4C8DA

Crystal structure of jmjc domain of human histone 3 lysine-specific demethylase 3b (kdm3b)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
341
structure length
332
Chain Sequence
TSHSWLCDGRLLCLHDPSNKNNWKIFRECWKQGQPVLVSGVHKKLKSELWKPEAFSQEFGDQDVDLVNCRNCAIISDVKVRDFWDGFEIICKRLRSEDGQPMVLKLKDWPPGEDFRDMMPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LYSINE-SPECIFIC DEMETHYLASE 3B
publication title Crystal Structure of Jmjc Domain of Human Histone 3 Lysine-Specific Demethylase 3B (Kdm3B)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 332
sequence length 341
ec nomenclature ec 1.14.11.-:
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 4c8dA00
3OPTA 4HOOA 4CCMA 5FZIA 2XXZA 5FZAA 2OX0A 4QX8A 5IVBA 5FY8A 5IVEA 5FP3A 4XDPA 5F2SA 4V2WA 5F5IA 4IGQA 4CUGA 4EZHA 5FZ4A 5LW9A 4UF0A 5FJHA 3DXTA 4LITA 5FUNA 2OQ6A 5A7WA 3NJYA 5IVVA 3PURA 5FYTA 5IW0A 4GAZA 2YU1A 2Q8CA 3AVRA 3N9LA 4QX7A 3AL6A 5F3GA 5FZ8A 2XMLA 5FY0A 5FZLA 5IVJA 5KR7A 5FXVA 5A3PA 5FY1A 4AAPA 4Y4RA 4AI9A 4CCKA 5F5CA 4CCLA 3KV9A 5FZ3A 3OPWA 5FZ6A 5A7PA 4QWNA 3KV4A 5IWFA 4E4HA 2YBKA 4LXLA 3UYJA 4Y3OA 3LD8A 4QU1A 3RVHA 4EZ4A 3LDBA 4UF0B 5ANQA 5FP4A 2XDVA 4IGOA 5FP9A 5FZ1A 5FZBA 3K3OA 4BU2A 5A3NA 4C8DA 5LY1A 5A7WB 4GJYA 5FZMA 1VRBA 5FZOB 5F3CA 2YBPA 5FP8A 5F37A 5A1LA 5FZ9A 2OT7A 5E6HA 3N9QA 5FXWA 2WWJA 2P5BA 5F3EA 4LIVA 5FJKA 5FYCA 5FWEA 3PUSA 3K2OA 3PU3A 5FY9A 4V2VA 4ASKA 4DIQA 5FPUA 3PDQA 4HONA 4Y33A 2PXJA 5F2WA 5A1FA 4XDOA 5FP7A 5FPBA 5FYVA 5FZCA 2Q8EA 3DXUA 5F39A 2YPDA 3KVBA 5FZHA 5A7QA 4CCOA 4QXHA 2YBSA 5FYYA 5A3TA 2YU2A 3N9NA 2W2IA 5FXZA 5LWBA 3K3NA 2GP3A 3PTRB 4CCJA 2Q8DA 5FYUA 3U78A 5A7NA 3N9OA 5FYBA 2OS2A 4TN7A 3ZLIA 5CEHA 3KV5A 3PUAA 4D6QA 4DO0A 5F32A 3AVSA 5FV3A 4D6SA 2OQ7A 5FY4A 3ZPOA 3U4SA 5FY7A 2XUEA 4BISA 5FXXA 3N9MA 4D6RA 5FZKA 5IVYA 5FWJA 5FPVA 5FY5A 5FYZA 5FYHA 5FBJA 5IVFA 2VD7A 5F3IA 5FZFA 5FZ0A 4EYUA 5A3WA 4URAA 4LIUA 4CSWA 5LY2A 5FPAA 5FZOA 4GJZA 5FZGA 4NUBA 5FYIA 5A7OA 5ISLA 5A80A 4CCNA 5FZDA 5FYMA 5FZEA 5FPLA 2GP5A 3KV6A 3N9PA 4GD4A 4QXCA 5IVCA 2WWUA 4BXFA 5F5AA 5FZ7A 3AL5A 4QXBA 5K4LA 4IGPA 5FUPA 5FYSA 5A7SA 3PUQA 3PU8A 3KVAA
chains in the Genus database with same CATH superfamily
1R1ZA 1E5RA 2F6BA 4Y24A 1CAWA 4BHPA 4P5YA 5JXHA 4BOWA 2R0FA 3R4DB 4MX3A 3IDAA 3N7MA 2W87A 4PT6A 4RQPB 1UY2A 1GBGA 5ABJB 2HWE1 5KHKA 3TBDA 3MIBA 3VZNA 5FUNA 2QDNA 2EXHA 1ZBA3 2OQ6A 3SEEA 1LHVA 1POQA 1W9YA 3MLKA 1H9PA 3AVRA 3KM5A 2VTXA 2LW8A 4COWA 1C1LA 5DZFA 2BWAA 3O0VA 1MEC2 3E1F1 3OBTA 3WW1A 4EQVA 1WW6A 3ENRA 4CUAA 1LR5A 2HBUA 4AI9A 5T5LA 3KF3A 2HWC1 4NAMA 4H7MA 5GM0A 1I3HA 1UXXX 2I45A 1X8MA 4I3PA 1GR3A 1E5SA 1PNGA 1AL0G 1AYN3 2YBKA 1XNTA 4OMCA 3IKWA 4Y3OA 1N1YA 3LEMA 4UW4A 4IEQA 4YGDA 3NV3A 4EJRA 4C0BA 4GB31 3U0ZA 1UOFA 1O6UA 5FP4A 1RUE3 5FZ1A 4F7ZA 1MR5A 4FQZA 4CEWC 3EYPA 5FZOB 5GLZA 4AEJA 1RUF1 1K12A 2ZPXA 5DG2A 2RS33 2WFF2 2VCCA 4IW3A 4AVCA 1HRI2 5FYCA 3MFAA 3LPFA 4XF4A 1J1LA 2WIIB 4BQXA 1XNAA 3CZJA 3M2MA 3PUSA 3WNOA 4IE0A 4UI9L 3WF3A 4BLJA 2WC2A 2VOXA 1BHGA 1DGRN 5C9AC 1XNBA 5EV7A 2WSUA 2Q4SA 5FO9B 2EICA 2WNEA 5AVPA 3DEMA 4MUVA 4CDWA 4LEJA 3IAPA 3NNGA 5ACA2 5A3TA 1ND2A 3GZUC 3PMSA 3H9AA 1FXZA 1QH7A 3UGHA 4CDQC 1GANA 3DPRC 2D44A 1UU5A 3NRUA 5FYUA 3HVDA 3MBWA 2R6QA 5C3PA 2UY8A 3MI8A 5DDJ1 2DCZA 2O1QA 3AP6A 1RUG1 3I3EA 3JBG2 3OJBA 3WCSA 3ZXLA 1W6MA 2O8OA 3NAPA 2WT1A 5IK5A 2XUEA 2FDKA 3UGGA 3BIWE 3HJRA 1R082 2AGSA 2VNVA 3N9MA 4IE6A 4Y5TA 4M00A 4I0AA 2QQOA 5HCFA 1VALA 3SCFA 2JDHA 4XJAA 3RI9A 5C5UA 1QGLA 2VCBA 4NHMA 4BQ3A 4LO5B 2OYZA 1PK6C 4NJ4A 3AFGA 1ULOA 1VRH2 4PI0A 1YYNA 2IXJA 1TE1B 3VBSB 2VW1A 4ZZ8A 2KR2A 4ONUA 2CU5A 4W6YA 4OUMA 4UOJA 1RUE1 1RL3A 3S6PA 5K4LA 2D7FA 3MIEA 4BB3A 4PLMA 5FMOS 4AGGA 3VBUC 1NXD1 1NA1C 3PUQA 4Q8KA 3KVAA 4CCMA 1GWMA 4O65A 2XXZA 3QH7A 3ZSEA 2OPKA 4IE7A 2RR13 1AJOA 5BY5A 3AMNA 2JD4A 1Z7S2 2KM2A 2NLRA 4FVVA 2CGPA 3K4ZA 4PF1A 3WLUA 2BUKA 4XMIA 3S0MA 2W52A 1IZ3A 3OD0A 1UMIA 4XCAA 3LKJA 2QZ2A 4NHXA 4JCKA 3W58A 2YY1A 1VBC1 4FP3A 1CONA 3HD8B 4IEVA 1SZBA 3N9LA 3E5QA 2PHTA 5IVJA 1CR7A 3T0BA 1QKQA 1UU6A 2D6KA 4YPJA 5FY1A 3USUA 2WNUC 3ZFFC 4B4QA 3I49A 1ZRFA 2X5IC 1Q56A 1R091 2BDRA 4C1XA 1MQTC 2WA4A 4Q4V2 1VLNA 4QWNA 4LOTA 2BOJA 2VMHA 2W94A 2ZGTA 4PQ9A 1NYWA 2W47A 3ZFEA 2XL9A 1RXGA 1GNZA 3AYAA 4AOCA 2WQ4A 3I97A 4FBFA 1RUH3 5DZEA 2ZOEB 1LCLA 3KF5A 1D4VB 1WLCA 2CL2A 5DXDA 4LJHA 5CKNA 4QT6A 1XQNA 2W0XA 3HNYM 2VH9A 4EE2A 2V5DA 1V6NA 3IPVB 1MZFA 3ZYRA 4WV8A 2FCTA 2CGOA 2QKDA 2VBDA 4BXSV 3V0AB 5FZ9A 1JHJA 4ARXA 1HXS1 1QJFA 4KGQA 4Y20B 1RVF3 5J96B 2P5BA 3AJZA 1H1MA 1D0HA 4XTMA 3PU3A 3AJYA 3ROUA 3SCGA 4V2VA 5L9BA 1AR61 1K5JA 2VULA 1LGNA 2RE9A 1DG6A 1UX6A 5JOXA 1T6GC 1EY2A 1O3RA 2DUOA 1OLMA 2Z4FA 5CFDB 2YBSA 4CEYB 2RS51 1JYIA 3U11A 2Z79A 3RPQA 1FATA 1UU4A 2MEV1 4CCJA 1U5ZA 4B1MA 4Q1RA 3LAGA 2BZDA 3AXEA 1YXWA 3M3IA 2LALA 1JUIA 1O4ZA 1POV0 2DVFA 3PHMA 3EJKA 1A6CA 1NY72 5GLTA 1ULPA 3UETA 4RFRB 1V9U3 4ISRA 5CZKA 3U4SA 5E8AA 5FY7A 2WR9A 2AC1A 4AL9A 5JMCA 2B9VA 3GALA 3DKQA 4NPLA 1IPSA 4YZ5A 4WZCA 2WYFA 3AMPA 3KHBA 2D5FA 4RD7A 4CDXB 1COV2 1W2TA 5I93A 1PGL1 2B8MA 5I0DA 5J37A 3VKFC 1DLCA 2VZRA 3B9IA 2DF7A 1FOD1 2PFWA 5B4XA 1G8WA 1W2AX 5A80A 4M0NA 1A3KA 1GLHA 4RS5A 1K45A 5FYMA 2JEMA 4P08A 3U1XA 1JZ2A 1YJKA 2J1EA 2W1WA 1MEC3 3AP9A 1AHSA 3I3DA 3OGRA 3OBAA 3R05A 4BXFA 1SHWB 4CDWC 3H8RA 5FKBA 1WZXA 1I6XA 1ND2C 4YM2A 4HVQA 2VY0A 2DU0A 1SLAA 4P9XA 1RVF1 5A6QA 2D40A 3D5OA 5LZ6A 4XFCA 1OHFA 2FMDA 3O1RA 3BKZA 2OPWA 2ZS6B 4WM7B 1HV0A 3NAPC 4LITA 1Y9GA 1NZIA 4H2AA 5IK8A 1QJU2 4LE3A 2R042 3NJYA 4YYOA 3WDVA 1Q8QA 1OQ1A 2Y6GA 2ZX4A 4D7TA 3D4KA 4OFGA 3RJ2X 1C8M1 3I8TA 1XE7A 1AX1A 1GZCA 2QVSB 4KWJA 4WVWA 2H6BA 2DURA 2WFF3 4IL7A 1JU3A 1O3QA 1HRI3 4OULA 2LM3A 3VD5A 4A42A 3ST7A 1LGBA 3EB7A 4QB1A 1W6PB 2KD7A 3WDWA 1I9RA 4A3ZA 4ZU7A 1JODA 1ZRDA 5F8PA 3KV4A 1TG7A 3W9AA 3UYJA 1GICA 1LOFA 3F2ZA 4W6WA 5L9VA 3P3PA 1POV3 2ARAA 1Q5OA 1GP6A 4Q4X1 5ACA3 2WQZC 4AVAA 5KXCA 1Q43A 1IHMA 2XVLA 4GMP1 3UKTA 1TNRA 2VCAA 4A7ZA 4C8DA 1SEFA 5KXDA 3JUUA 5JVVA 1ZYBA 4C91A 5F3CA 5LA0A 2BNNA 3NV4A 3JBG3 4AQTA 4G3YC 1NT0A 2AR6A 3VKNA 4BE3A 5LB6A 3WD5A 5LK7B 1R083 3THCA 1N3PA 4PQQA 1QNWA 3MIDA 4AVTA 3LQCA 1YIFA 4DUVA 4CP2A 4CEWB 4CZSA 3SNMA 1S0CA 3JB8A 4XDOA 2JWPA 1PO12 4JQTA 1GP5A 2RMU2 2JDZA 3GNEA 3JXSA 4LNVA 2AACA 2G19A 4QXHA 2YFUA 1VRH3 4Q4Y2 4XXPA 2GC0A 4CUBA 5FO8B 1YFUA 5SV5A 3VBSA 4FOVA 3TN91 3ZN5A 4CP9B 1UOBA 3ZFEC 4LO8A 2K9ZA 4KQ7A 1CPNA 1BEV1 2XUMA 5C9AB 3W21A 4YW4A 2DDUA 3D3AA 3IZOA 3Q8BA 5DUWA 1MACA 4LO7A 4XHBA 2ZABA 2A75A 4RFT0 3HBZA 4XVHA 3O1TA 4MG2A 2P6CA 1HQWA 1Z7S3 5FBJA 3BI3A 2R30A 3DF0A 4K7JA 1QF3A 4MGKE 4EYUA 1EAH2 1R1A1 2VZPA 3CIHA 2IFWA 4QKFA 1YCIA 4ATFA 4UFLA 3JB4C 4FXKB 3W5MA 4R9CA 5FYIA 4BPZA 4BZ4A 2D93A 3HIFA 1F4AA 3VL8A 1LESA 2G9ZA 1LU1A 4QGLA 4XDQA 3X29B 4S2DA 4LPLA 3NKTA 1PM7A 4K6BA 1BK1A 1JBCA 2W3JA 5J98B 1D2QA 2UWCA 5LK5A 3BALA 2ZGQA 4M3CE 1SFYA 2ZKNA 3I3MA 4B7EA 1PK6B 2LRPA 4QPIB 5EJ3A 5FFOC 4D94A 1IPKA 1IQDC 1SLLA 2A6WA 3POJA 4Y5Z0 2BW8A 1DGWX 5F6KA 3O1PA 3DYOA 1VPHA 4YG0A 4AXOA 1PZ7A 4AWDA 3RI8A 1D0GA 4LULA 1SPPA 3WUCA 3IPVA 1ZBE1 4YM1A 2P6HA 5IW0A 3HN1A 4XYXA 3V0AA 2XQRA 3VBUB 1NA1B 5AVAA 2PN5A 4Y20A 2PHUA 3MLLA 4F8AA 1G86A 2UWAA 2XOMA 4CE8A 5CG9A 3URFA 2BPA2 4AYUA 1YI9A 1RUI2 2QQNA 4GULA 3NNLA 1W39A 5EJ1B 3WHUA 1XE0A 1K3IA 1KDMA 3AYEA 4DINB 2GN7A 1GQGA 4NIIA 5F7UA 4RS5C 2ADDA 1DP0A 4J1XA 1OBNA 4AEDB 4CU7A 4QX3A 5C3OA 2QQUA 2YB7A 1WD4A 2E51A 4JRLA 2X05A 5CFDA 3LOIA 4FOQA 4CEYA 4HVRA 1WCUA 2A3XA 2GC1A 3I7DA 2QQVA 1JZ5A 1OURA 4B8EA 4XJWA 1YIPA 3P3NA 1NUKA 1J59A 4IGOA 5A3NA 2W91A 3POSA 2WNUB 3R6SA 3ZFFB 2R0HA 2J1RA 1OMIA 1S55A 1MQTB 3M3EA 2FDIA 5FREA 4AEMA 5FLJA 2OW4A 4DXTA 4Q4W1 1HJGA 5F3EA 3THDA 1AYM2 4CCCA 1OD3A 1MS4A 1HN0A 5K9YA 1OOPB 2VZUA 3JZVA 4Y33A 4JQRA 2PLV1 3HNMA 4CDXA 1DQ0A 4XQDA 2VVFA 4GZ9A 1COV3 5LASA 3OUHA 5FPBA 4XHXA 1CAWB 2B46X 1JXNA 2GNDA 2XJRA 1GSLA 5LCWL 2YPDA 2GSYA 2AEYA 2GAUA 2K2SA 3NNJA 4I09A 4LHSA 2VAUA 4TLGA 3AKQA 3WUDA 2PQSA 2SBAA 1O4TA 2HH9A 4L92A 4FPYA 2VVEA 2VTFA 4W8JA 3U78A 1RMU1 3ZN6B 3MW2A 4I02A 4DRRA 1UQXA 4AHYA 3VZJA 3SKVA 3CJXA 2GNTA 5ANNA 1QJX2 2E7AA 4ZXKA 5I8TA 2VOTA 2J22A 5FXXA 4BYYA 2DTYA 3GZAA 3GZEA 3PIGA 3H50A 3ALQA 1HRV1 4COVA 2BVVA 4WM7A 3PUIA 2W68A 4Z1VA 5HCBA 3HNBM 1ULGA 2WZ8A 3E5XA 1L7RA 1SLCA 1YFYA 4XMAA 1WMXA 2DCJA 1QJU3 1WW5A 2R043 2ZHKA 4GJZA 2VTXJ 4XZUG 5C33A 2JXAA 5JPMB 5FO7B 2QE3A 1UO9A 4JGZA 4E8DA 5C8WA 3GJBA 4NRPA 3ZPYA 4GKYA 4QX0A 4NVPA 2VZ1A 4AI3A 1DGWA 1W6PA 3N4MA 2VUCA 4INDA 3BTZA 3VBSC 5HI0A 4QKDA 1CAXB 2H0BA 4H3WA 2UYBA 2HWF2 3C7OA 5FY8A 5T50A 1W8ZA 2XVKA 3UKNA 1JOJA 2J1VA 4IGQA 4DOUA 1M4WA 5D21A 4QHZA 5FJHA 1NE6A 2P3IA 3JD72 3VDDA 1G9CA 5CA6A 4MLOA 3S5QA 1DGRA 3PNAA 4AI2A 5LA2A 2R49A 1O7FA 2VW2A 2YDEA 5FYTA 4YM3A 1ND2B 4XFHA 2RJ2A 1VB2A 2YUEA 3OUIA 1JOBA 2YC4A 4H7LA 3SKJE 4DZGA 1FMD1 1AXKA 1QY4A 1H2KA 5A3PA 2P3KA 1X82A 4RGKA 4Y4RA 5APAA 3WDXA 3FUQA 3DUIA 1XU1A 3NMBA 1W6MB 2ZX1A 2KXLA 4LBLA 4OI0A 4PLNA 1GZ9A 2Y26A 1PO13 5CFCA 3QH6A 2I2SA 2RMU3 4A7KA 1OFSA 1UYPA 1U5XA 3MFCA 4JX0A 1LOBA 1LKNA 4Y4YA 1H8TA 2YZ4A 4Q4Y3 5IATA 1GWLA 4DXSA 2PELA 3VZMA 2QQMA 1B35B 3H3ZA 1VAVA 1WW7A 5LY1A 1F4HA 4FFHA 4GJYA 1AX0A 5KHHA 1HB4A 4PDWA 3AM2A 2JG8A 3I2GA 1W9FA 4XAEA 5F37A 2JDAA 