4C8QC

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
79
structure length
79
Chain Sequence
METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 13
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qC00
4C8QC 3JCMJ 3RUXA 1D3BA 5GAN5 1I8FA 4M75A 3RKYA 1I81A 2DTOA 2DXTA 3RKXA 4JRIA 4RCCA 3V7SA 1KQ2A 5LJ3j 4M7DE 3BW1A 2JN0A 4M7DF 3HSBA 4XTVA 4JLIA 1I5LA 4C8QE 3AHUA 4V2SA 5GAN7 4M7DD 4M7AA 3QO3A 4WF2A 3BY7A 4C8QG 2EJFA 4M7DC 3V7CA 5GAN6 3QHSA 4RCBA 3FJPA 3JCMh 4M78D 1WQ7A 4M77B 4PJOA 4J6XA 5LJ5j 4XU1A 3JB9J 4J6YA 3JCMP 5LJ5d 3JB9I 4X9DA 4HT9A 3QSUA 4N0AA 4M78G 2RM4A 3BDUA 4PNOA 5GAOl 4F7UA 3JCMV 4EMKA 5DY9A 1LJOA 5I21A 1N9RA 4EMHA 4M78B 5LJ3d 3JCMc 4PJOC 3JCMf 3JCMg 3VU3C 3SWNB 5GAOp 4PJOD 2EJGA 1M5Q1 1YCYA 2QTXA 4C92F 1HXDA 1U1SA 5GMKh 4N0AC 4M7DB 2ZGWA 2DZ9A 2FYKA 4XTXA 3JCMe 1MGQA 4M77F 5LJ3e 1KQ1A 5GAOr 1B34A 5GMKi 4NOYA 5GAN2 1BIBA 4M77C 2E1HA 2DXUA 4EMKC 3JCMb 5GANd 2EAYA 4DQ2A 5GAMf 5GAMg 5GAOn 3JB9F 4M77D 1B34B 1JRIA 2DZCA 3RKWA 4OP0A 3BFMA 1WQWA 4C92A 5GANj 3SB2A 4F7UG 4F7UB 4M7AG 2DKGA 3RIRA 1U1TA 4JUVA 4M77E 2VC8A 4M78E 3HFOA 4PJOF 3SWNA 5GANg 5GANf 3JCMW 3L1AA 4XTZA 4PJOG 3RESA 1LOJA 3M4GA 2DJZA 3QUIA 2E41A 5GMKl 3JCMQ 1WPYA 3V8JA 5LJ5h 1M8VA 2DVEA 4HA8A 3V7RA 3INZA 4JRKA 1Y96B 4C92C 1D3BB 1N9SA 4M78C 4C8QA 4NL3A 4J6WA 3HFNA 4XU0A 4A53A 4HT8A 5GMKm 2RA2A 4J5YA 5GAOq 4PJOB 3EFRA 5LJ3h 4M75E 4F7UF 2CGHA 5GAN4 1BIAA 2FB7A 4C92E 4MMLA 2YLCA 4XU3A 5CAIA 4M7AD 3FIFA 5LJ5g 4M75G 4A54A 4EMKB 5LJ5f 3JB9D 2VXFA 4M7AC 2E10A 4M7AE 2E65A 4M78A 3JB9H 4QVDA 4M75F 4Y91A 4M77G 5GAN3 1WNLA 3V8LA 2EWNA 1HK9A 3JCMX 5LJ5e 1Y96A 5GANh 3RERA 3L2ZA 4XTYA 4F7UE 5GAMj 5GAN8 2DTIA 5GAMd 1LNXA 4M75D 2RD1A 3JB9G 4C8QF 4C8QB 4M7DA 2K57A 4XU2A 2YHTA 4MMKA 5GAOm 4M7DG 2DTHA 2EJ9A 3EFSA 3JCMd 4M7AF 4XTWA 4M78F 4PJOE 4C8QD 2VXEA 4M75B 2I2LA 2E64A 5GAMe 2DEQA 4XTUA 4C92B 3FB9A 1I4K1 4NL2A 1H641 3SWNC 4C92G 1TH7A 2Y90A 3V8KA 2YLBA 4M7AB 5GMKj 2RB6A 5GAMh 2HNIA 4XQ3A 4M75C 5LJ3f 5LJ3g 5GANe 4X9CA 4EMGA 1X01A 1JBMA 5GMKe 4QVCA 3PGGA 3GIBA 4C92D 4M77A
chains in the Genus database with same CATH superfamily
2RJEA 3GLXA 4JZ4A 3S3MA 3MJXA 4RCCA 3WXMB 1LCKA 1NZ9A 1I5LA 2RI3A 4C8QE 2DMOA 2YUQA 3TREA 1MMDA 3CC4A 3VS1A 4KRTA 5IN1A 3CCQT 1WLPB 5HK3A 3CCRQ 2L3RA 2NUPA 3PT9A 4LUEA 2PNIA 1RAHB 4M78G 1JJ2P 3CC2A 4F7UA 2P0PA 1PSFA 4F14A 1QP3A 3OW2A 1Z9QA 2G3RA 1NJIC 1M5Q1 2QTXA 1VQOA 1AWOA 4C5IA 4N0AC 3M56A 2M9UA 1ZA1B 3OSVA 2EAYA 1VQKT 4J9GA 4DA4A 2CZ7B 2HKQB 1MNDA 1OI1A 1OU9A 2YRDA 4XTZA 3M4GA 4JJCA 3CCEQ 2BIVA 4C8QA 1BI1A 4M78C 1YJNA 3CCQQ 4HT8A 1CKBA 4WTOB 2A0FB 2VVKA 1Q82C 2CGHA 4OMOA 1VQLA 2E6ZA 2ESWA 3FIFA 1PC0A 1ZSZB 1K73C 2DXBA 1R0BG 3DKMA 2X4JA 2K7AA 2FZGB 4R0KA 3L2ZA 3J81E 4FW1A 5FLXE 3MO8A 1VQ4T 3OBYA 2LC4A 3CD6A 1M3AA 4ZGEB 4E7HA 2HKNA 4E7KA 1VQ6T 2M0OA 1MUZA 3GIBA 2KYBA 3UT1A 3L2RA 4JJNK 3JSCA 2XICA 3C0CA 3UWNA 3OYIA 3DLLA 1EX4A 2DXTA 5KE2A 4GLMA 4A63B 3S3OA 1MV0B 1QCNA 2NLUA 1Q95G 4C5GA 3OW2S 1ABOA 3OYCA 2A7YA 4BI3A 1KFZA 1GCQC 4FSXA 1XOVA 2KVQG 2JZ2A 1IO6A 4HT9A 2FPEA 3M58A 1PG5B 1D1CA 4N0AA 1XQHA 2AKKA 1PRMC 4EMKA 4O6JA 5I21A 3FC3A 1WIEA 2DBMA 3OMGA 1VQKA 1ZSGA 3I9QA 2KR3A 3LYIA 4XTXA 2DETA 1UHCA 4M77F 1AOJA 2J7IA 1BI0A 2EW3A 5D6YA 5GANd 3CC7T 4C92A 3GF5A 1K0XA 1VQ4Q 1IREB 3SB2A 3NPFA 1JJ2S 2FRYA 1FMKA 4Y28E 4KGZB 3G71A 2E41A 2AIRB 4N4GA 4RKUE 4OGEA 1UTIA 2DF6A 1WXTA 3VS7A 2HCKA 2K5FA 1QVFP 2VV5A 1UGVA 2YXYA 3LW5E 1VQPA 1JO8A 2YLCA 1VQMT 4M75G 3QZ5B 5J26A 2X4WA 2LT4A 3JB9H 5FU6C 2QEXT 1N8RU 3CCJQ 1ARKA 1Z9ZA 2YHTA 5C0MA 2K2MA 3MCAB 1RLPC 4XTWA 4QT7A 2ECZA 3PVQA 4FT4A 1SG5A 3X25B 4MZPA 1YI2A 1H3ZA 3J7AF 3MEVA 1EZZB 2RHUA 3QWXX 1I8FA 4M75A 4IURA 3RKXA 3CCET 1W70A 2GFAA 3QKJA 3OYGA 2V1RA 2QYZA 2WSFE 1UB4A 1ZLMA 2JUFA 2L3SA 5KYWA 2JS2A 4M78D 2DK3A 1M1KC 1J3TA 1V76A 2CSQA 1VQ8A 2KI7A 4AT1B 2RHYA 3SFMA 5DM7R 2YRVA 4FT2A 1WHHA 1XTDA 4FL6A 3CCVQ 4NS5A 1MMAA 2QASA 2J6FA 3JCMf 2MWPA 3CCLT 3GP8A 2PQWA 1Q82R 3C4SA 2LX9A 3DLMA 1KQ1A 4EDUA 4M7DF 4BY6C 2GFUA 5GAOn 1YHQT 2E12A 1YITT 4F7UG 2DNUA 3TCJA 4ME7A 2E4HA 2FRWA 2VWFA 1JXMA 3CC4Q 1YI2T 3A98A 2L89A 4NL3A 2EGEA 1UJ0A 2XDDA 2J05A 1BI2A 3CC7Q 3META 2A37A 2VASA 3VS3A 1YFNA 2MMPA 5LJ5e 1Y96A 1D1AA 1VIEA 3KXTA 1ABQA 3NTKA 2QG9B 2QQ9A 1HD3A 3I56Q 2VGMA 4LD6A 4BB7A 2QQRA 2IPOB 5KYUA 3N5BB 2RJDA 3G4ST 1JBMA 1SKUB 1YJNQ 4ESRA 4C5EA 2DL4A 2ZPEB 2OI3A 3V7SA 4CC7A 2DA9A 4HVVA 1M2OA 4C0GA 4AFQC 5HK0A 3QJYA 2JN0A 2P0QA 2RO0A 3HSBA 2BZ8A 3OQ5A 2ZAEA 4J9CA 2HQEA 1X6BA 5CKFA 2KRMA 5L8RE 2EJFA 1OEBA 1WX6A 4F17A 2A08A 2DRKA 4JJBA 4XU1A 1QKXA 2EBPA 3H6ZA 3QDFA 1SF9A 7AT1B 3CD6Q 3URGA 3VU3C 1WGSA 3EHQA 2OTJQ 2FYKA 1UG1A 1Q86C 2JVVA 5GMKi 3VRYA 1K8AU 3HP9A 4IIOA 1OQKA 4M77D 3FRNA 3RKWA 3OS0A 1K9MR 5IHIA 4IUTA 3RR6A 4PJOF 1NE8A 3JCMW 2C0IA 3L1AA 1NEBA 4Z88A 1N8RC 2ED0A 1M90U 5GMKl 3V8JA 1Q7YU 3EG9B 1WHKA 4ATOA 3VKIA 4LDXA 3GBQA 4N4IA 2BZXA 4DBRA 1NJIR 5A0LA 1VQ7T 4F7UF 5GAN4 2AZVA 2PU9B 3HPWA 1P92A 4OB2B 4GBQA 4ZGDB 3HRUA 4QVDA 3M9QA 1OPKA 2JM8A 1HJDA 3OYBA 3UF4A 1YJ9Q 5GAMj 5GAN8 3M57A 3MHXA 4C0ZA 1G5VA 1RACB 3JCMd 2LP5A 2GGRA 4PJJA 3VUBA 1Q86R 1K73U 2DEQA 1NBEB 2SRCA 2K79A 1AHJB 3NTIA 1PSEA 1BBZA 4FYXB 4QQGA 3CCUQ 1ZHIA 4C8QC 1NLOC 1BCMA 3MKDA 2L0AA 5GJVB 3J80E 4J9FA 3REBB 1GFDA 3BY7A 4RTUA 1KIKA 2MF2A 1VQ7A 1QCOA 2EYYA 4PKCC 1K4US 2O9SA 4BY6B 4J6YA 1UJYA 1KHCA 3EGXB 2JTEA 5GAOl 3BDUA 3JCMV 5KCOA 1AWJA 3LX7A 5DLQE 3SWNB 2EJGA 3EH2A 3OYDA 5KYUB 1U3OA 4M7DB 1OX8A 3PIPA 2GTJA 3LLRA 2HMAA 2YUOA 4M77C 2XG8D 1SEMA 1M3CA 1VQ5A 3UA7A 2CP3A 2FL7A 1X27A 2NUTB 3NFCA 3OMCA 1ZX6A 5GANf 3OY9A 1LVKA 3RESA 1M4ZA 3JCMQ 4E7JA 2L2PA 2GQVA 2H3EB 3PMIA 3M0SA 4XU0A 1K8AC 1VQ6Q 1WJSA 3EFRA 2OX7A 3QBYA 1QVGA 5CKDA 2QQAA 2QEXA 4M7AE 3NHNA 4FYWB 2QQBA 4M77G 1QVPA 5HCKA 2XK0A 1AWXA 2DTIA 2EQUA 2R58A 1VQLT 2DE0X 2VXEA 3R6OA 1H92A 1IB8A 3CCST 1D09B 2KXDA 2YSQA 4XQ3A 3I5RA 2A28A 1XNIA 4BI8B 3P8BB 3UATA 4K11A 1KC8R 2ZPGB 4J7FA 3BE3A 4M77A 2CP2A 4L5GA 3A8MB 1VQ9A 1Q81C 2I0NA 3AT1B 1Q7YR 3ZL7C 4M7DE 2LX7A 5FU7B 2OJ2A 2LMJA 2QA4A 1K9MC 2JTFA 2LTOA 3NGPA 2DX1A 2JJ9A 4LDWA 2EVRA 4PL6A 5KYWB 1JXOA 2RJFA 3DB4A 1AVZC 2DPPB 3OYEA 2NUZA 1OOTA 2BE9B 2GNCA 1NYGA 3OS5A 3CCVT 4E47A 5KYYA 1HXDA 3CCJT 3M4YA 4RTZA 3X26B 4MZMA 3NMZC 2DZCA 2KGTA 2V8JA 3O8VA 2LJ3A 1FWZA 3RDVA 2XMFA 2GBQA 1G8XA 1U1TA 4JUVA 1C0MA 4OF1A 1LOJA 5FRNA 4GLKA 1YIJA 3G6EQ 4LUDA 1K73R 1WXUA 4LNPA 1SSHA 3OB9A 3PNWC 1W2BP 3QYHB 1ZQ1A 3JRZA 1YBYA 2FHDA 3QPHA 2RF0A 1VQOQ 2VXFA 5FROA 4B6MA 1WNLA 2L8DA 3WVDB 1IGUA 2VKNA 1PKTA 1VQPT 4OMQA 2MOXA 4AFSC 3GNFB 4M7DA 1CSKA 4J9EA 2QGGA 3CBPA 3S3NA 3VUZA 2X9HA 2I2LA 3Q1JA 1YJWT 5IH2A 1BYMA 1UFFA 2CDTA 2CP5A 2JXBA 1VQMQ 2PZ1A 1TH7A 2ZPIB 4J9IA 2DBKA 