4A 5CD1A 3GRFA 1X8KA 1INLA 2DH5A 1ZXBA 1Q44A 4NI5A 3D7NA 2D3WA 1VQ1A 2GBCA 2VPQA 4KAJA 4YCDA 1XAHA 2QYHA 4CZ2A 5AW1A 1HFEL 1YJ5A 4G4SO 4JL6A 4P3XA 1AE1A 1YQDA 1NAHA 3NHRA 1HNZB 1G42A 5NULA 3ZV3A 2J0UA 4NKRA 4ZKDA 1RYEA 4PYMA 3NBXX 3MG9A 1V5IA 2SKEA 4R1LA 3VOSA 3CUEF 1FFBA 1FFDA 1U7ZA 3FFTA 3NKLA 4IG9A 4ME6A 3B1KA 3NHWA 4RULA 1KAQA 2Y99A 5BORA 4X3CA 1KMHB 3FYUA 4HS9A 1RE0A 2P2GA 4QASA 4BO1A 2ARKA 3VDQA 1N9ZA 1OBOA 1OLOA 2G04A 3NFYA 3TG8A 1TGVA 4LJRA 2FOLA 2X1VA 3DOOA 4NQZA 4B6FA 1QH1B 2A57A 1N6IA 3ZD6A 1I4EB 2LBPA 4CKWB 4JP2A 5I9NA 4YFYA 4O63O 1E3DA 2V5AA 4B6OA 5EIXA 1QTQA 1E5DA 1YKGA 4GWLA 4EVIA 3QELA 5B4VA 5KTSA 4U7DA 2WYWA 1I10A 3TW0A 3U39A 1J6UA 1KO8A 3RHSA 1XA3A 1UBHS 4C4RA 2XDAA 2WIGA 2J41A 3JR7A 4JKIA 2Q41A 2QMUA 4X8LA 4XVRA 5T3UA 4C6SA 4CTOA 5LN1A 4FHZA 5KYXA 1H2BA 2AI3A 1AZWA 4CDNA 2ZS8A 4EHNA 1VSBA 2XUAA 5JAOA 3SQWA 3PTZA 3L4EA 3MILA 3O9MA 3PR2B 5D3MB 5F1PA 2XSZD 3MFQA 4ZCMA 3NEYA 1URPA 4CKXA 9GPBA 1EFRD 5JE8A 5LWHA 2PYZA 4JQYA 1ZJ6A 2H11A 2NM0A 2V7UA 3FKQA 1LBTA 4A16A 5I7HA 5KYWB 4GPTA 4LF5B 2NXJA 4YDRA 2A4MA 1H2FA 2J59A 4KVGA 4ZVUA 2GEJA 3L8ZA 3RIXA 2AFIB 3GPBA 3PFCA 4E5VA 2PRSA 2R2GA 4I1SA 5GONF 1QO9A 4ARSA 1PJLA 1XLUA 3B12A 2Y9MB 3TBHA 3C3PA 3MWDB 4D8WA 4ZEVA 1SKBA 1S0UA 4PLHA 4I81A 5HUJA 5D51S 1FSZA 1A2QA 4R3NA 5T4FA 2M1XA 4DNOA 2WLTA 2HKIA 2QMOA 4MW2A 3HDVA 2J6IA 3CW9A 3GH3A 4BZXA 5KX5F 4D92A 4H60A 4ZXPA 3VPXA 1QQBA 5FNVF 2DTDA 4XIGS 1U0SY 5A3SA 3OEYA 1X19A 3M6LA 2AZ4A 3DD1A 4L8YA 3UJ7A 1SBNE 4ZT4A 3BXXA 4EPWA 1P9LA 4X5OA 2AXQA 2FSVC 2VYNA 3R7NA 2WHXA 2ECQA 2DQKA 4W6QA 3IHWA 1GTL1 1A69A 4JT4A 3WHIA 1Z63A 4Z1MD 5EZQA 3L1VA 2HUPA 3V7FA 3G02A 4ZIRA 4LRXA 2O2CA 4JJ4A 3SC4A 3RU9A 1SKAA 1C30A 3R1IA 3FVRA 3PJRA 3N2EA 1RVDA 2Z8YA 3EBPA 3LI2A 4J03A 2H16A 3CNOA 3C4VA 2NTEA 3LBHA 2NZVG 4RY8A 4DJFC 1OI4A 2H2DA 2QRZA 3TPFA 4RSMA 3VNUA 4TVKA 2VF4X 1PVVA 3JVEA 5B1IA 3HDTA 4LBYA 4DLPA 3A8TA 4P98A 3GFQA 3HEAA 4Y2PA 2X5XA 4M76B 5CIYA 2VH2A 4QTXA 3TSAA 2PX0A 3L4KA 1WHTB 2KX7A 3H9EO 5CFQA 4G5XA 1H2ZA 4NEQA 1X7ZA 1RRKA 3SBEA 4XPIB 5CNJA 1EXWA 1NR5A 1Z2OX 2XJ9A 3E3LA 4XOUA 2P27A 1OE0A 3RLFA 1PTJC 1QANA 1WF6A 1H2WA 2Z6QA 1N9GA 1I4TD 1T36B 2ZTVA 3BRCA 1PT7A 4DCOA 1GNVA 1Q2UA 2GCIA 5J2TB 1M2EA 4MW5A 2JCBA 1JUDA 