5BV6A 5JOZA 3RMXA 2W92A 3UKVA 1NAEA 1VBA1 1PO22 5FWEA 1N3QA 2EA7A 3HEIA 4ZU4A 1EV11 4Z8BA 4IV3A 3AYCA 4E4DX 4OMDA 2JECA 4HZFA 3BPZA 1HB1A 5EFUA 1CJPA 3T0AA 1UKRA 1I5ZA 3ZYHA 1HQLA 3BIEA 5FP7A 1EAH3 5FUIA 4NO4A 4LORA 1FNYA 1X7NA 4LUKA 3HQXA 3KCCA 2WAAA 3LFIA 4LO6B 1UWWA 5FYYA 3AZZA 4J25A 4SLIA 3J7HA 2VQUA 4LLOA 2CSGA 1SBEA 3LDKA 2CTVA 3LOBA 4QHBA 4XUNA 5J48A 2DVBA 4Y22B 3VLBB 2YMZA 3A0KA 2ENRA 2RS12 4I01A 3NVCA 4CEYC 3LGRA 3TEXA 4ET7A 1WA6X 4N7UA 3ZSJA 4D8MA 1OF4A 5GLUA 3H1YA 1XE8A 2DUPA 4QPIA 4LHLA 1UZWA 5BXXA 3USUB 2VMFA 1H1IA 1LEMA 3WT3A 1OLRA 3TRSB 3FMGA 3WG1A 2P4EA 3T3YA 4OHZA 1L7QA 5FYHA 5IUQA 3ZN4A 5AC91 1QHDA 5T5JA 1Q8VA 1UF2C 1ENXA 2G1MA 2VNGA 2ZGSA 1J3RA 2ZJCA 3I2KA 2JDUA 3HT1A 4OQ8A 4LA3A 3VBFB 1NA1A 3EQEA 2A1XA 4ZKTB 2PHDA 1S0FA 3POWA 1XYOA 5J3UA 2ZHMA 2VMIA 2GP5A 3KV6A 4K3UA 4DMIA 1PIV2 3WW3A 5FZ7A 3ZX7A 2VJXA 1RUI3 2Y8KA 4IGPA 1OFNA 1KITA 3T08A 4HPKA 4XC9A 4BIFA 1G6NA 1FV2A 1RC6A 2LS6A 4AEDA 1I1EA 1MS8A 1TME1 1A8MA 1DYKA 3T2OA 2W1QA 2CAUA 4XF1A 4LKDA 3E6CC 4B7KA 1TQ5A 3QOPA 2RM22 5JI7A 2R062 4EZHA 3LE0A 5FPXA 4AI8A 2A3YA 3ZO0B 2QZ3A 2FHRA 1RJ8A 4Q26A 4GWMA 4QQ2A 3O7OA 5ERLA 4AE2A 2WS91 3MV01 1JZ8A 5JIUA 2QUOA 1MQTA 3SCHA 1HDKA 1KD7A 2EALA 1UAIA 3M1HA 5H9PA 4BH9A 2J1SA 1LEDA 1ZZ8A 2P17A 2PAKA 4WM7C 1RUD2 5FZLA 3PJQA 2VZTA 1QQP1 3VKLA 4OCTA 1AYM3 1SLTA 2BJSA 1WCKA 4UYBA 2Q8OA 3WNKA 1UIKA 4NHLA 3AZVA 1RUJ2 1OOPA 4CCLA 1F15A 3O0XA 3R4SA 4KWUA 4P14A 3WP3A 4JGZC 3NJVA 4P9WA 4QGMA 2B9UA 4P02B 5BUVA 1KS4A 2VVDA 3KMHA 2VXJA 2VPVA 4LBOA 1BBT1 1CAVA 4UF0B 1D4M1 4XIKA 3MICA 5LA9A 1AR82 3ZN6A 1M06G 5CU1A 3TAYA 4YWAA 4RL7A 2BTVC 2NMNA 1B09A 2HEVF 4ES9A 4CUCA 1JYTA 4YVSA 1S2KA 2NN8A 4P9JA 4RS5B 3J7MA 5IK7A 4TWTA 2ZGMA 3RZGA 5FKCA 4NIDA 1QJX3 1UCXA 2VQ0A 4AF9A 4O61A 3J7NA 1WA4A 2HWB1 5CVRA 3POFA 3VDDC 4XBQA 1UXZA 4FOWA 2Y38A 1A8DA 5FPUA 4AHZA 4AFAA 3BCWA 4Q27A 5HPOA 4JDMA 1S0GA 1HV1A 3CMGA 5GZCA 3ACLA 4UW5A 1OF3A 4ISQA 5CADA 5FMDA 3AZWA 4K8FA 3OYWB 4LOSA 1BVVA 3LCPA 2ATFA 3PL0A 1W3XA 2ID4A 1OA3A 2Q1MA 5C3SA 3E5UA 2C6SA 2ZTNA 5CFCC 2ORZA 3AC0A 4CCDA 5JI9A 4DRVA 1H8TC 3O1MA 4Z2AA 2ZMLA 4JKLA 1CAXA 4CRQA 4FTSA 1ULCA 2AYHA 5DAVA 3I2HA 1ASJ2 3T1LA 2X53S 1AR71 4DUWA 5IVYA 2EVXA 4PDWC 2GC2A 2JG8C 2X09A 4HANA 5DPNA 5FY5A 2A73B 3J8F1 4M01A 3KCXA 4N43B 1O5LA 1Q3EA 3NW4A 3RFRA 2VZSA 5GZGA 3JD73 2JD9A 3DV8A 3UESA 4CU8A 4LLFA 2XKPA 4Q0PA 5A7OA 4N9IA 1SBDA 1SFPA 3LSDA 4IV3C 5KC6A 1F2NA 3PVOA 4LMFA 3SHRA 1DYPA 2J1AA 2QTWB 4IDZA 4NR1A 2VNOA 2RJKA 2C1FA 1Z0HA 2QDRA 2WT0A 4FPJA 1ZBA1 3CO2A 1WCDJ 1IG0A 4GXLA 3MF6A 3BTYA 5A7SA 4HETA 2K46A 4OLLA 4G4FA 1ONAA 2G9FA 1AR92 1YQ6A 3AKSA 1MZEA 4C90A 5IVBA 5JSOA 3VD4A 1C8NA 1W2OA 4OYUA 2BRTA 5T5PA 1PZ9A 2GDFA 1WUVA 5B2GB 1OPOA 2OVUA 1B35A 2EIBA 3ES1A 4QXKA 4MXWB 1Q8OA 2Y0IA 2B5HA 4QPIC 1AXYA 2W9XA 1W6OB 5GLWA 1AYN1 4JC1A 5BNOB 4BCUA 3JQWA 5LBEA 1YI7A 4Q0UA 3ATGA 5JIAA 1C28A 3AL6A 2XMLA 3BVCA 4L0PA 3VHNA 4QPGB 1MZ5A 1PO23 3ILNA 2XLAA 3MPBA 3OGJA 4AAPA 4CXYA 1RHI3 2ZGLA 3GBWA 5A32A 1K5MA 2EIGA 2Y6LA 3OGSA 4YFWA 1W03A 1LNSA 5I0TA 3H3UA 1S0JA 4LR4A 3I59A 1JN2P 5F6LB 2RS31 1YEWA 4XFIA 2YPJA 4OHYA 4JVAA 4JDOA 1WMDA 4OUEA 2FCVA 1LODA 3FZ3A 1KEXA 3LDBA 4FPLA 4Y1XA 4YZ4A 2F17A 3FJSA 5FP9A 5FZBA 4AEDC 2J7MA 2VUAA 3K3OA 3MGUA 4WVVA 5I0SA 3T4VA 1GYKA 4Y22A 3C2UA 3NV2A 1A34A 2JB8A 1NZCA 4LK6A 3JQXA 2RS13 4RA0A 1MZ6A 2OT7A 3LPGA 3ZMNA 1UZZA 3IT8A 4OHVA 4EWDA 1ZREA 1TMF2 4AVBA 5FJKA 1AXZA 1S4CA 2IXIA 3EXUA 2F4PA 4X6RB 1HX6A 2IXKA 4A44A 2WZR2 4FTBA 5FY9A 5JWPA 2A6YA 3E6DA 4B4RA 3L2YA 2BBAA 3AZXA 3ZOIA 1QXPA 3EHKA 2FD8A 1DLLA 1W90A 4OVEA 3KVBA 1GQPA 3VB9A 3G7DA 3VBFA 4KMQA 2H0VA 1OOPC 4LTAA 5LBCA 2WZPP 2QFEA 5EQUA 1QU0A 1VBE3 1OVPA 1H4HA 2ZAHA 1TNFA 2FDHA 1JMUB 3H7YA 3MUY1 1W2UA 4JHZA 1DQ4A 1SPPB 3ZYPA 4AQ2A 5JR2A 4TN7A 2C26A 3KV5A 1PIV3 5FCCA 4E2QA 3HBKA 4AHWA 2XBO2 3AKRA 3J7LA 4IETA 2A6VA 2NP0A 2DYCA 3CHXA 2OQ7A 3FE5A 4NAOA 3D82A 3WV6A 1OPMA 4MADA 1NLQA 1Y3TA 2ARXA 3NNFA 4RSUA 1KJRA 4AQ6A 1SDWA 3OUJA 5EIYB 3B01A 1ZRRA 3C7FA 3O5SA 5FWJA 2BQPA 1X33A 2RM23 2LROA 2JENA 2R063 3I2FA 3I3QA 3OEAA 4FOYA 4GWIA 3POBA 4Q0VA 1VR3A 1NKGA 1RHI1 1XC6A 3AYDA 1VJ2A 4KWKA 1FAYA 5JOYA 2XH6A 3OGGA 3WW2A 4N7IA 4E9KA 3K4AA 2RR11 4CCNA 1W6NA 4PLOA 1UZVA 1RUD3 4EWAA 5A6ZA 1W8HA 4GD4A 4MGYE 3SEPA 4QXBA 5LBFA 3O1VA 3T0DA 2Y6HA 2WO7A 2RS11 3M3QA 3OPTA 4K40A 4KL1A 3RWNA 2C9AA 3IWZA 4XEZA 3B3QE 4ES8A 5DUVA 3RYRA 4C0HA 3APBA 5A1AA 5F2SA 5KXEA 3NQHA 2GC3A 2VL4A 4UF0A 2J1UA 4XIOA 4OQ9A 5EJZB 1LU2A 2P3YA 1AR83 3N7JA 3KSCA 3DKWA 3MW4A 4PIXA 2C5DA 4CPBD 2EXIA 4M0HA 4Y5SA 1RUH1 3RG0A 3OSDA 5AFEA 2ZEWA 1V6LA 1MS0A 1VBE1 2ZGUA 3N3HA 3EMRA 1XNKA 2IXHA 3KV9A 2WDBA 2RG4A 3VDCA 1NQJA 4NWVA 2BV4A 2AZ5A 4QU1A 3H8UA 4HBNA 4XBNA 5JSRA 5C3RA 3O12A 4R9AA 2D3PA 4EZ4A 4HFSA 5FIXA 3OYWA 2CV6A 4QMAA 4NROA 3R4UA 2BOIA 2PAMA 4YW7A 1YRZA 4R9BA 2A6ZA 4XUPA 2D6MA 3NNMA 1C4RA 5M0TA 3ZYFA 5JDBA 1N47A 2XONA 1BMV1 5FOBB 4JGZB 1VIWB 1UY0A 2ADEA 4XCBA 1B35C 2GMPA 2ZMNA 1UOGA 3ES4A 4YGBA 5IJRA 1ASJ3 5I8YA 2K0GA 1YWKA 4M3CA 3VD9A 4ASKA 4RHV2 4B4PA 4O9GA 2V5YA 1VBD2 1A78A 1JZ7A 5D1IA 1DYOA 4N43A 4ZS2A 1IPJA 4EN8B 2Y60A 4XURA 3RJRA 1V9U1 5FZCA 1IQAA 4MGIE 4I0BA 5D8AC 1LOEA 1PGW2 4K1YA 3WG4A 4Q0QA 3ZKUA 5FXZA 1K5MC 3K3NA 1FPN2 1XOYA 2A3WA 3T09A 4BA6A 1CIWA 3PTRB 3T2QA 2V4AA 3VDDB 4LHNA 1XB9A 3HQRA 1EUUA 4LO4B 5JCTA 1YFXA 1AZDA 4JRAA 3MEPA 1FX5A 3A4UA 4LBNA 4YGEA 5EHDA 4AFMA 4D6SA 2L9LA 2YC0A 2CYFA 3KT7A 3N35A 2NMOA 1WCQA 2FBEA 3GHMA 3UK9A 1AR93 3AKPA 5E88A 1WBFA 3U10A 2MNGA 3FLTA 1MEC1 4LBMA 1OA4A 2UY9A 3O1UA 1YUDA 2DTWA 3E6BA 3LF7A 5F3IA 1FT9A 1MVEA 2IFRA 3LEGA 4MXWA 5FZ0A 4AK3A 5A3WA 5CFCB 1RXFA 4LIUA 1AL22 1W6OA 2RDRA 5BNOA 4QPWA 1H8TB 2Q1FA 4BMEA 4B1LA 4LT5A 3C8XA 1GOHA 2VG9A 5FOJB 4QPGA 2QCSB 3P5BA 2C9KA 4QKBA 3ACIA 4PDWB 1BCXA 4X8NA 1LOGA 2JG8B 4N8MA 5GJ6A 4A4AA 3SC7X 3VBFC 1FYUA 3GF6A 4YW6A 4MHRA 4QDSA 3USSA 5F5QA 3IM0A 2WFF1 3WXPA 1Y7BA 3K51A 3AK0A 1HRI1 4HSJA 1VB4A 3CJIB 4IV3B 2WFPA 4V2WA 1STMA 2RDNA 2R16A 2ZHLA 2ILMA 3WSOA 4FPCA 4NHKA 2BGOA 1GZWB 4V1PA 3DXTA 2O0OA 1US3A 1YFWA 2A70A 4MOAA 4RYDA 1S0DA 5EXOA 3FHAA 5IAXA 3B93A 2RVAA 1BXHA 3D6EA 4GAZA 2YGMA 2B45X 2Q8CA 1POV1 2R072 1ZZ7A 4JAAA 4IEPA 1W8WA 4QX7A 5ACA1 4LBQD 1PVC2 3POGA 4YVSC 5F3GA 1TMF3 1WLDA 4YNIA 1JW6A 2D6OX 1L3JA 2HWD2 5JXIA 1FV3A 1NCQB 2QQKA 3U4XA 2WZR3 3AB0A 2WBKA 1QJY2 3B02A 1NOVA 1J58A 5DZGA 4Q4V3 1CESA 4IEXA 4K21A 1EPWA 2FMYA 3WINE 4UW3A 2VBBA 3JBG1 5IWFA 4XE9A 1W05A 4LXLA 3NL1A 4JV4A 5LRRA 3ZXEA 1GV9A 4LE4A 5HCAA 1R081 3VKMA 5DQ0A 1QOSA 3FBYA 4NHYA 3WG2A 4NOTA 3BU0A 2ZX3A 1D2SA 1MVQA 1W8TA 1ZZ6A 3CLPA 4XZPA 5I91A 1REFA 3O1OA 1QXJA 4XABA 3C7HA 1UW8A 2XBO3 4GH4B 2JDYA 5E6HA 1DIWA 4COUA 1VRH1 4MVTA 1YQ2A 1XJAA 1NQDA 1ZRIA 3TNQA 2HWE2 1BZWA 4ZPIA 4COYA 4HPKB 4JZRA 1CZTA 4PF5A 4S2HA 3LDRA 4NMIA 5HCHA 5TSWA 2ZXQA 1LJ7A 1MS3A 3ZDSA 1VBB2 3QBQA 4F83A 2KA3A 4L11A 2YC2A 5G04L 3WP5A 2OZ6A 3I3BA 4FPHA 1OH3A 3M7AA 5LBBA 4CXWA 3LB9A 2GP3A 4KG8A 1Z7S1 3KQRA 5CYYA 2HWC2 2JICA 3ZLIA 2OS2A 5E1RA 1ACCA 1REDA 4Q1PA 4XFGA 2D97A 2VM9A 4KNCA 3ABZA 5BNPA 2P34A 2D5HA 1W8NA 2ZGRA 4GB32 2V4VA 5BNNC 1IGOA 3MUZ1 2ZX0A 1UYYA 2Z5WA 3CDZB 5K0UB 1SLIA 1RUF2 2AEZA 4Q4V1 1ALYA 5GALA 5JAXA 2OA2A 2PHXA 3LA2A 4CSWA 3J4UH 1IS3A 1XSQA 3C3VA 1CZVA 2AENA 1JS9A 4CXXA 2XGXA 4RGAA 4NE9A 5FZDA 1CAVB 1UPIA 2GN3A 4XACA 2JIGA 4N43C 3D8CA 1V70A 5JSPA 4IQPA 3I2DA 2IC1A 3I4IA 3ZXKA 5IVCA 3U37A 4YVSB 1H6YA 2XVGA 5I8SA 4FXGB 1IS4A 2WKKA 5FYSA 3CEWA 3PU8A 4K8RB 4MXVA 1UPSA 1H2NA 5FDBA 4TYSA 5KXBA 4UW6A 3TOJA 1QEXA 1RJ7A 3TWIA 4YZ2A 5FK7A 5LW9A 4BQYA 2GNBA 2CAVA 3VBOA 1X50A 2G9GA 5DDJ2 1SQ4A 1QMJA 2VZVA 3RMYA 1RUG2 1Z78A 3H7JA 4FSJA 4XETA 3S5AA 1YQ8A 3KT4A 3N36A 3N7KA 2VMDA 5F9TA 1W0NA 4KBZA 5K7PA 3KGZA 2XJVA 3L2HA 2VBPA 4EN6B 1QDOA 2JDMA 1GUIA 1BLZA 3G6JB 5BNOC 4RHV3 3VBRA 1C5HA 3O1SA 3WNXA 1VBD3 5T3NA 1NY71 5FR3A 1H8VA 1WKYA 1BYHA 3OB8A 4QPGC 1SBFA 5AFBA 4DQAA 1HIXA 3RVHA 3M8LA 4GIQA 2XJQA 4GKXA 2ZGNA 1FPN3 1RUE2 3AMHA 3TB0A 3W20A 3ZYJB 3RS6A 5JMOA 2WINB 1EUTA 1W0OA 1COV1 3IDCB 2RHPA 3MO4A 3GGLA 3NKGA 4HL0A 3RZKA 2YBPA 2BEOA 3MIFA 3S57A 5JPNB 2C4XA 3N9QA 3POEA 3CQOA 5A3UA 2XB6C 4PI2A 5CNAA 3CBNA 4ZY9A 2OIIA 4P00B 5D2AA 4UT5A 5EYXA 2Q0AA 4X8PA 3FLRA 1QOTA 1WMFA 2VMEA 4K9SA 4RR3A 5KC5A 2LUWA 1BQPA 5LEKA 4L99A 5L7OA 1VBC2 3J26N 1YNAA 5A7QA 1ULEA 1AL23 3ETPA 2A71A 4DXRA 1ZA7A 1RITA 4OI2A 4Z2WA 5JLVA 5J1XA 1JYXA 4E2SA 1UN1A 1HLCA 3OPZA 4AFCA 2CGNA 2E7TA 1R092 2Z42A 5A7NA 2ZBJA 3DCQA 4JGYA 3MLJA 1LHUA 4XJ9A 2Q1ZB 1QJU1 2R041 1DQ5A 4LQRA 5EZWA 3HWJA 1H9WA 5D8AB 3B5LB 4K20A 3CF6E 4J6GA 1JZ4A 4M4PA 3CJIA 5E89A 5A32B 1K5MB 5T5OA 4L9BA 4MYEA 5DUXA 4XFBA 2GH8A 2JX9A 1YO8A 3WNPA 1GZWA 4LKSA 3I59B 2ORXA 1KFXL 4KBBA 5LY2A 3J9SA 1HXS2 3BUCA 4D7YA 1F9KA 1U12A 4QX5A 2R073 3WOGA 3AFKA 1RIRA 2R1BA 1AR62 1NCQA 4XQ4A 2HWD3 3ITQA 1RINA 5HV0A 4FFIA 4BQ1A 3K48A 3BB6A 2YYOA 1S2BA 1MS1A 4O7XA 1AJKA 4H14A 4C1WA 5JR7B 1PZ8A 2Y34A 4DFSA 2RS52 2ZA9A 4E2GA 1JZ6A 4WM8A 5IVEA 3SH4A 4XDPA 2MEV2 3BYWA 4BQWA 3S7IA 3FC0A 2E31A 2JG9A 1CZSA 5BPXA 4HN0A 4DEQA 5BNPC 1MS5A 2E53A 1RUOA 2BERA 2H6CA 4RN5A 3TNPB 2W95A 1NCRC 2ZCWA 1PO11 3MZHA 3LSEA 2YU1A 2RMU1 2VECA 3KLSA 1S0BA 1V0AA 3PUHA 4GH4A 3WDTA 3ZIWA 2XLGA 3B9CA 3H1MA 4Q4Y1 5C5TA 3OBZA 4E4ZA 1SCRA 5FY0A 