4C8QC

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
79
structure length
79
Chain Sequence
METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 13
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qC00
3RESA 3BW1A 4C8QC 1D3BA 3V7SA 1LOJA 1Y96A 4JRIA 4JUVA 1YCYA 2E64A 2EAYA 5GAN3 4HT9A 5GAMh 1M5Q1 3JB9G 3EFRA 5DY9A 5GAN8 5GMKj 5GANe 4XU2A 3HSBA 5GMKh 5GAOn 4JLIA 2EJ9A 2HNIA 1M8VA 1LJOA 4J5YA 3JCMe 4M7AE 4J6YA 2YLBA 4M7DB 3HFNA 2E41A 4F7UG 5GAN4 4NL3A 2E10A 2Y90A 3FB9A 4EMGA 1MGQA 3FIFA 1BIAA 3V8LA 4PJOE 4M75F 5I21A 4XTVA 3BDUA 4RCBA 4MMLA 3JCMX 4XTUA 3INZA 4J6XA 2YLCA 2EJGA 3PGGA 4HT8A 4M77C 3QHSA 3RKWA 4C8QF 4M7AF 2RM4A 1WQ7A 4M78E 4XTWA 1H641 3SB2A 3JB9I 5GAN7 4J6WA 2VC8A 4C92E 1JRIA 2QTXA 5GMKm 2K57A 4PJOF 4M75E 1I81A 2I2LA 1I8FA 3QUIA 3M4GA 2YHTA 1WQWA 4M7DE 4F7UB 3GIBA 2DTIA 5GANf 4M77B 4C8QE 3QO3A 4DQ2A 4A54A 4M7AD 3L2ZA 4F7UA 5GANg 2JN0A 4M78F 4EMHA 4M7AG 2VXFA 3JCMf 4M77A 5GANj 1WPYA 1HK9A 4OP0A 1B34B 3JCMJ 4C92F 3JCMg 4X9DA 4PJOD 5GMKl 1WNLA 5GAOm 1B34A 1N9RA 1U1SA 4QVCA 3BY7A 4M7DF 1U1TA 3V8KA 2RA2A 2RB6A 4XQ3A 4NL2A 3RKXA 5LJ5e 3JB9H 3SWNB 1LNXA 3L1AA 4M78D 3AHUA 4M78G 3JCMb 3RIRA 3SWNA 4XU0A 4XTZA 4XU1A 4C92D 2EJFA 5LJ5g 4C92G 1X01A 4M75D 5LJ3e 4EMKB 4M75G 4QVDA 5GAOl 1HXDA 4M77E 5LJ3f 4M7DD 1JBMA 2EWNA 4EMKA 4M7DG 4XTYA 3EFSA 5LJ3g 5GANd 4C8QD 3JCMP 2VXEA 2FB7A 3SWNC 4C8QG 3JB9F 4M7AA 2DTHA 3JCMc 3RERA 5GAMe 3V7RA 3JCMd 4WF2A 1KQ2A 1I5LA 4N0AA 1N9SA 4XTXA 3RUXA 5GANh 5GAOq 5GAMf 4HA8A 3QSUA 4PJOG 3JB9J 4EMKC 4F7UF 5GMKe 2DTOA 2E1HA 3VU3C 3JCMh 5GAMg 2DJZA 2CGHA 2DVEA 4M77F 4PNOA 3JCMV 5GAMj 2DEQA 4M78B 4M7AC 3JCMW 4NOYA 4A53A 3V8JA 4N0AC 3JB9D 4M78A 3V7CA 4C92B 5LJ5f 4PJOC 1I4K1 2DZ9A 2ZGWA 4M75B 3FJPA 5LJ5d 2RD1A 5CAIA 4C92A 5GMKi 3HFOA 4M75A 2DKGA 4F7UE 5LJ5j 2DZCA 4RCCA 5LJ5h 4M7AB 4C8QB 4M77D 4XU3A 2DXUA 5LJ3d 4Y91A 4M77G 3JCMQ 4M78C 5GAN2 1TH7A 5GAOp 2FYKA 4C8QA 5LJ3j 4MMKA 5GAN5 3BFMA 4C92C 1KQ1A 3RKYA 4PJOB 5LJ3h 2DXTA 4M75C 5GAOr 4M7DA 4V2SA 5GAN6 1BIBA 4PJOA 2E65A 1D3BB 5GAMd 4M7DC 1Y96B 4X9CA 4JRKA
chains in the Genus database with same CATH superfamily
2JMCA 2P0KA 5GAMh 5LL6S 1VYVA 4FW2A 2NUZA 3HSBA 3OYKA 1PG5B 4CI0C 4CC7A 4F7UG 2E10A 3NTHA 1NYGA 1UECA 2EGEA 3CMEQ 1M1KU 4HCZA 5KYWB 3OYHA 2YUNA 4IUUA 2DE0X 2OTJQ 4XTWA 5HK3A 2LQWA 2QQSA 1KHCA 2VC8A 4FYXB 2AT1B 3L2UA 4M75E 2MMPA 1RAIB 4BB7A 2DK3A 3M0UA 3QUIA 2CZ1B 5D6YA 4JRPA 1SSFA 4P5NA 2RJEA 2E6NA 2J05A 1UDLA 1TWBA 1HK9A 1FYNA 3HRUA 1B34A 3OS1A 1UGPB 2FVUA 1D0ZA 3CPWP 2XG8D 1T0HA 4E47A 1VQMT 4A63B 2PQWA 3DLLA 4M77E 2CDTA 5LJ3g 1SRLA 3OB9A 1X2KA 1NEGA 3CC2T 2L89A 2F5KA 2RN8A 5FRNA 2X4YA 1BCOA 2DJZA 1K8AC 1VQ8Q 3CCST 2IIMA 1M9SA 2AZVA 3QKJA 1PCXA 4N4IA 3EGXB 2H3JA 4KGZB 4CC4B 3OYIA 1PWTA 1R8OB 1VQ5Q 5KH6A 3JV3A 3CMAQ 2DFUA 2WSCE 2E5KA 1NJIU 5GAN8 1LOJA 2V8KA 2L3QA 1ZUYA 4A4KA 1XTDA 4R0KA 3EFRA 3EGUA 5GMKj 1YIJT 4JLIA 4BD3A 3CCQA 1M30A 2HZYA 1WYXA 2CT4A 2Y90A 3G4ST 5KYYA 1Q81U 2MOXA 1VQ9Q 3REAB 3NTIA 4GY5A 2CH4A 1VQ4A 4MZPA 2IG0A 5FW9A 4LDUA 1PD1A 3GLXA 2CKKA 4C8QF 4JJCA 1MV3A 3URGA 1WHHA 5GMKm 2EQJA 3HP9A 4J9CA 1A0NB 1G3TA 2K79A 2PZ1A 4E7LA 3ZL7C 2FZKB 2OI3A 1QP2A 4ME7A 3V8KA 3UATA 4ZTJA 4MZMA 4ELZC 2MI6A 5KE2A 4JS4A 1GL5A 1ZSZB 5D6WA 2EBPA 4OB1B 4QVZA 4M7DD 2ED0A 3SDZA 5GANd 2D9TA 2E3IA 4RG8A 2KYBA 3JCMd 4IUPA 3CCJQ 4DA4A 5GAMf 1YCSB 4F14A 2EQMA 2DVEA 1YITA 4J9FA 1B7TA 1VQNT 1TU0B 2O4XA 1AOJA 3QG1A 3FJPA 1S72Q 1VUBA 3FDRA 3HFOA 9ATCB 2DERA 4F7UE 2DD4A 1RADB 2J6FA 4M7DA 5GAN2 1UEBA 4RTVA 1TUDA 3CCMQ 3CPWA 2HSPA 4C5EA 5KCOA 1KQ1A 5GAOr 4RTXA 4M7DC 3E19A 2GNCA 1YIJA 1N8RU 2HL3A 3A1PA 2CSIA 1Y07A 1MMNA 3G4SA 5IT9E 1N5ZA 1WJSA 2JNGA 3QJ6A 1RAAB 2BZYA 4LD9K 2MWOA 1JJ2A 1H3HA 2RMOA 4M75F 5I21A 3BDLA 1ABOA 4OMOA 3EGDB 2LMJA 1VIFA 3C0CA 3PGGA 1I07A 3CCLT 1IGQA 4E7JA 3L2VA 4CC2A 1UE9A 4Z89A 3P8DA 3L2WA 3VS4A 2DTIA 4M7AD 2C0IA 3TSZA 1Y71A 1TS9A 1YHQT 4OMNA 1H3ZA 2QEXT 2KAFA 3VS5A 2LP5A 1RABB 1PNJA 2DIGA 3G1JA 3A8OB 3SEMA 2EYYA 2ABLA 1V76A 2XMFA 5GAOl 1RUWA 1MNDA 1JBMA 3FJ5A 4C8QD 4M7AA 1WI7A 1BYMA 1D0YA 2DPPB 1KQ2A 2EIFA 1F1BB 2C06A 3VYHB 3OA6A 4M7AC 3JCMV 3M53A 2XKOC 4RTZA 5IN1A 4A53A 2E6ZA 3V7CA 1YJWT 1H8KA 3I56Q 3OYFA 1PRLC 2FEIA 3WVEB 2ZZDA 4C8QA 2OX7A 3MHXA 2RHYA 5IXFA 2YRVA 1OQKA 2X4WA 4ZN1A 2A37A 4C8QC 3V7SA 1IZ6A 2EAYA 1CKAA 1K1ZA 2FPFA 5J39A 4J9EA 1PM3A 3NPFA 1M27C 1WZOA 1M8VA 2M9UA 1PC0A 2XDPA 5D6XA 4HCCA 2E41A 1NG2A 1GXIE 4BE0A 4AFQC 1ZSGA 4PJOE 1UGSB 3BDUA 3CCLA 4ATOA 2L3RA 2K4YA 4AG1C 1ABQA 1T3SA 4GLMA 1WJQA 4LUDA 1M3AA 4L5GA 1QLYA 1TUGB 3GP8A 3G6ET 4LUEA 2P4TA 1I8FA 4LXCA 5DLOA 1UJYA 2RI2A 4B6MA 3OBWA 1BKBA 2QQAA 3G71A 1VQ6A 2JTFA 4FU6A 1YI2Q 2RO0A 3EHQA 3I55Q 5DM7R 1KG1A 2SRCA 3TSWA 5LJ5e 3OYMA 3L1AA 3AHUA 2RQVA 2O9SA 2RH2A 2PUKB 4M75D 3AT1B 3CCRT 2YWWA 3Q1JA 1FMKA 1WLPB 2YT6A 3A8HB 3JCMc 1NLPC 3SHWA 1TG0A 2OTLT 4F7UF 3M0RA 4M4ZA 2NUTA 1VIEA 3VKIA 2JXBA 2V1RA 5D7UA 2P0QA 2R58A 1ACMB 2ROLA 5LJ5f 2CP2A 2CP0A 4KULA 4FIBA 3VS2A 5CAIA 4FL6A 3UA7A 1GCQA 4M75A 2ENMA 3PVQA 2XICA 2XU8A 2RQRA 4M77D 5LJ3d 1WDXA 1MMAA 5IAYA 2GTJA 3RKYA 1ZX6A 4M75C 2EQUA 2OJ2A 2FPEA 3RESA 3C4SA 1YCYA 4A4GA 4E2FB 4Y92A 5CQYA 1OI1A 3SD4A 2F5TX 2XDDA 3META 5GMKh 1JXOA 2W0ZA 3CC4T 4B9WA 1UTIA 4DBFA 2KI7A 2M1HA 3J7AF 1YJ9T 3O5ZA 4FCYA 4KUDK 3G6EA 4M77C 3RKWA 2OAWA 4ANJA 1VA7A 2NLUA 1QCOA 3JB9I 2RHXA 4J6WA 4ZGJB 1JRIA 1C0MA 4L6V5 2I2LA 3QJYA 1Y57A 3CCVT 3OMGA 1J3TA 5CKBA 3CEYA 1K9AA 4KT0E 1AHJB 4A54A 1VQKQ 1Q7YU 2EKOA 1B34B 1VQOA 3C95A 2HQHA 4IUTA 2DAQA 3LLRA 1QWEA 3L2QA 5J3BA 2RB6A 2K9GA 3CCRA 2O9VA 4XU1A 5LJ5g 1E6HA 3LWIA 1BU1A 4ESRA 4XTYA 2OTLA 4B9XA 2VXEA 2FB7A 2HSEB 1UHFA 1X6OA 1NLOC 2BZXA 2D6FA 1DJ7B 2K5LA 3CC7Q 3EH2A 3PE0A 1QW1A 2JUFA 1D1CA 1SSHA 3P8BB 2LTOA 1W2BS 2YUQA 4EPCA 3VJPA 1B07A 2CZ0B 5HKCA 1OV3A 1WXBA 1ZUUA 1KC8U 2K3BA 3CXCP 4E7KA 3EFOA 2BZ8A 1VQPQ 1Y0MA 1LPLA 2DXBA 1MNEA 2NWMA 1G3SA 3QYGB 2BTTA 1Y96A 2RHUA 5DLQE 4JRQA 8AT1B 4RTYA 1U5SA 2H3EB 2JTMA 1QCFA 1MMGA 1LJOA 4J5YA 5KYYB 2XIDA 2A36A 4ZNXA 4ELYC 1P92A 5GAN4 4IKFA 3CMET 5FU6C 4F16A 3QZ9B 3C12A 5FRMA 3EG1A 2L0AA 5A0DA 2OTJT 2LCSA 3PIOA 2DBKA 1SG5A 1QKWA 1UHCA 2O31A 3QDRB 2EJGA 4PJNA 1M90U 3CPFA 1RI9A 1YN8A 3TQ7P 3RMQA 5KE3A 2V26A 3HTRA 1ZA1B 4HVVA 4N4HA 4QQDA 3GNGA 1M8MA 4F7UA 3S3MA 3OYCA 2EYQA 4OP0A 3WVDB 3JSCA 2EFIA 1M90R 4JZ3A 4M7DF 1VQLT 4ORZA 3HHTB 3RKXA 2NUPB 2COWA 4C92G 2FL7A 4MZTA 3MP1A 1H92A 3EFSA 3J80E 1D1BA 1VQ7Q 1M1KR 4MDWA 1OPLA 1OYXA 5GAOq 2ZPBB 1ZBXA 3JB9J 2XHCA 1WHGA 2DF6A 2O4XB 5I2MA 2KK4A 3VUZA 3I9QA 2PVDB 2WACA 1NPPA 1VYTA 1HD3A 2VV5A 3HPWA 3OYLA 4BUGA 5GMKi 2L3PA 1VQ5T 5IHIA 5KYUA 1OOTA 4Y91A 3R6NA 3CMAT 2XDBA 4MDXA 4O6JA 1MV0B 5LJ3j 4J9IA 2MAMA 3CCQQ 4FSXA 4AMCA 3OS5A 