4O5OA 3DPUA 2Y1FA 4CLOA 1RM4A 3WMXA 1GM5A 4AY2A 4D4GA 1S3FA 3HR4A 1H2YA 5AFSA 3FGNA 4QTUB 3OLZA 3OMWA 3HCCA 4FU0A 3X1DA 3ZE9A 2JFYA 2PGNA 2B1RA 2ODPA 3SM3A 1U7WA 1DDGA 4AJ4A 4UTPA 2P9HA 1TF2A 1U7TA 2AEEA 2FPPB 1YR1A 4GGOA 5CW2A 4J1TC 4BJHB 4LYHA 3VUEA 1UKBA 2V1XA 3U40A 2ZYGA 3LK7A 4CM3A 2H06A 4RTJA 3QEAZ 1JFTA 1RJGA 4HATA 3ZWAA 3CO5A 5CG2A 4F3KA 2H4HA 3GO4A 5EG5A 1P61B 1JNYA 4YECA 5FWNA 2W2MA 3T7DA 1SBCA 4LTDA 1U0BB 3RSHA 5J4HA 5B7PA 1A3CA 3Q0TA 1RAAA 4INOA 4OFWA 1DAOA 1T4GA 4N8SA 3V1LA 1YVDA 2Z3WA 1KDOA 2ZCUA 2ZUUA 2BD0A 4UM7A 5HF5A 5IBCA 1X0XA 5JYEA 3LDAA 3HFSA 2G9QA 1E3MA 3PWKA 2BKUA 2PY6A 2BP7B 1CVRA 2VKQA 1V1MB 3AEKA 1ES9A 3DWIA 1M3SA 2IDMA 3CYFA 4DANA 2IIPA 3JWEA 5K6RA 1ABEA 1QFYA 2YJ6A 3MWKA 4E31A 4R71A 1UK8A 1CFZA 3GJZA 1B6GA 3ZI7A 1L3IA 2EIHA 3ICPA 4RCZA 1JT9A 5TVKA 3VNQA 2BEVA 2HMAA 3DR3A 3K4QA 4PYQA 5EP2A 3QLTA 4M54A 1T24A 1NULA 4C3ZA 5KSYA 2R8ZA 2AOUB 3WAGA 5BW6B 2H1LA 1FP1D 2BJHA 4JQOA 3RU7A 2XIJA 1K5HA 1KZ4A 2EDCA 2ZANA 3LGXA 4RY0A 1SQFA 1WMSA 1TCCA 5ILGA 5FT9A 4E4TA 1BVYF 4PC7A 1NQWA 1T4CA 2AG6A 1D2RA 1NMXA 2OY0A 4B33A 3ZQ4A 1GPJA 1LDBA 1SFRA 1AC5A 4D9KA 3AFMA 3BWVA 2C5FA 4HX9A 3GJ8A 2FGKA 5EA2A 3CN9A 1K3FA 1YCHA 2JKZA 3AYZB 1E89A 4PO1A 1W4AA 3AB3A 1AKQA 4GOLD 4A5SA 4KQMA 4OHUA 1II9A 1FFXA 1TOAA 1QHIA 2VPZA 2ETVA 4TRJA 5CH5A 4AKEA 2DH6A 3TX6A 1OQAA 5DNVA 2YWCA 3U4CA 1WXHA 2OAEA 2YXPX 3ER6A 1D2EA 1JILA 1CJSA 3M33A 4Q00A 4X1IA 5ALPA 4EHAA 2X0RA 4F1KA 3ASZA 2PMCA 1JKIA 5LYYA 4INZA 5HZHA 5TS3A 1CLUA 3SNHA 3CZ5A 3VC2A 2OECA 2A0FA 1J8QA 4G2NA 4IXDA 1KQ3A 5DMXA 4BWFB 3KAPA 4XE5A 5TB5A 4CLHA 3BILA 4X54A 4NE9A 5ALMA 3ZXIA 1EYZA 3D1VA 3C24A 2AGVA 1V71A 3TNLA 5COQA 2RJOA 1FRVA 2ADOA 2BZSA 4CE6A 1D1TA 3ZK7A 4RA9B 1ZH6A 3BIJA 2O07A 2HF9A 4W5HA 4LYYA 3UHPA 4EHLA 5DDIP 2ATVA 5J5CA 1BFUA 1B43A 4IGKA 2Q7OE 3B2QA 1K92A 1SXIA 4OMCA 2P41A 4EABA 1KRWA 1NOIA 1AUPA 1XR3A 4FWBA 4J3FA 3OQMA 4A2CA 3ZCPA 4JYZA 3I73A 5IF3A 2XQVA 4IHJB 4HEHA 2VHQA 1U7PA 2IXFA 2IOFA 3EG5A 3GRCA 1UPBA 2W8ZA 1OC2A 3BXGA 2FMHA 4IVRA 2JH8A 2NNLD 3MWFA 1UDCA 3NYQA 4L9SA 4QGAA 5AXBA 2W4QA 5I01A 2BEWA 3PKJA 4EI2A 1CZHA 4FR0A 4IP0A 4QOFA 4BNXA 1U81A 2NN3C 2G28A 3CEJA 1MN6A 3EPJA 1NJFA 1BJKA 2FPMA 2RAUA 4K8OA 2EJTA 5E9WA 4CFSA 3PDIA 4NATA 