2AH2A 2HLEA 4Y26A 4MGTA 4ZU5A 3BOWA 5GZFA 4S2FA 2HWE3 4FP2A 3THPA 1PGL2 4AR2A 3B69A 4OHWA 4EN9B 1XBFA 3MIHA 3QACA 4BQ2A 1UMHA 1G9BA 2ZEYA 1WLWA 2BGCA 2DCTA 1FOD2 5CIRA 1BVP1 4WVMA 1VBB3 4QDQA 4YZ1A 3DN7A 2BYVE 2Z2SB 3PVBB 2BFUL 3WDYA 1KRIA 2HKXA 1V00A 3A21A 1PMIA 1LULA 3ACGA 4FI9A 2VOWA 2HWC3 2WN3A 5EP9A 1EAH1 3SLIA 1Q8SA 1DHKB 1G9FA 5FPZA 5LRSA 1G9DA 1W6NB 4FPKA 4MGSA 2FQPA 1RVF2 3V64A 1VMJA 2PHFA 3VBOC 1QJEA 1XNDA 5DMYA 3UJQA 4GB33 1C5IA 4DIQA 1ULFA 4PHZA 2V09A 3DYPA 1YC61 3QLQA 5K0UA 4U2AA 4KGGA 1RUF3 1C8M2 3W5NA 1SLBA 2N7GA 2PYTA 4CCOA 1X36A 3D0SA 1DCSA 1W9TA 5IYYA 5L73A 4B29A 2XHNA 3VBRC 4FTEA 1BKZA 3NSTA 1L7LA 3N7LA 4XQWA 1TVGA 3HOBA 2W1UA 4FPGA 4I0WB 5A3OA 2OUJA 3CU7A 3GXUA 3K46A 4U36A 4GWNA 4AQSA 2Q30A 4DO0A 3AKTA 1APNA 1EP0A 1KDKA 2PHLA 1JH5A 1WW4A 2DBIA 2DFBA 4TXWA 1DU3D 1OI6A 5C4WA 3T2PA 3WHTA 4BISA 2WAOA 4Q4X2 1XXNA 4IE5A 3SH3A 2BNOA 4YSFA 2XWJB 1LGCA 2UWBA 5IFPA 1JUHA 1NX9A 4OZXA 2SLIA 2ZKLA 5FPVA 3MHZA 1E5HA 4FFGA 3K4DA 1RUI1 2NPIA 1UY3A 4DUXA 4PJYA 3H8OA 2UU8A 3LIGA 5C7GA 1RTVA 5DDJ3 2XJUA 1RUG3 1ODMA 3VHOA 3CL1A 4NUBA 3WQ7A 4E8CA 5ISLA 2EAAA 1VBB1 2B7YA 4XUTA 2C0ZA 4RR3C 2ZHNA 3AXDA 4N90A 1X8EA 5KWRA 5FPLA 2W39A 2ZGOA 4QXCA 5GZEA 5BNNB 5L7OC 1K42A 1NXMA 2CDPA 2ZZQA 5T54A 2Y6JA 4UXAA 3UL2A 2DVAA 2X10A 3LA7A 2D43A 3VN4A 4JKMA 3WNNA 4FAHA 1ZZCA 1X9TA 4R4ZA 4AI0A 4A7YA 2ZMKA 2HWF3 1CX1A 1U5IA 1ZX5A 1OC1A 4M3CB 4JGYC 1GOGA 2YV8A 1AYM1 4D3WA 3TN92 4CUGA 3B00A 3VZKA 1W6QA 1F5FA 3ACHA 4RGGA 2AUYA 2Y33A 3OF1A 5JZGA 1W28A 4UBHA 2P37A 4A6SA 4LKFA 4W6XA 1BEV2 1Y9MA 2HEWF 4BM8A 4QPYA 5IVVA 3PURA 2WUHA 1S0IA 3CJIC 4IXLA 1FNZA 4BK4A 4ITCA 3ZSKA 3K75B 4DS0A 3PTYA 5JOWA 5DG1A 4XPVA 2XKOA 3VBHB 4KG0A 2GALA 2UYAA 1DQ2A 5HXVA 3LEKA 1NG0A 4H55A 3Q8AA 4AHXA 1KGYA 2P3JA 2ZEXA 5FZ3A 3W59A 1CGPA 1R1A2 4XAAA 2I74A 3P6BA 3OBRA 4R9DA 4CYDA 4LKEA 1UD1A 2BVBA 2B4KA 1VBC3 3IMNA 1QJX1 3MW3A 4QX1A 5DUUA 1NCQC 3T1MA 5KHJA 3KS7A 2DVDA 2XJPA 1JU4A 2HJIA 1QH6A 2GH2A 3FFQA 4UFMA 1WWYA 3B94A 2EF6A 5A7WB 2QQLA 1R093 2RJLA 4YVWA 5JXGA 4HMZA 3FX3A 1YLLA 2DCKA 4WM8C 3KT1A 4CDUB 1W2NA 1WD3A 3RGBA 4BMBA 2A5ZA 4I2OA 2JG9C 3I2OA 5D8AA 2Y6FA 4FT8A 4P9GA 2WRAA 5DAXA 5T55A 4M4RA 5F1RA 1I5PA 4YGCA 1CIYA 3WEZA 1OLQA 4DB5A 2YROA 3UV9A 4N53B 3ZFGB 4KH9A 4PIYA 4HONA 4GALA 4YARA 1H1AA 3LWCA 4GH4C 3ZYBA 1JZ3A 3LEIA 2HEYF 3RYKA 3S30A 2E6VA 3F95A 2D6NA 1ZBE2 5H9QA 3ILFA 5FRAA 5FYVA 4Y1YA 3GYDA 2GMMA 4XF3A 1WLTA 2GZWA 4FCAA 3OY8A 1HXS3 2HWF1 2VU9A 1BJQA 1LHNA 3N9NA 3RNSA 1T2XA 2DCYA 4OUSA 3KB5A 3VD3A 1RUNA 2ET1A 4F3JA 4NRMA 3V0BB 4EN0A 3FBMA 3NJXA 1ENQA 4LBQB 1N1TA 2IXLA 1AR63 1UKGA 2YHJA 3RSJA 3VDAA 3JD71 2XQXA 3HQUA 4YW3A 1JOPA 4D6QA 1PM4A 2FCUA 5F32A 1WMEA 4HT1T 2WT2A 5FQ0B 3VV1A 1ZRCA 2E9QA 2E32A 1OT5A 4NPRA 1OXCA 2RS53 1RUC2 1LECA 4YRDA 4D6RA 2B39A 2WO3A 3A0NA 3ZXGA 2MEV3 4DNYA 2VXRA 3DGTA 1PX4A 3BN6A 1HB2A 2VD7A 2OZJA 4QU2A 3MPPG 4KWLA 4CCEA 4J1WA 4CU9A 1RGSA 2ZEZA 3RWKX 1V6MA 2J1TA 4ASMB 3WQ0A 5A3MA 4Q4W2 3POIA 3A23A 3GM8A 4GMP0 3O0WA 1PHMA 4MGZE 4TZDA 4NIHA 3PIJA 2O8QA 4AG4A 5K0UC 4EROA 3AZYA 1JYCA 1OQDA 2PLV2 5F5AA 5FK8A 3VHPA 3QCWA 2P1BA 3WDUA 1UY4A 1HQNA 4WVZA 1F5JA 2JE7A 3M3OA 4HOOA 3LA3A 4YG6A 4LHKA 5FZAA 4BJ0A 1FOD3 4Q0SA 3I2IA 4PIZA 4JTOA 1PO21 3I54A 4MO3M 3MIGA 4D0QA 3WP4A 2DUQA 3T30A 5K8SA 3IMMA 3IN9A 3ETQA 2XHKA 4IV1A 1RMU2 1EYBA 1W8OA 2NM1A 3SISA 4OI1A 1V6JA 1V6IA 2XR4A 2HBTA 3WZ1A 1ND3A 5DAPA 3NJZA 4ZS3A 4AZZA 1IKPA 5C4WC 1O8SA 1IKQA 3ZSMA 2PMWB 2JE9A 3HAGA 2R1DA 1AX2A 2C24A 1CAUA 4QD2A 4Q2FA 1Y4WA 2E26A 3WNMA 1GKBA 1KXGA 3ILRA 1LOAA 5FXVA 3UJOA 1HRV2 4TSVA 1QDCA 3ORJA 4G9SB 2EIDA 1RUJ3 1LRHA 5F5CA 1QNYA 1KFUL 1WCSA 5A7PA 1W06A 4HN1A 2R32A 3GCXA 5BNPB 4XILA 4CP0A 4EN7B 2QQWA 1NCRB 2E7QA 1C8M3 3BGAA 2BU9A 4FFFA 2XWBB 4HK9A 2CHHA 5GZDA 1E57A 5B4NA 1W04A 3ZMOA 4HKWA 4CPBA 5ANQA 1H0BA 2IWGB 4QX2A 5BYNA 3Q8FA 2Y0OA 1UY1A 3KD4A 4LUMA 3Q9OA 4BDVB 2D3SA 1LHWA 4NWWA 4ARYA 1QJZA 4XJUA 4DY5A 4Z92B 3ZVXA 5A33A 2WWJA 2VQAA 5JZGC 5L19A 1XSRA 3VZOA 3ZDVA 2NYYA 1HN1A 4QQOA 3FFZA 4Q4X3 4UWDA 3H8XA 5C6CA 4XJZA 1XPWA 5LA1A 3O14A 2A7AA 4GMP3 1PIV1 2PXJA 1KJLA 4RQPA 5ABJA 2D6LX 5A1FA 3RZHA 1F8VA 4XF0A 3L9JT 3C7EA 5CB7A 1V6OA 1XYNA 5F39A 1H6XA 2EIEA 2W08A 2WL1A 1O3TA 4QKNA 5FMBA 4Z07A 4XFFA 3S7EA 2D6PA 1FMD2 2I07B 3IDBB 3VKOA 4LBJA 3VBOB 1FI2A 2DU1A 2R061 2RM21 2WZEA 2OKXA 4WBBA 4DEVA 5BNNA 5J7MA 5FMCA 2ETEA 1CX4A 1UOJA 3PUAA 3IIIA 4AW7A 5FV3A 1RB8G 4AI1A 5FY4A 5DN2A 4JDNA 2G4IA 2Y64A 4BQ5A 4IEWA 4COZA 1RUD1 2VNRA 3ZXAC 4YVWC 1UZ0A 1AUYA 2VMCA 3VBRB 4BK5A 3TN93 2BNMA 4NN0A 2WNVB 5IVFA 1CPMA 1RUJ1 2XLFA 5C8CB 1XRUA 2VZ3A 4S2GA 3ZR6A 2JE8A 1CWPA 2VOKA 2DBNA 1BEV3 5FZOA 4KI5M 2W1SA 2QNKA 5CISA 4LK7A 4Y1VA 5KBFA 1VBA2 5DAWA 2GU9A 1GQHA 1O8PA 2XG3A 3VBHA 2CWMA 1EV12 3R0RA 2PTMA 4I30A 3VZLA 2ZZJA 1PGSA 1AR81 1WBLA 3LZZA 3WF2A 1R1A3 2ES3A 2WSVA 2JDPA 4QQLA 3WVJA 5A6XA 1C3HA 2TNFA 3AX4A 2EXKA 4MV2A 2OX0A 4P9YA 3FN9A 4W4ZA 4PCRA 4L97A 3VD7A 2WO2A 4META 5FZ4A 4RR3B 1OLME 2WO1A 3HPNA 1G7YA 1MPXA 5IFTA 2IVIB 5L7OB 2X8KA 3D0JA 2J42A 2VGDA 5E16A 5A7WA 2WA3A 5CBLA 4XBLA 4CDUA 2QQIA 1TZOA 3POYA 3ZXDA 4QAWA 3SXWA 1JTZX 1VMHA 2VQTA 2WLPA 3KHCA 3RDIA 1E5IA 3RQ0A 1LAJA 4JGYB 4TTGA 5FBZA 2JKXA 3A22A 1VMFA 4N53A 3ZFGA 5AC92 3DL3A 3MDPA 3P1IA 5FZ6A 1IS5A 4QDRA 1UYZA 1SACA 2CY6A 4JHTA 4YW1A 4DPNA 1ZBE3 4MH0E 4E4HA 4YM0A 2FDFA 1CVNA 4IERA 3DECA 3ZYIB 1GU3A 1N1SA 1PVXA 1ASJ1 4AFBA 4DXZA 4XFAA 4MHUA 2XDVA 1VAMA 1XU2A 4BU2A 3V0BA 3INAA 2IUWA 4HK8A 1XYPA 4JKKA 4LBKA 4LBQA 3RZZA 3VGIA 1ZZBA 1VP6A 2P2KA 1QXRA 4IUGA 5FP8A 5A1LA 1TME2 3SQOA 1SDDB 5FQ0A 2PAEA 3OGVA 1ENRA 2RDQA 4IV1C 1OKQA 2FZ2A 2NQYA 1JI6A 1PMJX 1F35A 1ND3C 3NV1A 4IEZA 2JKBA 1RUC3 3EBRA 5A70A 5HBAA 5KHGA 3IDEA 4K1ZA 1ENSA 5FMOL 4CDQB 3LFMA 4YZ3A 1RYYA 2JJ6A 2GMEA 1LOCA 5CKQA 5I0UA 3DPRB 1VE0A 2WS92 1ZZ9A 4ORFA 1HW5A 3U07A 2ZACA 3CZUA 3DXUA 4WM8B 4YW5A 5FZHA 3Q8EA 1UMZA 1Q8PA 3WP6A 1AR91 1DQ6A 2DFCA 2YU2A 1S2EA 1N3OA 1KS5A 1OUXA 1QQP2 2JG9B 3OTFA 4FO9A 2JB4A 4Q4W3 3WF1A 4A6OA 5C3QA 3RZMA 4R4XA 3OD4A 3THTA 1DZTA 5H9SA 3GDBA 3N9OA 1JYVA 4JTNA 2CWSA 1S1AA 1PNFA 2ARCA 2PLV3 5DABA 1SFNA 3TEWA 2LTNA 1CJDA 4EV0A 4AVVA 4CP1A 3JU9A 1ODNA 3BTXA 4YG3A 1YHFA 3ME2A 3SH5A 4KU7A 3H3LA 1BBT2 3WNLA 3OOXA 1D4M2 4YLZA 5IT6A 4QQHA 1QOOA 2BFUS 4UFKA 3OEBA 1RMU3 2WLQA 4WVMB 4FAGA 1IG3A 1JHNA 5FZGA 2VOVA 2A6XA 2PHWA 2VUDA 4OHXA 1AVBA 5G05L 4RQPC 2HWB2 4ZXEA 2D98A 5ABJC 3FHIB 5FZEA 1CD3G 1OH4A 5I0RA 2V73A 1HRV3 3FLPA 4ASLA 2AREA 5FAXA 1OKOA 2VUJA 4E4SA 3LIHA 1H4GA 4SBVA 2RV9A 4L8QA 4D7SA 4X6QB 2XL7A 1VAKA 2ZX2A 1NCRA 5FZIA 4QX8A 3WX5A 2FDJA 1MS9A 1IOAA 1TMF1 1O5UA 5FP3A 3ZXJA 4XOGA 4AEKA 2ET7A 2IXCA 3UGFA 3MV11 1RUC1 2QBXA 2WZR1 4Y1ZA 1CQ9A 3HMYA 2WYSA 4HKOA 4XW3A 2X5IB 2FZ1A 3FUOA 1ST8A 3IBMA 3KQ4B 2QJVA 2WNOA 1DDLA 1AR72 3ZXFA 5KR7A 4FPOB 4DY3A 3KGLA 2Q5TA 2CDOA 2BBVA 1Y43B 3J8F2 4PBOA 4CCKA 3OPWA 3I2JA 4EWEA 1J84A 3M70A 3WF0A 2OXBA 4AGRA 4UBGA 4Q29A 2EAKA 5C4WB 2XBO1 5DAQA 1URXA 3HN3A 2YXSA 4W50A 3VBHC 2HYKA 2FDGA 3KZ4C 3FL7A 1HB3A 1BK0A 1D7PM 4TLFA 3SMHA 2VW0A 4E27A 5HXMA 1FMD3 3A7QA 4P9IA 3CKHA 3VHRA 4HLTA 1ZBA2 2VMGA 4HVOA 4HKLA 4ZONA 1JYNA 5FZMA 5HV4A 4NIGA 1VRBA 5LEJA 2BP6A 3WG3A 1LOFC 3OG2A 3K77A 1YJLA 3WF4A 2QQPA 1T6BX 1UYXA 4L2NA 5FXWA 4XXAA 2XJSA 3M4FA 4QM8A 4LIVA 5J36A 1EPZA 3QD6A 3PVNA 1IS6A 3ZR5A 4BIOA 3K2OA 4CTEA 3ON7A 4O9EA 1AF9A 3PDQA 5FLHA 4CDUC 4QQPA 2WNVA 4IE4A 1PX3A 4KU8A 5C8CA 2VZOA 1LTEA 2E33A 2ZAAA 3VDBA 3U75A 1AYN2 4WZFA 3ZM8A 2PA7A 5SV8A 3WQ1A 3GZTB 4MSVA 1W9SA 3MYXA 5FLIA 4BWOA 5IK4A 3KCYA 4MZUA 1X9PA 1W6QB 3WY6A 4NPMA 1C1FA 4N53C 3RRDA 3ZFGC 4AVSA 2VE1A 3T2TA 2R7EB 1DZRA 5JZGB 1VBA3 5LWBA 1O3SA 2F4LA 4UFIA 1QWRA 2DV9A 4GA9A 2Q8DA 1WGPA 3ZIXA 4AAXA 1EV13 1SCSA 2MPFA 2WABA 5JUVA 4NRQA 5IAVA 2RS32 1J3QA 2IZWA 3ZSLA 1DF0A 3VL9A 2VC9A 3ZPOA 4FPFA 1ZA4A 1JYWA 2QQJA 1OD5A 4PBPA 1F31A 5H9RA 1H2LA 3T4HB 1W0PA 3AMQA 5FZKA 4CU6A 2VO5A 4Q5OA 4ZHNA 1REEA 2WJSA 1GNHA 1HKDA 4XUQA 4Y1UA 5FYZA 3IB3A 4NIAA 1GMMA 3BU7A 2JDKA 1J3PA 1UL9A 2XJTA 3ZYGA 2EXJA 2YFZA 3H0OA 4URTA 4URAA 1G9AA 2TUNA 3C7GA 3RYPA 4A2UA 4CDWB 1W9WA 3GBGA 1UZYA 3TYJA 3BODA 1H30A 3FWEA 3GCWA 4HG6B 2BGPA 4ZZ5A 1GOFA 4YVWB 4A41A 2WWUA 1ZM1A 2W5FA 3AL5A 1DQ1A 5AC93 1O91A 4FQ4A 4FPEA 4P5HA 5EPAA 2HYXA 4CEWA 1U5YA 1UNBA 3NAPB 4XUOA 4GWJA 1XNCA 4UFJA 1GWKA 1V6KA 2DVGA 4AFDA 4A45A 4BQ4A 5F5IA 1UIJA 1OSGA 2ARBA 1ULDA 1W8UA 4RHV1 3RZLA 2RDSA 1VBD1 1OVSA 3H42B 4CP9A 3EO6A 4B3NA 2YG0A 3OY8B 1ZVFA 3WW4A 5IHRA 2ZGKA 1J1TA 2NZ9A 3NWKA 2Z69A 5CG8A 1PGW1 1TME3 1LB2A 4UAPA 5C9AA 3E97A 1PVC3 2VCMA 5FZ8A 5J09A 5EWSA 1Y9QA 1HJFA 1N1VA 1S0EA 1DZQA 1FPN1 2PHRA 3AP4A 3JCIA 4LA2A 1ZNPA 3ACFA 4N9HA 4CVUA 1RHI2 1QJY3 2XPJA 3BOPA 4CDQA 4MGQA 4M3CF 1DGLA 5GLVA 3DPRA 4ATEA 1GP4A 4HXCA 4UFHA 3UT0A 2WS93 1QIQA 1W99A 3SITA 1TEIA 1DFQA 2O14A 3H1WA 1OA2A 3LD8A 2RR12 4QHOA 4A3XA 1NLSA 1R64A 4R52A 4AGVA 2MHFA 1QQP3 5EYYA 3UNPA 4Z82A 1OQEA 3MF9A 2GNMA 4OZOA 2ZGPA 2WQ8A 4QM9A 3ZKYA 3ASIA 3CNAA 1PMHX 2UURA 3AMMA 1AL21 4OI4A 3U14A 3V65A 3PLQA 5CFDC 1W8FA 4IEOA 2X29A 4I3GA 1PK6A 1KQRA 3PVEA 4YW2A 5CAZA 5KHIA 3ECQA 3GHNA 4IESA 5LATA 1YQCA 1U0AA 2ERFA 3FHQA 1BBT3 4YFZA 1D4M3 3WQBA 1LENA 5F2WA 3AP5A 2VZQA 2B42B 2WWSA 3ZFEB 2D3RA 1YQ5A 3HR9A 2Q8EA 4QB2A 5T52A 4BLIA 5L9RA 3AP7A 3RZJA 1RUH2 2YGLA 2OUHA 4QB6A 3WR0A 3HT2A 3WCRA 2W2IA 3ELNA 4IV1B 3VBUA 1VBE2 5FTTC 2HWB3 2TEPA 1NLRA 1ND3B 2IVJA 4CDXC 4HSLA 2W46A 4Q8LA 5FYBA 5CEHA 4QGNA 2PQQA 3PMEA 4IEUA 1GZTA 3B7MA 2TBVA 2WN2A 1CAUB 3AVSA 2E63A 2Y6KA 1LHOA 1H2MA 1O59A 3BPSA 5A3LA 1UX7A 3GBFA 3NO8A 2JIJA 1C57A 2R071 1OUSA 1PVC1 4W65A 3DYMA 5BNQA 5C70A 5L36A 5A6YA 3TEZA 3KWVA 1CN1A 1GNYA 1SG3A 2BWCA 2DWRA 2HWD1 4R8HA 4CA9A 5C71A 1DBNA 3BTAA 5JXJA 1QJY1 5FZFA 3TEYA 1P8JA 3Q8CA 2WNUA 3ZFFA 1O4YA 3IAQA 2X5IA 5FPAA 1BMV2 1US2A 4XTPA 3PJYA 5CKMA 3OCPA 1J83A 3IIAA 2WNVC 4IEYA 3M3CA 5C8CC 1AR73 1SMVA 4P9LA 3GJAA 3N9PA 5GKAC 1NE4A 2V72A 4D69A 4XF9A 2JDNA 4GQ7A 3J8F3 1V9U2 5FUPA 1W3VA 2CNAA 5A33B 1GFF2 2VR4A 3V56A 3VUOA 4XJ8A
