4C89A

Crystal structure of carboxylesterase lpest1 from lactobacillus plantarum: high resolution model
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
341
structure length
341
Chain Sequence
YFQGMPTINSIQTTVNGVVKIVKPFNNDIAGEQFDPHVLQTLTAFKQPAILENDLAALRSGSLTPAIADPVGDAVTVQSRNITALNRTVSVEWLTPQNVINHTVLVYFHGGAFYGGVPGNNTVLLKLVAAKSHCEILNVDYSLAPEAPAPAGILDGLAIFQYLEQRDAETMITVAGDSAGANVIMAATNLNQQLGSNRINQQLLLYPVTAPNADHAGPLWDLAAFPIIDSQRAILTNYHDLFRQLDSIMTDYYVPENFDSHSPLISPLHQENFTMTPPTTIMVGEFDPFRPQAWAYAQRLAAADTATTFIQYQGLNHAFAPLVDQYWQSQDVAQVMAAALI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
publication title Esterase Lpest1 from Lactobacillus Plantarum: A Novel and Atypical Member of the Alpha Beta Hydrolase Superfamily of Enzymes
pubmed doi rcsb
source organism Lactobacillus plantarum
molecule tags Hydrolase
total genus 107
structure length 341
sequence length 341
chains with identical sequence B, C, D
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c89A00
2C5FA 3HI4A 3K6KA 4DGQA 4YK7A 1QIJA 1DU4A 1LLFA 1TCCA 5K3AA 1CRLA 4DLNA 5ALXA 5LLSA 1WCYA 2HU8A 4L0CA 3Q8WA 4BBZA 1HL7A 3I2IA 4X00A 3WYNA 1XRLA 5K3CA 3V1MA 2JGEA 5HK8A 1R9MA 1WB6A 2ACEA 3KXPA 4LXGA 3W2TA 5LZ5A 2ZJ6A 4KACA 3WK5A 3H2IA 3R3XA 2O2GA 6YASA 4HRYA 5HF6A 2O7RA 1WOMA 4H7KA 1NU6A 4J7AA 5AOBA 4J0IA 2YH2A 1L7QA 1XQWA 5HF9A 3SX4A 1HLGA 4OB7A 1YAHA 4C88A 3LIIA 2QZPA 4H77A 2R11A 1CVLA 4AZ3A 1UOPA 3JW8A 1GKLA 4LKOA 3T52A 4FNMA 1GPKA 1F0NA 3H19A 4B6GA 3WMRA 2CUTA 2WHPB 1RYYA 4Q34A 2O2HA 3DKKA 4GBGA 4UUQA 5DTIA 4F21A 1OXMA 2ZSHA 3ICWA 4BAZA 4U2BA 1CLEA 4NMWA 4XWGA 5K3EA 3KOOA 1Z68A 2QJRA 2IIVA 2ES4A 4M0EA 5AKKA 5AK5A 1TK3A 2Q0XA 5BWCA 4QE3A 2XUIA 4X94A 1ZJ4A 3YASA 4TVKA 2B20A 4X3CA 3AINA 5DYYA 3FCYA 4EHBA 1XZDA 3HC7A 3IUNA 1ODCA 4V2IA 1P0PA 2XUQA 3SK0A 3HACA 2XUKA 2XQFA 2OCGA 2WTNA 4H7EA 2AJCA 2VTVA 2VAVA 4F60A 1AUOA 3WKDA 4UHFA 4MYDA 2J3QA 1DQYA 2JGFA 4LXIA 2HIHA 4GI1A 2H1IA 1CUAA 2YASA 4B83A 2HL6A 2HADA 5F4ZA 1LPBB 4EY5A 1UXOA 5E4YA 3G7NA 2WIGA 4ZV9A 4BE4A 4E46A 5C8ZA 2ZJ7A 4BVKA 3H1BA 5AK3A 2Z8ZA 3O0DA 5A7GA 4INZA 5ALJA 5ESRA 1MNQA 4F5ZA 4BVLA 2OXEA 2XQIA 5K3BA 3WWPA 5JAHA 5JZBA 4H7HA 3I2JA 1J06A 1C7IA 1H2YA 2HM7A 2CBGA 4FDMA 1GPNA 1ZD4A 5JZSA 5KBYA 5K3FA 1XRRA 1A8UA 2JGLA 5AI9A 1G4HA 1BCRA 3A6ZA 2HA5A 3BF7A 3C6ZA 3BDVA 5LZ2A 2O2IA 1BEEA 2IITA 3KDAA 4J0JA 1E8NA 3C6BA 3FLBA 4B9EA 4JNCA 2VT6A 5IVDA 3FYUB 1FFCA 1BCSA 3C6YA 3FWHA 4HXEB 1T4MA 2WILA 3QYJA 3QPCA 2DR0A 1EVEA 4AO8A 2AXEA 4BP9A 1AC5A 3HLKA 2HA3A 3I2FA 3V1NA 1DTEA 3VXKA 3H2JA 5FXMA 3CN9A 3ZLVA 3H2KA 3IURA 4WDRA 4U2FA 1XZCA 3QMMA 2XUFA 4UBIA 3SC2A 1YAJA 2WG1A 3ZLTA 4MEBA 1ACJA 3C70A 3U0VA 4EB0A 1IVYA 1OCEA 4P9NA 1EX9A 4EA6A 1CUXA 4KEAA 4JEIA 5KREA 3WA6A 2DHCA 1K5PA 3C43A 4G8DA 1ZD2P 4N8SA 3O9VA 4CI9A 1J1IA 4L72A 1H2XA 1TAHA 5ALWA 4BCDA 2DCMA 3R3UA 1MAHA 3CCBA 3UUFA 4G5XA 3SWWA 3IUQA 4XJVA 1AZWA 3O9MA 2CEKA 1ZIYA 1VE6A 2PPLA 5AO9A 3IIIA 3NUZA 2C0PA 2RI6A 1QONA 1VZ3A 1P0MA 2QUAA 1XRNA 3WWCA 4G8CA 1MAAA 1QLWA 2G5PA 1K63A 3R3VA 4B0OA 4NS4A 4MWTA 3HJUA 3AZQA 4B80A 1Y7HA 5LZ8A 5EHNA 2XMQA 1EI9A 5EFZA 1U2EA 1XZFA 2G4LA 1W1IA 5JAUA 4BCCA 3RARA 2PU5A 4B85A 1N5MA 2J4FA 5HQ3A 4CG1A 2WUGA 4RGYA 1QGED 1O6GA 4FLFA 3WK4A 3AFIA 4E14A 3WK7A 1EDDA 3G9TA 3BL8A 1YASA 4RE6A 3G0GA 4B9AA 2OGTA 3C45A 3O4JA 2WHPA 2XUDA 3DNMA 4C87A 4MJ3A 4LYEA 2C4HA 5CXXA 1QIKA 2HFKA 4H35A 1QTIA 3NGMA 2OGSA 5ALTA 4GHWA 1EB9A 5DLPA 2EDCA 1P0IA 3R41A 1XQYA 3B3QA 5HKBA 5AM4A 1JI3A 1CEXA 1CUDA 5AI6A 4OUKX 1X2EA 3HXKA 1VA4A 4G4JA 1XZGA 2Y2VA 2PUJA 3DKRA 3EQ7A 3HEAA 3L1HA 4JUIA 3PF8A 4PO3X 2RIPA 5HCUA 3BXPA 1W4LA 1M33A 3OPMA 2V98A 5AM1A 3UMJA 2XMRA 5FPPA 4KAAA 1QFMA 3L1JA 3EBLA 5JADA 3ESBA 4ROTA 1BROA 5JYCA 1QIIA 1AX9A 4HVTA 3W9UA 1VKHA 3V48A 1FFDA 4Q1VA 2PUHA 1DWOA 2WG2A 3S8YA 1W75A 3FBWA 1UT6A 1VA5A 5K5EA 5LZ4A 1H23A 5AK6A 4CIBA 4CIAA 2XMZA 3CN7A 2RGUA 3AUKA 1ZOIA 4EUSA 1YB7A 5FP0A 5C7YA 1JJFA 3KD2A 1CQWA 1BN7A 5ALNA 1K4YA 5JAOA 4B0PA 1HKHA 2BKLA 5AKHA 4MYSA 5AKYA 3S2ZA 1E3QA 1DWPA 1WHTA 4NZZA 3EQ8A 5AOCA 1QIFA 4KR0A 4H7JA 4X71A 5D3ZA 1G42A 2XMSA 2RHTA 1GZ7A 1SCQA 4EY4A 2XUPA 1QIDA 2ZYHA 3D4LA 5AM2A 1SC9A 4BP8A 2PSDA 1CUJA 4RPCA 1IUPA 3FYUA 1XLUA 5FPQA 2ROQA 5IVKA 4CCYA 4Q3LA 1F0PA 4W63A 3WL7A 2I03A 1BU8A 4J0KA 4KJXA 5T4BA 5JD5A 4DMHA 4XVCA 4DNOA 1XROA 3MVEA 2GYUA 3GZJA 4AB1A 5CT6A 2BGNA 1H22A 3R40A 3W05A 1XZLA 1SCIA 1IMJA 4QDTA 3WWEA 3PFCA 1O6FA 4J0HA 1XQXA 5JD6A 5ALKA 4O08A 5CT5A 4UHHA 5ALOA 3G0CA 2X8BA 3D2BA 1UWCA 1XZAA 4QZVA 1QJ4A 1U8EA 2WU4A 5I8PA 2C5GA 3PDCA 5AKLA 3WJ2A 3VVMA 2FJ0A 3DCNA 2QOEA 1CUCA 4QLOA 5CT9A 1OILA 3KWFA 2XDWA 1R3DA 1CFJA 4WCVA 3JWEA 3QITA 1JKMA 2ZYSA 3H04A 2HA0A 1XZJA 4MEAA 3DYIA 1IZ8A 3O4HA 3AIMA 5AHXA 1W6RA 4QDOA 1NX9A 3OM8A 2WIDA 5T4HA 4A23A 5E2IA 1DWQA 2GZRA 2QMQA 1MO2A 2ECFA 2Y2UA 2G63A 1L7AA 1QO7A 4X6XA 3M3DA 1J2EA 1D07A 4UBKA 1EH5A 3TJMA 3WL5A 5SYMA 4DNQA 4F0JA 5CTAA 2WFMA 1UKAA 1T2NA 3C87A 4GXNA 1CUHA 3DS8A 5ALEA 3D2AA 3C5WP 1C4XA 4CFSA 3T4UA 4OB8A 1ZGCA 3I28A 1JMKC 2ZJFA 1LZKA 3H18A 3RKSA 5E4TA 2PVSA 3BIWA 4ZGBA 1K6EA 5IVIA 3I2HA 3N2ZB 4RNCA 2QR5A 5LZ7A 3AIOA 4A16A 5ALIA 3FNBA 4DIUA 