1X6BA 1M1KC 2KE9A 2QDYB 1JJ2P 2RNAA 1RLQC 5I2SA 1VQ4Q 3CMEA 2LT1A 4C0ZA 3NMZC 2VYTA 2PVGB 2EJ9A 1VQ9T 2HQXA 2OTJA 1GFDA 4KBMB 4ZGEB 3LX7A 1V29B 2MYSA 2RJCA 2WSFE 5FWCA 2VVKA 4JS5A 4QW2A 4HT8A 4M7AF 1BB9A 1WQ7A 3LH0A 3E9GA 4RTUA 3CXCA 3IQLA 2HEQA 2KRMA 5CR2A 3GIBA 1LVKA 3H0FA 2C0OA 1WHLA 2JOYA 2DL7A 1VQLA 1D1AA 2FPDA 2ESWA 3O8VA 4PJOD 1TOVA 4OF1A 1NJIR 2ZPGB 2WSEE 1PRMC 2DILA 3UA6A 4M78G 1OZ2A 2EW3A 2EJFA 4C0GA 4A4EA 2KY9A 3MEVA 3EHRA 2CYZB 1FMVA 2CP5A 2KT8A 3FLGA 4QQ6A 1YITQ 2JT4A 1Q81R 3CD6T 3GNFB 3JCMP 3TVTA 3ME9A 1QVFS 2X51A 4R56A 5GAMe 3CCET 2DMOA 1N9SA 4XTXA 5GANh 3LGLA 1QKXA 4PJOG 3RR6A 2K6DA 3JCMh 2K3YA 2DXCA 1S72T 1VQMA 1VQ5A 3I5SA 4D8KA 1NJIC 1M1GA 1K73U 4PJOC 2HKNA 4IUVA 5GJWB 2JM8A 3CCMT 4C8QB 5FROA 3CC2A 1TH7A 2KVQG 3QZ5B 4ZN3A 2LQNA 1Q86U 2JW4A 1AWOA 3CCSA 1Q81C 2VB6A 5KYWA 4JRKA 1K76A 1K73R 3TU4K 4TVRA 1BI2A 1VQ9A 4A4FA 1Q82U 4LDVA 2XD0A 4E7ZA 3MJXA 3MEWA 3EAEA 2E70A 2X3XD 4A4HA 4J6YA 1EX4A 3HFNA 3NFCA 1TSFA 4J9GA 2P84A 1GCPA 1MGQA 4E6RA 1XJWB 2HMAA 3DB3A 2DBMA 3QYHB 1X75C 2QDLA 3INZA 4C0DC 2DL8A 1Q82R 5EG2A 5M9OA 2DEUA 2K2VA 4C92E 4AG2C 2A08A 3KBGA 5IHNA 2D1XA 2QA4T 4LDWA 1OU8A 4II1A 2KDSA 3CQTA 1NBEB 2MF2A 4EMHA 2MCNA 3H41A 4EDUA 3QPHA 5J26A 5GMKl 4E7HA 1U1SA 3BY7A 1N8RR 2RHZA 2GQIA 4XQ3A 4JJNK 2DD5A 2DNUA 2DIQA 3RIRA 3CD6A 4XU0A 4RTWA 1X69A 4F04B 3CCEA 3VV0A 2ROTA 1N6AA 2LJ0A 1K9MU 3WXMB 3EG2A 1IXDA 3OSVA 1S72A 2PUOB 2QXFA 5CO7A 1PHTA 5GAMg 4M77F 5GAMj 3I56T 1RAHB 4NS5A 1GBRA 1WXTA 4M75B 5LJ5d 1N8RC 2XK0A 4PLLA 1JEGA 1U3OA 2M16A 3PNWC 2MK5A 3OS0A 2F69A 1S1NA 1YJNQ 2KXDA 5EC7A 3BFMA 5FU7C 3QXEB 1VQNA 1RAEB 3BW1A 5I22A 1M5Q1 3R6OA 3HRTA 5GANe 3PVLA 2C0TA 5AT1B 4F17A 1KQSS 3JCMe 1RAFB 1CKBA 3GPLA 2LCCA 4PL6A 1OX8A 2J6OA 4KH0B 1G8XA 2YDLA 5CKEA 1TTHB 2KT1A 1EZZB 2QQBA 4XTUA 3LW5E 5HY6A 3G71Q 1ARKA 2QA4A 4M78E 1VQ6Q 4RKUE 1ZUKA 4J8OA 4OMMA 4BE1A 2CZ6B 5GANf 1YI2T 2KEAA 2E3HA 3L42A 3PFSA 3JCMf 3I55T 1ZSZC 2X4XA 2RJFA 4Z02A 1OULA 2L5QA 1QVFP 1SEMA 1R77A 4LD6A 2LQKA 1WHMA 1Y7XA 3EG9A 1X01A 4YTLA 4FSSA 2KRNA 1YHQA 1IREB 3OYYA 6AT1B 4DBHA 1PKSA 4PFPA 2QEXA 1QVPA 3RERA 2DLPA 2HAXA 1I5LA 3I56A 3H6ZA 1QCNA 2F2VA 1WA7A 1RI0A 3OW2S 5CKDA 3E9FA 1I4K1 1TXQA 2GF7A 2D0NA 4C5GA 3ASKA 4XU3A 2YRCA 3EFOB 1WX6A 2FYKA 1HYOA 3HL8A 3VRYA 5LJ3h 2DXTA 2CH4W 3NHNA 4V2SA 3M54A 1IRXA 1C6VX 1BIBA 2K5IA 3ZFJA 1Y96B 4JLGA 4D8DA 1YJWA 2YRDA 3CBOA 3M56A 1QQJA 3CCUQ 4OB2B 1X27A 2LQ8A 1E6GA 2V8IA 4XU2A 3MO8A 3MP8A 2JTEA 2HNIA 4HKEA 3OY9A 3G6EQ 4LDXA 1WFWA 4NL3A 2ED1A 4XK8E 3FB9A 1M4ZA 1G3WA 2QI2A 3FIFA 1EFNA 4C5HA 1SKUB 2JMAA 3E1SA 2XI9A 4FYVB 2M0YA 1M2VA 4JJBA 2DJQA 2IVWA 2KBTA 1YWOA 1MMDA 1AVZC 1N27A 1SRMA 1YI2A 1VQOQ 3A8GB 2K57A 2E5QA 2QGGA 1I81A 1WHKA 5L8RE 3I55A 3OQ5A 1VQKT 4F7UB 2VASA 3CCRQ 4DQ2A 2X3WD 3M9QA 4M77A 4KUIA 2Y4YA 3PIPA 1QMCA 2EYZA 4PK4A 4D6WA 4QT7A 1ZBJA 2CZ7B 3VS7A 2KMTA 5HCKA 3SWNA 4FYWB 2P0PA 2GBQA 3KXTA 4GLKA 1OPKA 3OYGA 1Q95G 1X43A 2EWNA 4EMKA 4Y28E 3VS1A 3MEAA 2QAZA 3SWNC 3VS0A 2LJ1A 1GFCA 4J9BA 2MWPA 4J7FA 3CC7T 1I1JA 2A7YA 4KGXB 1M2OA 4EMKC 1JU5C 2QQRA 3EG3A 3BE3A 4PNOA 5FWBA 1WHJA 2DEQA 5A0LA 1BCMA 3V8JA 2DL5A 2K2MA 4JZ4A 4BY6C 1GRIA 5A0GA 5KYUB 2CP3A 5LJ5j 2DZCA 1QVFA 1Q7YR 1AWWA 2DXUA 8ATCB 1VQPT 4N4GA 3RNJA 3VS6A 3ZEHA 2YUOA 1KQSP 2CT3A 4Z88A 4X9CA 3OSSC 3J81E 2VGMA 4BDYA 1UB4A 2KXCA 1X6GA 1KD1U 2EQKA 2QQ9A 2K5FA 4DOVA 1BIAA 2COYA 1ZQ1A 4BE2A 2G6FX 1UG1A 1T0JA 1Q7YC 1OZ3A 2GCXA 3PMIA 3PT9A 2P4RA 2YLCA 2LDMA 3SB2A 1VQKA 1ZHIA 3EG0A 2KRSA 3H9NA 4OVAA 2YXYA 4PJOF 3CC4A 1XNIA 4LNPA 3S6WA 2CS7A 1KC8R 3QO3A 3L2ZA 1YWPA 1YJ9A 5AYFA 5HK0A 1KK7A 2F1LA 4HCKA 1FXXA 4BI4A 3CCVA 1QVGS 4C92D 3REBB 4O5VA 2EVRA 2B8AA 1VQ7T 4R55A 5LJ3f 3OYNA 3CC7A 5KYNA 2RI5A 1M3BA 3QDFA 2D8HA 2LX9A 3CBMA 1KC8C 2L2PA 4OB3B 4HVUA 1WGSA 5GMKe 3F70A 3OYJA 3LYIA 3UWNA 3PTAA 4WTOB 2LRQA 3JB9D 2HL5C 3RDVA 1GBQA 1I5OB 1VQPA 2F2WA 4C92A 4AFUC 1FX7A 1BI0A 3CCQT 5IHKA 4C92C 5A2QE 1K8AU 1VQ8T 1RL2A 2E65A 5GAMd 2BIVA 3ER0A 1UFFA 2CUBA 1VQ4T 1U06A 4JRIA 2M51A 4JUVA 2VWFA 3E2UA 2CP6A 3SFMA 2LZ6B 3NGPA 3JB9G 1M90C 1Z9ZA 4QKUA 1UGVA 4L59A 2ECZA 2L8DA 4M7DB 4C0DB 5KYXA 3KUFA 1XOVA 3M57A 3THKA 1NZ9A 2V8JA 1K8AR 4RMOA 1QP3A 1G3YA 4RCBA 4X34A 3JCMX 2AIRB 1RAGB 5IXBA 1SPKA 3QHSA 4JDSA 1T3LA 2RF0A 1VQLQ 3OYDA 2QYZA 2DA9A 1KQSA 2G3RA 2RQWA 3H0IA 2YHTA 2GGRA 2RQUA 3X24B 3M55A 3LH5A 4DEYA 1WNLA 3UDCA 2RQTA 2RJDA 2ATCB 1VQ7A 4M78D 1AEYA 2DVJA 3JCMb 2RHIA 5FLXE 1YITT 1KFZA 3L2RA 2IPOB 3MKDA 2CSQA 1VQMQ 2H8HA 1RLPC 2HKQB 2KGTA 2LC4A 2QG9B 2ZPEB 4N0AA 2FG0A 1UUEA 3QSUA 1B3QA 3S3OA 5I11A 1XQHA 2M0OA 3RMSA 2DTOA 4LDYA 3CC2Q 4RTTA 1JXMA 2EKHA 3M4YA 4BI3A 1G5VA 4OGEA 2OAUA 4N0AC 3M58A 4M78A 5FU7B 2X4JA 1NEBA 2DZ9A 3GF5A 4C5IA 3CCSQ 3X20B 4FT2A 4PJMA 1YBYA 1K0XA 1JB0E 3OYBA 3M0SA 4M7AB 4JJDA 1LCKA 4OB0B 1VQ8A 4M78C 3CCJT 2I0NA 2R5AA 5GAN5 1W2BP 2JM9A 1UGQB 2KROA 2MIOA 3OW2A 2CUDA 4LE9A 4PJOA 1JO8A 2V1QA 1D3BA 2HBWA 3OYAA 2QASA 3OS2A 2K7AA 1ZA2B 3I5RA 1OU9A 3CMAA 3JAME 3P8HA 4BI8B 1AWJA 1YIJQ 4EMGA 3V8LA 3X26B 4OMQA 1OX9A 4MMLA 2K3XA 3G4SQ 2JS2A 2YSQA 2NYSA 2B86A 5GAN7 3FC3A 2NUPA 2RK1A 4KRTA 3UF4A 3MPUB 3UPUA 1IHWA 3G7ZA 1QVGP 4PLIA 1C1AA 1Q86R 3CD6Q 1AT1B 1W6XA 2PNIA 2O2OA 4E7SA 2A0FB 3HRSA 5GAOm 4QVCA 3CCEQ 1Z9QA 1QWFA 3EG9B 1VYUA 3KFVA 4XAXB 2DRMA 4XTZA 1NM7A 3FRNA 4QVDA 1K73C 1HXDA 2FO0A 4M7DG 1K4US 3OMCA 1NPRA 2RI3A 3HKSA 3M5AA 1SF9A 3D7SB 2LNHB 5GJVB 2M02A 5C0MA 1Q86C 3M0TA 5CIUA 2CGHA 5CKFA 2EYXA 2QTVA 2R57A 1E7OA 2LVMA 3QIIA 2ZPIB 1VQNQ 4IURA 3CCJA 4RUGA 2AZSA 5C6SA 1Q82C 2DKGA 1YJNT 3EGXA 4OMLA 3QWXX 2MPXC 2JZ2A 5LJ5h 1X2QA 3H8ZA 3JCMQ 2JVVA 3OYEA 2HBPA 2X9HA 3M0QA 3A5ZB 2KR3A 2PU9B 2COZA 2NUTB 3VRZA 1R0CB 1O75A 2DM1A 3UT1A 3CCMA 1I0CA 1YP5A 3TCJA 3RBBB 2LX7A 2YLBA 2QA4Q 1K9MR 2J06A 4PJJA 4UC4A 2D0QB 1AZGB 2KSSA 1M2VB 2AHJB 2O01E 2GQVA 3G71T 1VQ6T 4J9HA 4J6XA 1SHFA 1SHGA 2RM4A 2L3SA 2RK2A 3MEUA 2DYIA 4E7IA 1YNZA 1W2BA 1R0BG 3CCLQ 3H0HA 1IGUA 4BACA 1WQWA 2JJ9A 1TUCA 2GFUA 4M77B 4M7AG 3T9NA 2HQEA 3VS3A 3JCMJ 1K9MC 1WIEA 1YHQQ 5IH2A 2DO3A 2CREA 2D8JA 2QEXQ 2FRYA 3SWNB 1LNXA 2SEMA 2VUBA 1FWZA 4VUBA 4CC3A 4EMKB 1HJDA 3X25B 1ZSZA 1KHIA 1OEBA 2EGAA 1PD0A 4J83A 4C8QG 2DTHA 2BUDA 4PFZA 4WF2A 4BY6B 2ZPHB 4HA8A 4HXJA 2F2XA 4OGCA 1QVGA 4J9DA 4NOYA 1YJNA 1KJWA 1W4SA 2ZGWA 1PKTA 1CSKA 2RD1A 3ULRB 3C94A 3CXCS 5KCHA 2HDAA 4HCBA 1YJWQ 2A28A 4JPBW 1WXUA 4RCCA 3ZBDA 3CBPA 5GAOp 2ZCFB 3NTKA 1G83A 2DL3A 2Y4XA 3MP6A 2PTKA 5ECAA 5GAN6 3CCUT 1MUZA 2DX1A 4AFSC 2E64A 5GAN3 4AFZC 4EIKA 5CQXA 5DY9A 3U23A 4K11A 1JQQA 1FMWA 2W10A 2EPDA 1K0SA 1M1FA 1UJ0A 2CP7A 3S3NA 2FRWA 1AD5A 2QGFB 1VQOT 1PSEA 3EGDA 1H641 5FU6B 3X28B 2QTXA 3GBQA 3M59A 1UGRB 1VOMA 1D0XA 1HSQA 3M4GA 4M7DE 5GANg 1AZEA 4PJLA 