2DHQA 4P6VF 5E2AA 4EHFA 3K70B 1TQ4A 2HCTA 4RKFA 3X2EA 2CNWD 3L6CA 1VCMA 1VJTA 4DG9A 621PA 3T3OA 2IW1A 1KFEB 3A28A 2PGIA 3OP1A 3QVKA 2CMGA 2IQIA 2VJCA 3E7FA 2OFFA 3VHQA 3HVRA 3PTAA 4OYRA 2QTWB 3HPQA 3I12A 1Y8RB 3HBFA 3M8KA 3NTOA 4H16A 2JGDB 3I9KA 3PFWO 4RD4A 2JI8A 3LKBA 3ZU6A 4BQEA 3IX7A 1DFGA 5CEJA 3ZY3A 1JEOA 3E1KA 4M1TA 2VSXA 2MSNA 2Y0EA 3AM5A 2H4FA 3QWIA 2OLKA 3D81A 3QLEA 2BGLA 3TXXA 1C1XA 3CSUA 1NVGA 1ZNQO 3Q2KA 1U2EA 4KR0A 1PZXA 1NX9A 3NHPA 5IXYA 2IZ7A 3KG2A 3PHHA 2FJUA 1U8XX 5JY1A 3NWJA 4LRTB 3CA8A 3IIJA 1JIJA 4LJLA 1E3LA 4HYQA 1GTVA 2JA1A 2K2WA 3EH2A 3JQ8B 1Y98A 1N7GA 4G1MB 4IR7A 3V8QA 3L4JA 2EXXA 1IOWA 5BRJA 1BC5A 3DYIA 1M6VB 3VTZA 1L6RA 4I5GA 1QXSA 5B36A 3GPDG 3L0OA 5ESDA 4ZOCA 2FZEA 2VCHA 3BOSA 2D3TA 1E18A 3A04A 4QG7A 3QJYA 3S4YA 2H92A 3AUYA 3RSCA 2E4YA 3VJRA 2BBSA 2BDTA 2BONA 2O7RA 2IZ0A 3C6BA 5IBRA 1Y4UA 4FCVA 3UMYA 5BP7A 5E4FA 5GVSA 2IKQA 1T1SA 3C87A 3DCIA 4RF2A 3G7SA 2EC5A 2HL6A 2QVXX 2WTAA 3KU4A 1HDEA 2IYZA 2QSUA 3GR6A 3PI7A 1NQVA 4H6WA 1B8NA 4HBZA 4YWHA 4RSRA 3SSMA 4A6XA 4ZOLB 4JEUA 1A7UA 3AHGA 3DOFA 3FTDA 1JJBA 3JQCA 2FPUA 1EVEA 2HJHA 1E5XA 2VPYA 1YRWA 1A9RA 4MIKA 4LJ9A 3ZBPA 4W5QA 1YRYE 1OFUX 2VRWA 2UZ1A 1VKJA 4NYJR 4XDHA 3L0DA 3P7MA 3B6MA 4CM5A 4DIOA 4PGAA 3KEQA 4K46A 2YJTD 4XQGA 2JHGA 3W7VA 5CCEA 1KAMA 3EWSA 5HOQA 3BRQA 1OSNA 1U7XA 1ULZA 2G09A 1SOVA 3EULA 1DS6A 3EZ9A 1TRKA 4LY6A 5K01A 3A2NA 2JLXA 1L7BA 1UBCA 2SCUA 2PJUA 3CV3A 2RB5A 1AGPA 3HSYA 4PBTA 3QA3E 2OD7A 4LDRA 3HJHA 1NI3A 1ZX1A 4WNIA 1GPMA 3BWEA 2ZSEA 4MMXB 3KHUA 4HSGA 2Q07A 4HDNB 5IYZA 4FDTA 1P74A 3JQAD 1ONBA 2UV8A 3Q3GE 4GVPA 4MW6A 3SU8A 1QG0A 4UBJA 2R751 3IA7A 5GY7A 4QDKA 4OBBA 2YL2A 1ZCFA 1YDMA 4MJXA 3UMRA 4B3HA 3DAYA 2J4CA 2ZJYA 1E4OA 1EMDA 4FFSA 3H3JA 4KACA 3ZQJA 4DA4A 3LHDA 4AMVA 3I8XA 2V6FA 1IJEA 3A6LA 3P4XA 5JANA 3MJ4A 3I2YX 3BULA 3II6X 3RVSA 4JIGA 2E1PA 4WZ6A 1FLNA 3ORRA 3TJMA 5KJ1A 1NNEA 3COJA 1Y4ZA 4G0YA 3AG6A 3HWRA 2QP4A 1PFUA 3OOYA 2GCGA 4RHTA 3DZFA 4UJ5A 1SVOA 1G5PA 4HMOA 5I7VA 1U9IA 3R3VA 3REFA 5K2MA 4MHSA 3GA7A 1XQ1A 1HV8A 3N0VA 3UIEA 3HCNA 2VHUA 4AKIA 3L4SO 5KWIA 2AJLI 4JP8A 1ZU5A 1IN6A 1I30A 4LDZA 4YUVA 2QPLA 3MLAA 1T3HA 4JR1A 1B6RA 2AOXA 1YI1A 1X7YA 3L1JA 5DASA 3EZFA 1FYWA 2BIFA 3BL5A 4ZV9A 1FDOA 2JCGA 