4C8PA

Mouse znrf3 ectodomain crystal form v, disulfide-bridged s90c variant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
144
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLCAEGEIVQMHPLGLCLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 38
structure length 144
sequence length 151
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8pA00
2C6GA 2CIJA 4JZ0A 3IWWA 4NGTA 4C9EA 2C6CA 4OC0A 4C99A 4MCQA 4CDJA 4OC4A 4MCPA 3S9NA 4NGQA 1CX8A 4CDKA 4C9UA 2OOTA 3IIBA 4P4EA 4C8TA 4C8FA 5D29A 4C8UA 3FEDA 4P45A 2JBKA 4C9VA 5F09A 5ELYA 4P4IA 5IB9A 4P4FA 4LQGA 3BHXA 4C9RA 3BI0A 3SJGA 4MCRA 3BI1A 4NGMA 4YN3A 3ICUA 4OMEA 4OC5A 4P4DA 3FEEA 2OR4A 4C85A 3SJFA 4NGNA 3I6SA 1Y9ZA 3D7DA 1WVMA 4NGPA 3D7HA 3SJEA 4KNGE 3SJXA 2XEIA 4P4BA 2PVVA 4W9YA 3S9MA 1Z8LA 2JBJA 2XEJA 4C86A 2XEGA 4NGRA 4OC1A 3EIFA 4MCSA 4TJXA 3D7FA 4C9AA 2EK8A 4X3RA 4C84A 2PVWA 4OC2A 4P4JA 2EK9A 4P44A 4C8CA 1XF1A 4TJVA 3I74A 4NGSA 3KASA 4C8AA 2XEFA 1DE4C 4JYWA 1V6CA 4TWEA 3D7GA 3RBUA 3BXMA 3S9LA 3FECA 3FF3A 3VTAA 4OC3A 4C8PA 2C6PA
chains in the Genus database with same CATH superfamily
2C6GA 2CIJA 1JDEA 1Q5XA 1CS0B 4JZ0A 3IWWA 5F5XA 4NGTA 2D0PA 4C9EA 2C6CA 3U1BA 3TYXA 4OC0A 1M6VB 2FM4A 4C99A 2OLSA 1JDBC 1CE8B 4MCQA 3TLCA 4CDJA 4INJA 1EZAA 1ZRSA 3K4IA 4JVOA 4MCPA 4OC4A 1KBLA 3S9NA 4NGQA 2D0OA 3TLBA 1CX8A 1NBWA 4CDKA 4E5SA 4M8DA 4C9UA 2OOTA 3IIBA 4P4EA 3SR3A 4C8TA 4C8FA 5D29A 2R82A 4C8UA 4H1HA 1T36B 3FEDA 2HI6A 4IIYA 3C8OA 4P45A 2JBKA 4C9VA 5F09A 3TLEA 5ELYA 4P4IA 3T0TA 5IB9A 2EZBA 4P4FA 1C3OB 4LQGA 3BHXA 1DIKA 4C9RA 3BI0A 3T05A 3SJGA 4MCRA 3TLGA 3BI1A 4NGMA 4IIXA 3EZEA 4YN3A 3ICUA 4MJXA 2B0AA 5FD8A 4OMEA 4CO9A 4OC5A 3T5MA 2E28A 4P4DA 3FEEA 2OR4A 3G23A 3SJFA 4C85A 1VBGA 3TLAA 4NGNA 3I6SA 4COGA 1Y9ZA 3D7DA 2PCNA 3EZAA 3EZBA 1ZL0A 3TLGB 1WVMA 4NGPA 3D7HA 3SJEA 1EZBA 4KNGE 3SJXA 2XEIA 3GJZA 5IR2A 1A9XB 2AUMA 2DIKA 1J3LA 4MI1A 1C30B 1ZYMA 4P4BA 2PVVA 2YJTA 4COBA 4W9YA 2C5QA 3S9MA 1BXRB 1Z8LA 2X0SA 2JBJA 2XEJA 4C86A 2XEGA 4NGRA 1R61A 2HWGA 4OC1A 3EIFA 4MCSA 4TJXA 3KRVA 3D7FA 2HROA 4C9AA 3K9TA 2EK8A 4X3RA 2EZCA 5F9MA 2PVWA 4OC2A 4C84A 4P4JA 2EK9A 4P44A 4C8CA 1XF1A 4CZ1A 1NXJA 4TJVA 3T07A 1KC7A 3I74A 4NGSA 3KASA 1GGOA 4C8AA 3TLZA 5K99A 1VI4A 2XEFA 1DE4C 2AUNA 4JYWA 3TLYA 2YJVA 1V6CA 4TWEA 3D7GA 3RBUA 1VBHA 3BXMA 3S9LA 2MP0A 4E94A 5F1YA 2GP4A 3FECA 1KEEB 2EZAA 4J0NA 3FF3A 4EYSA 3VTAA 3NOJA 4OC3A 4C8PA 5JVLA 2C6PA 5JYBA
chains in the Genus database with same CATH topology