2VXFA 3N5BB 2ZPFB 5GANj 1WPYA 4C92F 3JCMg 1YFNA 4IIOA 4X9DA 2BE9B 4X1VA 3EH1A 1U1TA 4NL2A 4WCIA 1W70A 4AT1B 2HD0A 3OBYA 4Q5WA 5CK9A 4M75G 1D09B 2A3LA 2FZCB 4FT4A 1W1FA 3GOXA 3JB9F 2FHDA 2O88A 1IHVA 1M3CA 1GCQC 1ZLMA 3RUXA 4J7IA 2E12A 2GFAA 3CPWS 2LCLA 2JS0A 2VGNA 3PMTA 4FYYB 3VYGA 2OTLQ 4DBQA 2LJ3A 4C92B 2RPNA 2DL4A 1AWXA 1EIFA 5CCAA 2VKNA 2DETA 3DKMA 2BKDN 4DOWA 4M77G 1BI3A 3CCUA 3TEEA 3DLMA 1BI1A 2X35A 1JJ2S 4QQGA 2AKLA 2LNVA 3JB9H 4CRIA 4HT9A 2AK5A 3A8LB 2AKKA 5GAOn 5KYXB 2BE7D 1G2BA 1BBZA 3TREA 1BK2A 4M7AE 2KQWA 1KIKA 2QK0A 3CC4Q 4XTVA 3M0PA 4GBQA 4KGVB 2DRKA 4Z8AA 3JRZA 1YJ9Q 2GTOA 3I35A 1WJRA 3A8MB 5CVIA 4FM4B 4HVWA 4C8QE 3DB4A 2JN0A 4M78F 3CCVQ 3A98A 4C0FA 2ZAEA 5L23A 4FW1A 2J6KA 2KNBB 4ZTFA 1N9RA 3QWYA 2RA2A 1KD1R 4BDZA 2YUPA 7AT1B 1IO6A 1IB8A 1O9SA 1V1CA 5LJ3e 5CKHA 2Z0WA 2HCKA 2J7IA 1NE8A 4DBRA 2DYBA 2LT4A 3V7RA 4PFOA 1U8RA 4DEXA 2E1HA 3VU3C 2EQIA 4M78B 4RG2A 4ZGDB 4PKCC 3FEOA 2EGCA 3JCMW 3QBYA 4OMPA 3LWHA 1RACB 4IIMA 3LGFA 3OW2P 4KH1B 1KD1C 3VUBA 2E4HA 2PVOB 1NYFA 2R5MA 3MCAB 2EYWA 1KSWA 4MMKA 2KYMA 4PJOB 4LN2A 1MHNA 1PSFA 1D3BB 4IUQA 2FZGB 4OMFB
chains in the Genus database with same CATH topology
3RESA 3BW1A 3C4SA 1D3BA 3OYAA 2P0KA 1YCYA 4A4GA 3OS2A 5GAMh 5CQYA 3SD4A 1OI1A 1M5Q1 5LL6S 2F5TX 3R6OA 3HRTA 2XDDA 3META 5GANe 3CMAA 3HSBA 5GMKh 3JAME 3OYKA 1KQSS 4CI0C 3JCMe 3P8HA 3CC4T 4BI8B 3GPLA 2LCCA 4B9WA 4F7UG 2E10A 4PL6A 4EMGA 3NTHA 3V8LA 5CKEA 3X26B 2QQBA 4MMLA 2M1HA 2K3XA 1M1KU 4HCZA 1YJ9T 4XTUA 3J7AF 3LW5E 3OYHA 4IUUA 4KUDK 5HY6A 3G6EA 4M77C 3RKWA 4XTWA 2QA4A 4M78E 2NLUA 5HK3A 3JB9I 5GAN7 2RHXA 4J6WA 4ZGJB 2QQSA 3FC3A 1KHCA 2VC8A 1JRIA 4RKUE 2RK1A 3L2UA 4M75E 1KC8C 2MMPA 4L6V5 2DK3A 2I2LA 4BB7A 3QJYA 3QUIA 4J8OA 3CCVT 4BE1A 3OMGA 2CZ1B 2CZ6B 3CEYA 4KT0E 5CKBA 5D6YA 4JRPA 5GANf 3UPUA 1YI2T 1AHJB 3G7ZA 4A54A 4PLIA 1SSFA 3L42A 3PFSA 4P5NA 2RJEA 1Q7YU 3JCMf 2E6NA 3I55T 1HK9A 2EKOA 1B34B 3HRUA 1VQOA 3HRSA 5GAOm 3C95A 2X4XA 2RJFA 1B34A 4IUTA 2DAQA 4Z02A 4QVCA 2L5QA 3OS1A 1UGPB 2FVUA 3LLRA 3L2QA 5J3BA 2RB6A 3CCRA 4LD6A 2XG8D 4XAXB 2LQKA 4XTZA 1Y7XA 4XU1A 5LJ5g 4E47A 1X01A 4YTLA 1VQMT 3LWIA 3FRNA 4QVDA 1K73C 2PQWA 1HXDA 4M77E 3DLLA 1IREB 1YHQA 3OYYA 4M7DG 4XTYA 3OMCA 5LJ3g 2OTLA 3OB9A 1NPRA 2VXEA 2FB7A 4B9XA 2QEXA 1QVPA 3RERA 2RI3A 3HKSA 3M5AA 1X6OA 2HAXA 1I5LA 3I56A 3CC2T 3H6ZA 2L89A 2D6FA 5C0MA 2F5KA 1Q86C 5FRNA 1DJ7B 2K5LA 1RI0A 2X4YA 2DJZA 2CGHA 5CIUA 5CKFA 1K8AC 3OW2S 5CKDA 3CCST 2R57A 3E9FA 2LVMA 1M9SA 3QIIA 3QKJA 1QW1A 1I4K1 2JUFA 2ZPIB 4N4IA 4IURA 3CCJA 3P8BB 2H3JA 2GF7A 5C6SA 2LTOA 1W2BS 4C5GA 1Q82C 2DKGA 4EPCA 1YJNT 3VJPA 3OYIA 5LJ5h 2JZ2A 2CZ0B 1R8OB 3ASKA 4XU3A 5HKCA 3H8ZA 3JCMQ 2JVVA 1KC8U 2FYKA 3OYEA 2HBPA 5KH6A 4E7KA 3A5ZB 3HL8A 2PU9B 2DXTA 5LJ3h 4V2SA 3M54A 1BIBA 2DXBA 2K5IA 2WSCE 3ZFJA 1Y96B 4JLGA 1NJIU 1O75A 1YJWA 1G3SA 3QYGB 3UT1A 5GAN8 1LOJA 1Y96A 2V8KA 3CBOA 3M56A 2RHUA 3CCMA 5DLQE 4OB2B 4A4KA 4JRQA 1XTDA 2LQ8A 3EFRA 5GMKj 2V8IA 4XU2A 3MO8A 3MP8A 3TCJA 1YIJT 2JTMA 2HNIA 4HKEA 4JLIA 4BD3A 3OY9A 3CCQA 1LJOA 4J5YA 4LDXA 2XIDA 2YLBA 4ELYC 1P92A 5GAN4 4NL3A 4IKFA 4XK8E 4UC4A 2Y90A 3FB9A 5FU6C 1M4ZA 3G4ST 3CMET 1Q81U 1G3WA 2QI2A 3FIFA 3QZ9B 2D0QB 3C12A 3NTIA 2KSSA 4GY5A 5FRMA 2AHJB 2O01E 5A0DA 2OTJT 2GQVA 4C5HA 3PIOA 3G71T 3E1SA 4MZPA 2XI9A 1VQ4A 1VQ6T 2IG0A 3QDRB 4LDUA 4J6XA 2IVWA 3GLXA 2EJGA 2CKKA 4C8QF 2RM4A 1N27A 1M90U 3CPFA 3URGA 2RK2A 3MEUA 5GMKm 4E7IA 1YI2A 3A8GB 2EQJA 2K57A 3HP9A 2E5QA 1W2BA 1I81A 5L8RE 3RMQA 5KE3A 3I55A 3OQ5A 1VQKT 1G3TA 1WQWA 4N4HA 4QQDA 4F7UB 4BACA 3GNGA 2GFUA 4M77B 4DQ2A 4E7LA 4F7UA 3S3MA 4M7AG 3M9QA 3OYCA 4M77A 2EYQA 2HQEA 4KUIA 2Y4YA 4OP0A 3T9NA 3JSCA 3WVDB 3PIPA 3JCMJ 2EFIA 1K9MC 1QP2A 4D6WA 4ME7A 2CZ7B 4M7DF 3V8KA 1VQLT 2DO3A 3HHTB 2KMTA 3RKXA 4ZTJA 4MZMA 3SWNB 1LNXA 4ELZC 2MI6A 2VUBA 3SWNA 5KE2A 4JS4A 4C92G 1FWZA 4VUBA 5D6WA 4EMKB 4OB1B 2FL7A 4MZTA 4QVZA 2P0PA 3KXTA 4GLKA 3X25B 3OYGA 4M7DD 2EWNA 1KHIA 3MP1A 4Y28E 4EMKA 3EFSA 3J80E 3SDZA 3MEAA 5GANd 2D9TA 4RG8A 3SWNC 4J83A 4C8QG 2DTHA 2BUDA 4MDWA 3JCMd 4IUPA 4WF2A 4BY6B 1OYXA 2MWPA 4J7FA 5GAOq 3CC7T 2ZPHB 2ZPBB 5GAMf 1ZBXA 4HA8A 2A7YA 4DA4A 3JB9J 4EMKC 2XHCA 2O4XB 2QQRA 4OGCA 5I2MA 2EQMA 2KK4A 3VUZA 4PNOA 2DVEA 1YITA 1QVGA 2PVDB 2DEQA 2WACA 5A0LA 1VQNT 2O4XA 4NOYA 1NPPA 1YJNA 3V8JA 1W4SA 3QG1A 2VV5A 2ZGWA 3FJPA 3HPWA 4BY6C 1VUBA 5A0GA 2RD1A 3OYLA 3C94A 4BUGA 5GMKi 3FDRA 5KCHA 3CXCS 3HFOA 1VQ5T 4HCBA 5LJ5j 4F7UE 2DZCA 1QVFA 4RCCA 3ZBDA 2DD4A 3CBPA 4Y91A 2DXUA 2ZCFB 5GAN2 1UEBA 3NTKA 5GAOp 4N4GA 1VQPT 3CPWA 3CMAT 2XDBA 4MDXA 4O6JA 2Y4XA 3MP6A 4C5EA 5LJ3j 3ZEHA 5KCOA 1KQ1A 2MAMA 5GAOr 4FSXA 5GAN6 3OS5A 3CCUT 4M7DC 4X9CA 3OSSC 3E19A 3J81E 2VGMA 1M1KC 4BDYA 1YIJA 1UB4A 1N8RU 2E64A 2QDYB 5GAN3 1KD1U 1Y07A 2EQKA 5CQXA 5I2SA 5DY9A 3CMEA 2LT1A 3G4SA 4C0ZA 5IT9E 2VYTA 1WJSA 2JNGA 2EJ9A 2PVGB 3QJ6A 2QQ9A 2K5FA 1VQ9T 2HQXA 2OTJA 4KBMB 4ZGEB 2MWOA 4LD9K 1JJ2A 3LX7A 1V29B 4DOVA 1BIAA 4BE2A 1ZQ1A 1M1FA 2RJCA 2WSFE 4M75F 5I21A 3S3NA 3BDLA 1Q7YC 1OZ3A 2GCXA 3PMIA 3PT9A 1VIFA 4JS5A 4QW2A 2YLCA 3PGGA 4HT8A 2LDMA 1VQOT 1PSEA 4M7AF 3SB2A 1WQ7A 1H641 3CCLT 1VQKA 1ZHIA 3LH0A 5FU6B 3X28B 4E7JA 3L2VA 3E9GA 3CXCA 4OVAA 2QTXA 3M59A 4PJOF 3CC4A 1UGRB 3P8DA 1XNIA 3M4GA 4M7DE 3L2WA 3S6WA 5CR2A 3GIBA 2DTIA 2CS7A 3QO3A 4M7AD 3L2ZA 5GANg 1YJ9A 2VXFA 1Y71A 2ZPFB 3N5BB 5AYFA 2JOYA 5HK0A 1WPYA 5GANj 1YHQT 1VQLA 4C92F 3JCMg 3O8VA 4X9DA 4PJOD 4OF1A 2QEXT 1H3ZA 2KAFA 1FXXA 2ZPGB 1U1TA 4BI4A 2WSEE 4NL2A 2DIGA 3CCVA 4M78G 3A8OB 2HD0A 1OZ2A 1QVGS 4C92D 3OBYA 2EJFA 4C0GA 4O5VA 4Q5WA 4A4EA 2KY9A 5CK9A 2B8AA 3MEVA 4M75G 5GAOl 2A3LA 4R55A 2CYZB 4QQ6A 1VQ7T 3FLGA 5LJ3f 3OYNA 1JBMA 3CC7A 3CD6T 4FT4A 2RI5A 3GNFB 3GOXA 4C8QD 3JCMP 4M7AA 3JB9F 3ME9A 2FHDA 1QVFS 1BYMA 4R56A 2DPPB 5GAMe 3CCET 1KQ2A 2EIFA 2LX9A 1N9SA 3CBMA 2E12A 4J7IA 2GFAA 3LGLA 4XTXA 3RUXA 2LCLA 3VYHB 5GANh 4PJOG 3OA6A 3CPWS 2C06A 4OB3B 1WGSA 5GMKe 3JCMh 3F70A 2K3YA 3OYJA 4M7AC 3LYIA 2VGNA 3UWNA 3JCMV 3PMTA 2DXCA 2XKOC 3M53A 3VYGA 3PTAA 5IN1A 1VQMA 1S72T 1VQ5A 4A53A 2E6ZA 2LRQA 3JB9D 1NJIC 1M1GA 3V7CA 4C92B 1K73U 4PJOC 1YJWT 3OYFA 1VQPA 4C92A 1EIFA 5CCAA 4IUVA 3CCMT 3WVEB 1FX7A 3DKMA 1BI0A 2BKDN 4C8QB 4DOWA 2ZZDA 4M77G 5FROA 3CC2A 1BI3A 1TH7A 3CCQT 3CCUA 3TEEA 2KVQG 4C8QA 3QZ5B 4ZN3A 4C92C 5A2QE 1Q86U 3MHXA 3DLMA 1BI1A 2X35A 2RHYA 1JJ2S 4QQGA 3CCSA 1Q81C 1K8AU 1VQ8T 2YRVA 1RL2A 2E65A 5GAMd 2BIVA 2X4WA 4ZN1A 3ER0A 2LNVA 4JRKA 1VQ4T 4C8QC 3V7SA 3JB9H 4JRIA 4JUVA 1IZ6A 4CRIA 2EAYA 4TVRA 3TU4K 4HT9A 1BI2A 5J39A 1VQ9A 4A4FA 3SFMA 1Q82U 4LDVA 3A8LB 3JB9G 1M90C 2XD0A 5GAOn 3MEWA 1M8VA 3EAEA 2E70A 4L59A 2M9UA 5D6XA 2L8DA 2XDPA 3TREA 4A4HA 4M7AE 4J6YA 4M7DB 4C0DB 3HFNA 2E41A 3NFCA 3KUFA 1XOVA 3M57A 