chains in the Genus database with same CATH topology
3OPTA 4HOOA 4CCMA 5FZIA 2XXZA 5FZAA 2OX0A 4QX8A 5IVBA 5FY8A 5IVEA 5FP3A 4XDPA 5F2SA 4V2WA 5F5IA 4IGQA 4CUGA 4EZHA 5FZ4A 5LW9A 4UF0A 5FJHA 3DXTA 4LITA 5FUNA 2OQ6A 5A7WA 3NJYA 5IVVA 3PURA 5FYTA 5IW0A 4GAZA 2YU1A 2Q8CA 3AVRA 3N9LA 4QX7A 3AL6A 5F3GA 5FZ8A 2XMLA 5FY0A 5FZLA 5IVJA 5KR7A 5FXVA 5A3PA 5FY1A 4AAPA 4Y4RA 4AI9A 4CCKA 5F5CA 4CCLA 3KV9A 5FZ3A 3OPWA 5FZ6A 5A7PA 4QWNA 3KV4A 5IWFA 4E4HA 2YBKA 4LXLA 3UYJA 4Y3OA 3LD8A 4QU1A 3RVHA 4EZ4A 3LDBA 4UF0B 5ANQA 5FP4A 2XDVA 4IGOA 5FP9A 5FZ1A 5FZBA 3K3OA 4BU2A 5A3NA 4C8DA 5LY1A 5A7WB 4GJYA 5FZMA 1VRBA 5FZOB 5F3CA 2YBPA 5FP8A 5F37A 5A1LA 5FZ9A 2OT7A 5E6HA 3N9QA 5FXWA 2WWJA 2P5BA 5F3EA 4LIVA 5FJKA 5FYCA 5FWEA 3PUSA 3K2OA 3PU3A 5FY9A 4V2VA 4ASKA 4DIQA 5FPUA 3PDQA 4HONA 4Y33A 2PXJA 5F2WA 5A1FA 4XDOA 5FP7A 5FPBA 5FYVA 5FZCA 2Q8EA 3DXUA 5F39A 2YPDA 3KVBA 5FZHA 5A7QA 4CCOA 4QXHA 2YBSA 5FYYA 5A3TA 2YU2A 3N9NA 2W2IA 5FXZA 5LWBA 3K3NA 2GP3A 3PTRB 4CCJA 2Q8DA 5FYUA 3U78A 5A7NA 3N9OA 5FYBA 2OS2A 4TN7A 3ZLIA 5CEHA 3KV5A 3PUAA 4D6QA 4DO0A 5F32A 3AVSA 5FV3A 4D6SA 2OQ7A 5FY4A 3ZPOA 3U4SA 5FY7A 2XUEA 4BISA 5FXXA 3N9MA 4D6RA 5FZKA 5IVYA 5FWJA 5FPVA 5FY5A 5FYZA 5FYHA 5FBJA 5IVFA 2VD7A 5F3IA 5FZFA 5FZ0A 4EYUA 5A3WA 4URAA 4LIUA 4CSWA 5LY2A 5FPAA 5FZOA 4GJZA 5FZGA 4NUBA 5FYIA 5A7OA 5ISLA 5A80A 4CCNA 5FZDA 5FYMA 5FZEA 5FPLA 2GP5A 3KV6A 3N9PA 4GD4A 4QXCA 5IVCA 2WWUA 4BXFA 5F5AA 5FZ7A 3AL5A 4QXBA 5K4LA 4IGPA 5FUPA 5FYSA 5A7SA 3PUQA 3PU8A 3KVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OPT A;  4HOO A;  4CCM A;  5FZI A;  2XXZ A;  5FZA A;  2OX0 A;  4QX8 A;  5IVB A;  5FY8 A;  5IVE A;  5FP3 A;  4XDP A;  5F2S A;  4V2W A;  5F5I A;  4IGQ A;  4CUG A;  4EZH A;  5FZ4 A;  5LW9 A;  4UF0 A;  5FJH A;  3DXT A;  4LIT A;  5FUN A;  2OQ6 A;  5A7W A;  3NJY A;  5IVV A;  3PUR A;  5FYT A;  5IW0 A;  4GAZ A;  2YU1 A;  2Q8C A;  3AVR A;  3N9L A;  4QX7 A;  3AL6 A;  5F3G A;  5FZ8 A;  2XML A;  5FY0 A;  5FZL A;  5IVJ A;  5KR7 A;  5FXV A;  5A3P A;  5FY1 A;  4AAP A;  4Y4R A;  4AI9 A;  4CCK A;  5F5C A;  4CCL A;  3KV9 A;  5FZ3 A;  3OPW A;  5FZ6 A;  5A7P A;  4QWN A;  3KV4 A;  5IWF A;  4E4H A;  2YBK A;  4LXL A;  3UYJ A;  4Y3O A;  3LD8 A;  4QU1 A;  3RVH A;  4EZ4 A;  3LDB A;  4UF0 B;  5ANQ A;  5FP4 A;  2XDV A;  4IGO A;  5FP9 A;  5FZ1 A;  5FZB A;  3K3O A;  4BU2 A;  5A3N A;  4C8D A;  5LY1 A;  5A7W B;  4GJY A;  5FZM A;  1VRB A;  5FZO B;  5F3C A;  2YBP A;  5FP8 A;  5F37 A;  5A1L A;  5FZ9 A;  2OT7 A;  5E6H A;  3N9Q A;  5FXW A;  2WWJ A;  2P5B A;  5F3E A;  4LIV A;  5FJK A;  5FYC A;  5FWE A;  3PUS A;  3K2O A;  3PU3 A;  5FY9 A;  4V2V A;  4ASK A;  4DIQ A;  5FPU A;  3PDQ A;  4HON A;  4Y33 A;  2PXJ A;  5F2W A;  5A1F A;  4XDO A;  5FP7 A;  5FPB A;  5FYV A;  5FZC A;  2Q8E A;  3DXU A;  5F39 A;  2YPD A;  3KVB A;  5FZH A;  5A7Q A;  4CCO A;  4QXH A;  2YBS A;  5FYY A;  5A3T A;  2YU2 A;  3N9N A;  2W2I A;  5FXZ A;  5LWB A;  3K3N A;  2GP3 A;  3PTR B;  4CCJ A;  2Q8D A;  5FYU A;  3U78 A;  5A7N A;  3N9O A;  5FYB A;  2OS2 A;  4TN7 A;  3ZLI A;  5CEH A;  3KV5 A;  3PUA A;  4D6Q A;  4DO0 A;  5F32 A;  3AVS A;  5FV3 A;  4D6S A;  2OQ7 A;  5FY4 A;  3ZPO A;  3U4S A;  5FY7 A;  2XUE A;  4BIS A;  5FXX A;  3N9M A;  4D6R A;  5FZK A;  5IVY A;  5FWJ A;  5FPV A;  5FY5 A;  5FYZ A;  5FYH A;  5FBJ A;  5IVF A;  2VD7 A;  5F3I A;  5FZF A;  5FZ0 A;  4EYU A;  5A3W A;  4URA A;  4LIU A;  4CSW A;  5LY2 A;  5FPA A;  5FZO A;  4GJZ A;  5FZG A;  4NUB A;  5FYI A;  5A7O A;  5ISL A;  5A80 A;  4CCN A;  5FZD A;  5FYM A;  5FZE A;  5FPL A;  2GP5 A;  3KV6 A;  3N9P A;  4GD4 A;  4QXC A;  5IVC A;  2WWU A;  4BXF A;  5F5A A;  5FZ7 A;  3AL5 A;  4QXB A;  5K4L A;  4IGP A;  5FUP A;  5FYS A;  5A7S A;  3PUQ A;  3PU8 A;  3KVA A; 
#chains in the Genus database with same CATH topology
 1R1Z A;  1E5R A;  2F6B A;  4Y24 A;  1CAW A;  4BHP A;  4P5Y A;  5JXH A;  4BOW A;  2R0F A;  3R4D B;  4MX3 A;  3IDA A;  3N7M A;  2W87 A;  4PT6 A;  4RQP B;  1UY2 A;  1GBG A;  5ABJ B;  2HWE 1;  5KHK A;  3TBD A;  3MIB A;  3VZN A;  5FUN A;  2QDN A;  2EXH A;  1ZBA 3;  2OQ6 A;  3SEE A;  1LHV A;  1POQ A;  1W9Y A;  3MLK A;  1H9P A;  3AVR A;  3KM5 A;  2VTX A;  2LW8 A;  4COW A;  1C1L A;  5DZF A;  2BWA A;  3O0V A;  1MEC 2;  3E1F 1;  3OBT A;  3WW1 A;  4EQV A;  1WW6 A;  3ENR A;  4CUA A;  1LR5 A;  2HBU A;  4AI9 A;  5T5L A;  3KF3 A;  2HWC 1;  4NAM A;  4H7M A;  5GM0 A;  1I3H A;  1UXX X;  2I45 A;  1X8M A;  4I3P A;  1GR3 A;  1E5S A;  1PNG A;  1AL0 G;  1AYN 3;  2YBK A;  1XNT A;  4OMC A;  3IKW A;  4Y3O A;  1N1Y A;  3LEM A;  4UW4 A;  4IEQ A;  4YGD A;  3NV3 A;  4EJR A;  4C0B A;  4GB3 1;  3U0Z A;  1UOF A;  1O6U A;  5FP4 A;  1RUE 3;  5FZ1 A;  4F7Z A;  1MR5 A;  4FQZ A;  4CEW C;  3EYP A;  5FZO B;  5GLZ A;  4AEJ A;  1RUF 1;  1K12 A;  2ZPX A;  5DG2 A;  2RS3 3;  2WFF 2;  2VCC A;  4IW3 A;  4AVC A;  1HRI 2;  5FYC A;  3MFA A;  3LPF A;  4XF4 A;  1J1L A;  2WII B;  4BQX A;  1XNA A;  3CZJ A;  3M2M A;  3PUS A;  3WNO A;  4IE0 A;  4UI9 L;  3WF3 A;  4BLJ A;  2WC2 A;  2VOX A;  1BHG A;  1DGR N;  5C9A C;  1XNB A;  5EV7 A;  2WSU A;  2Q4S A;  5FO9 B;  2EIC A;  2WNE A;  5AVP A;  3DEM A;  4MUV A;  4CDW A;  4LEJ A;  3IAP A;  3NNG A;  5ACA 2;  5A3T A;  1ND2 A;  3GZU C;  3PMS A;  3H9A A;  1FXZ A;  1QH7 A;  3UGH A;  4CDQ C;  1GAN A;  3DPR C;  2D44 A;  1UU5 A;  3NRU A;  5FYU A;  3HVD A;  3MBW A;  2R6Q A;  5C3P A;  2UY8 A;  3MI8 A;  5DDJ 1;  2DCZ A;  2O1Q A;  3AP6 A;  1RUG 1;  3I3E A;  3JBG 2;  3OJB A;  3WCS A;  3ZXL A;  1W6M A;  2O8O A;  3NAP A;  2WT1 A;  5IK5 A;  2XUE A;  2FDK A;  3UGG A;  3BIW E;  3HJR A;  1R08 2;  2AGS A;  2VNV A;  3N9M A;  4IE6 A;  4Y5T A;  4M00 A;  4I0A A;  2QQO A;  5HCF A;  1VAL A;  3SCF A;  2JDH A;  4XJA A;  3RI9 A;  5C5U A;  1QGL A;  2VCB A;  4NHM A;  4BQ3 A;  4LO5 B;  2OYZ A;  1PK6 C;  4NJ4 A;  3AFG A;  1ULO A;  1VRH 2;  4PI0 A;  1YYN A;  2IXJ A;  1TE1 B;  3VBS B;  2VW1 A;  4ZZ8 A;  2KR2 A;  4ONU A;  2CU5 A;  4W6Y A;  4OUM A;  4UOJ A;  1RUE 1;  1RL3 A;  3S6P A;  5K4L A;  2D7F A;  3MIE A;  4BB3 A;  4PLM A;  5FMO S;  4AGG A;  3VBU C;  1NXD 1;  1NA1 C;  3PUQ A;  4Q8K A;  3KVA A;  4CCM A;  1GWM A;  4O65 A;  2XXZ A;  3QH7 A;  3ZSE A;  2OPK A;  4IE7 A;  2RR1 3;  1AJO A;  5BY5 A;  3AMN A;  2JD4 A;  1Z7S 2;  2KM2 A;  2NLR A;  4FVV A;  2CGP A;  3K4Z A;  4PF1 A;  3WLU A;  2BUK A;  4XMI A;  3S0M A;  2W52 A;  1IZ3 A;  3OD0 A;  1UMI A;  4XCA A;  3LKJ A;  2QZ2 A;  4NHX A;  4JCK A;  3W58 A;  2YY1 A;  1VBC 1;  4FP3 A;  1CON A;  3HD8 B;  4IEV A;  1SZB A;  3N9L A;  3E5Q A;  2PHT A;  5IVJ A;  1CR7 A;  3T0B A;  1QKQ A;  1UU6 A;  2D6K A;  4YPJ A;  5FY1 A;  3USU A;  2WNU C;  3ZFF C;  4B4Q A;  3I49 A;  1ZRF A;  2X5I C;  1Q56 A;  1R09 1;  2BDR A;  4C1X A;  1MQT C;  2WA4 A;  4Q4V 2;  1VLN A;  4QWN A;  4LOT A;  2BOJ A;  2VMH A;  2W94 A;  2ZGT A;  4PQ9 A;  1NYW A;  2W47 A;  3ZFE A;  2XL9 A;  1RXG A;  1GNZ A;  3AYA A;  4AOC A;  2WQ4 A;  3I97 A;  4FBF A;  1RUH 3;  5DZE A;  2ZOE B;  1LCL A;  3KF5 A;  1D4V B;  1WLC A;  2CL2 A;  5DXD A;  4LJH A;  5CKN A;  4QT6 A;  1XQN A;  2W0X A;  3HNY M;  2VH9 A;  4EE2 A;  2V5D A;  1V6N A;  3IPV B;  1MZF A;  3ZYR A;  4WV8 A;  2FCT A;  2CGO A;  2QKD A;  2VBD A;  4BXS V;  3V0A B;  5FZ9 A;  1JHJ A;  4ARX A;  1HXS 1;  1QJF A;  4KGQ A;  4Y20 B;  1RVF 3;  5J96 B;  2P5B A;  3AJZ A;  1H1M A;  1D0H A;  4XTM A;  3PU3 A;  3AJY A;  3ROU A;  3SCG A;  4V2V A;  5L9B A;  1AR6 1;  1K5J A;  2VUL A;  1LGN A;  2RE9 A;  1DG6 A;  1UX6 A;  5JOX A;  1T6G C;  1EY2 A;  1O3R A;  2DUO A;  1OLM A;  2Z4F A;  5CFD B;  2YBS A;  4CEY B;  2RS5 1;  1JYI A;  3U11 A;  2Z79 A;  3RPQ A;  1FAT A;  1UU4 A;  2MEV 1;  4CCJ A;  1U5Z A;  4B1M A;  4Q1R A;  3LAG A;  2BZD A;  3AXE A;  1YXW A;  3M3I A;  2LAL A;  1JUI A;  1O4Z A;  1POV 0;  2DVF A;  3PHM A;  3EJK A;  1A6C A;  1NY7 2;  5GLT A;  1ULP A;  3UET A;  4RFR B;  1V9U 3;  4ISR A;  5CZK A;  3U4S A;  5E8A A;  5FY7 A;  2WR9 A;  2AC1 A;  4AL9 A;  5JMC A;  2B9V A;  3GAL A;  3DKQ A;  4NPL A;  1IPS A;  4YZ5 A;  4WZC A;  2WYF A;  3AMP A;  3KHB A;  2D5F A;  4RD7 A;  4CDX B;  1COV 2;  1W2T A;  5I93 A;  1PGL 1;  2B8M A;  5I0D A;  5J37 A;  3VKF C;  1DLC A;  2VZR A;  3B9I A;  2DF7 A;  1FOD 1;  2PFW A;  5B4X A;  1G8W A;  1W2A X;  5A80 A;  4M0N A;  1A3K A;  1GLH A;  4RS5 A;  1K45 A;  5FYM A;  2JEM A;  4P08 A;  3U1X A;  1JZ2 A;  1YJK A;  2J1E A;  2W1W A;  1MEC 3;  3AP9 A;  1AHS A;  3I3D A;  3OGR A;  3OBA A;  3R05 A;  4BXF A;  1SHW B;  4CDW C;  3H8R A;  5FKB A;  1WZX A;  1I6X A;  1ND2 