3MD0A 1B4DA 3ONVA 4L7VA 3K1TA 1TK3A 3AY7A 3D6TB 1NLYA 1Z7GA 2HBYA 2BT4A 3R3ZA 4CMEA 4KO8A 4QNRA 3EEOA 4D3XA 1KZGB 3L8FA 4MQFA 1HYQA 1XQXA 1ZIXA 3DQZA 2AOUA 1U94A 2OGWA 3RBVA 5K8UA 1DAGA 1MBZA 3DDWA 4OXXA 4TS1A 5ANRB 1OZAA 2GZRA 1IXSB 3DE5X 3R5KA 1AMUA 2IYXA 1NL3A 3OPNA 2D5LA 1ESEA 3CPSA 1WDWB 1DXHA 3DVAB 4P3PA 1VJRA 4KXMA 4ZA2A 2IXBA 4BFWA 4EELA 1N8TA 4JBWA 5AVRA 1CJCA 1BIFA 5HKOA 1XAGA 1R16A 1UFKA 2QD4A 5AH0A 4NCBA 4UU8A 3EXHC 3EOBI 4B81A 2BZ1A 1GKKA 4IAOA 2O7VA 1R8YA 5EXSA 2HRQA 1P44A 2QZJA 3WGHA 1OLXA 2X5KO 2Y68A 3BEOA 1JBEA 4LI0A 4UBNA 4ZALA 3CE9A 3DWFA 4GVXA 1HGXA 5KYVA 1R4NA 5B12A 1AQJA 4DCMA 2VZ9A 1OAOC 3DTTA 4AUKA 1JHXA 4HPXB 2JBHA 1Z8HA 2VP3A 2XYHA 4D8XA 1Y4DE 3ISTA 5FP0A 4DTIA 4JSYA 4X8MA 4RZHA 3RKRA 4CT5A 1R88A 2XH8A 3RK0A 4J0JA 1VCHA 4R1QA 2GPSA 1B16A 1FRNA 2FSFA 1ZH4A 3DCJA 4D5EA 1T5LA 3GVIA 3IDSA 4C9BA 4P86A 3HB9A 3Q9UA 2A30A 4II7A 4M2LA 3PUXA 3R7DA 3V9PA 2Z3VA 5FEUA 1Z08A 5GIPE 2F4VB 1KPHA 1I7NA 1NY5A 1BCSB 4EF4A 5JV5A 1VJ0A 1BKYA 3V34A 2P3LA 3HBNA 2ZDQA 2AK2A 4C07A 2IE8A 1JJIA 4L0DA 1HORA 2JGRA 1G66A 2Q3EA 3D59A 3GAMA 1ULBA 3Q7IA 3MC1A 4PSKA 1PUXA 1EINA 4MIOA 2GHIA 5D84A 2IXAA 5EUBA 4DRZA 3BZBA 3LHSA 3RT7A 3RUDA 3K0EA 2IUYA 4GX0A 3BIXA 1PJCA 2Z09A 3JQRA 1ZWKA 3PQ2A 3R3WA 4LYJA 5CFLA 4PAWA 2ATCA 2JLQA 2FI1A 4GOND 1JQDA 2FUEA 2PH7A 3NRJA 5B3JC 1K6XA 4ZKEA 4G85A 5WRFA 3WOVA 1JXQA 3KQWA 2PX3A 3R9IA 3ICCA 2QZPA 1TEZA 4TLEA 3TTWA 2V3VA 1BX1A 1ZMTA 1GAWA 2AE2A 5IJAA 2P2ZA 5TX7A 2N75A 4CIXA 1WD7A 4J75A 1BCRB 3VJKA 3BPSA 1GPDG 1Z6AA 2GRAA 3H5OA 3IS3A 5SZIA 4P08A 3ZNQA 5F7XA 1NLMA 2QQFA 2B92A 1P6XA 1YUMA 4IF4A 5DPMA 1YZLA 5I4BA 4A15A 2QPTA 4FGSA 2D5IA 2IYVA 3K9NA 2RARA 1AV7A 4FXPA 2XBUA 1TU3A 3AG5A 3CUVA 4PZEA 2WY2D 4DL9A 2O8EA 1DC6A 5ECDA 4L0MA 2ISQA 1KI9A 3CJQA 3HYCA 2QAGB 1XLTC 1CUVA 1FVXA 2FOIA 1K6MA 1M8PA 2C42A 4NR0A 4OH7A 2G36A 3OFNA 3D6FA 1LFDB 2BTQB 2HDNB 2PGLA 2QRLA 1T9CA 2HFKA 4IUCS 2NZYA 3JWPA 4OQDA 2FW1A 1XLWA 2GPNA 4D6YA 1BWRA 2QVBA 1ORDA 5IJ9B 1KMHA 2IEGA 3FYUB 4ZEMA 1DUSA 1P3JA 1MB9A 5ECWA 4LYFA 1M2FA 4FMCF 4B0PA 2Q2VA 2IU3A 1UCFA 4R9NA 4ZYTA 4IDPA 1ZIDA 5EHGA 3ZXXA 1N8NA 2HIGA 4YCMA 1PR0A 2PUAA 2NSDA 4L7QA 3NEPX 4GNKA 2GEFA 2XZTA 3QKTA 4BLPA 5JAUA 4B6SA 2JK0A 4TRRA 1W47A 2EJUA 