4C8QC

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
79
structure length
79
Chain Sequence
METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 13
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qC00
3HFNA 3RIRA 4PJOC 2Y90A 3EFSA 2YHTA 3QSUA 4M7AF 4OP0A 4N0AC 3SWNB 4M7DF 2DEQA 4J6XA 4M75E 3JCMc 4C92A 2RD1A 4EMGA 3JCMd 3GIBA 4PJOB 2HNIA 2QTXA 5GANg 2DTOA 2DTIA 3V8LA 4M77A 2E1HA 4J6YA 4A53A 4C8QC 1JRIA 4JUVA 2YLCA 4PNOA 5GAN6 4C92E 5GMKj 5LJ5g 3JB9J 4XTWA 4M78F 3V7CA 4F7UA 4M7AA 2I2LA 2EAYA 1JBMA 4HT8A 4X9CA 2VXEA 3JB9D 5LJ5h 5GMKh 4JLIA 4M78C 3JCMP 1D3BB 4V2SA 4XTXA 1I8FA 2VC8A 3SB2A 4C8QB 5GAMf 4N0AA 5LJ5d 3JCMQ 3JCMW 5LJ5j 1Y96A 5GAOr 1H641 4PJOE 3V8KA 5GAN3 2E64A 4M75F 3SWNC 4QVDA 2ZGWA 4M78A 1LOJA 3FB9A 4WF2A 3V8JA 4EMHA 4F7UF 4NL3A 3RKXA 5GMKm 5GAN2 4M7DB 4M75C 2DKGA 4NOYA 1M5Q1 5GAMh 4XTVA 5GAOl 3BFMA 4XU0A 4M7AB 4HT9A 3EFRA 1B34A 4C92D 4M75D 2CGHA 2VXFA 1KQ1A 4M77B 5GANd 3JB9G 2RB6A 1YCYA 1BIAA 5LJ3d 2E41A 1LJOA 1WQ7A 3VU3C 3JB9I 3PGGA 4XQ3A 3SWNA 4PJOF 4F7UG 4XU1A 1HK9A 1D3BA 5GAMj 4F7UE 3HSBA 5GAN7 2DXUA 4NL2A 4X9DA 3V7SA 5LJ3j 5LJ5f 5GAMd 3RKWA 2DZ9A 1KQ2A 5GAN8 5GAOn 4RCBA 1U1TA 4PJOD 1BIBA 4M78B 4MMKA 4HA8A 5GAN4 4M78G 3BY7A 4JRKA 5LJ3g 2RM4A 4M77C 4C8QA 4EMKC 4XU2A 3JCMe 4XTYA 1WPYA 3JCMX 5GAOm 1I5LA 3L2ZA 1LNXA 3JCMV 3JCMJ 4XTZA 4XU3A 4M7AC 5GMKi 2FB7A 3JB9H 4M75A 5LJ3h 3BDUA 4C8QG 4M7DG 2DTHA 4M7DC 1I81A 4PJOG 5GANh 4C8QD 4M7AG 1N9SA 1Y96B 2E10A 1B34B 4C8QF 4EMKB 5GAOq 2RA2A 5LJ5e 2DZCA 1WNLA 4M77G 5LJ3f 5GAOp 3RESA 5GMKl 1HXDA 2DVEA 5GANf 1U1SA 5GAN5 4C92G 3RERA 4MMLA 4A54A 2YLBA 2K57A 3V7RA 2DJZA 4F7UB 4M77E 3HFOA 4J6WA 3L1AA 3QO3A 4M75B 4C92B 3BW1A 1MGQA 5CAIA 4J5YA 4PJOA 3FJPA 4M77D 3INZA 4M75G 2EJFA 5I21A 4M7DD 4M7AE 2EWNA 3QUIA 2DXTA 1WQWA 2EJGA 3JCMf 5DY9A 1I4K1 1X01A 3QHSA 1TH7A 3RUXA 4Y91A 5GANe 4C8QE 4M7AD 4M7DE 3JCMg 5GMKe 4XTUA 4QVCA 5LJ3e 3M4GA 4C92C 1N9RA 4JRIA 4M7DA 4C92F 3AHUA 3JCMb 4M78E 3JCMh 3FIFA 3JB9F 4EMKA 2E65A 5GAMe 1M8VA 4M77F 4M78D 3RKYA 5GAMg 5GANj 4RCCA 2FYKA 4DQ2A 2JN0A 2EJ9A
chains in the Genus database with same CATH superfamily
2YRCA 4OMPA 3JAME 3DLLA 4OP0A 3G71T 3MEAA 2F69A 3VJPA 2CP2A 4M7DF 4C92A 1RAHB 3URGA 1JRIA 2JOYA 4AT1B 4PLIA 1WFWA 1W1FA 5CKEA 1GXIE 3THKA 3JB9D 1M90C 4C0FA 4A4GA 2B8AA 4IUUA 3JCMP 1AEYA 2P4TA 2KK4A 1N8RC 1PM3A 2E3IA 2HZYA 3HRSA 1QKWA 2X51A 4QVDA 4NS5A 3CC2Q 2DL7A 4M7DB 1UB4A 2RJFA 3REBB 3EGDA 4PFOA 2QQ9A 2BKDN 1VIEA 1X75C 5KYXB 2COZA 3DLMA 2EQJA 2CH4W 4O5VA 3H9NA 2R57A 2LVMA 2K9GA 1ZSZB 3NFCA 2QEXQ 3OYAA 3FEOA 5GAN7 1G3SA 5J26A 3QJ6A 3MEUA 4RCBA 1YN8A 1BIBA 1K8AU 2YRVA 2A7YA 3CCMT 2K2VA 3OBWA 4BACA 2EKHA 4XU3A 1MHNA 2XMFA 4IUVA 2CT3A 3CQTA 3VUBA 4M75A 4M7DG 4D8KA 3OYMA 1B34B 3OBYA 1IREB 3CCMA 3RESA 2E6NA 2A08A 1B07A 2H8HA 1NEGA 2X4YA 3RERA 1KQSS 2K57A 4Z8AA 4DEXA 2L0AA 3OYBA 2JM8A 1E7OA 1NEBA 3CCET 1WZOA 3OY9A 3MP1A 2KNBB 1ZA1B 3CCJA 2YWWA 1R8OB 4OMMA 4X34A 2EGEA 3OQ5A 2XD0A 3CD6T 3GBQA 2QA4T 2ECZA 4X1VA 2Y90A 1PSEA 3CCLA 2QA4A 3U23A 1QLYA 3SWNB 1PHTA 2E5QA 2CYZB 2HNIA 3VV0A 4RKUE 2DTIA 2F1LA 2Z0WA 4M77A 1VQ9A 1LVKA 4J7FA 4C92E 4XTWA 4WCIA 5FRMA 4II1A 2M02A 2CP3A 1KD1C 4AMCA 2LT4A 4KGVB 4ZTJA 2BTTA 1MNDA 1WLPB 1WGSA 2BZXA 2HBPA 2GFUA 1BU1A 2DO3A 4CC2A 1M1GA 2VXFA 5GANd 2FG0A 3CCEQ 6AT1B 3ZEHA 3MPUB 4XQ3A 4KUDK 5GAMd 2HD0A 2LZ6B 1Q86R 2LCCA 2JM9A 3A8OB 3O5ZA 2QI2A 1ZA2B 4JRKA 2EIFA 4XU2A 1PD0A 2K4YA 3MO8A 3MP8A 3G71A 3G7ZA 4KH1B 3G1JA 3A8LB 1VQ9Q 2CP7A 3OYKA 2YLBA 1PD1A 4RUGA 2CUBA 4M7DD 4E7LA 1WQWA 2CZ7B 1OZ3A 3OSVA 1D1BA 3UATA 1IXDA 4XTUA 4HKEA 2EQKA 2DL3A 1OPLA 2XK0A 7AT1B 2RQTA 1M2VA 2R5AA 5I2SA 1Q7YC 1RACB 5FU6B 2YHTA 2X3XD 1UJ0A 2D0QB 3CC4Q 2G3RA 3ZFJA 1MV3A 4KGZB 4FSSA 1X6GA 3LLRA 2E1HA 3OYNA 1VQ7T 1IB8A 1D3BB 2LP5A 3L2WA 2ZGWA 1QP2A 3OYEA 4GLKA 5GAMh 4C5GA 4CC4B 1YCSB 2LJ3A 3FJ5A 1BK2A 3HRTA 1JO8A 2VV5A 5LJ3d 2ESWA 1W2BA 2X4WA 3OYHA 4MDXA 1H92A 1XJWB 4NL2A 1OX8A 5KE3A 4FYXB 3ER0A 3O8VA 5D7UA 2RHXA 1QW1A 2RM4A 1K9MC 3GLXA 3NTKA 1GL5A 4FM4B 2J05A 3G6EQ 3L2RA 4J9DA 2ED1A 4L59A 5HKCA 1IGUA 1N9SA 4LDWA 4XAXB 2J06A 1KG1A 2HMAA 2QAZA 5GAOp 4D8DA 3KUFA 3A8MB 5M9OA 1SSFA 3M54A 1Q82C 2ZPGB 3FRNA 2KT8A 3ZBDA 4E2FB 5HK3A 1WHLA 1AWWA 5I21A 1NG2A 3CEYA 3CBMA 1NM7A 1TH7A 1Q82R 4RMOA 3E2UA 4J9CA 3DB3A 4AG2C 4GBQA 4DBFA 2O2OA 5GAMe 3CCSQ 1PKSA 2OX7A 2QK0A 4IUPA 2D8JA 4DQ2A 3HFNA 2IPOB 1K73U 2FHDA 2DEQA 1VQ8A 1YIJT 3X24B 4J6YA 3QDRB 4HCBA 1WJQA 3F70A 5GMKj 5LJ5g 2E4HA 2EAYA 3PE0A 2JNGA 4R55A 3I9QA 4JS4A 3G6ET 2LT1A 4FT2A 3G6EA 4LXCA 1WJSA 4BI4A 4ZGDB 2PVGB 1VQNQ 2VASA 2KI7A 2ZPBB 3QBYA 1KQ1A 2COYA 1QCFA 4M77B 3S3MA 1QMCA 4XK8E 1X6BA 3UA7A 3I55A 4E7HA 1WQ7A 2RI5A 5KYYA 5IXFA 5C6SA 3LYIA 4LD9K 1OQKA 2KSSA 2DXUA 4L6V5 4RTVA 1RAGB 3FLGA 8AT1B 4ESRA 2CP6A 3PVQA 3NMZC 3JCMX 3JCMe 5HY6A 1VQ4T 1LNXA 4FYVB 4HCKA 3CCLQ 1BCOA 1XNIA 3CCSA 3E9GA 3BDUA 1HSQA 2AT1B 2ED0A 1RAFB 4CI0C 4M77G 3MHXA 1YJ9Q 3DB4A 3CC7A 1KFZA 3OSSC 2RHYA 4JJCA 5KCOA 3EG1A 1DJ7B 2CS7A 2NUPB 1GFCA 4M75G 1MV0B 3EGDB 4Y91A 1QCNA 4C8QE 3JCMg 1VQ6A 3J7AF 2KROA 1XQHA 5KYUA 3OYDA 3GPLA 2PQWA 5A0LA 1GCQA 4EMKA 3L2QA 2CH4A 1M8VA 2V1QA 2ZPFB 4ZGEB 1TS9A 1B3QA 2KXDA 2XDDA 2KR3A 1GCQC 4EMKC 5GANj 4JRPA 2MK5A 4PJLA 3EHQA 2BE9B 2VWFA 5KYWB 4J9BA 2CT4A 4OB0B 1MMAA 3GNFB 4RTZA 2LMJA 1JJ2S 5IXBA 8ATCB 4OGCA 2KDSA 1OZ2A 3S3NA 2FRWA 5CKDA 1K9MR 3EG3A 1YI2Q 1E6GA 2LJ0A 3OYFA 3CBPA 2E12A 5FU6C 1M90R 4M75C 2BZ8A 4XTVA 4C0ZA 1OYXA 2L3PA 1PCXA 2JZ2A 1VQOT 3CC7Q 2JVVA 3JB9I 1VYTA 3CCRT 3QG1A 5DLOA 1JJ2P 1D3BA 1EIFA 5LJ3j 1JB0E 4LNPA 1C6VX 1U8RA 2GTJA 4M78G 3QWYA 4XTYA 2LQ8A 4OMOA 3L2ZA 2EYQA 5GMKi 2KRSA 2NUPA 1SRMA 2FZCB 1TUDA 5IHNA 3S3OA 3JRZA 1GBQA 1K1ZA 4R0KA 2RHUA 4PK4A 2NYSA 4PJNA 4E47A 4DBRA 2OAUA 2QQRA 4J6WA 4B6MA 4O6JA 1KHIA 2H3EB 1YHQA 1VQKQ 2OI3A 1GBRA 1M8MA 2EWNA 4RTXA 2C0IA 2V8KA 4J9IA 3LWHA 2ZZDA 1NJIC 2XI9A 3META 2DIQA 5DLQE 1QWFA 5FROA 3CPWA 1X2KA 4CC7A 2J6KA 2YUPA 4HVWA 3GIBA 1M2OA 2FPFA 1YJNT 5GANg 4BE2A 3JB9H 2HKNA 2P4RA 1ZUUA 4X9CA 2VXEA 3CMEQ 4OB1B 2RQRA 1AWXA 5GMKh 2EGAA 3UWNA 1UGRB 1M3AA 4BI8B 3QDFA 3G4SA 3FDRA 2JMCA 2GTOA 3G71Q 4PJOE 1WHMA 3SWNC 3J81E 3HP9A 3V8JA 4EMHA 2Y4XA 4NL3A 4YTLA 1VQLT 1JXMA 3RBBB 3OB9A 3H6ZA 5GAOl 1PC0A 4J8OA 1TSFA 1G3WA 3EH2A 3QKJA 3WXMB 1Q86C 1BI1A 3A5ZB 1LJOA 1K9AA 3C0CA 5C0MA 1TWBA 4JPBW 1UDLA 2K3XA 5A2QE 2V26A 3UF4A 5LJ3g 2KEAA 4HXJA 3R6NA 1D09B 2FRYA 1AHJB 4C8QG 1ZQ1A 3EHRA 1NLPC 1Q86U 3QIIA 2M16A 3OMCA 4BD3A 2AIRB 3QZ9B 1PRMC 1YBYA 2DVEA 4N4HA 5DM7R 1AWOA 1W2BP 4M77E 4BY6B 4B9WA 2YUQA 1QQJA 2EJFA 5L23A 2DXTA 4PFZA 3M4YA 4M7DE 5CQXA 4C0DB 1PKTA 1SG5A 3E1SA 2CDTA 4JRIA 4M4ZA 5FU7C 3ZL7C 4JZ3A 2F2WA 4RCCA 1FX7A 4Z88A 4M7AF 2LQNA 4IKFA 4PJOB 5A0DA 1VQPQ 