2H7CA 2HU5A 2ONCA 4DTCA 4FBMA 1CUBA 2XUHA 4E11A 5IH7A 1L7RA 3A2MA 4C4ZA 1HQDA 2ZSIA 2QXTA 1EK2A 1XFDA 4G4GA 4PW0A 2WFLB 5YASA 3WL6A 2GYVA 1GPLA 5AK4A 5C8XA 3QZUA 4G9EA 4UHEA 2AJLI 4GLBA 5AKIA 1XQVA 4UHCA 4KE6A 4P08A 2QT9A 1XZBA 3WKEA 4AXBA 1G66A 5D7BA 4GW3A 2OCIA 3E0XA 1CUFA 3KWJA 1JJBA 3I6YA 4U2DA 4I4CA 2X76A 1ZD5A 3TGLA 5HZGA 4JH0A 4L9AA 5CW2A 4BTVA 4X7BA 1R88A 2I3ZA 1AURA 2VEOA 3H2HA 1EINA 1J07A 1ZI9A 3VKFA 2OCKA 3GA7A 2O7VA 3I6MA 2B61A 4BZZA 5SYNA 4M0FA 4N8EA 2XQKA 4ZI5A 3G9ZA 2BGRA 5DYTA 1UOQA 4DM7A 2QTBA 4H7IA 3GFFA 4ZXFA 4KE9A 2XUOA 3OC0A 4Y2PA 3K9BA 2Z5GA 4LHEA 2W6CX 4ARAA 4GECA 3G8YA 5JZ9A 2DFPA 1WB4A 4PQEA 1S8OA 3ZPXA 2LIPA 4QNNA 2VA9A 5LKRA 3RK4A 1VZ2A 5DNUA 3IDAA 2QXUA 2HU7A 3NWOA 4C4XA 3WI7A 4EBBA 1QIGA 4Q82A 3LIPA 3OURA 1GQSA 5AH0A 2PX6A 1QTRA 1E89A 5CH3A 4ZWNA 4C01A 1WPRA 2C58A 3MUNA 1CUSA 4GEGA 1B41A 1K8QA 2OLEA 4BRSA 5AKEA 1LPOA 5AJHA 3R0VA 2EEPA 2WIJA 4WJLA 5ALLA 1ISPA 2ACKA 2JIDA 4AMZA 1UFOA 4UHBA 3K2IA 5EIAA 4N5HX 1AQLA 2VATA 4AMYA 3NOXA 2JF0A 2QS9A 1USWA 4FLEA 3WZLA 5ALFA 3CXUA 1CIJA 1LPMA 3LS2A 3RLIA 4AZ0A 4BAUA 1MPXA 3M81A 4PSCA 2CZQA 4ETWA 3QMWA 4W1SA 2G5TA 4OD0A 3STUA 3WA7A 2WG0A 4QDUA 1I6WA 5HFNA 2VJCA 1N8SA 1VXRA 3STYA 4X95A 3WK6A 2QUBA 1AMNA 2D5LA 2HA2A 4P93A 1ZJ5A 4U2CA 3B5EA 4I3FA 5D3KA 1HPLA 4FTWA 4HXFB 1AKNA 3V1LA 2OQVA 2DHEA 3F97A 3FLAA 5ALDA 5AICA 1P0QA 5CBKA 1LZLA 1FFBA 2V97A 3L1IA 1ORVA 4B81A 3O95A 1U4NA 4KAFA 2VJAA 3H17A 1ZD3A 4X6UA 2C0QA 2Z8XA 3WKAA 2BUBA 1ZICA 4KAJA 2VF2A 4H7DA 4HAIA 5EGNA 3HABA 5A2GA 1X2BA 1HDEA 1XZIA 3WYDA 1IUNA 5DYWA 3DLTA 2GZSA 1MT3A 1YB6A 4B82A 5CT4A 1WM1A 4LYDA 5EIHA 5A62A 5K3DA 5FDFA 5FLKA 2WHRA 3I1YA 5AP9A 4LIPD 3PICA 2JEZA 2XUGA 2HFJA 5CURA 2Z3WA 5DWDA 5T4EA 2XT0A 5CH8A 1LPNA 4QWMA 1YA8A 3BJRA 1QOZA 3PUHA 2Z3ZA 5AKZA 5J3JA 5IVHA 2VSQA 1GT6A 4G4IA 4CG3A 2XUAA 4YPVA 3BJMA 1QZ3A 4G1FA 2RAUA 5HF8A 4WFJA 3DQZA 2RONA 4Y2QA 1U65A 2WFLA 4XIIA 3QVMA 2WSLA 4AO6A 2WJ6A 4KYVA 1ORWA 1UK9A 5AKJA 2PU7A 3PE6A 3VJLA 1UK7A 2Y6UA 2PL5A 1CR6A 2JGKA 1QO9A 3MUOA 2QJWA 4B7ZA 4PF1A 3QMVA 1FFAA 4BC0A 4FMPA 4J0DA 3IBTA 3ZI7A 1R1DA 1VLQA 4G8BA 1QE3A 2E3JA 4QLAA 1LBTA 3BF8A 1ZI8A 3FSGA 3GBSA 5AI4A 4UBJA 3PUIA 3WWOA 3DD5A 1XRPA 5DTJA 3TRDA 4BAGA 2OCLA 4N5IX 3AILA 5ALZA 4I19A 3TEJA 4WFKA 5A7HA 1DINA 3I2KA 3LP5A 4DSZA 1CUUA 1EXWA 2FUKA 2HA6A 2JGJA 4AX4A 3D59A 4B84A 4Y2TA 3HRHA 3IULA 3WIOA 1R50A 3PFBA 2PSJA 4HXGA 1TCAA 3W9BA 2BJHA 1VXOA 3RM3A 1CPYA 4YX9A 1BS9A 3WWDA 3VISA 2AJ8A 3QH4A 4EZIA 5EHQA 2WM2A 2UZ0A 4OB6A 1MTZA 3AZOA 1YSCA 3C8DA 3GROA 3MGAA 3R3WA 4H18A 3DL4A 1DT3A 2K2QB 2XB6A 3AJAA 1MX1A 5AKXA 4KE7A 3X3HA 2WIKA 3HZOA 2BFNA 2WKWA 2FJPA 3ESDA 2WQZA 1LPAB 1VOTA 5CRIA 4Y2SA 2PKYX 4OYLA 5JANA 4J3JA 3IUMA 5FKJA 5HK9A 3JYHA 4Q3OA 5LZ9A 3FYUC 5JALA 3UUEA 4OCZA 1EVQA 1F6WA 2ZVDA 1JJIA 3BDIA 3DDUA 1DX6A 4FFVA 2JGIA 3WJ1A 3GELA 1QIEA 4ZRDA 2EDAA 3A2NA 4IHAA 1HBJA 3STWA 4BB0A 2BAGA 4UFNA 4BATA 4J0CA 3QM1A 1UK6A 1WHSA 5JATA 4DNPA 4AQDA 5BWBA 4KRYA 3E4DA 3VJKA 4GWLA 2XMCA 3G0DA 1QIHA 1GXSA 4Y2YA 2WHQA 2JEYA 4UBLA 3C8HA 4HRXA 2XI4A 1CUIA 1TIBA 4Q05A 3G02A 3G9UA 4Z49A 4C4YA 1KEZA 1BRTA 4NVRA 4AO7A 2OAEA 4FOLA 1KU0A 4UFPA 3M82A 1XZEA 2PM8A 4OPMA 5T4FA 3WZMA 4DSAA 1UOOA 5BV7A 1ODTC 1G5FA 1DX4A 4Y2JA 5ALRA 4UFOA 4N8DA 4UPDA 2IX9A 1CUEA 3C6XA 3FSGD 5I7UA 4MQLA 5DNVA 2XMDA 4BE9A 4DYHA 1JU4A 4Y2RA 4MWSA 3WKBA 5HQ3B 1JT2A 5JD4A 1F8UA 4BRZA 4MQMA 1BN6A 5FRDA 4UBMA 3D5EA 1XLVA 4G9GA 4FKBA 3KSRA 4EY7A 4AN1A 2CB9A 1THTA 3V9AA 1YCDA 1WPXA 3FVRA 4H0CA 5HKAA 1EK1A 1Q84A 3W04A 3B12A 1FFEA 3IA2A 4WY5A 1RWQA 3FLEA 1CQZA 2PSHA 4QA9A 4Y9SA 3ICVA 1CUZA 5DNWA 5AM0A 3ZV7A 1Q0ZA 2Y6VA 1XZMA 1W52X 3E1GA 3ESAA 4QDZA 4J0GA 4YASA 4PNZA 4HZGA 1SOMA 4J03A 4BCBA 2VT7A 4FFWA 5AI8A 2GBFA 4PSUA 1X70A 2DSNA 5LYYA 3LCRA 4P92A 1C7JA 3FVTA 1NU8A 2B9VA 1TRHA 1ODSA 1XZHA 1CV2A 5E4JA 4WY8A 4X90A 3CCCA 1ZI6A 2DQYA 1B6GA 3DYVA 4KE8A 2YYSA 1JFRA 1FJ2A 3R3ZA 3LLCA 1CUYA 3QPAA 2CKMA 4BVJA 4X91A 3P2MA 4BTLA 1A7UA 1EDEA 4TGLA 2V9ZA 4KRXA 4S0XA 3IVMA 2QKYA 3O4IA 3D2CA 4IQ4A 3I1IA 2WJ4A 5AIAA 2H7XA 4K5QA 3W06A 4AN0A 2XUJA 4PV7A 4UBOA 1RP1A 1THGA 2J3DA 4HTAA 5CMLA 4K6KA 2X5XA 1H2WA 4L3WA 4BYMA 1EB8A 2XMBA 4BC1A 1VE7A 2VQ6A 1TKRA 4EY8A 2WUFA 4JYPA 5JIBA 1PV1A 4BZWA 3STXA 1TQHA 2OGZA 3DL7A 2PSEA 3VDXA 1AGYA 2WIFA 2WLSA 2B4KA 2HRQA 1UKCA 3BIXA 3C5VA 1MX9A 2V96A 4K6HA 3VVLA 4CCWA 5ALQA 5A71A 4U2EA 4CCYB 4K2AA 5BOVA 2JGMA 2GBGA 1QIMA 2CMFA 2QM0A 5FOQA 3D3NA 2XE4A 2QVBA 4Y2VA 5AM5A 1UKBA 4U2GA 2WUDA 4UBNA 3H0CA 3WK9A 2ZYIA 3F98A 1A88A 4QEKA 2HRRA 3OTQA 3H2GA 1EHYA 1XRQA 2XMGA 3IB3A 1WB5A 4E15A 5CT8A 4ZV7A 2WUEA 2Y1KA 1Y7IA 5LIPA 4OYYA 1GKKA 3WIBA 1EA5A 3ILSA 3ANSA 3E3AA 3DJYA 1CUWA 2HDWA 3D7RA 1IUOA 4MXDA 1MNAA 4H7FA 2W22A 3R3YA 1LPSA 2GBIA 3F67A 4TPKA 3O4GA 4IH4A 1YA4A 4WDQA 3VJMA 1R9NA 4RE5A 4FBLA 4XX1A 1XKTA 4OU4A 1YS1X 5HFAA 2P8SA 1N5RA 4GDMA 1BEZA 2VJBA 2BCEA 1A8SA 1KU6A 1JMYA 5AOAA 1ZGBA 2RHWA 4W1RA 1E66A 3Q0TA 2I3DA 4W1PA 1Q0RA 4Y2UA 1IZ7A 4ZREA 4BDTA 1DQZA 5JAPA 2PBLA 7YASA 1GQRA 2DQZA 2JBWA 1A8QA 3D0KA 4OU5A 3U1TA 1VJ5A 2HA7A 2OPHA 3DOHA 3EQ9A 2J4CA 3QPDA 5ALSA 3ZWQA 5FV4A 3EF3A 1XZKA 2YXPX 5C8VA 2D0DA 3F8SA 5EHZA 1LGYA 5HF5A 4DMCA 4X85A 1UK8A 1XKLA 3F96A 5AM3A 1Q83A 2XQJA 3ZLUA 4X97A 3QBJA 4C89A 4X6YA 4IH1A 1SCKA 3FAKA 2AJBA 5EHXA 5H3HA 1DT5A 5ALMA 1ETHA 1CUGA 4ARBA 3V1KA 1CUVA 2HHAA 1H2ZA 4W9RA 1E8MA 3I2GA 1SFRA 1MU0A 5AI5A 2H7YA 2CJPA 4DMKA 4X92A 5FUMA 1ZIXA 4FWBA 3N0TA 4M0MA 4Y2XA 5LP1A 1YS2X 2VJDA 1Y37A 3DEAA 5AI0A 4CG2A 3H1AA 1FSSA 3WL8A 4QWWA 3WK8A 4K6GA 3PF9A 2XLBA 4ITVA 1R4ZA 5ALVA 4UHDA 1TCBA 5C81A 1PFQA 4A5SA 1E5TA 5JASA 1MN6A 4HS9A 2XLCA 3AZPA 5CH5A 2XQGA 3ED1A 1GGVA 5IKXA 4DNFA 3F9CA 4D9JA 5CXUA 4QDXA 2ORYA 5EI5A 4X93A 4Y7DA 2WTMA 3FOBA 3I6ZA 3AIKA 2ZYRA 3WLAA 5KWJA 2BUCA 1LPPA 2WU3A 3G0IA 1UZAA 4W1QA 3WQHA 5JARA 1LNSA 5ALPA 5ISMA 5K3FB 5LKAA 2GYWA 4PSDA 1ACLA 4IO0A 4FHZA 5A7FA 4OSEA 2PSFA 5I9IA 2BUAA 2I78A 5ALHA 4LXHA 1MX5A 5ALUA 3OOSA 1E8DA 4JYMA 1XLWA 5EIEA 3IUJA 2OQIA 2AJDA 3OG9A 4Q3KA 2R8BA 4EY6A 2HA4A 2H9YA 3EIOA 3A2LA 2WJ3A 3ESCA 1BE0A 3WKCA 4BDSA 3STVA 3HYSA 3FYTA 1PJAA 1MJ5A 2NW6A 3GUUA 4DMFA 1LBSA 2DHDA 1JU3A 5D6OA 2GBCA 2WFZA 4FNGA 1QFSA 1EDBA 3BWXA 4C6HA 5AKGA 3ANTA 3A70A 4WFIA 3PI6A 1W76A 2C7BA 5ALYA 1XRMA 3G9XA 4FLMA 3M83A 2FX5A 5ALGA 3FCXA 3DOIA 1N1MA 2QRUA 5DJ5A 5A6VA 2OAGA 3STTA 2OG1A 3BE8A 5KWIA 3HSSA 5AIBA 4IH9A 3G0BA 2VAXA 1YR2A
chains in the Genus database with same CATH superfamily
3HGMA 1X1DA 2FZLA 2JVIA 4YK7A 1OKKA 5B7PA 5MF6A 1RDFA 5FA8A 3PVCA 1Y34E 1OFVA 4TXJA 4DLNA 3HGQA 4JCCA 4OAPA 4EUHA 1KO5A 2IH4A 4MINA 2IOFA 3KPYA 4ZO7A 2WABA 1WXEA 3EZ2A 2Q21A 1DKOA 4XUDA 3NBMA 2HU8A 3HR7A 4MB6A 2FW9A 1SR8A 1XR3A 1ISMA 1S7GA 4N0DA 1HL7A 1XTUA 4A6EA 3MBKA 2V5VA 1VJ0A 2R8OA 3FYDA 3WLFA 3NDBB 2YWHA 1XRLA 3F4LA 2EW1A 4LBVA 4BEWA 4UDXX 4B7UA 3FNGA 4UU1A 2JGEA 3GMSA 4YRRA 1HDOA 1HFEL 4MIOA 1DKRA 2ACEA 4MGEA 2ONKA 5JXJA 3KUXA 1V95A 1WF3A 2XOKD 4XPIB 2P3QA 4R5MA 2E87A 4ZQGA 2RKOA 1IEWA 1UM9B 2C7PA 2ZJ6A 2DLDA 4HG2A 2QRNA 4GM1A 1N5IA 3TD2A 1FDIA 2CMDA 3NAGA 2CVPA 2ODWA 3M1AA 2Z5VA 2VUUA 3MB5A 3QLJA 1YB2A 2O2GA 6YASA 3CPHA 4ZHQB 1U28C 3H7AA 1GADO 4FJ1A 3BMCB 2K5UA 4NFHA 4LHVA 4OSOA 1LLCA 2CCGA 2JI9A 3U7HB 3TO5A 4A2PA 3E9CA 3LQKA 4J7AA 4S1TA 2PA3A 2OO5A 3UO8B 4CF5A 1BFDA 2WWHA 1MBZA 4MVJF 1M2JA 4B48A 1XMIA 1DPFA 1NWHA 4KQXA 5ITWA 3TM5A 3VDMA 1JIQA 1SBIA 2VDWB 1K08A 5HF9A 3SX4A 1QR6A 4U4AA 1XMPA 5DM4A 1P5HA 4X8LA 3TCKA 5MGNA 4DIFA 4IDOA 4RAQA 5DCLA 4MUMA 3INYA 1RQLA 3E9RA 3K8QA 4YPOA 3MN1A 1F2TA 2VZ0A 1G16A 2IOHA 3OPYI 4US1R 1MJGM 3TXAA 2AL7A 1ENYA 1O58A 1GPKA 5CA1A 1F0NA 3GJTA 3H19A 3PCRB 5F2OA 3UJ9A 4YUYA 5ICGA 5E7JA 3D8HA 2R6DA 1VGQA 3D8TA 5CPBA 3T7JA 3UAGA 4B6GA 3AEUB 3EGXA 3DHVA 3QKUA 2WAMA 5A4FS 1BDIA 5EUCA 4EHHA 3D6FA 1J8YF 3JQBC 5EIFA 3JVIA 4DLLA 4WAUA 3T1QA 1M1NB 4F21A 1H8ED 2ZSHA 4BAZA 1QH8B 3WLJA 2J9ZB 1OVGA 4EJ6A 3LUFA 1QVZA 2C54A 1NT2A 2GN0A 4M0PA 3PWTA 1ZUD1 2PJZA 3N87A 1RI4A 4RNDB 4BZQA 4XEUA 4XFDA 4QO7A 4F5WA 1DSSG 1OX4A 4XWGA 3SF0A 3W8NA 3WLLA 2PKEA 2PUVA 1OR8A 4MTLA 1Z18A 4L76A 5TQJA 4YIKA 4CUJA 4D79A 3E6AA 2X40A 1NQXA 2ES4A 1XKXA 5FOXA 3ZX5A 7GPBA 2RB5A 3UMMA 1XT6A 1J5XA 4QYSA 5AK5A 3HPRA 5AKKA 1J39A 3CWQA 3U6KA 1J0CA 2FVXA 3D1JA 3FMGA 1H6AA 3IDFA 1QE5A 2OESA 3QE4A 3CB2A 4LHYA 4RWZA 1MJHA 2W6ZA 4UUBA 3MHPA 4UVIA 3KXDA 3X2SA 4HBGA 4LMPA 3QG1A 3ZVMA 2IPLA 4TVKA 4X3CA 1A7AA 4Q9LA 1RYNA 1IPFA 3WYCA 1MHPA 3NTQA 4JOBA 4RV9A 2ZWVA 2HYDA 2ZRQA 3LHFA 2RGDA 3I04A 1BX3A 1GU1A 4TXNA 1GLNA 3HC7A 2JFXA 3IUNA 5KDOA 1G7TA 4YUWA 2HCFA 5ELLA 1K4MA 1QK4A 4COOA 2XRZA 2XUQA 3EXHB 4WN9A 4P0TA 4ZA2A 2IYEA 2AH5A 4BUCA 2VPQA 1VYHA 2LD4A 1IULA 3QEJA 2QBYA 4OGFA 2ZWOA 4G0XA 2RAFA 3IP9A 4WA7A 1G3QA 5JS7A 4F60A 2OCBA 5D5PA 1AUOA 4HCJA 4UHFA 5F9HA 2CDNA 2VP4A 2QSZA 4UZFA 3AQIA 4LXIA 1EWQA 5JY1A 1N8KA 2CLMB 3I42A 4YBZA 3K70D 4FFSA 2X9VA 5K8VA 1EG2A 3EVDA 1PK8A 1SXJA 3X1YA 4KB5A 4MGKR 2RHJA 1SWVA 3E84A 3BTUA 4P81A 4RENA 5K0NA 1MO4A 1H5NA 1NZDA 5G02A 5E4YA 1C4OA 3V80A 2A3RA 4J75A 4DZZA 4P4SA 5EZSA 3PU6A 1PL0A 3G7NA 5KJ6A 1SVOA 2YOFA 2DWOA 3L82B 5D86A 4GI2A 4BE4A 4RY9A 2CNKA 2FPGA 4OHRA 2P78A 3V3TA 3VYUB 2X86A 4TWJA 1A5BB 3H1BA 3O26A 2B7CA 2JIBA 1VPEA 2ZG6A 4GXTA 4I46A 4AG6A 5ADUS 1JFSA 1NBIA 4OHYA 3QVSA 2HLHA 3MXOA 4YRDA 5ICSA 2VSNA 4C29A 2Z8ZA 1C1DB 2Z2JA 3ET5A 4CMEC 1XNQB 4UARA 4PBTA 3GEBA 2IYQA 2WYHA 4INZA 3F6EX 5ICFA 3HSYA 3Q85A 4NQZA 5ESRA 3GD7A 1MNQA 3P97A 4ETMA 3VR4H 3LY9A 4F5ZA 5LQKA 4QQRA 2XNCA 2GLUA 2HRZA 5JAHA 5J4HA 1NG1A 2OHJA 3OEEA 4MJLA 3EDYA 1B14A 1NXWA 3DBHB 1DQSA 1II8A 1N2XA 4MWCA 1GP2A 3UQZA 4BGEA 3GG9A 3GRYA 1X0XA 5E9JA 1IWOA 2GDZA 4RDXA 3AVTA 1WU8A 1C7IA 1G6HA 3IVRA 4IZIA 4RS4A 5H1YA 9ATCA 5I7EA 2RG7A 1IN6A 1E6WA 1QZTA 3WWYA 1Z5VA 1P9NA 2OHGA 5F64A 4CM5A 5K09A 1QP7A 1PQ4A 1HORA 1ZD4A 2D2XA 1KMNA 5EMMA 5J1TB 5KBYA 3ZV5A 2WICA 5KI6A 5K3FA 3IELA 3MGCA 3CT4A 4H6PA 3HZHA 2IIPA 2NO1A 4NU6A 3P5BA 1B74A 4P38A 1IB6A 2V7WA 2WJHA 3LXRA 3K9FC 1MXHA 4BNGA 1V5FA 2NT3A 2W2LA 4J43A 2JGLA 1RJWA 4G1BA 1M8FA 2FEXA 1CVRA 3Q7SA 3U17A 5TX7A 4AKHA 4G07A 2Q2WA 2ZTHA 2FV8A 1GNPA 1PJRA 4RIEA 2F43B 4MZDA 1I3OA 3A6ZA 5BPFA 4QUEA 3UCXA 3CXRA 2QN3A 1BS1A 4IUYA 3EK2A 1ZK2A 2H17A 4QASA 1JAXA 3MSCA 4RHXA 5K0CA 3EJ6A 4WCFB 1IXSB 2PH3A 4PQYA 4DLYA 2XCQA 2XEXA 3LHKA 3MCUA 3MMNA 4GYJA 