4YXFA 1MFZA 2CLLB 4BQQA 5H9WA 1WSBA 3E15A 4AJPA 1W5AA 1QIDA 4WERA 2DB3A 4PONA 4CIVA 2ZSBA 2PLAA 1KEWA 4LHSA 2XXAB 3B8HA 1HH4A 3C15C 4U6SA 3A1CA 3O2NA 3PD0A 4JP3A 4UU7A 5FD8A 1GR1A 4OBEA 1XYVA 2CJFA 1JRLA 4FMBB 5C5IA 1JU3A 3EFOA 5EY5B 3FETA 1PE0A 5F21A 3TLXA 2XE4A 3L1IA 4DQXA 1BDHA 3ER8A 2WB2A 4KODA 2OCLA 1HKUA 2B61A 1O97D 1HE8B 2VWQA 3B60A 1BX0A 5TT0A 1CR4A 1JAXA 1OAOA 2GEUA 2OGZA 5EIAA 2PS1A 2CN1A 4MAAA 4P8RA 4FLMA 4PLVA 5FI3A 2VBGA 1L7QA 1W96A 1UDXA 1RXIA 4BRZA 3LCUA 5SV2A 1UKZA 3KV3O 5AW5A 4QYSA 1GD1O 3RRBA 1JPJA 1NONA 2QBYB 2YXNA 1TNDA 4P81A 5CLHA 2B30A 1QO0A 2XDQB 1V2HE 1KK0A 2E21A 1ULUA 5DF1A 3GLFB 2CB9A 3M6IA 4IH1A 3UPDA 3CO0S 5A4FS 2PKQO 2VYND 4HRVA 1HE5A 3HBLA 3LT1A 3QI2A 2KSQA 3L0SA 5J4LA 1JU9A 1YACA 2RC6A 2YWBA 3G2NA 1D09A 4JA2A 4WLUA 4EITA 5BW5A 2QRPA 5DLQC 2BFOA 1QLWA 4BO3A 3QNWA 1C7JA 5DSZA 1BE1A 3E27A 4AZVA 1QIJA 1RLJA 4BECA 4J4TA 1R9GA 5FBKA 2Y4NA 2P2YA 4RZXA 5KQGA 1NBIA 5I7SA 1RJFA 4BBAA 4NG4A 3MBOA 3GGJA 3BMCA 2ZQZA 1G4HA 1VM6A 2NV6A 4MRMA 3IXLA 4RS4A 1GUBA 3JAWA 1PNTA 3TEMA 1W6UA 1MF7A 2QVCA 1MFPA 3HDQA 4EKIA 2PJDA 2C7QA 2OC9A 4E5YA 1SCUA 4KIFA 1AGYA 4GPBA 4L27A 5GQSA 4AROA 4U9UA 5FBRB 1GJRA 2ET6A 4XWTA 1HE3A 3BJRA 5B1EA 2P5TB 4LXUA 2BH2A 1ETUA 5G4KA 2A7QA 3RS8A 1N2GA 2G06A 3CNNA 1YZQA 5IW8A 1X7ZB 4F84A 3D02A 5FO0A 3UTCA 3HUEA 5HF8A 2BGRA 3KOMA 1JLKA 1IY1A 4XTRA 4CN8A 5KC8A 2HZBA 3ABIA 2ZUBA 1OW3B 2H3EA 2N42A 4GRIA 3MA0A 1BQ4A 1TT7A 4LXYA 4BLRA 3GJRA 1M34E 1ESNA 2P6NA 2YR0A 4AWAA 4BKOA 2FKNA 4RLFA 4G0MA 2OO5C 3TIXB 4ZCLA 5JS8A 1T3SA 2AMJA 2GZDA 2PMFA 2IBSA 3OD5A 721PA 1NN0A 1KGSA 1MORA 2NU7B 3BREA 2X0FA 3HU5A 4W5TA 4F8EA 2DTXA 1QK5A 3WNZA 3FHTA 1HDRA 1Z4MA 2ZTHA 3MTAA 2ZYIA 4NV1A 3KQUA 2NVUB 5DV9A 1U7OA 2P75A 1G5TA 2B78A 3JAWB 2ZPTX 1O6BA 4UU0A 3GLSA 4O2LA 1AS2A 2VHCA 5TF0A 2DLCX 2WYUA 2QX9A 3GY0A 5J2UA 2V4ZA 4MKXA 2OM6A 1W1UA 4JJZA 3AB7A 2C4VA 4QU8A 4J7XA 2Z9DA 3I76A 4FYWA 3V42A 2O57A 4CG1A 3WV4A 3ZG6A 4AL4A 2VSYA 3A06A 4BTEA 2O5CA 1JQBA 4ER6A 4KEAA 4KIWA 1YZYA 3BCUA 4W1SA 5E38A 3DEIA 3DV0B 1O2DA 1P60A 4QDJA 3I1JA 2VHZA 4U63A 3O83A 4G1VA 5BNZA 2OQVA 1I13A 3FF4A 3H5IA 4YAOA 1JPNA 1MRZA 4PHGA 4WNYA 1TUEA 4GG1A 2CHFA 3ITKA 3L2OB 4MROA 3RTAA 3UB3A 4FK8A 4KK3A 5GGXA 3FROA 3ANNA 3S1AB 