4OMLA 1ZUKA 2DF6A 1OPKA 4JUVA 3IQLA 4E7ZA 1TU0B 2ZPHB 4AFZC 2XIDA 1ARKA 3OYJA 2AK5A 3TVTA 2D0NA 1YIJA 1VQ8Q 4J9EA 2KY9A 3VS1A 5GAN3 2QXFA 2EQMA 1G2BA 4NOYA 4ANJA 4LE9A 2HQXA 3RR6A 2EYWA 1OX9A 2CZ1B 1UGPB 1N27A 3REAB 2DMOA 2RPNA 3V7SA 3HL8A 3CCVQ 4AG1C 3I5RA 1YJNA 4JDSA 1V29B 5CR2A 2KVQG 4VUBA 3QYGB 3UA6A 2C06A 2E3HA 1MMDA 2X4XA 1RABB 3OMGA 1UEBA 4JS5A 2HSPA 3JCMJ 2K5LA 2DTHA 5GANh 2D1XA 1K0XA 4QKUA 2LX9A 1WI7A 2MIOA 5GJWB 3CXCA 5GAN5 4MMLA 4A54A 5CO7A 3HHTB 1V1CA 4BE0A 1M4ZA 2M0OA 2AKLA 5CK9A 9ATCB 2ZCFB 3EH1A 3OS0A 3JCMf 3CBOA 1KD1R 2GNCA 3M4GA 2KE9A 1T3LA 2NWMA 4M7DA 3C95A 3M0PA 2PTKA 3JCMh 5GAMg 3H0FA 2F2XA 2EJ9A 2YUOA 3CXCS 1WHHA 2ABLA 4OVAA 2QEXA 1GFDA 3BE3A 4A53A 4PNOA 2QEXT 1KHCA 2W0ZA 1YJNQ 4M7AA 3OS5A 4HT8A 4A4KA 1G83A 4C5IA 4IUQA 3JCMQ 1I8FA 3JCMW 4N0AA 3L42A 1N6AA 1M90U 2F5TX 1G3YA 1S1NA 3CMET 3WVDB 1YWOA 2L3SA 3LW5E 1WHKA 4F7UF 1VQ5T 5GMKm 1H3HA 2MI6A 2DKGA 4OB3B 1M2VB 4FU6A 1P92A 1SEMA 1K73C 3VS6A 3HKSA 2RQUA 3VU3C 1D1CA 1M9SA 1AVZC 2DE0X 2P0KA 2VVKA 2FVUA 4QT7A 1X6OA 2ZPIB 2KYMA 1TUCA 2DEUA 2VGMA 2EYXA 2RQWA 3RMSA 4MMKA 1NZ9A 4RTYA 4XTZA 3MCAB 3CC4A 4PJMA 4IIMA 3A1PA 3AT1B 3QXEB 2HDAA 3OYYA 1ZLMA 3PNWC 1Q7YR 2QA4Q 2E10A 1QVGS 5J3BA 2K3YA 3LGLA 2JUFA 2GBQA 3NHNA 3HTRA 2DJZA 2JJ9A 2L5QA 2GQVA 4M75B 4PJOA 2CKKA 4PLLA 3PMIA 2L2PA 2O4XA 3VS4A 2EGCA 1QVPA 1RAIB 2RJEA 4KH0B 5IT9E 1WXTA 4MDWA 3CD6A 1IO6A 2LQWA 2HCKA 2PNIA 2E65A 4HVUA 2ENMA 3H41A 1H3ZA 3M59A 3HPWA 2NUTA 1YJWQ 1K0SA 4BUGA 1OULA 3JCMc 1CKAA 1M3BA 3JCMd 4E7SA 2JS2A 1UJYA 3ME9A 2L3RA 1K8AR 4EIKA 1NPPA 2DL5A 2D9TA 4MZTA 5FWBA 2YSQA 2BIVA 1Y57A 4XTXA 2DPPB 4J9HA 3OS2A 5LJ5j 1FYNA 2I0NA 4M75F 1Q82U 5FWCA 4FT4A 1M5Q1 1VQ8T 2DXBA 1VQ7A 3BFMA 4HT9A 3EFRA 4ZNXA 2BZYA 2HAXA 3I5SA 3ULRB 4JZ4A 4HCCA 2E6ZA 2RB6A 4BE1A 4PKCC 4F7UG 1K9MU 1G8XA 5GAMj 3CMAA 5LJ5f 2DZ9A 1VYVA 1VQNT 2LNHB 3OYIA 5KYNA 1RI9A 4M78B 1NBEB 2DNUA 1YWPA 1Q95G 3CCVT 1UTIA 4FIBA 3T9NA 4C8QA 4RTWA 2KT1A 4ZN1A 1IHWA 1QVGA 4E6RA 2B86A 2K5FA 2O01E 1UFFA 2X3WD 5LJ3h 1YJWA 2EKOA 2O88A 4L5GA 2M51A 5GMKl 1EFNA 1FXXA 4PJJA 4QQ6A 2QGFB 4RTUA 1JJ2A 4ZGJB 3M0RA 2DETA 1RAEB 4F7UB 3CCLT 1MNEA 2OTLQ 2DK3A 3EG9B 3NTHA 3PFSA 1UG1A 1Y0MA 1D1AA 4OMNA 1M30A 3M0SA 3VYGA 3L2VA 2VB6A 3VUZA 3QJYA 1Q7YU 2FYKA 3CCUA 4PJOC 3EFSA 5D6WA 2K3BA 2MAMA 1WYXA 1S72T 1NJIU 1UUEA 1XOVA 4N4IA 3ASKA 2YLCA 1BBZA 3OA6A 3CCJT 4M78F 5LL6S 1SKUB 2LRQA 2XU8A 3NPFA 3CMAT 3UT1A 4CC3A 3TREA 2ROTA 1R0CB 1IRXA 2E64A 1PRLC 2QDLA 2KMTA 4BY6C 2FZGB 1FMWA 2M9UA 1FMKA 1AOJA 4M75D 2CGHA 3CCQT 3VYHB 1VQ5Q 3OW2P 2JT4A 3JB9G 1WDXA 2PU9B 1BI0A 3NGPA 3UPUA 1T0JA 3KBGA 2FZKB 3GP8A 4F7UE 3HSBA 2PVOB 3M0UA 1W2BS 4FW2A 2PUKB 5CKHA 2FEIA 4M77C 1UHCA 1WPYA 2QQSA 1KC8U 1OU9A 2XDPA 2GF7A 3RDVA 2BUDA 4M7DC 1O75A 1B7TA 3CCST 3OYGA 1UGSB 1BYMA 3RMQA 4C8QF 1VQPA 4OMQA 2K79A 1WNLA 2DERA 4J9FA 4R56A 3PVLA 4IURA 4LDUA 3WVEB 5KE2A 1JU5C 4C92B 1KD1U 3BW1A 2EBPA 1M3CA 4M77D 3A8GB 1TUGB 5I2MA 5AYFA 2GCXA 1Z9QA 4DBHA 3CCMQ 2A37A 2DA9A 3NTIA 5IHIA 4C5EA 1YJ9A 2HEQA 5CIUA 4IIOA 2XHCA 2ATCB 3FIFA 4OB2B 2COWA 2MPXC 1K73R 3JSCA 2XICA 1C1AA 2XG8D 1RUWA 5KYXA 3X20B 4C8QC 3X26B 1W6XA 4HCZA 1VOMA 1VQ6T 2AZVA 4KULA 3CPWS 1PG5B 3KXTA 1N8RU 3GNGA 1OU8A 4ME7A 5GAMf 1UGQB 2QQAA 4F14A 2O9SA 2GGRA 3EFOB 2HQEA 2J6OA 3I55T 3MKDA 4M78A 1TTHB 5GAN2 1ZBJA 1YFNA 3CD6Q 4M7AB 4RG2A 1ZSGA 3P8HA 2DL8A 1VQKA 1WHJA 2VGNA 3SWNA 1AZEA 1AT1B 2M1HA 3VRYA 3EGXA 2CZ6B 2KQWA 1K76A 2QDYB 1ABQA 2NUZA 1AWJA 1O9SA 1S72A 4A4HA 3BDLA 1N8RR 4A4FA 3SEMA 3BY7A 2RNAA 1Q81U 3CCUT 2E5KA 2P0PA 5EG2A 5KYYB 5GAOm 1A0NB 1I1JA 2IVWA 3JCMV 1FMVA 4HVVA 3VS2A 1W70A 2OTJQ 2X9HA 3OYCA 2NUTB 1U5SA 4M7AG 1YITT 1RI0A 2L8DA 4ELYC 4C5HA 1VQ6Q 5CQYA 3MJXA 2XDBA 5CCAA 3CCQA 1D0ZA 5D6XA 3Q1JA 2RJCA 3CPFA 2KAFA 3I55Q 1UE9A 2PZ1A 3QHSA 2YXYA 2YUNA 1JEGA 4C92C 4QVZA 4ZTFA 5IH2A 5IAYA 2R58A 1QWEA 5CKBA 1KK7A 2DRMA 2D6FA 4OF1A 2C0TA 4JJBA 3RIRA 1VQOQ 2DXCA 2DRKA 1WA7A 2LCSA 4EMGA 3OYLA 4Y28E 3S6WA 2QTXA 3A98A 3CC2T 4F17A 3X28B 2EVRA 4B9XA 1S72Q 3LWIA 1UECA 2I2LA 3LH5A 2P0QA 5LJ5h 4M78C 2VC8A 5LJ5d 2OTJT 1C0MA 2LX7A 3H0IA 2FPEA 4GLMA 1VQOA 4RG8A 3M58A 2JMAA 1VQ4A 2OTJA 5I11A 4BI3A 3MEVA 3HRUA 4UC4A 3G4ST 2LQKA 1BI3A 1YP5A 4LDXA 1B34A 1VQMA 4C92D 2K2MA 1IZ6A 2QYZA 2CREA 1LCKA 1QVGP 3LGFA 3SHWA 1M1KR 2ROLA 3CCQQ 2DFUA 1N5ZA 1VQ7Q 1RLPC 1OEBA 4EPCA 3C12A 4LUEA 1Y7XA 1QKXA 2JW4A 2DILA 1QP3A 2DAQA 5A0GA 2JTFA 4QQGA 1NLOC 3EG2A 5HK0A 3VS7A 4MZPA 4ORZA 3TSZA 2DX1A 2K5IA 2QTVA 1KSWA 1ZSZC 2RI3A 4ATOA 5GAOq 1Q81R 1PSFA 4KGXB 1U1SA 2MWPA 4LDYA 3V7RA 4AFUC 3QZ5B 5CAIA 3EGXB 4M7AE 2YDLA 3G4SQ 5DY9A 1X01A 2EPDA 4M7AD 3RUXA 3M57A 5FLXE 4ELZC 1VQ5A 1TXQA 1RADB 4JJNK 1BB9A 3RKYA 1Y71A 1MMGA 5FW9A 3QWXX 2DD4A 4BB7A 1SSHA 1OOTA 1T3SA 4N0AC 5I22A 1SPKA 2MWOA 2HL3A 3V8LA 3M55A 2A36A 3D7SB 4DBQA 1IHVA 4FCYA 1WIEA 2DJQA 2AHJB 2JXBA 2DLPA 1WX6A 3EAEA 1Y96A 4QW2A 4BDYA 3QYHB 1QVFP 1LOJA 3FB9A 4WF2A 4JRQA 3PIPA 3R6OA 2MF2A 5EC7A 2E70A 3CXCP 1UHFA 5L8RE 2NLUA 5J39A 1YIJQ 2EYZA 3FC3A 3PGGA 3A8HB 2RN8A 2FO0A 1CKBA 2OTLA 3OS1A 1KQ2A 1RL2A 3MP6A 4Y92A 2J7IA 5GAOn 1I5OB 3M5AA 4PJOD 3VS3A 4P5NA 4WTOB 3PTAA 1VQ9T 3M0QA 2RF0A 5HCKA 4LN2A 1HJDA 4E7KA 5CVIA 2CP0A 1SF9A 1I81A 3CCUQ 2O4XB 1Y96B 3VKIA 2A0FB 1F1BB 2VKNA 1EX4A 2QQBA 4J9GA 1G5VA 1YITQ 2RH2A 1VQPT 2KRNA 1T0HA 2FPDA 2LC4A 4BDZA 3HFOA 2LDMA 3QO3A 1VA7A 4FYYB 5KCHA 1ACMB 3FJPA 1AD5A 1QVFA 3QUIA 2GFAA 1KQSA 4QVCA 2RHZA 1N9RA 1YITA 1LPLA 1V76A 3JCMb 1JQQA 1MMNA 1VIFA 4LDVA 3VS5A 3JV3A 2JN0A 2IG0A 1U3OA 1TG0A 2VUBA 1I0CA 2LTOA 3VRZA 1YJ9T 4Z02A 1OV3A 2PUOB 4FSXA 1ZX6A 4JLGA 1WHGA 1KJWA 2EYYA 2XKOC 1ZSZA 2D8HA 5GAOr 2L3QA 4DEYA 3V8KA 1M1KU 2Y4YA 1X2QA 3H0HA 3RNJA 3M0TA 2HQHA 3CPWP 2IIMA 4FL6A 2E41A 5KYWA 3EG0A 1MUZA 1X69A 2AZSA 3MEWA 4AFQC 1EZZB 1K8AC 2SEMA 1PNJA 1SHGA 4GY5A 2K6DA 2V8IA 3I56A 1K4US 2F2VA 4HA8A 3E19A 1FWZA 1J3TA 1NYFA 1YI2T 1CSKA 2LCLA 1VYUA 4DA4A 4KBMB 2DBMA 4F04B 1BKBA 1YI2A 4C8QD 4TVRA 5GJVB 3I56Q 4EMKB 2RA2A 2DZCA 1VQNA 2PVDB 2P84A 2RQVA 1HXDA 1M1FA 1M1KC 3CCEA 3CCRQ 5FU7B 2V1RA 4C92G 1BCMA 2RMOA 1OI1A 2YT6A 1KC8C 3TQ7P 4K11A 4CRIA 4KT0E 1GRIA 1ZHIA 5LJ3e 3CCVA 2RHIA 1KC8R 1VQMQ 1RAAB 4N4GA 3JB9F 2LNVA 5CKFA 1YHQQ 2EFIA 3GOXA 2FL7A 4E7JA 2OTLT 2O9VA 2JTEA 1NJIR 2KGTA 4M75E 2RD1A 3M56A 4JJDA 5GMKe 2O31A 3PT9A 2RK1A 2RK2A 3V7CA 4F7UA 1JBMA 2HBWA 2RJDA 2L89A 4JLIA 4V2SA 1D0YA 2F5KA 1JXOA 3TU4K 3EG9A 3TCJA 2BE7D 2J6FA 3CCJQ 4XU0A 2KYBA 1X27A 2DVJA 4D6WA 4DOVA 3LX7A 2V8JA 3SD4A 3I35A 1AZGB 4LD6A 1YCYA 1BIAA 3CCRA 1SHFA 1YNZA 1VQ4Q 1I07A 4XU1A 5KH6A 1VQLA 1IGQA 2MYSA 5IHKA 3C94A 2HL5C 4J7IA 4A4EA 1NPRA 2CSIA 3RKWA 3SFMA 2DM1A 3P8BB 4AFSC 1VQMT 2H3JA 5GAN4 1YHQT 1BI2A 2SRCA 2WACA 1KQSP 1NYGA 2QG9B 1I5LA 