5LJ3f 3I55A 1W2BA 1M9SA 1D0ZA 5CO7A 4KBMB 3PMTA 2NUTA 2GF7A 3CC2T 1VQLQ 4AFZC 1GCQA 5EG2A 4FYYB 3X28B 3AHUA 1KG1A 2RQWA 1MMGA 4AG2C 5IXFA 3CQTA 3UA6A 1R8OB 1YJ9A 1TTHB 4JPBW 3V7CA 2AK5A 2BKDN 1S72A 1VQNA 4M77B 4B9WA 4X9DA 2DVJA 3HHTB 3T9NA 3QJ6A 4A4GA 1MMNA 2Y4XA 1YJWQ 4DEXA 2KDSA 1NPPA 1WHLA 2K6DA 2ENMA 2AHJB 3JCMc 1RAAB 1GCPA 2K3XA 3SD4A 2CREA 4LXCA 4KH1B 4C0DB 4ELYC 4IUPA 3JCMe 3CCUA 4OB3B 3U23A 3RBBB 4DQ2A 1GFCA 4PJMA 1WQWA 1GRIA 4QKUA 1FXXA 2LQKA 1PWTA 3HTRA 5KYXB 2CZ0B 1C1AA 3CPFA 4QQ6A 3VS4A 3CCEA 2FVUA 5ECAA 3QWYA 4HCBA 4LD9K 4N4HA 5GAOq 1AEYA 3IQLA 3X20B 1KJWA 1VA7A 1X2QA 2KNBB 4LDVA 2KMTA 5KH6A 2FG0A 1ZSZA 5A0GA 3SHWA 1ZA2B 2P4TA 2RI5A 3EG9A 2HSEB 2QAZA 5GAMd 4PJLA 2K5LA 5M9OA 2DL3A 1Q81U 4HKEA 1PCXA 2GTOA 1VQNT 1KD1U 2F2WA 3TVTA 3HKSA 2RI2A 5GAMe 1JEGA 3CCRT 4OMLA 2W0ZA 1FX7A 4PFZA 3V8KA 5GMKj 1B3QA 4M75C 5GANe 3LGFA 3ZEHA 2LT1A 1UGSB 1U5SA 4C92D 1QMCA 1NPRA 4BE0A 1PNJA 4J9HA 2F5KA 3CCUT 4E7LA 1F1BB 1WZOA 2CUDA 3LH0A 2QEXQ 1D0YA 3QZ9B 4L6V5 4M7DD 4OGCA 4JRQA 2HQHA 3G4SQ 3FJPA 4BE1A 2QDYB 5LJ5j 1HYOA 2EQMA 4HCKA 3JB9J 3E1SA 3M53A 4F04B 2ATCB 1TS9A 1AT1B 3CMAQ 1VQKQ 1K76A 1KK7A 3C95A 2VGNA 2C0TA 4FYVB 2DXUA 2RK2A 5IHKA 5GAMf 2EIFA 3BFMA 2B86A 4F16A 1GBQA 8ATCB 3RIRA 2K5IA 3HFOA 3CXCP 2LNHB 2EYXA 5LJ5h 3V7RA 4HA8A 3QIIA 2VUBA 2K3YA 2D0QB 1N9SA 1VQ8Q 5EC7A 1FMWA 2CH4W 3JAME 1ZUKA 4J5YA 2WSEE 4M75E 3PIOA 2JMCA 1M8MA 2ZPFB 2C0OA 2XHCA 4Y91A 2COWA 5KE3A 3A8LB 1VYVA 2FPFA 2KSSA 4OMMA 4F7UE 1LNXA 1V1CA 2RK1A 1SRMA 4IUVA 2E3IA 2LQWA 1M27C 2KXCA 3EFSA 4B9XA 1W2BS 3CCSA 1UHFA 3A1PA 1TOVA 4XTUA 4NL2A 1YI2Q 1UECA 3VS2A 2AT1B 3QYGB 8AT1B 2YLBA 1IHVA 5D6WA 1XJWB 2HNIA 2HSPA 1IGQA 5GAMh 4OB1B 1X01A 4MDWA 1G3SA 2MIOA 3PGGA 1KQSP 1VQ8T 3H8ZA 2RH2A 4YTLA 4LDUA 3RKYA 1M1FA 3FEOA 1AZGB 2M16A 2F69A 1K8AR 3G71T 2A36A 3EGUA 1QVGS 2W10A 2KT8A 3OBWA 2MPXC 1YHQQ 4RTTA 3JB9I 1MV3A 4JZ3A 4OVAA 3CMET 3CCVA 4LE9A 1K1ZA 1MNEA 3CEYA 2JW4A 3C12A 1U06A 2OAWA 3M55A 3A5ZB 2YWWA 1G3WA 1QQJA 2DZ9A 1Y0MA 3CC4T 2COYA 3UDCA 2C06A 4NOYA 5KYNA 1BIBA 3JCMb 1ZUYA 2NYSA 5CVIA 1E7OA 1M3BA 1X69A 4C5HA 4F7UB 4M7AG 1GL5A 3M0RA 2ABLA 4M77E 6AT1B 4BI4A 3G71Q 2CUBA 4OMFB 2JMAA 3G7ZA 1YITQ 3INZA 4JRKA 4AFUC 1BK2A 2LRQA 4BACA 2HL3A 1ZSZC 5LL6S 4A53A 2HQXA 4LN2A 4A4FA 2M51A 5GJWB 1VQ5T 4MMLA 1YIJT 4RTWA 4BUGA 4HVWA 5A2QE 2LJ1A 1W1FA 2EWNA 3ME9A 4JJDA 5CIUA 4C0DC 2DO3A 4C8QB 4XU2A 2HD0A 1QWEA 4PJOE 3C94A 2RHIA 4MZTA 5FRMA 2DL8A 4VUBA 2JNGA 4X34A 2OTLT 2ROTA 3EG0A 2WSCE 1TSFA 3ASKA 3LWHA 4EMGA 3ULRB 1X6GA 1I07A 5GAN5 1I81A 4JS4A 4A4HA 4XAXB 4EPCA 2KAFA 2KBTA 2LZ6B 1X2KA 2QQSA 1Q86U 4M7DC 3GOXA 1MHNA 4E2FB 2CP6A 1EFNA 2RM4A 1YJ9T 1TUCA 1ACMB 1SSFA 1N9RA 2L5QA 3OS1A 3JCMg 2COZA 4OMNA 4BDZA 1YCSB 3CCMQ 2X3XD 5IXBA 1JQQA 1MGQA 1IRXA 1V29B 2QK0A 4ZGJB 4FM4B 2CT3A 4BE2A 1JRIA 2CH4A 2ROLA 2JM9A 3EFOB 3MPUB 5I2MA 3TSWA 3OYYA 2KYMA 2PVOB 4D8DA 2QTVA 1ZUUA 3QUIA 3P8DA 1ZBXA 2DLPA 4EIKA 1S1NA 3HFNA 4RUGA 2DD5A 3CCQA 3E9GA 2GQIA 1QVFS 2RNAA 1WXBA 4E7SA 1BIAA 2FB7A 3TU4K 1FMVA 2CSIA 4TVRA 1JU5C 2E70A 5IHNA 2D1XA 4DOWA 3M0TA 2DIQA 3OYNA 1BI3A 1QWFA 2DTHA 5AYFA 1W4SA 3OYKA 4M78F 1PD0A 3MEAA 5FU7C 1UGQB 2QDLA 1TWBA 1H641 1OULA 3OYFA 1QVGP 5CQXA 1SPKA 1Q7YC 2IG0A 3JCMX 2RMOA 2WACA 3RMQA 4EMHA 1N8RR 1PD1A 4CI0C 1D3BA 1WHMA 5IAYA 2DTOA 4C0FA 2SEMA 3EGXA 1RADB 2EYWA 4XTVA 2GCXA 1KC8C 3VRZA 3CCLA 5I22A 2OTLQ 1M2VA 1N5ZA 3GNGA 4C8QG 1NYFA 1OU8A 2EKOA 5LJ5d 3RNJA 1KSWA 1TUGB 1BB9A 4DOVA 3L2WA 3CC2Q 3M5AA 2DERA 2K2VA 2O88A 1T3LA 4PJOC 3HRTA 5GAOp 3GPLA 5GMKh 2DM1A 1PKSA 1PM3A 2YUPA 3THKA 1S72T 4Z8AA 3RMSA 4AMCA 3OYMA 4KUDK 2BE7D 2L3QA 3SWNA 2AKLA 2BUDA 2MWOA 3CCMT 5D7UA 4J6WA 2CP7A 2RA2A 3EG3A 2DAQA 2NUPB 4UC4A 1R0CB 1M90C 5CAIA 2DD4A 1GXIE 1IXDA 1BKBA 2CZ6B 4M78A 3EG2A 3CCJA 4J9DA 3OS2A 4R55A 1K9AA 3G1JA 2LDMA 4OMPA 2LVMA 1R77A 2DFUA 2KRNA 2L3PA 3E2UA 2LCCA 3PE0A 1M1GA 1E6GA 1O75A 1TG0A 3H0FA 3EFOA 1X75C 1VQOT 3M54A 2Y90A 4KULA 3VV0A 3H41A 3OYAA 1RI9A 1VIFA 2DEUA 1VOMA 2HL5C 2M0YA 3HRSA 1EIFA 2LQ8A 3KFVA 4BD3A 5LJ3j 1U8RA 3OW2P 2LNVA 2MI6A 3VYHB 3X24B 1YWOA 4ZN3A 3M0UA 1VQ7Q 4ORZA 3PVLA 3JCMh 2KE9A 4AG1C 3JCMP 2ZPHB 3A8OB 2KQWA 3QSUA 5CR2A 4PNOA 1TU0B 5DY9A 1AWWA 4RTXA 3R6NA 3I55Q 1YCYA 3DB3A 2MK5A 4JLGA 1K9MU 5GAN2 2E6NA 3SEMA 2D8HA 2FZCB 2OAUA 2DL5A 3ZBDA 5GANg 4KT0E 4DEYA 2DIGA 1Q81R 1WPYA 1WHJA 1T3SA 1YIJQ 4C92C 2PTKA 2O01E 2F5TX 2EYQA 1OX9A 2PUKB 2M1HA 4CC2A 1VQPQ 4PFOA 4A4KA 2EQIA 3CMEQ 2LQNA 2E5QA 2HEQA 2J6KA 4A54A 3EH1A 1NJIU 2HBPA 2E65A 1QW1A 1HK9A 2ZCFB 5GANh 3RERA 1ZBJA 2XKOC 3E9FA 2RD1A 1NLPC 1RL2A 1QP2A 1YP5A 4CC3A 2CT4A 4M7AF 2X35A 4ZTJA 2B8AA 3EG1A 4M75B 4XK8E 5D6XA 4C92B 4R56A 3TEEA 5HKCA 5C6SA 4LDYA 1VQMA 2ED1A 4C92G 4M7AB 2XIDA 2DRMA 2XDBA 1E6HA 3CBOA 3FLGA 1KQSS 2KRSA 5J39A 3JCMJ 2J06A 4Y92A 4FW2A 4HVUA 1G3TA 2V26A 1UGPB 5KYXA 1SHFA 3BW1A 1Y57A 4V2SA 3LWIA 4KUIA 3MEWA 4DBQA 2QA4Q 2D9TA 4WF2A 1KD1R 2LCSA 1M2VB 9ATCB 4D6WA 1VQNQ 3EHRA 1NEGA 2YRCA 3PFSA 1WHGA 1N27A 4CRIA 4JRPA 1WJQA 2KEAA 1JB0E 1LJOA 3ER0A 1X6OA 4PJOD 2PVGB 3L2VA 2EQKA 5FW9A 1U1SA 4JDSA 3MP8A 4DBHA 5GAOr 1QVFA 1B34A 2X4YA 1AZEA 3JB9F 2YT6A 3CCLQ 3L42A 2VC8A 4M78E 2R5MA 5KYYB 3OSSC 2O2OA 4RTVA 3REAB 2O31A 4IUUA 1D3BB 2IVWA 1RAFB 4D8KA 2KROA 1BCOA 3CPWP 1KD1C 4PJOB 3VS0A 5LJ3h 1BU1A 4GY5A 3A8HB 4XU3A 2DXCA 1I0CA 3CMAA 4DBFA 5GAN3 1AD5A 4RMOA 3V8LA 4IKFA 1RAEB 2EGAA 2ZZDA 1QKWA 3JB9G 1VQ9T 1GBRA 4M7DG 1H8KA 1HSQA 5CKHA 1YNZA 2BTTA 2F2XA 1TXQA 1Q82U 4ZTFA 4E7ZA 2CKKA 4A4EA 3EGDA 2X3WD 2KY9A 2XI9A 1WA7A 2R57A 3F70A 3I5SA 4OB0B 3ZFJA 3EAEA 2YUNA 4O5VA 4JRIA 1KQ2A 2XDPA 2V8IA 5CCAA 1UGRB 2M02A 5HY6A 5CK9A 2MYSA 2O4XB 1RABB 4M7AA 3QO3A 3JV3A 4KH0B 2MAMA 1S72Q 3G4SA 1B07A 3H0HA 1WQ7A 4PFPA 4Z02A 1DJ7B 1SRLA 4ANJA 3CMAT 1KQSA 1G3YA 3CCSQ 1KC8U 2K4YA 3S6WA 3LH5A 2DYIA 4RTYA 2QA4T 2VYTA 2OTJT 4M78B 2G6FX 4MDXA 3CC7A 4II1A 3MP1A 4FSSA 2QGFB 5LJ3e 2E1HA 2J6OA 3CPWS 2EFIA 1W6XA 2RQTA 3MP6A 1Y07A 2P84A 2V1QA 2H8HA 3I56A 1OPLA 3MEUA 2O9VA 2RJCA 4IUQA 2PVDB 5A0DA 3QG1A 1M30A 2JT4A 3UPUA 2EPDA 5GMKm 1VQ6A 1YJNT 3VS6A 2HBWA 1M1KR 3KBGA 4J8OA 4WCIA 4M7AC 4ZN1A 2FO0A 4M75F 3OA6A 2P4RA 5FU6B 4C8QF 2CZ1B 3CD6T 1RAIB 2K57A 2K9GA 3WVEB 4MMKA 1WFWA 2PUOB 2D0NA 1H3HA 3CCRA 1D0XA 3M0PA 4P5NA 1RUWA 3SWNC 2RB6A 4ELZC 4ZNXA 2A3LA 1YITA 3I35A 4X9CA 2OTJA 2MCNA 3LGLA 5GMKe 4QVCA 1WI7A 3TSZA 2R5AA 2QXFA 3CMEA 2QI2A 4QVZA 2JS0A 3E19A 4FIBA 4JLIA 2E5KA 2FZKB 2Y4YA 5GAN7 3NTHA 4PK4A 2EKHA 3QHSA 4RCBA 1RI0A 4E6RA 3L2UA 1YHQA 4J6XA 2CP0A 5I2SA 2JOYA 2Z0WA 4L59A 4FCYA 2K3BA 2EQJA 1I1JA 1G2BA 2O4XA 2JTMA 2NWMA 2IIMA 1SHGA 4JS5A 3KUFA 2LCLA 4HCCA 1Y71A 5GANj 2X4XA 1UEBA 5GAMg 1VQ5Q 2D6FA 5DLOA 3H9NA 2DKGA 2VB6A 2DJQA 4J7IA 2FEIA 3OYHA 2HZYA 