4C8PA

Mouse znrf3 ectodomain crystal form v, disulfide-bridged s90c variant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
144
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLCAEGEIVQMHPLGLCLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 38
structure length 144
sequence length 151
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8pA00
4P4DA 4MCRA 3FF3A 2XEIA 1DE4C 2JBKA 1Y9ZA 2XEJA 4C8FA 4C84A 4C9EA 4OC3A 2EK8A 4C85A 3S9MA 2OR4A 4P4EA 4CDJA 3FEDA 5F09A 4C8PA 4P4IA 3BI0A 1XF1A 4C9AA 2JBJA 4C99A 1Z8LA 3BXMA 5D29A 1V6CA 4TJVA 3VTAA 4KNGE 2EK9A 4C8CA 4JZ0A 3BI1A 4P4FA 4C86A 1CX8A 2XEFA 2PVWA 4JYWA 4MCPA 3BHXA 4W9YA 4NGPA 3D7FA 2C6CA 4CDKA 4NGRA 3IWWA 4MCSA 4OC1A 4P4BA 3SJGA 3IIBA 3FEEA 2C6PA 3EIFA 4NGQA 4YN3A 3RBUA 4NGSA 3SJFA 3SJXA 4TJXA 2OOTA 2CIJA 1WVMA 4NGTA 5ELYA 4C9UA 3FECA 3D7DA 4C8TA 4OMEA 3SJEA 4TWEA 3S9LA 4P45A 3KASA 5IB9A 4C9VA 3S9NA 2PVVA 3I74A 3D7GA 3I6SA 4NGMA 2C6GA 4X3RA 4C9RA 3ICUA 4C8UA 4OC4A 4LQGA 4P4JA 4NGNA 4OC0A 3D7HA 2XEGA 4MCQA 4OC2A 4P44A 4C8AA 4OC5A
chains in the Genus database with same CATH superfamily
4P4DA 4MCRA 3FF3A 4CZ1A 3TYXA 2XEIA 4INJA 1DIKA 3T07A 2EZBA 3K4IA 2EZAA 1DE4C 2JBKA 1Y9ZA 2XEJA 3TLBA 4IIXA 4C8FA 4MJXA 4C84A 4C9EA 4OC3A 1R61A 2X0SA 2EK8A 1KEEB 2E28A 2YJTA 2D0OA 2YJVA 3SR3A 1VI4A 4C85A 3S9MA 2OR4A 4P4EA 4CDJA 3FEDA 5F09A 4C8PA 4P4IA 3BI0A 1XF1A 1C30B 4C9AA 2JBJA 2HI6A 4C99A 4COBA 1Z8LA 3BXMA 5D29A 1V6CA 3EZAA 5JVLA 4TJVA 1JDEA 5F5XA 3VTAA 4KNGE 2EK9A 1EZAA 2OLSA 3KRVA 3G23A 1NBWA 3TLGA 4C8CA 4JZ0A 1NXJA 4E94A 3BI1A 1CS0B 3C8OA 2FM4A 4P4FA 1KBLA 4C86A 3U1BA 5K99A 1CX8A 2XEFA 2PVWA 4JYWA 5F1YA 1EZBA 3TLGB 2AUMA 4MCPA 3T5MA 3BHXA 4W9YA 4NGPA 3K9TA 5FD8A 3D7FA 2C6CA 4H1HA 4CDKA 2HROA 3NOJA 4NGRA 2D0PA 3IWWA 4MCSA 2EZCA 2MP0A 4OC1A 3TLEA 2B0AA 4P4BA 5IR2A 3SJGA 3IIBA 3FEEA 3GJZA 2C5QA 2C6PA 3TLZA 3EIFA 3EZBA 3TLAA 1C3OB 4NGQA 4YN3A 3RBUA 3EZEA 4NGSA 3SJFA 3SJXA 1KC7A 1M6VB 1JDBC 4TJXA 4E5SA 1CE8B 1ZYMA 1Q5XA 1A9XB 3T0TA 3TLCA 2OOTA 2CIJA 1WVMA 1VBGA 2GP4A 4NGTA 5ELYA 4C9UA 3FECA 3D7DA 4C8TA 1ZRSA 1VBHA 3T05A 4OMEA 1GGOA 2AUNA 2HWGA 4TWEA 3SJEA 1BXRB 4M8DA 3S9LA 4P45A 3KASA 5IB9A 5JYBA 2R82A 4MI1A 4C9VA 3S9NA 2PVVA 4CO9A 4J0NA 4EYSA 2DIKA 3I74A 3TLYA 3D7GA 3I6SA 4NGMA 2C6GA 4X3RA 5F9MA 3ICUA 4C8UA 4IIYA 4C9RA 1ZL0A 4OC4A 4LQGA 1T36B 4P4JA 4NGNA 1J3LA 4OC0A 4JVOA 3D7HA 2XEGA 4COGA 4MCQA 2PCNA 4OC2A 4P44A 4C8AA 4OC5A
chains in the Genus database with same CATH topology
