4C8QC

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
79
structure length
79
Chain Sequence
METPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESERRCEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 13
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qC00
4M78F 3EFRA 1B34B 2DXUA 4M7DC 4F7UA 4QVCA 4J6WA 3V8KA 4M7DA 1HXDA 4M77E 2E1HA 1LNXA 2K57A 3V7SA 4XU1A 2DZCA 4XTUA 4M75C 5LJ5d 4XTXA 4EMKC 4M75A 5GAN8 3BY7A 4PJOC 2FB7A 4EMKA 3FIFA 2DKGA 1TH7A 3SWNA 4OP0A 4JRIA 3BFMA 5GAOp 4NL2A 2E65A 4C92C 5LJ3j 5CAIA 3JB9G 5LJ3g 4HT8A 2QTXA 5GAN3 3BDUA 5GAMj 4C8QE 1LJOA 2EJFA 3RUXA 4C8QD 3JB9I 1JBMA 3JCMe 3JB9J 3JB9D 4NL3A 5GAMg 5GAN5 4X9CA 4M77D 1I81A 2YLCA 4M78A 4MMKA 1I4K1 2FYKA 1Y96A 4MMLA 4N0AA 4A53A 4C8QF 1U1SA 2YHTA 3JCMh 5LJ5f 2I2LA 5GAOl 3L2ZA 3JB9F 5LJ5e 4PJOE 5GAN7 5GANh 4JUVA 4WF2A 5I21A 1BIBA 4M77A 4M77F 5DY9A 3JCMb 5GAN4 4HT9A 3L1AA 4M7AG 1X01A 4XQ3A 5GAOq 1M5Q1 5LJ5h 4C92E 1WQ7A 3SWNC 4RCBA 3V7CA 1N9SA 3JCMc 2DVEA 5GMKl 4M7DG 1KQ1A 2EWNA 4JRKA 4J6YA 2RD1A 4M75B 4XTZA 4EMKB 2E64A 3BW1A 5GANj 4PJOB 3PGGA 4M7AE 2RA2A 4HA8A 1KQ2A 1B34A 5GANg 2RM4A 5LJ3f 4M75G 4XTYA 3JB9H 4F7UE 4PJOG 1H641 5GMKi 4XU3A 4JLIA 4Y91A 4C92B 4M7DE 2VXEA 3VU3C 5GAN6 3V8LA 5GAMf 5LJ3d 5GAOr 4V2SA 4DQ2A 2JN0A 4M78C 2DTOA 4NOYA 4EMGA 3RKYA 4C8QC 4N0AC 5GMKe 4PJOD 3JCMQ 4C8QA 4M7AB 4C92G 4M75E 2E41A 5GAMd 3FB9A 3JCMV 4M77C 1YCYA 2EJ9A 3M4GA 5GMKh 4PJOF 3HFOA 4F7UB 2VXFA 2ZGWA 3JCMJ 4M7DB 4XTWA 2DEQA 2DTIA 1MGQA 2EJGA 4F7UG 3RERA 4M7AD 2RB6A 2DJZA 5GAOm 1WPYA 3QSUA 1HK9A 1JRIA 1D3BA 2HNIA 3SWNB 3JCMg 1M8VA 2CGHA 3FJPA 2EAYA 4M7DD 4M7AF 4M78E 5LJ3e 5LJ5j 3QO3A 3JCMd 1I5LA 4RCCA 5GMKm 3V7RA 4F7UF 3QUIA 2VC8A 4EMHA 1WQWA 5LJ5g 4X9DA 5GANd 4M75D 3GIBA 3HSBA 5GAMe 3RESA 3RKXA 5GAN2 4M7DF 2DTHA 1BIAA 5LJ3h 3RKWA 3JCMX 1I8FA 3QHSA 3V8JA 1LOJA 4QVDA 4M75F 4M78B 1U1TA 5GAMh 1Y96B 4C8QB 4PJOA 4C92D 3HFNA 3SB2A 2YLBA 2DXTA 4J5YA 2DZ9A 4M78G 4M77B 2E10A 4C8QG 4C92F 3EFSA 4C92A 1WNLA 4XTVA 3RIRA 3JCMW 4J6XA 4M78D 3INZA 5GANe 5GMKj 4M77G 3JCMf 4XU2A 5GAOn 3JCMP 4M7AC 3AHUA 4A54A 5GANf 1N9RA 4M7AA 2Y90A 4XU0A 4PNOA 1D3BB
chains in the Genus database with same CATH superfamily
4M7DC 4M77E 2MIOA 2QI2A 1XQHA 3CCRQ 4CC3A 4ESRA 5CIUA 2COYA 1JB0E 4JRPA 2AT1B 2LMJA 3M59A 5KE2A 2HAXA 1W70A 1GBQA 1M1FA 2KVQG 1YIJA 2RQRA 1Y96A 5LJ5f 4Q5WA 5I2MA 3CC4A 2BZXA 4PJMA 4J6YA 2RD1A 2Y4YA 5GANj 1GCQA 1ZA1B 1X6BA 5IHIA 2DXBA 3HRTA 2X35A 1NLOC 2QASA 3TSWA 2E3HA 3PFSA 1IRXA 4M78C 3EG9B 2LCCA 3QXEB 4A4GA 3EG1A 1W6XA 2EBPA 3P8HA 2H8HA 5L23A 4BUGA 1Q86C 4BD3A 2DTIA 1NE8A 4BY6C 3CCEA 1VQ5A 3M56A 2PVOB 1ZSZA 3Q1JA 5KYYA 1X2QA 2DXCA 3QIIA 2AZSA 3QO3A 1YJNA 1X6GA 3DB3A 3QHSA 1RLQC 1WDXA 3ZBDA 1GRIA 2EKHA 1SRLA 1TUGB 1LPLA 2DRMA 5LL6S 2E10A 4C8QG 3O5ZA 2OTLT 4XK8E 2CYZB 4BB7A 3MKDA 3RDVA 3TVTA 1BI2A 4PK4A 4N4GA 2X51A 5GANe 3CC2T 5CKEA 1Q82C 1BI3A 4E7ZA 3FDRA 1S72A 1E7OA 6AT1B 5DLOA 1PKSA 1KK7A 4EMKA 2DKGA 2BZ8A 3KUFA 4OGEA 4FT2A 1W4SA 3I56Q 1YFNA 3QKJA 1SRMA 3RUXA 2CS7A 5A0DA 3CC7T 3OB9A 5GAN5 2P0KA 3X20B 1H92A 5A0LA 1OX9A 2P4RA 1K76A 4DOVA 5GAN7 4MZPA 4M7AG 2A36A 1QLYA 4QQDA 4N4HA 2MPXC 2IVWA 3I55Q 2WSEE 4FW1A 1VQOQ 2DMOA 2C0TA 4Z02A 1UHCA 3PVLA 9ATCB 2MCNA 3KBGA 3AT1B 5IXFA 3TU4K 3BDLA 1K9MR 5ECAA 1VQ6T 5DM7R 2YRVA 2OAUA 2RI5A 3MCAB 1C1AA 4IUPA 2A28A 4KGXB 3X26B 4FYXB 1Q95G 2F2WA 3CCQT 2LJ0A 3MP6A 3QYGB 4A63B 3X28B 2RJDA 1VQPA 1XTDA 4KUDK 5GMKm 2VC8A 5DLQE 4BE1A 2HSEB 4M75D 3P8DA 3EGDB 1VQMA 2L3RA 3OSSC 3GP8A 4CC4B 2EYYA 2COZA 1K8AU 3CCLQ 3VS5A 3LW5E 5FU7B 3OYEA 1QMCA 1WXTA 1YP5A 5GAOn 1VQ7A 1ZX6A 1M27C 3EG0A 2Z0WA 1B34B 1VQNQ 1VQ9Q 3DLMA 3VJPA 2D1XA 5KYUB 4XU1A 3OS2A 5LJ5d 2VGNA 2LX9A 1OPKA 1AZGB 2LTOA 4OB3B 2K7AA 2PVDB 2A0FB 1VYTA 3NFCA 3ASKA 2MI6A 2YUQA 3S6WA 2QDLA 1M1KC 2D8JA 4PFZA 3PIOA 1JBMA 2DL4A 3O8VA 2D8HA 4C8QF 4Z88A 3JB9F 2EQIA 3PTAA 1N8RU 1ZA2B 4C0ZA 3A98A 3L1AA 2HKQB 2VGMA 1YJ9A 3M58A 2JXBA 3QDRB 4EMKB 4IUUA 1NLPC 2DAQA 2DL8A 1AHJB 2DRKA 3S3NA 3S3MA 2FPFA 1UE9A 4XU3A 3QPHA 5KYXA 3SD4A 2B8AA 1QW1A 2F5TX 3LX7A 3OS0A 4J9IA 4M7AB 4M75E 1Q7YC 3UATA 5GAMd 3EFOA 3CMEQ 1YCYA 5C0MA 4KUIA 2ZGWA 3VRZA 2EQMA 1YIJQ 3SDZA 4RG8A 2D0NA 4E7KA 2DJZA 5KYWB 1MNEA 1HK9A 3CC4Q 2HNIA 2KBTA 3FJPA 4M7AF 2B86A 1FXXA 1UUEA 2JTEA 2P0QA 4LN2A 2V26A 1VQKA 5LJ5j 2D0QB 4X9DA 3OA6A 1NYGA 3RKXA 2MOXA 2RJEA 5AYFA 2X4JA 3UA6A 1XNIA 2QXFA 3VYGA 3H0FA 1NEBA 1RI9A 4LXCA 1M3BA 1WX6A 1I07A 3I56T 1VQ8T 5FW9A 3JCMf 4XU2A 3HRSA 1OV3A 1N9RA 3A8LB 4CRIA 3D7SB 4X34A 3FLGA 2KT1A 1TSFA 3M0TA 2L0AA 3I55T 3QJ6A 1BKBA 4AFSC 2K9GA 1XJWB 5GAMj 3JB9I 2E3IA 1VQOT 3JB9J 2X4XA 4C5GA 4M78A 4MMLA 4II1A 1D1BA 1ZHIA 5LJ5e 4WF2A 5FRNA 2V1RA 1D0YA 1MMNA 1VIEA 1YJWT 2EW3A 1KD1U 2EWNA 2K3YA 1NG2A 1D1AA 5CQYA 2A08A 2O88A 2RO0A 2DE0X 4A4HA 2VXEA 4PFPA 5LJ3d 2OAWA 4NOYA 1EFNA 3NMZC 3I9QA 4C8QC 3OYJA 3NTIA 1HD3A 2HEQA 3MEWA 1IB8A 2CP6A 1WGSA 2RHXA 4C0DC 1RL2A 2VWFA 4F7UG 3VS3A 3OYNA 3CCLT 1WHLA 2CGHA 4M7DD 3H0HA 3LGLA 3WVEB 5EG2A 4IURA 5GAMe 3G6EA 2BTTA 3G71Q 1AEYA 1VQNT 1B07A 4DOWA 3SHWA 1H8KA 2HBPA 1Z9QA 1CKBA 4KBMB 1UG1A 3RIRA 4OVAA 1PM3A 3EAEA 3GPLA 5CKBA 1IREB 4M7AC 3AHUA 3HP9A 1VA7A 2M0YA 2DNUA 2HDAA 2R58A 4RTYA 4XU0A 5FU6C 1VQ4A 2YWWA 2EGEA 2J06A 2DO3A 2DERA 3MHXA 3RMSA 1EX4A 4KGVB 2YRDA 2PZ1A 2XG8D 2EGAA 1K8AR 4OP0A 1C0MA 3A8GB 5LJ3j 2E65A 3OYYA 1V76A 2O9SA 2LQNA 2K3XA 3M53A 4X9CA 1KHIA 2JZ2A 4YTLA 1M2VB 2E6ZA 5D7UA 1IGQA 4OMNA 1VQ7Q 2L5QA 1W2BP 3PIPA 1R0CB 2QQ9A 4OMQA 2K2VA 5LJ5h 4RCBA 2M16A 1YIJT 1KQ1A 3GBQA 4PJOB 3PT9A 3E9GA 5EC7A 3G1JA 2QDYB 3OYIA 3DB4A 5GANg 1HJDA 2AZVA 2KAFA 4JZ4A 2CZ0B 3CC4T 2K3BA 3FEOA 1KC8U 3RNJA 4AG1C 4C92B 4M7DE 5GAN6 2EKOA 1G5VA 1N8RR 1WA7A 2DTOA 2YT6A 5CKDA 4RTVA 1BCOA 2OJ2A 2DIQA 2G3RA 4PJOF 1PHTA 2VXFA 1WHKA 1WYXA 2DL7A 3NGPA 3N5BB 1WXBA 1O9SA 2RB6A 3M0PA 3SWNB 1UJ0A 1ABOA 1M30A 5LJ3e 1AZEA 3JCMd 2DYIA 3CCET 1VQ5T 2K4YA 1FMVA 2LQ8A 1B7TA 1U1TA 5GAMh 4FCYA 4E6RA 2XMFA 2NUPB 4M77B 3EFSA 1NPRA 1P92A 3L42A 5GMKj 2RI3A 1QCNA 1NJIU 2GNCA 3CBMA 2RI2A 4QVCA 1U5SA 5HY6A 3G4SA 2DPPB 1SEMA 3PE0A 3QZ5B 4XTUA 2CSQA 2COWA 3E2UA 4BI8B 1DJ7B 1AWOA 1GFCA 2GCXA 2FB7A 3FIFA 3VUZA 1JEGA 1FYNA 2X4YA 3CCQQ 1S72T 2JUFA 3QYHB 5L8RE 2P0PA 4HCCA 2M1HA 4A53A 1WLPB 2K79A 2RNAA 2V8JA 1CKAA 4ME7A 1PRLC 1BK2A 2CUDA 1N9SA 1B3QA 2ZPGB 2IPOB 1TXQA 4LUDA 3UA7A 1EZZB 3GLXA 4F7UE 3M4YA 4JLIA 4ZN3A 3V8LA 3H9NA 1Y57A 1OULA 3M5AA 5GMKe 2HCKA 2JS0A 3A8OB 1VUBA 1NYFA 4O5VA 3G71T 1NPPA 4X1VA 2KSSA 1KD1R 5J39A 1RAHB 3TSZA 2VKNA 2J05A 1QCFA 2CKKA 3I5RA 4J9EA 2A7YA 1QCOA 1WJRA 5CK9A 4QVZA 3TEEA 3GF5A 1VYUA 2DLPA 5LJ3h 1V29B 3H6ZA 3VS0A 3HRUA 3A5ZB 1K0XA 2EYZA 2FPEA 3SB2A 1WJQA 4LDUA 4RTZA 1JJ2A 2ZPHB 5IN1A 4WTOB 1Q86U 3I35A 2KXDA 2EQKA 