C;  4YM2 A;  4HVQ A;  2VY0 A;  2DU0 A;  1SLA A;  4P9X A;  1RVF 1;  5A6Q A;  2D40 A;  3D5O A;  5LZ6 A;  4XFC A;  1OHF A;  2FMD A;  3O1R A;  3BKZ A;  2OPW A;  2ZS6 B;  4WM7 B;  1HV0 A;  3NAP C;  4LIT A;  1Y9G A;  1NZI A;  4H2A A;  5IK8 A;  1QJU 2;  4LE3 A;  2R04 2;  3NJY A;  4YYO A;  3WDV A;  1Q8Q A;  1OQ1 A;  2Y6G A;  2ZX4 A;  4D7T A;  3D4K A;  4OFG A;  3RJ2 X;  1C8M 1;  3I8T A;  1XE7 A;  1AX1 A;  1GZC A;  2QVS B;  4KWJ A;  4WVW A;  2H6B A;  2DUR A;  2WFF 3;  4IL7 A;  1JU3 A;  1O3Q A;  1HRI 3;  4OUL A;  2LM3 A;  3VD5 A;  4A42 A;  3ST7 A;  1LGB A;  3EB7 A;  4QB1 A;  1W6P B;  2KD7 A;  3WDW A;  1I9R A;  4A3Z A;  4ZU7 A;  1JOD A;  1ZRD A;  5F8P A;  3KV4 A;  1TG7 A;  3W9A A;  3UYJ A;  1GIC A;  1LOF A;  3F2Z A;  4W6W A;  5L9V A;  3P3P A;  1POV 3;  2ARA A;  1Q5O A;  1GP6 A;  4Q4X 1;  5ACA 3;  2WQZ C;  4AVA A;  5KXC A;  1Q43 A;  1IHM A;  2XVL A;  4GMP 1;  3UKT A;  1TNR A;  2VCA A;  4A7Z A;  4C8D A;  1SEF A;  5KXD A;  3JUU A;  5JVV A;  1ZYB A;  4C91 A;  5F3C A;  5LA0 A;  2BNN A;  3NV4 A;  3JBG 3;  4AQT A;  4G3Y C;  1NT0 A;  2AR6 A;  3VKN A;  4BE3 A;  5LB6 A;  3WD5 A;  5LK7 B;  1R08 3;  3THC A;  1N3P A;  4PQQ A;  1QNW A;  3MID A;  4AVT A;  3LQC A;  1YIF A;  4DUV A;  4CP2 A;  4CEW B;  4CZS A;  3SNM A;  1S0C A;  3JB8 A;  4XDO A;  2JWP A;  1PO1 2;  4JQT A;  1GP5 A;  2RMU 2;  2JDZ A;  3GNE A;  3JXS A;  4LNV A;  2AAC A;  2G19 A;  4QXH A;  2YFU A;  1VRH 3;  4Q4Y 2;  4XXP A;  2GC0 A;  4CUB A;  5FO8 B;  1YFU A;  5SV5 A;  3VBS A;  4FOV A;  3TN9 1;  3ZN5 A;  4CP9 B;  1UOB A;  3ZFE C;  4LO8 A;  2K9Z A;  4KQ7 A;  1CPN A;  1BEV 1;  2XUM A;  5C9A B;  3W21 A;  4YW4 A;  2DDU A;  3D3A A;  3IZO A;  3Q8B A;  5DUW A;  1MAC A;  4LO7 A;  4XHB A;  2ZAB A;  2A75 A;  4RFT 0;  3HBZ A;  4XVH A;  3O1T A;  4MG2 A;  2P6C A;  1HQW A;  1Z7S 3;  5FBJ A;  3BI3 A;  2R30 A;  3DF0 A;  4K7J A;  1QF3 A;  4MGK E;  4EYU A;  1EAH 2;  1R1A 1;  2VZP A;  3CIH A;  2IFW A;  4QKF A;  1YCI A;  4ATF A;  4UFL A;  3JB4 C;  4FXK B;  3W5M A;  4R9C A;  5FYI A;  4BPZ A;  4BZ4 A;  2D93 A;  3HIF A;  1F4A A;  3VL8 A;  1LES A;  2G9Z A;  1LU1 A;  4QGL A;  4XDQ A;  3X29 B;  4S2D A;  4LPL A;  3NKT A;  1PM7 A;  4K6B A;  1BK1 A;  1JBC A;  2W3J A;  5J98 B;  1D2Q A;  2UWC A;  5LK5 A;  3BAL A;  2ZGQ A;  4M3C E;  1SFY A;  2ZKN A;  3I3M A;  4B7E A;  1PK6 B;  2LRP A;  4QPI B;  5EJ3 A;  5FFO C;  4D94 A;  1IPK A;  1IQD C;  1SLL A;  2A6W A;  3POJ A;  4Y5Z 0;  2BW8 A;  1DGW X;  5F6K A;  3O1P A;  3DYO A;  1VPH A;  4YG0 A;  4AXO A;  1PZ7 A;  4AWD A;  3RI8 A;  1D0G A;  4LUL A;  1SPP A;  3WUC A;  3IPV A;  1ZBE 1;  4YM1 A;  2P6H A;  5IW0 A;  3HN1 A;  4XYX A;  3V0A A;  2XQR A;  3VBU B;  1NA1 B;  5AVA A;  2PN5 A;  4Y20 A;  2PHU A;  3MLL A;  4F8A A;  1G86 A;  2UWA A;  2XOM A;  4CE8 A;  5CG9 A;  3URF A;  2BPA 2;  4AYU A;  1YI9 A;  1RUI 2;  2QQN A;  4GUL A;  3NNL A;  1W39 A;  5EJ1 B;  3WHU A;  1XE0 A;  1K3I A;  1KDM A;  3AYE A;  4DIN B;  2GN7 A;  1GQG A;  4NII A;  5F7U A;  4RS5 C;  2ADD A;  1DP0 A;  4J1X A;  1OBN A;  4AED B;  4CU7 A;  4QX3 A;  5C3O A;  2QQU A;  2YB7 A;  1WD4 A;  2E51 A;  4JRL A;  2X05 A;  5CFD A;  3LOI A;  4FOQ A;  4CEY A;  4HVR A;  1WCU A;  2A3X A;  2GC1 A;  3I7D A;  2QQV A;  1JZ5 A;  1OUR A;  4B8E A;  4XJW A;  1YIP A;  3P3N A;  1NUK A;  1J59 A;  4IGO A;  5A3N A;  2W91 A;  3POS A;  2WNU B;  3R6S A;  3ZFF B;  2R0H A;  2J1R A;  1OMI A;  1S55 A;  1MQT B;  3M3E A;  2FDI A;  5FRE A;  4AEM A;  5FLJ A;  2OW4 A;  4DXT A;  4Q4W 1;  1HJG A;  5F3E A;  3THD A;  1AYM 2;  4CCC A;  1OD3 A;  1MS4 A;  1HN0 A;  5K9Y A;  1OOP B;  2VZU A;  3JZV A;  4Y33 A;  4JQR A;  2PLV 1;  3HNM A;  4CDX A;  1DQ0 A;  4XQD A;  2VVF A;  4GZ9 A;  1COV 3;  5LAS A;  3OUH A;  5FPB A;  4XHX A;  1CAW B;  2B46 X;  1JXN A;  2GND A;  2XJR A;  1GSL A;  5LCW L;  2YPD A;  2GSY A;  2AEY A;  2GAU A;  2K2S A;  3NNJ A;  4I09 A;  4LHS A;  2VAU A;  4TLG A;  3AKQ A;  3WUD A;  2PQS A;  2SBA A;  1O4T A;  2HH9 A;  4L92 A;  4FPY A;  2VVE A;  2VTF A;  4W8J A;  3U78 A;  1RMU 1;  3ZN6 B;  3MW2 A;  4I02 A;  4DRR A;  1UQX A;  4AHY A;  3VZJ A;  3SKV A;  3CJX A;  2GNT A;  5ANN A;  1QJX 2;  2E7A A;  4ZXK A;  5I8T A;  2VOT A;  2J22 A;  5FXX A;  4BYY A;  2DTY A;  3GZA A;  3GZE A;  3PIG A;  3H50 A;  3ALQ A;  1HRV 1;  4COV A;  2BVV A;  4WM7 A;  3PUI A;  2W68 A;  4Z1V A;  5HCB A;  3HNB M;  1ULG A;  2WZ8 A;  3E5X A;  1L7R A;  1SLC A;  1YFY A;  4XMA A;  1WMX A;  2DCJ A;  1QJU 3;  1WW5 A;  2R04 3;  2ZHK A;  4GJZ A;  2VTX J;  4XZU G;  5C33 A;  2JXA A;  5JPM B;  5FO7 B;  2QE3 A;  1UO9 A;  4JGZ A;  4E8D A;  5C8W A;  3GJB A;  4NRP A;  3ZPY A;  4GKY A;  4QX0 A;  4NVP A;  2VZ1 A;  4AI3 A;  1DGW A;  1W6P A;  3N4M A;  2VUC A;  4IND A;  3BTZ A;  3VBS C;  5HI0 A;  4QKD A;  1CAX B;  2H0B A;  4H3W A;  2UYB A;  2HWF 2;  3C7O A;  5FY8 A;  5T50 A;  1W8Z A;  2XVK A;  3UKN A;  1JOJ A;  2J1V A;  4IGQ A;  4DOU A;  1M4W A;  5D21 A;  4QHZ A;  5FJH A;  1NE6 A;  2P3I A;  3JD7 2;  3VDD A;  1G9C A;  5CA6 A;  4MLO A;  3S5Q A;  1DGR A;  3PNA A;  4AI2 A;  5LA2 A;  2R49 A;  1O7F A;  2VW2 A;  2YDE A;  5FYT A;  4YM3 A;  1ND2 B;  4XFH A;  2RJ2 A;  1VB2 A;  2YUE A;  3OUI A;  1JOB A;  2YC4 A;  4H7L A;  3SKJ E;  4DZG A;  1FMD 1;  1AXK A;  1QY4 A;  1H2K A;  5A3P A;  2P3K A;  1X82 A;  4RGK A;  4Y4R A;  5APA A;  3WDX A;  3FUQ A;  3DUI A;  1XU1 A;  3NMB A;  1W6M B;  2ZX1 A;  2KXL A;  4LBL A;  4OI0 A;  4PLN A;  1GZ9 A;  2Y26 A;  1PO1 3;  5CFC A;  3QH6 A;  2I2S A;  2RMU 3;  4A7K A;  1OFS A;  1UYP A;  1U5X A;  3MFC A;  4JX0 A;  1LOB A;  1LKN A;  4Y4Y A;  1H8T A;  2YZ4 A;  4Q4Y 3;  5IAT A;  1GWL A;  4DXS A;  2PEL A;  3VZM A;  2QQM A;  1B35 B;  3H3Z A;  1VAV A;  1WW7 A;  5LY1 A;  1F4H A;  4FFH A;  4GJY A;  1AX0 A;  5KHH A;  1HB4 A;  4PDW A;  3AM2 A;  2JG8 A;  3I2G A;  1W9F A;  4XAE A;  5F37 A;  2JDA A;  5BV6 A;  5JOZ A;  3RMX A;  2W92 A;  3UKV A;  1NAE A;  1VBA 1;  1PO2 2;  5FWE A;  1N3Q A;  2EA7 A;  3HEI A;  4ZU4 A;  1EV1 1;  4Z8B A;  4IV3 A;  3AYC A;  4E4D X;  4OMD A;  2JEC A;  4HZF A;  3BPZ A;  1HB1 A;  5EFU A;  1CJP A;  3T0A A;  1UKR A;  1I5Z A;  3ZYH A;  1HQL A;  3BIE A;  5FP7 A;  1EAH 3;  5FUI A;  4NO4 A;  4LOR A;  1FNY A;  1X7N A;  4LUK A;  3HQX A;  3KCC A;  2WAA A;  3LFI A;  4LO6 B;  1UWW A;  5FYY A;  3AZZ A;  4J25 A;  4SLI A;  3J7H A;  2VQU A;  4LLO A;  2CSG A;  1SBE A;  3LDK A;  2CTV A;  3LOB A;  4QHB A;  4XUN A;  5J48 A;  2DVB A;  4Y22 B;  3VLB B;  2YMZ A;  3A0K A;  2ENR A;  2RS1 2;  4I01 A;  3NVC A;  4CEY C;  3LGR A;  3TEX A;  4ET7 A;  1WA6 X;  4N7U A;  3ZSJ A;  4D8M A;  1OF4 A;  5GLU A;  3H1Y A;  1XE8 A;  2DUP A;  4QPI A;  4LHL A;  1UZW A;  5BXX A;  3USU B;  2VMF A;  1H1I A;  1LEM A;  3WT3 A;  1OLR A;  3TRS B;  3FMG A;  3WG1 A;  2P4E A;  3T3Y A;  4OHZ A;  1L7Q A;  5FYH A;  5IUQ A;  3ZN4 A;  5AC9 1;  1QHD A;  5T5J A;  1Q8V A;  1UF2 C;  1ENX A;  2G1M A;  2VNG A;  2ZGS A;  1J3R A;  2ZJC A;  3I2K A;  2JDU A;  3HT1 A;  4OQ8 A;  4LA3 A;  3VBF B;  1NA1 A;  3EQE A;  2A1X A;  4ZKT B;  2PHD A;  1S0F A;  3POW A;  1XYO A;  5J3U A;  2ZHM A;  2VMI A;  2GP5 A;  3KV6 A;  4K3U A;  4DMI A;  1PIV 2;  3WW3 A;  5FZ7 A;  3ZX7 A;  2VJX A;  1RUI 3;  2Y8K A;  4IGP A;  1OFN A;  1KIT A;  3T08 A;  4HPK A;  4XC9 A;  4BIF A;  1G6N A;  1FV2 A;  1RC6 A;  2LS6 A;  4AED A;  1I1E A;  1MS8 A;  1TME 1;  1A8M A;  1DYK A;  3T2O A;  2W1Q A;  2CAU A;  4XF1 A;  4LKD A;  3E6C C;  4B7K A;  1TQ5 A;  3QOP A;  2RM2 2;  5JI7 A;  2R06 2;  4EZH A;  3LE0 A;  5FPX A;  4AI8 A;  2A3Y A;  3ZO0 B;  2QZ3 A;  2FHR A;  1RJ8 A;  4Q26 A;  4GWM A;  4QQ2 A;  3O7O A;  5ERL A;  4AE2 A;  2WS9 1;  3MV0 1;  1JZ8 A;  5JIU A;  2QUO A;  1MQT A;  3SCH A;  1HDK A;  1KD7 A;  2EAL A;  1UAI A;  3M1H A;  5H9P A;  4BH9 A;  2J1S A;  1LED A;  1ZZ8 A;  2P17 A;  2PAK A;  4WM7 C;  1RUD 2;  5FZL A;  3PJQ A;  2VZT A;  1QQP 1;  3VKL A;  4OCT A;  1AYM 3;  1SLT A;  2BJS A;  1WCK A;  4UYB A;  2Q8O A;  3WNK A;  1UIK A;  4NHL A;  3AZV A;  1RUJ 2;  1OOP A;  4CCL A;  1F15 A;  3O0X A;  3R4S A;  4KWU A;  4P14 A;  3WP3 A;  4JGZ C;  3NJV A;  4P9W A;  4QGM A;  2B9U A;  4P02 B;  5BUV A;  1KS4 A;  2VVD A;  3KMH A;  2VXJ A;  2VPV A;  4LBO A;  1BBT 1;  1CAV A;  4UF0 B;  1D4M 1;  4XIK A;  3MIC A;  5LA9 A;  1AR8 2;  3ZN6 A;  1M06 G;  5CU1 A;  3TAY A;  4YWA A;  4RL7 A;  2BTV C;  2NMN A;  1B09 A;  2HEV F;  4ES9 A;  4CUC A;  1JYT A;  4YVS A;  1S2K A;  2NN8 A;  4P9J A;  4RS5 B;  3J7M A;  5IK7 A;  4TWT A;  2ZGM A;  3RZG A;  5FKC A;  4NID A;  1QJX 3;  1UCX A;  2VQ0 A;  4AF9 A;  4O61 A;  3J7N A;  1WA4 A;  2HWB 1;  5CVR A;  3POF A;  3VDD C;  4XBQ A;  1UXZ A;  4FOW A;  2Y38 A;  1A8D A;  5FPU A;  4AHZ A;  4AFA A;  3BCW A;  4Q27 A;  5HPO A;  4JDM A;  1S0G A;  1HV1 A;  3CMG A;  5GZC A;  3ACL A;  4UW5 A;  1OF3 A;  4ISQ A;  5CAD A;  5FMD A;  3AZW A;  4K8F A;  3OYW B;  4LOS A;  1BVV A;  3LCP A;  2ATF A;  3PL0 A;  1W3X A;  2ID4 A;  1OA3 A;  2Q1M A;  5C3S A;  3E5U A;  2C6S A;  2ZTN A;  5CFC C;  2ORZ A;  3AC0 A;  4CCD A;  5JI9 A;  4DRV A;  1H8T C;  3O1M A;  4Z2A A;  2ZML A;  4JKL A;  1CAX A;  4CRQ A;  4FTS A;  1ULC A;  2AYH A;  5DAV A;  3I2H A;  1ASJ 2;  3T1L A;  2X53 S;  1AR7 1;  4DUW A;  5IVY A;  2EVX A;  4PDW C;  2GC2 A;  2JG8 C;  2X09 A;  4HAN A;  5DPN A;  5FY5 A;  2A73 