2C6GA 2CIJA 4JZ0A 3IWWA 4NGTA 4C9EA 2C6CA 4OC0A 4C99A 4MCQA 4CDJA 4OC4A 4MCPA 3S9NA 4NGQA 1CX8A 4CDKA 4C9UA 2OOTA 3IIBA 4P4EA 4C8TA 4C8FA 5D29A 4C8UA 3FEDA 4P45A 2JBKA 4C9VA 5F09A 5ELYA 4P4IA 5IB9A 4P4FA 4LQGA 3BHXA 4C9RA 3BI0A 3SJGA 4MCRA 3BI1A 4NGMA 4YN3A 3ICUA 4OMEA 4OC5A 4P4DA 3FEEA 2OR4A 4C85A 3SJFA 4NGNA 3I6SA 1Y9ZA 3D7DA 1WVMA 4NGPA 3D7HA 3SJEA 4KNGE 3SJXA 2XEIA 5IR2A 4P4BA 2PVVA 4W9YA 2C5QA 3S9MA 1Z8LA 2JBJA 2XEJA 4C86A 2XEGA 4NGRA 4OC1A 3EIFA 4MCSA 4TJXA 3D7FA 4C9AA 3K9TA 2EK8A 4X3RA 4C84A 2PVWA 4OC2A 4P4JA 2EK9A 4P44A 4C8CA 1XF1A 4TJVA 3I74A 4NGSA 3KASA 4C8AA 2XEFA 1DE4C 4JYWA 1V6CA 4TWEA 3D7GA 3RBUA 3BXMA 3S9LA 2GP4A 3FECA 3FF3A 3VTAA 4OC3A 4C8PA 2C6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C6G A;  2CIJ A;  4JZ0 A;  3IWW A;  4NGT A;  4C9E A;  2C6C A;  4OC0 A;  4C99 A;  4MCQ A;  4CDJ A;  4OC4 A;  4MCP A;  3S9N A;  4NGQ A;  1CX8 A;  4CDK A;  4C9U A;  2OOT A;  3IIB A;  4P4E A;  4C8T A;  4C8F A;  5D29 A;  4C8U A;  3FED A;  4P45 A;  2JBK A;  4C9V A;  5F09 A;  5ELY A;  4P4I A;  5IB9 A;  4P4F A;  4LQG A;  3BHX A;  4C9R A;  3BI0 A;  3SJG A;  4MCR A;  3BI1 A;  4NGM A;  4YN3 A;  3ICU A;  4OME A;  4OC5 A;  4P4D A;  3FEE A;  2OR4 A;  4C85 A;  3SJF A;  4NGN A;  3I6S A;  1Y9Z A;  3D7D A;  1WVM A;  4NGP A;  3D7H A;  3SJE A;  4KNG E;  3SJX A;  2XEI A;  4P4B A;  2PVV A;  4W9Y A;  3S9M A;  1Z8L A;  2JBJ A;  2XEJ A;  4C86 A;  2XEG A;  4NGR A;  4OC1 A;  3EIF A;  4MCS A;  4TJX A;  3D7F A;  4C9A A;  2EK8 A;  4X3R A;  4C84 A;  2PVW A;  4OC2 A;  4P4J A;  2EK9 A;  4P44 A;  4C8C A;  1XF1 A;  4TJV A;  3I74 A;  4NGS A;  3KAS A;  4C8A A;  2XEF A;  1DE4 C;  4JYW A;  1V6C A;  4TWE A;  3D7G A;  3RBU A;  3BXM A;  3S9L A;  3FEC A;  3FF3 A;  3VTA A;  4OC3 A;  4C8P A;  2C6P A; 
#chains in the Genus database with same CATH topology
 2C6G A;  2CIJ A;  1JDE A;  1Q5X A;  1CS0 B;  4JZ0 A;  3IWW A;  5F5X A;  4NGT A;  2D0P A;  4C9E A;  2C6C A;  3U1B A;  3TYX A;  4OC0 A;  1M6V B;  2FM4 A;  4C99 A;  2OLS A;  1JDB C;  1CE8 B;  4MCQ A;  3TLC A;  4CDJ A;  4INJ A;  1EZA A;  1ZRS A;  3K4I A;  4JVO A;  4MCP A;  4OC4 A;  1KBL A;  3S9N A;  4NGQ A;  2D0O A;  3TLB A;  1CX8 A;  1NBW A;  4CDK A;  4E5S A;  4M8D A;  4C9U A;  2OOT A;  3IIB A;  4P4E A;  3SR3 A;  4C8T A;  4C8F A;  5D29 A;  2R82 A;  4C8U A;  4H1H A;  1T36 B;  3FED A;  2HI6 A;  4IIY A;  3C8O A;  4P45 A;  2JBK A;  4C9V A;  5F09 A;  3TLE A;  5ELY A;  4P4I A;  3T0T A;  5IB9 A;  2EZB A;  4P4F A;  1C3O