3C94A 1M2OA 1T0HA 2GTOA 4E7IA 2DZCA 4KULA 3CCJA 1VQ7T 4XTXA 1D09B 3U23A 5IAYA 4M75A 1WIEA 1VIFA 3OYCA 1JJ2S 2LNVA 4HVWA 1AOJA 3E9FA 5D6YA 2PTKA 2KYMA 3GNGA 3EH1A 3JB9G 2ED0A 4J9CA 4J8OA 1CSKA 4JZ3A 3FC3A 2CZ1B 2KXCA 1PSFA 3GOXA 1MV0B 3WXMB 4FT4A 1VYVA 2MF2A 5FWBA 2XICA 1U1SA 2X3XD 2PVGB 2VB6A 5DY9A 3F70A 5GAOq 4IUVA 1HSQA 1OU9A 3V7CA 1T3LA 2E64A 1VQ8Q 1UECA 2E70A 4E2FB 3VS4A 3M55A 5CR2A 3JB9H 3ZEHA 4CC7A 2A3LA 4M4ZA 4PJLA 2F2VA 4FW2A 1PWTA 2MWOA 3WVDB 2RHIA 2L3SA 5KCHA 5GMKh 2ZPEB 1M4ZA 3VUBA 2DETA 2NLUA 4C5HA 4C0FA 3NTKA 1D3BA 1KC8R 4LD9K 2LVMA 1YHQQ 1M8MA 2WSFE 4EMHA 3OYGA 5LJ5g 5A2QE 1UGRB 1OX8A 4BE0A 2DTHA 4GLMA 1ZSGA 4Z8AA 2HL3A 3META 3C12A 1Y96B 2J6KA 4R55A 1YJWQ 2CZ6B 3REBB 1VQLA 1WXUA 2DYBA 4JJNK 3LGFA 3DLLA 2F69A 4HKEA 3MEUA 3CQTA 1T3SA 4L5GA 3M0SA 1G2BA 2W10A 5CKHA 3QWYA 1NM7A 4J6WA 1XOVA 4HVUA 3EHRA 2FZGB 3V7SA 2QQSA 4LDYA 1QVFA 1NBEB 2ROTA 2JM9A 2CZ7B 2QGFB 3IQLA 1OU8A 2CSIA 1UHFA 3CXCA 5I22A 2QTXA 2QQRA 2KDSA 1LJOA 4C8QD 1MV3A 2H3JA 1NJIR 3JB9D 3C95A 2DL3A 2BUDA 5GAMg 1ZSZB 1K8AC 4ELZC 5KYYB 2FEIA 3L2WA 1QVFS 2CT3A 2EVRA 3L2QA 1M90U 3TCJA 4E47A 5GAOl 2LT1A 5GANh 5GAN4 4RG2A 1M5Q1 3CPWA 2C0IA 3CXCS 3VS7A 1YITQ 4LDWA 1H3HA 4M75B 2MAMA 1FMKA 4LD6A 1OYXA 4OMLA 3EH2A 1ZLMA 1KHCA 2GFAA 8ATCB 1SSFA 3CPWS 3ZFJA 3LH0A 2KK4A 4MDWA 1MMAA 1M1KU 3VV0A 4FSSA 1UGQB 2DEQA 2GQVA 1J3TA 3CC2A 5IHKA 1GFDA 3RERA 4M7AD 4C5EA 1RUWA 2A37A 1RABB 3J81E 2XIDA 2XHCA 4LE9A 3OYFA 1TU0B 1I8FA 1JU5C 1RI0A 4RMOA 1FWZA 1PSEA 3CEYA 3CC7A 1KG1A 4JS4A 1M3CA 3LH5A 3ER0A 1ARKA 2BE9B 4BI4A 2KI7A 2M02A 5KE3A 2RHYA 2CREA 1UDLA 4ATOA 3CMAA 3INZA 2M0OA 3OBWA 4A54A 4RTUA 4C8QE 1D3BB 3L2VA 3V8KA 4M7DA 2XDPA 2K57A 2KRMA 3BY7A 2JOYA 2ZPFB 3I5SA 1VQ4T 4AFUC 2LX7A 4DEYA 3OYKA 5IT9E 3QBYA 4N4IA 1Q86R 3CD6A 5LJ3g 1WZOA 3OYDA 4KT0E 4WCIA 3CCEQ 1VQ5Q 2JS2A 3HPWA 2QGGA 4MMKA 1QVGA 3PNWC 3M57A 3VYHB 4IUQA 4PKCC 2QTVA 3OS5A 1K1ZA 2L3PA 1KQSA 4ZNXA 1ZUKA 4KRTA 1YJNQ 1GCQC 1M8VA 3CCJQ 4M7AE 4FL6A 2QG9B 1QVGS 4MZMA 3H41A 4PJOG 3EGXA 3QWXX 4Y91A 3OYLA 3CCRA 3VU3C 2LCSA 1YHQT 4JJCA 2DEUA 2LNHB 3VS1A 4C92G 1KQSS 2ZZDA 2HKNA 2X4WA 3FB9A 2ENMA 2EJ9A 2DA9A 5HK3A 1R8OB 5FU7C 3J80E 3CCUA 2BIVA 1BYMA 2JVVA 2XK0A 1ZQ1A 2EIFA 3BE3A 1S72Q 1C6VX 2LJ3A 2ZPBB 2OTJA 5HK0A 1JRIA 1BU1A 1E6GA 2VYTA 2JJ9A 1R77A 4JRQA 3QUIA 3GIBA 2FRYA 3RESA 1JO8A 1KFZA 4MDXA 5HCKA 1QQJA 3J7AF 3A1PA 5FWCA 1RAAB 2J7IA 1D0ZA 4RKUE 1YN8A 1ZUUA 2O4XA 2YLBA 1K9AA 2QAZA 4BE2A 1BI1A 3JV3A 4M77G 2F1LA 2CP5A 3MO8A 8AT1B 5I2SA 2KT8A 3SEMA 4AG2C 1K4US 3EFRA 2FL7A 4F7UA 1GL5A 1UGVA 1AWJA 1MMGA 2DX1A 5KYXB 1LNXA 1OQKA 1YCSB 1BCMA 1RLPC 4EMKC 1OI1A 5IH2A 2W0ZA 2CH4W 2RF0A 1IO6A 3EFOB 4JRIA 2DM1A 1YITT 1ABQA 5GAOp 2DL5A 1K73U 3OW2A 3NTHA 1UEBA 2VUBA 1KIKA 2JTFA 3NPFA 4HCZA 2KRNA 1UFFA 3UDCA 1HYOA 3OSVA 4PLLA 2FO0A 2M9UA 1VQPQ 1X01A 2FG0A 1BB9A 2QEXA 3OW2S 5GMKl 2EGCA 4JRKA 4PLIA 1VQMQ 1KQ2A 1Q81U 2HQEA 2DD5A 4HXJA 4DQ2A 1M90R 4PJOD 4OGCA 2F2XA 2E41A 4QT7A 3I56A 1Y07A 2G6FX 1X6OA 3OMGA 1U06A 1I1JA 2EJGA 2DBKA 2QA4A 4E7LA 1IXDA 2VVKA 2YXYA 4RCCA 4OB0B 1M1KR 3I55A 4F04B 2HZYA 2JMAA 4M78B 3ME9A 1KC8C 2EQJA 1YBYA 2DZ9A 3R6NA 2XD0A 2HL5C 4C92F 3JAME 2DD4A 5CVIA 3JCMP 1K9MC 3EG9A 4BY6B 2CP3A 1MHNA 4HCBA 2HQXA 1YJ9Q 3GNFB 4PNOA 4M78F 1WHHA 4QQ6A 1FX7A 1IZ6A 1OZ3A 3OS1A 1TOVA 2WSCE 2ZAEA 2LQWA 1QWFA 4NL2A 1YJNT 4QW2A 1OZ2A 3CCJT 2D9TA 4JS5A 2LDMA 3ZL7C 3PMTA 4F16A 1V1CA 2YRCA 2FYKA 3CMAQ 4PJOE 4EDUA 2FRWA 3G7ZA 4GY5A 4M77F 5I21A 3RR6A 3LWHA 4IKFA 4HT9A 2PUKB 1VQKQ 3E19A 3MEVA 3VRYA 2EYXA 4C92E 1WQ7A 1NJIC 2K5LA 7AT1B 1AVZC 3C0CA 2LRQA 1UB4A 4J83A 3JRZA 1VQ9A 3LWIA 1QKWA 2RM4A 4MZTA 1G3TA 1OOTA 5CO7A 1AD5A 2JN0A 2RK2A 2I0NA 3A8HB 3JCMV 5KH6A 4BDYA 2KQWA 1MNDA 3MPUB 3S3OA 2EYQA 2FZKB 2K6DA 2GBQA 2HSPA 2P84A 4OMOA 1JQQA 3M0UA 2GF7A 1BBZA 1R0BG 3RMQA 1WQWA 4ANJA 1RADB 4RTWA 2PU9B 4QVDA 4LUEA 4JPBW 2LZ6B 2E6NA 5FROA 2H3EB 2LJ1A 4J5YA 1N5ZA 1ZUYA 1WNLA 1W1FA 4J9BA 1JJ2P 3CCUQ 3CMEA 3SFMA 2HBWA 3VS6A 1WFWA 1AWWA 1VQLT 3X24B 2OTJQ 3L2RA 5AT1B 4FIBA 1X27A 1RAEB 4PJOC 1VQPT 3CCMA 1GCPA 4KH1B 2LCLA 3CCVA 1TH7A 2O01E 2EPDA 4C92C 1PD1A 2K5IA 4HT8A 2CT4A 1VQMT 2MYSA 3EGDA 1YI2A 3JCMe 4ELYC 2FZCB 1UTIA 4PL6A 4JLGA 3MP8A 1WHMA 2I2LA 4ZGDB 3KXTA 3M9QA 1RAIB 4FU6A 1M9SA 2DIGA 1G3SA 3SWNC 3CBPA 3G6EQ 1K73R 4EIKA 2RA2A 4HVVA 1B34A 4M75G 2PQWA 4J7FA 3LYIA 2QQBA 5GJVB 5KYUA 5GAMf 4V2SA 3M54A 4OMPA 4N0AC 1X2KA 4C8QA 4K11A 3CCSA 2PNIA 4M77C 2XU8A 2GGRA 3UPUA 5FRMA 4E7SA 1VQ4Q 1MGQA 4F17A 3CBOA 2L89A 1Q81R 1Q82U 2P4TA 4PFOA 5D6WA 2KE9A 2QEXQ 1SF9A 2GFUA 1YJ9T 1UGPB 1TS9A 4L6V5 4JDSA 1X75C 3JCMX 2C06A 2ROLA 3UF4A 3M0QA 4C0GA 3OYBA 2RQWA 1TUCA 2FPDA 2K2MA 1YNZA 2XDBA 4B9XA 2NYSA 4M7AA 2ABLA 2K5FA 2OI3A 1N6AA 1Y7XA 2QA4Q 3OBYA 1ZBXA 2CDTA 2E1HA 2EFIA 4ZGJB 3CMAT 4D6WA 2AHJB 2VV5A 1G83A 2QYZA 1QVFP 5GAN8 5KYWA 1VQKT 3H0IA 2CP2A 1OPLA 3BFMA 2QK0A 2RJCA 3G71A 3CXCP 4OMFB 4LDXA 4NL3A 4A4FA 4Y28E 2DJQA 2YLCA 2VASA 1D1CA 2JW4A 3JCMh 3L2ZA 3CD6T 3EG2A 1T0JA 2BE7D 1G8XA 2E5KA 3EHQA 3CPWP 4ZN1A 3OYHA 3OQ5A 2FHDA 3BW1A 4DEXA 5LJ3f 1QKXA 4KGZB 5GMKi 1AT1B 1MMDA 2JT4A 4FYYB 3PMIA 4EMGA 3JCMQ 4AFQC 2YUOA 2LC4A 2O9VA 2HD0A 2R5MA 1SSHA 3CCRT 3JCMJ 4XTWA 2BZYA 4AFZC 2X9HA 1G3YA 2KR3A 5KCOA 3G4SQ 1M90C 4QKUA 4OF1A 3VKIA 1WPYA 4E7HA 2R57A 4GLKA 1G3WA 1BI0A 1X43A 3CCUT 1I5LA 4J9HA 2LT4A 1SHGA 4PJJA 1UGSB 2OTJT 2JNGA 2OTLA 4D8KA 1LOJA 2ED1A 2RQVA 4M75F 4C8QB 2LP5A 4Z89A 3UWNA 4FYWB 2NUZA 2OX7A 1M3AA 4FSXA 1N8RC 2AK5A 4J6XA 4C0DB 4J9GA 3OMCA 2RK1A 1F1BB 2MK5A 4RTTA 2E5QA 4AT1B 2RPNA 1H3ZA 2CP7A 1SHFA 2V8KA 3FRNA 1JXOA 2F5KA 2WACA 3THKA 2V8IA 2EQUA 2JM8A 3G6ET 4D8DA 3ULRB 2DFUA 1Q7YU 3DKMA 1Y0MA 4CI0C 5IHNA 4J7IA 4NS5A 1E6HA 4DBRA 1TUDA 3MJXA 2KYBA 4BDZA 4ZGEB 1QVGP 2V1QA 2AKLA 5FU6B 4R56A 3JCMb 3P8BB 4XQ3A 2L3QA 3E1SA 2NWMA 1U3OA 1S1NA 3EGUA 3X25B 1I5OB 1KQSP 3JCMc 2EYWA 2DVEA 1N27A 4M7DG 4IUTA 2XI9A 4J9DA 1VQ6A 3PGGA 1TTHB 5C6SA 5I11A 4HA8A 3CCMQ 3CCVQ 1PD0A 1H641 2QEXT 4TVRA 3UT1A 2Y4XA 2KGTA 2IIMA 4GBQA 2HMAA 3CCQA 4HCKA 2JTMA 1YI2Q 1WJSA 3OYAA 3VS2A 1PG5B 3RBBB 3R6OA 2LQKA 3L2UA 2RMOA 1IHWA 1FMWA 3CPFA 4FYVB 1M2VA 3QG1A 2JMCA 2XKOC 2AKKA 5GAN3 3MEAA 4RUGA 1BIAA 1RACB 5A0GA 3RKWA 2QA4T 5CCAA 4UC4A 1KSWA 2DBMA 3FJ5A 4PJOA 5J26A 3HFNA 2DXTA 2J6FA 1QP3A 1Q82R 4M78G 3CCSQ 1PNJA 4C92A 1ZSZC 4R0KA 3M0RA 4B6MA 5GANf 1KJWA 3REAB 1QWEA 1PCXA 1KD1C 2L2PA 4B9WA 1HXDA 3HKSA 4IIMA 2ESWA 4M75C 2YSQA 3OY9A 3NHNA 3PVQA 5D6XA 3TQ7P 3SWNA 5CAIA 1WHJA 4KH0B 2RN8A 3OW2P 2RHUA 2NUTA 4L59A 2X3WD 2RJFA 3C4SA 2DF6A 2DVJA 1I81A 4JJBA 1I4K1 4N0AA 2NUPA 4JUVA 4M77A 1GXIE 1EIFA 2XDDA 2KRSA 2KMTA 1WI7A 1UJYA 2E12A 2KNBB 4XTZA 3MP1A 3QZ9B 2RH2A 3G4ST 2ECZA 1AWXA 5J3BA 4ZTFA 2RHZA 3EG3A 1VQLQ 5GJWB 