1IU9A 2PO7A 5CLFA 5GZ3A 1EUZA 1GDHA 3PNMA 2PL9A 2D06A 2IVZA 2OCDA 2WJGA 1LWNA 1NC3A 2ZBDA 1H6BA 1KDPA 3CSDA 3KV3O 5G2OA 3WV4A 4YYZA 1B6RA 1PS8A 3IJEB 4ZOQI 5A1JA 2PS9A 1WKVA 4HDKA 1E8NA 4RK5A 3C6BA 4UNNA 3FLBA 4CM8B 1E3WB 3OQHA 4IVRA 4XARA 2V4UA 4OG2A 3PFNA 5I01A 5KQLA 4CDMA 1POWA 1YQEA 4LXQA 1XJQA 1P7ZA 3ID6C 4RIIA 4Q0MA 3WAKA 3UAYA 2IYLD 3HA3A 2K87A 3GEEA 3FWHA 1DBIA 4XJTA 5LXTF 4HXEB 3N86A 5LLTA 5MN6A 3O1JC 2DR0A 1R64A 3F7TA 4MRSA 3G3EA 1M1ZA 5JLAA 2CNLA 4PZYA 4AO8A 4AP9A 1BE8A 1QYWA 2P0YA 2CMGA 3JV7A 3S2GA 3MZ0A 5TE9A 4BVAA 4AECA 3JWPA 3KJFA 2QTVB 1R0CA 4HB4A 5KOHA 4BPBA 3QKSA 2HA3A 5BO5A 1LY1A 2MMGA 2H63A 2VDMB 2ZRKA 2VDQB 1BXGB 2K4MA 2OCAA 1NR5A 2RJOA 4AI6A 1O57A 2AFVA 1OBFO 2B0CA 3CN9A 3ZLVA 3W3AD 1VMEA 2VTDA 1MH1A 4TL7A 1T1JA 3KETA 5JSKA 1MJNA 2YDXA 3H2KA 3IPCA 3K05A 3IQWA 1XZCA 2ADOA 1OZ0A 2BFDB 4PE5B 3SC2A 3A0UA 1GKIA 4OV6B 2GAFA 1KJJA 1Z4IA 4FW9A 1C3XA 2IKSA 3C70A 3OCXA 3PBKA 4MEBA 4AJIA 4OBXA 5KAPA 1JV2B 4XYEA 5I48A 2EKBA 1PAUA 3HWWA 3IS3A 4NZ9A 4V03A 3T5GA 3IP8A 2GXSA 4WKPA 2YWFA 1KEWA 3G8BA 3S7ZA 4EA6A 1PGOA 4Y1GA 4MLCA 4B32A 3T9FA 1YZLA 1DC8A 1ORIA 2PQ0A 4OMCA 5E2AA 1A2BA 2EZ8A 3KJIA 1X7WA 2PZEA 4YO8A 4C0LA 5ADWA 3QE2A 4H9GA 1K5PA 2V3VA 2J9YB 3C43A 3PQ3A 3L8FA 4G8DA 4MCJA 4QPPA 5IXYA 3HA5A 5IWAB 3ZOZA 1CFZA 2WBLC 4N03A 1RBZA 4DJ5X 3W5AA 4CI9A 4O5AA 2G06A 2IYSA 1ESNA 4EATA 3N8HA 4TMFA 2B35A 4MR7A 4LOJA 4YUVA 1H6DA 4DV3B 4BCDA 4KP7A 2O8EA 2BFBB 5LWHA 2NU8A 4EENA 4QPNA 4QARA 1WHSB 2EX0A 4GZMA 2ZE6A 3B53X 2W5UA 1XP5A 4Z7QB 2QENA 4U2KA 1G8AA 4U7FA 3CCBA 4G5XA 4N49A 4XJVA 5T41A 4Z3OA 4X8HA 5EKXA 1AZWA 3O9MA 1P8JA 4BL5A 4FZJA 5AO9A 5AD1A 1KP2A 3NUZA 4OP3A 2V6GA 1NUAA 4L5JA 2C0PA 2XXJA 2C9BA 1EUDB 1GU7A 1XVIA 2O14A 1QONA 3FPCA 4TQ9A 2WTBA 1P0MA 4L6CA 4R0MA 2FRVA 1T5DX 2Y0PA 1FFGA 1XZPA 3ZLBA 3PEUA 3PR1A 1MP0A 4PO8A 4KXYA 1X7HA 1AKYA 3NHJA 4V0QA 1BIFA 5KQPA 1RYZA 4NS4A 5C7LO 2XDAA 1YJ8A 3ZIAD 3B89A 2ZCVA 3OJ0A 1T1RA 3RAGA 2I0FA 3R20A 3V46A 1FDVA 2Y77A 4P3XA 3K71B 4BNDB 1RJFA 4TSFD 3H8WA 1UBFA 3I53A 3EE6A 3KT0A 4NYJR 1O94D 4P98A 2WA2A 4RZHA 1IOWA 4W8OA 2I7CA 2FSFA 2J7PD 2RH9B 3GUZA 5SZKB 1QHSA 3VBCA 2H2FA 3E3OA 2LR0A 5KQRA 3CRZA 4D97A 1W5TA 3HB9A 3VKWA 5HW0A 4MI1A 4JJ6A 3ZYZA 5LZ8A 5EHNA 1RZ3A 2XMQA 3BZBA 3PVSA 1MOSA 1LF5A 1JAYA 1OYWA 3QKTA 4ILEA 2H1WA 2P65A 4AUMA 4DRXB 1KEKA 4RF2A 2FN3A 4QTUB 4B5KA 2J0SA 2G4LA 2ZU6A 1Z39A 3DE6X 3K6SB 4I3GA 3KHKA 1E9VA 1V5WA 2ZSFA 4P82A 1U02A 2ZRFA 5EG5A 1Q77A 4MV1A 5EE3A 4B85A 2J4FA 3AY3A 1L1QA 2Z8YA 3FLMA 1ML3A 4ROSA 2WSBA 5CLLA 4E7OA 5HQ3A 1KK1A 4ZCMA 3UJNA 3GRCA 4CHGA 4AZTA 3G59A 1H2FA 2C4TA 2R7LA 4JD5A 4O4JF 1O6GA 3B5IA 2UVPB 3GEPA 3AFIA 3KLBA 4FLFA 4R2JA 4D7AA 1Z06A 2G08A 1EDDA 4OHZA 3BL8A 1LLQA 2FP4B 2O2YA 3FVWA 4RE6A 2C8LA 3VDRA 3HCOA 5KTKA 2IJGX 3C45A 1Q1ZA 1ZP6A 1YS4A 2ZIVB 2FSPA 2BRUA 2EG5A 5C34B 4C87A 1OWPA 1O5OA 1QGUB 1RQRA 1XL1A 2H4HA 1E18A 4MJ3A 4OF4A 2JS7A 4ZVLA 2C4HA 4DJEC 4QT4A 1JFVA 2Y76A 1ZJZA 1LS6A 3IPRA 1J8FA 3OZCA 4I1VA 2LDBA 4FXPA 4H35A 4OI0A 3QEMA 1C2YA 3AB3A 4Z4CA 3ZE8A 1KNQA 3N75A 3VR2D 4NCHA 1BVRA 2QMYA 3ENNA 2ZI5A 4JC4A 4PYJA 3OQPA 1A5ZA 4I36A 4TTPA 4B3DA 5JQGB 3FDZA 5KMGB 3KOMA 2XKJE 3AJDA 2YBDA 1PO7A 2P2SA 3AFHA 3I34X 4NDZA 5EXPA 4CU5A 1JDBB 3QKWA 3E5MA 3B3QA 5DISB 3ZGOA 2BHNA 3WGJA 2G9VA 4KXVA 1JI3A 1CUDA 5DP2A 4AY5A 2DFTA 4Q9NA 3EA5A 4RTOA 4Q24A 1VA4A 1TTPB 2FPRA 1B73A 3NO4A 3FJ1A 4PWZA 2A4KA 4AL4A 3EQ7A 3DKRA 3CUYA 2WAOA 2ID9A 3GDGA 1NX6A 3GUHA 1AKWA 4J2HA 4QOJA 3UWDA 3FOZA 1H4SA 2NPOA 3PF8A 2RIPA 1IMOA 4PO3X 3ZD7A 4D0GA 1BX1A 2NZVG 3T3HA 4TLAA 4RPLA 3UGKA 4XR9A 4KFTA 3BXPA 3MT8A 1ZGZA 2G9UA 2ZRAA 3CRNA 1H9BA 4M1KA 4X63A 2GK7A 3BB4A 3NJRA 5H8WA 1UWKA 1J33A 2AF3C 2ZIXA 3HB0A 4NOJA 1AS3A 3RKRA 2W6NA 4F4HA 4EIWA 2XXAA 1NR7A 5C5CA 3CGGA 3DF9A 5E1BA 3TW4A 3DMFA 1VBNA 1QDLB 1TJ4A 3HSKA 2N47A 4M1WA 3TDKA 4G0NA 4PQGA 3IOYA 1BROA 3SPXA 1E1RD 1NFQA 4ZO4A 4MWGA 3WQSB 4YMGA 2O19A 3LX8A 3W9UA 4BJ3A 1RTTA 4AUNA 4GX5A 5AYVA 3PNBA 3TLKA 1MC5A 4LISA 1FFDA 4Q1VA 2Q9CA 2PUHA 4YR9A 2IH5A 2B8JA 1V7ZA 2H16A 2ZBVA 3K8OE 1MIOB 2O1SA 4MA4A 3BH7A 1KMMA 5DULA 1NATA 3R7WA 3S8YA 3TGLA 3PXGA 2J45A 2VYVD 3RRMA 1ZRSA 2COUA 1UFKA 4U02A 2QMOA 1L5QA 2PWPA 2IYOA 4QKQA 3W7VA 3FM9A 3IKLA 5LZ4A 3OMWA 4EY3A 2P40A 4MMZB 3L4KA 3WC4A 4GD3Q 3ZEAA 2JDIA 3FKSD 4YRTA 1M8GA 3LXMA 4F7WA 2FLKA 2VO1A 4IUCS 1FE8A 2VXOA 1T6XA 2NTEA 4FZVA 3WL3A 2REQA 4IEFB 2RGUA 4BO6A 4F38A 2ZW9A 1UBOS 4R54A 3EIUA 3UK0A 2PJUA 2XE7A 1MC8A 4PNEA 4EUSA 3OEYA 2Y8EA 2PX2A 4PR0A 3SYLA 3E7FA 5BXYA 2CCKA 4TQUS 1JHUA 3MWGA 4OBBA 5FP0A 4AWBA 5C7YA 5CLGA 2YICA 4NXNB 1BN7A 1E4EB 1ZFNA 2I2XB 1CX9B 2P9BA 1LJLA 1P1FA 1O97C 2YIVX 3HHPA 4I6JA 4F97A 5JAOA 3THXB 4GSLA 4F8YA 3EISA 4MVJM 5FBZA 2O1XA 4N7BA 1PNOA 5AKYA 4JBHA 2J4DA 5GVRA 4AKSA 3HI6A 4QYTA 1CRZA 3BBPA 3CLSD 2CJWA 1DCKA 1G5RA 4UATA 4LBWA 1VSUA 4IEEA 4X1IA 3WIDA 1JR3D 3I9FA 2Z2ZA 4NZZA 1ZMBA 3VTAA 2H6EA 3CZQA 3S55A 5BSEA 1QGZA 2OENG 3QLVA 2H18A 1MQSA 1QIFA 1L7PA 1E94E 1ODIA 2J9XB 3CZPA 4ZRNA 4U63A 4X71A 3RIYA 2MCFA 5DHRA 2H8GA 1TXGA 5D3ZA 1G42A 3AB7A 2GSWA 4FYYA 4OQXA 1SZDA 1L5GB 4D41A 4HFRA 2XMSA 1GZ7A 3QE3A 2GXUA 2P91A 1FXUA 4K6MA 5L8VA 