4HCCA 2KQWA 1NZ9A 1GXIE 4BE0A 2V8JA 1MGQA 4RMOA 4PJOE 1QP3A 1UGSB 1G3YA 3BDUA 4RCBA 4X34A 4XTVA 2L3RA 3DB3A 3JCMX 3CCLA 3QYHB 4ATOA 1X75C 2K4YA 3INZA 3JRZA 3QHSA 4C0DC 4JDSA 5EG2A 5M9OA 1WJQA 3OYDA 2K2VA 4L5GA 4C92E 1WJRA 1KQSA 2G3RA 3GP8A 3G6ET 3KBGA 2P4TA 2QA4T 3A8MB 4LDWA 1I8FA 4II1A 5CVIA 2YHTA 5DLOA 2KDSA 4FM4B 2RI2A 4C8QE 3OBWA 3X24B 3M55A 1BKBA 2QQAA 2JN0A 2MF2A 3DB4A 4M78F 4EMHA 3G71A 1VQ6A 2JTFA 4FU6A 4C0FA 4EDUA 3QPHA 2RO0A 5J26A 1WNLA 3UDCA 5GMKl 4E7HA 4ZTFA 1N9RA 1U1SA 5DM7R 1KG1A 3BY7A 2RJDA 2RA2A 2RHZA 4XQ3A 5LJ5e 4BDZA 4JJNK 3OYMA 3L1AA 1VQ7A 4M78D 3AHUA 2DD5A 3JCMb 2DIQA 2RHIA 3RIRA 5FLXE 4XU0A 3CD6A 1O9SA 2RH2A 1YITT 2PUKB 4M75D 5LJ3e 3CCRT 5CKHA 3Q1JA 3CCEA 3L2RA 3VV0A 3A8HB 1N6AA 1NE8A 1K9MU 3WXMB 3JCMc 3OSVA 2LC4A 2LT4A 2ZPEB 3V7RA 4N0AA 1S72A 2PUOB 2QXFA 1U8RA 5CO7A 2OTLT 3S3OA 3QSUA 1XQHA 2M0OA 4F7UF 3RMSA 2DTOA 2E1HA 3VU3C 5GAMg 1VIEA 4M77F 3VKIA 4LDYA 5GAMj 4M78B 4RG2A 4ZGDB 4PKCC 3I56T 3FEOA 3M4YA 4BI3A 3QBYA 3JCMW 4NS5A 4OGEA 1G5VA 2OAUA 2P0QA 2R58A 3M58A 4M78A 4N0AC 2X4JA 5FU7B 5LJ5f 3LWHA 2DZ9A 3GF5A 4M75B 4C5IA 5LJ5d 4KULA 2XK0A 4FIBA 4PLLA 5CAIA 1N8RC 4FL6A 3X20B 3LGFA 4FT2A 1YBYA 1KD1C 4M75A 2M16A 3PNWC 1JB0E 2XICA 2PVOB 3VUBA 2XU8A 3OYBA 2R5MA 4M7AB 4M77D 5LJ3d 3MCAB 4OB0B 1VQ8A 4M78C 3OS0A 2F69A 3CCJT 5IAYA 2R5AA 4MMKA 5GAN5 3BFMA 5FU7C 3RKYA 4PJOB 3QXEB 1UGQB 4M75C 4M7DA 1VQNA 3OW2A 1MHNA 4PJOA 1PSFA 1D3BB 4IUQA 4OMFB 2EQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RES A;  3BW1 A;  4C8Q C;  1D3B A;  3V7S A;  1LOJ A;  1Y96 A;  4JRI A;  4JUV A;  1YCY A;  2E64 A;  2EAY A;  5GAN 3;  4HT9 A;  5GAM h;  1M5Q 1;  3JB9 G;  3EFR A;  5DY9 A;  5GAN 8;  5GMK j;  5GAN e;  4XU2 A;  3HSB A;  5GMK h;  5GAO n;  4JLI A;  2EJ9 A;  2HNI A;  1M8V A;  1LJO A;  4J5Y A;  3JCM e;  4M7A E;  4J6Y A;  2YLB A;  4M7D B;  3HFN A;  2E41 A;  4F7U G;  5GAN 4;  4NL3 A;  2E10 A;  2Y90 A;  3FB9 A;  4EMG A;  1MGQ A;  3FIF A;  1BIA A;  3V8L A;  4PJO E;  4M75 F;  5I21 A;  4XTV A;  3BDU A;  4RCB A;  4MML A;  3JCM X;  4XTU A;  3INZ A;  4J6X A;  2YLC A;  2EJG A;  3PGG A;  4HT8 A;  4M77 C;  3QHS A;  3RKW A;  4C8Q F;  4M7A F;  2RM4 A;  1WQ7 A;  4M78 E;  4XTW A;  1H64 1;  3SB2 A;  3JB9 I;  5GAN 7;  4J6W A;  2VC8 A;  4C92 E;  1JRI A;  2QTX A;  5GMK m;  2K57 A;  4PJO F;  4M75 E;  1I81 A;  2I2L A;  1I8F A;  3QUI A;  3M4G A;  2YHT A;  1WQW A;  4M7D E;  4F7U B;  3GIB A;  2DTI A;  5GAN f;  4M77 B;  4C8Q E;  3QO3 A;  4DQ2 A;  4A54 A;  4M7A D;  3L2Z A;  4F7U A;  5GAN g;  2JN0 A;  4M78 F;  4EMH A;  4M7A G;  2VXF A;  3JCM f;  4M77 A;  5GAN j;  1WPY A;  1HK9 A;  4OP0 A;  1B34 B;  3JCM J;  4C92 F;  3JCM g;  4X9D A;  4PJO D;  5GMK l;  1WNL A;  5GAO m;  1B34 A;  1N9R A;  1U1S A;  4QVC A;  3BY7 A;  4M7D F;  1U1T A;  3V8K A;  2RA2 A;  2RB6 A;  4XQ3 A;  4NL2 A;  3RKX A;  5LJ5 e;  3JB9 H;  3SWN B;  1LNX A;  3L1A A;  4M78 D;  3AHU A;  4M78 G;  3JCM b;  3RIR A;  3SWN A;  4XU0 A;  4XTZ A;  4XU1 A;  4C92 D;  2EJF A;  5LJ5 g;  4C92 G;  1X01 A;  4M75 D;  5LJ3 e;  4EMK B;  4M75 G;  4QVD A;  5GAO l;  1HXD A;  4M77 E;  5LJ3 f;  4M7D D;  1JBM A;  2EWN A;  4EMK A;  4M7D G;  4XTY A;  3EFS A;  5LJ3 g;  5GAN d;  4C8Q D;  3JCM P;  2VXE A;  2FB7 A;  3SWN C;  4C8Q G;  3JB9 F;  4M7A A;  2DTH A;  3JCM c;  3RER A;  5GAM e;  3V7R A;  3JCM d;  4WF2 A;  1KQ2 A;  1I5L A;  4N0A A;  1N9S A;  4XTX A;  3RUX A;  5GAN h;  5GAO q;  5GAM f;  4HA8 A;  3QSU A;  4PJO G;  3JB9 J;  4EMK C;  4F7U F;  5GMK e;  2DTO A;  2E1H A;  3VU3 C;  3JCM h;  5GAM g;  2DJZ A;  2CGH A;  2DVE A;  4M77 F;  4PNO A;  3JCM V;  5GAM j;  2DEQ A;  4M78 B;  4M7A C;  3JCM W;  4NOY A;  4A53 A;  3V8J A;  4N0A C;  3JB9 D;  4M78 A;  3V7C A;  4C92 B;  5LJ5 f;  4PJO C;  1I4K 1;  2DZ9 A;  2ZGW A;  4M75 B;  3FJP A;  5LJ5 d;  2RD1 A;  5CAI A;  4C92 A;  5GMK i;  3HFO A;  4M75 A;  2DKG A;  4F7U E;  5LJ5 j;  2DZC A;  4RCC A;  5LJ5 h;  4M7A B;  4C8Q B;  4M77 D;  4XU3 A;  2DXU A;  5LJ3 d;  4Y91 A;  4M77 G;  3JCM Q;  4M78 C;  5GAN 2;  1TH7 A;  5GAO p;  2FYK A;  4C8Q A;  5LJ3 j;  4MMK A;  5GAN 5;  3BFM A;  4C92 C;  1KQ1 A;  3RKY A;  4PJO B;  5LJ3 h;  2DXT A;  4M75 C;  5GAO r;  4M7D A;  4V2S A;  5GAN 6;  1BIB A;  4PJO A;  2E65 A;  1D3B B;  5GAM d;  4M7D C;  1Y96 B;  4X9C A;  4JRK A; 
#chains in the Genus database with same CATH topology
 2JMC A;  2P0K A;  5GAM h;  5LL6 S;  1VYV A;  4FW2 A;  2NUZ A;  3HSB A;  3OYK A;  1PG5 B;  4CI0 C;  4CC7 A;  4F7U G;  2E10 A;  3NTH A;  1NYG A;  1UEC A;  2EGE A;  3CME Q;  1M1K U;  4HCZ A;  5KYW B;  3OYH A;  2YUN A;  4IUU A;  2DE0 X;  2OTJ Q;  4XTW A;  5HK3 A;  2LQW A;  2QQS A;  1KHC A;  2VC8 A;  4FYX B;  2AT1 B;  3L2U A;  4M75 E;  2MMP A;  1RAI B;  4BB7 A;  2DK3 A;  3M0U A;  3QUI A;  2CZ1 B;  5D6Y A;  4JRP A;  1SSF A;  4P5N A;  2RJE A;  2E6N A;  2J05 A;  1UDL A;  1TWB A;  1HK9 A;  1FYN A;  3HRU A;  1B34 A;  3OS1 A;  1UGP B;  2FVU A;  1D0Z A;  3CPW P;  2XG8 D;  1T0H A;  4E47 A;  1VQM T;  4A63 B;  2PQW A;  3DLL A;  4M77 E;  2CDT A;  5LJ3 g;  1SRL A;  3OB9 A;  1X2K A;  1NEG A;  3CC2 T;  2L89 A;  2F5K A;  2RN8 A;  5FRN A;  2X4Y A;  1BCO A;  2DJZ A;  1K8A C;  1VQ8 Q;  3CCS T;  2IIM A;  1M9S A;  2AZV A;  3QKJ A;  1PCX A;  4N4I A;  3EGX B;  2H3J A;  4KGZ B;  4CC4 B;  3OYI A;  1PWT A;  1R8O B;  1VQ5 Q;  5KH6 A;  3JV3 A;  3CMA Q;  2DFU A;  2WSC E;  2E5K A;  1NJI U;  5GAN 8;  1LOJ A;  2V8K A;  2L3Q A;  1ZUY A;  4A4K A;  1XTD A;  4R0K A;  3EFR A;  3EGU A;  5GMK j;  1YIJ T;  4JLI A;  4BD3 A;  3CCQ A;  1M30 A;  2HZY A;  1WYX A;  2CT4 A;  2Y90 A;  3G4S T;  5KYY A;  1Q81 U;  2MOX A;  1VQ9 Q;  3REA B;  3NTI A;  4GY5 A;  2CH4 A;  1VQ4 A;  4MZP A;  2IG0 A;  5FW9 A;  4LDU A;  1PD1 A;  3GLX A;  2CKK A;  4C8Q F;  4JJC A;  1MV3 A;  3URG A;  1WHH A;  5GMK m;  2EQJ A;  3HP9 A;  4J9C A;  1A0N B;  1G3T A;  2K79 A;  2PZ1 A;  4E7L A;  3ZL7 C;  2FZK B;  2OI3 A;  1QP2 A;  4ME7 A;  3V8K A;  3UAT A;  4ZTJ A;  4MZM A;  4ELZ C;  2MI6 A;  5KE2 A;  4JS4 A;  1GL5 A;  1ZSZ B;  5D6W A;  2EBP A;  4OB1 B;  4QVZ A;  4M7D D;  2ED0 A;  3SDZ A;  5GAN d;  2D9T A;  2E3I A;  4RG8 A;  2KYB A;  3JCM d;  4IUP A;  3CCJ Q;  4DA4 A;  5GAM f;  1YCS B;  4F14 A;  2EQM A;  2DVE A;  1YIT A;  4J9F A;  1B7T A;  1VQN T;  1TU0 B;  2O4X A;  1AOJ A;  3QG1 A;  3FJP A;  1S72 Q;  1VUB A;  3FDR A;  3HFO A;  9ATC B;  2DER A;  4F7U E;  2DD4 A;  1RAD B;  2J6F A;  4M7D A;  5GAN 2;  1UEB A;  4RTV A;  1TUD A;  3CCM Q;  3CPW A;  2HSP A;  4C5E A;  5KCO A;  1KQ1 A;  5GAO r;  4RTX A;  4M7D C;  3E19 A;  2GNC A;  1YIJ A;  1N8R U;  2HL3 A;  3A1P A;  2CSI A;  1Y07 A;  1MMN A;  3G4S A;  5IT9 E;  1N5Z A;  1WJS A;  2JNG A;  3QJ6 A;  1RAA B;  2BZY A;  4LD9 K;  2MWO