2L8DA 2CUBA 4DBQA 1X69A 1RAGB 1ZBJA 1K73C 1VQ9T 3HFOA 4LDVA 4M7DB 1NEGA 4C5IA 1GBRA 4O6JA 1PKTA 3T9NA 2E4HA 2AIRB 2ZPIB 1IHVA 3JCMg 1M1GA 3LLRA 2EAYA 3URGA 4Y92A 3TREA 1MUZA 4BI3A 5CQXA 1Z9ZA 3V7RA 4M7DF 5GAN2 1Q81C 1VQ8A 2RQUA 2CP0A 4C92D 4JJDA 2FVUA 2M51A 5KYNA 2KROA 4RTXA 1JXMA 1WHGA 4DBHA 3OYMA 1ACMB 3JCMW 4M78D 4DBFA 2MWPA 2Y90A 5FLXE 1Y71A 2DXUA 1LCKA 3EGXB 1QVPA 4LNPA 4P5NA 3A8MB 4F14A 3CMET 4AMCA 2CH4A 1VQOA 1YHQA 1PRMC 4VUBA 1VOMA 2GQIA 5CKFA 2OTLQ 4A4EA 5M9OA 4FM4B 2YUNA 3BDUA 2ZCFB 2EJFA 3CCMT 3QJYA 3CC2Q 3CCVT 1IGUA 2D6FA 1YJWA 4M77D 4BACA 2KEAA 2YHTA 1A0NB 1W2BA 1K9MU 1BIBA 4IIOA 4J9FA 2O2OA 1YI2T 1LVKA 1NZ9A 3JSCA 3KFVA 1TG0A 1SPKA 2O31A 1Q7YR 4DA4A 2SRCA 2O4XB 1PC0A 1RAFB 3HTRA 2HQHA 2SEMA 3CC7Q 4XTYA 2MMPA 5HKCA 1W2BS 2IG0A 5GAOr 2C0OA 2NUTB 2PUOB 3RKYA 1OEBA 4OB2B 1O75A 2KY9A 3CCLA 2BKDN 3M4GA 2YUPA 4F7UB 2DK3A 3H8ZA 1YWPA 4EPCA 2RQTA 1I0CA 5GAOm 3CCST 3QSUA 1VQNA 3HHTB 2R5AA 2ATCB 2YDLA 3HL8A 4M78E 2GTJA 3QDFA 2QQAA 2DILA 1QP2A 4F7UF 5GANd 1YITA 1VQ6Q 1YWOA 1K0SA 3HSBA 4ORZA 3CD6Q 3V8JA 4XAXB 4PJNA 1SG5A 4OB1B 4OMMA 4ZTJA 1TWBA 4CC2A 1SKUB 4XTVA 2J6OA 4A4KA 4E7JA 4QQGA 1D0XA 5IXBA 1U8RA
chains in the Genus database with same CATH topology
2K5FA 4M7DC 1N6AA 1Y7XA 3V8KA 2DO3A 4M7DA 3OBYA 4M77E 2XDPA 1ZBXA 2E1HA 2EFIA 3MHXA 3RMSA 4ZGJB 2K57A 2QI2A 4D6WA 3CMAT 2AHJB 2VV5A 1XQHA 2XG8D 5GAN8 3BY7A 2JOYA 2ZPFB 1VQKT 1VQ4T 5CIUA 4OP0A 3A8GB 1JB0E 3BFMA 4JRPA 5LJ3j 2E65A 2RJCA 3OYKA 5IT9E 3QBYA 3OYYA 4N4IA 3CD6A 3M59A 5LJ3g 3G71A 4OMFB 4LDXA 3OYDA 5KE2A 2K3XA 3M53A 2HAXA 4KT0E 4NL3A 4A4FA 4X9CA 1KHIA 4Y28E 1M1FA 3HPWA 2KVQG 2YLCA 4MMKA 1YIJA 1QVGA 1Y96A 2JZ2A 4YTLA 2E6ZA 5LJ5f 3PNWC 3JCMh 3M57A 3VYHB 3L2ZA 3CD6T 4IUQA 4PKCC 2L5QA 4Q5WA 5I2MA 3OS5A 3PIPA 2QQ9A 3CC4A 2K2VA 1KQSA 5LJ5h 4ZN1A 4RCBA 2M16A 1YIJT 3OYHA 1KQ1A 3OQ5A 4J6YA 2FHDA 2RD1A 2Y4YA 1M8VA 3BW1A 5GANj 3PT9A 4PJOB 3E9GA 4M7AE 2DXBA 2QDYB 4FL6A 3OYIA 3DB4A 5GANg 5LJ3f 1QVGS 3HRTA 4MZMA 2X35A 2KAFA 3CC4T 2CZ0B 3FEOA 4PJOG 5GMKi 3PFSA 3CCRA 4C92B 4Y91A 3OYLA 1KC8U 4M7DE 3VU3C 5GAN6 2EKOA 1YHQT 1G5VA 4M78C 2DTOA 2LCCA 3PMIA 3QXEB 4EMGA 4A4GA 3JCMQ 4C92G 1KQSS 2LC4A 5CKDA 2ZZDA 2X4WA 3FB9A 2HD0A 3P8HA 2R5MA 2EJ9A 2DIQA 2G3RA 4PJOF 4BUGA 4BD3A 5HK3A 1Q86C 2VXFA 1R8OB 5FU7C 3CCRT 4XTWA 3J80E 2BIVA 2DTIA 3CCUA 3JCMJ 1VQ4A 1BYMA 2JVVA 1NE8A 2XK0A 3N5BB 1ZQ1A 2EIFA 4BY6C 1G3YA 3CCEA 1VQ5A 5KCOA 1O9SA 1M90C 3M56A 2RB6A 2PVOB 4OF1A 1WPYA 3VKIA 4E7HA 2ZPBB 2OTJA 2R57A 5HK0A 3Q1JA 1JRIA 4GLKA 3SWNB 2DXCA 1G3WA 1BI0A 2VYTA 5LJ3e 3CCUT 3QIIA 3QO3A 3JCMd 1I5LA 2LT4A 4JRQA 1VQ5T 3CCET 2K4YA 3QUIA 2LQ8A 3GIBA 1UGSB 3RESA 1YJNA 2OTJT 3DB3A 2JNGA 3QHSA 2OTLA 4MDXA 1LOJA 3ZBDA 3J7AF 4M75F 1U1TA 5GAMh 4C8QB 4RKUE 2O4XA 2YLBA 3UWNA 4M77B 5LL6S 2E10A 4C8QG 3EFSA 1NPRA 4FSXA 1P92A 1N8RC 4XK8E 2OTLT 4BE2A 1BI1A 2CYZB 4BB7A 4J6XA 3L42A 4C0DB 5GMKj 4M77G 2RI3A 3OMCA 3MO8A 1BI2A 2RK1A 4N4GA 5GANe 5I2SA 1NJIU 3EFRA 3CC2T 5CKEA 2E5QA 2FL7A 3CBMA 2RI2A 4F7UA 4QVCA 1H3ZA 5HY6A 1Q82C 1BI3A 3G4SA 1LNXA 3FDRA 2DPPB 1S72A 2V8KA 3QZ5B 5DLOA 3FRNA 4XTUA 4BI8B 1DJ7B 4EMKC 1OI1A 2GCXA 2FB7A 4EMKA 3FIFA 2F5KA 2DKGA 2WACA 3VUZA 4JRIA 2V8IA 1YITT 3KUFA 4OGEA 4FT2A 5GAOp 1W4SA 2EQUA 2X4YA 3G6ET 3QKJA 1K73U 1S72T 3OW2A 1Q7YU 2JUFA 3DKMA 3NTHA 3QYHB 1UEBA 2VUBA 4CI0C 2JTFA 3RUXA 2CS7A 5A0DA 4HCZA 4J7IA 4NS5A 5L8RE 3CC7T 2P0PA 3OB9A 5GAN5 2P0KA 3UDCA 2M1HA 3X20B 4HCCA 4A53A 5A0LA 4BDZA 4ZGEB 4DOVA 3OSVA 4PLLA 5GAN7 2V8JA 2M9UA 5FU6B 4MZPA 4R56A 3JCMb 3P8BB 4M7AG 1X01A 4XQ3A 4ME7A 3E1SA 2QEXA 3OW2S 3X25B 1N9SA 3JCMc 4QQDA 2DVEA 4N4HA 5GMKl 1N27A 4M7DG 4JRKA 2IVWA 2ZPGB 4IUTA 2XI9A 4PLIA 2WSEE 1VQ6A 3PGGA 5C6SA 4HA8A 1KQ2A 1Q81U 3GLXA 4Z02A 4F7UE 1H641 3M4YA 4TVRA 4JLIA 3UT1A 4ZN3A 2QEXT 3KBGA 2HQEA 2Y4XA 3V8LA 2DD5A 4DQ2A 3M5AA 5GMKe 3TU4K 4PJOD 3BDLA 4OGCA 3A8OB 1VQ6T 2E41A 3CCQA 1VUBA 3I56A 2JTMA 4O5VA 3G71T 1Y07A 5DM7R 1GXIE 1NPPA 1WJSA 2YRVA 3OYAA 2OAUA 2KSSA 2RI5A 1X6OA 3MCAB 3OMGA 5J39A 4IUPA 2EJGA 3R6OA 2LQKA 3L2UA 3X26B 3CCQT 3MP6A 3QYGB 2QA4A 4E7LA 3CPFA 3X28B 2RJDA 2CKKA 1VQPA 3QG1A 2XKOC 2A7YA 1XTDA 1WJRA 4RCCA 5CK9A 4KUDK 5GMKm 5GAN3 4OB0B 2VC8A 4QVZA 5DLQE 4BE1A 4M75D 3P8DA 3GF5A 3TEEA 3MEAA 1BIAA 5LJ3h 1V29B 3H6ZA 3RKWA 3HRUA 5A0GA 3I55A 3A5ZB 2QA4T 5CCAA 4UC4A 1VQMA 2L3RA 3OSSC 4M78B 3GP8A 3ME9A 1KC8C 4PJOA 5J26A 3HFNA 3SB2A 2EQJA 1YBYA 2DXTA 1WJQA 1K8AU 1QP3A 2DZ9A 4M78G 4LDUA 2XD0A 3LW5E 4C92F 4C92A 5FU7B 3OYEA 1W2BS 1JJ2A 2ZPHB 2DD4A 5CVIA 3JAME 5GAOn 3JCMP 1K9MC 5IN1A 4BY6B 1MHNA 1Q86U 1VQ7A 4HCBA 5GANf 2HQXA 3GNFB 2EQKA 4PNOA 4M78F 4QQ6A 3C94A 1B34B 1FX7A 1KD1C 1IZ6A 4B9WA 1HXDA 3HKSA 4E7IA 3DLMA 3VJPA 3OS2A 4XU1A 2DZCA 4KULA 4M75C 5LJ5d 4XTXA 3CCJA 5IAYA 1VQ7T 2VGNA 4M75A 3OY9A 1VIFA 3OYCA 1OZ3A 1JJ2S 2LX9A 5D6XA 3SWNA 2LNVA 3OS1A 2LTOA 3E9FA 4OB3B 5D6YA 2PVDB 2WSCE 4NL2A 5CAIA 3GNGA 3NFCA 1YJNT 3ASKA 4QW2A 3JB9G 4J8OA 1OZ2A 2MI6A 3S6WA 2D9TA 3FC3A 3CCJT 4JS5A 2CZ1B 2RHUA 1PSFA 2LDMA 3GOXA 1M1KC 4L59A 3PIOA 1JBMA 3WXMB 2RJFA 3C4SA 4FT4A 3PMTA 3O8VA 2MF2A 1I81A 1I4K1 2FYKA 2XICA 4N0AA 4C8QF 1U1SA 1N8RU 3PTAA 3JB9F 4PJOE 4EDUA 3G7ZA 4C0ZA 2PVGB 4JUVA 4GY5A 4M77F 4M77A 5DY9A 5I21A 1EIFA 3F70A 2XDDA 3LWHA 3L1AA 2PUKB 4IKFA 5GAOq 4HT9A 3E19A 3MEVA 4IUVA 2VGMA 2KMTA 4C92E 1YJ9A 1WQ7A 3V7CA 1NJIC 2K5LA 3M58A 3QDRB 2E12A 2LRQA 4XTZA 1UB4A 3MP1A 2E64A 4J83A 3JRZA 3QZ9B 4IUUA 2RH2A 4EMKB 3G4ST 1VQ9A 2DAQA 3LWIA 1AHJB 2RM4A 3S3NA 2E70A 3S3MA 1YI2A 5J3BA 4MZTA 4ZTFA 3M55A 1G3TA 2RHZA 5CR2A 3JB9H 4XU3A 3ZEHA 3QPHA 5CO7A 2L8DA 3SD4A 2A3LA 2JN0A 2B8AA 1QW1A 2F5TX 2RK2A 3LX7A 3OS0A 1K73C 4M7AB 4M75E 1VQ9T 1Q7YC 5GAMd 2MWOA 3A8HB 3WVDB 3JCMV 2RHIA 5KH6A 5KCHA 1YCYA 5GMKh 3HFOA 5C0MA 4BDYA 4LDVA 4KUIA 2ZGWA 2KQWA 2ZPEB 1M4ZA 4M7DB 2EQMA 3VUBA 4C5IA 3SDZA 3S3OA 2EYQA 2NLUA 4RG8A 4C5HA 4E7KA 4C0FA 4O6JA 2DJZA 3T9NA 3NTKA 1HK9A 2ZPIB 1D3BA 2HNIA 3JCMg 1M1GA 4LD9K 3LLRA 3FJPA 2EAYA 3URGA 3TREA 2LVMA 4M7AF 1FXXA 2GF7A 2P0QA 4BI3A 1VQKA 5LJ5j 5CQXA 2D0QB 3V7RA 2WSFE 3RMQA 4EMHA 1WQWA 5LJ5g 1UGRB 4X9DA 5A2QE 3OYGA 3OA6A 4M7DF 3RKXA 5GAN2 4BE0A 2DTHA 2PU9B 1Q81C 2RJEA 3META 1VQ8A 5AYFA 4QVDA 2X4JA 3C12A 1Y96B 2E6NA 1XNIA 5FROA 4R55A 4C92D 2CZ6B 2QXFA 3VYGA 2FVUA 1VQLA 4J5YA 4JJNK 3LGFA 3DLLA 2F69A 4HKEA 3OYMA 1WNLA 3MEUA 3JCMW 3I56T 1VQ8T 4L5GA 4M78D 3JCMf 4XU2A 3CMEA 3SFMA 3HRSA 2MWPA 1N9RA 2Y90A 5FLXE 1Y71A 5CKHA 1VQLT 3X24B 2DXUA 3L2RA 4J6WA 1XOVA 4FIBA 3A8LB 1QVPA 4P5NA 4CRIA 4X34A 3A8MB 3V7SA 2QQSA 4LDYA 3CMET 1QVFA 3FLGA 4PJOC 1VQOA 1VQPT 3CCMA 2LCLA 1YHQA 3CCVA 1TH7A 2CZ7B 4VUBA 2O01E 5CKFA 4A4EA 4C92C 5M9OA 4FM4B 3I55T 3QJ6A 3CXCA 2K5IA 4HT8A 1BKBA 2QTXA 2QQRA 2KDSA 1VQMT 3BDUA 2ZCFB 5GAMj 1LJOA 