3BDLA 3FDRA 1M8VA 2DVEA 4M4ZA 1FYNA 4QW2A 1WYXA 2F2VA 2KT1A 1OZ2A 2RPNA 3VYGA 1VYUA 2XD0A 4RG2A 1Y7XA 4HXJA 3G6ET 4M7AD 5CQYA 5LJ5f 1RAGB 5AT1B 3JB9D 2HAXA 2AZSA 2P0KA 2RQUA 3CCMA 2DL7A 4XTYA 1WJRA 2RHXA 1WDXA 3O5ZA 1UDLA 5GAOm 5J3BA 1YN8A 2E64A 1RLQC 3QDRB 1NG2A 1G83A 4PJNA 3A8GB 2HDAA 1UUEA 5LJ3g 2RHZA 3H0IA 1LPLA 4KGXB 2CYZB 3I55T 4OP0A 3RUXA 3PTAA 1YWPA 2ZPBB 1C6VX 4E7IA 1X43A 1VQ4A 1QCFA 3D7SB 3OYLA 3SDZA 5GAN6 4QQDA 1N6AA 1IZ6A 5L23A 4BDYA 4J83A 3OYJA 4J9BA 4RG8A 1NM7A 3TQ7P 4PJOA 5KCHA 1T0HA 2FPDA 3I56T 1YJWA 2RQVA 1B7TA 5LJ3d 4Z89A 3VS5A 1K0SA 3L2QA 4X1VA 4C92F 1VUBA 2KK4A 2ZGWA 1PHTA 2RN8A 2D8JA 1VYTA 5FWCA 2E3HA 3CPWA 1QLYA 4EMKC 4CC4B 1M1KU 3M0QA 1B34B 4Q5WA 4KGVB 4FU6A 2DYBA 3CXCS 1IHWA 3M59A 2OTLA 4HCZA 3P8HA 1I5OB 4PJOG 1CKAA 2DJZA 2BZYA 3G6EA 2CS7A 2EYZA 3QXEB 1Y96B 1T0JA 1M90R 1TUDA 5CKBA 2XU8A 3CBMA 4PLLA 1VQ9Q 1O9SA 2YDLA 4C92E 1D1BA 2EGCA 2V8KA 4IIMA 3HL8A 5LJ5g 4EMKB 2RQRA 2E10A 1UE9A 1OZ3A 1PRLC 5CKEA 1KHIA 5FWBA 3VJPA 2DILA 4M75D 2EJ9A 3CXCA 1A0NB 4C8QD 1OYXA 3FJ5A 4PLIA 3FB9A 2H3JA 1I4K1 2LJ0A 5I11A 2F1LA 1OV3A 5IT9E 1JJ2A 2X51A 3EGDB
chains in the Genus database with same CATH topology
1ZHIA 4C8QC 3H8ZA 5J39A 3JCMJ 1VQ8T 2RH2A 4YTLA 4LDUA 2RJEA 3GLXA 3S3MA 1G3TA 3RKYA 1M1FA 4RCCA 1UGPB 3WXMB 3BW1A 1NZ9A 1I5LA 2RI3A 4C8QE 3FEOA 3J80E 2M16A 2F69A 3TREA 4V2SA 3G71T 3LWIA 4KUIA 3MEWA 1QVGS 3CC4A 2D9TA 4WF2A 3BY7A 3OBWA 2MF2A 1VQ7A 4D6WA 4PKCC 5IN1A 4BY6B 3CCQT 5HK3A 4J6YA 2L3RA 3PFSA 1KHCA 3PT9A 1N27A 4CRIA 3JB9I 1WJQA 4JRPA 4OVAA 5GAOl 4M78G 3BDUA 3CMET 4F7UA 2P0PA 3JCMV 3CC2A 1PSFA 3CCVA 1JB0E 1LJOA 5KCOA 3CEYA 3ER0A 1X6OA 3C12A 1QP3A 3LX7A 3M55A 5DLQE 3OW2A 3SWNB 2G3RA 2EJGA 3A5ZB 1M5Q1 2PVGB 2EQKA 2QTXA 1U1SA 3OYDA 4C5IA 3L2VA 4N0AC 1VQOA 3M56A 1G3WA 4JDSA 4M7DB 2M9UA 2DZ9A 3MP8A 3PIPA 3CC4T 3LLRA 3UDCA 5GAOr 1QVFA 1B34A 2C06A 3OSVA 4NOYA 1BIBA 4M77C 3JCMb 2XG8D 2EAYA 2X4YA 1VQ5A 1VQKT 3JB9F 2FL7A 5CVIA 4DA4A 4C5HA 3NFCA 4F7UB 2CZ7B 4M7AG 3OMCA 3L42A 1OI1A 4M77E 2VC8A 4M78E 4BI4A 2R5MA 5GANf 3OSSC 3OY9A 4XTZA 3RESA 4OMFB 1M4ZA 3JCMQ 3M4GA 4E7JA 3G7ZA 2BIVA 2GQVA 3INZA 4IUUA 4JRKA 3PMIA 1D3BB 4C8QA 1BI1A 4M78C 2LRQA 4BACA 1YJNA 4XU0A 2IVWA 4A53A 4HT8A 5LL6S 1K8AC 2HQXA 1KD1C 4PJOB 1WJSA 3EFRA 3QBYA 5LJ3h 4GY5A 4A4FA 1Q82C 2CGHA 3A8HB 1VQ5T 4MMLA 4XU3A 1YIJT 5CKDA 2DXCA 2QQAA 1QVGA 4BUGA 1VQLA 2E6ZA 3FIFA 2QEXA 3CMAA 5A2QE 1K73C 2DXBA 3DKMA 2X4JA 4M7AE 2QQBA 5GAN3 4M77G 4RMOA 3V8LA 2EWNA 4IKFA 1QVPA 3L2ZA 3ME9A 2XK0A 3J81E 2DTIA 2ZZDA 5CIUA 4C0DC 2EQUA 2DO3A 3JB9G 1VQ9T 4C8QB 2R58A 4XU2A 2HD0A 4M7DG 1VQLT 4PJOE 5FLXE 2VXEA 3MO8A 5CKHA 3C94A 2RHIA 3R6OA 4MZTA 1VQ4T 5FRMA 3OBYA 4VUBA 2LC4A 4ZTFA 1Q82U 3CCST 2JNGA 2CKKA 4X34A 2OTLT 3CD6A 2WSCE 4A4EA 3ASKA 4XQ3A 4ZGEB 4E7HA 2KY9A 1XNIA 3LWHA 2XI9A 4BI8B 4EMGA 4E7KA 2R57A 3P8BB 3F70A 1VQ6T 2M0OA 3GIBA 3UT1A 2ZPGB 4J7FA 4OB0B 3JSCA 4M77A 2XICA 3UWNA 3ZFJA 3L2RA 4JJNK 3EAEA 3OYIA 5GAN5 4L5GA 3DLLA 3A8MB 1VQ9A 1I81A 1Q81C 2DXTA 4JS4A 4O5VA 4JRIA 1KQ2A 4A4HA 2XDPA 4M7DE 5FU7B 5KE2A 2V8IA 5CCAA 3S3OA 1UGRB 5HY6A 5CK9A 2NLUA 2O4XB 4C5GA 3OW2S 4XAXB 4EPCA 2KAFA 4M7AA 3QO3A 2QA4A 1Q86U 2QQSA 3OYCA 2A7YA 4M7DC 4BI3A 3GOXA 1K9MC 1MHNA 2JTFA 2LTOA 2MAMA 3G4SA 4FSXA 1WQ7A 1XOVA 2KVQG 4Z02A 1DJ7B 4LDWA 3CMAT 4PL6A 2JZ2A 1KQSA 1G3YA 1KC8U 2K4YA 3S6WA 4HT9A 3M58A 2RJFA 3DB4A 4N0AA 2RM4A 1XQHA 1YJ9T 2QA4T 2DPPB 4EMKA 3OYEA 1SSFA 2VYTA 4O6JA 5I21A 1N9RA 2L5QA 4M78B 3OS1A 3FC3A 4MDXA 2OTJT 3CC7A 3OMGA 3JCMg 3OS5A 3CCVT 4E47A 4II1A 1VQKA 4BDZA 1HXDA 3CCJT 3LYIA 3MP1A 3M4YA 4XTXA 1MGQA 4M77F 1V29B 4ZGJB 5LJ3e 4FM4B 2E1HA 1BI0A 2EFIA 5D6YA 3X26B 5GANd 4MZMA 3CPWS 3MP6A 4BE2A 1JRIA 3CC7T 2DZCA 4C92A 3GF5A 2V8JA 3O8VA 1IREB 1Y07A 5I2MA 3SB2A 1FWZA 3I56A 3OYYA 1JJ2S 1U1TA 4JUVA 3MEUA 4Y28E 3G71A 2PVOB 4OF1A 1LOJA 2RJCA 3QUIA 2PVDB 2E41A 3P8DA 4IUQA 5A0DA 5FRNA 1ZBXA 4GLKA 4N4GA 4OGEA 4RKUE 1YIJA 3QG1A 3L2WA 3HFNA 2K5FA 2DD5A 3CCQA 3UPUA 2VV5A 3E9GA 3OB9A 3PNWC 5GMKm 1VQ6A 3LW5E 1VQPA 3QYHB 1YJNT 1QVFS 1ZQ1A 3JRZA 1YBYA 1BIAA 2FB7A 2YLCA 3KBGA 3TU4K 1VQMT 2FHDA 3QPHA 4M75G 3QZ5B 4J8OA 5J26A 2VXFA 2X4WA 4ZN1A 4M7AC 2LT4A 5FROA 4TVRA 3JB9H 5FU6C 4M75F 2QEXT 1WNLA 1N8RU 2E70A 3OA6A 2L8DA 3WVDB 1VQPT 4DOWA 5FU6B 2DIQA 3GNFB 3OYNA 4M7DA 4C8QF 2CZ1B 1BI3A 3CD6T 2K57A 3WVEB 2YHTA 2PUOB 3CBPA 4MMKA 5C0MA 2DTHA 3VUZA 3MCAB 5AYFA 3S3NA 1W4SA 3OYKA 4XTWA 4M78F 3MEAA 3CCRA 2I2LA 3Q1JA 4FT4A 5FU7C 3X25B 1YJWT 1BYMA 4P5NA 1UGQB 4MZPA 1YI2A 1H3ZA 1H641 3SWNC 3OYFA 3MEVA 5CQXA 1TH7A 3J7AF 2ZPIB 2RB6A 4ELZC 5LJ3f 2A3LA 3I55A 1YITA 1W2BA 2OTJA 4X9CA 1Q7YC 1M9SA 3LGLA 5GMKe 4QVCA 2IG0A 2RHUA 3JCMX 2WACA 5CO7A 3RMQA 4EMHA 2R5AA 4KBMB 4CI0C 1D3BA 3PMTA 1I8FA 4M75A 2GF7A 2QXFA 5IAYA 2DTOA 4IURA 3RKXA 4C0FA 3CMEA 3CC2T 3CCET 2QI2A 2GFAA 4QVZA 3QKJA 3E19A 4XTVA 4FIBA 2GCXA 4JLIA 1KC8C 5EG2A 3X28B 3CCLA 3AHUA 3OYGA 1KG1A 2WSFE 2Y4YA 1UB4A 5GAN7 3NTHA 1R8OB 3GNGA 4C8QG 1YJ9A 3V7CA 2JUFA 3QHSA 4RCBA 2BKDN 1RI0A 1S72A 1VQNA 4M78D 2DK3A 1M1KC 3L2UA 1YHQA 4M77B 4J6XA 4B9WA 1VQ8A 2EKOA 2RHYA 5LJ5d 3SFMA 5DM7R 4X9DA 2YRVA 3HHTB 4FT2A 3T9NA 5I2SA 2JOYA 1XTDA 3QJ6A 4DOVA 4L59A 3M5AA 2Y4XA 2EQJA 4FL6A 4A4GA 4NS5A 2K2VA 2KDSA 1NPPA 4PJOC 3JCMc 2AHJB 2K3XA 3HRTA 3SD4A 3JCMf 2O4XA 5GAOp 2MWPA 3GPLA 2JTMA 4C0DB 4ELYC 3CCLT 4IUPA 5GMKh 3GP8A 2PQWA 3JCMe 3C4SA 3CCUA 2LX9A 4JS5A 3KUFA 2LCLA 4HCCA 3DLMA 1KQ1A 1Y71A 4EDUA 4OB3B 5GANj 4M7DF 2X4XA 4BY6C 2GFUA 5GAOn 1UEBA 4DQ2A 5GAMg 1S72T 2D6FA 1YHQT 2E12A 1WQWA 1YITT 5DLOA 3RMSA 4F7UG 3OYMA 1FXXA 3TCJA 4ME7A 4KUDK 2DKGA 2LQKA 3SWNA 4J7IA 2BUDA 2CZ0B 3OYHA 3CPFA 2MWOA 3BDLA 3FDRA 1YI2T 1M8VA 4QQ6A 2DVEA 3CCEA 2FVUA 2L89A 4QW2A 4NL3A 3CCMT 4J6WA 4HCBA 4LD9K 1OZ2A 4N4HA 3VYGA 2RA2A 5GAOq 2DAQA 2XDDA 2XD0A 4RG2A 4UC4A 1Y7XA 1BI2A 3X20B 1M90C 3G6ET 5CAIA 4M7AD 2DD4A 5CQYA 5LJ5f 3JB9D 1BKBA 3META 2CZ6B 1GXIE 2HAXA 4LDVA 2KMTA 2P0KA 4M78A 5KH6A 3CCMA 2MMPA 3CCJA 5LJ5e 1Y96A 5A0GA 2P4TA 4XTYA 2RI5A 3OS2A 5GAMd 1WJRA 2RHXA 4R55A 1VIEA 2LDMA 2K5LA 5GAOm 5J3BA 5M9OA 3KXTA 1Q81U 2LVMA 4HKEA 3NTKA 2LCCA 2QQ9A 1VQNT 1KD1U 3HKSA 1M1GA 2E64A 2RI2A 5GAMe 2VGMA 4LD6A 3QDRB 3CCRT 4BB7A 2QQRA 1O75A 1X75C 1FX7A 3A8GB 3M54A 2Y90A 3V8KA 5GMKj 3N5BB 4KULA 1VQOT 5LJ3g 4M75C 3VV0A 5GANe 3OYAA 2RJDA 3G4ST 1JBMA 3LGFA 3ZEHA 2RHZA 2LT1A 1UGSB 2CYZB 4C92D 1VIFA 4OP0A 3I55T 3RUXA 1NPRA 3PTAA 4BE0A 4PJOD 4C5EA 2ZPBB 2ZPEB 3HRSA 2F5KA 1EIFA 3CCUT 2LQ8A 4E7LA 3V7SA 4E7IA 4BD3A 4C0GA 5HK0A 5LJ3j 2RO0A 2JN0A 2P0QA 3LH0A 3QJYA 1VQ4A 1U8RA 2LNVA 2MI6A 3OQ5A 3QZ9B 3VYHB 3HSBA 2HQEA 4L6V5 3X24B 4M7DD 5CKFA 4OGCA 3OYLA 5L8RE 3SDZA 4ZN3A 4JRQA 1NJIC 2EJFA 5GAN6 4QQDA 3FJPA 1N6AA 3JCMh 1IZ6A 4BDYA 4BE1A 