4C8PA

Mouse znrf3 ectodomain crystal form v, disulfide-bridged s90c variant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
144
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLCAEGEIVQMHPLGLCLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 38
structure length 144
sequence length 151
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8pA00
4OC5A 4TJXA 3IIBA 4P4BA 2XEFA 4P44A 4P45A 4NGSA 1CX8A 2PVWA 3KASA 3RBUA 4C8FA 3BI0A 4LQGA 4P4IA 3SJXA 4TWEA 3ICUA 1DE4C 3FECA 4C99A 4C84A 4TJVA 2PVVA 4NGMA 3I74A 4NGNA 1V6CA 4P4EA 4OC4A 4MCSA 4C9UA 4JYWA 4OC2A 3BI1A 4NGRA 2JBJA 1WVMA 2XEGA 3BXMA 4NGPA 2JBKA 2C6GA 5D29A 4C8AA 4MCRA 3S9LA 2CIJA 3FEEA 4MCQA 4P4DA 4P4FA 1XF1A 4NGQA 2XEIA 1Z8LA 4P4JA 4W9YA 1Y9ZA 5F09A 4OC0A 3D7GA 3FEDA 4CDJA 3I6SA 2XEJA 4C9EA 3D7FA 4C85A 4C9AA 3S9NA 5IB9A 4C9VA 3IWWA 4NGTA 4YN3A 5ELYA 4KNGE 3BHXA 4C9RA 4CDKA 3SJEA 3SJGA 4C8TA 4C8CA 3D7HA 4OC1A 3SJFA 2C6CA 4C8PA 4MCPA 3VTAA 3EIFA 4C8UA 2C6PA 4OC3A 2EK9A 4OMEA 2EK8A 3D7DA 4X3RA 3FF3A 3S9MA 2OOTA 4C86A 4JZ0A 2OR4A
chains in the Genus database with same CATH superfamily
4OC5A 1J3LA 2YJVA 3IIBA 4P4BA 4TJXA 2AUNA 2XEFA 4IIYA 4P44A 4P45A 4NGSA 5FD8A 1CX8A 2PVWA 3KASA 3RBUA 4C8FA 2OLSA 3BI0A 3SR3A 3G23A 1C30B 3KRVA 4LQGA 1VI4A 4P4IA 3SJXA 5IR2A 4CZ1A 5JYBA 2B0AA 4TWEA 4EYSA 3ICUA 4COGA 1DE4C 3FECA 4C99A 4C84A 4TJVA 2PVVA 4NGMA 3K4IA 3I74A 4NGNA 1V6CA 4P4EA 4OC4A 4MCSA 4C9UA 4JYWA 2X0SA 4OC2A 3BI1A 2C5QA 4NGRA 2R82A 2JBJA 1WVMA 3T0TA 2XEGA 3BXMA 4E5SA 5K99A 4NGPA 3TLAA 1JDBC 1M6VB 2C6GA 2EZCA 2JBKA 4E94A 5D29A 3U1BA 3GJZA 1CE8B 4COBA 3T07A 4C8AA 1ZRSA 4MCRA 3S9LA 2CIJA 3FEEA 3C8OA 1ZYMA 1KC7A 4MCQA 1C3OB 1VBGA 4P4DA 1EZBA 4P4FA 3NOJA 1XF1A 2D0OA 4NGQA 2XEIA 1Z8LA 1A9XB 1Q5XA 1DIKA 3EZAA 1NBWA 4P4JA 4W9YA 1Y9ZA 5F09A 2E28A 1NXJA 4OC0A 2AUMA 5F1YA 1VBHA 3D7GA 3FEDA 2GP4A 4CDJA 2D0PA 3T5MA 1BXRB 2XEJA 3I6SA 3TLGB 4C9EA 1ZL0A 3D7FA 5F5XA 5F9MA 4C85A 4M8DA 2PCNA 4C9AA 3S9NA 5IB9A 4J0NA 4C9VA 2HROA 2FM4A 3IWWA 4NGTA 4YN3A 4MI1A 1GGOA 3K9TA 5ELYA 1EZAA 4KNGE 3BHXA 3TYXA 4C9RA 1R61A 4CDKA 3SJEA 3TLZA 3TLYA 4INJA 5JVLA 1KBLA 3SJGA 4MJXA 1CS0B 4C8TA 4IIXA 4C8CA 3D7HA 4OC1A 3SJFA 2C6CA 4C8PA 4MCPA 2EZAA 4H1HA 3T05A 3EIFA 3VTAA 2HWGA 3EZBA 4C8UA 2C6PA 4JVOA 4OC3A 2EK9A 4OMEA 2EK8A 3TLEA 1JDEA 2HI6A 3D7DA 4X3RA 3TLCA 3FF3A 2YJTA 2EZBA 3EZEA 4CO9A 3TLGA 1T36B 3S9MA 2DIKA 2OOTA 4C86A 4JZ0A 3TLBA 2MP0A 2OR4A 1KEEB
chains in the Genus database with same CATH topology