3HB4X 4XOIA 2BCEA 3HYLA 2JFNA 4PQGA 3MS4A 3GI1A 3W2EA 5JWOA 1IB0A 3SMQA 1PR6A 1W6RA 3ZX5A 4DUGA 4G4GA 1U0OC 3EF3A 4XJTA 2Z2IA 5EHXA 3FRJA 1WBJB 2IEYA 4RVGA 4UHKA 5D5HA 1SWVA 1P7WA 2F1JA 2F6RA 5DMHA 5E7QA 3TLYA 3I9LA 1ODSA 2RGRA 4OFXA 1NASA 4TTTS 4YPVA 1YHZA 1OLSA 4G1CA 3E7PA 3EEYA 5JDIC 4FOLA 4KO4S 5K0BA 5BV0A 4EB0A 1BHJA 3NT4A 1ZA1A 3SQOA 2L18A 1C0LA 5BXYA 3NTQA 4JSRA 4CEJA 4KE6A 4WESA 1B0UA 3PHGA 5DYNA 4E6PA 4GLOA 4JUIA 2UYHA 4FYHA 1Z2NX 3IIKA 3LHKA 3M4JA 3V4OA 4ZJPA 5TQ2B 4IFTA 1QRSA 3EXIA 1L5MA 3QWHA 5KMGB 3FCOA 4J3JA 1EE9A 3KYIB 3EAQA 1P9RA 2CYCA 1SRRA 1OILA 3DO8A 1MG0A 4C3VA 2BHSA 4ZZ0A 3RSQA 1M75A 3EEBA 1EVLA 3QKIA 3QU4A 1J97A 3AJ8A 1EVZA 3GBPA 3A9VA 1R18A 3FDXA 4K9MA 2YRXA 3NCTA 4TSFA 3ZDEA 2HM7A 2X3FA 3L6BA 1H0KA 1LPNA 3IDFA 3UV6A 2O48X 4P3KA 1S3GA 2Z58A 1LPPA 4KDCA 1Z07A 4ZI7B 1KKUA 5IABA 4IQFA 4FHGA 2BBTA 4UDOA 2H59A 4A2WA 1NMYA 2Y76A 4RV4A 1WLSA 1M7BA 2DPXA 1JDJA 3H4MA 3SEAA 3PQDA 5ES4B 3EXG2 4Z4GA 2W6PA 4DJJA 2ZUVA 1JVSA 2WU0A 2BP7A 5FORA 3B53X 1I6WA 4G5QA 1WS6A 3LQKA 4Q0MA 3VSBA 3K73O 4MLCA 2O0HA 5CA0F 4K2HA 1QGUB 2V8BA 4BO9A 3R9XB 1I3KA 3HSSA 3GLHE 2J7PD 3HLKA 3ZGNA 5AOAA 5B3AA 4YN3A 4CMKA 1JMYA 1G20B 1RYFA 4LV5B 3BRWD 3B3AA 2BTOA 2JZCA 4U2CA 1MAHA 3DB1A 2G08A 3KOUA 4KMSA 5IDYA 1XEAA 5IYZF 3WK7A 4BRWA 4Y3UA 1A8UA 1P4AA 3Q6IA 4M99A 4M55A 4Y1RB 1TAHA 3HE3A 4UHFA 1UH5A 4GBGA 1N25A 5A6SB 2V0NA 1CUIA 3V3TA 4GR4A 3DQQA 3L05A 3UANA 4CCWA 3ROKA 1NF8A 1P1CA 4R2MA 4XFKA 2PUJA 2PG3A 2NT4A 3B7GA 1L7NA 5DGXA 5IN5A 4J0KA 1VCOA 1EWRA 2ZJ2A 3SNKA 1B0PA 3TZEA 1E94E 3G0IA 5CNIA 3C70A 2ZREA 4AZ0A 4ER7A 4BN4A 3Q3IA 3T54A 2R68A 3CUYA 3IOYA 2L2QA 4PC6A 2OBYA 3JYPA 4L75A 1WQ4A 3PNYA 1YJQA 1FJGB 4LY0A 4EX7A 1E69A 5F3RA 1KARA 4FW8A 3QE4A 1DJLA 4FYVA 4G81A 3CNBA 1JALA 1AHNA 2PO7A 3FRHA 1Y8CA 3WICA 2BHTA 1PJAA 1ADFA 3KOOA 5G0UA 2BKVA 3QVLA 4MICA 4YASA 3RRJA 3UF0A 1FX1A 1XAIA 2DQZA 2QTZA 4IS2A 4XIJA 1IULA 1SHLA 5JXHA 3OIGA 1KDVA 2F4NA 1XZBA 2DUMA 2X6QA 3CTPA 1SXJE 1UMCA 5JSQA 1RRMA 1WBDA 1QK4A 5F3WB 3K6JA 1T1IA 2L19A 3GT3A 4JHXA 3QH4A 2PGAA 5JMWA 1AB5A 3OT4A 1U9YA 1YZTA 3ME5A 3ZWQA 2W2XA 3M9WA 1O9BA 1RJDA 4EG4A 1M7GA 2GO1A 2DBYA 1E0KA 1V4BA 1L5WA 3R20A 6CHYA 4GNRA 5CYPA 5CDFA 1UZAA 3HK2A 1DBSA 2QXYA 5DM60 4DLZA 