4J83A 3OYJA 4RG8A 2QDYB 5LJ5j 4XU1A 4PJOA 2EQMA 3JCMP 3JB9J 5KCHA 2ZPHB 3E1SA 3A8OB 2KQWA 3M53A 3QSUA 3H6ZA 5CR2A 4PNOA 3I56T 1YJWA 5DY9A 5LJ3d 3URGA 3VU3C 3L2QA 1WGSA 1YCYA 4C92F 1VUBA 3DB3A 4JLGA 2KK4A 2ZGWA 2FYKA 3C95A 1Q86C 2VGNA 1K9MU 2JVVA 5GMKi 5GAN2 1K8AU 3CPWA 2DXUA 2E6NA 2RK2A 3HP9A 4EMKC 5GAMf 1M1KU 4M77D 1B34B 2EIFA 3FRNA 3RKWA 3OS0A 3BFMA 2OAUA 4Q5WA 4FU6A 4IUTA 3CXCS 3RIRA 2K5IA 3M59A 3ZBDA 4PJOF 2OTLA 3HFOA 4HCZA 5GANg 1NE8A 4KT0E 3JCMW 2DIGA 3L1AA 1N8RC 1M90U 3P8HA 4PJOG 5GMKl 2DJZA 1WPYA 3V8JA 5LJ5h 3V7RA 4HA8A 2CS7A 3QIIA 2VUBA 3QXEB 1Y96B 2K3YA 2D0QB 4C92C 2O01E 1Q7YU 1N9SA 2F5TX 3JAME 2EYQA 4ATOA 3VKIA 2PUKB 2M1HA 4J5YA 2XU8A 4N4IA 5CKBA 4LDXA 2WSEE 3CBMA 4M75E 4PLLA 1O9SA 4A4KA 5A0LA 4F7UF 3PIOA 1VQ7T 5GAN4 4C92E 2PU9B 2E5QA 3HPWA 2V8KA 1P92A 3HL8A 4OB2B 4A54A 4EMKB 3HRUA 4ZGDB 5LJ5g 1NJIU 2HBPA 2E10A 2ZPFB 2E65A 4QVDA 2XHCA 1QW1A 3M9QA 4Y91A 1OZ3A 5KE3A 3A8LB 1HK9A 2ZCFB 1KHIA 5CKEA 3VJPA 5GANh 3OYBA 2KSSA 5GAMj 3M57A 4F7UE 5GAN8 3RERA 1LNXA 2XKOC 3E9FA 2RD1A 4M75D 2RK1A 1RL2A 1QP2A 3MHXA 4IUVA 4C0ZA 1G5VA 3G6EA 2EJ9A 3CXCA 3EFSA 3JCMd 4M7AF 2X35A 4B9XA 4ZTJA 4C8QD 2B8AA 3VUBA 4M75B 1W2BS 1OYXA 4XK8E 3CCSA 1K73U 5D6XA 2DEQA 4XTUA 4PLIA 4C92B 4R56A 3FB9A 2H3JA 1I4K1 4NL2A 3TEEA 5C6SA 5HKCA 4LDYA 1VQMA 3QYGB 4C92G 2YLBA 4M7AB 2XIDA 5D6WA 1AHJB 2HNIA 3NTIA 5GAMh 5IT9E 1JJ2A 1PSEA 2XDBA 3CBOA 3FLGA 4OB1B 1X01A 4MDWA 1KQSS 1G3SA 4QQGA 3PGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q C;  3JCM J;  3RUX A;  1D3B A;  5GAN 5;  1I8F A;  4M75 A;  3RKY A;  1I81 A;  2DTO A;  2DXT A;  3RKX A;  4JRI A;  4RCC A;  3V7S A;  1KQ2 A;  5LJ3 j;  4M7D E;  3BW1 A;  2JN0 A;  4M7D F;  3HSB A;  4XTV A;  4JLI A;  1I5L A;  4C8Q E;  3AHU A;  4V2S A;  5GAN 7;  4M7D D;  4M7A A;  3QO3 A;  4WF2 A;  3BY7 A;  4C8Q G;  2EJF A;  4M7D C;  3V7C A;  5GAN 6;  3QHS A;  4RCB A;  3FJP A;  3JCM h;  4M78 D;  1WQ7 A;  4M77 B;  4PJO A;  4J6X A;  5LJ5 j;  4XU1 A;  3JB9 J;  4J6Y A;  3JCM P;  5LJ5 d;  3JB9 I;  4X9D A;  4HT9 A;  3QSU A;  4N0A A;  4M78 G;  2RM4 A;  3BDU A;  4PNO A;  5GAO l;  4F7U A;  3JCM V;  4EMK A;  5DY9 A;  1LJO A;  5I21 A;  1N9R A;  4EMH A;  4M78 B;  5LJ3 d;  3JCM c;  4PJO C;  3JCM f;  3JCM g;  3VU3 C;  3SWN B;  5GAO p;  4PJO D;  2EJG A;  1M5Q 1;  1YCY A;  2QTX A;  4C92 F;  1HXD A;  1U1S A;  5GMK h;  4N0A C;  4M7D B;  2ZGW A;  2DZ9 A;  2FYK A;  4XTX A;  3JCM e;  1MGQ A;  4M77 F;  5LJ3 e;  1KQ1 A;  5GAO r;  1B34 A;  5GMK i;  4NOY A;  5GAN 2;  1BIB A;  4M77 C;  2E1H A;  2DXU A;  4EMK C;  3JCM b;  5GAN d;  2EAY A;  4DQ2 A;  5GAM f;  5GAM g;  5GAO n;  3JB9 F;  4M77 D;  1B34 B;  1JRI A;  2DZC A;  3RKW A;  4OP0 A;  3BFM A;  1WQW A;  4C92 A;  5GAN j;  3SB2 A;  4F7U G;  4F7U B;  4M7A G;  2DKG A;  3RIR A;  1U1T A;  4JUV A;  4M77 E;  2VC8 A;  4M78 E;  3HFO A;  4PJO F;  3SWN A;  5GAN g;  5GAN f;  3JCM W;  3L1A A;  4XTZ A;  4PJO G;  3RES A;  1LOJ A;  3M4G A;  2DJZ A;  3QUI A;  2E41 A;  5GMK l;  3JCM Q;  1WPY A;  3V8J A;  5LJ5 h;  1M8V A;  2DVE A;  4HA8 A;  3V7R A;  3INZ A;  4JRK A;  1Y96 B;  4C92 C;  1D3B B;  1N9S A;  4M78 C;  4C8Q A;  4NL3 A;  4J6W A;  3HFN A;  4XU0 A;  4A53 A;  4HT8 A;  5GMK m;  2RA2 A;  4J5Y A;  5GAO q;  4PJO B;  3EFR A;  5LJ3 h;  4M75 E;  4F7U F;  2CGH A;  5GAN 4;  1BIA A;  2FB7 A;  4C92 E;  4MML A;  2YLC A;  4XU3 A;  5CAI A;  4M7A D;  3FIF A;  5LJ5 g;  4M75 G;  4A54 A;  4EMK B;  5LJ5 f;  3JB9 D;  2VXF A;  4M7A C;  2E10 A;  4M7A E;  2E65 A;  4M78 A;  3JB9 H;  4QVD A;  4M75 F;  4Y91 A;  4M77 G;  5GAN 3;  1WNL A;  3V8L A;  2EWN A;  1HK9 A;  3JCM X;  5LJ5 e;  1Y96 A;  5GAN h;  3RER A;  3L2Z A;  4XTY A;  4F7U E;  5GAM j;  5GAN 8;  2DTI A;  5GAM d;  1LNX A;  4M75 D;  2RD1 A;  3JB9 G;  4C8Q F;  4C8Q B;  4M7D A;  2K57 A;  4XU2 A;  2YHT A;  4MMK A;  5GAO m;  4M7D G;  2DTH A;  2EJ9 A;  3EFS A;  3JCM d;  4M7A F;  4XTW A;  4M78 F;  4PJO E;  4C8Q D;  2VXE A;  4M75 B;  2I2L A;  2E64 A;  5GAM e;  2DEQ A;  4XTU A;  4C92 B;  3FB9 A;  1I4K 1;  4NL2 A;  1H64 1;  3SWN C;  4C92 G;  1TH7 A;  2Y90 A;  3V8K A;  2YLB A;  4M7A B;  5GMK j;  2RB6 A;  5GAM h;  2HNI A;  4XQ3 A;  4M75 C;  5LJ3 f;  5LJ3 g;  5GAN e;  4X9C A;  4EMG A;  1X01 A;  1JBM A;  5GMK e;  4QVC A;  3PGG A;  3GIB A;  4C92 D;  4M77 A; 
#chains in the Genus database with same CATH topology
 2RJE A;  3GLX A;  4JZ4 A;  3S3M A;  3MJX A;  4RCC A;  3WXM B;  1LCK A;  1NZ9 A;  1I5L A;  2RI3 A;  4C8Q E;  2DMO A;  2YUQ A;  3TRE A;  1MMD A;  3CC4 A;  3VS1 A;  4KRT A;  5IN1 A;  3CCQ T;  1WLP B;  5HK3 A;  3CCR Q;  2L3R A;  2NUP A;  3PT9 A;  4LUE A;  2PNI A;  1RAH B;  4M78 G;  1JJ2 P;  3CC2 A;  4F7U A;  2P0P A;  1PSF A;  4F14 A;  1QP3 A;  3OW2 A;  1Z9Q A;  2G3R A;  1NJI C;  1M5Q 1;  2QTX A;  1VQO A;  1AWO A;  4C5I A;  4N0A C;  3M56 A;  2M9U A;  1ZA1 B;  3OSV A;  2EAY A;  1VQK T;  4J9G A;  4DA4 A;  2CZ7 B;  2HKQ B;  1MND A;  1OI1 A;  1OU9 A;  2YRD A;  4XTZ A;  3M4G A;  4JJC A;  3CCE Q;  2BIV A;  4C8Q A;  1BI1 A;  4M78 C;  1YJN A;  3CCQ Q;  4HT8 A;  1CKB A;  4WTO B;  2A0F B;  2VVK A;  1Q82 C;  2CGH A;  4OMO A;  1VQL A;  2E6Z A;  2ESW A;  3FIF A;  1PC0 A;  1ZSZ B;  1K73 C;  2DXB A;  1R0B G;  3DKM A;  2X4J A;  2K7A A;  2FZG B;  4R0K A;  3L2Z A;  3J81 E;  4FW1 A;  5FLX E;  3MO8 A;  1VQ4 T;  3OBY A;  2LC4 A;  3CD6 A;  1M3A A;  4ZGE B;  4E7H A;  2HKN A;  4E7K A;  1VQ6 T;  2M0O A;  1MUZ A;  3GIB A;  2KYB A;  3UT1 A;  3L2R A;  4JJN K;  3JSC A;  2XIC A;  3C0C A;  3UWN A;  3OYI A;  3DLL A;  1EX4 A;  2DXT A;  5KE2 A;  4GLM A;  4A63 B;  3S3O A;  1MV0 B;  1QCN A;  2NLU A;  1Q95 G;  4C5G A;  3OW2 S;  1ABO A;  3OYC A;  2A7Y A;  4BI3 A;  1KFZ A;  1GCQ C;  4FSX A;  1XOV A;  2KVQ G;  2JZ2 A;  1IO6 A;  4HT9 A;  2FPE A;  3M58 A;  1PG5 B;  1D1C A;  4N0A A;  1XQH A;  2AKK A;  1PRM C;  4EMK A;  4O6J A;  5I21 A;  3FC3 A;  1WIE A;  2DBM A;  3OMG A;  1VQK A;  1ZSG A;  3I9Q A;  2KR3 A;  3LYI A;  4XTX A;  2DET A;  1UHC A;  4M77 F;  1AOJ A;  2J7I A;  1BI0 A;  2EW3 A;  5D6Y A;  5GAN d;  3CC7 T;  4C92 A;  3GF5 A;  1K0X A;  1VQ4 Q;  1IRE B;  3SB2 A;  3NPF A;  1JJ2 S;  2FRY A;  1FMK A;  4Y28 E;  4KGZ B;  3G71 A;  2E41 A;  2AIR B;  4N4G A;  4RKU E;  4OGE A;  1UTI A;  2DF6 A;  1WXT A;  3VS7 A;  2HCK A;  2K5F A;  1QVF P;  2VV5 A;  1UGV A;  2YXY A;  3LW5 E;  1VQP A;  1JO8 A;  2YLC A;  1VQM T;  4M75 G;  3QZ5 B;  5J26 A;  2X4W A;  2LT4 A;  3JB9 H;  5FU6 C;  2QEX T;  1N8R U;  3CCJ Q;  1ARK A;  1Z9Z A;  2YHT A;  5C0M A;  2K2M A;  3MCA B;  1RLP C;  4XTW A;  4QT7 A;  2ECZ A;  3PVQ A;  4FT4 A;  1SG5 A;  3X25 B;  4MZP A;  1YI2 A;  1H3Z A;  3J7A F;  3MEV A;  1EZZ B;  2RHU A;  3QWX X;  1I8F A;  4M75 A;  4IUR A;  3RKX A;  3CCE T;  