3HO8A 4L22A 4EY4A 3DXZA 5E6UB 5SV2A 1BYUA 1NV8A 4OQPA 5A6SB 1YQWA 3NNSA 1CF9A 1PGQA 2ZB2A 3GJZA 3HCFA 1QIDA 3OU6A 4MQUA 1SIBE 2QRHA 2ZYHA 3UATA 2DWQA 1E6MA 3FI0A 1SC9A 3KQPA 4C0BA 1XNRB 3HL4A 1JBQA 1PGPA 4C7VA 1G3MA 3KJHA 4Y2HA 4DHEA 4W5QA 1O0BA 3ZQJA 1M2VB 2ZE7A 2ZPUA 1DAMA 1Y9ZA 3C2QA 2PV0A 3DFIA 4IXNA 4P2BA 3VYSB 1T0PA 3WGGA 4RH1A 4C14A 4CLEA 4CTOA 4YAIA 1C8VB 3FSRA 1IBLB 2BDEA 1XLUA 2WKPA 1O6CA 2WK1A 3AOGA 3RSGA 1EQ2A 4BLVA 2F8TA 5JQGF 2WV7A 4K6OA 1E9CA 1BS2A 4E2YA 1A9YA 2IP1A 3QUBA 4ZDIA 4MYRA 5KYXA 3O31A 1H3FA 2VYQA 1OZHA 3AH8A 3RWBA 2W6IA 2BGJA 1JHDA 1E62A 1R0YA 4CQJA 3IQDB 1VPWA 1KE1A 1BU8A 3I73A 1I4OA 3RGWS 2HLDD 4BMCA 1OOEA 2CXXA 4V0RA 3A1WA 4PRLA 1NVVR 1Z7WA 2EBFX 3GFVA 4O2BB 5FUXA 5EIBD 2NX2A 4MI3A 4ZAZA 4E1VA 3SIPA 3WVNA 4EFMA 4DNOA 4CT0A 4NNJA 3UC5A 4GQAA 3FUWA 1XROA 5FWAA 3V8MA 1OI3A 1W48A 2AG1A 4ZCRA 3GZJA 5IJ0A 5CT6A 4ZICA 3A6DA 4BZPA 2BGNA 1H22A 3AONB 2BSQA 2HF9A 1LBHA 3R40A 1GUZA 3NVKI 2HOQA 3MK31 2H54A 3DDHA 1CBUA 1SCIA 2PYZA 2XCIA 2XYHA 2PFSA 4GPEA 3T9CA 1KDTA 3ZDYB 2VP6A 2PCJA 1SOAA 1FX0A 1YGYA 2VK1A 3GX1A 3QX8A 4R3NA 2XA9A 2CZCA 3HCBA 2G0TA 4DVJA 1KWGA 1XQXA 3QELB 5JD6A 2RHHA 1GY8A 1YD7A 2FMFA 4NZYA 3RTGA 3LW8A 1N2EA 2R6AA 2VDPB 3DHEA 3I72A 3ZHQA 4CDGA 4DMUB 3HXMA 3M4NA 2W7TA 3MWEB 3G0CA 3TB4A 3WBBA 1RI2A 1HT0A 4JI7B 1XYVA 6CHYA 3RS7A 3VPAA 2JKYA 5FR1A 1KY2A 2IUUA 3ZHOA 4ZI3A 1KEEA 4HHEA 4DA4A 1YFLA 3JAWB 4P1ZA 5EHIA 4ARIA 4MITA 3N2GB 2PGAA 2CCJA 4LC9A 5FWXA 2C5GA 5I9SA 3RREA 1RWNA 1FP6A 1YKFA 4G81A 4ED9A 4YP0A 3VVMA 4Y7CA 1YZGA 2QOEA 4MVYA 1C30A 3G1UA 1ML4A 2IHZA 2IIBA 4DCMA 1UPUA 4EJ0A 2HBZA 1YR7A 4MV6A 1NI5A 4RKFA 3RPEA 4GWKA 3G23A 3G6WA 3ND6A 1JX6A 2DULA 4X1YB 1OUMA 2WWRA 4QVGA 1JDJA 1QM5A 4XWWA 3QXGA 3GGDA 1GZVA 1HH4A 1OY1A 3EFOA 3VNRA 4EJSB 2VQFB 2HQBA 2JZCA 3AVOA 4DIBA 3HXPA 3H04A 3ME5A 4G1MB 3OC6A 1Y82A 1P7CA 1EZZA 2BFFA 2JJ2D 1IJEA 3AY0A 4MEAA 3E2PA 4PC7A 1E99A 1U7WA 2JLYA 1FYVA 2FRXA 2FWAA 2QY6A 3O4HA 5JRJA 1Z88A 5FPHA 5GM1A 1OU4A 3RAFC 1A9XA 1RC8A 3K4QA 3H1TA 4X64B 4UULA 5F33A 1E2HA 4F72A 2BEVA 2C3OA 4E32A 1OFUX 2C94A 2SCUA 3A4LA 1R9GA 4G0ZA 3VH1A 2MSDB 2QB5A 2FHSA 1N5JA 3FTQA 1AHIA 3W6NA 3DUFA 3MHTA 4QM6A 1KZ7B 4BNWA 3QHPA 3L5OA 3N7TA 3RFUA 1ESMA 2QMQA 1MO2A 1NIJA 3N3BC 2HHHB 1E9EA 2Y2UA 4TKVA 3BAZA 2XYRA 4X6XA 1OAAA 1FP7A 2VWQA 4D5EA 4ZHSA 1ES9A 2BW0A 1AHHA 2XYGA 1K8RA 3MFQA 4R71A 3RG2A 4DNQA 4PHGA 4LFAB 3INRA 1TUBB 3IAEA 3HWX1 3QPVA 3GT0A 2BE7A 1AE1A 4KRFA 2A30A 4H0NA 1W1UA 1IOVA 3A9WA 5DGTA 5JWHA 2PFGA 1T2NA 3C87A 4GXNA 2ENUA 2PUFA 2OZVA 5ALEA 3D2AA 4NPAA 1C4XA 3SEAA 3W78A 4RBNA 2CT8A 3PSAA 4A91A 2I8CA 3T4UA 4JODA 2BN4A 3RH0A 2O7QA 3I28A 4TT3D 1C81A 2EJWA 2ZJFA 2RI1A 1DWUA 1LZKA 4PXSA 4C0WA 1TGVA 4GH5A 3DDWA 4M0CA 1Y1RA 5E4TA 5BXQC 3GLSA 5C1BA 1L5FA 1M6YA 1O0SA 1L7XA 1ZCZA 4AX8A 3ASZA 1KQPA 4M87A 2IRWA 3KYCA 3PFIA 1HXHA 1CDOA 1LDEA 3N2ZB 1EYZA 4DUYB 2B7LA 3FJOA 2QR5A 2X13A 3DGFC 3QF4B 5GMOA 1MGPA 4NECA 1OT3A 2IX3A 5ALIA 4RD0A 2XIQA 1G9XA 3LVFO 1TM2A 2ZUSA 2R8YA 4ZVRA 4ECAA 1Z74A 4F46A 5A04A 3GAAA 3NAZA 2HU5A 3WIUA 2IHUA 2EJTA 5TPZA 3T7RA 2E85A 2IUFA 3GLRA 5F5LA 2Y1FA 4YT2A 3CKLA 5EEHA 3T0GA 4LXYA 4YJ2A 3P9NA 4F4IA 4PLFA 3A2MA 3LVQE 1TC1A 4O2AF 3NATA 4FSDA 2ZSIA 1YH3A 3A25A 3WZ2A 1XFDA 1NC1A 1PUJA 2DJIA 1JHMA 2QGZA 3VZQA 5JV5A 3EY9A 2GCNA 3PGJA 1OYVA 3RR2A 2WFLB 1RPTA 1VE5A 3Q7QA 1J2RA 1HDZA 3QU5A 4LDAA 4RFSB 2HUPA 2VPYA 2Q0QA 4IKPA 1Z0KA 5EHGA 5C8XA 3N7UA 4WH0A 4TMYA 2MDTA 1AKQA 2H85A 2OP1A 3P9SA 4O4HA 1IN1A 1NJ8A 2NVUB 4KH0A 5ECWA 4AZVA 1SNYA 1P4JA 1XQVA 4UHCA 1Q0TA 3BHMA 1OT5A 3EGDA 3OKCA 4MTCA 1TD1A 2UDPA 2I87A 4EKEA 1IHYA 2M98A 1TZKA 4P08A 2HRBA 3H6GA 4MVJP 1H65A 2H59A 2XMPA 1XZBA 4GNRA 5G40A 1JDNA 2F1RA 3EXEA 1ZN2A 5C4IA 1PZGA 1G66A 3P1JA 5D7BA 3UB4A 1VSTA 5KWEA 1YF3A 3MQ2A 3JZDA 1Z47A 1ADBA 4KREA 3WBJA 2FEPA 2V6MA 3U48A 1PR2A 3IIMA 4QJ5A 3GEGA 4G1UC 1JF8A 2FQYA 2X76A 4I4CA 4U2DA 2QPAA 3RHTA 3GPDG 1R6XA 1RZRD 1ZD5A 3TVYA 1FVHA 2W0SA 3U49A 3LBAA 3QEBZ 5DFAA 1ZVJA 2G1KA 2C2MA 1Q7BA 3V34A 4GXRA 2X5OA 3IUPA 2ZI9A 4YALA 5HZGA 5K6AC 4B3SB 1EWVA 1UBHS 4KO3S 3CWZA 1EA7A 2H2HA 1B6TA 2I2WA 1UT8A 1RMQA 2D2IA 3Q1LA 3TOCA 4RESA 1M6HA 5LC1A 2FSVC 2I8AA 2OBYA 4QBHA 1N2CB 2B4AA 5UKDA 4ZTZB 1ZRMA 2ZIEA 5HDQA 4B3TB 2OFPA 2KBEA 2YJ6A 1J07A 2ZYGA 3UK1A 1DUVG 4XM0A 4HXYA 3ICCA 3TLCA 2J5XA 3C1UA 4ZFNA 1ZG3A 2OCKA 1F60A 3A32A 1JUDA 2O7VA 2VDVE 2IOYA 3SR3A 2C78A 1QKIA 1Y8RA 2LDXA 1KQNA 3TMYA 3RAEC 1NOIA 4N8EA 2QE7A 3NTOA 4AQ7A 1LRJA 2EARA 4RTQA 1QQBA 1UXKA 4RMGA 5G0TA 1U1CA 3G9ZA 1M2NA 5K6RA 2P11A 1P31A 4W9NC 4G4SO 2PIDA 4XIGS 1JQBA 3RTBA 2X14A 5EQFA 5J23A 4KW7A 1PEKE 2WJWA 2UYHA 4GBMA 1B23P 1DOAA 5LBTA 2QTBA 4H7IA 1P74A 4TV8B 5DLDA 1RMYA 5HR5A 3LPDA 4Q19A 2XT6A 2RAPA 2Y0EA 4KE9A 1I14A 3W5IA 4BO3A 4ZT2A 4C7XA 3KB2A 1Z45A 1V6SA 3HN6A 4Y2PA 5K8IA 2H0QA 3K9BA 2Z5GA 3BWCA 3RTDA 3KZXA 1L5NA 4ARAA 5JZ9A 1ZNZA 2QAIA 2PUTA 2DFPA 1XSEA 4JWTA 4PYLA 3WNVA 4HC4A 3C85A 2M6LA 1S8OA 3EMKA 3V1UA 2YS6A 2AN1A 1UBMS 5DHFA 1PSZA 1FZTA 1ND5A 1JQDA 1MR3F 2OUKA 3DNFA 3DOUA 3EXIA 5AXDA 4B3CA 4YCMA 3QI2A 3HN2A 4CMIA 2CD7A 3BA1A 3SJAA 1VZ2A 2QLBA 3SCZA 2HU7A 2XAAA 3NWOA 2ZXFA 1HDYA 