2HKQB 1VQLQ 4F16A 4Q5WA 1QCOA 4OGEA 4J83A 2EW3A 2CSQA 1YJWT 4QQDA 5LJ3f 3C4SA 2DIGA 4IUTA 2QGGA 3H8ZA 3L2UA 1HYOA 1U06A 1PWTA 4J5YA 3INZA 4MZMA 1UGVA 4EDUA 1ABOA 3TSWA 2WSEE 3PMTA 5AT1B 3DKMA 3LH0A 2R5MA 3M53A 4C92F 3OW2A 3AHUA 4M78E 2KXCA 2CUDA 2C0OA 4M78D 4Z89A 1SRLA 1R0BG 4DOWA 1NE8A 3QSUA 1E6HA 2DYBA 2WSCE 2MCNA 1KIKA 2OJ2A 2X4JA 1HD3A 4J6XA 1Y07A 3VS0A 2DTOA 2ZAEA 5GAN6 1GCPA 2CZ0B 2EQUA 3JB9J 2QASA 3KFVA 2ZPEB 2MMPA 3P8DA 1G3TA 3SB2A 3CC7T 4C8QB 4RTTA 1H641 3X25B 1WJRA 4A63B 2KRMA 2YRDA 3RKXA 2WSFE 4PL6A 2DBKA 4C0DC 1WXBA 4PJOF 2HSEB 1HK9A 5KYUB 4X9DA 5GAN8 3J80E 1U1TA 2MOXA 1X43A 5FRNA 1TOVA 1QVFS 1WXUA 2DD5A 4ZN3A 2JTMA 3E9FA 2GQIA 5ECAA 2KBTA 3CMEA 1R77A 2DYIA 2K7AA 2VYTA 3EFOA 4M7AC 2FB7A 4KRTA 1VQKT 2G6FX 3GF5A 3SDZA 4PJOG 1H8KA 3EGUA 1XTDA 4OMFB 1W4SA 2JS0A 5LJ5e 4PFPA 3M9QA 2X35A 2RO0A 5GANf 5IN1A 2CP5A 2M0YA 2RI2A 3I56T 2A3LA 3QPHA 4KUIA 1Z9ZA 3L1AA 2OAWA 1MGQA 1Q81C 1ZUYA 1D0XA 4E7IA 4LUDA 2EJGA 3CC2A 3TEEA 1I4K1 5GANe 3PIOA 3CMAQ 2LJ1A 2AKKA 1RLQC 2A28A 3UDCA 2EQIA 5D6YA 1VUBA 4C0GA 2W10A 3OW2S 1ZBXA 2DL4A 3CC4T 4M77F 3N5BB 1M27C 4FYWB 4FW1A
chains in the Genus database with same CATH topology
2DD4A 3M59A 3HPWA 4BB7A 4JRPA 4BUGA 3JAME 3DLLA 4OP0A 4N0AC 3MEAA 2F69A 3VJPA 3G71T 4M7DF 4C92A 4OB0B 3JCMc 3GNFB 3JCMd 2MWOA 3URGA 3V8LA 3M55A 1JRIA 2JOYA 3ME9A 1JJ2S 4PLIA 2L3RA 5CKEA 1GXIE 1NPPA 3JB9D 4OGCA 2AHJB 4A4GA 2B8AA 2D9TA 2KDSA 4IUUA 4MZTA 1OZ2A 2P4TA 4C0FA 2BIVA 4XTXA 2KK4A 2DPPB 1N8RC 3G4ST 3OS2A 5LJ5j 3EAEA 1Y96A 4QW2A 4BDYA 3S3NA 5CKDA 3HRSA 4M75F 4QVDA 3OYFA 3CBPA 3QYHB 1Q82U 1LOJA 2E12A 3FB9A 4NS5A 4WF2A 3PIPA 4FT4A 3R6OA 5FU6C 4JRQA 2MF2A 4M7DB 1UB4A 4M75C 1M5Q1 1VQ8T 2DXBA 1VQ7A 4XTVA 2RJFA 3BFMA 4C0ZA 2E70A 1OYXA 2QQ9A 4HT9A 2BKDN 3EFRA 1VIEA 1X75C 5L8RE 2HAXA 2NLUA 2JZ2A 3DLMA 2EQJA 4O5VA 1VQOT 4HCCA 2E6ZA 2R57A 2RB6A 2JVVA 2LVMA 5J39A 4BE1A 3FC3A 3JB9I 3PGGA 4PKCC 3A8HB 3NFCA 3CCRT 4F7UG 3QG1A 5DLOA 3OYAA 1K9MU 2OTLA 1D3BA 5GAMj 1EIFA 3FEOA 5GAN7 3CMAA 5LJ3j 5LJ5f 1G3SA 2DZ9A 3OS1A 1KQ2A 1RL2A 3MP6A 1VQNT 1JB0E 5J26A 3QJ6A 3OYIA 3MEUA 5GAOn 4RCBA 1U8RA 3M5AA 4PJOD 1BIBA 4M78B 1K8AU 2YRVA 4M78G 2A7YA 4P5NA 4FIBA 3T9NA 4C8QA 3PTAA 2K2VA 4ZN1A 3CCMT 4XTYA 1VQ9T 1QVGA 3OBWA 2LQ8A 4BACA 3L2ZA 1MHNA 2EYQA 2K5FA 2O01E 4IUVA 4XU3A 3VUBA 5CVIA 5GMKi 4M75A 5LJ3h 4E7KA 4M7DG 3OYMA 1I81A 2O4XB 1YJWA 2EKOA 3S3OA 1Y96B 1B34B 3VKIA 3JRZA 3OBYA 4L5GA 1IREB 3CCMA 2RHUA 3RESA 1FXXA 2E6NA 5GMKl 2QQBA 4QQ6A 1G5VA 1JJ2A 4E47A 2RH2A 2X4YA 4ZGJB 1VQPT 3RERA 1KQSS 2K57A 2LC4A 2OAUA 4F7UB 2QQRA 3OYBA 3HFOA 3CCLT 4J6WA 4BDZA 2LDMA 3QO3A 4O6JA 1KHIA 5KCHA 1YHQA 3FJPA 3CCET 1QVFA 2EWNA 3QUIA 2GFAA 3OY9A 2DK3A 3MP1A 1KQSA 3NTHA 4QVCA 2RHZA 3PFSA 3CCJA 1N9RA 1R8OB 1YITA 4X34A 2V8KA 3LWHA 2ZZDA 3OQ5A 1NJIC 2XI9A 3VYGA 3L2VA 3JCMb 3VUZA 3META 2DIQA 1VIFA 5DLQE 5FROA 3CPWA 2XD0A 3QJYA 4LDVA 3CD6T 1Q7YU 2FYKA 2QA4T 3CCUA 2JN0A 2IG0A 4PJOC 2Y90A 2VUBA 1PSEA 3EFSA 5D6WA 3CCLA 2QA4A 2LTOA 1YJ9T 2MAMA 4Z02A 2PUOB 3SWNB 1S72T 3GIBA 2E5QA 1NJIU 2CYZB 2HNIA 3VV0A 5GANg 1YJNT 4N4IA 1XOVA 4BE2A 4RKUE 2DTIA 4FSXA 4M77A 1VQ9A 3JB9H 3ASKA 2YLCA 4J7FA 4C92E 4JLGA 4XTWA 3OA6A 4M78F 3CCJT 4X9CA 5LL6S 2VXEA 5FRMA 4OB1B 5GMKh 2LRQA 2XU8A 4II1A 1UGRB 3UWNA 4BI8B 3CMAT 3UT1A 3G4SA 3TREA 3FDRA 1KD1C 2LT4A 2XKOC 5GAOr 4PJOE 3V8KA 2E64A 3SWNC 3J81E 3HP9A 3V8JA 1M1KU 2Y4YA 2Y4XA 4EMHA 4ZTJA 2KMTA 4NL3A 4YTLA 1VQLT 4BY6C 3OB9A 1WGSA 3H6ZA 5GAOl 2HBPA 2GFUA 4J8OA 2DO3A 2M9UA 1G3WA 3QKJA 4M75D 2CGHA 3CCQT 3VYHB 1M1GA 2VXFA 3WXMB 1Q86C 3JB9G 5GANd 1BI1A 2PU9B 1BI0A 3A5ZB 4FL6A 2E41A 1LJOA 3ZEHA 4XQ3A 5C0MA 3UPUA 4KUDK 3KBGA 3GP8A 4F7UE 3HSBA 2PVOB 2HD0A 3MEWA 5GAMd 2LCCA 1K8AC 2K3XA 1W2BS 4GY5A 3A8OB 5A2QE 2V8IA 3I56A 2PUKB 4HA8A 2QI2A 3E19A 1FWZA 4JRKA 5CKHA 2EIFA 4M77C 5LJ3g 1YI2T 4XU2A 2LCLA 1WPYA 2K4YA 2QQSA 3MO8A 1KC8U 3MP8A 2XDPA 3G71A 2GF7A 4KBMB 4DA4A 1AHJB 2BUDA 1BKBA 1ZQ1A 4C8QG 1YI2A 4M7DC 1O75A 3G7ZA 1Q86U 4C8QD 3CCST 3OYGA 1UGSB 4TVRA 3QIIA 1BYMA 2M16A 3RMQA 4C8QF 1VQPA 4EMKB 2RA2A 2DZCA 1WNLA 3A8LB 1VQNA 2PVDB 3OMCA 4BD3A 3QZ9B 1HXDA 1M1FA 1YBYA 2DVEA 4N4HA 3CCEA 1M1KC 5FU7B 5DM7R 4C92G 4R56A 3OYKA 2YLBA 4IURA 4LDUA 4M77E 1OI1A 3WVEB 4BY6B 4C92B 5KE2A 1KC8C 4B9WA 3BW1A 1KD1U 4M77D 3A8GB 2EJFA 5I2MA 5AYFA 4KT0E 4CRIA 4M7DD 2GCXA 4E7LA 2DXTA 1WQWA 2CZ7B 1OZ3A 3OSVA 3M4YA 4M7DE 1ZHIA 5CQXA 4XTUA 4HKEA 3NTIA 4C0DB 4C5EA 2EQKA 5LJ3e 1YJ9A 3CCVA 2RHIA 3E1SA 4JRIA 5CIUA 2XK0A 2XHCA 4N4GA 5FU7C 2LNVA 2R5AA 3FIFA 5CKFA 3JB9F 5I2SA 4OB2B 4RCCA 2EFIA 3GOXA 2FL7A 4E7JA 1FX7A 1Q7YC 2OTLT 3JSCA 5FU6B 2YHTA 4M7AF 2XICA 2D0QB 2G3RA 2XG8D 3ZFJA 4M75E 4IKFA 2RD1A 3M56A 5A0DA 4PJOB 3X20B 5GMKm 3LLRA 5GMKe 4C8QC 2E1HA 4JUVA 3PT9A 2RK1A 3X26B 3OYNA 2ZPHB 2RK2A 4HCZA 3V7CA 4F7UA 1VQ6T 1VQ7T 3CPWS 1JBMA 4KULA 2RJDA 2XIDA 2L89A 3KXTA 3OYJA 4JLIA 1N8RU 1D3BB 4V2SA 3GNGA 2F5KA 4ME7A 5GAMf 3TU4K 1UGQB 2QQAA 1YIJA 2KY9A 3L2WA 5GAN3 2HQEA 3I55T 2ZGWA 2QXFA 4M78A 3TCJA 1QP2A 5GAN2 3OYEA 2EQMA 4NOYA 4GLKA 5GAMh 2HQXA 4C5GA 4XU0A 4M7AB 4RG2A 4D6WA 3HRTA 4DOVA 2C06A 2CZ1B 3LX7A 2V8JA 3SD4A 4LD6A 1UGPB 1YCYA 1BIAA 2VV5A 3P8HA 5LJ3d 3CCRA 1VQKA 1W2BA 1N27A 2VGNA 2X4WA 3SWNA 3OYHA 4MDXA 4XU1A 5KH6A 1VQLA 2M1HA 3C94A 4NL2A 2CZ6B 2KQWA 4J7IA 3V7SA 1NPRA 3HL8A 3RKWA 2QDYB 3P8BB 3SFMA 4A4EA 1VQMT 5KE3A 1YJNA 1O9SA 3ER0A 3O8VA 4JDSA 1V29B 5CR2A 1S72A 4A4HA 2KVQG 4VUBA 2RHXA 3BDLA 3QYGB 1QW1A 2H3JA 4A4FA 2X4XA 5GAN4 1BI2A 3BY7A 1YHQT 2RM4A 3OMGA 2WACA 1Q81U 1K9MC 3GLXA 3CCUT 5EG2A 2P0PA 5GAOm 1I5LA 1UEBA 3NTKA 4JS5A 2IVWA 3JCMV 3JCMJ 4FM4B 3L2RA 2K5LA 2DTHA 4Q5WA 4L59A 5HKCA 5GANh 3OYCA 4OGEA 4J83A 4M7AG 1YITT 1N9SA 1RI0A 4LDWA 2L8DA 4XAXB 4ELYC 4C5HA 1YJWT 1KG1A 4QQDA 5LJ3f 2LX9A 5GAOp 3KUFA 5CQYA 3C4SA 2DIGA 3A8MB 4IUTA 5M9OA 3CXCA 5GAN5 2XDBA 1SSFA 3M54A 5CCAA 2ZPGB 3H8ZA 3FRNA 1Q82C 3L2UA 3CCQA 4MMLA 4A54A 5CO7A 5D6XA 3HHTB 4BE0A 3ZBDA 1M4ZA 2M0OA 2RJCA 3Q1JA 5CK9A 2ZCFB 3CPFA 2KAFA 4J5YA 5HK3A 1M90C 3OS0A 3INZA 5I21A 4MZMA 3JCMP 3CEYA 4EDUA 3CBMA 3JCMf 3CBOA 3QHSA 1TH7A 2WSEE 3PMTA 4RMOA 3M4GA 3DB3A 4C92C 4QVZA 3DKMA 3LH0A 4ZTFA 2R5MA 5IAYA 4M7DA 3M53A 3C95A 2R58A 4C92F 3OW2A 3CC7T 5CKBA 3AHUA 4M78E 3JCMh 5GAMe 4M78D 5GAMg 3CCVT 4IUPA 2D6FA 4DQ2A 2EJ9A 4OF1A 4DOWA 1NE8A 3HFNA 3RIRA 3CXCS 3QSUA 2WSCE 1K73U 2X4JA 2DXCA 2FHDA 4OVAA 2DEQA 4J6XA 1VQ8A 1YIJT 1Y07A 4EMGA 4Y28E 3S6WA 3OYLA 2QEXA 2QTXA 3CC2T 2DTOA 3X24B 3X28B 4J6YA 5GAN6 3QDRB 4A53A 4HCBA 4PNOA 2QEXT 1WJQA 2CZ0B 2EQUA 1KHCA 3F70A 4B9XA 5GMKj 5LJ5g 3LWIA 2ZPEB 3JB9J 4M7AA 3OS5A 2I2LA 2EAYA 2MMPA 2P0QA 3P8DA 1G3TA 2JNGA 4A4KA 4HT8A 4R55A 5LJ5h 4M78C 4JS4A 4C5IA 3G6ET 4IUQA 3JCMQ 1I8FA 2VC8A 3SB2A 4C8QB 5LJ5d 