1W70 A;  2GFA A;  3QKJ A;  3OYG A;  2V1R A;  2QYZ A;  2WSF E;  1UB4 A;  1ZLM A;  2JUF A;  2L3S A;  5KYW A;  2JS2 A;  4M78 D;  2DK3 A;  1M1K C;  1J3T A;  1V76 A;  2CSQ A;  1VQ8 A;  2KI7 A;  4AT1 B;  2RHY A;  3SFM A;  5DM7 R;  2YRV A;  4FT2 A;  1WHH A;  1XTD A;  4FL6 A;  3CCV Q;  4NS5 A;  1MMA A;  2QAS A;  2J6F A;  3JCM f;  2MWP A;  3CCL T;  3GP8 A;  2PQW A;  1Q82 R;  3C4S A;  2LX9 A;  3DLM A;  1KQ1 A;  4EDU A;  4M7D F;  4BY6 C;  2GFU A;  5GAO n;  1YHQ T;  2E12 A;  1YIT T;  4F7U G;  2DNU A;  3TCJ A;  4ME7 A;  2E4H A;  2FRW A;  2VWF A;  1JXM A;  3CC4 Q;  1YI2 T;  3A98 A;  2L89 A;  4NL3 A;  2EGE A;  1UJ0 A;  2XDD A;  2J05 A;  1BI2 A;  3CC7 Q;  3MET A;  2A37 A;  2VAS A;  3VS3 A;  1YFN A;  2MMP A;  5LJ5 e;  1Y96 A;  1D1A A;  1VIE A;  3KXT A;  1ABQ A;  3NTK A;  2QG9 B;  2QQ9 A;  1HD3 A;  3I56 Q;  2VGM A;  4LD6 A;  4BB7 A;  2QQR A;  2IPO B;  5KYU A;  3N5B B;  2RJD A;  3G4S T;  1JBM A;  1SKU B;  1YJN Q;  4ESR A;  4C5E A;  2DL4 A;  2ZPE B;  2OI3 A;  3V7S A;  4CC7 A;  2DA9 A;  4HVV A;  1M2O A;  4C0G A;  4AFQ C;  5HK0 A;  3QJY A;  2JN0 A;  2P0Q A;  2RO0 A;  3HSB A;  2BZ8 A;  3OQ5 A;  2ZAE A;  4J9C A;  2HQE A;  1X6B A;  5CKF A;  2KRM A;  5L8R E;  2EJF A;  1OEB A;  1WX6 A;  4F17 A;  2A08 A;  2DRK A;  4JJB A;  4XU1 A;  1QKX A;  2EBP A;  3H6Z A;  3QDF A;  1SF9 A;  7AT1 B;  3CD6 Q;  3URG A;  3VU3 C;  1WGS A;  3EHQ A;  2OTJ Q;  2FYK A;  1UG1 A;  1Q86 C;  2JVV A;  5GMK i;  3VRY A;  1K8A U;  3HP9 A;  4IIO A;  1OQK A;  4M77 D;  3FRN A;  3RKW A;  3OS0 A;  1K9M R;  5IHI A;  4IUT A;  3RR6 A;  4PJO F;  1NE8 A;  3JCM W;  2C0I A;  3L1A A;  1NEB A;  4Z88 A;  1N8R C;  2ED0 A;  1M90 U;  5GMK l;  3V8J A;  1Q7Y U;  3EG9 B;  1WHK A;  4ATO A;  3VKI A;  4LDX A;  3GBQ A;  4N4I A;  2BZX A;  4DBR A;  1NJI R;  5A0L A;  1VQ7 T;  4F7U F;  5GAN 4;  2AZV A;  2PU9 B;  3HPW A;  1P92 A;  4OB2 B;  4GBQ A;  4ZGD B;  3HRU A;  4QVD A;  3M9Q A;  1OPK A;  2JM8 A;  1HJD A;  3OYB A;  3UF4 A;  1YJ9 Q;  5GAM j;  5GAN 8;  3M57 A;  3MHX A;  4C0Z A;  1G5V A;  1RAC B;  3JCM d;  2LP5 A;  2GGR A;  4PJJ A;  3VUB A;  1Q86 R;  1K73 U;  2DEQ A;  1NBE B;  2SRC A;  2K79 A;  1AHJ B;  3NTI A;  1PSE A;  1BBZ A;  4FYX B;  4QQG A;  3CCU Q;  1ZHI A;  4C8Q C;  1NLO C;  1BCM A;  3MKD A;  2L0A A;  5GJV B;  3J80 E;  4J9F A;  3REB B;  1GFD A;  3BY7 A;  4RTU A;  1KIK A;  2MF2 A;  1VQ7 A;  1QCO A;  2EYY A;  4PKC C;  1K4U S;  2O9S A;  4BY6 B;  4J6Y A;  1UJY A;  1KHC A;  3EGX B;  2JTE A;  5GAO l;  3BDU A;  3JCM V;  5KCO A;  1AWJ A;  3LX7 A;  5DLQ E;  3SWN B;  2EJG A;  3EH2 A;  3OYD A;  5KYU B;  1U3O A;  4M7D B;  1OX8 A;  3PIP A;  2GTJ A;  3LLR A;  2HMA A;  2YUO A;  4M77 C;  2XG8 D;  1SEM A;  1M3C A;  1VQ5 A;  3UA7 A;  2CP3 A;  2FL7 A;  1X27 A;  2NUT B;  3NFC A;  3OMC A;  1ZX6 A;  5GAN f;  3OY9 A;  1LVK A;  3RES A;  1M4Z A;  3JCM Q;  4E7J A;  2L2P A;  2GQV A;  2H3E B;  3PMI A;  3M0S A;  4XU0 A;  1K8A C;  1VQ6 Q;  1WJS A;  3EFR A;  2OX7 A;  3QBY A;  1QVG A;  5CKD A;  2QQA A;  2QEX A;  4M7A E;  3NHN A;  4FYW B;  2QQB A;  4M77 G;  1QVP A;  5HCK A;  2XK0 A;  1AWX A;  2DTI A;  2EQU A;  2R58 A;  1VQL T;  2DE0 X;  2VXE A;  3R6O A;  1H92 A;  1IB8 A;  3CCS T;  1D09 B;  2KXD A;  2YSQ A;  4XQ3 A;  3I5R A;  2A28 A;  1XNI A;  4BI8 B;  3P8B B;  3UAT A;  4K11 A;  1KC8 R;  2ZPG B;  4J7F A;  3BE3 A;  4M77 A;  2CP2 A;  4L5G A;  3A8M B;  1VQ9 A;  1Q81 C;  2I0N A;  3AT1 B;  1Q7Y R;  3ZL7 C;  4M7D E;  2LX7 A;  5FU7 B;  2OJ2 A;  2LMJ A;  2QA4 A;  1K9M C;  2JTF A;  2LTO A;  3NGP A;  2DX1 A;  2JJ9 A;  4LDW A;  2EVR A;  4PL6 A;  5KYW B;  1JXO A;  2RJF A;  3DB4 A;  1AVZ C;  2DPP B;  3OYE A;  2NUZ A;  1OOT A;  2BE9 B;  2GNC A;  1NYG A;  3OS5 A;  3CCV T;  4E47 A;  5KYY A;  1HXD A;  3CCJ T;  3M4Y A;  4RTZ A;  3X26 B;  4MZM A;  3NMZ C;  2DZC A;  2KGT A;  2V8J A;  3O8V A;  2LJ3 A;  1FWZ A;  3RDV A;  2XMF A;  2GBQ A;  1G8X A;  1U1T A;  4JUV A;  1C0M A;  4OF1 A;  1LOJ A;  5FRN A;  4GLK A;  1YIJ A;  3G6E Q;  4LUD A;  1K73 R;  1WXU A;  4LNP A;  1SSH A;  3OB9 A;  3PNW C;  1W2B P;  3QYH B;  1ZQ1 A;  3JRZ A;  1YBY A;  2FHD A;  3QPH A;  2RF0 A;  1VQO Q;  2VXF A;  5FRO A;  4B6M A;  1WNL A;  2L8D A;  3WVD B;  1IGU A;  2VKN A;  1PKT A;  1VQP T;  4OMQ A;  2MOX A;  4AFS C;  3GNF B;  4M7D A;  1CSK A;  4J9E A;  2QGG A;  3CBP A;  3S3N A;  3VUZ A;  2X9H A;  2I2L A;  3Q1J A;  1YJW T;  5IH2 A;  1BYM A;  1UFF A;  2CDT A;  2CP5 A;  2JXB A;  1VQM Q;  2PZ1 A;  1TH7 A;  2ZPI B;  4J9I A;  2DBK A;  5LJ3 f;  3I55 A;  1W2B A;  1M9S A;  1D0Z A;  5CO7 A;  4KBM B;  3PMT A;  2NUT A;  2GF7 A;  3CC2 T;  1VQL Q;  4AFZ C;  1GCQ A;  5EG2 A;  4FYY B;  3X28 B;  3AHU A;  1KG1 A;  2RQW A;  1MMG A;  4AG2 C;  5IXF A;  3CQT A;  3UA6 A;  1R8O B;  1YJ9 A;  1TTH B;  4JPB W;  3V7C A;  2AK5 A;  2BKD N;  1S72 A;  1VQN A;  4M77 B;  4B9W A;  4X9D A;  2DVJ A;  3HHT B;  3T9N A;  3QJ6 A;  4A4G A;  1MMN A;  2Y4X A;  1YJW Q;  4DEX A;  2KDS A;  1NPP A;  1WHL A;  2K6D A;  2ENM A;  2AHJ B;  3JCM c;  1RAA B;  1GCP A;  2K3X A;  3SD4 A;  2CRE A;  4LXC A;  4KH1 B;  4C0D B;  4ELY C;  4IUP A;  3JCM e;  3CCU A;  4OB3 B;  3U23 A;  3RBB B;  4DQ2 A;  1GFC A;  4PJM A;  1WQW A;  1GRI A;  4QKU A;  1FXX A;  2LQK A;  1PWT A;  3HTR A;  5KYX B;  2CZ0 B;  1C1A A;  3CPF A;  4QQ6 A;  3VS4 A;  3CCE A;  2FVU A;  5ECA A;  3QWY A;  4HCB A;  4LD9 K;  4N4H A;  5GAO q;  1AEY A;  3IQL A;  3X20 B;  1KJW A;  1VA7 A;  1X2Q A;  2KNB B;  4LDV A;  2KMT A;  5KH6 A;  2FG0 A;  1ZSZ A;  5A0G A;  3SHW A;  1ZA2 B;  2P4T A;  2RI5 A;  3EG9 A;  2HSE B;  2QAZ A;  5GAM d;  4PJL A;  2K5L A;  5M9O A;  2DL3 A;  1Q81 U;  4HKE A;  1PCX A;  2GTO A;  1VQN T;  1KD1 U;  2F2W A;  3TVT A;  3HKS A;  2RI2 A;  5GAM e;  1JEG A;  3CCR T;  4OML A;  2W0Z A;  1FX7 A;  4PFZ A;  3V8K A;  5GMK j;  1B3Q A;  4M75 C;  5GAN e;  3LGF A;  3ZEH A;  2LT1 A;  1UGS B;  1U5S A;  4C92 D;  1QMC A;  1NPR A;  4BE0 A;  1PNJ A;  4J9H A;  2F5K A;  3CCU T;  4E7L A;  1F1B B;  1WZO A;  2CUD A;  3LH0 A;  2QEX Q;  1D0Y A;  3QZ9 B;  4L6V 5;  4M7D D;  4OGC A;  4JRQ A;  2HQH A;  3G4S Q;  3FJP A;  4BE1 A;  2QDY B;  5LJ5 j;  1HYO A;  2EQM A;  4HCK A;  3JB9 J;  3E1S A;  3M53 A;  4F04 B;  2ATC B;  1TS9 A;  1AT1 B;  3CMA Q;  1VQK Q;  1K76 A;  1KK7 A;  3C95 A;  2VGN A;  2C0T A;  4FYV B;  2DXU A;  2RK2 A;  5IHK A;  5GAM f;  2EIF A;  3BFM A;  2B86 A;  4F16 A;  1GBQ A;  8ATC B;  3RIR A;  2K5I A;  3HFO A;  3CXC P;  2LNH B;  2EYX A;  5LJ5 h;  3V7R A;  4HA8 A;  3QII A;  2VUB A;  2K3Y A;  2D0Q B;  1N9S A;  1VQ8 Q;  5EC7 A;  1FMW A;  2CH4 W;  3JAM E;  1ZUK A;  4J5Y A;  2WSE E;  4M75 E;  3PIO A;  2JMC A;  1M8M A;  2ZPF B;  2C0O A;  2XHC A;  4Y91 A;  2COW A;  5KE3 A;  3A8L B;  1VYV A;  2FPF