A;  1JJ2 A;  1H3H A;  2RMO A;  4M75 F;  5I21 A;  3BDL A;  1ABO A;  4OMO A;  3EGD B;  2LMJ A;  1VIF A;  3C0C A;  3PGG A;  1I07 A;  3CCL T;  1IGQ A;  4E7J A;  3L2V A;  4CC2 A;  1UE9 A;  4Z89 A;  3P8D A;  3L2W A;  3VS4 A;  2DTI A;  4M7A D;  2C0I A;  3TSZ A;  1Y71 A;  1TS9 A;  1YHQ T;  4OMN A;  1H3Z A;  2QEX T;  2KAF A;  3VS5 A;  2LP5 A;  1RAB B;  1PNJ A;  2DIG A;  3G1J A;  3A8O B;  3SEM A;  2EYY A;  2ABL A;  1V76 A;  2XMF A;  5GAO l;  1RUW A;  1MND A;  1JBM A;  3FJ5 A;  4C8Q D;  4M7A A;  1WI7 A;  1BYM A;  1D0Y A;  2DPP B;  1KQ2 A;  2EIF A;  1F1B B;  2C06 A;  3VYH B;  3OA6 A;  4M7A C;  3JCM V;  3M53 A;  2XKO C;  4RTZ A;  5IN1 A;  4A53 A;  2E6Z A;  3V7C A;  1YJW T;  1H8K A;  3I56 Q;  3OYF A;  1PRL C;  2FEI A;  3WVE B;  2ZZD A;  4C8Q A;  2OX7 A;  3MHX A;  2RHY A;  5IXF A;  2YRV A;  1OQK A;  2X4W A;  4ZN1 A;  2A37 A;  4C8Q C;  3V7S A;  1IZ6 A;  2EAY A;  1CKA A;  1K1Z A;  2FPF A;  5J39 A;  4J9E A;  1PM3 A;  3NPF A;  1M27 C;  1WZO A;  1M8V A;  2M9U A;  1PC0 A;  2XDP A;  5D6X A;  4HCC A;  2E41 A;  1NG2 A;  1GXI E;  4BE0 A;  4AFQ C;  1ZSG A;  4PJO E;  1UGS B;  3BDU A;  3CCL A;  4ATO A;  2L3R A;  2K4Y A;  4AG1 C;  1ABQ A;  1T3S A;  4GLM A;  1WJQ A;  4LUD A;  1M3A A;  4L5G A;  1QLY A;  1TUG B;  3GP8 A;  3G6E T;  4LUE A;  2P4T A;  1I8F A;  4LXC A;  5DLO A;  1UJY A;  2RI2 A;  4B6M A;  3OBW A;  1BKB A;  2QQA A;  3G71 A;  1VQ6 A;  2JTF A;  4FU6 A;  1YI2 Q;  2RO0 A;  3EHQ A;  3I55 Q;  5DM7 R;  1KG1 A;  2SRC A;  3TSW A;  5LJ5 e;  3OYM A;  3L1A A;  3AHU A;  2RQV A;  2O9S A;  2RH2 A;  2PUK B;  4M75 D;  3AT1 B;  3CCR T;  2YWW A;  3Q1J A;  1FMK A;  1WLP B;  2YT6 A;  3A8H B;  3JCM c;  1NLP C;  3SHW A;  1TG0 A;  2OTL T;  4F7U F;  3M0R A;  4M4Z A;  2NUT A;  1VIE A;  3VKI A;  2JXB A;  2V1R A;  5D7U A;  2P0Q A;  2R58 A;  1ACM B;  2ROL A;  5LJ5 f;  2CP2 A;  2CP0 A;  4KUL A;  4FIB A;  3VS2 A;  5CAI A;  4FL6 A;  3UA7 A;  1GCQ A;  4M75 A;  2ENM A;  3PVQ A;  2XIC A;  2XU8 A;  2RQR A;  4M77 D;  5LJ3 d;  1WDX A;  1MMA A;  5IAY A;  2GTJ A;  3RKY A;  1ZX6 A;  4M75 C;  2EQU A;  2OJ2 A;  2FPE A;  3RES A;  3C4S A;  1YCY A;  4A4G A;  4E2F B;  4Y92 A;  5CQY A;  1OI1 A;  3SD4 A;  2F5T X;  2XDD A;  3MET A;  5GMK h;  1JXO A;  2W0Z A;  3CC4 T;  4B9W A;  1UTI A;  4DBF A;  2KI7 A;  2M1H A;  3J7A F;  1YJ9 T;  3O5Z A;  4FCY A;  4KUD K;  3G6E A;  4M77 C;  3RKW A;  2OAW A;  4ANJ A;  1VA7 A;  2NLU A;  1QCO A;  3JB9 I;  2RHX A;  4J6W A;  4ZGJ B;  1JRI A;  1C0M A;  4L6V 5;  2I2L A;  3QJY A;  1Y57 A;  3CCV T;  3OMG A;  1J3T A;  5CKB A;  3CEY A;  1K9A A;  4KT0 E;  1AHJ B;  4A54 A;  1VQK Q;  1Q7Y U;  2EKO A;  1B34 B;  1VQO A;  3C95 A;  2HQH A;  4IUT A;  2DAQ A;  3LLR A;  1QWE A;  3L2Q A;  5J3B A;  2RB6 A;  2K9G A;  3CCR A;  2O9V A;  4XU1 A;  5LJ5 g;  1E6H A;  3LWI A;  1BU1 A;  4ESR A;  4XTY A;  2OTL A;  4B9X A;  2VXE A;  2FB7 A;  2HSE B;  1UHF A;  1X6O A;  1NLO C;  2BZX A;  2D6F A;  1DJ7 B;  2K5L A;  3CC7 Q;  3EH2 A;  3PE0 A;  1QW1 A;  2JUF A;  1D1C A;  1SSH A;  3P8B B;  2LTO A;  1W2B S;  2YUQ A;  4EPC A;  3VJP A;  1B07 A;  2CZ0 B;  5HKC A;  1OV3 A;  1WXB A;  1ZUU A;  1KC8 U;  2K3B A;  3CXC P;  4E7K A;  3EFO A;  2BZ8 A;  1VQP Q;  1Y0M A;  1LPL A;  2DXB A;  1MNE A;  2NWM A;  1G3S A;  3QYG B;  2BTT A;  1Y96 A;  2RHU A;  5DLQ E;  4JRQ A;  8AT1 B;  4RTY A;  1U5S A;  2H3E B;  2JTM A;  1QCF A;  1MMG A;  1LJO A;  4J5Y A;  5KYY B;  2XID A;  2A36 A;  4ZNX A;  4ELY C;  1P92 A;  5GAN 4;  4IKF A;  3CME T;  5FU6 C;  4F16 A;  3QZ9 B;  3C12 A;  5FRM A;  3EG1 A;  2L0A A;  5A0D A;  2OTJ T;  2LCS A;  3PIO A;  2DBK A;  1SG5 A;  1QKW A;  1UHC A;  2O31 A;  3QDR B;  2EJG A;  4PJN A;  1M90 U;  3CPF A;  1RI9 A;  1YN8 A;  3TQ7 P;  3RMQ A;  5KE3 A;  2V26 A;  3HTR A;  1ZA1 B;  4HVV A;  4N4H A;  4QQD A;  3GNG A;  1M8M A;  4F7U A;  3S3M A;  3OYC A;  2EYQ A;  4OP0 A;  3WVD B;  3JSC A;  2EFI A;  1M90 R;  4JZ3 A;  4M7D F;  1VQL T;  4ORZ A;  3HHT B;  3RKX A;  2NUP B;  2COW A;  4C92 G;  2FL7 A;  4MZT A;  3MP1 A;  1H92 A;  3EFS A;  3J80 E;  1D1B A;  1VQ7 Q;  1M1K R;  4MDW A;  1OPL A;  1OYX A;  5GAO q;  2ZPB B;  1ZBX A;  3JB9 J;  2XHC A;  1WHG A;  2DF6 A;  2O4X B;  5I2M A;  2KK4 A;  3VUZ A;  3I9Q A;  2PVD B;  2WAC A;  1NPP A;  1VYT A;  1HD3 A;  2VV5 A;  3HPW A;  3OYL A;  4BUG A;  5GMK i;  2L3P A;  1VQ5 T;  5IHI A;  5KYU A;  1OOT A;  4Y91 A;  3R6N A;  3CMA T;  2XDB A;  4MDX A;  4O6J A;  1MV0 B;  5LJ3 j;  4J9I A;  2MAM A;  3CCQ Q;  4FSX A;  4AMC A;  3OS5 A;  1X6B A;  1M1K C;  2KE9 A;  2QDY B;  1JJ2 P;  2RNA A;  1RLQ C;  5I2S A;  1VQ4 Q;  3CME A;  2LT1 A;  4C0Z A;  3NMZ C;  2VYT A;  2PVG B;  2EJ9 A;  1VQ9 T;  2HQX A;  2OTJ A;  1GFD A;  4KBM B;  4ZGE B;  3LX7 A;  1V29 B;  2MYS A;  2RJC A;  2WSF E;  5FWC A;  2VVK A;  4JS5 A;  4QW2 A;  4HT8 A;  4M7A F;  1BB9 A;  1WQ7 A;  3LH0 A;  3E9G A;  4RTU A;  3CXC A;  3IQL A;  2HEQ A;  2KRM A;  5CR2 A;  3GIB A;  1LVK A;  3H0F A;  2C0O A;  1WHL A;  2JOY A;  2DL7 A;  1VQL A;  1D1A A;  2FPD A;  2ESW A;  3O8V A;  4PJO D;  1TOV A;  4OF1 A;  1NJI R;  2ZPG B;  2WSE E;  1PRM C;  2DIL A;  3UA6 A;  4M78 G;  1OZ2 A;  2EW3 A;  2EJF A;  4C0G A;  4A4E A;  2KY9 A;  3MEV A;  3EHR A;  2CYZ B;  1FMV A;  2CP5 A;  2KT8 A;  3FLG A;  4QQ6 A;  1YIT Q;  2JT4 A;  1Q81 R;  3CD6 T;  3GNF B;  3JCM P;  3TVT A;  3ME9 A;  1QVF S;  2X51 A;  4R56 A;  5GAM e;  3CCE T;  2DMO A;  1N9S A;  4XTX A;  5GAN h;  3LGL A;  1QKX A;  4PJO G;  3RR6 A;  2K6D A;  3JCM h;  2K3Y A;  2DXC A;  1S72 T;  1VQM A;  1VQ5 A;  3I5S A;  4D8K A;  1NJI C;  1M1G A;  1K73 U;  4PJO C;  2HKN A;  4IUV A;  5GJW B;  2JM8 A;  3CCM T;  4C8Q B;  5FRO A;  3CC2 A;  1TH7 A;  2KVQ G;  3QZ5 B;  4ZN3 A;  2LQN A;  1Q86 U;  2JW4 A;  1AWO A;  3CCS A;  1Q81 C;  2VB6 A;  5KYW A;  4JRK A;  1K76 A;  1K73 R;  3TU4 K;  4TVR A;  1BI2 A;  1VQ9 A;  4A4F A;  1Q82 U;  4LDV A;  2XD0 A;  4E7Z A;  3MJX A;  3MEW A;  3EAE A;  2E70 A;  2X3X D;  4A4H A;  4J6Y A;  1EX4 A;  3HFN A;  3NFC A;  1TSF A;  4J9G A;  2P84 A;  1GCP A;  1MGQ A;  4E6R A;  1XJW B;  2HMA A;  3DB3 A;  2DBM A;  3QYH B;  1X75 C;  2QDL A;  3INZ A;  4C0D C;  2DL8 A;  1Q82 R;  5EG2 A;  5M9O A;  2DEU A;  2K2V A;  4C92 E;  4AG2 C;  2A08 A;  3KBG A;  5IHN A;  2D1X A;  2QA4 T;  4LDW A;  1OU8 A;  4II1 A;  2KDS A;  3CQT A;  1NBE B;  2MF2 A;  4EMH A;  2MCN A;  3H41 A;  4EDU A;  3QPH A;  5J26 A;  5GMK l;  4E7H A;  1U1S A;  3BY7 A;  1N8R R;  2RHZ A;  2GQI A;  4XQ3 A;  4JJN K;  2DD5 A;  2DNU A;  2DIQ A;  3RIR A;  3CD6 A;  4XU0 A;  4RTW A;  1X69 A;  4F04 B;  3CCE A;  3VV0 A;  2ROT A;  1N6A A;  2LJ0 A;  1K9M U;  3WXM B;  3EG2 A;  1IXD A;  3OSV A;  1S72 A;  2PUO B;  2QXF A;  5CO7 A;  1PHT A;  5GAM g;  4M77 F;  5GAM j;  