B;  3J8F 1;  4M01 A;  3KCX A;  4N43 B;  1O5L A;  1Q3E A;  3NW4 A;  3RFR A;  2VZS A;  5GZG A;  3JD7 3;  2JD9 A;  3DV8 A;  3UES A;  4CU8 A;  4LLF A;  2XKP A;  4Q0P A;  5A7O A;  4N9I A;  1SBD A;  1SFP A;  3LSD A;  4IV3 C;  5KC6 A;  1F2N A;  3PVO A;  4LMF A;  3SHR A;  1DYP A;  2J1A A;  2QTW B;  4IDZ A;  4NR1 A;  2VNO A;  2RJK A;  2C1F A;  1Z0H A;  2QDR A;  2WT0 A;  4FPJ A;  1ZBA 1;  3CO2 A;  1WCD J;  1IG0 A;  4GXL A;  3MF6 A;  3BTY A;  5A7S A;  4HET A;  2K46 A;  4OLL A;  4G4F A;  1ONA A;  2G9F A;  1AR9 2;  1YQ6 A;  3AKS A;  1MZE A;  4C90 A;  5IVB A;  5JSO A;  3VD4 A;  1C8N A;  1W2O A;  4OYU A;  2BRT A;  5T5P A;  1PZ9 A;  2GDF A;  1WUV A;  5B2G B;  1OPO A;  2OVU A;  1B35 A;  2EIB A;  3ES1 A;  4QXK A;  4MXW B;  1Q8O A;  2Y0I A;  2B5H A;  4QPI C;  1AXY A;  2W9X A;  1W6O B;  5GLW A;  1AYN 1;  4JC1 A;  5BNO B;  4BCU A;  3JQW A;  5LBE A;  1YI7 A;  4Q0U A;  3ATG A;  5JIA A;  1C28 A;  3AL6 A;  2XML A;  3BVC A;  4L0P A;  3VHN A;  4QPG B;  1MZ5 A;  1PO2 3;  3ILN A;  2XLA A;  3MPB A;  3OGJ A;  4AAP A;  4CXY A;  1RHI 3;  2ZGL A;  3GBW A;  5A32 A;  1K5M A;  2EIG A;  2Y6L A;  3OGS A;  4YFW A;  1W03 A;  1LNS A;  5I0T A;  3H3U A;  1S0J A;  4LR4 A;  3I59 A;  1JN2 P;  5F6L B;  2RS3 1;  1YEW A;  4XFI A;  2YPJ A;  4OHY A;  4JVA A;  4JDO A;  1WMD A;  4OUE A;  2FCV A;  1LOD A;  3FZ3 A;  1KEX A;  3LDB A;  4FPL A;  4Y1X A;  4YZ4 A;  2F17 A;  3FJS A;  5FP9 A;  5FZB A;  4AED C;  2J7M A;  2VUA A;  3K3O A;  3MGU A;  4WVV A;  5I0S A;  3T4V A;  1GYK A;  4Y22 A;  3C2U A;  3NV2 A;  1A34 A;  2JB8 A;  1NZC A;  4LK6 A;  3JQX A;  2RS1 3;  4RA0 A;  1MZ6 A;  2OT7 A;  3LPG A;  3ZMN A;  1UZZ A;  3IT8 A;  4OHV A;  4EWD A;  1ZRE A;  1TMF 2;  4AVB A;  5FJK A;  1AXZ A;  1S4C A;  2IXI A;  3EXU A;  2F4P A;  4X6R B;  1HX6 A;  2IXK A;  4A44 A;  2WZR 2;  4FTB A;  5FY9 A;  5JWP A;  2A6Y A;  3E6D A;  4B4R A;  3L2Y A;  2BBA A;  3AZX A;  3ZOI A;  1QXP A;  3EHK A;  2FD8 A;  1DLL A;  1W90 A;  4OVE A;  3KVB A;  1GQP A;  3VB9 A;  3G7D A;  3VBF A;  4KMQ A;  2H0V A;  1OOP C;  4LTA A;  5LBC A;  2WZP P;  2QFE A;  5EQU A;  1QU0 A;  1VBE 3;  1OVP A;  1H4H A;  2ZAH A;  1TNF A;  2FDH A;  1JMU B;  3H7Y A;  3MUY 1;  1W2U A;  4JHZ A;  1DQ4 A;  1SPP B;  3ZYP A;  4AQ2 A;  5JR2 A;  4TN7 A;  2C26 A;  3KV5 A;  1PIV 3;  5FCC A;  4E2Q A;  3HBK A;  4AHW A;  2XBO 2;  3AKR A;  3J7L A;  4IET A;  2A6V A;  2NP0 A;  2DYC A;  3CHX A;  2OQ7 A;  3FE5 A;  4NAO A;  3D82 A;  3WV6 A;  1OPM A;  4MAD A;  1NLQ A;  1Y3T A;  2ARX A;  3NNF A;  4RSU A;  1KJR A;  4AQ6 A;  1SDW A;  3OUJ A;  5EIY B;  3B01 A;  1ZRR A;  3C7F A;  3O5S A;  5FWJ A;  2BQP A;  1X33 A;  2RM2 3;  2LRO A;  2JEN A;  2R06 3;  3I2F A;  3I3Q A;  3OEA A;  4FOY A;  4GWI A;  3POB A;  4Q0V A;  1VR3 A;  1NKG A;  1RHI 1;  1XC6 A;  3AYD A;  1VJ2 A;  4KWK A;  1FAY A;  5JOY A;  2XH6 A;  3OGG A;  3WW2 A;  4N7I A;  4E9K A;  3K4A A;  2RR1 1;  4CCN A;  1W6N A;  4PLO A;  1UZV A;  1RUD 3;  4EWA A;  5A6Z A;  1W8H A;  4GD4 A;  4MGY E;  3SEP A;  4QXB A;  5LBF A;  3O1V A;  3T0D A;  2Y6H A;  2WO7 A;  2RS1 1;  3M3Q A;  3OPT A;  4K40 A;  4KL1 A;  3RWN A;  2C9A A;  3IWZ A;  4XEZ A;  3B3Q E;  4ES8 A;  5DUV A;  3RYR A;  4C0H A;  3APB A;  5A1A A;  5F2S A;  5KXE A;  3NQH A;  2GC3 A;  2VL4 A;  4UF0 A;  2J1U A;  4XIO A;  4OQ9 A;  5EJZ B;  1LU2 A;  2P3Y A;  1AR8 3;  3N7J A;  3KSC A;  3DKW A;  3MW4 A;  4PIX A;  2C5D A;  4CPB D;  2EXI A;  4M0H A;  4Y5S A;  1RUH 1;  3RG0 A;  3OSD A;  5AFE A;  2ZEW A;  1V6L A;  1MS0 A;  1VBE 1;  2ZGU A;  3N3H A;  3EMR A;  1XNK A;  2IXH A;  3KV9 A;  2WDB A;  2RG4 A;  3VDC A;  1NQJ A;  4NWV A;  2BV4 A;  2AZ5 A;  4QU1 A;  3H8U A;  4HBN A;  4XBN A;  5JSR A;  5C3R A;  3O12 A;  4R9A A;  2D3P A;  4EZ4 A;  4HFS A;  5FIX A;  3OYW A;  2CV6 A;  4QMA A;  4NRO A;  3R4U A;  2BOI A;  2PAM A;  4YW7 A;  1YRZ A;  4R9B A;  2A6Z A;  4XUP A;  2D6M A;  3NNM A;  1C4R A;  5M0T A;  3ZYF A;  5JDB A;  1N47 A;  2XON A;  1BMV 1;  5FOB B;  4JGZ B;  1VIW B;  1UY0 A;  2ADE A;  4XCB A;  1B35 C;  2GMP A;  2ZMN A;  1UOG A;  3ES4 A;  4YGB A;  5IJR A;  1ASJ 3;  5I8Y A;  2K0G A;  1YWK A;  4M3C A;  3VD9 A;  4ASK A;  4RHV 2;  4B4P A;  4O9G A;  2V5Y A;  1VBD 2;  1A78 A;  1JZ7 A;  5D1I A;  1DYO A;  4N43 A;  4ZS2 A;  1IPJ A;  4EN8 B;  2Y60 A;  4XUR A;  3RJR A;  1V9U 1;  5FZC A;  1IQA A;  4MGI E;  4I0B A;  5D8A C;  1LOE A;  1PGW 2;  4K1Y A;  3WG4 A;  4Q0Q A;  3ZKU A;  5FXZ A;  1K5M C;  3K3N A;  1FPN 2;  1XOY A;  2A3W A;  3T09 A;  4BA6 A;  1CIW A;  3PTR B;  3T2Q A;  2V4A A;  3VDD B;  4LHN A;  1XB9 A;  3HQR A;  1EUU A;  4LO4 B;  5JCT A;  1YFX A;  1AZD A;  4JRA A;  3MEP A;  1FX5 A;  3A4U A;  4LBN A;  4YGE A;  5EHD A;  4AFM A;  4D6S A;  2L9L A;  2YC0 A;  2CYF A;  3KT7 A;  3N35 A;  2NMO A;  1WCQ A;  2FBE A;  3GHM A;  3UK9 A;  1AR9 3;  3AKP A;  5E88 A;  1WBF A;  3U10 A;  2MNG A;  3FLT A;  1MEC 1;  4LBM A;  1OA4 A;  2UY9 A;  3O1U A;  1YUD A;  2DTW A;  3E6B A;  3LF7 A;  5F3I A;  1FT9 A;  1MVE A;  2IFR A;  3LEG A;  4MXW A;  5FZ0 A;  4AK3 A;  5A3W A;  5CFC B;  1RXF A;  4LIU A;  1AL2 2;  1W6O A;  2RDR A;  5BNO A;  4QPW A;  1H8T B;  2Q1F A;  4BME A;  4B1L A;  4LT5 A;  3C8X A;  1GOH A;  2VG9 A;  5FOJ B;  4QPG A;  2QCS B;  3P5B A;  2C9K A;  4QKB A;  3ACI A;  4PDW B;  1BCX A;  4X8N A;  1LOG A;  2JG8 B;  4N8M A;  5GJ6 A;  4A4A A;  3SC7 X;  3VBF C;  1FYU A;  3GF6 A;  4YW6 A;  4MHR A;  4QDS A;  3USS A;  5F5Q A;  3IM0 A;  2WFF 1;  3WXP A;  1Y7B A;  3K51 A;  3AK0 A;  1HRI 1;  4HSJ A;  1VB4 A;  3CJI B;  4IV3 B;  2WFP A;  4V2W A;  1STM A;  2RDN A;  2R16 A;  2ZHL A;  2ILM A;  3WSO A;  4FPC A;  4NHK A;  2BGO A;  1GZW B;  4V1P A;  3DXT A;  2O0O A;  1US3 A;  1YFW A;  2A70 A;  4MOA A;  4RYD A;  1S0D A;  5EXO A;  3FHA A;  5IAX A;  3B93 A;  2RVA A;  1BXH A;  3D6E A;  4GAZ A;  2YGM A;  2B45 X;  2Q8C A;  1POV 1;  2R07 2;  1ZZ7 A;  4JAA A;  4IEP A;  1W8W A;  4QX7 A;  5ACA 1;  4LBQ D;  1PVC 2;  3POG A;  4YVS C;  5F3G A;  1TMF 3;  1WLD A;  4YNI A;  1JW6 A;  2D6O X;  1L3J A;  2HWD 2;  5JXI A;  1FV3 A;  1NCQ B;  2QQK A;  3U4X A;  2WZR 3;  3AB0 A;  2WBK A;  1QJY 2;  3B02 A;  1NOV A;  1J58 A;  5DZG A;  4Q4V 3;  1CES A;  4IEX A;  4K21 A;  1EPW A;  2FMY A;  3WIN E;  4UW3 A;  2VBB A;  3JBG 1;  5IWF A;  4XE9 A;  1W05 A;  4LXL A;  3NL1 A;  4JV4 A;  5LRR A;  3ZXE A;  1GV9 A;  4LE4 A;  5HCA A;  1R08 1;  3VKM A;  5DQ0 A;  1QOS A;  3FBY A;  4NHY A;  3WG2 A;  4NOT A;  3BU0 A;  2ZX3 A;  1D2S A;  1MVQ A;  1W8T A;  1ZZ6 A;  3CLP A;  4XZP A;  5I91 A;  1REF A;  3O1O A;  1QXJ A;  4XAB A;  3C7H A;  1UW8 A;  2XBO 3;  4GH4 B;  2JDY A;  5E6H A;  1DIW A;  4COU A;  1VRH 1;  4MVT A;  1YQ2 A;  1XJA A;  1NQD A;  1ZRI A;  3TNQ A;  2HWE 2;  1BZW A;  4ZPI A;  4COY A;  4HPK B;  4JZR A;  1CZT A;  4PF5 A;  4S2H A;  3LDR A;  4NMI A;  5HCH A;  5TSW A;  2ZXQ A;  1LJ7 A;  1MS3 A;  3ZDS A;  1VBB 2;  3QBQ A;  4F83 A;  2KA3 A;  4L11 A;  2YC2 A;  5G04 L;  3WP5 A;  2OZ6 A;  3I3B A;  4FPH A;  1OH3 A;  3M7A A;  5LBB A;  4CXW A;  3LB9 A;  2GP3 A;  4KG8 A;  1Z7S 1;  3KQR A;  5CYY A;  2HWC 2;  2JIC A;  3ZLI A;  2OS2 A;  5E1R A;  1ACC A;  1RED A;  4Q1P A;  4XFG A;  2D97 A;  2VM9 A;  4KNC A;  3ABZ A;  5BNP A;  2P34 A;  2D5H A;  1W8N A;  2ZGR A;  4GB3 2;  2V4V A;  5BNN C;  1IGO A;  3MUZ 1;  2ZX0 A;  1UYY A;  2Z5W A;  3CDZ B;  5K0U B;  1SLI A;  1RUF 2;  2AEZ A;  4Q4V 1;  1ALY A;  5GAL A;  5JAX A;  2OA2 A;  2PHX A;  3LA2 A;  4CSW A;  3J4U H;  1IS3 A;  1XSQ A;  3C3V A;  1CZV A;  2AEN A;  1JS9 A;  4CXX A;  2XGX A;  4RGA A;  4NE9 A;  5FZD A;  1CAV B;  1UPI A;  2GN3 A;  4XAC A;  2JIG A;  4N43 C;  3D8C A;  1V70 A;  5JSP A;  4IQP A;  3I2D A;  2IC1 A;  3I4I A;  3ZXK A;  5IVC A;  3U37 A;  4YVS B;  1H6Y A;  2XVG A;  5I8S A;  4FXG B;  1IS4 A;  2WKK A;  5FYS A;  3CEW A;  3PU8 A;  4K8R B;  4MXV A;  1UPS A;  1H2N A;  5FDB A;  4TYS A;  5KXB A;  4UW6 A;  3TOJ A;  1QEX A;  1RJ7 A;  3TWI A;  4YZ2 A;  5FK7 A;  5LW9 A;  4BQY A;  2GNB A;  2CAV A;  3VBO A;  1X50 A;  2G9G A;  5DDJ 2;  1SQ4 A;  1QMJ A;  2VZV A;  3RMY A;  1RUG 2;  1Z78 A;  3H7J A;  4FSJ A;  4XET A;  3S5A A;  1YQ8 A;  3KT4 A;  3N36 A;  3N7K A;  2VMD A;  5F9T A;  1W0N A;  4KBZ A;  5K7P A;  3KGZ A;  2XJV A;  3L2H A;  2VBP A;  4EN6 B;  1QDO A;  2JDM A;  1GUI A;  1BLZ A;  3G6J B;  5BNO C;  4RHV 3;  3VBR A;  1C5H A;  3O1S A;  3WNX A;  1VBD 3;  5T3N A;  1NY7 1;  5FR3 A;  1H8V A;  1WKY A;  1BYH A;  3OB8 A;  4QPG C;  1SBF A;  5AFB A;  4DQA A;  1HIX A;  3RVH A;  3M8L A;  4GIQ A;  2XJQ A;  4GKX A;  2ZGN A;  1FPN 3;  1RUE 2;  3AMH A;  3TB0 A;  3W20 A;  3ZYJ B;  3RS6 A;  5JMO A;  2WIN B;  1EUT A;  1W0O A;  1COV 1;  3IDC B;  2RHP A;  3MO4 A;  3GGL A;  3NKG A;  4HL0 A;  3RZK A;  2YBP A;  2BEO A;  3MIF A;  3S57 A;  5JPN B;  2C4X A;  3N9Q A;  3POE A;  3CQO A;  5A3U A;  2XB6 C;  4PI2 A;  5CNA A;  3CBN A;  4ZY9 A;  2OII A;  4P00 B;  5D2A A;  4UT5 A;  5EYX A;  2Q0A A;  4X8P A;  3FLR A;  1QOT A;  1WMF A;  2VME A;  4K9S A;  4RR3 A;  5KC5 A;  2LUW A;  1BQP A;  5LEK A;  4L99 A;  5L7O A;  1VBC 2;  3J26 N;  1YNA A;  5A7Q A;  1ULE A;  1AL2 3;  3ETP A;  2A71 A;  4DXR A;  1ZA7 A;  1RIT A;  4OI2 A;  4Z2W A;  5JLV A;  5J1X A;  1JYX A;  4E2S A;  1UN1 A;  1HLC A;  3OPZ A;  4AFC A;  2CGN A;  2E7T A;  1R09 2;  2Z42 A;  5A7N