4OC5A 4TJXA 3IIBA 4P4BA 2XEFA 4P44A 4P45A 4NGSA 1CX8A 2PVWA 3KASA 3RBUA 4C8FA 3BI0A 4LQGA 4P4IA 3SJXA 5IR2A 4TWEA 3ICUA 1DE4C 3FECA 4C99A 4C84A 4TJVA 2PVVA 4NGMA 3I74A 4NGNA 1V6CA 4P4EA 4OC4A 4MCSA 4C9UA 4JYWA 4OC2A 3BI1A 2C5QA 4NGRA 2JBJA 1WVMA 2XEGA 3BXMA 4NGPA 2JBKA 2C6GA 5D29A 4C8AA 4MCRA 3S9LA 2CIJA 3FEEA 4MCQA 4P4DA 4P4FA 1XF1A 4NGQA 2XEIA 1Z8LA 4P4JA 4W9YA 1Y9ZA 5F09A 4OC0A 3D7GA 3FEDA 2GP4A 4CDJA 3I6SA 2XEJA 4C9EA 3D7FA 4C85A 4C9AA 3S9NA 5IB9A 4C9VA 3IWWA 4NGTA 4YN3A 3K9TA 5ELYA 4KNGE 3BHXA 4C9RA 4CDKA 3SJEA 3SJGA 4C8TA 4C8CA 3D7HA 4OC1A 3SJFA 2C6CA 4C8PA 4MCPA 3VTAA 3EIFA 4C8UA 2C6PA 4OC3A 2EK9A 4OMEA 2EK8A 3D7DA 4X3RA 3FF3A 3S9MA 2OOTA 4C86A 4JZ0A 2OR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OC5 A;  4TJX A;  3IIB A;  4P4B A;  2XEF A;  4P44 A;  4P45 A;  4NGS A;  1CX8 A;  2PVW A;  3KAS A;  3RBU A;  4C8F A;  3BI0 A;  4LQG A;  4P4I A;  3SJX A;  4TWE A;  3ICU A;  1DE4 C;  3FEC A;  4C99 A;  4C84 A;  4TJV A;  2PVV A;  4NGM A;  3I74 A;  4NGN A;  1V6C A;  4P4E A;  4OC4 A;  4MCS A;  4C9U A;  4JYW A;  4OC2 A;  3BI1 A;  4NGR A;  2JBJ A;  1WVM A;  2XEG A;  3BXM A;  4NGP A;  2JBK A;  2C6G A;  5D29 A;  4C8A A;  4MCR A;  3S9L A;  2CIJ A;  3FEE A;  4MCQ A;  4P4D A;  4P4F A;  1XF1 A;  4NGQ A;  2XEI A;  1Z8L A;  4P4J A;  4W9Y A;  1Y9Z A;  5F09 A;  4OC0 A;  3D7G A;  3FED A;  4CDJ A;  3I6S A;  2XEJ A;  4C9E A;  3D7F A;  4C85 A;  4C9A A;  3S9N A;  5IB9 A;  4C9V A;  3IWW A;  4NGT A;  4YN3 A;  5ELY A;  4KNG E;  3BHX A;  4C9R A;  4CDK A;  3SJE A;  3SJG A;  4C8T A;  4C8C A;  3D7H A;  4OC1 A;  3SJF A;  2C6C A;  4C8P A;  4MCP A;  3VTA A;  3EIF A;  4C8U A;  2C6P A;  4OC3 A;  2EK9 A;  4OME A;  2EK8 A;  3D7D A;  4X3R A;  3FF3 A;  3S9M A;  2OOT A;  4C86 A;  4JZ0 A;  2OR4 A; 
#chains in the Genus database with same CATH topology
 4OC5 A;  1J3L A;  2YJV A;  3IIB A;  4P4B A;  4TJX A;  2AUN A;  2XEF A;  4IIY A;  4P44 A;  4P45 A;  4NGS A;  5FD8 A;  1CX8 A;  2PVW A;  3KAS A;  3RBU A;  4C8F A;  2OLS A;  3BI0 A;  3SR3 A;  3G23 A;  1C30 B;  3KRV A;  4LQG A;  1VI4 A;  4P4I A;  3SJX A;  5IR2 A;  4CZ1 A;  5JYB A;  2B0A A;  4TWE A;  4EYS A;  3ICU A;  4COG A;  1DE4 C;  3FEC A;  4C99 A;  4C84 A;  4TJV A;  2PVV A;  4NGM A;  3K4I A;  3I74 A;  4NGN A;  1V6C A;  4P4E A;  4OC4 A;  4MCS A;  4C9U A;  4JYW A;  2X0S A;  4OC2 A;  3BI1 A;  2C5Q A;  4NGR A;  2R82 A;  2JBJ A;  1WVM A;  3T0T A;  2XEG A;  3BXM A;  4E5S A;  5K99 A;  4NGP A;  3TLA A;  1JDB C;  1M6V