B;  4LQG A;  3BHX A;  1DIK A;  4C9R A;  3BI0 A;  3T05 A;  3SJG A;  4MCR A;  3TLG A;  3BI1 A;  4NGM A;  4IIX A;  3EZE A;  4YN3 A;  3ICU A;  4MJX A;  2B0A A;  5FD8 A;  4OME A;  4CO9 A;  4OC5 A;  3T5M A;  2E28 A;  4P4D A;  3FEE A;  2OR4 A;  3G23 A;  3SJF A;  4C85 A;  1VBG A;  3TLA A;  4NGN A;  3I6S A;  4COG A;  1Y9Z A;  3D7D A;  2PCN A;  3EZA A;  3EZB A;  1ZL0 A;  3TLG B;  1WVM A;  4NGP A;  3D7H A;  3SJE A;  1EZB A;  4KNG E;  3SJX A;  2XEI A;  3GJZ A;  5IR2 A;  1A9X B;  2AUM A;  2DIK A;  1J3L A;  4MI1 A;  1C30 B;  1ZYM A;  4P4B A;  2PVV A;  2YJT A;  4COB A;  4W9Y A;  2C5Q A;  3S9M A;  1BXR B;  1Z8L A;  2X0S A;  2JBJ A;  2XEJ A;  4C86 A;  2XEG A;  4NGR A;  1R61 A;  2HWG A;  4OC1 A;  3EIF A;  4MCS A;  4TJX A;  3KRV A;  3D7F A;  2HRO A;  4C9A A;  3K9T A;  2EK8 A;  4X3R A;  2EZC A;  5F9M A;  2PVW A;  4OC2 A;  4C84 A;  4P4J A;  2EK9 A;  4P44 A;  4C8C A;  1XF1 A;  4CZ1 A;  1NXJ A;  4TJV A;  3T07 A;  1KC7 A;  3I74 A;  4NGS A;  3KAS A;  1GGO A;  4C8A A;  3TLZ A;  5K99 A;  1VI4 A;  2XEF A;  1DE4 C;  2AUN A;  4JYW A;  3TLY A;  2YJV A;  1V6C A;  4TWE A;  3D7G A;  3RBU A;  1VBH A;  3BXM A;  3S9L A;  2MP0 A;  4E94 A;  5F1Y A;  2GP4 A;  3FEC A;  1KEE B;  2EZA A;  4J0N A;  3FF3 A;  4EYS A;  3VTA A;  3NOJ A;  4OC3 A;  4C8P A;  5JVL A;  2C6P A;  5JYB A; 
#chains in the Genus database with same CATH homology
 2C6G A;  2CIJ A;  4JZ0 A;  3IWW A;  4NGT A;  4C9E A;  2C6C A;  4OC0 A;  4C99 A;  4MCQ A;  4CDJ A;  4OC4 A;  4MCP A;  3S9N A;  4NGQ A;  1CX8 A;  4CDK A;  4C9U A;  2OOT A;  3IIB A;  4P4E A;  4C8T A;  4C8F A;  5D29 A;  4C8U A;  3FED A;  4P45 A;  2JBK A;  4C9V A;  5F09 A;  5ELY A;  4P4I A;  5IB9 A;  4P4F A;  4LQG A;  3BHX A;  4C9R A;  3BI0 A;  3SJG A;  4MCR A;  3BI1 A;  4NGM A;  4YN3 A;  3ICU A;  4OME A;  4OC5 A;  4P4D A;  3FEE A;  2OR4 A;  4C85 A;  3SJF A;  4NGN A;  3I6S A;  1Y9Z A;  3D7D A;  1WVM A;  4NGP A;  3D7H A;  3SJE A;  4KNG E;  3SJX A;  2XEI A;  5IR2 A;  4P4B A;  2PVV A;  4W9Y A;  2C5Q A;  3S9M A;  1Z8L A;  2JBJ A;  2XEJ A;  4C86 A;  2XEG A;  4NGR A;  4OC1 A;  3EIF A;  4MCS A;  4TJX A;  3D7F A;  4C9A A;  3K9T A;  2EK8 A;  4X3R A;  4C84 A;  2PVW A;  4OC2 A;  4P4J A;  2EK9 A;  4P44 A;  4C8C A;  1XF1 A;  4TJV A;  3I74 A;  4NGS A;  3KAS A;  4C8A A;  2XEF A;  1DE4 C;  4JYW A;  1V6C A;  4TWE A;  3D7G A;  3RBU A;  3BXM A;  3S9L A;  2GP4 A;  3FEC A;  3FF3 A;  3VTA A;  4OC3 A;  4C8P A;  2C6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...