2EJFA 4C8QD 3JB9I 1VQOT 2H3JA 3CCMT 3JCMe 3QJYA 4ELYC 3JB9J 3JB9D 3C95A 5GAMg 2BUDA 2X4XA 4PL6A 3CCVT 4ELZC 1YJWA 1K8AC 2D6FA 3L2WA 1QVFS 4M77D 4M78A 4C5GA 4BACA 4JLGA 4MMLA 4II1A 3MP8A 3L2QA 1M90U 2YHTA 3TCJA 4E47A 2I2LA 5GAOl 1ZHIA 2LT1A 4ZGDB 5LJ5e 5GANh 3KXTA 1W2BA 1K9MU 5GAN4 4WF2A 1BIBA 3M9QA 4FU6A 1M9SA 1YI2T 5FRNA 2DIGA 1M5Q1 1NZ9A 3JSCA 4RG2A 3CPWA 3CXCS 1G3SA 1VIEA 3CBPA 3SWNC 1YJWT 4LDWA 1KD1U 2EWNA 4M75B 2K3YA 2MAMA 4DA4A 2O4XB 2RA2A 4LD6A 1B34A 1OYXA 5CQYA 4M75G 2RO0A 4XTYA 2PQWA 2MMPA 4A4HA 5HKCA 4J7FA 3LYIA 2GFAA 1KHCA 2QQBA 2IG0A 2VXEA 5GAMf 5GAOr 5LJ3d 3M54A 1SSFA 1U8RA 4V2SA 4NOYA 2PUOB 3RKYA 4N0AC 4C8QC 3ZFJA 3OYJA 3CPWS 3NTIA 3LH0A 1O75A 4OB2B 4C8QA 2KY9A 3CCLA 4XU0A 3CCSA 2KK4A 4MDWA 2BKDN 4M77C 1M1KU 3VV0A 3M4GA 3MEWA 2XU8A 4F7UB 3UPUA 2DK3A 3H8ZA 5FRMA 1UGQB 2DEQA 2GQVA 1WGSA 2RHXA 1MGQA 4C0DC 3CC2A 1RL2A 4EPCA 4F7UG 3RERA 4M7AD 4C5EA 3CBOA 2L89A 5GAOm 3OYNA 3CCLT 2P4TA 1Q82U 5D6WA 3CCST 3QSUA 1VQNA 3HHTB 2R5AA 2CGHA 4M7DD 3J81E 3HL8A 4M78E 3LGLA 2GFUA 2QQAA 2XIDA 2XHCA 3WVEB 1QP2A 5EG2A 1YJ9T 4F7UF 5GANd 1YITA 1UGPB 3OYFA 4IURA 4L6V5 5GAMe 3G6EA 3HSBA 4JDSA 1X75C 3JCMX 1I8FA 3V8JA 1RI0A 4XAXB 1VQNT 4RMOA 2C06A 4DOWA 1FWZA 1PSEA 3CEYA 3CC7A 4C0GA 1KG1A 3OYBA 2HBPA 4OB1B 4JS4A 3ER0A 4ZTJA 4KBMB 4BI4A 5KE3A 2RHYA 4XTVA 4OVAA 3RIRA 4ATOA 2XDBA 3EAEA 3CMAA 3INZA 3GPLA 2M0OA 3OBWA 5CKBA 1IREB 4M7AC 4A4KA 3HP9A 4A54A 4B9XA 4QQGA 4E7JA 3AHUA 4M7AA 2R58A 4C8QE 1D3BB 5FU6C 3L2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M78 F;  3EFR A;  1B34 B;  2DXU A;  4M7D C;  4F7U A;  4QVC A;  4J6W A;  3V8K A;  4M7D A;  1HXD A;  4M77 E;  2E1H A;  1LNX A;  2K57 A;  3V7S A;  4XU1 A;  2DZC A;  4XTU A;  4M75 C;  5LJ5 d;  4XTX A;  4EMK C;  4M75 A;  5GAN 8;  3BY7 A;  4PJO C;  2FB7 A;  4EMK A;  3FIF A;  2DKG A;  1TH7 A;  3SWN A;  4OP0 A;  4JRI A;  3BFM A;  5GAO p;  4NL2 A;  2E65 A;  4C92 C;  5LJ3 j;  5CAI A;  3JB9 G;  5LJ3 g;  4HT8 A;  2QTX A;  5GAN 3;  3BDU A;  5GAM j;  4C8Q E;  1LJO A;  2EJF A;  3RUX A;  4C8Q D;  3JB9 I;  1JBM A;  3JCM e;  3JB9 J;  3JB9 D;  4NL3 A;  5GAM g;  5GAN 5;  4X9C A;  4M77 D;  1I81 A;  2YLC A;  4M78 A;  4MMK A;  1I4K 1;  2FYK A;  1Y96 A;  4MML A;  4N0A A;  4A53 A;  4C8Q F;  1U1S A;  2YHT A;  3JCM h;  5LJ5 f;  2I2L A;  5GAO l;  3L2Z A;  3JB9 F;  5LJ5 e;  4PJO E;  5GAN 7;  5GAN h;  4JUV A;  4WF2 A;  5I21 A;  1BIB A;  4M77 A;  4M77 F;  5DY9 A;  3JCM b;  5GAN 4;  4HT9 A;  3L1A A;  4M7A G;  1X01 A;  4XQ3 A;  5GAO q;  1M5Q 1;  5LJ5 h;  4C92 E;  1WQ7 A;  3SWN C;  4RCB A;  3V7C A;  1N9S A;  3JCM c;  2DVE A;  5GMK l;  4M7D G;  1KQ1 A;  2EWN A;  4JRK A;  4J6Y A;  2RD1 A;  4M75 B;  4XTZ A;  4EMK B;  2E64 A;  3BW1 A;  5GAN j;  4PJO B;  3PGG A;  4M7A E;  2RA2 A;  4HA8 A;  1KQ2 A;  1B34 A;  5GAN g;  2RM4 A;  5LJ3 f;  4M75 G;  4XTY A;  3JB9 H;  4F7U E;  4PJO G;  1H64 1;  5GMK i;  4XU3 A;  4JLI A;  4Y91 A;  4C92 B;  4M7D E;  2VXE A;  3VU3 C;  5GAN 6;  3V8L A;  5GAM f;  5LJ3 d;  5GAO r;  4V2S A;  4DQ2 A;  2JN0 A;  4M78 C;  2DTO A;  4NOY A;  4EMG A;  3RKY A;  4C8Q C;  4N0A C;  5GMK e;  4PJO D;  3JCM Q;  4C8Q A;  4M7A B;  4C92 G;  4M75 E;  2E41 A;  5GAM d;  3FB9 A;  3JCM V;  4M77 C;  1YCY A;  2EJ9 A;  3M4G A;  5GMK h;  4PJO F;  3HFO A;  4F7U B;  2VXF A;  2ZGW A;  3JCM J;  4M7D B;  4XTW A;  2DEQ A;  2DTI A;  1MGQ A;  2EJG A;  4F7U G;  3RER A;  4M7A D;  2RB6 A;  2DJZ A;  5GAO m;  1WPY A;  3QSU A;  1HK9 A;  1JRI A;  1D3B A;  2HNI A;  3SWN B;  3JCM g;  1M8V A;  2CGH A;  3FJP A;  2EAY A;  4M7D D;  4M7A F;  4M78 E;  5LJ3 e;  5LJ5 j;  3QO3 A;  3JCM d;  1I5L A;  4RCC A;  5GMK m;  3V7R A;  4F7U F;  3QUI A;  2VC8 A;  4EMH A;  1WQW A;  5LJ5 g;  4X9D A;  5GAN d;  4M75 D;  3GIB A;  3HSB A;  5GAM e;  3RES A;  3RKX A;  5GAN 2;  4M7D F;  2DTH A;  1BIA A;  5LJ3 h;  3RKW A;  3JCM X;  1I8F A;  3QHS A;  3V8J A;  1LOJ A;  4QVD A;  4M75 F;  4M78 B;  1U1T A;  5GAM h;  1Y96 B;  4C8Q B;  4PJO A;  4C92 D;  3HFN A;  3SB2 A;  2YLB A;  2DXT A;  4J5Y A;  2DZ9 A;  4M78 G;  4M77 B;  2E10 A;  4C8Q G;  4C92 F;  3EFS A;  4C92 A;  1WNL A;  4XTV A;  3RIR A;  3JCM W;  4J6X A;  4M78 D;  3INZ A;  5GAN e;  5GMK j;  4M77 G;  3JCM f;  4XU2 A;  5GAO n;  3JCM P;  4M7A C;  3AHU A;  4A54 A;  5GAN f;  1N9R A;  4M7A A;  2Y90 A;  4XU0 A;  4PNO A;  1D3B B; 
#chains in the Genus database with same CATH topology
 4M7D C;  4M77 E;  2MIO A;  2QI2 A;  1XQH A;  3CCR Q;  4CC3 A;  4ESR A;  5CIU A;  2COY A;  1JB0 E;  4JRP A;  2AT1 B;  2LMJ A;  3M59 A;  5KE2 A;  2HAX A;  1W70 A;  1GBQ A;  1M1F A;  2KVQ G;  1YIJ A;  2RQR A;  1Y96 A;  5LJ5 f;  4Q5W A;  5I2M A;  3CC4 A;  2BZX A;  4PJM A;  4J6Y A;  2RD1 A;  2Y4Y A;  5GAN j;  1GCQ A;  1ZA1 B;  1X6B A;  5IHI A;  2DXB A;  3HRT A;  2X35 A;  1NLO C;  2QAS A;  3TSW A;  2E3H A;  3PFS A;  1IRX A;  4M78 C;  3EG9 B;  2LCC A;  3QXE B;  4A4G A;  3EG1 A;  1W6X A;  2EBP A;  3P8H A;  2H8H A;  5L23 A;  4BUG A;  1Q86 C;  4BD3 A;  2DTI A;  1NE8 A;  4BY6 C;  3CCE A;  1VQ5 A;  3M56 A;  2PVO B;  1ZSZ A;  3Q1J A;  5KYY A;  1X2Q A;  2DXC A;  3QII A;  2AZS A;  3QO3 A;  1YJN A;  1X6G A;  3DB3 A;  3QHS A;  1RLQ C;  1WDX A;  3ZBD A;  1GRI A;  2EKH A;  1SRL A;  1TUG B;  1LPL A;  2DRM A;  5LL6 S;  2E10 A;  4C8Q G;  3O5Z A;  2OTL T;  4XK8 E;  2CYZ B;  4BB7 A;  3MKD A;  3RDV A;  3TVT A;  1BI2 A;  4PK4 A;  4N4G A;  2X51 A;  5GAN e;  3CC2 T;  5CKE A;  1Q82 C;  1BI3 A;  4E7Z A;  3FDR A;  1S72 A;  1E7O A;  6AT1 B;  5DLO A;  1PKS A;  1KK7 A;  4EMK A;  2DKG A;  2BZ8 A;  3KUF A;  4OGE A;  4FT2 A;  1W4S A;  3I56 Q;  1YFN A;  3QKJ A;  1SRM A;  3RUX A;  2CS7 A;  5A0D A;  3CC7 T;  3OB9 A;  5GAN 5;  2P0K A;  3X20 B;  1H92 A;  5A0L A;  1OX9 A;  2P4R A;  1K76 A;  4DOV A;  5GAN 7;  4MZP A;  4M7A G;  2A36 A;  1QLY A;  4QQD A;  4N4H A;  2MPX C;  2IVW A;  3I55 Q;  2WSE E;  4FW1 A;  1VQO Q;  2DMO A;  2C0T A;  4Z02 A;  1UHC A;  3PVL A;  9ATC B;  2MCN A;  3KBG A;  3AT1 B;  5IXF A;  3TU4 K;  3BDL A;  1K9M R;  5ECA A;  1VQ6 T;  5DM7 R;  2YRV A;  2OAU A;  2RI5 A;  3MCA B;  1C1A A;  4IUP A;  2A28 A;  4KGX B;  3X26 B;  4FYX B;  1Q95 G;  2F2W A;  3CCQ T;  2LJ0 A;  3MP6 A;  3QYG B;  4A63 B;  3X28 B;  2RJD A;  1VQP A;  1XTD A;  4KUD K;  5GMK m;  2VC8 A;  5DLQ E;  4BE1 A;  2HSE B;  4M75 D;  3P8D A;  3EGD B;  1VQM A;  2L3R A;  3OSS C;  3GP8 A;  4CC4 B;  2EYY A;  2COZ A;  1K8A U;  3CCL Q;  3VS5 A;  3LW5 E;  5FU7 B;  3OYE A;  1QMC A;  1WXT A;  1YP5 A;  5GAO n;  1VQ7 A;  1ZX6 A;  1M27 C;  3EG0 A;  2Z0W A;  1B34 B;  1VQN Q;  1VQ9 Q;  3DLM A;  3VJP A;  2D1X A;  5KYU B;  4XU1 A;  3OS2 A;  5LJ5 d;  2VGN A;  2LX9 A;  1OPK A;  1AZG B;  2LTO A;  4OB3 B;  2K7A A;  2PVD B;  2A0F B;  1VYT A;  3NFC