2CV1A 1DG1G 4EGQA 2WHXA 4N39A 3PE4A 4RL4A 3KQYA 1DFHA 2UUOA 3L7CA 3LC0A 3P9CA 4WGFA 4P3YA 4ZDJA 3KPVA 4CKBB 4CT4B 3UV7A 1D4ZA 4DCOA 1YRLA 5JYDA 1M5TA 2I4OA 2Q3EA 3SJCA 1H3EA 4CMAA 2WAAA 2BFEA 4U7HA 1QIGA 2NZJA 5B1YA 3Q5DA 4ACAA 2OWDA 1NMYA 1ISSA 5BN5A 4Q82A 5EMJA 5IMBA 4D3ZA 1WL8A 1KSFX 3GT3A 3W6PA 4I5IA 3R8XA 2BR4A 3OSUA 4OJQA 3AUJB 2LRHA 3L4BC 2BY4A 1D2CA 1KR5A 2I33A 5CH3A 2AI1A 4ANFA 2CC2A 2JLZA 3M1IA 1WPRA 1AV6A 4H08A 3FZEA 3MUNA 4J2TA 1CUSA 1IZYA 3E9YA 3FTDA 1YUBA 3F5FA 4RCYA 3F9RA 1L9XA 4GEGA 1CJSA 1B41A 4JLUA 2QN7A 1OXSC 1Y5IA 2OLEA 2RGGA 3LZCA 4IMJB 4MWBA 3U4DA 4HPWA 1SBTA 4FYKA 1LBEA 1A9TA 1WDTA 3IEIA 5BV0A 4H6XA 4IDQA 2J87A 4QOGA 3FYSA 2HGZA 2WIJA 4GX1A 4JA2A 1U3WA 2PFKA 5E6RA 1L1FA 4OHMA 3WMXA 3T3PB 2UYCA 2A94A 1I5RA 1C3OB 1OIVA 1X7XA 3RJ9A 1M5RA 4L0MA 3T8YA 4K9OA 3K2IA 1C41A 4NDNE 2QAJA 3A04A 3OT1A 4IIHA 4AMYA 1MXFA 1UBUS 2W6JD 1DTWB 4AZWA 3NUQA 1OMOA 2QS9A 4FB5A 3P4YA 1T8YA 2J9GA 1Y9JA 3DE2X 3OETA 4W5RA 3GA0A 4GVXA 3UWPA 3G8DA 3CXUA 1G18A 1KH3A 3LS2A 3COVA 3KWLA 3RLIA 1BD3A 1FFHA 2A1UB 3M81A 4BAUA 4YUAA 4OJYA 5TY0A 1Z83A 3VAAA 5B2FA 4DR6B 5G3ZA 2CZQA 4G5SA 2P5SA 2X22A 2J6IA 3UKOA 2PZLA 3JZAA 1TJNA 1CTQA 1U9IC 2IGTA 3BXOA 3PQCA 4FFMA 1Q1AA 1WP9A 2CDBA 2GILA 2G5TA 3ZTYA 1KI1A 4JY7A 1B43A 3LPLA 2EOAA 3ND7A 1SG9A 3RS0A 4AJ9A 3Q8XB 3STUA 2VYND 3BMNB 1SCJA 3D5TA 1XDBA 3GT7A 3JWGA 3M6FA 4RADA 3RYTC 4BZXA 3CO5A 4BP1A 4PX9A 4C03A 1I6WA 3F49S 3IAM1 5CNIA 2VJCA 3D0OA 4E03A 4F9FA 1QHXA 4N3NA 3PRJA 1G20E 2Q4BA 1JYFA 1Z17A 2EU8A 4L02A 4TL9A 1A2KC 2J8ZA 3EMVA 3MRXA 1G6KA 3ROTA 2HA2A 4U2CA 3TWOA 1JNXX 3TR5A 4US0R 3V8NA 5CFMA 3HXLA 5DZSA 4LI0A 4R9RA 4YUXA 1RWOA 1Z2PX 1EE9A 4I3FA 5HJ7A 3BB1A 4A15A 1HE5A 4BO7A 2ORVA 4XPIA 4EYOA 2H29A 1H2HA 1EKXA 1ODLA 1U0OC 1E3EA 2VR1A 1P1CA 1UM9A 3V1LA 3WTBA 1S8NA 1FC0A 1JKXA 2OM6A 3RD5A 2DHEA 1P0QA 4N9QA 5L4SA 3AP1A 3P26A 1THMA 4G85A 2RKBA 2BTQB 2V1UA 3SVTA 4LYFA 4BNTA 1H0KA 2V97A 4ENVA 4ZHQA 3BMCA 4RTPA 4UMEA 3DMTC 1QYRA 1XN4A 2B25A 3TMKA 4KAFA 2GNAA 4QREA 1ZD3A 3SMQA 4OI4A 1FYFA 4B3JA 1JHAA 4FDVA 5ELXA 3EHDA 1JDPA 2O4UX 4IVQA 1VJ1A 2BUBA 3ELWA 1CQXA 2I3AA 3IAHA 3CW8X 4FR2A 4KAJA 2JBAB 4H7DA 5EJAA 3EF1A 1F14A 2ZSEA 3MEQA 2EKLA 1A77A 4R8KA 4YACA 5FYQA 5AUNB 1WA5A 1NF8A 1QSGA 1U0RA 1ZOPA 2FUG1 4QU8A 2ISQA 3TNYA 1B16A 1GGHA 2CVFA 2ZTLA 4IX9A 2JLQA 4D4KA 1PSWA 1UPXA 1X2BA 2C31A 4XPZA 5DN6D 4GYWA 3PQ4A 1QQTA 3ON5A 3DXXA 1DMRA 3TQFA 2O8FB 4M7OA 1J20A 3DLTA 5EMLA 2P6NA 3OH8A 3I30X 1BQ3A 1ISGA 2A9RA 2RGNC 4URWR 2MU1A 2VC2B 3P9XA 3PFHA 3PNYA 2JBHA 3RC3A 4ZVUA 1LA2A 1R6BX 2NXJA 1B0UA 5CEEA 4D9CA 3S8EA 3AEUA 2TYSB 2PXAA 4O29A 4O59O 5EIHA 1TPZA 5K3DA 3ZIUA 2X23A 5FDFA 3G2KA 3IQHX 3VYTB 3X0DA 1WF6A 3WGYA 4CTNA 1GQOA 3I1YA 1G5TA 1P4HA 3NHMA 3GN1A 3PWKA 1Y5NA 1QH8A 4LDQA 3PICA 4Q5IA 2ODBA 2JEZA 2Y68A 3GLIB 2B1RA 2GPAA 2OV1A 1QG4A 2XUGA 3AKCA 4FE3A 1OLSB 3OU7A 2YCLA 3S2UA 5ED4A 1EJ2A 1G3IA 2WWIA 3DTVA 2R6FA 3KTDA 3MTGA 3IC5A 2XCTB 2G71A 2V4ZA 5E0KB 3GOQA 5AT1A 4WACA 3EEYA 3B7WA 4Z4FA 1I2DA 1ZMXA 3VR5D 2RKWA 1DEOA 5H16A 1LPNA 1PLLA 5KU1A 1DE0A 4QD3A 3RT1A 5HEKA 2VT3A 1NYLA 2Q6LA 3P8ZA 1XEWY 1T9GR 3EWIA 1HK7A 1QOZA 1RJEA 2JGDB 4YMIA 1HZZA 1L5ZA 5AKZA 2VNIA 5J3JA 3CMCO 5IVHA 2VSQA 2IW3A 2X8AA 2O52A 3EVAA 3DOFA 1VTKA 3GRVA 2XCUA 4EW3A 2IBTA 5AVVA 1FSGA 2DTEA 4BUJA 4G4IA 1HT2E 3PQ7A 1UAAA 1XELA 1UF9A 3EARA 3U5TA 4XIJA 4YPVA 3NWEA 5E7IA 3FETA 4H3HB 1N3IA 1R12A 3VNQA 1WZNA 5CITA 2A9KA 2H48A 3BH0A 1YR6A 4MLPA 3UK2A 4HBZA 3WOHA 4BEBA 4IUDS 1N2ZA 1FYEA 1Q1BA 3EXHA 1WV0A 3JZIA 3O2SB 4ND3A 3DWIA 3OO1A 1ESEA 4Q03A 2G82A 2CWDA 4QODA 2RH4A 3HLYA 5JUWA 4BVGA 1NRJB 1QNLA 4LZNA 3N70A 1W5FA 2GASA 3AR3A 1U6JA 2ZI4A 3D5QA 5B4UA 5IVPA 2ZTVA 3LH5A 4DCVA 2EJUA 1WMEA 5BT8A 1EJ0A 1JSRA 3QHQA 4DA7A 3QXCA 2R8EA 4KYVA 4I81A 5F1YA 4DC9A 1NG9A 4JZKA 5AHWA 3ZE7A 2YN4A 1DIRA 2R79A 3PE6A 1EXDA 1XQ6A 4HQKA 2FPSA 1AQJA 1L4EA 3QFFA 2WM3A 2ECPA 1RCTE 1O8CA 4FCWA 3UPDA 2V54A 4U39A 3PTLA 1PQPA 1EEHA 1G8SA 4HGNA 1QFXA 4N6NA 4BQPA 5I5EA 4DG8A 2JGKA 2FI1A 2WKRA 2QTHA 3ECSA 4MROA 3G2IA 4C6TB 1BOOA 1A4IA 1S3SA 1WD7A 2VP9A 3P0FA 4YV0A 3R7BA 3AV0B 1TMGE 2JI6A 3DE3X 4B7ZA 1YO6A 3JU3A 5JH7B 5LL6P 4D9IA 1TJ3A 4HMQA 1QUFA 3HCNA 4HX2A 5KYUB 1VCNA 1SCDA 2QVXX 2Z4TA 4Q93A 3S3TA 3HU1A 1PNRA 3ODPA 1R1DA 4GRDA 1C1DA 1QE3A 2I66A 1D8TA 4AN4A 3R1IA 4RIGA 1C4KA 1PTKA 1DPGA 1LBTA 1T43A 4FR0A 1E0DA 3GBSA 4QPZA 3NFYA 2P4EA 4R1MA 1Z13A 3NHSA 5H83A 2UUBB 2Q9UA 1P4GA 1NOKA 3WWOA 3ZZ1A 2IXGA 5CAEA 1ZEJA 1PJ4A 2JLCA 1P1RA 2XE8A 2WTEA 1K5HA 5CW1A 4JUBA 5FA6A 3LLUA 1ICIA 4ZYXA 1M34B 5K0LA 3VJRA 1KSJA 1NSYA 4DSZA 3I2KA 2QI9C 3LP5A 1F9AA 3WNDA 3VPFA 1J25A 3FG9A 1SZPA 4RLSA 5IJWA 3GAFA 4EMSA 1AD2A 4DZRA 4E12A 1IK4A 3LBYA 4RVCA 4E21A 3L04A 1SELA 1XTKA 4QDJA 3MJFA 3HRHA 3IMEA 3IULA 1QYDA 4KAXA 4LYHA 1P3DA 3OQ6A 5B3AA 1KP3A 2AG5A 1AN0A 3JQCA 2NUAB 4DUGA 4V2UA 5A06A 3UBMA 1RZVA 1TCAA 4ZCLA 5JVDB 3JVEA 4KFUA 4YJ3F 1U0JA 3PNSA 4YQZA 5ULLA 4ZVNA 4X7PA 3RM3A 1B8NA 2QQGA 4DLZA 3QEOA 2GFQA 2EF0A 3N0VA 4GX2A 1VPDA 2FSGA 1LSJA 4LHWA 2XXBA 1VB5A 2CXUA 3ECCA 3ZW9A 4QUJA 2NACA 1MX3A 3IAUA 5EJ8A 1ZCAA 1U8XX 4WCFA 2QGFA 1UUFA 4IWXA 4QX6A 4B3IA 4M36A 4MYUA 