3K96A 3GLGA 4X7MA 1Z5GA 1ICEA 2HGSA 2R87A 3W9UA 1PZMA 4JC4A 4YRBA 3H16A 5CK4A 1Q83A 4XM2A 4WLEA 2GH1A 3W5IA 4IIJF 4CLXA 1Z7BA 4I9FA 1S7CA 1ZCZA 2J45A 3NONA 3RYHB 3O94A 2P5SA 1YJCA 1ZSVA 2HF8A 4A5OA 5HG0A 2X41A 3CR3C 1VZ3A 1VSUA 1LBSA 3E0QA 5ALDA 1BH6A 1V11B 1TC1A 5IJXA 1S8AA 3Q8XB 5ICFA 2PXCA 4B2YA 2DBQA 1K8ZB 4O4IA 4DXAA 4F3NA 5H4GA 1ULTA 4HAWA 2MJLA 1NGSA 4IINA 2GILA 2GK4A 3M7IA 5ALGA 1QR6A 3KPUA 5D87A 4H1WA 3ZHRA 3G8CA 2Z6VA 1PWHA 2GWHA 3MJDA 1X86B 1VYUA 1DNPA 3TIGA 1U02A 4BV8A 3LM8A 4BUJA 3PGJA 1UJ5A 1YE5A 3L6DA 4PHFA 4B74A 2EZ9A 1FP7A 4K8RB 2RMKA 2Q6OA 1BCSA 3A10A 3H83A 5C8DA 3QVOA 3TOXA 2BMVA 1YU9A 2Z6AA 1XJCA 5IMSA 1IAVA 4XCVA 1SC4A 2QNBA 3E61A 2CDRA 4FKBA 3ZHSA 5DNYB 1V2GA 6GPBA 4J0FA 3U5ZB 1MOSA 1CS0B 5I9IA 1OTYA 3GWGA 1T6BY 4FDLA 2EF0A 4TWIA 4FI3F 5IASA 4DV4B 3UAGA 3ZUPA 4JMLA 5T41A 3M3DA 4N9QA 2PL9A 3ZNNA 4V02A 4F5DA 4NNJA 4KXYA 4N0EA 4RM3A 5KOIA 3BIFA 2X14A 3R09A 3NB0A 1PLKA 2EKBA 1FW8A 4DRXA 1YF3A 3VHXA 3U44B 1NW4A 1CD5A 1CS4C 1F17A 1JAHA 1JJ7A 3L0IB 1R8XA 2HC9A 4GWKA 4ADSG 5DNUA 4OSPA 3ZGXA 5GV7A 2WSLA 3E8XA 2QUBA 3P52A 3FHJA 1IJFA 1TFUA 5I45A 2GESA 3NBFA 2NZUG 3KD3A 2ONCA 5EMMA 4ZV7A 3H1BA 2GBIA 2F59A 1V9SA 3ZXSA 2V7PA 3T3NA 1OTHA 2CYBA 3O8LA 3OO1A 4U2DA 2NVWA 2Q4DA 4QL3A 1W0KD 1PCXA 1QGYA 3UEOA 6REQA 5JSZB 1FMLA 1Z4PX 5SZJA 3WGJA 2VTBB 1KAHA 4GSKA 2FN3A 1RQGA 2W6NA 4LHVA 3SPXA 4DA7A 4QREA 3N76A 4XX1A 4E32A 2X8JA 4UOQA 4W9NC 5I6DA 2FB9A 4JL8A 3UJCA 2QBYA 1G3QA 1P1IA 4OGFA 3T3PB 4WLNA 1EE2A 4DQ0A 1XDUA 1A76A 2GJ8A 4Z8YA 4E5SA 5EHNA 5TARA 2MDTA 3N2YA 1TEXA 3PQFA 4G1FA 3D0RA 4RKYA 5K3SA 5C8YB 4X0EA 2FVYA 1MQSA 3DLCA 2G6TA 3Q7EA 4LQDA 3SSOA 4QDUA 3T12A 4EMBA 4D26A 4I1OA 5IT0A 1IY8A 1WCV1 3Q41A 5HF6A 5DI9A 3HJFA 1S2NA 1XCOA 3FGOA 1FZQA 3ABSB 2ADFA 2XHEA 3MWEB 2A9OA 4BN0A 2ZYHA 3KKPA 4EB6A 3DMYA 4REOA 1BA2A 4NMLA 4JI2B 2H6EA 2ZYVX 2GKGA 1NATA 2FETA 2XQFA 4PRLA 5CB4A 3SQNA 5IYZB 2E0IA 2I91A 4K0RA 2QX8A 4KPUA 3U4QB 1FDIA 1R0XA 3QUBA 4HWOA 4R2XA 4Q4AA 3LWDA 3WNBA 1RWWA 1JFFB 2CV0A 1GQOA 1Y9DA 2FPOA 1Z0UA 2EX0A 2JL1A 3JZAA 1E9EA 3D8TA 3ZD9A 3GUYA 4F7DA 1QKJA 5AI8A 5HUHA 1EFCA 5CJPA 4C88A 1ZBDA 2ZVJA 3JVIA 5FV7A 1YQXA 4M60A 4V03A 2HREA 4MEBA 5BSKA 1GGNA 1LTKA 3TCXB 3GMSA 3INTA 2G0TA 3IMGA 3FTCA 4XIFA 