4N0AA 3L42A 1N6AA 3JCMW 2LT1A 1VQOA 1M90U 2OTJT 4RG8A 2F5TX 1G3YA 1H641 3X25B 3M58A 3CMET 1VQ4A 2OTJA 3WVDB 3LW5E 4BI3A 1WJRA 4FT2A 3MEVA 3HRUA 4UC4A 4F7UF 3G6EA 1VQ5T 3RKXA 1WJSA 2LQKA 2MI6A 4BI4A 1BI3A 2PVGB 2DKGA 2WSFE 4ZGDB 4OB3B 4FU6A 1P92A 2ZPBB 1B34A 4LDXA 1VQMA 4C92D 1K73C 4PL6A 3QBYA 1KQ1A 1IZ6A 3S3MA 4M77B 3HKSA 4XK8E 3LGFA 3I55A 4E7HA 1WQ7A 2RI5A 1M9SA 3VU3C 2P0KA 5C6SA 4C0DC 2FVUA 4PJOF 3LYIA 4LD9K 1HK9A 1X6OA 2KSSA 2ZPIB 2DXUA 4L6V5 4X9DA 3FLGA 5GAN8 4EPCA 3J80E 1U1TA 3C12A 2VGMA 1Y7XA 3RMSA 4MMKA 1NZ9A 5FRNA 1QP3A 2DAQA 5A0GA 3JCMX 1QVFS 2JTFA 3JCMe 4QQGA 2DD5A 5HY6A 2JTMA 3E9FA 4ZN3A 3CMEA 1LNXA 1VQ4T 2VYTA 4XTZA 4M7AC 3MCAB 3CC4A 2FB7A 1XNIA 3CCSA 3E9GA 3BDUA 1VQKT 3GF5A 5HK0A 3SDZA 4PJOG 4MZPA 1XTDA 4OMFB 2K5IA 3QXEB 3OYYA 3PNWC 1W4SA 2E10A 1QVGS 2RI3A 5J3BA 4ATOA 2K3YA 5GAOq 5LJ5e 4CI0C 3LGLA 2X35A 3M9QA 2JUFA 4M77G 2RO0A 3MHXA 1PSFA 3DB4A 3CC7A 5GANf 5IN1A 1U1SA 3OSSC 2RI2A 2RHYA 5KCOA 3I56T 2MWPA 2A3LA 3QPHA 4KUIA 4LDYA 3V7RA 2DJZA 1DJ7B 2CS7A 2GQVA 2L5QA 3L1AA 3QZ5B 4M75B 5CAIA 1MGQA 2CKKA 4PLLA 4PJOA 3PMIA 1Q81C 2O4XA 4M75G 4E7IA 4M7AE 2EJGA 3CC2A 3TEEA 5DY9A 1QVPA 1I4K1 1X01A 4Y91A 2RJEA 3RUXA 5GANe 4M7AD 4C8QE 3PIOA 3JCMg 1VQ6A 3M57A 5FLXE 4ELZC 5IT9E 3J7AF 3UDCA 1XQHA 4MDWA 5D6YA 1VUBA 3OYDA 3CD6A 4C0GA 1VQ5A 3GPLA 3OW2S 2PQWA 5A0LA 1ZBXA 4EMKA 4JJNK 2E65A 3L2QA 3CC4T 1M8VA 4M77F 2ZPFB 1Y71A 3N5BB 3RKYA 4ZGEB 5GANj 2XDDA 4EMKC 1H3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HFN A;  3RIR A;  4PJO C;  2Y90 A;  3EFS A;  2YHT A;  3QSU A;  4M7A F;  4OP0 A;  4N0A C;  3SWN B;  4M7D F;  2DEQ A;  4J6X A;  4M75 E;  3JCM c;  4C92 A;  2RD1 A;  4EMG A;  3JCM d;  3GIB A;  4PJO B;  2HNI A;  2QTX A;  5GAN g;  2DTO A;  2DTI A;  3V8L A;  4M77 A;  2E1H A;  4J6Y A;  4A53 A;  4C8Q C;  1JRI A;  4JUV A;  2YLC A;  4PNO A;  5GAN 6;  4C92 E;  5GMK j;  5LJ5 g;  3JB9 J;  4XTW A;  4M78 F;  3V7C A;  4F7U A;  4M7A A;  2I2L A;  2EAY A;  1JBM A;  4HT8 A;  4X9C A;  2VXE A;  3JB9 D;  5LJ5 h;  5GMK h;  4JLI A;  4M78 C;  3JCM P;  1D3B B;  4V2S A;  4XTX A;  1I8F A;  2VC8 A;  3SB2 A;  4C8Q B;  5GAM f;  4N0A A;  5LJ5 d;  3JCM Q;  3JCM W;  5LJ5 j;  1Y96 A;  5GAO r;  1H64 1;  4PJO E;  3V8K A;  5GAN 3;  2E64 A;  4M75 F;  3SWN C;  4QVD A;  2ZGW A;  4M78 A;  1LOJ A;  3FB9 A;  4WF2 A;  3V8J A;  4EMH A;  4F7U F;  4NL3 A;  3RKX A;  5GMK m;  5GAN 2;  4M7D B;  4M75 C;  2DKG A;  4NOY A;  1M5Q 1;  5GAM h;  4XTV A;  5GAO l;  3BFM A;  4XU0 A;  4M7A B;  4HT9 A;  3EFR A;  1B34 A;  4C92 D;  4M75 D;  2CGH A;  2VXF A;  1KQ1 A;  4M77 B;  5GAN d;  3JB9 G;  2RB6 A;  1YCY A;  1BIA A;  5LJ3 d;  2E41 A;  1LJO A;  1WQ7 A;  3VU3 C;  3JB9 I;  3PGG A;  4XQ3 A;  3SWN A;  4PJO F;  4F7U G;  4XU1 A;  1HK9 A;  1D3B A;  5GAM j;  4F7U E;  3HSB A;  5GAN 7;  2DXU A;  4NL2 A;  4X9D A;  3V7S A;  5LJ3 j;  5LJ5 f;  5GAM d;  3RKW A;  2DZ9 A;  1KQ2 A;  5GAN 8;  5GAO n;  4RCB A;  1U1T A;  4PJO D;  1BIB A;  4M78 B;  4MMK A;  4HA8 A;  5GAN 4;  4M78 G;  3BY7 A;  4JRK A;  5LJ3 g;  2RM4 A;  4M77 C;  4C8Q A;  4EMK C;  4XU2 A;  3JCM e;  4XTY A;  1WPY A;  3JCM X;  5GAO m;  1I5L A;  3L2Z A;  1LNX A;  3JCM V;  3JCM J;  4XTZ A;  4XU3 A;  4M7A C;  5GMK i;  2FB7 A;  3JB9 H;  4M75 A;  5LJ3 h;  3BDU A;  4C8Q G;  4M7D G;  2DTH A;  4M7D C;  1I81 A;  4PJO G;  5GAN h;  4C8Q D;  4M7A G;  1N9S A;  1Y96 B;  2E10 A;  1B34 B;  4C8Q F;  4EMK B;  5GAO q;  2RA2 A;  5LJ5 e;  2DZC A;  1WNL A;  4M77 G;  5LJ3 f;  5GAO p;  3RES A;  5GMK l;  1HXD A;  2DVE A;  5GAN f;  1U1S A;  5GAN 5;  4C92 G;  3RER A;  4MML A;  4A54 A;  2YLB A;  2K57 A;  3V7R A;  2DJZ A;  4F7U B;  4M77 E;  3HFO A;  4J6W A;  3L1A A;  3QO3 A;  4M75 B;  4C92 B;  3BW1 A;  1MGQ A;  5CAI A;  4J5Y A;  4PJO A;  3FJP A;  4M77 D;  3INZ A;  4M75 G;  2EJF A;  5I21 A;  4M7D D;  4M7A E;  2EWN A;  3QUI A;  2DXT A;  1WQW A;  2EJG A;  3JCM f;  5DY9 A;  1I4K 1;  1X01 A;  3QHS A;  1TH7 A;  3RUX A;  4Y91 A;  5GAN e;  4C8Q E;  4M7A D;  4M7D E;  3JCM g;  5GMK e;  4XTU A;  4QVC A;  5LJ3 e;  3M4G A;  4C92 C;  1N9R A;  4JRI A;  4M7D A;  4C92 F;  3AHU A;  3JCM b;  4M78 E;  3JCM h;  3FIF A;  3JB9 F;  4EMK A;  2E65 A;  5GAM e;  1M8V A;  4M77 F;  4M78 D;  3RKY A;  5GAM g;  5GAN j;  4RCC A;  2FYK A;  4DQ2 A;  2JN0 A;  2EJ9 A; 
#chains in the Genus database with same CATH topology
 2YRC A;  4OMP A;  3JAM E;  3DLL A;  4OP0 A;  3G71 T;  3MEA A;  2F69 A;  3VJP A;  2CP2 A;  4M7D F;  4C92 A;  1RAH B;  3URG A;  1JRI A;  2JOY A;  4AT1 B;  4PLI A;  1WFW A;  1W1F A;  5CKE A;  1GXI E;  3THK A;  3JB9 D;  1M90 C;  4C0F A;  4A4G A;  2B8A A;  4IUU A;  3JCM P;  1AEY A;  2P4T A;  2KK4 A;  1N8R C;  1PM3 A;  2E3I A;  2HZY A;  3HRS A;  1QKW A;  2X51 A;  4QVD A;  4NS5 A;  3CC2 Q;  2DL7 A;  4M7D B;  1UB4 A;  2RJF A;  3REB B;  3EGD A;  4PFO A;  2QQ9 A;  2BKD N;  1VIE A;  1X75 C;  5KYX B;  2COZ A;  3DLM A;  2EQJ A;  2CH4 W;  4O5V A;  3H9N A;  2R57 A;  2LVM A;  2K9G A;  1ZSZ B;  3NFC A;  2QEX Q;  3OYA A;  3FEO A;  5GAN 7;  1G3S A;  5J26 A;  3QJ6 A;  3MEU A;  4RCB A;  1YN8 A;  1BIB A;  1K8A U;  2YRV A;  2A7Y A;  3CCM T;  2K2V A;  3OBW A;  4BAC A;  2EKH A;  4XU3 A;  1MHN A;  2XMF A;  4IUV A;  2CT3 A;  3CQT A;  3VUB A;  4M75 A;  4M7D G;  4D8K A;  3OYM A;  1B34 B;  3OBY A;  1IRE B;  3CCM A;  3RES A;  2E6N A;  2A08 A;  1B07 A;  2H8H A;  1NEG A;  2X4Y A;  3RER A;  1KQS S;  2K57 A;  4Z8A A;  4DEX A;  2L0A A;  3OYB A;  2JM8 A;  1E7O A;  1NEB A;  3CCE T;  1WZO A;  3OY9 A;  3MP1 A;  2KNB B;  1ZA1 B;  3CCJ A;  2YWW A;  1R8O B;  4OMM A;  4X34 A;  2EGE A;  3OQ5 A;  2XD0 A;  3CD6 T;  3GBQ A;  2QA4 T;  2ECZ A;  4X1V A;  2Y90 A;  1PSE A;  3CCL A;  2QA4 A;  3U23 A;  1QLY A;  3SWN B;  1PHT A;  2E5Q A;  2CYZ B;  2HNI A;  3VV0 A;  4RKU E;  2DTI A;  2F1L A;  2Z0W A;  4M77 A;  1VQ9 A;  1LVK A;  4J7F A;  4C92 E;  4XTW A;  4WCI A;  5FRM A;  4II1 A;  2M02 A;  2CP3 A;  1KD1 C;  4AMC A;  2LT4 A;  4KGV B;  4ZTJ A;  2BTT A;  1MND A;  1WLP B;  1WGS A;  2BZX A;  2HBP A;  2GFU A;  1BU1 A;  2DO3 A;  4CC2 A;  1M1G A;  2VXF A;  5GAN d;  2FG0 A;  3CCE Q;  6AT1 B;  3ZEH A;  3MPU B;  4XQ3 A;  4KUD K;  5GAM d;  2HD0 A;  2LZ6 B;  1Q86 R;  2LCC A;  2JM9 A;  3A8O B;  3O5Z A;  2QI2 A;  1ZA2 B;  4JRK A;  2EIF A;  4XU2 A;  1PD0 A;  2K4Y A;  3MO8 A;  3MP8 A;  3G71 A;  3G7Z A;  4KH1 B;  3G1J A;  3A8L B;  1VQ9 Q;  2CP7 A;  3OYK A;  2YLB A;  1PD1 A;  4RUG A;  2CUB A;  4M7D D;  4E7L A;  1WQW A;  2CZ7 B;  1OZ3 A;  3OSV A;  1D1B A;  3UAT A;  1IXD A;  4XTU A;  4HKE A;  2EQK A;  2DL3 A;  1OPL A;  2XK0 A;  7AT1 B;  2RQT A;  1M2V A;  2R5A A;  5I2S A;  1Q7Y C;  1RAC B;  5FU6 B;  2YHT A;  2X3X D;  1UJ0 A;  2D0Q B;  3CC4 Q;  2G3R A;  3ZFJ A;  1MV3 A;  4KGZ B;  4FSS A;  1X6G A;  3LLR A;  2E1H A;  3OYN A;  1VQ7 T;  1IB8 A;  1D3B B;  2LP5 A;  3L2W A;  2ZGW A;  1QP2 A;  3OYE A;  4GLK A;  5GAM h;  4C5G A;  4CC4 B;  1YCS B;  2LJ3 A;  3FJ5 A;  1BK2 A;  3HRT A;  1JO8 A;  2VV5 A;  5LJ3 d;  2ESW A;  1W2B A;  2X4W A;  3OYH A;  4MDX A;  1H92 A;  1XJW B;  4NL2 A;  1OX8 A;  5KE3 A;  4FYX B;  3ER0 A;  3O8V A;  5D7U A;  2RHX A;  1QW1 A;  2RM4 A;  1K9M C;  3GLX A;  3NTK A;  1GL5 A;  4FM4 B;  2J05 A;  3G6E Q;  3L2R A;  4J9D A;  2ED1 A;  4L59 A;  5HKC A;  1IGU A;  1N9S A;  4LDW A;  4XAX B;  2J06 A;  1KG1 A;  2HMA A;  2QAZ A;  5GAO p;  4D8D A;  3KUF A;  3A8M B;  5M9O A;  1SSF A;  3M54 A;  1Q82 C;  2ZPG B;  3FRN A;  2KT8 A;  3ZBD A;  4E2F B;  5HK3 A;  1WHL A;  1AWW A;  5I21 A;  1NG2 A;  3CEY A;  3CBM A;  1NM7 A;  1TH7 A;  1Q82 R;  4RMO A;  3E2U A;  4J9C A;  3DB3 A;  4AG2 C;  4GBQ A;  4DBF A;  2O2O A;  5GAM e;  3CCS Q;  1PKS A;  2OX7 A;  2QK0 A;  4IUP A;  2D8J A;  4DQ2 A;  3HFN A;  2IPO B;  1K73 U;  2FHD A;  2DEQ A;  1VQ8 A;  1YIJ T;  3X24 B;  4J6Y A;  3QDR B;  4HCB A;  1WJQ A;  3F70 A;  5GMK j;  5LJ5 g;  2E4H A;  2EAY A;  3PE0 A;  2JNG A;  4R55 A;  3I9Q A;  4JS4 A;  3G6E T;  2LT1 A;  4FT2 A;  3G6E A;  4LXC A;  1WJS A;  4BI4 A;  4ZGD B;  2PVG B;  1VQN Q;  2VAS A;  2KI7 A;  2ZPB B;  3QBY A;  1KQ1 A;  2COY A;  1QCF A;  4M77 B;  3S3M A;  1QMC A;  4XK8 E;  1X6B A;  3UA7 A;  3I55 A;  4E7H A;  1WQ7 A;  2RI5 A;  5KYY A;  5IXF A;  5C6S A;  3LYI A;  4LD9 K;  1OQK A;  2KSS A;  2DXU A;  4L6V 5;  4RTV A;  1RAG B;  3FLG A;  8AT1 B;  4ESR A;  2CP6 A;  3PVQ A;  3NMZ C;  3JCM X;  3JCM e;  5HY6 A;  1VQ4 T;  1LNX A;  4FYV B;  4HCK A;  3CCL Q;  1BCO A;  1XNI A;  3CCS A;  3E9G A;  3BDU A;  1HSQ A;  2AT1 B;  2ED0 A;  1RAF B;  4CI0 C;  4M77 G;  3MHX A;  1YJ9 Q;  3DB4 A;  3CC7 A;  1KFZ A;  3OSS C;  2RHY A;  4JJC A;  5KCO A;  3EG1 A;  1DJ7 B;  2CS7 A;  2NUP B;  1GFC A;  4M75 G;  1MV0 B;  3EGD B;  4Y91 A;  1QCN A;  4C8Q E;  3JCM g;  1VQ6 A;  3J7A F;  2KRO A;  1XQH A;  5KYU A;  3OYD A;  3GPL A;  2PQW A;  5A0L A;  1GCQ A;  4EMK A;  3L2Q A;  2CH4 A;  1M8V A;  2V1Q A;  2ZPF B;  4ZGE B;  1TS9 A;  1B3Q A;  2KXD A;  2XDD A;  2KR3 A;  1GCQ C;  4EMK C;  5GAN j;  4JRP A;  2MK5 A;  4PJL A;  3EHQ A;  2BE9 B;  2VWF A;  5KYW B;  4J9B A;  2CT4 A;  4OB0 B;  1MMA A;  3GNF B;  4RTZ A;  2LMJ A;  1JJ2 S;  5IXB A;  8ATC B;  4OGC A;  2KDS A;  1OZ2 A;  3S3N A;  2FRW A;  5CKD A;  1K9M R;  3EG3 A;  1YI2 Q;  1E6G A;  2LJ0 A;  3OYF A;  3CBP A;  2E12 A;  5FU6 C;  1M90 R;  4M75 C;  2BZ8 A;  4XTV A;  4C0Z A;  1OYX A;  2L3P A;  1PCX A;  2JZ2 A;  1VQO T;  3CC7 Q;  2JVV A;  3JB9 I;  1VYT A;  3CCR T;  3QG1 A;  5DLO A;  1JJ2 P;  1D3B A;  1EIF A;  5LJ3 j;  1JB0 E;  4LNP A;  1C6V X;  1U8R A;  2GTJ A;  4M78 G;  3QWY A;  4XTY A;  2LQ8 A;  4OMO A;  3L2Z A;  2EYQ A;  5GMK i;  2KRS A;  2NUP A;  1SRM A;  2FZC B;  1TUD A;  5IHN A;  3S3O A;  3JRZ A;  1GBQ A;  1K1Z A;  4R0K A;  2RHU A;  4PK4 A;  2NYS A;  4PJN A;  4E47 A;  4DBR A;  2OAU A;  2QQR A;  4J6W A;  4B6M A;  4O6J A;  1KHI A;  2H3E B;  1YHQ A;  1VQK Q;  2OI3 A;  1GBR A;  1M8M A;  2EWN A;  4RTX A;  2C0I A;  2V8K A;  4J9I A;  3LWH A;  2ZZD A;  1NJI C;  2XI9 A;  3MET A;  2DIQ A;  5DLQ E;  1QWF A;  5FRO A;  3CPW A;  1X2K A;  4CC7 A;  2J6K A;  2YUP A;  4HVW A;  3GIB A;  1M2O A;  2FPF A;  1YJN T;  5GAN g;  4BE2 A;  3JB9 H;  2HKN A;  2P4R A;  1ZUU A;  4X9C A;  2VXE A;  3CME Q;  4OB1 B;  2RQR A;  1AWX A;  5GMK h;  2EGA A;  3UWN A;  1UGR B;  1M3A A;  4BI8 B;  3QDF A;  3G4S A;  3FDR A;  2JMC A;  2GTO A;  3G71 Q;  4PJO E;  1WHM A;  3SWN C;  3J81 E;  3HP9 A;  3V8J A;  4EMH A;  2Y4X A;  4NL3 A;  4YTL A;  1VQL T;  1JXM A;  3RBB B;  3OB9 A;  3H6Z A;  5GAO l;  1PC0 A;  4J8O A;  1TSF A;  1G3W A;  3EH2 A;  3QKJ A;  3WXM B;  1Q86 C;  1BI1 A;  3A5Z B;  1LJO A;  1K9A A;  3C0C A;  5C0M A;  1TWB A;  4JPB W;  1UDL A;  2K3X A;  5A2Q E;  2V26 A;  3UF4 A;  5LJ3 g;  2KEA A;  4HXJ A;  3R6N A;  1D09 B;  2FRY A;  1AHJ B;  4C8Q G;  1ZQ1 A;  3EHR A;  1NLP C;  1Q86 U;  3QII A;  2M16 A;  3OMC A;  4BD3 A;  2AIR B;  3QZ9 B;  1PRM C;  1YBY A;  2DVE A;  4N4H A;  5DM7 R;  1AWO A;  1W2B P;  4M77 E;  4BY6 B;  4B9W A;  2YUQ A;  1QQJ A;  2EJF A;  5L23 A;  2DXT A;  4PFZ A;  3M4Y A;  4M7D E;  5CQX A;  4C0D B;  1PKT A;  1SG5 A;  3E1S A;  2CDT A;  4JRI A;  4M4Z A;  5FU7 C;  3ZL7 C;  4JZ3 A;  2F2W A;  4RCC A;  1FX7 A;  4Z88 A;  4M7A F;  2LQN A;  4IKF A;  4PJO B;  5A0D A;  1VQP Q;  4OML A;  1ZUK A;  2DF6 A;  1OPK A;  4JUV A;  3IQL A;  4E7Z A;  1TU0 B;  2ZPH B;  4AFZ C;  2XID A;  1ARK A;  3OYJ A;  2AK5 A;  3TVT A;  2D0N A;  1YIJ A;  1VQ8 Q;  4J9E A;  2KY9 A;  3VS1 A;  5GAN 3;  2QXF A;  2EQM A;  1G2B A;  4NOY A;  4ANJ A;  4LE9 A;  2HQX A;  3RR6 A;  2EYW A;  1OX9 A;  2CZ1 B;  1UGP B;  1N27 A;  3REA B;  2DMO A;  2RPN A;  3V7S A;  3HL8 A;  3CCV Q;  4AG1 C;  3I5R A;  1YJN A;  4JDS A;  1V29 B;  5CR2 A;  2KVQ G;  4VUB A;  3QYG B;  3UA6 A;  2C06 A;  2E3H A;  1MMD A;  2X4X A;  1RAB B;  3OMG A;  1UEB A;  4JS5 A;  2HSP A;  3JCM J;  2K5L A;  2DTH A;  5GAN h;  2D1X A;  1K0X A;  4QKU A;  2LX9 A;  1WI7 A;  2MIO A;  5GJW B;  3CXC A;  5GAN 5;  4MML A;  4A54 A;  5CO7 A;  3HHT B;  1V1C A;  4BE0 A;  1M4Z A;  2M0O A;  2AKL A;  5CK9 A;  9ATC B;  2ZCF B;  3EH1 A;  3OS0 A;  3JCM f;  3CBO A;  1KD1 R;  2GNC A;  3M4G A;  2KE9 A;  1T3L A;  2NWM A;  4M7D A;  3C95 A;  3M0P A;  2PTK A;  3JCM h;  5GAM g;  3H0F A;  2F2X A;  2EJ9 A;  2YUO A;  3CXC S;  1WHH A;  2ABL A;  4OVA A;  2QEX A;  1GFD A;  3BE3 A;  4A53 A;  4PNO A;  2QEX T;  1KHC A;  2W0Z A;  1YJN Q;  4M7A A;  3OS5 A;  4HT8 A;  4A4K A;  1G83 A;  4C5I A;  4IUQ A;  3JCM Q;  1I8F A;  3JCM W;  4N0A A;  3L42 A;  1N6A A;  1M90 U;  2F5T X;  1G3Y A;  1S1N A;  3CME T;  3WVD B;  1YWO A;  2L3S A;  3LW5 E;  1WHK A;  4F7U F;  1VQ5 T;  5GMK m;  1H3H A;  2MI6 A;  2DKG A;  4OB3 B;  1M2V B;  4FU6 A;  1P92 A;  1SEM A;  1K73 C;  3VS6 A;  3HKS A;  2RQU A;  3VU3 C;  1D1C A;  1M9S A;  1AVZ C;  2DE0 X;  2P0K A;  2VVK A;  2FVU A;  4QT7 A;  1X6O A;  2ZPI B;  2KYM A;  1TUC A;  2DEU A;  2VGM A;  2EYX A;  2RQW A;  3RMS A;  4MMK A;  1NZ9 A;  4RTY A;  4XTZ A;  3MCA B;  3CC4 A;  4PJM A;  4IIM A;  3A1P A;  3AT1 B;  3QXE B;  2HDA A;  3OYY A;  1ZLM A;  3PNW C;  1Q7Y R;  2QA4 Q;  2E10 A;  1QVG S;  5J3B A;  2K3Y A;  3LGL A;  2JUF A;  2GBQ A;  3NHN A;  3HTR A;  2DJZ A;  2JJ9 A;  2L5Q A;  2GQV A;  4M75 B;  4PJO A;  2CKK A;  4PLL A;  3PMI A;  2L2P A;  2O4X A;  3VS4 A;  2EGC A;  1QVP A;  1RAI B;  2RJE A;  4KH0 B;  5IT9 E;  1WXT A;  4MDW A;  3CD6 A;  1IO6 A;  2LQW A;  2HCK A;  2PNI A;  2E65 A;  4HVU A;  2ENM A;  3H41 A;  1H3Z A;  3M59 A;  3HPW A;  