5JWOA 1KQGA 3ZNOA 4KR7A 2W70A 2H4WA 4ZCSA 1BXRB 3RHZA 4NU8X 1N1GA 3DT8A 4Q1CA 4DF3A 2Q3BA 1SQ5A 2YV4A 4UVEA 3MS2A 4WNYA 5GV8A 1Q12A 3TLBA 4B74A 4BJHB 4XXHA 3NB0A 4A23A 4KMRA 4XVRA 3AZOA 2W8ZA 3ZHCA 4NXMB 1YSCA 5FL7D 1DARA 3QYFA 1E3WA 4O4JA 2CNWD 2JA1A 5HHTA 2DF8A 5FULA 3C8DA 4G2TA 1QCCA 4Z8XA 3GROA 3T5AA 4FEEA 4ME6A 2GPYA 4IL5A 3DL4A 4MGIR 1YS9A 2NVBA 1OVMA 3OKAA 1JVBA 4P5EA 4UU0A 4OX9B 1WJGA 3EZNA 2BHRA 1Q6ZA 1KMHB 3SM3A 5DM0A 1HDRA 2PZJA 1Z7YA 5AUPB 5BURA 1ISFA 4RQTA 1CY2A 2X58A 3A6JA 2YHBA 1G21B 2A9JA 4KE7A 4YAKA 1CR1A 2WJJA 2BFNA 2H9AA 4CLDA 4KXWA 5K6TA 4MQEB 1BXGA 1KOJA 3Q8MA 2QMUA 5AW7A 5FYDA 3Q7IA 3WGTA 3EN0A 3AL0C 1D2GA 3SXUA 3O73A 2WQZA 4GL4A 3RT9A 3U1BA 3M4YA 4HDCA 3GYGA 4UD6A 1S2MA 2BM8A 2HWWA 5CRIA 2PKYX 2XECA 2H9IA 2FETA 3CUTA 4PZ0A 2HO5A 4F7DA 1WBDA 1IN4A 1ULTA 1ZEMA 4YB8A 1QQAA 4M21A 5KYKA 2DPMA 2BFDA 4BE7B 2HPHA 2NZYA 1OLUB 1NXQA 1VHQA 3L8DA 3N2LA 3QUSA 4LRTB 4M0LA 2QAGC 1O4WA 3R0QA 4GO1A 5IHXA 3RYCB 2F1OA 4RTLA 1G20A 1W94A 5EZ6B 1OLXA 3H83A 4CHTA 2I9PA 2PK3A 5LZ9A 3FYUC 1I3LA 3M5CA 3MB8A 2C9CA 4C4TA 1G9SA 1CQIB 1CWUA 3HM2A 2IBSA 4FFVA 2ZJYA 1VQ1A 3AR2A 3GELA 1PFWA 3DZ8A 4UTPA 4KGXA 4IICA 1I4TD 4HAYA 5WRFA 3UICA 3ZXIA 3X1KA 2ZYAA 3IVAA 3M6IA 1KHTA 4JFAA 3UG7A 3V1YA 3L0PA 1QQ6A 1JN0A 1RWXA 4JLSA 4KJZA 3B1ZA 3U9SA 4KXNA 3AX6A 2BAGA 5DTEA 3TW0A 2OB2A 1CHNA 2QRKA 4UFNA 1QZZA 4J0CA 3CLRC 1JIJA 3UH1A 1ID8A 1YQXA 2BFBA 3ELBA 2IH2A 4B7XA 2JFUA 4NENA 1NUQA 1FLNA 4RD1A 1WHSA 2GTHA 5LU8A 1XTRA 1U04A 2N3ZA 3JALA 2EVWX 4OXNA 4ZALA 4DNPA 4G4SP 1G7RA 2X2PA 1U0HC 3UNXA 5IYZB 1OBOA 1KEUA 1N1EA 4TTTS 5J2UB 5K8LA 3PPIA 4OM7A 2XMCA 3BTOA 3QIAA 3JQ7B 4IJ5A 2AZDA 3HU5A 4Y8VA 4PYRA 1GXSA 1FP2A 2JZNA 2Q3LA 2WHQA 3K53A 4UBLA 5KX5F 5C3MA 1A5SB 1AU9A 3IE2A 3BL5A 2VNAA 3JQAD 1EUDA 5THKA 4HUTA 4FDAA 3C8UA 1U0BB 8MHTA 3OJWA 2O1EA 2EJVA 1X8XA 2AMYA 4IO1A 2QLNA 4AF6A 3F5MA 2B99A 2ZR0A 4IHQA 4X41A 5DNAA 2QGNA 2WQ7A 4YRPA 3E48A 5IK2A 1NFRA 4TXMA 4P6VF 2HRDA 1H0HA 5E9QA 2O0KA 3EPPA 3DOOA 2R4UA 1U1GA 2MINB 5JMWA 2QORA 4E6PA 4EAQA 4YDSA 2J9RA 4D8UA 2XODA 5DLEA 5IS2A 2TMKA 1ZITA 4TRMA 4BNDA 5ADHA 5JSZB 1EFVB 1RBQA 4UVDA 3OIUA 2PM8A 2X6QA 4DCCA 5DGXA 3DT6A 3EOAI 1V8PA 3JQBA 4GZ5A 5FL3A 3RU7A 4DSAA 4I55F 4PC2A 3DBRB 5J2TF 2DERA 1TT7A 4RD2A 1F0KA 4HNAB 1C9KA 2W90A 4IQ8A 2IX9A 1KKLA 1TA0A 4N8DA 4JYAB 3R9XB 4LFBB 5F7OA 3L6RA 3ZDXB 2VNSA 2VHJA 4DRXA 4FOPA 5AW9A 3LUGA 5A0FA 5JCOC 4HN2A 1DLJA 4JDPA 3BEDA 2W71A 4Q48A 2IHTA 2JB9A 2ZT6A 1LNZA 2VHZA 4QGGA 5LLDA 1GZUA 1JQ3A 1AS2A 2ET6A 1H85A 2GO7A 4GR5A 4URYR 2H07A 3W5JA 4BE9A 4Z7OB 4KQEA 2VTEA 3WKBA 4EZBA 5GZ1A 5CYPA 1XFAA 2QLTA 5BYKA 1QZXA 4FMCB 3LZ6A 4KGDA 3KSUA 1XN1A 3IUYA 4B87A 1VHJA 4J1SA 4BRZA 2BC9A 1BN6A 2LCIA 4OK3A 3I9JA 1Q6YA 5EE5B 3SEFA 2NVOA 3TLMA 2GEDA 4G9GA 4FKBA 3W34A 1RKBA 2FP4A 2WRZA 2Y9MB 3LPMA 3O38A 4EY7A 5K0EA 2Q3HA 1YFJA 5CCXA 2AQKA 2NWQA 1QS0A 1THTA 3CJTA 1RXSA 2VXYA 3G8CA 5E8RA 3TIIA 3CX3A 1FLVA 4LSMA 3WLHA 3E1KA 3ZS9A 2JEOA 1YMUA 4Q12A 3CZ9A 4TVSA 1YCDA 1ZLXA 1UM8A 2PT6A 3FTCA 3KUUA 2PNJA 3U3DA 4LYYA 1ZNWA 1QGDA 2ZQ5A 3OE7D 4KQ6A 4D3FA 1WPXA 2MSNA 5HKAA 4IZHA 4B4DA 1AKTA 3VR4D 1XDSA 1KYZA 1V2GA 1R8JA 4DLBA 1U8FO 5D00A 3B12A 1X80B 1ULBA 2C2KA 2V0CA 1SRRA 3QX9A 4JGGA 4EUFA 3IA2A 1L7NA 3N5CA 4WY5A 3VR1A 1PEYA 3EMBA 1CJUC 2YJ3A 4G41A 3FLEA 2GA8A 4GR4A 5AVJA 2HV9A 3EVCA 5JQGA 1PFKA 3UAZA 5KMGA 4QA9A 2I22A 3RVRA 2D54A 3ICVA 2VJQA 4O5OA 3KBOA 1UFVA 2PKQO 3LA6A 3RUHA 2D5AA 2FX3A 1D09A 1K89A 1YI0A 2Y6VA 3FGZA 3OT5A 4I5EA 1E5DA 1VMDA 5BSFA 1SBCA 2UAGA 2R1TB 1L4LA 3E1GA 3IAS1 1NXPA 5JDIA 2RD2A 5F2NA 4P53A 3KT8A 3B1KA 3U44B 1KK2A 1T4GA 4OHBA 2ZTSA 4FYXA 2Q7XA 2MR5A 1UKZA 3C7AA 3AYXB 2GBPA 3CLKA 4IIJF 1N5OX 4FFWA 5FFMA 3PQFA 3VZDA 2Q9AA 2FX2A 5HCIA 3WDLA 2CUNA 1ZSNA 3D6HA 4NL4H 5EJ2A 2W2TA 1KR2A 1DDOA 2PKRA 2X42A 5LYYA 3ZZTA 2G5GX 3FPEA 2FPXA 3MWLA 4KIGA 4D9BA 2VJMB 4JI0B 3QVXA 2O3JA 3CLRD 1S96A 2DMRA 5T3UA 4M1ZA 3KEGA 4KUHA 1YMVA 1YRQA 1UEJA 2HCBA 2QRMA 4NESA 3GNQA 3S28A 2C83A 1XB2A 1GLGA 1UP7A 3D6JA 5E4JA 3O2JA 2P3SA 3UHAA 5ER9A 2Q6OA 3K0BA 1DRVA 3TZKA 2DQYA 4KE8A 3O8RA 1KO7A 1COWD 4P36A 4QFDA 1J7KA 1OQAA 1V7PC 4ID3A 3LLCA 1GRCA 1QAOA 4ZAYA 4BKPA 4C2TA 1MFZA 3ZDDA 2WD8A 3GEIA 4HNTA 1PKXA 3KKQA 2C95A 2XDQB 3QPAA 4LMRA 2BOVA 3DUWA 2R68A 2LKCA 1I1OA 4UC0A 2AHRA 3UMSA 5L4LA 1D03A 2WU1A 4IRXA 5H4HA 3COYA 4BTLA 1HG1A 1JR2A 2CLEB 5EN4A 3HJRA 2RI0A 2YUTA 1E1CA 4CEJB 1TCVA 1Y81A 2PSSA 1ZBDA 4TGLA 5AJWA 4C0HA 4KSCA 2LV8A 1OIXA 2O05A 3WQRA 4RKRA 5B53A 1FMLA 1XA0A 3PUXA 4C76A 1S1CA 1WR8A 3FDJA 1NPTO 4S0XA 2ALJA 5EPEA 3OE1A 3AOEC 2WV9A 3VO1A 3KZ1E 4J2OA 2QG4A 5JO9A 1ZJJA 3JQQA 3PL1A 4DCGA 1G4AE 4ENWA 1DAIA 4MNTA 4EKIA 3V4FA 4DILA 2QPTA 3I1IA 3UTCA 1FBTA 3UC9A 2HO4A 2XNDD 1PT6A 2ZOSA 3D3JA 4BIMA 3W06A 4U9UA 1SN7A 1TVKB 3CUUA 3LMKA 4JVNA 4E3ZA 4FEGA 2XUJA 1OZGA 3NRCA 4N7RA 1Z6AA 3T7SA 6AT1A 1CJBA 3EZYA 2VH1A 3OF2A 4HAVA 3WSWA 4KDCA 2ZIWB 3VU3A 3ZCQA 2WF6A 3OPVA 2B4TO 1G60A 3P4XA 4QU0A 3ULKA 1E4EA 5AJTA 1NGSA 1R0WA 1WDKA 4HYQA 3THXA 3W8FA 3QWBA 1SXGA 1KKMA 1A9RA 5HJEA 4OI1A 2WINI 2XB9A 3NVMB 2C7GA 2JLBA 721PA 5IT0A 3ET4A 1H2WA 1RRMA 1E4YA 4EP1A 3TEFA 1VCIA 4L3WA 