4GL4A 4NONA 1ENYA 4NYMQ 4PXYA 1E3QA 1D2AA 4DLBA 5F35A 1TCAA 2ERXA 4HQFA 2AI2A 4DFDA 1GARA 1AK1A 2GDZA 3DTYA 4P53A 3GGCA 4RXTA 1AUQA 5H8WA 4O3MA 4MPPA 1NDUA 2D2XA 4FW9A 1SPXA 2H1SA 1YUBA 3QP9A 2VLBA 1K7CA 4YB8A 5GOZA 2GYVA 3PXGA 2O0MA 1KMCA 1U04A 1VBFA 2WZCA 4LZWA 4U7WA 1JIKA 3FBTA 4RDIA 3RE1A 5ECYA 5EXEA 2C00A 3D54D 1M34B 2OCIA 4MP6A 1XWFA 5CIWA 5DH9A 4RJJA 3MJSA 3PRHA 4C04A 3GNSA 5JAPA 1I4DD 2CNOA 3B1YA 1UXGA 5A2GA 1JFLA 1I8TA 2G5TA 2R5NA 3WKAA 4P33A 4G8JA 4RORA 3WRXA 4H4CA 5LA6A 4J0IA 1WKCA 3Q3EA 2V9PA 3K2IA 1HT3A 2O1XA 1N6OA 4O2BB 5D3ZA 3ZU2A 3D1JA 4HC4A 4AAYA 2GM4A 2F3SA 2OBNA 2ORIA 2OQRA 4UNIA 1CB0A 4URYR 1LV8A 5ENZA 2HRZA 2IUTA 1R9JA 3MSXA 3QOFA 3ESAA 4RPCA 3ANYB 5JYCA 4OL0A 4UCWA 4MW1A 3T7EA 2XCIA 3TXAA 3H8SA 4MUJA 1OLXB 1KFCB 3BD8A 3Q0EA 4CNQA 1T0JB 2BFBB 3PVZA 4QODA 4CMJA 4RJTA 5CDTA 5K4AA 3CM0A 3D2AA 4TQ9A 1Z37A 3RYIA 2ZR0A 1CZOA 3WL8A 2OKGA 3L43A 2ACWA 5ALIA 1T2EA 1VCIA 2R4UA 5AUQA 4PC3A 3DF9A 3VR5H 2VYVA 4JLDA 4KX3A 4U3JA 2WQZA 5DHQA 2VJDA 1X1RA 2XZOA 4JX9A 1F1JA 4XQCA 4GR9A 4FDAA 4YLGA 3B6IA 2JGDA 3ZTWA 3QQ5A 4JROA 4F5WA 3BQMB 3P9PA 4X6YA 2PX5A 2RB4A 3V6LA 5C7OO 3FDZA 4DA8A 3CF4G 4HWTA 2C7GA 5HKKD 4KE7A 4HS4A 2DVMA 3KB8A 3WLMA 1T26A 1QO7A 1Z29A 1XIVA 2GNPA 5TF4A 5EEGA 4RA6B 5L53A 1FMFA 1LY1A 3L7YA 3NHBA 2I3GA 3VYSB 3SE0A 4MKIA 3WB0A 3PDCA 1FPMA 1DJPA 3QVWA 4KV9A 1H4TA 5J43A 4ZEXA 2KHZA 2PKCA 4DBVO 3HUUA 3B51X 4KVFA 1NPDA 2C07A 1GU7A 4R2KA 5A71A 1RHRA 4M9RA 1Q7GA 2RSLA 2C1XA 5DM2A 4AS2A 4CL8A 4RANA 5CDUA 3OIWA 3QTLA 5TS2A 2HOQA 3I6YA 4EW2A 4HYEA 1CHDA 1E61A 1JMKC 1ZUWA 1NN3A 2V58A 3JQAA 3OIYA 1TYEB 2QM8A 4H7IA 1SD5A 4HB2A 4U7HA 3GRAA 3W5JA 4CMIA 2XRFA 4O5AA 2O05A 3PFFA 1BQ3A 1BWSA 1XL0A 4MDYA 4JH0A 2J8ZA 2CXOA 5COAA 4RPHA 2CHUA 1KU6A 2CUNA 3GD5A 3GJTA 4FGJA 5GWXA 4CDMA 5I3CA 1RYNA 4OH1A 2OC4A 3MJTA 5D01A 5A3VA 2YCBA 4YJHA 2JVIA 1XXHE 1RJ9B 4D82A 1IN7A 2DLNA 4Q1BA 5DX1A 1P2GA 4QGBA 3FPGA 1U99A 1X1DA 4GI5A 3PNOA 3OZXA 3F3MA 1TRHA 5MGNA 4ZMBA 2P9GA 2R60A 4J4BA 4C4PA 1W0JA 2CXRA 2MYUA 1ITZA 4TMYA 2GI4A 5AXAA 3EZ2A 3QY9A 3WBBA 4QNMA 1KH3A 4MWOA 3NTVA 5K8LA 1N2ZA 3DAFA 2SCUB 4E33A 4JK3A 1PFWA 2ZT8A 1XEWY 1K1EA 2J4DA 3TR6A 4UOZA 3CZAA 1O6ZA 2D7CA 5CEEA 1SUCA 2HXYA 1EFVB 2X2PA 3D0KA 1POXA 3KOZA