3I56 T;  1RAH B;  4NS5 A;  1GBR A;  1WXT A;  4M75 B;  5LJ5 d;  1N8R C;  2XK0 A;  4PLL A;  1JEG A;  1U3O A;  2M16 A;  3PNW C;  2MK5 A;  3OS0 A;  2F69 A;  1S1N A;  1YJN Q;  2KXD A;  5EC7 A;  3BFM A;  5FU7 C;  3QXE B;  1VQN A;  1RAE B;  3BW1 A;  5I22 A;  1M5Q 1;  3R6O A;  3HRT A;  5GAN e;  3PVL A;  2C0T A;  5AT1 B;  4F17 A;  1KQS S;  3JCM e;  1RAF B;  1CKB A;  3GPL A;  2LCC A;  4PL6 A;  1OX8 A;  2J6O A;  4KH0 B;  1G8X A;  2YDL A;  5CKE A;  1TTH B;  2KT1 A;  1EZZ B;  2QQB A;  4XTU A;  3LW5 E;  5HY6 A;  3G71 Q;  1ARK A;  2QA4 A;  4M78 E;  1VQ6 Q;  4RKU E;  1ZUK A;  4J8O A;  4OMM A;  4BE1 A;  2CZ6 B;  5GAN f;  1YI2 T;  2KEA A;  2E3H A;  3L42 A;  3PFS A;  3JCM f;  3I55 T;  1ZSZ C;  2X4X A;  2RJF A;  4Z02 A;  1OUL A;  2L5Q A;  1QVF P;  1SEM A;  1R77 A;  4LD6 A;  2LQK A;  1WHM A;  1Y7X A;  3EG9 A;  1X01 A;  4YTL A;  4FSS A;  2KRN A;  1YHQ A;  1IRE B;  3OYY A;  6AT1 B;  4DBH A;  1PKS A;  4PFP A;  2QEX A;  1QVP A;  3RER A;  2DLP A;  2HAX A;  1I5L A;  3I56 A;  3H6Z A;  1QCN A;  2F2V A;  1WA7 A;  1RI0 A;  3OW2 S;  5CKD A;  3E9F A;  1I4K 1;  1TXQ A;  2GF7 A;  2D0N A;  4C5G A;  3ASK A;  4XU3 A;  2YRC A;  3EFO B;  1WX6 A;  2FYK A;  1HYO A;  3HL8 A;  3VRY A;  5LJ3 h;  2DXT A;  2CH4 W;  3NHN A;  4V2S A;  3M54 A;  1IRX A;  1C6V X;  1BIB A;  2K5I A;  3ZFJ A;  1Y96 B;  4JLG A;  4D8D A;  1YJW A;  2YRD A;  3CBO A;  3M56 A;  1QQJ A;  3CCU Q;  4OB2 B;  1X27 A;  2LQ8 A;  1E6G A;  2V8I A;  4XU2 A;  3MO8 A;  3MP8 A;  2JTE A;  2HNI A;  4HKE A;  3OY9 A;  3G6E Q;  4LDX A;  1WFW A;  4NL3 A;  2ED1 A;  4XK8 E;  3FB9 A;  1M4Z A;  1G3W A;  2QI2 A;  3FIF A;  1EFN A;  4C5H A;  1SKU B;  2JMA A;  3E1S A;  2XI9 A;  4FYV B;  2M0Y A;  1M2V A;  4JJB A;  2DJQ A;  2IVW A;  2KBT A;  1YWO A;  1MMD A;  1AVZ C;  1N27 A;  1SRM A;  1YI2 A;  1VQO Q;  3A8G B;  2K57 A;  2E5Q A;  2QGG A;  1I81 A;  1WHK A;  5L8R E;  3I55 A;  3OQ5 A;  1VQK T;  4F7U B;  2VAS A;  3CCR Q;  4DQ2 A;  2X3W D;  3M9Q A;  4M77 A;  4KUI A;  2Y4Y A;  3PIP A;  1QMC A;  2EYZ A;  4PK4 A;  4D6W A;  4QT7 A;  1ZBJ A;  2CZ7 B;  3VS7 A;  2KMT A;  5HCK A;  3SWN A;  4FYW B;  2P0P A;  2GBQ A;  3KXT A;  4GLK A;  1OPK A;  3OYG A;  1Q95 G;  1X43 A;  2EWN A;  4EMK A;  4Y28 E;  3VS1 A;  3MEA A;  2QAZ A;  3SWN C;  3VS0 A;  2LJ1 A;  1GFC A;  4J9B A;  2MWP A;  4J7F A;  3CC7 T;  1I1J A;  2A7Y A;  4KGX B;  1M2O A;  4EMK C;  1JU5 C;  2QQR A;  3EG3 A;  3BE3 A;  4PNO A;  5FWB A;  1WHJ A;  2DEQ A;  5A0L A;  1BCM A;  3V8J A;  2DL5 A;  2K2M A;  4JZ4 A;  4BY6 C;  1GRI A;  5A0G A;  5KYU B;  2CP3 A;  5LJ5 j;  2DZC A;  1QVF A;  1Q7Y R;  1AWW A;  2DXU A;  8ATC B;  1VQP T;  4N4G A;  3RNJ A;  3VS6 A;  3ZEH A;  2YUO A;  1KQS P;  2CT3 A;  4Z88 A;  4X9C A;  3OSS C;  3J81 E;  2VGM A;  4BDY A;  1UB4 A;  2KXC A;  1X6G A;  1KD1 U;  2EQK A;  2QQ9 A;  2K5F A;  4DOV A;  1BIA A;  2COY A;  1ZQ1 A;  4BE2 A;  2G6F X;  1UG1 A;  1T0J A;  1Q7Y C;  1OZ3 A;  2GCX A;  3PMI A;  3PT9 A;  2P4R A;  2YLC A;  2LDM A;  3SB2 A;  1VQK A;  1ZHI A;  3EG0 A;  2KRS A;  3H9N A;  4OVA A;  2YXY A;  4PJO F;  3CC4 A;  1XNI A;  4LNP A;  3S6W A;  2CS7 A;  1KC8 R;  3QO3 A;  3L2Z A;  1YWP A;  1YJ9 A;  5AYF A;  5HK0 A;  1KK7 A;  2F1L A;  4HCK A;  1FXX A;  4BI4 A;  3CCV A;  1QVG S;  4C92 D;  3REB B;  4O5V A;  2EVR A;  2B8A A;  1VQ7 T;  4R55 A;  5LJ3 f;  3OYN A;  3CC7 A;  5KYN A;  2RI5 A;  1M3B A;  3QDF A;  2D8H A;  2LX9 A;  3CBM A;  1KC8 C;  2L2P A;  4OB3 B;  4HVU A;  1WGS A;  5GMK e;  3F70 A;  3OYJ A;  3LYI A;  3UWN A;  3PTA A;  4WTO B;  2LRQ A;  3JB9 D;  2HL5 C;  3RDV A;  1GBQ A;  1I5O B;  1VQP A;  2F2W A;  4C92 A;  4AFU C;  1FX7 A;  1BI0 A;  3CCQ T;  5IHK A;  4C92 C;  5A2Q E;  1K8A U;  1VQ8 T;  1RL2 A;  2E65 A;  5GAM d;  2BIV A;  3ER0 A;  1UFF A;  2CUB A;  1VQ4 T;  1U06 A;  4JRI A;  2M51 A;  4JUV A;  2VWF A;  3E2U A;  2CP6 A;  3SFM A;  2LZ6 B;  3NGP A;  3JB9 G;  1M90 C;  1Z9Z A;  4QKU A;  1UGV A;  4L59 A;  2ECZ A;  2L8D A;  4M7D B;  4C0D B;  5KYX A;  3KUF A;  1XOV A;  3M57 A;  3THK A;  1NZ9 A;  2V8J A;  1K8A R;  4RMO A;  1QP3 A;  1G3Y A;  4RCB A;  4X34 A;  3JCM X;  2AIR B;  1RAG B;  5IXB A;  1SPK A;  3QHS A;  4JDS A;  1T3L A;  2RF0 A;  1VQL Q;  3OYD A;  2QYZ A;  2DA9 A;  1KQS A;  2G3R A;  2RQW A;  3H0I A;  2YHT A;  2GGR A;  2RQU A;  3X24 B;  3M55 A;  3LH5 A;  4DEY A;  1WNL A;  3UDC A;  2RQT A;  2RJD A;  2ATC B;  1VQ7 A;  4M78 D;  1AEY A;  2DVJ A;  3JCM b;  2RHI A;  5FLX E;  1YIT T;  1KFZ A;  3L2R A;  2IPO B;  3MKD A;  2CSQ A;  1VQM Q;  2H8H A;  1RLP C;  2HKQ B;  2KGT A;  2LC4 A;  2QG9 B;  2ZPE B;  4N0A A;  2FG0 A;  1UUE A;  3QSU A;  1B3Q A;  3S3O A;  5I11 A;  1XQH A;  2M0O A;  3RMS A;  2DTO A;  4LDY A;  3CC2 Q;  4RTT A;  1JXM A;  2EKH A;  3M4Y A;  4BI3 A;  1G5V A;  4OGE A;  2OAU A;  4N0A C;  3M58 A;  4M78 A;  5FU7 B;  2X4J A;  1NEB A;  2DZ9 A;  3GF5 A;  4C5I A;  3CCS Q;  3X20 B;  4FT2 A;  4PJM A;  1YBY A;  1K0X A;  1JB0 E;  3OYB A;  3M0S A;  4M7A B;  4JJD A;  1LCK A;  4OB0 B;  1VQ8 A;  4M78 C;  3CCJ T;  2I0N A;  2R5A A;  5GAN 5;  1W2B P;  2JM9 A;  1UGQ B;  2KRO A;  2MIO A;  3OW2 A;  2CUD A;  4LE9 A;  4PJO A;  1JO8 A;  2V1Q A;  1D3B A;  2HBW A;  3OYA A;  2QAS A;  3OS2 A;  2K7A A;  1ZA2 B;  3I5R A;  1OU9 A;  3CMA A;  3JAM E;  3P8H A;  4BI8 B;  1AWJ A;  1YIJ Q;  4EMG A;  3V8L A;  3X26 B;  4OMQ A;  1OX9 A;  4MML A;  2K3X A;  3G4S Q;  2JS2 A;  2YSQ A;  2NYS A;  2B86 A;  5GAN 7;  3FC3 A;  2NUP A;  2RK1 A;  4KRT A;  3UF4 A;  3MPU B;  3UPU A;  1IHW A;  3G7Z A;  1QVG P;  4PLI A;  1C1A A;  1Q86 R;  3CD6 Q;  1AT1 B;  1W6X A;  2PNI A;  2O2O A;  4E7S A;  2A0F B;  3HRS A;  5GAO m;  4QVC A;  3CCE Q;  1Z9Q A;  1QWF A;  3EG9 B;  1VYU A;  3KFV A;  4XAX B;  2DRM A;  4XTZ A;  1NM7 A;  3FRN A;  4QVD A;  1K73 C;  1HXD A;  2FO0 A;  4M7D G;  1K4U S;  3OMC A;  1NPR A;  2RI3 A;  3HKS A;  3M5A A;  1SF9 A;  3D7S B;  2LNH B;  5GJV B;  2M02 A;  5C0M A;  1Q86 C;  3M0T A;  5CIU A;  2CGH A;  5CKF A;  2EYX A;  2QTV A;  2R57 A;  1E7O A;  2LVM A;  3QII A;  2ZPI B;  1VQN Q;  4IUR A;  3CCJ A;  4RUG A;  2AZS A;  5C6S A;  1Q82 C;  2DKG A;  1YJN T;  3EGX A;  4OML A;  3QWX X;  2MPX C;  2JZ2 A;  5LJ5 h;  1X2Q A;  3H8Z A;  3JCM Q;  2JVV A;  3OYE A;  2HBP A;  2X9H A;  3M0Q A;  3A5Z B;  2KR3 A;  2PU9 B;  2COZ A;  2NUT B;  3VRZ A;  1R0C B;  1O75 A;  2DM1 A;  3UT1 A;  3CCM A;  1I0C A;  1YP5 A;  3TCJ A;  3RBB B;  2LX7 A;  2YLB A;  2QA4 Q;  1K9M R;  2J06 A;  4PJJ A;  4UC4 A;  2D0Q B;  1AZG B;  2KSS A;  1M2V B;  2AHJ B;  2O01 E;  2GQV A;  3G71 T;  1VQ6 T;  4J9H A;  4J6X A;  1SHF A;  1SHG A;  2RM4 A;  2L3S A;  2RK2 A;  3MEU A;  2DYI A;  4E7I A;  1YNZ A;  1W2B A;  1R0B G;  3CCL Q;  3H0H A;  1IGU A;  4BAC A;  1WQW A;  2JJ9 