4P4DA 4MCRA 3FF3A 2XEIA 1DE4C 2JBKA 1Y9ZA 2XEJA 4C8FA 4C84A 4C9EA 4OC3A 2EK8A 4C85A 3S9MA 2OR4A 4P4EA 4CDJA 3FEDA 5F09A 4C8PA 4P4IA 3BI0A 1XF1A 4C9AA 2JBJA 4C99A 1Z8LA 3BXMA 5D29A 1V6CA 4TJVA 3VTAA 4KNGE 2EK9A 4C8CA 4JZ0A 3BI1A 4P4FA 4C86A 1CX8A 2XEFA 2PVWA 4JYWA 4MCPA 3BHXA 4W9YA 4NGPA 3K9TA 3D7FA 2C6CA 4CDKA 4NGRA 3IWWA 4MCSA 4OC1A 4P4BA 5IR2A 3SJGA 3IIBA 3FEEA 2C6PA 2C5QA 3EIFA 4NGQA 4YN3A 3RBUA 4NGSA 3SJFA 3SJXA 4TJXA 2OOTA 2CIJA 1WVMA 2GP4A 4NGTA 5ELYA 4C9UA 3FECA 3D7DA 4C8TA 4OMEA 3SJEA 4TWEA 3S9LA 4P45A 3KASA 5IB9A 4C9VA 3S9NA 2PVVA 3I74A 3D7GA 3I6SA 4NGMA 2C6GA 4X3RA 4C9RA 3ICUA 4C8UA 4OC4A 4LQGA 4P4JA 4NGNA 4OC0A 3D7HA 2XEGA 4MCQA 4OC2A 4P44A 4C8AA 4OC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4D A;  4MCR A;  3FF3 A;  2XEI A;  1DE4 C;  2JBK A;  1Y9Z A;  2XEJ A;  4C8F A;  4C84 A;  4C9E A;  4OC3 A;  2EK8 A;  4C85 A;  3S9M A;  2OR4 A;  4P4E A;  4CDJ A;  3FED A;  5F09 A;  4C8P A;  4P4I A;  3BI0 A;  1XF1 A;  4C9A A;  2JBJ A;  4C99 A;  1Z8L A;  3BXM A;  5D29 A;  1V6C A;  4TJV A;  3VTA A;  4KNG E;  2EK9 A;  4C8C A;  4JZ0 A;  3BI1 A;  4P4F A;  4C86 A;  1CX8 A;  2XEF A;  2PVW A;  4JYW A;  4MCP A;  3BHX A;  4W9Y A;  4NGP A;  3D7F A;  2C6C A;  4CDK A;  4NGR A;  3IWW A;  4MCS A;  4OC1 A;  4P4B A;  3SJG A;  3IIB A;  3FEE A;  2C6P A;  3EIF A;  4NGQ A;  4YN3 A;  3RBU A;  4NGS A;  3SJF A;  3SJX A;  4TJX A;  2OOT A;  2CIJ A;  1WVM A;  4NGT A;  5ELY A;  4C9U A;  3FEC A;  3D7D A;  4C8T A;  4OME A;  3SJE A;  4TWE A;  3S9L A;  4P45 A;  3KAS A;  5IB9 A;  4C9V A;  3S9N A;  2PVV A;  3I74 A;  3D7G A;  3I6S A;  4NGM A;  2C6G A;  4X3R A;  4C9R A;  3ICU A;  4C8U A;  4OC4 A;  4LQG A;  4P4J A;  4NGN A;  4OC0 A;  3D7H A;  2XEG A;  4MCQ A;  4OC2 A;  4P44 A;  4C8A A;  4OC5 A; 
#chains in the Genus database with same CATH topology
 4P4D A;  4MCR A;  3FF3 A;  4CZ1 A;  3TYX A;  2XEI A;  4INJ A;  1DIK A;  3T07 A;  2EZB A;  3K4I A;  2EZA A;  1DE4 C;  2JBK A;  1Y9Z A;  2XEJ A;  3TLB A;  4IIX A;  4C8F A;  4MJX A;  4C84 A;  4C9E A;  4OC3 A;  1R61 A;  2X0S A;  2EK8 A;  1KEE B;  2E28 A;  2YJT A;  2D0O A;  2YJV A;  3SR3 A;  1VI4 A;  4C85 A;  3S9M A;  2OR4 A;  4P4E A;  4CDJ A;  3FED A;  5F09 A;  4C8P A;  4P4I A;  3BI0 A;  1XF1 A;  1C30 B;  4C9A A;  2JBJ A;  2HI6 A;  4C99 A;  4COB A;  1Z8L A;  3BXM A;  5D29 A;  1V6C A;  3EZA A;  5JVL A;  4TJV A;  1JDE A;  5F5X A;  3VTA A;  4KNG E;  2EK9 A;  1EZA A;  2OLS A;  3KRV A;  3G23 A;  1NBW A;  3TLG A;  4C8C