A;  2KSS A;  4OMM A;  4F7U E;  1LNX A;  1V1C A;  2RK1 A;  1SRM A;  4IUV A;  2E3I A;  2LQW A;  1M27 C;  2KXC A;  3EFS A;  4B9X A;  1W2B S;  3CCS A;  1UHF A;  3A1P A;  1TOV A;  4XTU A;  4NL2 A;  1YI2 Q;  1UEC A;  3VS2 A;  2AT1 B;  3QYG B;  8AT1 B;  2YLB A;  1IHV A;  5D6W A;  1XJW B;  2HNI A;  2HSP A;  1IGQ A;  5GAM h;  4OB1 B;  1X01 A;  4MDW A;  1G3S A;  2MIO A;  3PGG A;  1KQS P;  1VQ8 T;  3H8Z A;  2RH2 A;  4YTL A;  4LDU A;  3RKY A;  1M1F A;  3FEO A;  1AZG B;  2M16 A;  2F69 A;  1K8A R;  3G71 T;  2A36 A;  3EGU A;  1QVG S;  2W10 A;  2KT8 A;  3OBW A;  2MPX C;  1YHQ Q;  4RTT A;  3JB9 I;  1MV3 A;  4JZ3 A;  4OVA A;  3CME T;  3CCV A;  4LE9 A;  1K1Z A;  1MNE A;  3CEY A;  2JW4 A;  3C12 A;  1U06 A;  2OAW A;  3M55 A;  3A5Z B;  2YWW A;  1G3W A;  1QQJ A;  2DZ9 A;  1Y0M A;  3CC4 T;  2COY A;  3UDC A;  2C06 A;  4NOY A;  5KYN A;  1BIB A;  3JCM b;  1ZUY A;  2NYS A;  5CVI A;  1E7O A;  1M3B A;  1X69 A;  4C5H A;  4F7U B;  4M7A G;  1GL5 A;  3M0R A;  2ABL A;  4M77 E;  6AT1 B;  4BI4 A;  3G71 Q;  2CUB A;  4OMF B;  2JMA A;  3G7Z A;  1YIT Q;  3INZ A;  4JRK A;  4AFU C;  1BK2 A;  2LRQ A;  4BAC A;  2HL3 A;  1ZSZ C;  5LL6 S;  4A53 A;  2HQX A;  4LN2 A;  4A4F A;  2M51 A;  5GJW B;  1VQ5 T;  4MML A;  1YIJ T;  4RTW A;  4BUG A;  4HVW A;  5A2Q E;  2LJ1 A;  1W1F A;  2EWN A;  3ME9 A;  4JJD A;  5CIU A;  4C0D C;  2DO3 A;  4C8Q B;  4XU2 A;  2HD0 A;  1QWE A;  4PJO E;  3C94 A;  2RHI A;  4MZT A;  5FRM A;  2DL8 A;  4VUB A;  2JNG A;  4X34 A;  2OTL T;  2ROT A;  3EG0 A;  2WSC E;  1TSF A;  3ASK A;  3LWH A;  4EMG A;  3ULR B;  1X6G A;  1I07 A;  5GAN 5;  1I81 A;  4JS4 A;  4A4H A;  4XAX B;  4EPC A;  2KAF A;  2KBT A;  2LZ6 B;  1X2K A;  2QQS A;  1Q86 U;  4M7D C;  3GOX A;  1MHN A;  4E2F B;  2CP6 A;  1EFN A;  2RM4 A;  1YJ9 T;  1TUC A;  1ACM B;  1SSF A;  1N9R A;  2L5Q A;  3OS1 A;  3JCM g;  2COZ A;  4OMN A;  4BDZ A;  1YCS B;  3CCM Q;  2X3X D;  5IXB A;  1JQQ A;  1MGQ A;  1IRX A;  1V29 B;  2QK0 A;  4ZGJ B;  4FM4 B;  2CT3 A;  4BE2 A;  1JRI A;  2CH4 A;  2ROL A;  2JM9 A;  3EFO B;  3MPU B;  5I2M A;  3TSW A;  3OYY A;  2KYM A;  2PVO B;  4D8D A;  2QTV A;  1ZUU A;  3QUI A;  3P8D A;  1ZBX A;  2DLP A;  4EIK A;  1S1N A;  3HFN A;  4RUG A;  2DD5 A;  3CCQ A;  3E9G A;  2GQI A;  1QVF S;  2RNA A;  1WXB A;  4E7S A;  1BIA A;  2FB7 A;  3TU4 K;  1FMV A;  2CSI A;  4TVR A;  1JU5 C;  2E70 A;  5IHN A;  2D1X A;  4DOW A;  3M0T A;  2DIQ A;  3OYN A;  1BI3 A;  1QWF A;  2DTH A;  5AYF A;  1W4S A;  3OYK A;  4M78 F;  1PD0 A;  3MEA A;  5FU7 C;  1UGQ B;  2QDL A;  1TWB A;  1H64 1;  1OUL A;  3OYF A;  1QVG P;  5CQX A;  1SPK A;  1Q7Y C;  2IG0 A;  3JCM X;  2RMO A;  2WAC A;  3RMQ A;  4EMH A;  1N8R R;  1PD1 A;  4CI0 C;  1D3B A;  1WHM A;  5IAY A;  2DTO A;  4C0F A;  2SEM A;  3EGX A;  1RAD B;  2EYW A;  4XTV A;  2GCX A;  1KC8 C;  3VRZ A;  3CCL A;  5I22 A;  2OTL Q;  1M2V A;  1N5Z A;  3GNG A;  4C8Q G;  1NYF A;  1OU8 A;  2EKO A;  5LJ5 d;  3RNJ A;  1KSW A;  1TUG B;  1BB9 A;  4DOV A;  3L2W A;  3CC2 Q;  3M5A A;  2DER A;  2K2V A;  2O88 A;  1T3L A;  4PJO C;  3HRT A;  5GAO p;  3GPL A;  5GMK h;  2DM1 A;  1PKS A;  1PM3 A;  2YUP A;  3THK A;  1S72 T;  4Z8A A;  3RMS A;  4AMC A;  3OYM A;  4KUD K;  2BE7 D;  2L3Q A;  3SWN A;  2AKL A;  2BUD A;  2MWO A;  3CCM T;  5D7U A;  4J6W A;  2CP7 A;  2RA2 A;  3EG3 A;  2DAQ A;  2NUP B;  4UC4 A;  1R0C B;  1M90 C;  5CAI A;  2DD4 A;  1GXI E;  1IXD A;  1BKB A;  2CZ6 B;  4M78 A;  3EG2 A;  3CCJ A;  4J9D A;  3OS2 A;  4R55 A;  1K9A A;  3G1J A;  2LDM A;  4OMP A;  2LVM A;  1R77 A;  2DFU A;  2KRN A;  2L3P A;  3E2U A;  2LCC A;  3PE0 A;  1M1G A;  1E6G A;  1O75 A;  1TG0 A;  3H0F A;  3EFO A;  1X75 C;  1VQO T;  3M54 A;  2Y90 A;  4KUL A;  3VV0 A;  3H41 A;  3OYA A;  1RI9 A;  1VIF A;  2DEU A;  1VOM A;  2HL5 C;  2M0Y A;  3HRS A;  1EIF A;  2LQ8 A;  3KFV A;  4BD3 A;  5LJ3 j;  1U8R A;  3OW2 P;  2LNV A;  2MI6 A;  3VYH B;  3X24 B;  1YWO A;  4ZN3 A;  3M0U A;  1VQ7 Q;  4ORZ A;  3PVL A;  3JCM h;  2KE9 A;  4AG1 C;  3JCM P;  2ZPH B;  3A8O B;  2KQW A;  3QSU A;  5CR2 A;  4PNO A;  1TU0 B;  5DY9 A;  1AWW A;  4RTX A;  3R6N A;  3I55 Q;  1YCY A;  3DB3 A;  2MK5 A;  4JLG A;  1K9M U;  5GAN 2;  2E6N A;  3SEM A;  2D8H A;  2FZC B;  2OAU A;  2DL5 A;  3ZBD A;  5GAN g;  4KT0 E;  4DEY A;  2DIG A;  1Q81 R;  1WPY A;  1WHJ A;  1T3S A;  1YIJ Q;  4C92 C;  2PTK A;  2O01 E;  2F5T X;  2EYQ A;  1OX9 A;  2PUK B;  2M1H A;  4CC2 A;  1VQP Q;  4PFO A;  4A4K A;  2EQI A;  3CME Q;  2LQN A;  2E5Q A;  2HEQ A;  2J6K A;  4A54 A;  3EH1 A;  1NJI U;  2HBP A;  2E65 A;  1QW1 A;  1HK9 A;  2ZCF B;  5GAN h;  3RER A;  1ZBJ A;  2XKO C;  3E9F A;  2RD1 A;  1NLP C;  1RL2 A;  1QP2 A;  1YP5 A;  4CC3 A;  2CT4 A;  4M7A F;  2X35 A;  4ZTJ A;  2B8A A;  3EG1 A;  4M75 B;  4XK8 E;  5D6X A;  4C92 B;  4R56 A;  3TEE A;  5HKC A;  5C6S A;  4LDY A;  1VQM A;  2ED1 A;  4C92 G;  4M7A B;  2XID A;  2DRM A;  2XDB A;  1E6H A;  3CBO A;  3FLG A;  1KQS S;  2KRS A;  5J39 A;  3JCM J;  2J06 A;  4Y92 A;  4FW2 A;  4HVU A;  1G3T A;  2V26 A;  1UGP B;  5KYX A;  1SHF A;  3BW1 A;  1Y57 A;  4V2S A;  3LWI A;  4KUI A;  3MEW A;  4DBQ A;  2QA4 Q;  2D9T A;  4WF2 A;  1KD1 R;  2LCS A;  1M2V B;  9ATC B;  4D6W A;  1VQN Q;  3EHR A;  1NEG A;  2YRC A;  3PFS A;  1WHG A;  1N27 A;  4CRI A;  4JRP A;  1WJQ A;  2KEA A;  1JB0 E;  1LJO A;  3ER0 A;  1X6O A;  4PJO D;  2PVG B;  3L2V A;  2EQK A;  5FW9 A;  1U1S A;  4JDS A;  3MP8 A;  4DBH A;  5GAO r;  1QVF A;  1B34 A;  2X4Y A;  1AZE A;  3JB9 F;  2YT6 A;  3CCL Q;  3L42 A;  2VC8 A;  4M78 E;  2R5M A;  5KYY B;  3OSS C;  2O2O A;  4RTV A;  3REA B;  2O31 A;  4IUU A;  1D3B B;  2IVW A;  1RAF B;  4D8K A;  2KRO A;  1BCO A;  3CPW P;  1KD1 C;  4PJO B;  3VS0 A;  5LJ3 h;  1BU1 A;  4GY5 A;  3A8H B;  4XU3 A;  2DXC A;  1I0C A;  3CMA A;  4DBF A;  5GAN 3;  1AD5 A;  4RMO A;  3V8L A;  4IKF A;  1RAE B;  2EGA A;  2ZZD A;  1QKW A;  3JB9 G;  1VQ9 T;  1GBR A;  4M7D G;  1H8K A;  1HSQ A;  5CKH A;  1YNZ A;  2BTT A;  2F2X A;  1TXQ A;  1Q82 U;  4ZTF A;  4E7Z A;  2CKK A;  4A4E A;  3EGD A;  2X3W D;  2KY9 A;  2XI9 A;  1WA7 A;  2R57 A;  3F70 A;  3I5S A;  4OB0 B;  3ZFJ A;  3EAE A;  2YUN A;  4O5V A;  4JRI A;  1KQ2 A;  2XDP A;  2V8I A;  5CCA A;  1UGR B;  2M02 A;  5HY6 A;  5CK9 A;  2MYS A;  2O4X B;  1RAB B;  4M7A A;  3QO3 A;  3JV3 A;  4KH0 B;  2MAM A;  1S72 Q;  3G4S A;  1B07 A;  3H0H A;  1WQ7 A;  4PFP A;  4Z02 A;  1DJ7 B;  1SRL A;  4ANJ A;  3CMA T;  1KQS A;  1G3Y A;  3CCS Q;  1KC8 U;  2K4Y A;  3S6W A;  3LH5 A;  2DYI A;  4RTY A;  2QA4 T;  2VYT A;  2OTJ T;  4M78 B;  2G6F X;  4MDX A;  3CC7 A;  4II1 A;  3MP1 A;  4FSS A;  2QGF B;  5LJ3 e;  2E1H A;  2J6O A;  3CPW S;  2EFI A;  1W6X A;  2RQT A;  3MP6 A;  1Y07 A;  2P84 A;  2V1Q A;  2H8H