A;  2ZBJ A;  3DCQ A;  4JGY A;  3MLJ A;  1LHU A;  4XJ9 A;  2Q1Z B;  1QJU 1;  2R04 1;  1DQ5 A;  4LQR A;  5EZW A;  3HWJ A;  1H9W A;  5D8A B;  3B5L B;  4K20 A;  3CF6 E;  4J6G A;  1JZ4 A;  4M4P A;  3CJI A;  5E89 A;  5A32 B;  1K5M B;  5T5O A;  4L9B A;  4MYE A;  5DUX A;  4XFB A;  2GH8 A;  2JX9 A;  1YO8 A;  3WNP A;  1GZW A;  4LKS A;  3I59 B;  2ORX A;  1KFX L;  4KBB A;  5LY2 A;  3J9S A;  1HXS 2;  3BUC A;  4D7Y A;  1F9K A;  1U12 A;  4QX5 A;  2R07 3;  3WOG A;  3AFK A;  1RIR A;  2R1B A;  1AR6 2;  1NCQ A;  4XQ4 A;  2HWD 3;  3ITQ A;  1RIN A;  5HV0 A;  4FFI A;  4BQ1 A;  3K48 A;  3BB6 A;  2YYO A;  1S2B A;  1MS1 A;  4O7X A;  1AJK A;  4H14 A;  4C1W A;  5JR7 B;  1PZ8 A;  2Y34 A;  4DFS A;  2RS5 2;  2ZA9 A;  4E2G A;  1JZ6 A;  4WM8 A;  5IVE A;  3SH4 A;  4XDP A;  2MEV 2;  3BYW A;  4BQW A;  3S7I A;  3FC0 A;  2E31 A;  2JG9 A;  1CZS A;  5BPX A;  4HN0 A;  4DEQ A;  5BNP C;  1MS5 A;  2E53 A;  1RUO A;  2BER A;  2H6C A;  4RN5 A;  3TNP B;  2W95 A;  1NCR C;  2ZCW A;  1PO1 1;  3MZH A;  3LSE A;  2YU1 A;  2RMU 1;  2VEC A;  3KLS A;  1S0B A;  1V0A A;  3PUH A;  4GH4 A;  3WDT A;  3ZIW A;  2XLG A;  3B9C A;  3H1M A;  4Q4Y 1;  5C5T A;  3OBZ A;  4E4Z A;  1SCR A;  5FY0 A;  2AH2 A;  2HLE A;  4Y26 A;  4MGT A;  4ZU5 A;  3BOW A;  5GZF A;  4S2F A;  2HWE 3;  4FP2 A;  3THP A;  1PGL 2;  4AR2 A;  3B69 A;  4OHW A;  4EN9 B;  1XBF A;  3MIH A;  3QAC A;  4BQ2 A;  1UMH A;  1G9B A;  2ZEY A;  1WLW A;  2BGC A;  2DCT A;  1FOD 2;  5CIR A;  1BVP 1;  4WVM A;  1VBB 3;  4QDQ A;  4YZ1 A;  3DN7 A;  2BYV E;  2Z2S B;  3PVB B;  2BFU L;  3WDY A;  1KRI A;  2HKX A;  1V00 A;  3A21 A;  1PMI A;  1LUL A;  3ACG A;  4FI9 A;  2VOW A;  2HWC 3;  2WN3 A;  5EP9 A;  1EAH 1;  3SLI A;  1Q8S A;  1DHK B;  1G9F A;  5FPZ A;  5LRS A;  1G9D A;  1W6N B;  4FPK A;  4MGS A;  2FQP A;  1RVF 2;  3V64 A;  1VMJ A;  2PHF A;  3VBO C;  1QJE A;  1XND A;  5DMY A;  3UJQ A;  4GB3 3;  1C5I A;  4DIQ A;  1ULF A;  4PHZ A;  2V09 A;  3DYP A;  1YC6 1;  3QLQ A;  5K0U A;  4U2A A;  4KGG A;  1RUF 3;  1C8M 2;  3W5N A;  1SLB A;  2N7G A;  2PYT A;  4CCO A;  1X36 A;  3D0S A;  1DCS A;  1W9T A;  5IYY A;  5L73 A;  4B29 A;  2XHN A;  3VBR C;  4FTE A;  1BKZ A;  3NST A;  1L7L A;  3N7L A;  4XQW A;  1TVG A;  3HOB A;  2W1U A;  4FPG A;  4I0W B;  5A3O A;  2OUJ A;  3CU7 A;  3GXU A;  3K46 A;  4U36 A;  4GWN A;  4AQS A;  2Q30 A;  4DO0 A;  3AKT A;  1APN A;  1EP0 A;  1KDK A;  2PHL A;  1JH5 A;  1WW4 A;  2DBI A;  2DFB A;  4TXW A;  1DU3 D;  1OI6 A;  5C4W A;  3T2P A;  3WHT A;  4BIS A;  2WAO A;  4Q4X 2;  1XXN A;  4IE5 A;  3SH3 A;  2BNO A;  4YSF A;  2XWJ B;  1LGC A;  2UWB A;  5IFP A;  1JUH A;  1NX9 A;  4OZX A;  2SLI A;  2ZKL A;  5FPV A;  3MHZ A;  1E5H A;  4FFG A;  3K4D A;  1RUI 1;  2NPI A;  1UY3 A;  4DUX A;  4PJY A;  3H8O A;  2UU8 A;  3LIG A;  5C7G A;  1RTV A;  5DDJ 3;  2XJU A;  1RUG 3;  1ODM A;  3VHO A;  3CL1 A;  4NUB A;  3WQ7 A;  4E8C A;  5ISL A;  2EAA A;  1VBB 1;  2B7Y A;  4XUT A;  2C0Z A;  4RR3 C;  2ZHN A;  3AXD A;  4N90 A;  1X8E A;  5KWR A;  5FPL A;  2W39 A;  2ZGO A;  4QXC A;  5GZE A;  5BNN B;  5L7O C;  1K42 A;  1NXM A;  2CDP A;  2ZZQ A;  5T54 A;  2Y6J A;  4UXA A;  3UL2 A;  2DVA A;  2X10 A;  3LA7 A;  2D43 A;  3VN4 A;  4JKM A;  3WNN A;  4FAH A;  1ZZC A;  1X9T A;  4R4Z A;  4AI0 A;  4A7Y A;  2ZMK A;  2HWF 3;  1CX1 A;  1U5I A;  1ZX5 A;  1OC1 A;  4M3C B;  4JGY C;  1GOG A;  2YV8 A;  1AYM 1;  4D3W A;  3TN9 2;  4CUG A;  3B00 A;  3VZK A;  1W6Q A;  1F5F A;  3ACH A;  4RGG A;  2AUY A;  2Y33 A;  3OF1 A;  5JZG A;  1W28 A;  4UBH A;  2P37 A;  4A6S A;  4LKF A;  4W6X A;  1BEV 2;  1Y9M A;  2HEW F;  4BM8 A;  4QPY A;  5IVV A;  3PUR A;  2WUH A;  1S0I A;  3CJI C;  4IXL A;  1FNZ A;  4BK4 A;  4ITC A;  3ZSK A;  3K75 B;  4DS0 A;  3PTY A;  5JOW A;  5DG1 A;  4XPV A;  2XKO A;  3VBH B;  4KG0 A;  2GAL A;  2UYA A;  1DQ2 A;  5HXV A;  3LEK A;  1NG0 A;  4H55 A;  3Q8A A;  4AHX A;  1KGY A;  2P3J A;  2ZEX A;  5FZ3 A;  3W59 A;  1CGP A;  1R1A 2;  4XAA A;  2I74 A;  3P6B A;  3OBR A;  4R9D A;  4CYD A;  4LKE A;  1UD1 A;  2BVB A;  2B4K A;  1VBC 3;  3IMN A;  1QJX 1;  3MW3 A;  4QX1 A;  5DUU A;  1NCQ C;  3T1M A;  5KHJ A;  3KS7 A;  2DVD A;  2XJP A;  1JU4 A;  2HJI A;  1QH6 A;  2GH2 A;  3FFQ A;  4UFM A;  1WWY A;  3B94 A;  2EF6 A;  5A7W B;  2QQL A;  1R09 3;  2RJL A;  4YVW A;  5JXG A;  4HMZ A;  3FX3 A;  1YLL A;  2DCK A;  4WM8 C;  3KT1 A;  4CDU B;  1W2N A;  1WD3 A;  3RGB A;  4BMB A;  2A5Z A;  4I2O A;  2JG9 C;  3I2O A;  5D8A A;  2Y6F A;  4FT8 A;  4P9G A;  2WRA A;  5DAX A;  5T55 A;  4M4R A;  5F1R A;  1I5P A;  4YGC A;  1CIY A;  3WEZ A;  1OLQ A;  4DB5 A;  2YRO A;  3UV9 A;  4N53 B;  3ZFG B;  4KH9 A;  4PIY A;  4HON A;  4GAL A;  4YAR A;  1H1A A;  3LWC A;  4GH4 C;  3ZYB A;  1JZ3 A;  3LEI A;  2HEY F;  3RYK A;  3S30 A;  2E6V A;  3F95 A;  2D6N A;  1ZBE 2;  5H9Q A;  3ILF A;  5FRA A;  5FYV A;  4Y1Y A;  3GYD A;  2GMM A;  4XF3 A;  1WLT A;  2GZW A;  4FCA A;  3OY8 A;  1HXS 3;  2HWF 1;  2VU9 A;  1BJQ A;  1LHN A;  3N9N A;  3RNS A;  1T2X A;  2DCY A;  4OUS A;  3KB5 A;  3VD3 A;  1RUN A;  2ET1 A;  4F3J A;  4NRM A;  3V0B B;  4EN0 A;  3FBM A;  3NJX A;  1ENQ A;  4LBQ B;  1N1T A;  2IXL A;  1AR6 3;  1UKG A;  2YHJ A;  3RSJ A;  3VDA A;  3JD7 1;  2XQX A;  3HQU A;  4YW3 A;  1JOP A;  4D6Q A;  1PM4 A;  2FCU A;  5F32 A;  1WME A;  4HT1 T;  2WT2 A;  5FQ0 B;  3VV1 A;  1ZRC A;  2E9Q A;  2E32 A;  1OT5 A;  4NPR A;  1OXC A;  2RS5 3;  1RUC 2;  1LEC A;  4YRD A;  4D6R A;  2B39 A;  2WO3 A;  3A0N A;  3ZXG A;  2MEV 3;  4DNY A;  2VXR A;  3DGT A;  1PX4 A;  3BN6 A;  1HB2 A;  2VD7 A;  2OZJ A;  4QU2 A;  3MPP G;  4KWL A;  4CCE A;  4J1W A;  4CU9 A;  1RGS A;  2ZEZ A;  3RWK X;  1V6M A;  2J1T A;  4ASM B;  3WQ0 A;  5A3M A;  4Q4W 2;  3POI A;  3A23 A;  3GM8 A;  4GMP 0;  3O0W A;  1PHM A;  4MGZ E;  4TZD A;  4NIH A;  3PIJ A;  2O8Q A;  4AG4 A;  5K0U C;  4ERO A;  3AZY A;  1JYC A;  1OQD A;  2PLV 2;  5F5A A;  5FK8 A;  3VHP A;  3QCW A;  2P1B A;  3WDU A;  1UY4 A;  1HQN A;  4WVZ A;  1F5J A;  2JE7 A;  3M3O A;  4HOO A;  3LA3 A;  4YG6 A;  4LHK A;  5FZA A;  4BJ0 A;  1FOD 3;  4Q0S A;  3I2I A;  4PIZ A;  4JTO A;  1PO2 1;  3I54 A;  4MO3 M;  3MIG A;  4D0Q A;  3WP4 A;  2DUQ A;  3T30 A;  5K8S A;  3IMM A;  3IN9 A;  3ETQ A;  2XHK A;  4IV1 A;  1RMU 2;  1EYB A;  1W8O A;  2NM1 A;  3SIS A;  4OI1 A;  1V6J A;  1V6I A;  2XR4 A;  2HBT A;  3WZ1 A;  1ND3 A;  5DAP A;  3NJZ A;  4ZS3 A;  4AZZ A;  1IKP A;  5C4W C;  1O8S A;  1IKQ A;  3ZSM A;  2PMW B;  2JE9 A;  3HAG A;  2R1D A;  1AX2 A;  2C24 A;  1CAU A;  4QD2 A;  4Q2F A;  1Y4W A;  2E26 A;  3WNM A;  1GKB A;  1KXG A;  3ILR A;  1LOA A;  5FXV A;  3UJO A;  1HRV 2;  4TSV A;  1QDC A;  3ORJ A;  4G9S B;  2EID A;  1RUJ 3;  1LRH A;  5F5C A;  1QNY A;  1KFU L;  1WCS A;  5A7P A;  1W06 A;  4HN1 A;  2R32 A;  3GCX A;  5BNP B;  4XIL A;  4CP0 A;  4EN7 B;  2QQW A;  1NCR B;  2E7Q A;  1C8M 3;  3BGA A;  2BU9 A;  4FFF A;  2XWB B;  4HK9 A;  2CHH A;  5GZD A;  1E57 A;  5B4N A;  1W04 A;  3ZMO A;  4HKW A;  4CPB A;  5ANQ A;  1H0B A;  2IWG B;  4QX2 A;  5BYN A;  3Q8F A;  2Y0O A;  1UY1 A;  3KD4 A;  4LUM A;  3Q9O A;  4BDV B;  2D3S A;  1LHW A;  4NWW A;  4ARY A;  1QJZ A;  4XJU A;  4DY5 A;  4Z92 B;  3ZVX A;  5A33 A;  2WWJ A;  2VQA A;  5JZG C;  5L19 A;  1XSR A;  3VZO A;  3ZDV A;  2NYY A;  1HN1 A;  4QQO A;  3FFZ A;  4Q4X 3;  4UWD A;  3H8X A;  5C6C A;  4XJZ A;  1XPW A;  5LA1 A;  3O14 A;  2A7A A;  4GMP 3;  1PIV 1;  2PXJ A;  1KJL A;  4RQP A;  5ABJ A;  2D6L X;  5A1F A;  3RZH A;  1F8V A;  4XF0 A;  3L9J T;  3C7E A;  5CB7 A;  1V6O A;  1XYN A;  5F39 A;  1H6X A;  2EIE A;  2W08 A;  2WL1 A;  1O3T A;  4QKN A;  5FMB A;  4Z07 A;  4XFF A;  3S7E A;  2D6P A;  1FMD 2;  2I07 B;  3IDB B;  3VKO A;  4LBJ A;  3VBO B;  1FI2 A;  2DU1 A;  2R06 1;  2RM2 1;  2WZE A;  2OKX A;  4WBB A;  4DEV A;  5BNN A;  5J7M A;  5FMC A;  2ETE A;  1CX4 A;  1UOJ A;  3PUA A;  3III A;  4AW7 A;  5FV3 A;  1RB8 G;  4AI1 A;  5FY4 A;  5DN2 A;  4JDN A;  2G4I A;  2Y64 A;  4BQ5 A;  4IEW A;  4COZ A;  1RUD 1;  2VNR A;  3ZXA C;  4YVW C;  1UZ0 A;  1AUY A;  2VMC A;  3VBR B;  4BK5 A;  3TN9 3;  2BNM A;  4NN0 A;  2WNV B;  5IVF A;  1CPM A;  1RUJ 1;  2XLF A;  5C8C B;  1XRU A;  2VZ3 A;  4S2G A;  3ZR6 A;  2JE8 A;  1CWP A;  2VOK A;  2DBN A;  1BEV 3;  5FZO A;  4KI5 M;  2W1S A;  2QNK A;  5CIS A;  4LK7 A;  4Y1V A;  5KBF A;  1VBA 2;  5DAW A;  2GU9 A;  1GQH A;  1O8P A;  2XG3 A;  3VBH A;  2CWM A;  1EV1 2;  3R0R A;  2PTM A;  4I30 A;  3VZL A;  2ZZJ A;  1PGS A;  1AR8 1;  1WBL A;  3LZZ A;  3WF2 A;  1R1A 3;  2ES3 A;  2WSV A;  2JDP A;  4QQL A;  3WVJ A;  5A6X A;  1C3H A;  2TNF A;  3AX4 A;  2EXK A;  4MV2 A;  2OX0 A;  4P9Y A;  3FN9 A;  4W4Z A;  4PCR A;  4L97 A;  3VD7 A;  2WO2 A;  4MET A;  5FZ4 A;  4RR3 B;  1OLM E;  2WO1 A;  3HPN A;  1G7Y A;  1MPX A;  5IFT A;  2IVI B;  5L7O B;  2X8K A;  3D0J A;  2J42 A;  2VGD A;  5E16 A;  5A7W A;  2WA3 A;  5CBL A;  4XBL A;  4CDU A;  2QQI A;  1TZO A;  3POY A;  3ZXD A;  4QAW A;  3SXW A;  1JTZ X;  1VMH A;  2VQT A;  2WLP A;  3KHC A;  3RDI A;  1E5I A;  3RQ0 A;  1LAJ A;  4JGY B;  4TTG A;  5FBZ A;  2JKX A;  3A22 A;  1VMF A;  4N53 A;  3ZFG A;  5AC9 2;  3DL3 A;  3MDP A;  3P1I A;  5FZ6 A;  1IS5 A;  4QDR A;  1UYZ A;  1SAC A;  2CY6 A;  4JHT A;  4YW1 A;  4DPN A;  1ZBE 3;  4MH0 E;  4E4H A;  4YM0 A;  2FDF A;  1CVN A;  4IER