A;  4JZ0 A;  1NXJ A;  4E94 A;  3BI1 A;  1CS0 B;  3C8O A;  2FM4 A;  4P4F A;  1KBL A;  4C86 A;  3U1B A;  5K99 A;  1CX8 A;  2XEF A;  2PVW A;  4JYW A;  5F1Y A;  1EZB A;  3TLG B;  2AUM A;  4MCP A;  3T5M A;  3BHX A;  4W9Y A;  4NGP A;  3K9T A;  5FD8 A;  3D7F A;  2C6C A;  4H1H A;  4CDK A;  2HRO A;  3NOJ A;  4NGR A;  2D0P A;  3IWW A;  4MCS A;  2EZC A;  2MP0 A;  4OC1 A;  3TLE A;  2B0A A;  4P4B A;  5IR2 A;  3SJG A;  3IIB A;  3FEE A;  3GJZ A;  2C5Q A;  2C6P A;  3TLZ A;  3EIF A;  3EZB A;  3TLA A;  1C3O B;  4NGQ A;  4YN3 A;  3RBU A;  3EZE A;  4NGS A;  3SJF A;  3SJX A;  1KC7 A;  1M6V B;  1JDB C;  4TJX A;  4E5S A;  1CE8 B;  1ZYM A;  1Q5X A;  1A9X B;  3T0T A;  3TLC A;  2OOT A;  2CIJ A;  1WVM A;  1VBG A;  2GP4 A;  4NGT A;  5ELY A;  4C9U A;  3FEC A;  3D7D A;  4C8T A;  1ZRS A;  1VBH A;  3T05 A;  4OME A;  1GGO A;  2AUN A;  2HWG A;  4TWE A;  3SJE A;  1BXR B;  4M8D A;  3S9L A;  4P45 A;  3KAS A;  5IB9 A;  5JYB A;  2R82 A;  4MI1 A;  4C9V A;  3S9N A;  2PVV A;  4CO9 A;  4J0N A;  4EYS A;  2DIK A;  3I74 A;  3TLY A;  3D7G A;  3I6S A;  4NGM A;  2C6G A;  4X3R A;  5F9M A;  3ICU A;  4C8U A;  4IIY A;  4C9R A;  1ZL0 A;  4OC4 A;  4LQG A;  1T36 B;  4P4J A;  4NGN A;  1J3L A;  4OC0 A;  4JVO A;  3D7H A;  2XEG A;  4COG A;  4MCQ A;  2PCN A;  4OC2 A;  4P44 A;  4C8A A;  4OC5 A; 
#chains in the Genus database with same CATH homology
 4P4D A;  4MCR A;  3FF3 A;  2XEI A;  1DE4 C;  2JBK A;  1Y9Z A;  2XEJ A;  4C8F A;  4C84 A;  4C9E A;  4OC3 A;  2EK8 A;  4C85 A;  3S9M A;  2OR4 A;  4P4E A;  4CDJ A;  3FED A;  5F09 A;  4C8P A;  4P4I A;  3BI0 A;  1XF1 A;  4C9A A;  2JBJ A;  4C99 A;  1Z8L A;  3BXM A;  5D29 A;  1V6C A;  4TJV A;  3VTA A;  4KNG E;  2EK9 A;  4C8C A;  4JZ0 A;  3BI1 A;  4P4F A;  4C86 A;  1CX8 A;  2XEF A;  2PVW A;  4JYW A;  4MCP A;  3BHX A;  4W9Y A;  4NGP A;  3K9T A;  3D7F A;  2C6C A;  4CDK A;  4NGR A;  3IWW A;  4MCS A;  4OC1 A;  4P4B A;  5IR2 A;  3SJG A;  3IIB A;  3FEE A;  2C6P A;  2C5Q A;  3EIF A;  4NGQ A;  4YN3 A;  3RBU A;  4NGS A;  3SJF A;  3SJX A;  4TJX A;  2OOT A;  2CIJ A;  1WVM A;  2GP4 A;  4NGT A;  5ELY A;  4C9U A;  3FEC A;  3D7D A;  4C8T A;  4OME A;  3SJE A;  4TWE A;  3S9L A;  4P45 A;  3KAS A;  5IB9 A;  4C9V A;  3S9N A;  2PVV A;  3I74 A;  3D7G A;  3I6S A;  4NGM A;  2C6G A;  4X3R A;  4C9R A;  3ICU A;  4C8U A;  4OC4 A;  4LQG A;  4P4J A;  4NGN A;  4OC0 A;  3D7H A;  2XEG A;  4MCQ A;  4OC2 A;  4P44 A;  4C8A A;  4OC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...