2NUT A;  1YJW Q;  1K0S A;  4BUG A;  1OUL A;  3JCM c;  1CKA A;  1M3B A;  3JCM d;  4E7S A;  2JS2 A;  1UJY A;  3ME9 A;  2L3R A;  1K8A R;  4EIK A;  1NPP A;  2DL5 A;  2D9T A;  4MZT A;  5FWB A;  2YSQ A;  2BIV A;  1Y57 A;  4XTX A;  2DPP B;  4J9H A;  3OS2 A;  5LJ5 j;  1FYN A;  2I0N A;  4M75 F;  1Q82 U;  5FWC A;  4FT4 A;  1M5Q 1;  1VQ8 T;  2DXB A;  1VQ7 A;  3BFM A;  4HT9 A;  3EFR A;  4ZNX A;  2BZY A;  2HAX A;  3I5S A;  3ULR B;  4JZ4 A;  4HCC A;  2E6Z A;  2RB6 A;  4BE1 A;  4PKC C;  4F7U G;  1K9M U;  1G8X A;  5GAM j;  3CMA A;  5LJ5 f;  2DZ9 A;  1VYV A;  1VQN T;  2LNH B;  3OYI A;  5KYN A;  1RI9 A;  4M78 B;  1NBE B;  2DNU A;  1YWP A;  1Q95 G;  3CCV T;  1UTI A;  4FIB A;  3T9N A;  4C8Q A;  4RTW A;  2KT1 A;  4ZN1 A;  1IHW A;  1QVG A;  4E6R A;  2B86 A;  2K5F A;  2O01 E;  1UFF A;  2X3W D;  5LJ3 h;  1YJW A;  2EKO A;  2O88 A;  4L5G A;  2M51 A;  5GMK l;  1EFN A;  1FXX A;  4PJJ A;  4QQ6 A;  2QGF B;  4RTU A;  1JJ2 A;  4ZGJ B;  3M0R A;  2DET A;  1RAE B;  4F7U B;  3CCL T;  1MNE A;  2OTL Q;  2DK3 A;  3EG9 B;  3NTH A;  3PFS A;  1UG1 A;  1Y0M A;  1D1A A;  4OMN A;  1M30 A;  3M0S A;  3VYG A;  3L2V A;  2VB6 A;  3VUZ A;  3QJY A;  1Q7Y U;  2FYK A;  3CCU A;  4PJO C;  3EFS A;  5D6W A;  2K3B A;  2MAM A;  1WYX A;  1S72 T;  1NJI U;  1UUE A;  1XOV A;  4N4I A;  3ASK A;  2YLC A;  1BBZ A;  3OA6 A;  3CCJ T;  4M78 F;  5LL6 S;  1SKU B;  2LRQ A;  2XU8 A;  3NPF A;  3CMA T;  3UT1 A;  4CC3 A;  3TRE A;  2ROT A;  1R0C B;  1IRX A;  2E64 A;  1PRL C;  2QDL A;  2KMT A;  4BY6 C;  2FZG B;  1FMW A;  2M9U A;  1FMK A;  1AOJ A;  4M75 D;  2CGH A;  3CCQ T;  3VYH B;  1VQ5 Q;  3OW2 P;  2JT4 A;  3JB9 G;  1WDX A;  2PU9 B;  1BI0 A;  3NGP A;  3UPU A;  1T0J A;  3KBG A;  2FZK B;  3GP8 A;  4F7U E;  3HSB A;  2PVO B;  3M0U A;  1W2B S;  4FW2 A;  2PUK B;  5CKH A;  2FEI A;  4M77 C;  1UHC A;  1WPY A;  2QQS A;  1KC8 U;  1OU9 A;  2XDP A;  2GF7 A;  3RDV A;  2BUD A;  4M7D C;  1O75 A;  1B7T A;  3CCS T;  3OYG A;  1UGS B;  1BYM A;  3RMQ A;  4C8Q F;  1VQP A;  4OMQ A;  2K79 A;  1WNL A;  2DER A;  4J9F A;  4R56 A;  3PVL A;  4IUR A;  4LDU A;  3WVE B;  5KE2 A;  1JU5 C;  4C92 B;  1KD1 U;  3BW1 A;  2EBP A;  1M3C A;  4M77 D;  3A8G B;  1TUG B;  5I2M A;  5AYF A;  2GCX A;  1Z9Q A;  4DBH A;  3CCM Q;  2A37 A;  2DA9 A;  3NTI A;  5IHI A;  4C5E A;  1YJ9 A;  2HEQ A;  5CIU A;  4IIO A;  2XHC A;  2ATC B;  3FIF A;  4OB2 B;  2COW A;  2MPX C;  1K73 R;  3JSC A;  2XIC A;  1C1A A;  2XG8 D;  1RUW A;  5KYX A;  3X20 B;  4C8Q C;  3X26 B;  1W6X A;  4HCZ A;  1VOM A;  1VQ6 T;  2AZV A;  4KUL A;  3CPW S;  1PG5 B;  3KXT A;  1N8R U;  3GNG A;  1OU8 A;  4ME7 A;  5GAM f;  1UGQ B;  2QQA A;  4F14 A;  2O9S A;  2GGR A;  3EFO B;  2HQE A;  2J6O A;  3I55 T;  3MKD A;  4M78 A;  1TTH B;  5GAN 2;  1ZBJ A;  1YFN A;  3CD6 Q;  4M7A B;  4RG2 A;  1ZSG A;  3P8H A;  2DL8 A;  1VQK A;  1WHJ A;  2VGN A;  3SWN A;  1AZE A;  1AT1 B;  2M1H A;  3VRY A;  3EGX A;  2CZ6 B;  2KQW A;  1K76 A;  2QDY B;  1ABQ A;  2NUZ A;  1AWJ A;  1O9S A;  1S72 A;  4A4H A;  3BDL A;  1N8R R;  4A4F A;  3SEM A;  3BY7 A;  2RNA A;  1Q81 U;  3CCU T;  2E5K A;  2P0P A;  5EG2 A;  5KYY B;  5GAO m;  1A0N B;  1I1J A;  2IVW A;  3JCM V;  1FMV A;  4HVV A;  3VS2 A;  1W70 A;  2OTJ Q;  2X9H A;  3OYC A;  2NUT B;  1U5S A;  4M7A G;  1YIT T;  1RI0 A;  2L8D A;  4ELY C;  4C5H A;  1VQ6 Q;  5CQY A;  3MJX A;  2XDB A;  5CCA A;  3CCQ A;  1D0Z A;  5D6X A;  3Q1J A;  2RJC A;  3CPF A;  2KAF A;  3I55 Q;  1UE9 A;  2PZ1 A;  3QHS A;  2YXY A;  2YUN A;  1JEG A;  4C92 C;  4QVZ A;  4ZTF A;  5IH2 A;  5IAY A;  2R58 A;  1QWE A;  5CKB A;  1KK7 A;  2DRM A;  2D6F A;  4OF1 A;  2C0T A;  4JJB A;  3RIR A;  1VQO Q;  2DXC A;  2DRK A;  1WA7 A;  2LCS A;  4EMG A;  3OYL A;  4Y28 E;  3S6W A;  2QTX A;  3A98 A;  3CC2 T;  4F17 A;  3X28 B;  2EVR A;  4B9X A;  1S72 Q;  3LWI A;  1UEC A;  2I2L A;  3LH5 A;  2P0Q A;  5LJ5 h;  4M78 C;  2VC8 A;  5LJ5 d;  2OTJ T;  1C0M A;  2LX7 A;  3H0I A;  2FPE A;  4GLM A;  1VQO A;  4RG8 A;  3M58 A;  2JMA A;  1VQ4 A;  2OTJ A;  5I11 A;  4BI3 A;  3MEV A;  3HRU A;  4UC4 A;  3G4S T;  2LQK A;  1BI3 A;  1YP5 A;  4LDX A;  1B34 A;  1VQM A;  4C92 D;  2K2M A;  1IZ6 A;  2QYZ A;  2CRE A;  1LCK A;  1QVG P;  3LGF A;  3SHW A;  1M1K R;  2ROL A;  3CCQ Q;  2DFU A;  1N5Z A;  1VQ7 Q;  1RLP C;  1OEB A;  4EPC A;  3C12 A;  4LUE A;  1Y7X A;  1QKX A;  2JW4 A;  2DIL A;  1QP3 A;  2DAQ A;  5A0G A;  2JTF A;  4QQG A;  1NLO C;  3EG2 A;  5HK0 A;  3VS7 A;  4MZP A;  4ORZ A;  3TSZ A;  2DX1 A;  2K5I A;  2QTV A;  1KSW A;  1ZSZ C;  2RI3 A;  4ATO A;  5GAO q;  1Q81 R;  1PSF A;  4KGX B;  1U1S A;  2MWP A;  4LDY A;  3V7R A;  4AFU C;  3QZ5 B;  5CAI A;  3EGX B;  4M7A E;  2YDL A;  3G4S Q;  5DY9 A;  1X01 A;  2EPD A;  4M7A D;  3RUX A;  3M57 A;  5FLX E;  4ELZ C;  1VQ5 A;  1TXQ A;  1RAD B;  4JJN K;  1BB9 A;  3RKY A;  1Y71 A;  1MMG A;  5FW9 A;  3QWX X;  2DD4 A;  4BB7 A;  1SSH A;  1OOT A;  1T3S A;  4N0A C;  5I22 A;  1SPK A;  2MWO A;  2HL3 A;  3V8L A;  3M55 A;  2A36 A;  3D7S B;  4DBQ A;  1IHV A;  4FCY A;  1WIE A;  2DJQ A;  2AHJ B;  2JXB A;  2DLP A;  1WX6 A;  3EAE A;  1Y96 A;  4QW2 A;  4BDY A;  3QYH B;  1QVF P;  1LOJ A;  3FB9 A;  4WF2 A;  4JRQ A;  3PIP A;  3R6O A;  2MF2 A;  5EC7 A;  2E70 A;  3CXC P;  1UHF A;  5L8R E;  2NLU A;  5J39 A;  1YIJ Q;  2EYZ A;  3FC3 A;  3PGG A;  3A8H B;  2RN8 A;  2FO0 A;  1CKB A;  2OTL A;  3OS1 A;  1KQ2 A;  1RL2 A;  3MP6 A;  4Y92 A;  2J7I A;  5GAO n;  1I5O B;  3M5A A;  4PJO D;  3VS3 A;  4P5N A;  4WTO B;  3PTA A;  1VQ9 T;  3M0Q A;  2RF0 A;  5HCK A;  4LN2 A;  1HJD A;  4E7K A;  5CVI A;  2CP0 A;  1SF9 A;  1I81 A;  3CCU Q;  2O4X B;  1Y96 B;  3VKI A;  2A0F B;  1F1B B;  2VKN A;  1EX4 A;  2QQB A;  4J9G A;  1G5V A;  1YIT Q;  2RH2 A;  1VQP T;  2KRN A;  1T0H A;  2FPD A;  2LC4 A;  4BDZ A;  3HFO A;  2LDM A;  3QO3 A;  1VA7 A;  4FYY B;  5KCH A;  1ACM B;  3FJP A;  1AD5 A;  1QVF A;  3QUI A;  2GFA A;  1KQS A;  4QVC A;  2RHZ A;  1N9R A;  1YIT A;  1LPL A;  1V76 A;  3JCM b;  1JQQ A;  1MMN A;  1VIF A;  4LDV A;  3VS5 A;  3JV3 A;  2JN0 A;  2IG0 A;  1U3O A;  1TG0 A;  2VUB A;  1I0C A;  2LTO A;  3VRZ A;  1YJ9 T;  4Z02 A;  1OV3 A;  2PUO B;  4FSX A;  1ZX6 A;  4JLG A;  1WHG A;  1KJW A;  2EYY A;  2XKO C;  1ZSZ A;  2D8H A;  5GAO r;  2L3Q A;  4DEY A;  3V8K A;  1M1K U;  2Y4Y A;  1X2Q A;  3H0H A;  3RNJ A;  3M0T A;  2HQH A;  3CPW P;  2IIM A;  4FL6 A;  2E41 A;  5KYW A;  3EG0 A;  1MUZ A;  1X69 A;  2AZS A;  3MEW A;  4AFQ C;  1EZZ B;  1K8A C;  2SEM A;  1PNJ A;  1SHG A;  4GY5 A;  2K6D A;  2V8I A;  3I56 A;  1K4U S;  2F2V A;  4HA8 A;  3E19 A;  1FWZ A;  1J3T A;  1NYF A;  1YI2 T;  1CSK A;  2LCL A;  1VYU A;  4DA4 A;  4KBM B;  2DBM A;  4F04 B;  1BKB A;  1YI2 A;  4C8Q D;  4TVR A;  5GJV B;  3I56 