A;  1TUC A;  2GFU A;  4M77 B;  4M7A G;  3T9N A;  2HQE A;  3VS3 A;  3JCM J;  1K9M C;  1WIE A;  1YHQ Q;  5IH2 A;  2DO3 A;  2CRE A;  2D8J A;  2QEX Q;  2FRY A;  3SWN B;  1LNX A;  2SEM A;  2VUB A;  1FWZ A;  4VUB A;  4CC3 A;  4EMK B;  1HJD A;  3X25 B;  1ZSZ A;  1KHI A;  1OEB A;  2EGA A;  1PD0 A;  4J83 A;  4C8Q G;  2DTH A;  2BUD A;  4PFZ A;  4WF2 A;  4BY6 B;  2ZPH B;  4HA8 A;  4HXJ A;  2F2X A;  4OGC A;  1QVG A;  4J9D A;  4NOY A;  1YJN A;  1KJW A;  1W4S A;  2ZGW A;  1PKT A;  1CSK A;  2RD1 A;  3ULR B;  3C94 A;  3CXC S;  5KCH A;  2HDA A;  4HCB A;  1YJW Q;  2A28 A;  4JPB W;  1WXU A;  4RCC A;  3ZBD A;  3CBP A;  5GAO p;  2ZCF B;  3NTK A;  1G83 A;  2DL3 A;  2Y4X A;  3MP6 A;  2PTK A;  5ECA A;  5GAN 6;  3CCU T;  1MUZ A;  2DX1 A;  4AFS C;  2E64 A;  5GAN 3;  4AFZ C;  4EIK A;  5CQX A;  5DY9 A;  3U23 A;  4K11 A;  1JQQ A;  1FMW A;  2W10 A;  2EPD A;  1K0S A;  1M1F A;  1UJ0 A;  2CP7 A;  3S3N A;  2FRW A;  1AD5 A;  2QGF B;  1VQO T;  1PSE A;  3EGD A;  1H64 1;  5FU6 B;  3X28 B;  2QTX A;  3GBQ A;  3M59 A;  1UGR B;  1VOM A;  1D0X A;  1HSQ A;  3M4G A;  4M7D E;  5GAN g;  1AZE A;  4PJL A;  2VXF A;  3N5B B;  2ZPF B;  5GAN j;  1WPY A;  4C92 F;  3JCM g;  1YFN A;  4IIO A;  4X9D A;  2BE9 B;  4X1V A;  3EH1 A;  1U1T A;  4NL2 A;  4WCI A;  1W70 A;  4AT1 B;  2HD0 A;  3OBY A;  4Q5W A;  5CK9 A;  4M75 G;  1D09 B;  2A3L A;  2FZC B;  4FT4 A;  1W1F A;  3GOX A;  3JB9 F;  2FHD A;  2O88 A;  1IHV A;  1M3C A;  1GCQ C;  1ZLM A;  3RUX A;  4J7I A;  2E12 A;  2GFA A;  3CPW S;  2LCL A;  2JS0 A;  2VGN A;  3PMT A;  4FYY B;  3VYG A;  2OTL Q;  4DBQ A;  2LJ3 A;  4C92 B;  2RPN A;  2DL4 A;  1AWX A;  1EIF A;  5CCA A;  2VKN A;  2DET A;  3DKM A;  2BKD N;  4DOW A;  4M77 G;  1BI3 A;  3CCU A;  3TEE A;  3DLM A;  1BI1 A;  2X35 A;  1JJ2 S;  4QQG A;  2AKL A;  2LNV A;  3JB9 H;  4CRI A;  4HT9 A;  2AK5 A;  3A8L B;  2AKK A;  5GAO n;  5KYX B;  2BE7 D;  1G2B A;  1BBZ A;  3TRE A;  1BK2 A;  4M7A E;  2KQW A;  1KIK A;  2QK0 A;  3CC4 Q;  4XTV A;  3M0P A;  4GBQ A;  4KGV B;  2DRK A;  4Z8A A;  3JRZ A;  1YJ9 Q;  2GTO A;  3I35 A;  1WJR A;  3A8M B;  5CVI A;  4FM4 B;  4HVW A;  4C8Q E;  3DB4 A;  2JN0 A;  4M78 F;  3CCV Q;  3A98 A;  4C0F A;  2ZAE A;  5L23 A;  4FW1 A;  2J6K A;  2KNB B;  4ZTF A;  1N9R A;  3QWY A;  2RA2 A;  1KD1 R;  4BDZ A;  2YUP A;  7AT1 B;  1IO6 A;  1IB8 A;  1O9S A;  1V1C A;  5LJ3 e;  5CKH A;  2Z0W A;  2HCK A;  2J7I A;  1NE8 A;  4DBR A;  2DYB A;  2LT4 A;  3V7R A;  4PFO A;  1U8R A;  4DEX A;  2E1H A;  3VU3 C;  2EQI A;  4M78 B;  4RG2 A;  4ZGD B;  4PKC C;  3FEO A;  2EGC A;  3JCM W;  3QBY A;  4OMP A;  3LWH A;  1RAC B;  4IIM A;  3LGF A;  3OW2 P;  4KH1 B;  1KD1 C;  3VUB A;  2E4H A;  2PVO B;  1NYF A;  2R5M A;  3MCA B;  2EYW A;  1KSW A;  4MMK A;  2KYM A;  4PJO B;  4LN2 A;  1MHN A;  1PSF A;  1D3B B;  4IUQ A;  2FZG B;  4OMF B; 
#chains in the Genus database with same CATH homology
 3RES A;  3BW1 A;  3C4S A;  1D3B A;  3OYA A;  2P0K A;  1YCY A;  4A4G A;  3OS2 A;  5GAM h;  5CQY A;  3SD4 A;  1OI1 A;  1M5Q 1;  5LL6 S;  2F5T X;  3R6O A;  3HRT A;  2XDD A;  3MET A;  5GAN e;  3CMA A;  3HSB A;  5GMK h;  3JAM E;  3OYK A;  1KQS S;  4CI0 C;  3JCM e;  3P8H A;  3CC4 T;  4BI8 B;  3GPL A;  2LCC A;  4B9W A;  4F7U G;  2E10 A;  4PL6 A;  4EMG A;  3NTH A;  3V8L A;  5CKE A;  3X26 B;  2QQB A;  4MML A;  2M1H A;  2K3X A;  1M1K U;  4HCZ A;  1YJ9 T;  4XTU A;  3J7A F;  3LW5 E;  3OYH A;  4IUU A;  4KUD K;  5HY6 A;  3G6E A;  4M77 C;  3RKW A;  4XTW A;  2QA4 A;  4M78 E;  2NLU A;  5HK3 A;  3JB9 I;  5GAN 7;  2RHX A;  4J6W A;  4ZGJ B;  2QQS A;  3FC3 A;  1KHC A;  2VC8 A;  1JRI A;  4RKU E;  2RK1 A;  3L2U A;  4M75 E;  1KC8 C;  2MMP A;  4L6V 5;  2DK3 A;  2I2L A;  4BB7 A;  3QJY A;  3QUI A;  4J8O A;  3CCV T;  4BE1 A;  3OMG A;  2CZ1 B;  2CZ6 B;  3CEY A;  4KT0 E;  5CKB A;  5D6Y A;  4JRP A;  5GAN f;  3UPU A;  1YI2 T;  1AHJ B;  3G7Z A;  4A54 A;  4PLI A;  1SSF A;  3L42 A;  3PFS A;  4P5N A;  2RJE A;  1Q7Y U;  3JCM f;  2E6N A;  3I55 T;  1HK9 A;  2EKO A;  1B34 B;  3HRU A;  1VQO A;  3HRS A;  5GAO m;  3C95 A;  2X4X A;  2RJF A;  1B34 A;  4IUT A;  2DAQ A;  4Z02 A;  4QVC A;  2L5Q A;  3OS1 A;  1UGP B;  2FVU A;  3LLR A;  3L2Q A;  5J3B A;  2RB6 A;  3CCR A;  4LD6 A;  2XG8 D;  4XAX B;  2LQK A;  4XTZ A;  1Y7X A;  4XU1 A;  5LJ5 g;  4E47 A;  1X01 A;  4YTL A;  1VQM T;  3LWI A;  3FRN A;  4QVD A;  1K73 C;  2PQW A;  1HXD A;  4M77 E;  3DLL A;  1IRE B;  1YHQ A;  3OYY A;  4M7D G;  4XTY A;  3OMC A;  5LJ3 g;  2OTL A;  3OB9 A;  1NPR A;  2VXE A;  2FB7 A;  4B9X A;  2QEX A;  1QVP A;  3RER A;  2RI3 A;  3HKS A;  3M5A A;  1X6O A;  2HAX A;  1I5L A;  3I56 A;  3CC2 T;  3H6Z A;  2L89 A;  2D6F A;  5C0M A;  2F5K A;  1Q86 C;  5FRN A;  1DJ7 B;  2K5L A;  1RI0 A;  2X4Y A;  2DJZ A;  2CGH A;  5CIU A;  5CKF A;  1K8A C;  3OW2 S;  5CKD A;  3CCS T;  2R57 A;  3E9F A;  2LVM A;  1M9S A;  3QII A;  3QKJ A;  1QW1 A;  1I4K 1;  2JUF A;  2ZPI B;  4N4I A;  4IUR A;  3CCJ A;  3P8B B;  2H3J A;  2GF7 A;  5C6S A;  2LTO A;  1W2B S;  4C5G A;  1Q82 C;  2DKG A;  4EPC A;  1YJN T;  3VJP A;  3OYI A;  5LJ5 h;  2JZ2 A;  2CZ0 B;  1R8O B;  3ASK A;  4XU3 A;  5HKC A;  3H8Z A;  3JCM Q;  2JVV A;  1KC8 U;  2FYK A;  3OYE A;  2HBP A;  5KH6 A;  4E7K A;  3A5Z B;  3HL8 A;  2PU9 B;  2DXT A;  5LJ3 h;  4V2S A;  3M54 A;  1BIB A;  2DXB A;  2K5I A;  2WSC E;  3ZFJ A;  1Y96 B;  4JLG A;  1NJI U;  1O75 A;  1YJW A;  1G3S A;  3QYG B;  3UT1 A;  5GAN 8;  1LOJ A;  1Y96 A;  2V8K A;  3CBO A;  3M56 A;  2RHU A;  3CCM A;  5DLQ E;  4OB2 B;  4A4K A;  4JRQ A;  1XTD A;  2LQ8 A;  3EFR A;  5GMK j;  2V8I A;  4XU2 A;  3MO8 A;  3MP8 A;  3TCJ A;  1YIJ T;  2JTM A;  2HNI A;  4HKE A;  4JLI A;  4BD3 A;  3OY9 A;  3CCQ A;  1LJO A;  4J5Y A;  4LDX A;  2XID A;  2YLB A;  4ELY C;  1P92 A;  5GAN 4;  4NL3 A;  4IKF A;  4XK8 E;  4UC4 A;  2Y90 A;  3FB9 A;  5FU6 C;  1M4Z A;  3G4S T;  3CME T;  1Q81 U;  1G3W A;  2QI2 A;  3FIF A;  3QZ9 B;  2D0Q B;  3C12 A;  3NTI A;  2KSS A;  4GY5 A;  5FRM A;  2AHJ B;  2O01 E;  5A0D A;  2OTJ T;  2GQV A;  4C5H A;  3PIO A;  3G71 T;  3E1S A;  4MZP A;  2XI9 A;  1VQ4 A;  1VQ6 T;  2IG0 A;  3QDR B;  4LDU A;  4J6X A;  2IVW A;  3GLX A;  2EJG A;  2CKK A;  4C8Q F;  2RM4 A;  1N27 A;  1M90 U;  3CPF A;  3URG A;  2RK2 A;  3MEU A;  5GMK m;  4E7I A;  1YI2 A;  3A8G B;  2EQJ A;  2K57 A;  3HP9 A;  2E5Q A;  1W2B A;  1I81 A;  5L8R E;  3RMQ A;  5KE3 A;  3I55 A;  3OQ5 A;  1VQK T;  1G3T A;  1WQW A;  4N4H A;  4QQD A;  4F7U B;  4BAC A;  3GNG A;  2GFU A;  4M77 B;  4DQ2 A;  4E7L A;  4F7U A;  3S3M A;  4M7A G;  3M9Q A;  3OYC A;  4M77 A;  2EYQ A;  2HQE A;  4KUI A;  2Y4Y A;  4OP0 A;  3T9N A;  3JSC A;  3WVD B;  3PIP A;  3JCM J;  2EFI A;  1K9M C;  1QP2 A;  4D6W A;  4ME7 A;  2CZ7 B;  