A;  3ASK A;  2MI6 A;  2YUQ A;  3S6W A;  2QDL A;  1M1K C;  2D8J A;  4PFZ A;  3PIO A;  1JBM A;  2DL4 A;  3O8V A;  2D8H A;  4C8Q F;  4Z88 A;  3JB9 F;  2EQI A;  3PTA A;  1N8R U;  1ZA2 B;  4C0Z A;  3A98 A;  3L1A A;  2HKQ B;  2VGM A;  1YJ9 A;  3M58 A;  2JXB A;  3QDR B;  4EMK B;  4IUU A;  1NLP C;  2DAQ A;  2DL8 A;  1AHJ B;  2DRK A;  3S3N A;  3S3M A;  2FPF A;  1UE9 A;  4XU3 A;  3QPH A;  5KYX A;  3SD4 A;  2B8A A;  1QW1 A;  2F5T X;  3LX7 A;  3OS0 A;  4J9I A;  4M7A B;  4M75 E;  1Q7Y C;  3UAT A;  5GAM d;  3EFO A;  3CME Q;  1YCY A;  5C0M A;  4KUI A;  2ZGW A;  3VRZ A;  2EQM A;  1YIJ Q;  3SDZ A;  4RG8 A;  2D0N A;  4E7K A;  2DJZ A;  5KYW B;  1MNE A;  1HK9 A;  3CC4 Q;  2HNI A;  2KBT A;  3FJP A;  4M7A F;  2B86 A;  1FXX A;  1UUE A;  2JTE A;  2P0Q A;  4LN2 A;  2V26 A;  1VQK A;  5LJ5 j;  2D0Q B;  4X9D A;  3OA6 A;  1NYG A;  3RKX A;  2MOX A;  2RJE A;  5AYF A;  2X4J A;  3UA6 A;  1XNI A;  2QXF A;  3VYG A;  3H0F A;  1NEB A;  1RI9 A;  4LXC A;  1M3B A;  1WX6 A;  1I07 A;  3I56 T;  1VQ8 T;  5FW9 A;  3JCM f;  4XU2 A;  3HRS A;  1OV3 A;  1N9R A;  3A8L B;  4CRI A;  3D7S B;  4X34 A;  3FLG A;  2KT1 A;  1TSF A;  3M0T A;  2L0A A;  3I55 T;  3QJ6 A;  1BKB A;  4AFS C;  2K9G A;  1XJW B;  5GAM j;  3JB9 I;  2E3I A;  1VQO T;  3JB9 J;  2X4X A;  4C5G A;  4M78 A;  4MML A;  4II1 A;  1D1B A;  1ZHI A;  5LJ5 e;  4WF2 A;  5FRN A;  2V1R A;  1D0Y A;  1MMN A;  1VIE A;  1YJW T;  2EW3 A;  1KD1 U;  2EWN A;  2K3Y A;  1NG2 A;  1D1A A;  5CQY A;  2A08 A;  2O88 A;  2RO0 A;  2DE0 X;  4A4H A;  2VXE A;  4PFP A;  5LJ3 d;  2OAW A;  4NOY A;  1EFN A;  3NMZ C;  3I9Q A;  4C8Q C;  3OYJ A;  3NTI A;  1HD3 A;  2HEQ A;  3MEW A;  1IB8 A;  2CP6 A;  1WGS A;  2RHX A;  4C0D C;  1RL2 A;  2VWF A;  4F7U G;  3VS3 A;  3OYN A;  3CCL T;  1WHL A;  2CGH A;  4M7D D;  3H0H A;  3LGL A;  3WVE B;  5EG2 A;  4IUR A;  5GAM e;  3G6E A;  2BTT A;  3G71 Q;  1AEY A;  1VQN T;  1B07 A;  4DOW A;  3SHW A;  1H8K A;  2HBP A;  1Z9Q A;  1CKB A;  4KBM B;  1UG1 A;  3RIR A;  4OVA A;  1PM3 A;  3EAE A;  3GPL A;  5CKB A;  1IRE B;  4M7A C;  3AHU A;  3HP9 A;  1VA7 A;  2M0Y A;  2DNU A;  2HDA A;  2R58 A;  4RTY A;  4XU0 A;  5FU6 C;  1VQ4 A;  2YWW A;  2EGE A;  2J06 A;  2DO3 A;  2DER A;  3MHX A;  3RMS A;  1EX4 A;  4KGV B;  2YRD A;  2PZ1 A;  2XG8 D;  2EGA A;  1K8A R;  4OP0 A;  1C0M A;  3A8G B;  5LJ3 j;  2E65 A;  3OYY A;  1V76 A;  2O9S A;  2LQN A;  2K3X A;  3M53 A;  4X9C A;  1KHI A;  2JZ2 A;  4YTL A;  1M2V B;  2E6Z A;  5D7U A;  1IGQ A;  4OMN A;  1VQ7 Q;  2L5Q A;  1W2B P;  3PIP A;  1R0C B;  2QQ9 A;  4OMQ A;  2K2V A;  5LJ5 h;  4RCB A;  2M16 A;  1YIJ T;  1KQ1 A;  3GBQ A;  4PJO B;  3PT9 A;  3E9G A;  5EC7 A;  3G1J A;  2QDY B;  3OYI A;  3DB4 A;  5GAN g;  1HJD A;  2AZV A;  2KAF A;  4JZ4 A;  2CZ0 B;  3CC4 T;  2K3B A;  3FEO A;  1KC8 U;  3RNJ A;  4AG1 C;  4C92 B;  4M7D E;  5GAN 6;  2EKO A;  1G5V A;  1N8R R;  1WA7 A;  2DTO A;  2YT6 A;  5CKD A;  4RTV A;  1BCO A;  2OJ2 A;  2DIQ A;  2G3R A;  4PJO F;  1PHT A;  2VXF A;  1WHK A;  1WYX A;  2DL7 A;  3NGP A;  3N5B B;  1WXB A;  1O9S A;  2RB6 A;  3M0P A;  3SWN B;  1UJ0 A;  1ABO A;  1M30 A;  5LJ3 e;  1AZE A;  3JCM d;  2DYI A;  3CCE T;  1VQ5 T;  2K4Y A;  1FMV A;  2LQ8 A;  1B7T A;  1U1T A;  5GAM h;  4FCY A;  4E6R A;  2XMF A;  2NUP B;  4M77 B;  3EFS A;  1NPR A;  1P92 A;  3L42 A;  5GMK j;  2RI3 A;  1QCN A;  1NJI U;  2GNC A;  3CBM A;  2RI2 A;  4QVC A;  1U5S A;  5HY6 A;  3G4S A;  2DPP B;  1SEM A;  3PE0 A;  3QZ5 B;  4XTU A;  2CSQ A;  2COW A;  3E2U A;  4BI8 B;  1DJ7 B;  1AWO A;  1GFC A;  2GCX A;  2FB7 A;  3FIF A;  3VUZ A;  1JEG A;  1FYN A;  2X4Y A;  3CCQ Q;  1S72 T;  2JUF A;  3QYH B;  5L8R E;  2P0P A;  4HCC A;  2M1H A;  4A53 A;  1WLP B;  2K79 A;  2RNA A;  2V8J A;  1CKA A;  4ME7 A;  1PRL C;  1BK2 A;  2CUD A;  1N9S A;  1B3Q A;  2ZPG B;  2IPO B;  1TXQ A;  4LUD A;  3UA7 A;  1EZZ B;  3GLX A;  4F7U E;  3M4Y A;  4JLI A;  4ZN3 A;  3V8L A;  3H9N A;  1Y57 A;  1OUL A;  3M5A A;  5GMK e;  2HCK A;  2JS0 A;  3A8O B;  1VUB A;  1NYF A;  4O5V A;  3G71 T;  1NPP A;  4X1V A;  2KSS A;  1KD1 R;  5J39 A;  1RAH B;  3TSZ A;  2VKN A;  2J05 A;  1QCF A;  2CKK A;  3I5R A;  4J9E A;  2A7Y A;  1QCO A;  1WJR A;  5CK9 A;  4QVZ A;  3TEE A;  3GF5 A;  1VYU A;  2DLP A;  5LJ3 h;  1V29 B;  3H6Z A;  3VS0 A;  3HRU A;  3A5Z B;  1K0X A;  2EYZ A;  2FPE A;  3SB2 A;  1WJQ A;  4LDU A;  4RTZ A;  1JJ2 A;  2ZPH B;  5IN1 A;  4WTO B;  1Q86 U;  3I35 A;  2KXD A;  2EQK A;  3C94 A;  1M2O A;  1T0H A;  2GTO A;  4E7I A;  2DZC A;  4KUL A;  3CCJ A;  1VQ7 T;  4XTX A;  1D09 B;  3U23 A;  5IAY A;  4M75 A;  1WIE A;  1VIF A;  3OYC A;  1JJ2 S;  2LNV A;  4HVW A;  1AOJ A;  3E9F A;  5D6Y A;  2PTK A;  2KYM A;  3GNG A;  3EH1 A;  3JB9 G;  2ED0 A;  4J9C A;  4J8O A;  1CSK A;  4JZ3 A;  3FC3 A;  2CZ1 B;  2KXC A;  1PSF A;  3GOX A;  1MV0 B;  3WXM B;  4FT4 A;  1VYV A;  2MF2 A;  5FWB A;  2XIC A;  1U1S A;  2X3X D;  2PVG B;  2VB6 A;  5DY9 A;  3F70 A;  5GAO q;  4IUV A;  1HSQ A;  1OU9 A;  3V7C A;  1T3L A;  2E64 A;  1VQ8 Q;  1UEC A;  2E70 A;  4E2F B;  3VS4 A;  3M55 A;  5CR2 A;  3JB9 H;  3ZEH A;  4CC7 A;  2A3L A;  4M4Z A;  4PJL A;  2F2V A;  4FW2 A;  1PWT A;  2MWO A;  3WVD B;  2RHI A;  2L3S A;  5KCH A;  5GMK h;  2ZPE B;  1M4Z A;  3VUB A;  2DET A;  2NLU A;  4C5H A;  4C0F A;  3NTK A;  1D3B A;  1KC8 R;  4LD9 K;  2LVM A;  1YHQ Q;  1M8M A;  2WSF E;  4EMH A;  3OYG A;  5LJ5 g;  5A2Q E;  1UGR B;  1OX8 A;  4BE0 A;  2DTH A;  4GLM A;  1ZSG A;  4Z8A A;  2HL3 A;  3MET A;  3C12 A;  1Y96 B;  2J6K A;  4R55 A;  1YJW Q;  2CZ6 B;  3REB B;  1VQL A;  1WXU A;  2DYB A;  4JJN K;  3LGF A;  3DLL A;  2F69 A;  4HKE A;  3MEU A;  3CQT A;  1T3S A;  4L5G A;  3M0S A;  1G2B A;  2W10 A;  5CKH A;  3QWY A;  1NM7 A;  4J6W A;  1XOV A;  4HVU A;  3EHR A;  2FZG B;  3V7S A;  2QQS A;  4LDY A;  1QVF A;  1NBE B;  2ROT A;  2JM9 A;  2CZ7 B;  2QGF B;  3IQL A;  1OU8 A;  2CSI A;  1UHF A;  3CXC A;  5I22 A;  2QTX A;  2QQR A;  2KDS A;  1LJO A;  4C8Q D;  1MV3 A;  2H3J A;  1NJI R;  3JB9 D;  3C95 A;  2DL3 A;  2BUD A;  5GAM g;  1ZSZ B;  1K8A C;  4ELZ C;  5KYY B;  2FEI A;  3L2W A;  1QVF S;  2CT3 A;  2EVR A;  3L2Q A;  1M90 U;  3TCJ A;  4E47 A;  5GAO l;  2LT1 A;  5GAN h;  5GAN 4;  4RG2 A;  1M5Q 1;  3CPW A;  2C0I A;  3CXC S;  3VS7 A;  1YIT Q;  4LDW A;  1H3H A;  4M75 B;  2MAM A;  1FMK A;  4LD6 A;  1OYX A;  4OML A;  3EH2 A;  1ZLM A;  1KHC A;  2GFA A;  8ATC B;  1SSF A;  3CPW S;  3ZFJ A;  3LH0 A;  2KK4 A;  4MDW A;  1MMA A;  1M1K U;  3VV0 A;  4FSS A;  1UGQ B;  2DEQ A;  2GQV A;  1J3T A;  3CC2 A;  5IHK A;  1GFD A;  3RER A;  4M7A D;  4C5E A;  1RUW A;  2A37 A;  1RAB B;  3J81 E;  2XID A;  2XHC A;  4LE9 A;  3OYF A;  1TU0 B;  1I8F A;  1JU5 C;  1RI0 A;  4RMO A;  1FWZ A;  1PSE A;  3CEY