A;  3I56 A;  1OPL A;  3MEU A;  2O9V A;  2RJC A;  4IUQ A;  2PVD B;  5A0D A;  3QG1 A;  1M30 A;  2JT4 A;  3UPU A;  2EPD A;  5GMK m;  1VQ6 A;  1YJN T;  3VS6 A;  2HBW A;  1M1K R;  3KBG A;  4J8O A;  4WCI A;  4M7A C;  4ZN1 A;  2FO0 A;  4M75 F;  3OA6 A;  2P4R A;  5FU6 B;  4C8Q F;  2CZ1 B;  3CD6 T;  1RAI B;  2K57 A;  2K9G A;  3WVE B;  4MMK A;  1WFW A;  2PUO B;  2D0N A;  1H3H A;  3CCR A;  1D0X A;  3M0P A;  4P5N A;  1RUW A;  3SWN C;  2RB6 A;  4ELZ C;  4ZNX A;  2A3L A;  1YIT A;  3I35 A;  4X9C A;  2OTJ A;  2MCN A;  3LGL A;  5GMK e;  4QVC A;  1WI7 A;  3TSZ A;  2R5A A;  2QXF A;  3CME A;  2QI2 A;  4QVZ A;  2JS0 A;  3E19 A;  4FIB A;  4JLI A;  2E5K A;  2FZK B;  2Y4Y A;  5GAN 7;  3NTH A;  4PK4 A;  2EKH A;  3QHS A;  4RCB A;  1RI0 A;  4E6R A;  3L2U A;  1YHQ A;  4J6X A;  2CP0 A;  5I2S A;  2JOY A;  2Z0W A;  4L59 A;  4FCY A;  2K3B A;  2EQJ A;  1I1J A;  1G2B A;  2O4X A;  2JTM A;  2NWM A;  2IIM A;  1SHG A;  4JS5 A;  3KUF A;  2LCL A;  4HCC A;  1Y71 A;  5GAN j;  2X4X A;  1UEB A;  5GAM g;  1VQ5 Q;  2D6F A;  5DLO A;  3H9N A;  2DKG A;  2VB6 A;  2DJQ A;  4J7I A;  2FEI A;  3OYH A;  2HZY A;  3BDL A;  3FDR A;  1M8V A;  2DVE A;  4M4Z A;  1FYN A;  4QW2 A;  1WYX A;  2F2V A;  2KT1 A;  1OZ2 A;  2RPN A;  3VYG A;  1VYU A;  2XD0 A;  4RG2 A;  1Y7X A;  4HXJ A;  3G6E T;  4M7A D;  5CQY A;  5LJ5 f;  1RAG B;  5AT1 B;  3JB9 D;  2HAX A;  2AZS A;  2P0K A;  2RQU A;  3CCM A;  2DL7 A;  4XTY A;  1WJR A;  2RHX A;  1WDX A;  3O5Z A;  1UDL A;  5GAO m;  5J3B A;  1YN8 A;  2E64 A;  1RLQ C;  3QDR B;  1NG2 A;  1G83 A;  4PJN A;  3A8G B;  2HDA A;  1UUE A;  5LJ3 g;  2RHZ A;  3H0I A;  1LPL A;  4KGX B;  2CYZ B;  3I55 T;  4OP0 A;  3RUX A;  3PTA A;  1YWP A;  2ZPB B;  1C6V X;  4E7I A;  1X43 A;  1VQ4 A;  1QCF A;  3D7S B;  3OYL A;  3SDZ A;  5GAN 6;  4QQD A;  1N6A A;  1IZ6 A;  5L23 A;  4BDY A;  4J83 A;  3OYJ A;  4J9B A;  4RG8 A;  1NM7 A;  3TQ7 P;  4PJO A;  5KCH A;  1T0H A;  2FPD A;  3I56 T;  1YJW A;  2RQV A;  1B7T A;  5LJ3 d;  4Z89 A;  3VS5 A;  1K0S A;  3L2Q A;  4X1V A;  4C92 F;  1VUB A;  2KK4 A;  2ZGW A;  1PHT A;  2RN8 A;  2D8J A;  1VYT A;  5FWC A;  2E3H A;  3CPW A;  1QLY A;  4EMK C;  4CC4 B;  1M1K U;  3M0Q A;  1B34 B;  4Q5W A;  4KGV B;  4FU6 A;  2DYB A;  3CXC S;  1IHW A;  3M59 A;  2OTL A;  4HCZ A;  3P8H A;  1I5O B;  4PJO G;  1CKA A;  2DJZ A;  2BZY A;  3G6E A;  2CS7 A;  2EYZ A;  3QXE B;  1Y96 B;  1T0J A;  1M90 R;  1TUD A;  5CKB A;  2XU8 A;  3CBM A;  4PLL A;  1VQ9 Q;  1O9S A;  2YDL A;  4C92 E;  1D1B A;  2EGC A;  2V8K A;  4IIM A;  3HL8 A;  5LJ5 g;  4EMK B;  2RQR A;  2E10 A;  1UE9 A;  1OZ3 A;  1PRL C;  5CKE A;  1KHI A;  5FWB A;  3VJP A;  2DIL A;  4M75 D;  2EJ9 A;  3CXC A;  1A0N B;  4C8Q D;  1OYX A;  3FJ5 A;  4PLI A;  3FB9 A;  2H3J A;  1I4K 1;  2LJ0 A;  5I11 A;  2F1L A;  1OV3 A;  5IT9 E;  1JJ2 A;  2X51 A;  3EGD B; 
#chains in the Genus database with same CATH homology
 1ZHI A;  4C8Q C;  3H8Z A;  5J39 A;  3JCM J;  1VQ8 T;  2RH2 A;  4YTL A;  4LDU A;  2RJE A;  3GLX A;  3S3M A;  1G3T A;  3RKY A;  1M1F A;  4RCC A;  1UGP B;  3WXM B;  3BW1 A;  1NZ9 A;  1I5L A;  2RI3 A;  4C8Q E;  3FEO A;  3J80 E;  2M16 A;  2F69 A;  3TRE A;  4V2S A;  3G71 T;  3LWI A;  4KUI A;  3MEW A;  1QVG S;  3CC4 A;  2D9T A;  4WF2 A;  3BY7 A;  3OBW A;  2MF2 A;  1VQ7 A;  4D6W A;  4PKC C;  5IN1 A;  4BY6 B;  3CCQ T;  5HK3 A;  4J6Y A;  2L3R A;  3PFS A;  1KHC A;  3PT9 A;  1N27 A;  4CRI A;  3JB9 I;  1WJQ A;  4JRP A;  4OVA A;  5GAO l;  4M78 G;  3BDU A;  3CME T;  4F7U A;  2P0P A;  3JCM V;  3CC2 A;  1PSF A;  3CCV A;  1JB0 E;  1LJO A;  5KCO A;  3CEY A;  3ER0 A;  1X6O A;  3C12 A;  1QP3 A;  3LX7 A;  3M55 A;  5DLQ E;  3OW2 A;  3SWN B;  2G3R A;  2EJG A;  3A5Z B;  1M5Q 1;  2PVG B;  2EQK A;  2QTX A;  1U1S A;  3OYD A;  4C5I A;  3L2V A;  4N0A C;  1VQO A;  3M56 A;  1G3W A;  4JDS A;  4M7D B;  2M9U A;  2DZ9 A;  3MP8 A;  3PIP A;  3CC4 T;  3LLR A;  3UDC A;  5GAO r;  1QVF A;  1B34 A;  2C06 A;  3OSV A;  4NOY A;  1BIB A;  4M77 C;  3JCM b;  2XG8 D;  2EAY A;  2X4Y A;  1VQ5 A;  1VQK T;  3JB9 F;  2FL7 A;  5CVI A;  4DA4 A;  4C5H A;  3NFC A;  4F7U B;  2CZ7 B;  4M7A G;  3OMC A;  3L42 A;  1OI1 A;  4M77 E;  2VC8 A;  4M78 E;  4BI4 A;  2R5M A;  5GAN f;  3OSS C;  3OY9 A;  4XTZ A;  3RES A;  4OMF B;  1M4Z A;  3JCM Q;  3M4G A;  4E7J A;  3G7Z A;  2BIV A;  2GQV A;  3INZ A;  4IUU A;  4JRK A;  3PMI A;  1D3B B;  4C8Q A;  1BI1 A;  4M78 C;  2LRQ A;  4BAC A;  1YJN A;  4XU0 A;  2IVW A;  4A53 A;  4HT8 A;  5LL6 S;  1K8A C;  2HQX A;  1KD1 C;  4PJO B;  1WJS A;  3EFR A;  3QBY A;  5LJ3 h;  4GY5 A;  4A4F A;  1Q82 C;  2CGH A;  3A8H B;  1VQ5 T;  4MML A;  4XU3 A;  1YIJ T;  5CKD A;  2DXC A;  2QQA A;  1QVG A;  4BUG A;  1VQL A;  2E6Z A;  3FIF A;  2QEX A;  3CMA A;  5A2Q E;  1K73 C;  2DXB A;  3DKM A;  2X4J A;  4M7A E;  2QQB A;  5GAN 3;  4M77 G;  4RMO A;  3V8L A;  2EWN A;  4IKF A;  1QVP A;  3L2Z A;  3ME9 A;  2XK0 A;  3J81 E;  2DTI A;  2ZZD A;  5CIU A;  4C0D C;  2EQU A;  2DO3 A;  3JB9 G;  1VQ9 T;  4C8Q B;  2R58 A;  4XU2 A;  2HD0 A;  4M7D G;  1VQL T;  4PJO E;  5FLX E;  2VXE A;  3MO8 A;  5CKH A;  3C94 A;  2RHI A;  3R6O A;  4MZT A;  1VQ4 T;  5FRM A;  3OBY A;  4VUB A;  2LC4 A;  4ZTF A;  1Q82 U;  3CCS T;  2JNG A;  2CKK A;  4X34 A;  2OTL T;  3CD6 A;  2WSC E;  4A4E A;  3ASK A;  4XQ3 A;  4ZGE B;  4E7H A;  2KY9 A;  1XNI A;  3LWH A;  2XI9 A;  4BI8 B;  4EMG A;  4E7K A;  2R57 A;  3P8B B;  3F70 A;  1VQ6 T;  2M0O A;  3GIB A;  3UT1 A;  2ZPG B;  4J7F A;  4OB0 B;  3JSC A;  4M77 A;  2XIC A;  3UWN A;  3ZFJ A;  3L2R A;  4JJN K;  3EAE A;  3OYI A;  5GAN 5;  4L5G A;  3DLL A;  3A8M B;  1VQ9 A;  1I81 A;  1Q81 C;  2DXT A;  4JS4 A;  4O5V A;  4JRI A;  1KQ2 A;  4A4H A;  2XDP A;  4M7D E;  5FU7 B;  5KE2 A;  2V8I A;  5CCA A;  3S3O A;  1UGR B;  5HY6 A;  5CK9 A;  2NLU A;  2O4X B;  4C5G A;  3OW2 S;  4XAX B;  4EPC A;  2KAF A;  4M7A A;  3QO3 A;  2QA4 A;  1Q86 U;  2QQS A;  3OYC A;  2A7Y A;  4M7D C;  4BI3 A;  3GOX A;  1K9M C;  1MHN A;  2JTF A;  2LTO A;  2MAM A;  3G4S A;  4FSX A;  1WQ7 A;  1XOV A;  2KVQ G;  4Z02 A;  1DJ7 B;  4LDW A;  3CMA T;  4PL6 A;  2JZ2 A;  1KQS A;  1G3Y A;  1KC8 U;  2K4Y A;  3S6W A;  4HT9 A;  3M58 A;  2RJF A;  3DB4 A;  4N0A A;  2RM4 A;  1XQH A;  1YJ9 T;  2QA4 T;  2DPP B;  4EMK A;  3OYE A;  1SSF A;  2VYT A;  4O6J A;  5I21 A;  1N9R A;  2L5Q A;  4M78 B;  3OS1 A;  3FC3 A;  4MDX A;  2OTJ T;  3CC7 A;  3OMG A;  3JCM g;  3OS5 A;  3CCV T;  4E47 A;  4II1 A;  1VQK A;  4BDZ A;  1HXD A;  3CCJ T;  3LYI A;  3MP1 A;  3M4Y A;  4XTX A;  1MGQ A;  4M77 F;  1V29 B;  4ZGJ B;  5LJ3 e;  4FM4 B;  2E1H A;  1BI0 A;  2EFI A;  5D6Y A;  3X26 B;  5GAN d;  4MZM A;  3CPW S;  3MP6 A;  4BE2 A;  1JRI A;  3CC7 T;  2DZC A;  4C92 A;  3GF5 A;  2V8J A;  