B;  2C6G A;  2EZC A;  2JBK A;  4E94 A;  5D29 A;  3U1B A;  3GJZ A;  1CE8 B;  4COB A;  3T07 A;  4C8A A;  1ZRS A;  4MCR A;  3S9L A;  2CIJ A;  3FEE A;  3C8O A;  1ZYM A;  1KC7 A;  4MCQ A;  1C3O B;  1VBG A;  4P4D A;  1EZB A;  4P4F A;  3NOJ A;  1XF1 A;  2D0O A;  4NGQ A;  2XEI A;  1Z8L A;  1A9X B;  1Q5X A;  1DIK A;  3EZA A;  1NBW A;  4P4J A;  4W9Y A;  1Y9Z A;  5F09 A;  2E28 A;  1NXJ A;  4OC0 A;  2AUM A;  5F1Y A;  1VBH A;  3D7G A;  3FED A;  2GP4 A;  4CDJ A;  2D0P A;  3T5M A;  1BXR B;  2XEJ A;  3I6S A;  3TLG B;  4C9E A;  1ZL0 A;  3D7F A;  5F5X A;  5F9M A;  4C85 A;  4M8D A;  2PCN A;  4C9A A;  3S9N A;  5IB9 A;  4J0N A;  4C9V A;  2HRO A;  2FM4 A;  3IWW A;  4NGT A;  4YN3 A;  4MI1 A;  1GGO A;  3K9T A;  5ELY A;  1EZA A;  4KNG E;  3BHX A;  3TYX A;  4C9R A;  1R61 A;  4CDK A;  3SJE A;  3TLZ A;  3TLY A;  4INJ A;  5JVL A;  1KBL A;  3SJG A;  4MJX A;  1CS0 B;  4C8T A;  4IIX A;  4C8C A;  3D7H A;  4OC1 A;  3SJF A;  2C6C A;  4C8P A;  4MCP A;  2EZA A;  4H1H A;  3T05 A;  3EIF A;  3VTA A;  2HWG A;  3EZB A;  4C8U A;  2C6P A;  4JVO A;  4OC3 A;  2EK9 A;  4OME A;  2EK8 A;  3TLE A;  1JDE A;  2HI6 A;  3D7D A;  4X3R A;  3TLC A;  3FF3 A;  2YJT A;  2EZB A;  3EZE A;  4CO9 A;  3TLG A;  1T36 B;  3S9M A;  2DIK A;  2OOT A;  4C86 A;  4JZ0 A;  3TLB A;  2MP0 A;  2OR4 A;  1KEE B; 
#chains in the Genus database with same CATH homology
 4OC5 A;  4TJX A;  3IIB A;  4P4B A;  2XEF A;  4P44 A;  4P45 A;  4NGS A;  1CX8 A;  2PVW A;  3KAS A;  3RBU A;  4C8F A;  3BI0 A;  4LQG A;  4P4I A;  3SJX A;  5IR2 A;  4TWE A;  3ICU A;  1DE4 C;  3FEC A;  4C99 A;  4C84 A;  4TJV A;  2PVV A;  4NGM A;  3I74 A;  4NGN A;  1V6C A;  4P4E A;  4OC4 A;  4MCS A;  4C9U A;  4JYW A;  4OC2 A;  3BI1 A;  2C5Q A;  4NGR A;  2JBJ A;  1WVM A;  2XEG A;  3BXM A;  4NGP A;  2JBK A;  2C6G A;  5D29 A;  4C8A A;  4MCR A;  3S9L A;  2CIJ A;  3FEE A;  4MCQ A;  4P4D A;  4P4F A;  1XF1 A;  4NGQ A;  2XEI A;  1Z8L A;  4P4J A;  4W9Y A;  1Y9Z A;  5F09 A;  4OC0 A;  3D7G A;  3FED A;  2GP4 A;  4CDJ A;  3I6S A;  2XEJ A;  4C9E A;  3D7F A;  4C85 A;  4C9A A;  3S9N A;  5IB9 A;  4C9V A;  3IWW A;  4NGT A;  4YN3 A;  3K9T A;  5ELY A;  4KNG E;  3BHX A;  4C9R A;  4CDK A;  3SJE A;  3SJG A;  4C8T A;  4C8C A;  3D7H A;  4OC1 A;  3SJF A;  2C6C A;  4C8P A;  4MCP A;  3VTA A;  3EIF A;  4C8U A;  2C6P A;  4OC3 A;  2EK9 A;  4OME A;  2EK8 A;  3D7D A;  4X3R A;  3FF3 A;  3S9M A;  2OOT A;  4C86 A;  4JZ0 A;  2OR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...