Q;  4EMK B;  2RA2 A;  2DZC A;  1VQN A;  2PVD B;  2P84 A;  2RQV A;  1HXD A;  1M1F A;  1M1K C;  3CCE A;  3CCR Q;  5FU7 B;  2V1R A;  4C92 G;  1BCM A;  2RMO A;  1OI1 A;  2YT6 A;  1KC8 C;  3TQ7 P;  4K11 A;  4CRI A;  4KT0 E;  1GRI A;  1ZHI A;  5LJ3 e;  3CCV A;  2RHI A;  1KC8 R;  1VQM Q;  1RAA B;  4N4G A;  3JB9 F;  2LNV A;  5CKF A;  1YHQ Q;  2EFI A;  3GOX A;  2FL7 A;  4E7J A;  2OTL T;  2O9V A;  2JTE A;  1NJI R;  2KGT A;  4M75 E;  2RD1 A;  3M56 A;  4JJD A;  5GMK e;  2O31 A;  3PT9 A;  2RK1 A;  2RK2 A;  3V7C A;  4F7U A;  1JBM A;  2HBW A;  2RJD A;  2L89 A;  4JLI A;  4V2S A;  1D0Y A;  2F5K A;  1JXO A;  3TU4 K;  3EG9 A;  3TCJ A;  2BE7 D;  2J6F A;  3CCJ Q;  4XU0 A;  2KYB A;  1X27 A;  2DVJ A;  4D6W A;  4DOV A;  3LX7 A;  2V8J A;  3SD4 A;  3I35 A;  1AZG B;  4LD6 A;  1YCY A;  1BIA A;  3CCR A;  1SHF A;  1YNZ A;  1VQ4 Q;  1I07 A;  4XU1 A;  5KH6 A;  1VQL A;  1IGQ A;  2MYS A;  5IHK A;  3C94 A;  2HL5 C;  4J7I A;  4A4E A;  1NPR A;  2CSI A;  3RKW A;  3SFM A;  2DM1 A;  3P8B B;  4AFS C;  1VQM T;  2H3J A;  5GAN 4;  1YHQ T;  1BI2 A;  2SRC A;  2WAC A;  1KQS P;  1NYG A;  2QG9 B;  1I5L A;  2HKQ B;  1VQL Q;  4F16 A;  4Q5W A;  1QCO A;  4OGE A;  4J83 A;  2EW3 A;  2CSQ A;  1YJW T;  4QQD A;  5LJ3 f;  3C4S A;  2DIG A;  4IUT A;  2QGG A;  3H8Z A;  3L2U A;  1HYO A;  1U06 A;  1PWT A;  4J5Y A;  3INZ A;  4MZM A;  1UGV A;  4EDU A;  1ABO A;  3TSW A;  2WSE E;  3PMT A;  5AT1 B;  3DKM A;  3LH0 A;  2R5M A;  3M53 A;  4C92 F;  3OW2 A;  3AHU A;  4M78 E;  2KXC A;  2CUD A;  2C0O A;  4M78 D;  4Z89 A;  1SRL A;  1R0B G;  4DOW A;  1NE8 A;  3QSU A;  1E6H A;  2DYB A;  2WSC E;  2MCN A;  1KIK A;  2OJ2 A;  2X4J A;  1HD3 A;  4J6X A;  1Y07 A;  3VS0 A;  2DTO A;  2ZAE A;  5GAN 6;  1GCP A;  2CZ0 B;  2EQU A;  3JB9 J;  2QAS A;  3KFV A;  2ZPE B;  2MMP A;  3P8D A;  1G3T A;  3SB2 A;  3CC7 T;  4C8Q B;  4RTT A;  1H64 1;  3X25 B;  1WJR A;  4A63 B;  2KRM A;  2YRD A;  3RKX A;  2WSF E;  4PL6 A;  2DBK A;  4C0D C;  1WXB A;  4PJO F;  2HSE B;  1HK9 A;  5KYU B;  4X9D A;  5GAN 8;  3J80 E;  1U1T A;  2MOX A;  1X43 A;  5FRN A;  1TOV A;  1QVF S;  1WXU A;  2DD5 A;  4ZN3 A;  2JTM A;  3E9F A;  2GQI A;  5ECA A;  2KBT A;  3CME A;  1R77 A;  2DYI A;  2K7A A;  2VYT A;  3EFO A;  4M7A C;  2FB7 A;  4KRT A;  1VQK T;  2G6F X;  3GF5 A;  3SDZ A;  4PJO G;  1H8K A;  3EGU A;  1XTD A;  4OMF B;  1W4S A;  2JS0 A;  5LJ5 e;  4PFP A;  3M9Q A;  2X35 A;  2RO0 A;  5GAN f;  5IN1 A;  2CP5 A;  2M0Y A;  2RI2 A;  3I56 T;  2A3L A;  3QPH A;  4KUI A;  1Z9Z A;  3L1A A;  2OAW A;  1MGQ A;  1Q81 C;  1ZUY A;  1D0X A;  4E7I A;  4LUD A;  2EJG A;  3CC2 A;  3TEE A;  1I4K 1;  5GAN e;  3PIO A;  3CMA Q;  2LJ1 A;  2AKK A;  1RLQ C;  2A28 A;  3UDC A;  2EQI A;  5D6Y A;  1VUB A;  4C0G A;  2W10 A;  3OW2 S;  1ZBX A;  2DL4 A;  3CC4 T;  4M77 F;  3N5B B;  1M27 C;  4FYW B;  4FW1 A; 
#chains in the Genus database with same CATH homology
 2DD4 A;  3M59 A;  3HPW A;  4BB7 A;  4JRP A;  4BUG A;  3JAM E;  3DLL A;  4OP0 A;  4N0A C;  3MEA A;  2F69 A;  3VJP A;  3G71 T;  4M7D F;  4C92 A;  4OB0 B;  3JCM c;  3GNF B;  3JCM d;  2MWO A;  3URG A;  3V8L A;  3M55 A;  1JRI A;  2JOY A;  3ME9 A;  1JJ2 S;  4PLI A;  2L3R A;  5CKE A;  1GXI E;  1NPP A;  3JB9 D;  4OGC A;  2AHJ B;  4A4G A;  2B8A A;  2D9T A;  2KDS A;  4IUU A;  4MZT A;  1OZ2 A;  2P4T A;  4C0F A;  2BIV A;  4XTX A;  2KK4 A;  2DPP B;  1N8R C;  3G4S T;  3OS2 A;  5LJ5 j;  3EAE A;  1Y96 A;  4QW2 A;  4BDY A;  3S3N A;  5CKD A;  3HRS A;  4M75 F;  4QVD A;  3OYF A;  3CBP A;  3QYH B;  1Q82 U;  1LOJ A;  2E12 A;  3FB9 A;  4NS5 A;  4WF2 A;  3PIP A;  4FT4 A;  3R6O A;  5FU6 C;  4JRQ A;  2MF2 A;  4M7D B;  1UB4 A;  4M75 C;  1M5Q 1;  1VQ8 T;  2DXB A;  1VQ7 A;  4XTV A;  2RJF A;  3BFM A;  4C0Z A;  2E70 A;  1OYX A;  2QQ9 A;  4HT9 A;  2BKD N;  3EFR A;  1VIE A;  1X75 C;  5L8R E;  2HAX A;  2NLU A;  2JZ2 A;  3DLM A;  2EQJ A;  4O5V A;  1VQO T;  4HCC A;  2E6Z A;  2R57 A;  2RB6 A;  2JVV A;  2LVM A;  5J39 A;  4BE1 A;  3FC3 A;  3JB9 I;  3PGG A;  4PKC C;  3A8H B;  3NFC A;  3CCR T;  4F7U G;  3QG1 A;  5DLO A;  3OYA A;  1K9M U;  2OTL A;  1D3B A;  5GAM j;  1EIF A;  3FEO A;  5GAN 7;  3CMA A;  5LJ3 j;  5LJ5 f;  1G3S A;  2DZ9 A;  3OS1 A;  1KQ2 A;  1RL2 A;  3MP6 A;  1VQN T;  1JB0 E;  5J26 A;  3QJ6 A;  3OYI A;  3MEU A;  5GAO n;  4RCB A;  1U8R A;  3M5A A;  4PJO D;  1BIB A;  4M78 B;  1K8A U;  2YRV A;  4M78 G;  2A7Y A;  4P5N A;  4FIB A;  3T9N A;  4C8Q A;  3PTA A;  2K2V A;  4ZN1 A;  3CCM T;  4XTY A;  1VQ9 T;  1QVG A;  3OBW A;  2LQ8 A;  4BAC A;  3L2Z A;  1MHN A;  2EYQ A;  2K5F A;  2O01 E;  4IUV A;  4XU3 A;  3VUB A;  5CVI A;  5GMK i;  4M75 A;  5LJ3 h;  4E7K A;  4M7D G;  3OYM A;  1I81 A;  2O4X B;  1YJW A;  2EKO A;  3S3O A;  1Y96 B;  1B34 B;  3VKI A;  3JRZ A;  3OBY A;  4L5G A;  1IRE B;  3CCM A;  2RHU A;  3RES A;  1FXX A;  2E6N A;  5GMK l;  2QQB A;  4QQ6 A;  1G5V A;  1JJ2 A;  4E47 A;  2RH2 A;  2X4Y A;  4ZGJ B;  1VQP T;  3RER A;  1KQS S;  2K57 A;  2LC4 A;  2OAU A;  4F7U B;  2QQR A;  3OYB A;  3HFO A;  3CCL T;  4J6W A;  4BDZ A;  2LDM A;  3QO3 A;  4O6J A;  1KHI A;  5KCH A;  1YHQ A;  3FJP A;  3CCE T;  1QVF A;  2EWN A;  3QUI A;  2GFA A;  3OY9 A;  2DK3 A;  3MP1 A;  1KQS A;  3NTH A;  4QVC A;  2RHZ A;  3PFS A;  3CCJ A;  1N9R A;  1R8O B;  1YIT A;  4X34 A;  2V8K A;  3LWH A;  2ZZD A;  3OQ5 A;  1NJI C;  2XI9 A;  3VYG A;  3L2V A;  3JCM b;  3VUZ A;  3MET A;  2DIQ A;  1VIF A;  5DLQ E;  5FRO A;  3CPW A;  2XD0 A;  3QJY A;  4LDV A;  3CD6 T;  1Q7Y U;  2FYK A;  2QA4 T;  3CCU A;  2JN0 A;  2IG0 A;  4PJO C;  2Y90 A;  2VUB A;  1PSE A;  3EFS A;  5D6W A;  3CCL A;  2QA4 A;  2LTO A;  1YJ9 T;  2MAM A;  4Z02 A;  2PUO B;  3SWN B;  1S72 T;  3GIB A;  2E5Q A;  1NJI U;  2CYZ B;  2HNI A;  3VV0 A;  5GAN g;  1YJN T;  4N4I A;  1XOV A;  4BE2 A;  4RKU E;  2DTI A;  4FSX A;  4M77 A;  1VQ9 A;  3JB9 H;  3ASK A;  2YLC A;  4J7F A;  4C92 E;  4JLG A;  4XTW A;  3OA6 A;  4M78 F;  3CCJ T;  4X9C A;  5LL6 S;  2VXE A;  5FRM A;  4OB1 B;  5GMK h;  2LRQ A;  2XU8 A;  4II1 A;  1UGR B;  3UWN A;  4BI8 B;  3CMA T;  3UT1 A;  3G4S A;  3TRE A;  3FDR A;  1KD1 C;  2LT4 A;  2XKO C;  5GAO r;  4PJO E;  3V8K A;  2E64 A;  3SWN C;  3J81 E;  3HP9 A;  3V8J A;  1M1K U;  2Y4Y A;  2Y4X A;  4EMH A;  4ZTJ A;  2KMT A;  4NL3 A;  4YTL A;  1VQL T;  4BY6 C;  3OB9 A;  1WGS A;  3H6Z A;  5GAO l;  2HBP A;  2GFU A;  4J8O A;  2DO3 A;  2M9U A;  1G3W A;  3QKJ A;  4M75 D;  2CGH A;  3CCQ T;  3VYH B;  1M1G A;  2VXF A;  3WXM B;  1Q86 C;  3JB9 G;  5GAN d;  1BI1 A;  2PU9 B;  1BI0 A;  3A5Z B;  4FL6 A;  2E41 A;  1LJO A;  3ZEH A;  4XQ3 A;  5C0M A;  3UPU A;  4KUD K;  3KBG A;  3GP8 A;  4F7U E;  3HSB A;  2PVO B;  2HD0 A;  3MEW A;  5GAM d;  2LCC A;  1K8A C;  2K3X A;  1W2B S;  