A;  3CC7 A;  1KG1 A;  4JS4 A;  1M3C A;  3LH5 A;  3ER0 A;  1ARK A;  2BE9 B;  4BI4 A;  2KI7 A;  2M02 A;  5KE3 A;  2RHY A;  2CRE A;  1UDL A;  4ATO A;  3CMA A;  3INZ A;  2M0O A;  3OBW A;  4A54 A;  4RTU A;  4C8Q E;  1D3B B;  3L2V A;  3V8K A;  4M7D A;  2XDP A;  2K57 A;  2KRM A;  3BY7 A;  2JOY A;  2ZPF B;  3I5S A;  1VQ4 T;  4AFU C;  2LX7 A;  4DEY A;  3OYK A;  5IT9 E;  3QBY A;  4N4I A;  1Q86 R;  3CD6 A;  5LJ3 g;  1WZO A;  3OYD A;  4KT0 E;  4WCI A;  3CCE Q;  1VQ5 Q;  2JS2 A;  3HPW A;  2QGG A;  4MMK A;  1QVG A;  3PNW C;  3M57 A;  3VYH B;  4IUQ A;  4PKC C;  2QTV A;  3OS5 A;  1K1Z A;  2L3P A;  1KQS A;  4ZNX A;  1ZUK A;  4KRT A;  1YJN Q;  1GCQ C;  1M8V A;  3CCJ Q;  4M7A E;  4FL6 A;  2QG9 B;  1QVG S;  4MZM A;  3H41 A;  4PJO G;  3EGX A;  3QWX X;  4Y91 A;  3OYL A;  3CCR A;  3VU3 C;  2LCS A;  1YHQ T;  4JJC A;  2DEU A;  2LNH B;  3VS1 A;  4C92 G;  1KQS S;  2ZZD A;  2HKN A;  2X4W A;  3FB9 A;  2ENM A;  2EJ9 A;  2DA9 A;  5HK3 A;  1R8O B;  5FU7 C;  3J80 E;  3CCU A;  2BIV A;  1BYM A;  2JVV A;  2XK0 A;  1ZQ1 A;  2EIF A;  3BE3 A;  1S72 Q;  1C6V X;  2LJ3 A;  2ZPB B;  2OTJ A;  5HK0 A;  1JRI A;  1BU1 A;  1E6G A;  2VYT A;  2JJ9 A;  1R77 A;  4JRQ A;  3QUI A;  3GIB A;  2FRY A;  3RES A;  1JO8 A;  1KFZ A;  4MDX A;  5HCK A;  1QQJ A;  3J7A F;  3A1P A;  5FWC A;  1RAA B;  2J7I A;  1D0Z A;  4RKU E;  1YN8 A;  1ZUU A;  2O4X A;  2YLB A;  1K9A A;  2QAZ A;  4BE2 A;  1BI1 A;  3JV3 A;  4M77 G;  2F1L A;  2CP5 A;  3MO8 A;  8AT1 B;  5I2S A;  2KT8 A;  3SEM A;  4AG2 C;  1K4U S;  3EFR A;  2FL7 A;  4F7U A;  1GL5 A;  1UGV A;  1AWJ A;  1MMG A;  2DX1 A;  5KYX B;  1LNX A;  1OQK A;  1YCS B;  1BCM A;  1RLP C;  4EMK C;  1OI1 A;  5IH2 A;  2W0Z A;  2CH4 W;  2RF0 A;  1IO6 A;  3EFO B;  4JRI A;  2DM1 A;  1YIT T;  1ABQ A;  5GAO p;  2DL5 A;  1K73 U;  3OW2 A;  3NTH A;  1UEB A;  2VUB A;  1KIK A;  2JTF A;  3NPF A;  4HCZ A;  2KRN A;  1UFF A;  3UDC A;  1HYO A;  3OSV A;  4PLL A;  2FO0 A;  2M9U A;  1VQP Q;  1X01 A;  2FG0 A;  1BB9 A;  2QEX A;  3OW2 S;  5GMK l;  2EGC A;  4JRK A;  4PLI A;  1VQM Q;  1KQ2 A;  1Q81 U;  2HQE A;  2DD5 A;  4HXJ A;  4DQ2 A;  1M90 R;  4PJO D;  4OGC A;  2F2X A;  2E41 A;  4QT7 A;  3I56 A;  1Y07 A;  2G6F X;  1X6O A;  3OMG A;  1U06 A;  1I1J A;  2EJG A;  2DBK A;  2QA4 A;  4E7L A;  1IXD A;  2VVK A;  2YXY A;  4RCC A;  4OB0 B;  1M1K R;  3I55 A;  4F04 B;  2HZY A;  2JMA A;  4M78 B;  3ME9 A;  1KC8 C;  2EQJ A;  1YBY A;  2DZ9 A;  3R6N A;  2XD0 A;  2HL5 C;  4C92 F;  3JAM E;  2DD4 A;  5CVI A;  3JCM P;  1K9M C;  3EG9 A;  4BY6 B;  2CP3 A;  1MHN A;  4HCB A;  2HQX A;  1YJ9 Q;  3GNF B;  4PNO A;  4M78 F;  1WHH A;  4QQ6 A;  1FX7 A;  1IZ6 A;  1OZ3 A;  3OS1 A;  1TOV A;  2WSC E;  2ZAE A;  2LQW A;  1QWF A;  4NL2 A;  1YJN T;  4QW2 A;  1OZ2 A;  3CCJ T;  2D9T A;  4JS5 A;  2LDM A;  3ZL7 C;  3PMT A;  4F16 A;  1V1C A;  2YRC A;  2FYK A;  3CMA Q;  4PJO E;  4EDU A;  2FRW A;  3G7Z A;  4GY5 A;  4M77 F;  5I21 A;  3RR6 A;  3LWH A;  4IKF A;  4HT9 A;  2PUK B;  1VQK Q;  3E19 A;  3MEV A;  3VRY A;  2EYX A;  4C92 E;  1WQ7 A;  1NJI C;  2K5L A;  7AT1 B;  1AVZ C;  3C0C A;  2LRQ A;  1UB4 A;  4J83 A;  3JRZ A;  1VQ9 A;  3LWI A;  1QKW A;  2RM4 A;  4MZT A;  1G3T A;  1OOT A;  5CO7 A;  1AD5 A;  2JN0 A;  2RK2 A;  2I0N A;  3A8H B;  3JCM V;  5KH6 A;  4BDY A;  2KQW A;  1MND A;  3MPU B;  3S3O A;  2EYQ A;  2FZK B;  2K6D A;  2GBQ A;  2HSP A;  2P84 A;  4OMO A;  1JQQ A;  3M0U A;  2GF7 A;  1BBZ A;  1R0B G;  3RMQ A;  1WQW A;  4ANJ A;  1RAD B;  4RTW A;  2PU9 B;  4QVD A;  4LUE A;  4JPB W;  2LZ6 B;  2E6N A;  5FRO A;  2H3E B;  2LJ1 A;  4J5Y A;  1N5Z A;  1ZUY A;  1WNL A;  1W1F A;  4J9B A;  1JJ2 P;  3CCU Q;  3CME A;  3SFM A;  2HBW A;  3VS6 A;  1WFW A;  1AWW A;  1VQL T;  3X24 B;  2OTJ Q;  3L2R A;  5AT1 B;  4FIB A;  1X27 A;  1RAE B;  4PJO C;  1VQP T;  3CCM A;  1GCP A;  4KH1 B;  2LCL A;  3CCV A;  1TH7 A;  2O01 E;  2EPD A;  4C92 C;  1PD1 A;  2K5I A;  4HT8 A;  2CT4 A;  1VQM T;  2MYS A;  3EGD A;  1YI2 A;  3JCM e;  4ELY C;  2FZC B;  1UTI A;  4PL6 A;  4JLG A;  3MP8 A;  1WHM A;  2I2L A;  4ZGD B;  3KXT A;  3M9Q A;  1RAI B;  4FU6 A;  1M9S A;  2DIG A;  1G3S A;  3SWN C;  3CBP A;  3G6E Q;  1K73 R;  4EIK A;  2RA2 A;  4HVV A;  1B34 A;  4M75 G;  2PQW A;  4J7F A;  3LYI A;  2QQB A;  5GJV B;  5KYU A;  5GAM f;  4V2S A;  3M54 A;  4OMP A;  4N0A C;  1X2K A;  4C8Q A;  4K11 A;  3CCS A;  2PNI A;  4M77 C;  2XU8 A;  2GGR A;  3UPU A;  5FRM A;  4E7S A;  1VQ4 Q;  1MGQ A;  4F17 A;  3CBO A;  2L89 A;  1Q81 R;  1Q82 U;  2P4T A;  4PFO A;  5D6W A;  2KE9 A;  2QEX Q;  1SF9 A;  2GFU A;  1YJ9 T;  1UGP B;  1TS9 A;  4L6V 5;  4JDS A;  1X75 C;  3JCM X;  2C06 A;  2ROL A;  3UF4 A;  3M0Q A;  4C0G A;  3OYB A;  2RQW A;  1TUC A;  2FPD A;  2K2M A;  1YNZ A;  2XDB A;  4B9X A;  2NYS A;  4M7A A;  2ABL A;  2K5F A;  2OI3 A;  1N6A A;  1Y7X A;  2QA4 Q;  3OBY A;  1ZBX A;  2CDT A;  2E1H A;  2EFI A;  4ZGJ B;  3CMA T;  4D6W A;  2AHJ B;  2VV5 A;  1G83 A;  2QYZ A;  1QVF P;  5GAN 8;  5KYW A;  1VQK T;  3H0I A;  2CP2 A;  1OPL A;  3BFM A;  2QK0 A;  2RJC A;  3G71 A;  3CXC P;  4OMF B;  4LDX A;  4NL3 A;  4A4F A;  4Y28 E;  2DJQ A;  2YLC A;  2VAS A;  1D1C A;  2JW4 A;  3JCM h;  3L2Z A;  3CD6 T;  3EG2 A;  1T0J A;  2BE7 D;  1G8X A;  2E5K A;  3EHQ A;  3CPW P;  4ZN1 A;  3OYH A;  3OQ5 A;  2FHD A;  3BW1 A;  4DEX A;  5LJ3 f;  1QKX A;  4KGZ B;  5GMK i;  1AT1 B;  1MMD A;  2JT4 A;  4FYY B;  3PMI A;  4EMG A;  3JCM Q;  4AFQ C;  2YUO A;  2LC4 A;  2O9V A;  2HD0 A;  2R5M A;  1SSH A;  3CCR T;  3JCM J;  4XTW A;  2BZY A;  4AFZ C;  2X9H A;  1G3Y A;  2KR3 A;  5KCO A;  3G4S Q;  1M90 C;  4QKU A;  4OF1 A;  3VKI A;  1WPY A;  4E7H A;  2R57 A;  4GLK A;  1G3W A;  1BI0 A;  1X43 A;  3CCU T;  1I5L A;  4J9H A;  2LT4 A;  1SHG A;  4PJJ A;  1UGS B;  2OTJ T;  2JNG A;  2OTL A;  4D8K A;  1LOJ A;  2ED1 A;  2RQV A;  4M75 F;  4C8Q B;  2LP5 A;  4Z89 A;  3UWN A;  4FYW B;  2NUZ A;  2OX7 A;  1M3A A;  4FSX A;  1N8R C;  2AK5 A;  4J6X A;  4C0D B;  4J9G A;  3OMC A;  2RK1 A;  1F1B B;  2MK5 A;  4RTT A;  2E5Q A;  4AT1 B;  2RPN A;  1H3Z A;  2CP7 A;  1SHF A;  2V8K A;  3FRN A;  1JXO A;  2F5K A;  2WAC A;  3THK A;  2V8I A;  2EQU A;  2JM8 A;  3G6E T;  4D8D A;  3ULR B;  2DFU A;  1Q7Y U;  3DKM A;  1Y0M A;  4CI0 C;  5IHN A;  4J7I A;  4NS5 A;  1E6H A;  4DBR A;  1TUD A;  3MJX A;  2KYB A;  4BDZ A;  4ZGE B;  1QVG P;  2V1Q A;  2AKL A;  5FU6 B;  4R56 A;  3JCM b;  3P8B B;  4XQ3 A;  2L3Q A;  3E1S A;  2NWM A;  1U3O A;  1S1N A;  3EGU A;  3X25 B;  1I5O B;  1KQS P;  3JCM c;  2EYW A;  2DVE A;  1N27 A;  4M7D G;  4IUT A;  2XI9 A;  4J9D A;  1VQ6 A;  3PGG A;  1TTH B;  5C6S A;  5I11 A;  4HA8 A;  3CCM Q;  3CCV Q;  1PD0 A;  1H64 1;  2QEX T;  4TVR A;  3UT1 A;  2Y4X A;  2KGT A;  2IIM A;  4GBQ A;  