3U7IA 1T5HX 5JXIA 1ZGJA 3VA7A 5F5XA 3ZKWA 3B3GA 3UWOA 1SVKA 1VE7A 4LCEA 5IUJC 1JBKA 3AC0A 2AKEA 3BT7A 3K1TA 1WZ2A 2C9ZA 3EVGA 4OGGA 3ONNA 1B76A 1Z7GA 3ELUA 3R6WA 3BVPA 2Q0HA 3CZAA 2PA0A 3K9WA 5GWXA 2BMDA 3SG0A 2SBTA 5JMOA 1GNTA 1ODJA 3B82A 3EWSA 2RC5A 5E6UA 3PE3A 3SE0A 4EHAA 4ZK6A 5A6SA 2YFKA 4PFJA 4MKXA 2J08A 3QF7A 2V7TA 3ABZA 3ITKA 3VDXA 3WISA 4CFYA 3BFXA 4OHFA 4J7CA 3T5PA 2AX4A 1Q7EA 1T9KA 2WLSA 4IMRA 4E2XA 4OTZA 4DC0A 3VOBA 3WWZA 4TTAA 1ZCJA 3C5VA 3OP1A 4EVRA 1JFTA 2HV8A 1MX9A 5I4IA 4C0SA 2KB0A 2V96A 1MTOA 4K6HA 4DDHA 3P9KA 3RJMA 4D8WA 3PNKA 3TL6A 4WLVA 4RQAA 5ALQA 3RRYA 1P6XA 4Y0NA 3N9IA 4EPYA 3T1TA 3ZVNA 4YP9A 1S9HA 3DMPA 1XCJA 3FPLA 3LW7A 3Q41A 3TI9A 4CCYB 4K2AA 1IHPA 1C9MA 1NPDA 2HK8A 3HWSA 3IUEA 4JL6A 3K70B 1DO8A 2OV3A 5E0OA 4C30A 2A7XA 3LYHA 4H59A 4IOKA 3C24A 4JHXA 1C1XB 1K68A 2PQ2A 2F8LA 1BMDA 5EINA 4O2BA 3I4LA 4HZUB 1AF4A 2VSYA 1NW6A 1NJ6A 1G2IA 4BWGA 3AF1A 4BNNA 1Z3CA 1NXSA 3GFPA 4WZZA 5CBPA 4QXQA 3OIGA 3MJSA 2P0EA 5JAZA 3OHSX 3AUSA 4GKVA 3WK9A 2ZCUA 2ZYIA 3IAM6 3H5OA 4NBUA 1Q7GA 1Y89A 4YVFA 2DETA 4J49A 2HRRA 3L84A 2JVJA 3AM3A 2BF7A 5KWVA 3EC7A 3HA2A 1N6NA 3A0RB 4NG4A 2D1QA 2VHCA 2GD0A 3EC2A 4X62B 1BG6A 2D7CA 3CX7A 1ILWA 3GWZA 5CT8A 3THSA 1Y4ZA 2A35A 4AG3A 4E15A 2YBEA 2A0KA 4LRUA 2Q8NA 5EP2A 4FFNA 1KQ3A 3HMQA 2J46A 1GKKA 3MWEA 4CR8A 1MC1A 5GJWC 4YLEA 5JFOA 1MOZA 1WVIA 1AQUA 1MVNA 2QI9F 2XGMA 3AP2A 2J67A 1TUGA 1ETUA 2RC6A 3H0KA 1QE0A 2O48X 3BJIC 3JAWA 3HVUA 3FUXA 3OECA 4H7FA 2ZRMA 3FZQA 4R84A 1M76A 2XKKA 2ZVPX 2Q1UA 3N2GA 4BX8A 4UNIA 2BMVA 1PT5A 4RZQA 1NVGA 3DM9B 2WMDA 1O7JA 4DKJA 4TPKA 2B92A 2VVTA 1ECFA 4FHEA 5KTNA 1Z2DA 1YA4A 1PYDA 4CPDA 5CUQA 1Q95A 2G8LA 2QYTA 4XX1A 3TZHA 1Q5PA 1AO3A 3QMPA 4EYGA 1BKYA 4RM3A 1T3HA 1VLJA 1ZCBA 4MWEA 2J7KA 1ZOLA 2GPBA 5L7TA 3B3JA 4AC9A 4EWLA 2E4YA 1KAOA 4U0KA 1QG0A 2P77A 3D6AA 2FUG6 5CX4A 1BEZA 1OU0A 1TO1E 2BCEA 2NUBA 1ZDMA 2VJBA 3EA0A 4Q9HA 4Q9AA 2RDMA 1A8SA 2FQXA 2BI7A 1TM1E 1JMYA 1K7YA 2EFCB 4L5IA 1Z0AA 4G26A 4ND7A 1A3CA 4V0OA 4UDYX 4MB2A 1KI7A 3REQB 5GV7A 4BMOB 1C3JA 4DABA 1SD5A 1C5KA 2YYAA 3FMOB 4W1PA 4Y2UA 3RVOA 5LYJB 3WYEA 2J33A 1XDWA 2CN1A 2NSJA 4GF5A 5F7JA 2GX6A 1LD3A 1TYEB 2HTEA 4ZREA 2IV7A 2OHFA 5BSKA 1PBTA 2GHIA 4RULA 1I3KA 7YASA 4KUEA 2ODPA 3HYTA 1W9HA 3FN4A 4U7JA 1SURA 4H17A 1A98A 4K28A 1A8QA 4UUPA 1OD6A 4GOLD 4KV9A 3ZW7A 1VJ5A 1M0SA 1Y9DA 2NYUA 2AEJA 3VZBA 1ZNXA 3DOHA 4JJ8A 5ERXA 4INJA 3MBOA 3G7SA 1IQUA 2J4CA 5G0VA 4IRUB 3K32A 1U80A 4JUAA 3KPJA 1NW8A 5KCMA 3SLGA 1TUBA 1AZTA 3D6UA 3LECA 2H92A 5AW5A 3O82A 3T5TA 1E3LA 4CEIB 1SBHA 3L92A 2EGUA 4LHZA 1KYVA 1ISJA 1QOQB 4LE2A 2YJTD 3WP1B 4D3SA 2HJVA 3GVPA 3ND8A 4HT3B 3FWNA 3RBZA 2WSIA 1WBJB 2IGBA 1IM5A 3JZMA 1U81A 1UDXA 5AM3A 3V3KA 5CB6A 1ADJA 1DC7A 3EDRA 2AQ8A 2GMWA 5L3VA 1KI8A 1Z2OX 2AG0A 2QR3A 3FXAA 4S24A 2BELA 3RC2A 1WMAA 3QBJA 1BFUA 3LL7A 3DZKA 2X0IA 4D3YA 1LC0A 1X19A 2OCXA 3NHUA 5IBCA 3IQFA 3JTEA 5ARCA 3UJCA 4C89A 4DEXA 1Y8AA 1SCKA 2FP3A 3OCYA 4GKAA 4V24A 1EUYA 1IWBB 1E1LA 1L4FA 2AJBA 3GXBA 1IHXA 4FFLA 5FI1B 4A73A 5EHXA 3NBUA 5MFPA 1A0OA 1KPIA 1RKUA 4MPPA 1GARA 5ALMA 3UMRA 2WTUA 5ICMA 4QOHA 1XTTA 3T3MB 3V1KA 1YIAA 4L3VA 5K2OA 2RCYA 1CUVA 4TMKA 1YCHA 4HWSA 4ZEWA 5C53B 5F4BA 4JROA 4J1QA 4XQ0A 1H2ZA 4NCIA 1J00A 3EFBA 1F4LA 1XNHA 3OFKA 4W9RA 4UCFA 1N4AA 1WMBA 1FXWA 1SFRA 2IDMA 3VOAA 1MU0A 4QBKA 4Z1MD 5BVGB 3MJEA 2QX8A 3DCIA 2PT5A 1ABFA 3DPSA 3AEXA 3P32A 4L1KA 1M54A 1K98A 1NBHA 1ZN8A 3WGLA 5JI2E 5FBQB 3GLIE 3Q12A 5AW4A 2ARKA 4DMKA 5EOVA 1QYVA 1UH5A 2QRZA 2ZANA 3DLPX 9LDTA 4B4WA 3LCMA 3BGSA 5F52A 2NAFA 1JG1A 1VPLA 2RGEA 2YNMA 1SHUX 4LKRA 4URZR 1FMJA 3ILVA 3LDHA 1NLFA 1EVLA 2TECE 3LL4A 2OD9A 4MKIA 4H7PA 2NVUA 3A11A 1RE0A 4I0WB 3VC2A 1W8DA 1FDWA 2QVGA 1BA3A 4TMVA 1YS2X 1X1QA 1HZJA 3KR2A 5L3QB 1XJ5A 2D13A 2PX8A 5CVEA 3HKCB 1C0KA 1TE2A 2Q3DA 4KOAA 1P0CA 3T5DA 4QFCA 1IONA 4EG8A 1FSSA 3WL8A 4QWWA 1F1BA 4NBVA 1I7SB 4K6GA 5KJ1A 1EZ1A 2EX4A 4WX2B 4ITVA 5ALVA 1O3YA 4D0LB 5C81A 1GUAA 3GAMA 4QAJA 1E5TA 5G1OA 4Q1AA 3WRVA 1ZGGA 1N4DA 3E23A 2Z5LA 1G8PA 3ZHTA 2BJVA 2XLCA 3AZPA 3F90A 4W5NA 2PRJA 1I6MA 1NVWQ 1ZNYA 2ZYTX 1MF7A 4H16A 1KDVA 3W5SA 3ZK8A 3EQ6A 4L5BA 4DNFA 2IPXA 3U37A 1UJ2A 1IM2A 2V6BA 2JIZD 4YV1A 1I3NA 5DASA 2NO7A 5GGYA 2WTMA 2AEFA 3FOBA 3RSOA 3BIFA 5D84A 1Z28A 3FRHA 3Q2IA 2GH1A 2VPWA 2BUCA 3T95A 4ER5A 3OEHA 5JSQA 5TJ9A 4YO7A 2GD2A 4ZQFA 1AMUA 1KORA 4R98A 3CA8A 3L4JA 2CNBA 3AWDA 4LVNA 2A84A 3NOQA 4LOIA 1T0BA 5K0FA 1FDTA 1YNSA 3IMCA 1KL7A 1BVUA 3IVGA 3MJRA 4IXMA 1A7KA 1X6VA 3T15A 2ILVA 3L06A 4LVOA 4MIKA 5DT2A 2XV1A 5KTSA 4MS3A 1FRZA 2AYZA 4OQYA 3ITNA 4J7UA 1G2QA 4S0ZA 4Y1RB 5CX1B 5JYBA 1AKEA 4HH3C 5EP1A 3UGQA 4D6XA 2CFOA 1ACLA 1YB5A 4FHZA 4KVFA 3THOA 1QRUA 1SU8A 3SKXA 2PSFA 4HDSB 2BUAA 3OLYA 3W1VA 3HUTA 5ALHA 1ZXXA 1MX5A 2ACVA 2GFHA 5ALUA 2AYYA 2D8AA 4KXXA 3SSMA 3RBXA 2XH8A 2ANBA 3RF6A 4WLEA 2DY1A 4RVOA 3K5IA 3DZGA 3UIEA 2FPKA 3CW9A 3GFOA 2L42A 2ZZKA 4M37A 1W44A 4QUDA 2X0RA 4JYMA 3MINB 2G9QA 5IXSA 1BOFA 2CHQA 1Z38A 1R4NB 2BM1A 4RHCA 1HWYA 1T5LA 3GPCA 4GOMD 1KDOA 3SX2A 2OQIA 3FVQA 2B4QA 4NF2A 3OG9A 2GM5A 2QP9X 1M34E 4Q3KA 3WDSA 1FVXA 2HLPA 2V9CA 3ZE2B 1USVA 5TGTA 1WABA 4FD2A 5LQJA 1IRIA