4GY5 A;  3A8O B;  5A2Q E;  2V8I A;  3I56 A;  2PUK B;  4HA8 A;  2QI2 A;  3E19 A;  1FWZ A;  4JRK A;  5CKH A;  2EIF A;  4M77 C;  5LJ3 g;  1YI2 T;  4XU2 A;  2LCL A;  1WPY A;  2K4Y A;  2QQS A;  3MO8 A;  1KC8 U;  3MP8 A;  2XDP A;  3G71 A;  2GF7 A;  4KBM B;  4DA4 A;  1AHJ B;  2BUD A;  1BKB A;  1ZQ1 A;  4C8Q G;  1YI2 A;  4M7D C;  1O75 A;  3G7Z A;  1Q86 U;  4C8Q D;  3CCS T;  3OYG A;  1UGS B;  4TVR A;  3QII A;  1BYM A;  2M16 A;  3RMQ A;  4C8Q F;  1VQP A;  4EMK B;  2RA2 A;  2DZC A;  1WNL A;  3A8L B;  1VQN A;  2PVD B;  3OMC A;  4BD3 A;  3QZ9 B;  1HXD A;  1M1F A;  1YBY A;  2DVE A;  4N4H A;  3CCE A;  1M1K C;  5FU7 B;  5DM7 R;  4C92 G;  4R56 A;  3OYK A;  2YLB A;  4IUR A;  4LDU A;  4M77 E;  1OI1 A;  3WVE B;  4BY6 B;  4C92 B;  5KE2 A;  1KC8 C;  4B9W A;  3BW1 A;  1KD1 U;  4M77 D;  3A8G B;  2EJF A;  5I2M A;  5AYF A;  4KT0 E;  4CRI A;  4M7D D;  2GCX A;  4E7L A;  2DXT A;  1WQW A;  2CZ7 B;  1OZ3 A;  3OSV A;  3M4Y A;  4M7D E;  1ZHI A;  5CQX A;  4XTU A;  4HKE A;  3NTI A;  4C0D B;  4C5E A;  2EQK A;  5LJ3 e;  1YJ9 A;  3CCV A;  2RHI A;  3E1S A;  4JRI A;  5CIU A;  2XK0 A;  2XHC A;  4N4G A;  5FU7 C;  2LNV A;  2R5A A;  3FIF A;  5CKF A;  3JB9 F;  5I2S A;  4OB2 B;  4RCC A;  2EFI A;  3GOX A;  2FL7 A;  4E7J A;  1FX7 A;  1Q7Y C;  2OTL T;  3JSC A;  5FU6 B;  2YHT A;  4M7A F;  2XIC A;  2D0Q B;  2G3R A;  2XG8 D;  3ZFJ A;  4M75 E;  4IKF A;  2RD1 A;  3M56 A;  5A0D A;  4PJO B;  3X20 B;  5GMK m;  3LLR A;  5GMK e;  4C8Q C;  2E1H A;  4JUV A;  3PT9 A;  2RK1 A;  3X26 B;  3OYN A;  2ZPH B;  2RK2 A;  4HCZ A;  3V7C A;  4F7U A;  1VQ6 T;  1VQ7 T;  3CPW S;  1JBM A;  4KUL A;  2RJD A;  2XID A;  2L89 A;  3KXT A;  3OYJ A;  4JLI A;  1N8R U;  1D3B B;  4V2S A;  3GNG A;  2F5K A;  4ME7 A;  5GAM f;  3TU4 K;  1UGQ B;  2QQA A;  1YIJ A;  2KY9 A;  3L2W A;  5GAN 3;  2HQE A;  3I55 T;  2ZGW A;  2QXF A;  4M78 A;  3TCJ A;  1QP2 A;  5GAN 2;  3OYE A;  2EQM A;  4NOY A;  4GLK A;  5GAM h;  2HQX A;  4C5G A;  4XU0 A;  4M7A B;  4RG2 A;  4D6W A;  3HRT A;  4DOV A;  2C06 A;  2CZ1 B;  3LX7 A;  2V8J A;  3SD4 A;  4LD6 A;  1UGP B;  1YCY A;  1BIA A;  2VV5 A;  3P8H A;  5LJ3 d;  3CCR A;  1VQK A;  1W2B A;  1N27 A;  2VGN A;  2X4W A;  3SWN A;  3OYH A;  4MDX A;  4XU1 A;  5KH6 A;  1VQL A;  2M1H A;  3C94 A;  4NL2 A;  2CZ6 B;  2KQW A;  4J7I A;  3V7S A;  1NPR A;  3HL8 A;  3RKW A;  2QDY B;  3P8B B;  3SFM A;  4A4E A;  1VQM T;  5KE3 A;  1YJN A;  1O9S A;  3ER0 A;  3O8V A;  4JDS A;  1V29 B;  5CR2 A;  1S72 A;  4A4H A;  2KVQ G;  4VUB A;  2RHX A;  3BDL A;  3QYG B;  1QW1 A;  2H3J A;  4A4F A;  2X4X A;  5GAN 4;  1BI2 A;  3BY7 A;  1YHQ T;  2RM4 A;  3OMG A;  2WAC A;  1Q81 U;  1K9M C;  3GLX A;  3CCU T;  5EG2 A;  2P0P A;  5GAO m;  1I5L A;  1UEB A;  3NTK A;  4JS5 A;  2IVW A;  3JCM V;  3JCM J;  4FM4 B;  3L2R A;  2K5L A;  2DTH A;  4Q5W A;  4L59 A;  5HKC A;  5GAN h;  3OYC A;  4OGE A;  4J83 A;  4M7A G;  1YIT T;  1N9S A;  1RI0 A;  4LDW A;  2L8D A;  4XAX B;  4ELY C;  4C5H A;  1YJW T;  1KG1 A;  4QQD A;  5LJ3 f;  2LX9 A;  5GAO p;  3KUF A;  5CQY A;  3C4S A;  2DIG A;  3A8M B;  4IUT A;  5M9O A;  3CXC A;  5GAN 5;  2XDB A;  1SSF A;  3M54 A;  5CCA A;  2ZPG B;  3H8Z A;  3FRN A;  1Q82 C;  3L2U A;  3CCQ A;  4MML A;  4A54 A;  5CO7 A;  5D6X A;  3HHT B;  4BE0 A;  3ZBD A;  1M4Z A;  2M0O A;  2RJC A;  3Q1J A;  5CK9 A;  2ZCF B;  3CPF A;  2KAF A;  4J5Y A;  5HK3 A;  1M90 C;  3OS0 A;  3INZ A;  5I21 A;  4MZM A;  3JCM P;  3CEY A;  4EDU A;  3CBM A;  3JCM f;  3CBO A;  3QHS A;  1TH7 A;  2WSE E;  3PMT A;  4RMO A;  3M4G A;  3DB3 A;  4C92 C;  4QVZ A;  3DKM A;  3LH0 A;  4ZTF A;  2R5M A;  5IAY A;  4M7D A;  3M53 A;  3C95 A;  2R58 A;  4C92 F;  3OW2 A;  3CC7 T;  5CKB A;  3AHU A;  4M78 E;  3JCM h;  5GAM e;  4M78 D;  5GAM g;  3CCV T;  4IUP A;  2D6F A;  4DQ2 A;  2EJ9 A;  4OF1 A;  4DOW A;  1NE8 A;  3HFN A;  3RIR A;  3CXC S;  3QSU A;  2WSC E;  1K73 U;  2X4J A;  2DXC A;  2FHD A;  4OVA A;  2DEQ A;  4J6X A;  1VQ8 A;  1YIJ T;  1Y07 A;  4EMG A;  4Y28 E;  3S6W A;  3OYL A;  2QEX A;  2QTX A;  3CC2 T;  2DTO A;  3X24 B;  3X28 B;  4J6Y A;  5GAN 6;  3QDR B;  4A53 A;  4HCB A;  4PNO A;  2QEX T;  1WJQ A;  2CZ0 B;  2EQU A;  1KHC A;  3F70 A;  4B9X A;  5GMK j;  5LJ5 g;  3LWI A;  2ZPE B;  3JB9 J;  4M7A A;  3OS5 A;  2I2L A;  2EAY A;  2MMP A;  2P0Q A;  3P8D A;  1G3T A;  2JNG A;  4A4K A;  4HT8 A;  4R55 A;  5LJ5 h;  4M78 C;  4JS4 A;  4C5I A;  3G6E T;  4IUQ A;  3JCM Q;  1I8F A;  2VC8 A;  3SB2 A;  4C8Q B;  5LJ5 d;  4N0A A;  3L42 A;  1N6A A;  3JCM W;  2LT1 A;  1VQO A;  1M90 U;  2OTJ T;  4RG8 A;  2F5T X;  1G3Y A;  1H64 1;  3X25 B;  3M58 A;  3CME T;  1VQ4 A;  2OTJ A;  3WVD B;  3LW5 E;  4BI3 A;  1WJR A;  4FT2 A;  3MEV A;  3HRU A;  4UC4 A;  4F7U F;  3G6E A;  1VQ5 T;  3RKX A;  1WJS A;  2LQK A;  2MI6 A;  4BI4 A;  1BI3 A;  2PVG B;  2DKG A;  2WSF E;  4ZGD B;  4OB3 B;  4FU6 A;  1P92 A;  2ZPB B;  1B34 A;  4LDX A;  1VQM A;  4C92 D;  1K73 C;  4PL6 A;  3QBY A;  1KQ1 A;  1IZ6 A;  3S3M A;  4M77 B;  3HKS A;  4XK8 E;  3LGF A;  3I55 A;  4E7H A;  1WQ7 A;  2RI5 A;  1M9S A;  3VU3 C;  2P0K A;  5C6S A;  4C0D C;  2FVU A;  4PJO F;  3LYI A;  4LD9 K;  1HK9 A;  1X6O A;  2KSS A;  2ZPI B;  2DXU A;  4L6V 5;  4X9D A;  3FLG A;  5GAN 8;  4EPC A;  3J80 E;  1U1T A;  3C12 A;  2VGM A;  1Y7X A;  3RMS A;  4MMK A;  1NZ9 A;  5FRN A;  1QP3 A;  2DAQ A;  5A0G A;  3JCM X;  1QVF S;  2JTF A;  3JCM e;  4QQG A;  2DD5 A;  5HY6 A;  2JTM A;  3E9F A;  4ZN3 A;  3CME A;  1LNX A;  1VQ4 T;  2VYT A;  4XTZ A;  4M7A C;  3MCA B;  3CC4 A;  2FB7 A;  1XNI A;  3CCS A;  3E9G A;  3BDU A;  1VQK T;  3GF5 A;  5HK0 A;  3SDZ A;  4PJO G;  4MZP A;  1XTD A;  4OMF B;  2K5I A;  3QXE B;  3OYY A;  3PNW C;  1W4S A;  2E10 A;  1QVG S;  2RI3 A;  5J3B A;  4ATO A;  2K3Y A;  5GAO q;  5LJ5 e;  4CI0 C;  3LGL A;  2X35 A;  3M9Q A;  2JUF A;  4M77 G;  2RO0 A;  3MHX A;  1PSF A;  3DB4 A;  3CC7 A;  5GAN f;  5IN1 A;  1U1S A;  3OSS C;  2RI2 A;  2RHY A;  5KCO A;  3I56 T;  2MWP A;  2A3L A;  3QPH A;  4KUI A;  4LDY A;  3V7R A;  2DJZ A;  1DJ7 B;  2CS7 A;  2GQV A;  2L5Q A;  3L1A A;  3QZ5 B;  4M75 B;  5CAI A;  1MGQ A;  2CKK A;  4PLL A;  4PJO A;  3PMI A;  1Q81 C;  2O4X A;  4M75 G;  4E7I A;  4M7A E;  2EJG A;  3CC2 A;  3TEE A;  5DY9 A;  1QVP A;  1I4K 1;  1X01 A;  4Y91 A;  2RJE A;  3RUX A;  5GAN e;  4M7A D;  4C8Q E;  3PIO A;  3JCM g;  1VQ6 A;  3M57 A;  5FLX E;  4ELZ C;  5IT9 E;  3J7A F;  3UDC A;  1XQH A;  4MDW A;  5D6Y A;  1VUB A;  3OYD A;  3CD6 A;  4C0G A;  1VQ5 A;  3GPL A;  3OW2 S;  2PQW A;  5A0L A;  1ZBX A;  4EMK A;  4JJN K;  2E65 A;  3L2Q A;  3CC4 T;  1M8V A;  4M77 F;  2ZPF B;  1Y71 A;  3N5B B;  3RKY A;  4ZGE B;  5GAN j;  2XDD A;  4EMK C;  1H3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...