2HMA A;  3CCQ A;  4HCK A;  2JTM A;  1YI2 Q;  1WJS A;  3OYA A;  3VS2 A;  1PG5 B;  3RBB B;  3R6O A;  2LQK A;  3L2U A;  2RMO A;  1IHW A;  1FMW A;  3CPF A;  4FYV B;  1M2V A;  3QG1 A;  2JMC A;  2XKO C;  2AKK A;  5GAN 3;  3MEA A;  4RUG A;  1BIA A;  1RAC B;  5A0G A;  3RKW A;  2QA4 T;  5CCA A;  4UC4 A;  1KSW A;  2DBM A;  3FJ5 A;  4PJO A;  5J26 A;  3HFN A;  2DXT A;  2J6F A;  1QP3 A;  1Q82 R;  4M78 G;  3CCS Q;  1PNJ A;  4C92 A;  1ZSZ C;  4R0K A;  3M0R A;  4B6M A;  5GAN f;  1KJW A;  3REA B;  1QWE A;  1PCX A;  1KD1 C;  2L2P A;  4B9W A;  1HXD A;  3HKS A;  4IIM A;  2ESW A;  4M75 C;  2YSQ A;  3OY9 A;  3NHN A;  3PVQ A;  5D6X A;  3TQ7 P;  3SWN A;  5CAI A;  1WHJ A;  4KH0 B;  2RN8 A;  3OW2 P;  2RHU A;  2NUT A;  4L59 A;  2X3W D;  2RJF A;  3C4S A;  2DF6 A;  2DVJ A;  1I81 A;  4JJB A;  1I4K 1;  4N0A A;  2NUP A;  4JUV A;  4M77 A;  1GXI E;  1EIF A;  2XDD A;  2KRS A;  2KMT A;  1WI7 A;  1UJY A;  2E12 A;  2KNB B;  4XTZ A;  3MP1 A;  3QZ9 B;  2RH2 A;  3G4S T;  2ECZ A;  1AWX A;  5J3B A;  4ZTF A;  2RHZ A;  3EG3 A;  1VQL Q;  5GJW B;  2L8D A;  2CUB A;  4DBQ A;  1X69 A;  1RAG B;  1ZBJ A;  1K73 C;  1VQ9 T;  3HFO A;  4LDV A;  4M7D B;  1NEG A;  4C5I A;  1GBR A;  4O6J A;  1PKT A;  3T9N A;  2E4H A;  2AIR B;  2ZPI B;  1IHV A;  3JCM g;  1M1G A;  3LLR A;  2EAY A;  3URG A;  4Y92 A;  3TRE A;  1MUZ A;  4BI3 A;  5CQX A;  1Z9Z A;  3V7R A;  4M7D F;  5GAN 2;  1Q81 C;  1VQ8 A;  2RQU A;  2CP0 A;  4C92 D;  4JJD A;  2FVU A;  2M51 A;  5KYN A;  2KRO A;  4RTX A;  1JXM A;  1WHG A;  4DBH A;  3OYM A;  1ACM B;  3JCM W;  4M78 D;  4DBF A;  2MWP A;  2Y90 A;  5FLX E;  1Y71 A;  2DXU A;  1LCK A;  3EGX B;  1QVP A;  4LNP A;  4P5N A;  3A8M B;  4F14 A;  3CME T;  4AMC A;  2CH4 A;  1VQO A;  1YHQ A;  1PRM C;  4VUB A;  1VOM A;  2GQI A;  5CKF A;  2OTL Q;  4A4E A;  5M9O A;  4FM4 B;  2YUN A;  3BDU A;  2ZCF B;  2EJF A;  3CCM T;  3QJY A;  3CC2 Q;  3CCV T;  1IGU A;  2D6F A;  1YJW A;  4M77 D;  4BAC A;  2KEA A;  2YHT A;  1A0N B;  1W2B A;  1K9M U;  1BIB A;  4IIO A;  4J9F A;  2O2O A;  1YI2 T;  1LVK A;  1NZ9 A;  3JSC A;  3KFV A;  1TG0 A;  1SPK A;  2O31 A;  1Q7Y R;  4DA4 A;  2SRC A;  2O4X B;  1PC0 A;  1RAF B;  3HTR A;  2HQH A;  2SEM A;  3CC7 Q;  4XTY A;  2MMP A;  5HKC A;  1W2B S;  2IG0 A;  5GAO r;  2C0O A;  2NUT B;  2PUO B;  3RKY A;  1OEB A;  4OB2 B;  1O75 A;  2KY9 A;  3CCL A;  2BKD N;  3M4G A;  2YUP A;  4F7U B;  2DK3 A;  3H8Z A;  1YWP A;  4EPC A;  2RQT A;  1I0C A;  5GAO m;  3CCS T;  3QSU A;  1VQN A;  3HHT B;  2R5A A;  2ATC B;  2YDL A;  3HL8 A;  4M78 E;  2GTJ A;  3QDF A;  2QQA A;  2DIL A;  1QP2 A;  4F7U F;  5GAN d;  1YIT A;  1VQ6 Q;  1YWO A;  1K0S A;  3HSB A;  4ORZ A;  3CD6 Q;  3V8J A;  4XAX B;  4PJN A;  1SG5 A;  4OB1 B;  4OMM A;  4ZTJ A;  1TWB A;  4CC2 A;  1SKU B;  4XTV A;  2J6O A;  4A4K A;  4E7J A;  4QQG A;  1D0X A;  5IXB A;  1U8R A; 
#chains in the Genus database with same CATH homology
 2K5F A;  4M7D C;  1N6A A;  1Y7X A;  3V8K A;  2DO3 A;  4M7D A;  3OBY A;  4M77 E;  2XDP A;  1ZBX A;  2E1H A;  2EFI A;  3MHX A;  3RMS A;  4ZGJ B;  2K57 A;  2QI2 A;  4D6W A;  3CMA T;  2AHJ B;  2VV5 A;  1XQH A;  2XG8 D;  5GAN 8;  3BY7 A;  2JOY A;  2ZPF B;  1VQK T;  1VQ4 T;  5CIU A;  4OP0 A;  3A8G B;  1JB0 E;  3BFM A;  4JRP A;  5LJ3 j;  2E65 A;  2RJC A;  3OYK A;  5IT9 E;  3QBY A;  3OYY A;  4N4I A;  3CD6 A;  3M59 A;  5LJ3 g;  3G71 A;  4OMF B;  4LDX A;  3OYD A;  5KE2 A;  2K3X A;  3M53 A;  2HAX A;  4KT0 E;  4NL3 A;  4A4F A;  4X9C A;  1KHI A;  4Y28 E;  1M1F A;  3HPW A;  2KVQ G;  2YLC A;  4MMK A;  1YIJ A;  1QVG A;  1Y96 A;  2JZ2 A;  4YTL A;  2E6Z A;  5LJ5 f;  3PNW C;  3JCM h;  3M57 A;  3VYH B;  3L2Z A;  3CD6 T;  4IUQ A;  4PKC C;  2L5Q A;  4Q5W A;  5I2M A;  3OS5 A;  3PIP A;  2QQ9 A;  3CC4 A;  2K2V A;  1KQS A;  5LJ5 h;  4ZN1 A;  4RCB A;  2M16 A;  1YIJ T;  3OYH A;  1KQ1 A;  3OQ5 A;  4J6Y A;  2FHD A;  2RD1 A;  2Y4Y A;  1M8V A;  3BW1 A;  5GAN j;  3PT9 A;  4PJO B;  3E9G A;  4M7A E;  2DXB A;  2QDY B;  4FL6 A;  3OYI A;  3DB4 A;  5GAN g;  5LJ3 f;  1QVG S;  3HRT A;  4MZM A;  2X35 A;  2KAF A;  3CC4 T;  2CZ0 B;  3FEO A;  4PJO G;  5GMK i;  3PFS A;  3CCR A;  4C92 B;  4Y91 A;  3OYL A;  1KC8 U;  4M7D E;  3VU3 C;  5GAN 6;  2EKO A;  1YHQ T;  1G5V A;  4M78 C;  2DTO A;  2LCC A;  3PMI A;  3QXE B;  4EMG A;  4A4G A;  3JCM Q;  4C92 G;  1KQS S;  2LC4 A;  5CKD A;  2ZZD A;  2X4W A;  3FB9 A;  2HD0 A;  3P8H A;  2R5M A;  2EJ9 A;  2DIQ A;  2G3R A;  4PJO F;  4BUG A;  4BD3 A;  5HK3 A;  1Q86 C;  2VXF A;  1R8O B;  5FU7 C;  3CCR T;  4XTW A;  3J80 E;  2BIV A;  2DTI A;  3CCU A;  3JCM J;  1VQ4 A;  1BYM A;  2JVV A;  1NE8 A;  2XK0 A;  3N5B B;  1ZQ1 A;  2EIF A;  4BY6 C;  1G3Y A;  3CCE A;  1VQ5 A;  5KCO A;  1O9S A;  1M90 C;  3M56 A;  2RB6 A;  2PVO B;  4OF1 A;  1WPY A;  3VKI A;  4E7H A;  2ZPB B;  2OTJ A;  2R57 A;  5HK0 A;  3Q1J A;  1JRI A;  4GLK A;  3SWN B;  2DXC A;  1G3W A;  1BI0 A;  2VYT A;  5LJ3 e;  3CCU T;  3QII A;  3QO3 A;  3JCM d;  1I5L A;  2LT4 A;  4JRQ A;  1VQ5 T;  3CCE T;  2K4Y A;  3QUI A;  2LQ8 A;  3GIB A;  1UGS B;  3RES A;  1YJN A;  2OTJ T;  3DB3 A;  2JNG A;  3QHS A;  2OTL A;  4MDX A;  1LOJ A;  3ZBD A;  3J7A F;  4M75 F;  1U1T A;  5GAM h;  4C8Q B;  4RKU E;  2O4X A;  2YLB A;  3UWN A;  4M77 B;  5LL6 S;  2E10 A;  4C8Q G;  3EFS A;  1NPR A;  4FSX A;  1P92 A;  1N8R C;  4XK8 E;  2OTL T;  4BE2 A;  1BI1 A;  2CYZ B;  4BB7 A;  4J6X A;  3L42 A;  4C0D B;  5GMK j;  4M77 G;  2RI3 A;  3OMC A;  3MO8 A;  1BI2 A;  2RK1 A;  4N4G A;  5GAN e;  5I2S A;  1NJI U;  3EFR A;  3CC2 T;  5CKE A;  2E5Q A;  2FL7 A;  3CBM A;  2RI2 A;  4F7U A;  4QVC A;  1H3Z A;  5HY6 A;  1Q82 C;  1BI3 A;  3G4S A;  1LNX A;  3FDR A;  2DPP B;  1S72 A;  2V8K A;  3QZ5 B;  5DLO A;  3FRN A;  4XTU A;  4BI8 B;  1DJ7 B;  4EMK C;  1OI1 A;  2GCX A;  2FB7 A;  4EMK A;  3FIF A;  2F5K A;  2DKG A;  2WAC A;  3VUZ A;  4JRI A;  2V8I A;  1YIT T;  3KUF A;  4OGE A;  4FT2 A;  5GAO p;  1W4S A;  2EQU A;  2X4Y A;  3G6E T;  3QKJ A;  1K73 U;  1S72 T;  3OW2 A;  1Q7Y U;  2JUF A;  3DKM A;  3NTH A;  3QYH B;  1UEB A;  2VUB A;  4CI0 C;  2JTF A;  3RUX A;  2CS7 A;  5A0D A;  4HCZ A;  4J7I A;  4NS5 A;  5L8R E;  3CC7 T;  2P0P A;  3OB9 A;  5GAN 5;  2P0K A;  3UDC A;  2M1H A;  3X20 B;  4HCC A;  4A53 A;  5A0L A;  4BDZ A;  4ZGE B;  4DOV A;  3OSV A;  4PLL A;  5GAN 7;  2V8J A;  2M9U A;  5FU6 B;  4MZP A;  4R56 A;  3JCM b;  3P8B B;  4M7A G;  1X01 A;  4XQ3 A;  4ME7 A;  3E1S A;  2QEX A;  3OW2 S;  3X25 B;  1N9S A;  3JCM c;  4QQD A;  2DVE A;  4N4H A;  5GMK l;  1N27 A;  4M7D G;  4JRK A;  2IVW A;  2ZPG B;  4IUT A;  2XI9 A;  4PLI A;  2WSE E;  1VQ6 A;  3PGG A;  5C6S A;  4HA8 A;  1KQ2 A;  1Q81 U;  3GLX A;  4Z02 A;  4F7U E;  1H64 1;  3M4Y A;  4TVR A;  4JLI A;  3UT1 A;  