A;  3DEC A;  3ZYI B;  1GU3 A;  1N1S A;  1PVX A;  1ASJ 1;  4AFB A;  4DXZ A;  4XFA A;  4MHU A;  2XDV A;  1VAM A;  1XU2 A;  4BU2 A;  3V0B A;  3INA A;  2IUW A;  4HK8 A;  1XYP A;  4JKK A;  4LBK A;  4LBQ A;  3RZZ A;  3VGI A;  1ZZB A;  1VP6 A;  2P2K A;  1QXR A;  4IUG A;  5FP8 A;  5A1L A;  1TME 2;  3SQO A;  1SDD B;  5FQ0 A;  2PAE A;  3OGV A;  1ENR A;  2RDQ A;  4IV1 C;  1OKQ A;  2FZ2 A;  2NQY A;  1JI6 A;  1PMJ X;  1F35 A;  1ND3 C;  3NV1 A;  4IEZ A;  2JKB A;  1RUC 3;  3EBR A;  5A70 A;  5HBA A;  5KHG A;  3IDE A;  4K1Z A;  1ENS A;  5FMO L;  4CDQ B;  3LFM A;  4YZ3 A;  1RYY A;  2JJ6 A;  2GME A;  1LOC A;  5CKQ A;  5I0U A;  3DPR B;  1VE0 A;  2WS9 2;  1ZZ9 A;  4ORF A;  1HW5 A;  3U07 A;  2ZAC A;  3CZU A;  3DXU A;  4WM8 B;  4YW5 A;  5FZH A;  3Q8E A;  1UMZ A;  1Q8P A;  3WP6 A;  1AR9 1;  1DQ6 A;  2DFC A;  2YU2 A;  1S2E A;  1N3O A;  1KS5 A;  1OUX A;  1QQP 2;  2JG9 B;  3OTF A;  4FO9 A;  2JB4 A;  4Q4W 3;  3WF1 A;  4A6O A;  5C3Q A;  3RZM A;  4R4X A;  3OD4 A;  3THT A;  1DZT A;  5H9S A;  3GDB A;  3N9O A;  1JYV A;  4JTN A;  2CWS A;  1S1A A;  1PNF A;  2ARC A;  2PLV 3;  5DAB A;  1SFN A;  3TEW A;  2LTN A;  1CJD A;  4EV0 A;  4AVV A;  4CP1 A;  3JU9 A;  1ODN A;  3BTX A;  4YG3 A;  1YHF A;  3ME2 A;  3SH5 A;  4KU7 A;  3H3L A;  1BBT 2;  3WNL A;  3OOX A;  1D4M 2;  4YLZ A;  5IT6 A;  4QQH A;  1QOO A;  2BFU S;  4UFK A;  3OEB A;  1RMU 3;  2WLQ A;  4WVM B;  4FAG A;  1IG3 A;  1JHN A;  5FZG A;  2VOV A;  2A6X A;  2PHW A;  2VUD A;  4OHX A;  1AVB A;  5G05 L;  4RQP C;  2HWB 2;  4ZXE A;  2D98 A;  5ABJ C;  3FHI B;  5FZE A;  1CD3 G;  1OH4 A;  5I0R A;  2V73 A;  1HRV 3;  3FLP A;  4ASL A;  2ARE A;  5FAX A;  1OKO A;  2VUJ A;  4E4S A;  3LIH A;  1H4G A;  4SBV A;  2RV9 A;  4L8Q A;  4D7S A;  4X6Q B;  2XL7 A;  1VAK A;  2ZX2 A;  1NCR A;  5FZI A;  4QX8 A;  3WX5 A;  2FDJ A;  1MS9 A;  1IOA A;  1TMF 1;  1O5U A;  5FP3 A;  3ZXJ A;  4XOG A;  4AEK A;  2ET7 A;  2IXC A;  3UGF A;  3MV1 1;  1RUC 1;  2QBX A;  2WZR 1;  4Y1Z A;  1CQ9 A;  3HMY A;  2WYS A;  4HKO A;  4XW3 A;  2X5I B;  2FZ1 A;  3FUO A;  1ST8 A;  3IBM A;  3KQ4 B;  2QJV A;  2WNO A;  1DDL A;  1AR7 2;  3ZXF A;  5KR7 A;  4FPO B;  4DY3 A;  3KGL A;  2Q5T A;  2CDO A;  2BBV A;  1Y43 B;  3J8F 2;  4PBO A;  4CCK A;  3OPW A;  3I2J A;  4EWE A;  1J84 A;  3M70 A;  3WF0 A;  2OXB A;  4AGR A;  4UBG A;  4Q29 A;  2EAK A;  5C4W B;  2XBO 1;  5DAQ A;  1URX A;  3HN3 A;  2YXS A;  4W50 A;  3VBH C;  2HYK A;  2FDG A;  3KZ4 C;  3FL7 A;  1HB3 A;  1BK0 A;  1D7P M;  4TLF A;  3SMH A;  2VW0 A;  4E27 A;  5HXM A;  1FMD 3;  3A7Q A;  4P9I A;  3CKH A;  3VHR A;  4HLT A;  1ZBA 2;  2VMG A;  4HVO A;  4HKL A;  4ZON A;  1JYN A;  5FZM A;  5HV4 A;  4NIG A;  1VRB A;  5LEJ A;  2BP6 A;  3WG3 A;  1LOF C;  3OG2 A;  3K77 A;  1YJL A;  3WF4 A;  2QQP A;  1T6B X;  1UYX A;  4L2N A;  5FXW A;  4XXA A;  2XJS A;  3M4F A;  4QM8 A;  4LIV A;  5J36 A;  1EPZ A;  3QD6 A;  3PVN A;  1IS6 A;  3ZR5 A;  4BIO A;  3K2O A;  4CTE A;  3ON7 A;  4O9E A;  1AF9 A;  3PDQ A;  5FLH A;  4CDU C;  4QQP A;  2WNV A;  4IE4 A;  1PX3 A;  4KU8 A;  5C8C A;  2VZO A;  1LTE A;  2E33 A;  2ZAA A;  3VDB A;  3U75 A;  1AYN 2;  4WZF A;  3ZM8 A;  2PA7 A;  5SV8 A;  3WQ1 A;  3GZT B;  4MSV A;  1W9S A;  3MYX A;  5FLI A;  4BWO A;  5IK4 A;  3KCY A;  4MZU A;  1X9P A;  1W6Q B;  3WY6 A;  4NPM A;  1C1F A;  4N53 C;  3RRD A;  3ZFG C;  4AVS A;  2VE1 A;  3T2T A;  2R7E B;  1DZR A;  5JZG B;  1VBA 3;  5LWB A;  1O3S A;  2F4L A;  4UFI A;  1QWR A;  2DV9 A;  4GA9 A;  2Q8D A;  1WGP A;  3ZIX A;  4AAX A;  1EV1 3;  1SCS A;  2MPF A;  2WAB A;  5JUV A;  4NRQ A;  5IAV A;  2RS3 2;  1J3Q A;  2IZW A;  3ZSL A;  1DF0 A;  3VL9 A;  2VC9 A;  3ZPO A;  4FPF A;  1ZA4 A;  1JYW A;  2QQJ A;  1OD5 A;  4PBP A;  1F31 A;  5H9R A;  1H2L A;  3T4H B;  1W0P A;  3AMQ A;  5FZK A;  4CU6 A;  2VO5 A;  4Q5O A;  4ZHN A;  1REE A;  2WJS A;  1GNH A;  1HKD A;  4XUQ A;  4Y1U A;  5FYZ A;  3IB3 A;  4NIA A;  1GMM A;  3BU7 A;  2JDK A;  1J3P A;  1UL9 A;  2XJT A;  3ZYG A;  2EXJ A;  2YFZ A;  3H0O A;  4URT A;  4URA A;  1G9A A;  2TUN A;  3C7G A;  3RYP A;  4A2U A;  4CDW B;  1W9W A;  3GBG A;  1UZY A;  3TYJ A;  3BOD A;  1H30 A;  3FWE A;  3GCW A;  4HG6 B;  2BGP A;  4ZZ5 A;  1GOF A;  4YVW B;  4A41 A;  2WWU A;  1ZM1 A;  2W5F A;  3AL5 A;  1DQ1 A;  5AC9 3;  1O91 A;  4FQ4 A;  4FPE A;  4P5H A;  5EPA A;  2HYX A;  4CEW A;  1U5Y A;  1UNB A;  3NAP B;  4XUO A;  4GWJ A;  1XNC A;  4UFJ A;  1GWK A;  1V6K A;  2DVG A;  4AFD A;  4A45 A;  4BQ4 A;  5F5I A;  1UIJ A;  1OSG A;  2ARB A;  1ULD A;  1W8U A;  4RHV 1;  3RZL A;  2RDS A;  1VBD 1;  1OVS A;  3H42 B;  4CP9 A;  3EO6 A;  4B3N A;  2YG0 A;  3OY8 B;  1ZVF A;  3WW4 A;  5IHR A;  2ZGK A;  1J1T A;  2NZ9 A;  3NWK A;  2Z69 A;  5CG8 A;  1PGW 1;  1TME 3;  1LB2 A;  4UAP A;  5C9A A;  3E97 A;  1PVC 3;  2VCM A;  5FZ8 A;  5J09 A;  5EWS A;  1Y9Q A;  1HJF A;  1N1V A;  1S0E A;  1DZQ A;  1FPN 1;  2PHR A;  3AP4 A;  3JCI A;  4LA2 A;  1ZNP A;  3ACF A;  4N9H A;  4CVU A;  1RHI 2;  1QJY 3;  2XPJ A;  3BOP A;  4CDQ A;  4MGQ A;  4M3C F;  1DGL A;  5GLV A;  3DPR A;  4ATE A;  1GP4 A;  4HXC A;  4UFH A;  3UT0 A;  2WS9 3;  1QIQ A;  1W99 A;  3SIT A;  1TEI A;  1DFQ A;  2O14 A;  3H1W A;  1OA2 A;  3LD8 A;  2RR1 2;  4QHO A;  4A3X A;  1NLS A;  1R64 A;  4R52 A;  4AGV A;  2MHF A;  1QQP 3;  5EYY A;  3UNP A;  4Z82 A;  1OQE A;  3MF9 A;  2GNM A;  4OZO A;  2ZGP A;  2WQ8 A;  4QM9 A;  3ZKY A;  3ASI A;  3CNA A;  1PMH X;  2UUR A;  3AMM A;  1AL2 1;  4OI4 A;  3U14 A;  3V65 A;  3PLQ A;  5CFD C;  1W8F A;  4IEO A;  2X29 A;  4I3G A;  1PK6 A;  1KQR A;  3PVE A;  4YW2 A;  5CAZ A;  5KHI A;  3ECQ A;  3GHN A;  4IES A;  5LAT A;  1YQC A;  1U0A A;  2ERF A;  3FHQ A;  1BBT 3;  4YFZ A;  1D4M 3;  3WQB A;  1LEN A;  5F2W A;  3AP5 A;  2VZQ A;  2B42 B;  2WWS A;  3ZFE B;  2D3R A;  1YQ5 A;  3HR9 A;  2Q8E A;  4QB2 A;  5T52 A;  4BLI A;  5L9R A;  3AP7 A;  3RZJ A;  1RUH 2;  2YGL A;  2OUH A;  4QB6 A;  3WR0 A;  3HT2 A;  3WCR A;  2W2I A;  3ELN A;  4IV1 B;  3VBU A;  1VBE 2;  5FTT C;  2HWB 3;  2TEP A;  1NLR A;  1ND3 B;  2IVJ A;  4CDX C;  4HSL A;  2W46 A;  4Q8L A;  5FYB A;  5CEH A;  4QGN A;  2PQQ A;  3PME A;  4IEU A;  1GZT A;  3B7M A;  2TBV A;  2WN2 A;  1CAU B;  3AVS A;  2E63 A;  2Y6K A;  1LHO A;  1H2M A;  1O59 A;  3BPS A;  5A3L A;  1UX7 A;  3GBF A;  3NO8 A;  2JIJ A;  1C57 A;  2R07 1;  1OUS A;  1PVC 1;  4W65 A;  3DYM A;  5BNQ A;  5C70 A;  5L36 A;  5A6Y A;  3TEZ A;  3KWV A;  1CN1 A;  1GNY A;  1SG3 A;  2BWC A;  2DWR A;  2HWD 1;  4R8H A;  4CA9 A;  5C71 A;  1DBN A;  3BTA A;  5JXJ A;  1QJY 1;  5FZF A;  3TEY A;  1P8J A;  3Q8C A;  2WNU A;  3ZFF A;  1O4Y A;  3IAQ A;  2X5I A;  5FPA A;  1BMV 2;  1US2 A;  4XTP A;  3PJY A;  5CKM A;  3OCP A;  1J83 A;  3IIA A;  2WNV C;  4IEY A;  3M3C A;  5C8C C;  1AR7 3;  1SMV A;  4P9L A;  3GJA A;  3N9P A;  5GKA C;  1NE4 A;  2V72 A;  4D69 A;  4XF9 A;  2JDN A;  4GQ7 A;  3J8F 3;  1V9U 2;  5FUP A;  1W3V A;  2CNA A;  5A33 B;  1GFF 2;  2VR4 A;  3V56 A;  3VUO A;  4XJ8 A; 
#chains in the Genus database with same CATH homology
 3OPT A;  4HOO A;  4CCM A;  5FZI A;  2XXZ A;  5FZA A;  2OX0 A;  4QX8 A;  5IVB A;  5FY8 A;  5IVE A;  5FP3 A;  4XDP A;  5F2S A;  4V2W A;  5F5I A;  4IGQ A;  4CUG A;  4EZH A;  5FZ4 A;  5LW9 A;  4UF0 A;  5FJH A;  3DXT A;  4LIT A;  5FUN A;  2OQ6 A;  5A7W A;  3NJY A;  5IVV A;  3PUR A;  5FYT A;  5IW0 A;  4GAZ A;  2YU1 A;  2Q8C A;  3AVR A;  3N9L A;  4QX7 A;  3AL6 A;  5F3G A;  5FZ8 A;  2XML A;  5FY0 A;  5FZL A;  5IVJ A;  5KR7 A;  5FXV A;  5A3P A;  5FY1 A;  4AAP A;  4Y4R A;  4AI9 A;  4CCK A;  5F5C A;  4CCL A;  3KV9 A;  5FZ3 A;  3OPW A;  5FZ6 A;  5A7P A;  4QWN A;  3KV4 A;  5IWF A;  4E4H A;  2YBK A;  4LXL A;  3UYJ A;  4Y3O A;  3LD8 A;  4QU1 A;  3RVH A;  4EZ4 A;  3LDB A;  4UF0 B;  5ANQ A;  5FP4 A;  2XDV A;  4IGO A;  5FP9 A;  5FZ1 A;  5FZB A;  3K3O A;  4BU2 A;  5A3N A;  4C8D A;  5LY1 A;  5A7W B;  4GJY A;  5FZM A;  1VRB A;  5FZO B;  5F3C A;  2YBP A;  5FP8 A;  5F37 A;  5A1L A;  5FZ9 A;  2OT7 A;  5E6H A;  3N9Q A;  5FXW A;  2WWJ A;  2P5B A;  5F3E A;  4LIV A;  5FJK A;  5FYC A;  5FWE A;  3PUS A;  3K2O A;  3PU3 A;  5FY9 A;  4V2V A;  4ASK A;  4DIQ A;  5FPU A;  3PDQ A;  4HON A;  4Y33 A;  2PXJ A;  5F2W A;  5A1F A;  4XDO A;  5FP7 A;  5FPB A;  5FYV A;  5FZC A;  2Q8E A;  3DXU A;  5F39 A;  2YPD A;  3KVB A;  5FZH A;  5A7Q A;  4CCO A;  4QXH A;  2YBS A;  5FYY A;  5A3T A;  2YU2 A;  3N9N A;  2W2I A;  5FXZ A;  5LWB A;  3K3N A;  2GP3 A;  3PTR B;  4CCJ A;  2Q8D A;  5FYU A;  3U78 A;  5A7N A;  3N9O A;  5FYB A;  2OS2 A;  4TN7 A;  3ZLI A;  5CEH A;  3KV5 A;  3PUA A;  4D6Q A;  4DO0 A;  5F32 A;  3AVS A;  5FV3 A;  4D6S A;  2OQ7 A;  5FY4 A;  3ZPO A;  3U4S A;  5FY7 A;  2XUE A;  4BIS A;  5FXX A;  3N9M A;  4D6R A;  5FZK A;  5IVY A;  5FWJ A;  5FPV A;  5FY5 A;  5FYZ A;  5FYH A;  5FBJ A;  5IVF A;  2VD7 A;  5F3I A;  5FZF A;  5FZ0 A;  4EYU A;  5A3W A;  4URA A;  4LIU A;  4CSW A;  5LY2 A;  5FPA A;  5FZO A;  4GJZ A;  5FZG A;  4NUB A;  5FYI A;  5A7O A;  5ISL A;  5A80 A;  4CCN A;  5FZD A;  5FYM A;  5FZE A;  5FPL A;  2GP5 A;  3KV6 A;  3N9P A;  4GD4 A;  4QXC A;  5IVC A;  2WWU A;  4BXF A;  5F5A A;  5FZ7 A;  3AL5 A;  4QXB A;  5K4L A;  4IGP A;  5FUP A;  5FYS A;  5A7S A;  3PUQ A;  3PU8 A;  3KVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...