4M7D F;  3V8K A;  1VQL T;  2DO3 A;  3HHT B;  2KMT A;  3RKX A;  4ZTJ A;  4MZM A;  3SWN B;  1LNX A;  4ELZ C;  2MI6 A;  2VUB A;  3SWN A;  5KE2 A;  4JS4 A;  4C92 G;  1FWZ A;  4VUB A;  5D6W A;  4EMK B;  4OB1 B;  2FL7 A;  4MZT A;  4QVZ A;  2P0P A;  3KXT A;  4GLK A;  3X25 B;  3OYG A;  4M7D D;  2EWN A;  1KHI A;  3MP1 A;  4Y28 E;  4EMK A;  3EFS A;  3J80 E;  3SDZ A;  3MEA A;  5GAN d;  2D9T A;  4RG8 A;  3SWN C;  4J83 A;  4C8Q G;  2DTH A;  2BUD A;  4MDW A;  3JCM d;  4IUP A;  4WF2 A;  4BY6 B;  1OYX A;  2MWP A;  4J7F A;  5GAO q;  3CC7 T;  2ZPH B;  2ZPB B;  5GAM f;  1ZBX A;  4HA8 A;  2A7Y A;  4DA4 A;  3JB9 J;  4EMK C;  2XHC A;  2O4X B;  2QQR A;  4OGC A;  5I2M A;  2EQM A;  2KK4 A;  3VUZ A;  4PNO A;  2DVE A;  1YIT A;  1QVG A;  2PVD B;  2DEQ A;  2WAC A;  5A0L A;  1VQN T;  2O4X A;  4NOY A;  1NPP A;  1YJN A;  3V8J A;  1W4S A;  3QG1 A;  2VV5 A;  2ZGW A;  3FJP A;  3HPW A;  4BY6 C;  1VUB A;  5A0G A;  2RD1 A;  3OYL A;  3C94 A;  4BUG A;  5GMK i;  3FDR A;  5KCH A;  3CXC S;  3HFO A;  1VQ5 T;  4HCB A;  5LJ5 j;  4F7U E;  2DZC A;  1QVF A;  4RCC A;  3ZBD A;  2DD4 A;  3CBP A;  4Y91 A;  2DXU A;  2ZCF B;  5GAN 2;  1UEB A;  3NTK A;  5GAO p;  4N4G A;  1VQP T;  3CPW A;  3CMA T;  2XDB A;  4MDX A;  4O6J A;  2Y4X A;  3MP6 A;  4C5E A;  5LJ3 j;  3ZEH A;  5KCO A;  1KQ1 A;  2MAM A;  5GAO r;  4FSX A;  5GAN 6;  3OS5 A;  3CCU T;  4M7D C;  4X9C A;  3OSS C;  3E19 A;  3J81 E;  2VGM A;  1M1K C;  4BDY A;  1YIJ A;  1UB4 A;  1N8R U;  2E64 A;  2QDY B;  5GAN 3;  1KD1 U;  1Y07 A;  2EQK A;  5CQX A;  5I2S A;  5DY9 A;  3CME A;  2LT1 A;  3G4S A;  4C0Z A;  5IT9 E;  2VYT A;  1WJS A;  2JNG A;  2EJ9 A;  2PVG B;  3QJ6 A;  2QQ9 A;  2K5F A;  1VQ9 T;  2HQX A;  2OTJ A;  4KBM B;  4ZGE B;  2MWO A;  4LD9 K;  1JJ2 A;  3LX7 A;  1V29 B;  4DOV A;  1BIA A;  4BE2 A;  1ZQ1 A;  1M1F A;  2RJC A;  2WSF E;  4M75 F;  5I21 A;  3S3N A;  3BDL A;  1Q7Y C;  1OZ3 A;  2GCX A;  3PMI A;  3PT9 A;  1VIF A;  4JS5 A;  4QW2 A;  2YLC A;  3PGG A;  4HT8 A;  2LDM A;  1VQO T;  1PSE A;  4M7A F;  3SB2 A;  1WQ7 A;  1H64 1;  3CCL T;  1VQK A;  1ZHI A;  3LH0 A;  5FU6 B;  3X28 B;  4E7J A;  3L2V A;  3E9G A;  3CXC A;  4OVA A;  2QTX A;  3M59 A;  4PJO F;  3CC4 A;  1UGR B;  3P8D A;  1XNI A;  3M4G A;  4M7D E;  3L2W A;  3S6W A;  5CR2 A;  3GIB A;  2DTI A;  2CS7 A;  3QO3 A;  4M7A D;  3L2Z A;  5GAN g;  1YJ9 A;  2VXF A;  1Y71 A;  2ZPF B;  3N5B B;  5AYF A;  2JOY A;  5HK0 A;  1WPY A;  5GAN j;  1YHQ T;  1VQL A;  4C92 F;  3JCM g;  3O8V A;  4X9D A;  4PJO D;  4OF1 A;  2QEX T;  1H3Z A;  2KAF A;  1FXX A;  2ZPG B;  1U1T A;  4BI4 A;  2WSE E;  4NL2 A;  2DIG A;  3CCV A;  4M78 G;  3A8O B;  2HD0 A;  1OZ2 A;  1QVG S;  4C92 D;  3OBY A;  2EJF A;  4C0G A;  4O5V A;  4Q5W A;  4A4E A;  2KY9 A;  5CK9 A;  2B8A A;  3MEV A;  4M75 G;  5GAO l;  2A3L A;  4R55 A;  2CYZ B;  4QQ6 A;  1VQ7 T;  3FLG A;  5LJ3 f;  3OYN A;  1JBM A;  3CC7 A;  3CD6 T;  4FT4 A;  2RI5 A;  3GNF B;  3GOX A;  4C8Q D;  3JCM P;  4M7A A;  3JB9 F;  3ME9 A;  2FHD A;  1QVF S;  1BYM A;  4R56 A;  2DPP B;  5GAM e;  3CCE T;  1KQ2 A;  2EIF A;  2LX9 A;  1N9S A;  3CBM A;  2E12 A;  4J7I A;  2GFA A;  3LGL A;  4XTX A;  3RUX A;  2LCL A;  3VYH B;  5GAN h;  4PJO G;  3OA6 A;  3CPW S;  2C06 A;  4OB3 B;  1WGS A;  5GMK e;  3JCM h;  3F70 A;  2K3Y A;  3OYJ A;  4M7A C;  3LYI A;  2VGN A;  3UWN A;  3JCM V;  3PMT A;  2DXC A;  2XKO C;  3M53 A;  3VYG A;  3PTA A;  5IN1 A;  1VQM A;  1S72 T;  1VQ5 A;  4A53 A;  2E6Z A;  2LRQ A;  3JB9 D;  1NJI C;  1M1G A;  3V7C A;  4C92 B;  1K73 U;  4PJO C;  1YJW T;  3OYF A;  1VQP A;  4C92 A;  1EIF A;  5CCA A;  4IUV A;  3CCM T;  3WVE B;  1FX7 A;  3DKM A;  1BI0 A;  2BKD N;  4C8Q B;  4DOW A;  2ZZD A;  4M77 G;  5FRO A;  3CC2 A;  1BI3 A;  1TH7 A;  3CCQ T;  3CCU A;  3TEE A;  2KVQ G;  4C8Q A;  3QZ5 B;  4ZN3 A;  4C92 C;  5A2Q E;  1Q86 U;  3MHX A;  3DLM A;  1BI1 A;  2X35 A;  2RHY A;  1JJ2 S;  4QQG A;  3CCS A;  1Q81 C;  1K8A U;  1VQ8 T;  2YRV A;  1RL2 A;  2E65 A;  5GAM d;  2BIV A;  2X4W A;  4ZN1 A;  3ER0 A;  2LNV A;  4JRK A;  1VQ4 T;  4C8Q C;  3V7S A;  3JB9 H;  4JRI A;  4JUV A;  1IZ6 A;  4CRI A;  2EAY A;  4TVR A;  3TU4 K;  4HT9 A;  1BI2 A;  5J39 A;  1VQ9 A;  4A4F A;  3SFM A;  1Q82 U;  4LDV A;  3A8L B;  3JB9 G;  1M90 C;  2XD0 A;  5GAO n;  3MEW A;  1M8V A;  3EAE A;  2E70 A;  4L59 A;  2M9U A;  5D6X A;  2L8D A;  2XDP A;  3TRE A;  4A4H A;  4M7A E;  4J6Y A;  4M7D B;  4C0D B;  3HFN A;  2E41 A;  3NFC A;  3KUF A;  1XOV A;  3M57 A;  4HCC A;  2KQW A;  1NZ9 A;  1GXI E;  4BE0 A;  2V8J A;  1MGQ A;  4RMO A;  4PJO E;  1QP3 A;  1UGS B;  1G3Y A;  3BDU A;  4RCB A;  4X34 A;  4XTV A;  2L3R A;  3DB3 A;  3JCM X;  3CCL A;  3QYH B;  4ATO A;  1X75 C;  2K4Y A;  3INZ A;  3JRZ A;  3QHS A;  4C0D C;  4JDS A;  5EG2 A;  5M9O A;  1WJQ A;  3OYD A;  2K2V A;  4L5G A;  4C92 E;  1WJR A;  1KQS A;  2G3R A;  3GP8 A;  3G6E T;  3KBG A;  2P4T A;  2QA4 T;  3A8M B;  4LDW A;  1I8F A;  4II1 A;  5CVI A;  2YHT A;  5DLO A;  2KDS A;  4FM4 B;  2RI2 A;  4C8Q E;  3OBW A;  3X24 B;  3M55 A;  1BKB A;  2QQA A;  2JN0 A;  2MF2 A;  3DB4 A;  4M78 F;  4EMH A;  3G71 A;  1VQ6 A;  2JTF A;  4FU6 A;  4C0F A;  4EDU A;  3QPH A;  2RO0 A;  5J26 A;  1WNL A;  3UDC A;  5GMK l;  4E7H A;  4ZTF A;  1N9R A;  1U1S A;  5DM7 R;  1KG1 A;  3BY7 A;  2RJD A;  2RA2 A;  2RHZ A;  4XQ3 A;  5LJ5 e;  4BDZ A;  4JJN K;  3OYM A;  3L1A A;  1VQ7 A;  4M78 D;  3AHU A;  2DD5 A;  3JCM b;  2DIQ A;  2RHI A;  3RIR A;  5FLX E;  4XU0 A;  3CD6 A;  1O9S A;  2RH2 A;  1YIT T;  2PUK B;  4M75 D;  5LJ3 e;  3CCR T;  5CKH A;  3Q1J A;  3CCE A;  3L2R A;  3VV0 A;  3A8H B;  1N6A A;  1NE8 A;  1K9M U;  3WXM B;  3JCM c;  3OSV A;  2LC4 A;  2LT4 A;  2ZPE B;  3V7R A;  4N0A A;  1S72 A;  2PUO B;  2QXF A;  1U8R A;  5CO7 A;  2OTL T;  3S3O A;  3QSU A;  1XQH A;  2M0O A;  4F7U F;  3RMS A;  2DTO A;  2E1H A;  3VU3 C;  5GAM g;  1VIE A;  4M77 F;  3VKI A;  4LDY A;  5GAM j;  4M78 B;  4RG2 A;  4ZGD B;  4PKC C;  3I56 T;  3FEO A;  3M4Y A;  4BI3 A;  3QBY A;  3JCM W;  4NS5 A;  4OGE A;  1G5V A;  2OAU A;  2P0Q A;  2R58 A;  3M58 A;  4M78 A;  4N0A C;  2X4J A;  5FU7 B;  5LJ5 f;  3LWH A;  2DZ9 A;  3GF5 A;  4M75 B;  4C5I A;  5LJ5 d;  4KUL A;  2XK0 A;  4FIB A;  4PLL A;  5CAI A;  1N8R C;  4FL6 A;  3X20 B;  3LGF A;  4FT2 A;  1YBY A;  1KD1 C;  4M75 A;  2M16 A;  3PNW C;  1JB0 E;  2XIC A;  2PVO B;  3VUB A;  2XU8 A;  3OYB A;  2R5M A;  4M7A B;  4M77 D;  5LJ3 d;  3MCA B;  4OB0 B;  1VQ8 A;  4M78 C;  3OS0 A;  2F69 A;  3CCJ T;  5IAY A;  2R5A A;  4MMK A;  5GAN 5;  3BFM A;  5FU7 C;  3RKY A;  4PJO B;  3QXE B;  1UGQ B;  4M75 C;  4M7D A;  1VQN A;  3OW2 A;  1MHN A;  4PJO A;  1PSF A;  1D3B B;  4IUQ A;  4OMF B;  2EQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...