3O8V A;  1IRE B;  1Y07 A;  5I2M A;  3SB2 A;  1FWZ A;  3I56 A;  3OYY A;  1JJ2 S;  1U1T A;  4JUV A;  3MEU A;  4Y28 E;  3G71 A;  2PVO B;  4OF1 A;  1LOJ A;  2RJC A;  3QUI A;  2PVD B;  2E41 A;  3P8D A;  4IUQ A;  5A0D A;  5FRN A;  1ZBX A;  4GLK A;  4N4G A;  4OGE A;  4RKU E;  1YIJ A;  3QG1 A;  3L2W A;  3HFN A;  2K5F A;  2DD5 A;  3CCQ A;  3UPU A;  2VV5 A;  3E9G A;  3OB9 A;  3PNW C;  5GMK m;  1VQ6 A;  3LW5 E;  1VQP A;  3QYH B;  1YJN T;  1QVF S;  1ZQ1 A;  3JRZ A;  1YBY A;  1BIA A;  2FB7 A;  2YLC A;  3KBG A;  3TU4 K;  1VQM T;  2FHD A;  3QPH A;  4M75 G;  3QZ5 B;  4J8O A;  5J26 A;  2VXF A;  2X4W A;  4ZN1 A;  4M7A C;  2LT4 A;  5FRO A;  4TVR A;  3JB9 H;  5FU6 C;  4M75 F;  2QEX T;  1WNL A;  1N8R U;  2E70 A;  3OA6 A;  2L8D A;  3WVD B;  1VQP T;  4DOW A;  5FU6 B;  2DIQ A;  3GNF B;  3OYN A;  4M7D A;  4C8Q F;  2CZ1 B;  1BI3 A;  3CD6 T;  2K57 A;  3WVE B;  2YHT A;  2PUO B;  3CBP A;  4MMK A;  5C0M A;  2DTH A;  3VUZ A;  3MCA B;  5AYF A;  3S3N A;  1W4S A;  3OYK A;  4XTW A;  4M78 F;  3MEA A;  3CCR A;  2I2L A;  3Q1J A;  4FT4 A;  5FU7 C;  3X25 B;  1YJW T;  1BYM A;  4P5N A;  1UGQ B;  4MZP A;  1YI2 A;  1H3Z A;  1H64 1;  3SWN C;  3OYF A;  3MEV A;  5CQX A;  1TH7 A;  3J7A F;  2ZPI B;  2RB6 A;  4ELZ C;  5LJ3 f;  2A3L A;  3I55 A;  1YIT A;  1W2B A;  2OTJ A;  4X9C A;  1Q7Y C;  1M9S A;  3LGL A;  5GMK e;  4QVC A;  2IG0 A;  2RHU A;  3JCM X;  2WAC A;  5CO7 A;  3RMQ A;  4EMH A;  2R5A A;  4KBM B;  4CI0 C;  1D3B A;  3PMT A;  1I8F A;  4M75 A;  2GF7 A;  2QXF A;  5IAY A;  2DTO A;  4IUR A;  3RKX A;  4C0F A;  3CME A;  3CC2 T;  3CCE T;  2QI2 A;  2GFA A;  4QVZ A;  3QKJ A;  3E19 A;  4XTV A;  4FIB A;  2GCX A;  4JLI A;  1KC8 C;  5EG2 A;  3X28 B;  3CCL A;  3AHU A;  3OYG A;  1KG1 A;  2WSF E;  2Y4Y A;  1UB4 A;  5GAN 7;  3NTH A;  1R8O B;  3GNG A;  4C8Q G;  1YJ9 A;  3V7C A;  2JUF A;  3QHS A;  4RCB A;  2BKD N;  1RI0 A;  1S72 A;  1VQN A;  4M78 D;  2DK3 A;  1M1K C;  3L2U A;  1YHQ A;  4M77 B;  4J6X A;  4B9W A;  1VQ8 A;  2EKO A;  2RHY A;  5LJ5 d;  3SFM A;  5DM7 R;  4X9D A;  2YRV A;  3HHT B;  4FT2 A;  3T9N A;  5I2S A;  2JOY A;  1XTD A;  3QJ6 A;  4DOV A;  4L59 A;  3M5A A;  2Y4X A;  2EQJ A;  4FL6 A;  4A4G A;  4NS5 A;  2K2V A;  2KDS A;  1NPP A;  4PJO C;  3JCM c;  2AHJ B;  2K3X A;  3HRT A;  3SD4 A;  3JCM f;  2O4X A;  5GAO p;  2MWP A;  3GPL A;  2JTM A;  4C0D B;  4ELY C;  3CCL T;  4IUP A;  5GMK h;  3GP8 A;  2PQW A;  3JCM e;  3C4S A;  3CCU A;  2LX9 A;  4JS5 A;  3KUF A;  2LCL A;  4HCC A;  3DLM A;  1KQ1 A;  1Y71 A;  4EDU A;  4OB3 B;  5GAN j;  4M7D F;  2X4X A;  4BY6 C;  2GFU A;  5GAO n;  1UEB A;  4DQ2 A;  5GAM g;  1S72 T;  2D6F A;  1YHQ T;  2E12 A;  1WQW A;  1YIT T;  5DLO A;  3RMS A;  4F7U G;  3OYM A;  1FXX A;  3TCJ A;  4ME7 A;  4KUD K;  2DKG A;  2LQK A;  3SWN A;  4J7I A;  2BUD A;  2CZ0 B;  3OYH A;  3CPF A;  2MWO A;  3BDL A;  3FDR A;  1YI2 T;  1M8V A;  4QQ6 A;  2DVE A;  3CCE A;  2FVU A;  2L89 A;  4QW2 A;  4NL3 A;  3CCM T;  4J6W A;  4HCB A;  4LD9 K;  1OZ2 A;  4N4H A;  3VYG A;  2RA2 A;  5GAO q;  2DAQ A;  2XDD A;  2XD0 A;  4RG2 A;  4UC4 A;  1Y7X A;  1BI2 A;  3X20 B;  1M90 C;  3G6E T;  5CAI A;  4M7A D;  2DD4 A;  5CQY A;  5LJ5 f;  3JB9 D;  1BKB A;  3MET A;  2CZ6 B;  1GXI E;  2HAX A;  4LDV A;  2KMT A;  2P0K A;  4M78 A;  5KH6 A;  3CCM A;  2MMP A;  3CCJ A;  5LJ5 e;  1Y96 A;  5A0G A;  2P4T A;  4XTY A;  2RI5 A;  3OS2 A;  5GAM d;  1WJR A;  2RHX A;  4R55 A;  1VIE A;  2LDM A;  2K5L A;  5GAO m;  5J3B A;  5M9O A;  3KXT A;  1Q81 U;  2LVM A;  4HKE A;  3NTK A;  2LCC A;  2QQ9 A;  1VQN T;  1KD1 U;  3HKS A;  1M1G A;  2E64 A;  2RI2 A;  5GAM e;  2VGM A;  4LD6 A;  3QDR B;  3CCR T;  4BB7 A;  2QQR A;  1O75 A;  1X75 C;  1FX7 A;  3A8G B;  3M54 A;  2Y90 A;  3V8K A;  5GMK j;  3N5B B;  4KUL A;  1VQO T;  5LJ3 g;  4M75 C;  3VV0 A;  5GAN e;  3OYA A;  2RJD A;  3G4S T;  1JBM A;  3LGF A;  3ZEH A;  2RHZ A;  2LT1 A;  1UGS B;  2CYZ B;  4C92 D;  1VIF A;  4OP0 A;  3I55 T;  3RUX A;  1NPR A;  3PTA A;  4BE0 A;  4PJO D;  4C5E A;  2ZPB B;  2ZPE B;  3HRS A;  2F5K A;  1EIF A;  3CCU T;  2LQ8 A;  4E7L A;  3V7S A;  4E7I A;  4BD3 A;  4C0G A;  5HK0 A;  5LJ3 j;  2RO0 A;  2JN0 A;  2P0Q A;  3LH0 A;  3QJY A;  1VQ4 A;  1U8R A;  2LNV A;  2MI6 A;  3OQ5 A;  3QZ9 B;  3VYH B;  3HSB A;  2HQE A;  4L6V 5;  3X24 B;  4M7D D;  5CKF A;  4OGC A;  3OYL A;  5L8R E;  3SDZ A;  4ZN3 A;  4JRQ A;  1NJI C;  2EJF A;  5GAN 6;  4QQD A;  3FJP A;  1N6A A;  3JCM h;  1IZ6 A;  4BDY A;  4BE1 A;  4J83 A;  3OYJ A;  4RG8 A;  2QDY B;  5LJ5 j;  4XU1 A;  4PJO A;  2EQM A;  3JCM P;  3JB9 J;  5KCH A;  2ZPH B;  3E1S A;  3A8O B;  2KQW A;  3M53 A;  3QSU A;  3H6Z A;  5CR2 A;  4PNO A;  3I56 T;  1YJW A;  5DY9 A;  5LJ3 d;  3URG A;  3VU3 C;  3L2Q A;  1WGS A;  1YCY A;  4C92 F;  1VUB A;  3DB3 A;  4JLG A;  2KK4 A;  2ZGW A;  2FYK A;  3C95 A;  1Q86 C;  2VGN A;  1K9M U;  2JVV A;  5GMK i;  5GAN 2;  1K8A U;  3CPW A;  2DXU A;  2E6N A;  2RK2 A;  3HP9 A;  4EMK C;  5GAM f;  1M1K U;  4M77 D;  1B34 B;  2EIF A;  3FRN A;  3RKW A;  3OS0 A;  3BFM A;  2OAU A;  4Q5W A;  4FU6 A;  4IUT A;  3CXC S;  3RIR A;  2K5I A;  3M59 A;  3ZBD A;  4PJO F;  2OTL A;  3HFO A;  4HCZ A;  5GAN g;  1NE8 A;  4KT0 E;  3JCM W;  2DIG A;  3L1A A;  1N8R C;  1M90 U;  3P8H A;  4PJO G;  5GMK l;  2DJZ A;  1WPY A;  3V8J A;  5LJ5 h;  3V7R A;  4HA8 A;  2CS7 A;  3QII A;  2VUB A;  3QXE B;  1Y96 B;  2K3Y A;  2D0Q B;  4C92 C;  2O01 E;  1Q7Y U;  1N9S A;  2F5T X;  3JAM E;  2EYQ A;  4ATO A;  3VKI A;  2PUK B;  2M1H A;  4J5Y A;  2XU8 A;  4N4I A;  5CKB A;  4LDX A;  2WSE E;  3CBM A;  4M75 E;  4PLL A;  1O9S A;  4A4K A;  5A0L A;  4F7U F;  3PIO A;  1VQ7 T;  5GAN 4;  4C92 E;  2PU9 B;  2E5Q A;  3HPW A;  2V8K A;  1P92 A;  3HL8 A;  4OB2 B;  4A54 A;  4EMK B;  3HRU A;  4ZGD B;  5LJ5 g;  1NJI U;  2HBP A;  2E10 A;  2ZPF B;  2E65 A;  4QVD A;  2XHC A;  1QW1 A;  3M9Q A;  4Y91 A;  1OZ3 A;  5KE3 A;  3A8L B;  1HK9 A;  2ZCF B;  1KHI A;  5CKE A;  3VJP A;  5GAN h;  3OYB A;  2KSS A;  5GAM j;  3M57 A;  4F7U E;  5GAN 8;  3RER A;  1LNX A;  2XKO C;  3E9F A;  2RD1 A;  4M75 D;  2RK1 A;  1RL2 A;  1QP2 A;  3MHX A;  4IUV A;  4C0Z A;  1G5V A;  3G6E A;  2EJ9 A;  3CXC A;  3EFS A;  3JCM d;  4M7A F;  2X35 A;  4B9X A;  4ZTJ A;  4C8Q D;  2B8A A;  3VUB A;  4M75 B;  1W2B S;  1OYX A;  4XK8 E;  3CCS A;  1K73 U;  5D6X A;  2DEQ A;  4XTU A;  4PLI A;  4C92 B;  4R56 A;  3FB9 A;  2H3J A;  1I4K 1;  4NL2 A;  3TEE A;  5C6S A;  5HKC A;  4LDY A;  1VQM A;  3QYG B;  4C92 G;  2YLB A;  4M7A B;  2XID A;  5D6W A;  1AHJ B;  2HNI A;  3NTI A;  5GAM h;  5IT9 E;  1JJ2 A;  1PSE A;  2XDB A;  3CBO A;  3FLG A;  4OB1 B;  1X01 A;  4MDW A;  1KQS S;  1G3S A;  4QQG A;  3PGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...