4ZN3 A;  2QEX T;  3KBG A;  2HQE A;  2Y4X A;  3V8L A;  2DD5 A;  4DQ2 A;  3M5A A;  5GMK e;  3TU4 K;  4PJO D;  3BDL A;  4OGC A;  3A8O B;  1VQ6 T;  2E41 A;  3CCQ A;  1VUB A;  3I56 A;  2JTM A;  4O5V A;  3G71 T;  1Y07 A;  5DM7 R;  1GXI E;  1NPP A;  1WJS A;  2YRV A;  3OYA A;  2OAU A;  2KSS A;  2RI5 A;  1X6O A;  3MCA B;  3OMG A;  5J39 A;  4IUP A;  2EJG A;  3R6O A;  2LQK A;  3L2U A;  3X26 B;  3CCQ T;  3MP6 A;  3QYG B;  2QA4 A;  4E7L A;  3CPF A;  3X28 B;  2RJD A;  2CKK A;  1VQP A;  3QG1 A;  2XKO C;  2A7Y A;  1XTD A;  1WJR A;  4RCC A;  5CK9 A;  4KUD K;  5GMK m;  5GAN 3;  4OB0 B;  2VC8 A;  4QVZ A;  5DLQ E;  4BE1 A;  4M75 D;  3P8D A;  3GF5 A;  3TEE A;  3MEA A;  1BIA A;  5LJ3 h;  1V29 B;  3H6Z A;  3RKW A;  3HRU A;  5A0G A;  3I55 A;  3A5Z B;  2QA4 T;  5CCA A;  4UC4 A;  1VQM A;  2L3R A;  3OSS C;  4M78 B;  3GP8 A;  3ME9 A;  1KC8 C;  4PJO A;  5J26 A;  3HFN A;  3SB2 A;  2EQJ A;  1YBY A;  2DXT A;  1WJQ A;  1K8A U;  1QP3 A;  2DZ9 A;  4M78 G;  4LDU A;  2XD0 A;  3LW5 E;  4C92 F;  4C92 A;  5FU7 B;  3OYE A;  1W2B S;  1JJ2 A;  2ZPH B;  2DD4 A;  5CVI A;  3JAM E;  5GAO n;  3JCM P;  1K9M C;  5IN1 A;  4BY6 B;  1MHN A;  1Q86 U;  1VQ7 A;  4HCB A;  5GAN f;  2HQX A;  3GNF B;  2EQK A;  4PNO A;  4M78 F;  4QQ6 A;  3C94 A;  1B34 B;  1FX7 A;  1KD1 C;  1IZ6 A;  4B9W A;  1HXD A;  3HKS A;  4E7I A;  3DLM A;  3VJP A;  3OS2 A;  4XU1 A;  2DZC A;  4KUL A;  4M75 C;  5LJ5 d;  4XTX A;  3CCJ A;  5IAY A;  1VQ7 T;  2VGN A;  4M75 A;  3OY9 A;  1VIF A;  3OYC A;  1OZ3 A;  1JJ2 S;  2LX9 A;  5D6X A;  3SWN A;  2LNV A;  3OS1 A;  2LTO A;  3E9F A;  4OB3 B;  5D6Y A;  2PVD B;  2WSC E;  4NL2 A;  5CAI A;  3GNG A;  3NFC A;  1YJN T;  3ASK A;  4QW2 A;  3JB9 G;  4J8O A;  1OZ2 A;  2MI6 A;  3S6W A;  2D9T A;  3FC3 A;  3CCJ T;  4JS5 A;  2CZ1 B;  2RHU A;  1PSF A;  2LDM A;  3GOX A;  1M1K C;  4L59 A;  3PIO A;  1JBM A;  3WXM B;  2RJF A;  3C4S A;  4FT4 A;  3PMT A;  3O8V A;  2MF2 A;  1I81 A;  1I4K 1;  2FYK A;  2XIC A;  4N0A A;  4C8Q F;  1U1S A;  1N8R U;  3PTA A;  3JB9 F;  4PJO E;  4EDU A;  3G7Z A;  4C0Z A;  2PVG B;  4JUV A;  4GY5 A;  4M77 F;  4M77 A;  5DY9 A;  5I21 A;  1EIF A;  3F70 A;  2XDD A;  3LWH A;  3L1A A;  2PUK B;  4IKF A;  5GAO q;  4HT9 A;  3E19 A;  3MEV A;  4IUV A;  2VGM A;  2KMT A;  4C92 E;  1YJ9 A;  1WQ7 A;  3V7C A;  1NJI C;  2K5L A;  3M58 A;  3QDR B;  2E12 A;  2LRQ A;  4XTZ A;  1UB4 A;  3MP1 A;  2E64 A;  4J83 A;  3JRZ A;  3QZ9 B;  4IUU A;  2RH2 A;  4EMK B;  3G4S T;  1VQ9 A;  2DAQ A;  3LWI A;  1AHJ B;  2RM4 A;  3S3N A;  2E70 A;  3S3M A;  1YI2 A;  5J3B A;  4MZT A;  4ZTF A;  3M55 A;  1G3T A;  2RHZ A;  5CR2 A;  3JB9 H;  4XU3 A;  3ZEH A;  3QPH A;  5CO7 A;  2L8D A;  3SD4 A;  2A3L A;  2JN0 A;  2B8A A;  1QW1 A;  2F5T X;  2RK2 A;  3LX7 A;  3OS0 A;  1K73 C;  4M7A B;  4M75 E;  1VQ9 T;  1Q7Y C;  5GAM d;  2MWO A;  3A8H B;  3WVD B;  3JCM V;  2RHI A;  5KH6 A;  5KCH A;  1YCY A;  5GMK h;  3HFO A;  5C0M A;  4BDY A;  4LDV A;  4KUI A;  2ZGW A;  2KQW A;  2ZPE B;  1M4Z A;  4M7D B;  2EQM A;  3VUB A;  4C5I A;  3SDZ A;  3S3O A;  2EYQ A;  2NLU A;  4RG8 A;  4C5H A;  4E7K A;  4C0F A;  4O6J A;  2DJZ A;  3T9N A;  3NTK A;  1HK9 A;  2ZPI B;  1D3B A;  2HNI A;  3JCM g;  1M1G A;  4LD9 K;  3LLR A;  3FJP A;  2EAY A;  3URG A;  3TRE A;  2LVM A;  4M7A F;  1FXX A;  2GF7 A;  2P0Q A;  4BI3 A;  1VQK A;  5LJ5 j;  5CQX A;  2D0Q B;  3V7R A;  2WSF E;  3RMQ A;  4EMH A;  1WQW A;  5LJ5 g;  1UGR B;  4X9D A;  5A2Q E;  3OYG A;  3OA6 A;  4M7D F;  3RKX A;  5GAN 2;  4BE0 A;  2DTH A;  2PU9 B;  1Q81 C;  2RJE A;  3MET A;  1VQ8 A;  5AYF A;  4QVD A;  2X4J A;  3C12 A;  1Y96 B;  2E6N A;  1XNI A;  5FRO A;  4R55 A;  4C92 D;  2CZ6 B;  2QXF A;  3VYG A;  2FVU A;  1VQL A;  4J5Y A;  4JJN K;  3LGF A;  3DLL A;  2F69 A;  4HKE A;  3OYM A;  1WNL A;  3MEU A;  3JCM W;  3I56 T;  1VQ8 T;  4L5G A;  4M78 D;  3JCM f;  4XU2 A;  3CME A;  3SFM A;  3HRS A;  2MWP A;  1N9R A;  2Y90 A;  5FLX E;  1Y71 A;  5CKH A;  1VQL T;  3X24 B;  2DXU A;  3L2R A;  4J6W A;  1XOV A;  4FIB A;  3A8L B;  1QVP A;  4P5N A;  4CRI A;  4X34 A;  3A8M B;  3V7S A;  2QQS A;  4LDY A;  3CME T;  1QVF A;  3FLG A;  4PJO C;  1VQO A;  1VQP T;  3CCM A;  2LCL A;  1YHQ A;  3CCV A;  1TH7 A;  2CZ7 B;  4VUB A;  2O01 E;  5CKF A;  4A4E A;  4C92 C;  5M9O A;  4FM4 B;  3I55 T;  3QJ6 A;  3CXC A;  2K5I A;  4HT8 A;  1BKB A;  2QTX A;  2QQR A;  2KDS A;  1VQM T;  3BDU A;  2ZCF B;  5GAM j;  1LJO A;  2EJF A;  4C8Q D;  3JB9 I;  1VQO T;  2H3J A;  3CCM T;  3JCM e;  3QJY A;  4ELY C;  3JB9 J;  3JB9 D;  3C95 A;  5GAM g;  2BUD A;  2X4X A;  4PL6 A;  3CCV T;  4ELZ C;  1YJW A;  1K8A C;  2D6F A;  3L2W A;  1QVF S;  4M77 D;  4M78 A;  4C5G A;  4BAC A;  4JLG A;  4MML A;  4II1 A;  3MP8 A;  3L2Q A;  1M90 U;  2YHT A;  3TCJ A;  4E47 A;  2I2L A;  5GAO l;  1ZHI A;  2LT1 A;  4ZGD B;  5LJ5 e;  5GAN h;  3KXT A;  1W2B A;  1K9M U;  5GAN 4;  4WF2 A;  1BIB A;  3M9Q A;  4FU6 A;  1M9S A;  1YI2 T;  5FRN A;  2DIG A;  1M5Q 1;  1NZ9 A;  3JSC A;  4RG2 A;  3CPW A;  3CXC S;  1G3S A;  1VIE A;  3CBP A;  3SWN C;  1YJW T;  4LDW A;  1KD1 U;  2EWN A;  4M75 B;  2K3Y A;  2MAM A;  4DA4 A;  2O4X B;  2RA2 A;  4LD6 A;  1B34 A;  1OYX A;  5CQY A;  4M75 G;  2RO0 A;  4XTY A;  2PQW A;  2MMP A;  4A4H A;  5HKC A;  4J7F A;  3LYI A;  2GFA A;  1KHC A;  2QQB A;  2IG0 A;  2VXE A;  5GAM f;  5GAO r;  5LJ3 d;  3M54 A;  1SSF A;  1U8R A;  4V2S A;  4NOY A;  2PUO B;  3RKY A;  4N0A C;  4C8Q C;  3ZFJ A;  3OYJ A;  3CPW S;  3NTI A;  3LH0 A;  1O75 A;  4OB2 B;  4C8Q A;  2KY9 A;  3CCL A;  4XU0 A;  3CCS A;  2KK4 A;  4MDW A;  2BKD N;  4M77 C;  1M1K U;  3VV0 A;  3M4G A;  3MEW A;  2XU8 A;  4F7U B;  3UPU A;  2DK3 A;  3H8Z A;  5FRM A;  1UGQ B;  2DEQ A;  2GQV A;  1WGS A;  2RHX A;  1MGQ A;  4C0D C;  3CC2 A;  1RL2 A;  4EPC A;  4F7U G;  3RER A;  4M7A D;  4C5E A;  3CBO A;  2L89 A;  5GAO m;  3OYN A;  3CCL T;  2P4T A;  1Q82 U;  5D6W A;  3CCS T;  3QSU A;  1VQN A;  3HHT B;  2R5A A;  2CGH A;  4M7D D;  3J81 E;  3HL8 A;  4M78 E;  3LGL A;  2GFU A;  2QQA A;  2XID A;  2XHC A;  3WVE B;  1QP2 A;  5EG2 A;  1YJ9 T;  4F7U F;  5GAN d;  1YIT A;  1UGP B;  3OYF A;  4IUR A;  4L6V 5;  5GAM e;  3G6E A;  3HSB A;  4JDS A;  1X75 C;  3JCM X;  1I8F A;  3V8J A;  1RI0 A;  4XAX B;  1VQN T;  4RMO A;  2C06 A;  4DOW A;  1FWZ A;  1PSE A;  3CEY A;  3CC7 A;  4C0G A;  1KG1 A;  3OYB A;  2HBP A;  4OB1 B;  4JS4 A;  3ER0 A;  4ZTJ A;  4KBM B;  4BI4 A;  5KE3 A;  2RHY A;  4XTV A;  4OVA A;  3RIR A;  4ATO A;  2XDB A;  3EAE A;  3CMA A;  3INZ A;  3GPL A;  2M0O A;  3OBW A;  5CKB A;  1IRE B;  4M7A C;  4A4K A;  3HP9 A;  4A54 A;  4B9X A;  4QQG A;  4E7J A;  3AHU A;  4M7A A;  2R58 A;  4C8Q E;  1D3B B;  5FU6 C;  3L2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...