4C8QE

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
83
structure length
83
Chain Sequence
b'EILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
molecule tags Transcription
source organism Saccharomyces cerevisiae
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
total genus 14
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qE00
4QVCA 2RD1A 1D3BA 4M78E 4C92D 4DQ2A 5GAOp 3BW1A 4C92A 3L2ZA 4M7DD 4F7UF 4EMHA 3VU3C 1N9RA 4C8QA 5I21A 5LJ3j 3INZA 4M75B 4M77E 4NL3A 5LJ5j 4JUVA 3EFSA 4M75E 3JCMV 4HT9A 1HK9A 2EJ9A 1KQ1A 2RA2A 1MGQA 4PJOE 2FB7A 3BY7A 4J6YA 4M7AE 2HNIA 5GANd 3JB9H 2K57A 3JCMc 4WF2A 1I8FA 4M75A 5GAN2 1WQWA 2EWNA 3JB9F 2E10A 3PGGA 5GAMj 4M7DE 5GMKm 1Y96A 4MMLA 2E1HA 4C8QF 4QVDA 4M7DB 4XTUA 3RESA 4C92F 3HSBA 2Y90A 4M78F 5LJ3e 5GANh 4EMKB 3JCMP 4PJOD 1WQ7A 4M78G 4XU1A 4M77C 1JRIA 5LJ5h 1Y96B 3JCMd 3BFMA 3SWNC 4M7DA 4C92E 1JBMA 4N0AC 3QO3A 2FYKA 4M75F 4XQ3A 2DVEA 4XU0A 1M5Q1 3V8KA 3HFNA 4M7AG 2YLCA 4PJOG 3QSUA 2ZGWA 4EMKA 4JRKA 4J5YA 4M78B 2E64A 3V7RA 3SB2A 1HXDA 2RM4A 4F7UG 3HFOA 2VXFA 4M7AD 3AHUA 4M75D 2DEQA 2RB6A 1U1SA 4PNOA 5GAMf 5GAMg 3RERA 2JN0A 4M7AC 4PJOC 3FIFA 1B34A 1WNLA 4C8QG 1I81A 1TH7A 2E65A 5GAMd 5GAN4 1M8VA 1KQ2A 4M78A 1I4K1 4M78D 1N9SA 4PJOF 2CGHA 1H641 4M75C 4JLIA 5LJ3h 4C92C 3JCMb 5GANf 4A54A 3QHSA 5GMKl 3JB9I 1I5LA 4XTXA 5GMKh 5GAOl 4C8QC 3JCMe 2DXTA 4Y91A 1B34B 4C8QD 4EMGA 1BIAA 3JCMQ 3V8LA 2YHTA 3JCMg 3JB9D 4MMKA 3V7SA 5GAOr 3M4GA 2DKGA 3RKXA 3BDUA 5LJ5g 5GAOm 4M7DF 2EJGA 4A53A 3GIBA 4EMKC 4JRIA 4RCBA 5LJ5e 4V2SA 2DTOA 1LNXA 3SWNB 5GAMh 1YCYA 4N0AA 5GAN5 3JCMX 3QUIA 4XTWA 2VC8A 3RUXA 5LJ3d 2DTIA 4HT8A 2EAYA 5GAN6 3JCMJ 4M77B 2DZ9A 3V7CA 2DTHA 2VXEA 4X9CA 3SWNA 4F7UE 4XU2A 5GAOn 4F7UB 5GANg 3V8JA 3JB9J 2DXUA 2EJFA 5GMKe 4PJOA 5LJ5f 5GAOq 4J6XA 3L1AA 5GAN3 1X01A 4M77D 4J6WA 2DJZA 5LJ3g 5LJ3f 3RKYA 4M77A 4M78C 4RCCA 4M77G 3FJPA 3JB9G 3JCMf 4XU3A 4C8QE 4M77F 4M7AF 5CAIA 5GMKj 3JCMW 4F7UA 5GAN8 5GAN7 5LJ5d 4XTYA 4NOYA 3JCMh 5GANj 4PJOB 4M7DC 3EFRA 4HA8A 1BIBA 1LOJA 3FB9A 4M7AA 5GANe 4XTZA 1D3BB 4NL2A 5GMKi 4C92B 4XTVA 4M7DG 4X9DA 2DZCA 1U1TA 5DY9A 2YLBA 3RIRA 4M75G 3RKWA 2QTXA 4C8QB 1WPYA 4C92G 5GAMe 1LJOA 2I2LA 4M7AB 2E41A 4OP0A
chains in the Genus database with same CATH superfamily
4A63B 4C92D 1CSKA 4J9CA 4F7UF 5KYXA 4M77E 3UF4A 2M0OA 3VJPA 1EZZB 4L59A 4J6YA 5KYXB 5I2SA 2K57A 4WCIA 1VQKA 2LMJA 3CC4A 1WHKA 5GMKm 4MMLA 5HK0A 2E1HA 4M78F 2L8DA 5CKFA 4XAXB 4NS5A 2JM8A 3BFMA 5AYFA 2L3RA 3QO3A 3OBYA 2RHXA 3G71A 3CCLA 1I5OB 2FRYA 5IXFA 3AHUA 2DEQA 4TVRA 3RMSA 3X24B 1AT1B 1YJWA 1NYFA 2E65A 1X27A 1M1KR 5LJ3h 1XJWB 4HVWA 1BU1A 5KYWB 2KSSA 1SSHA 1VOMA 2DKGA 3M0QA 2F5KA 4LNPA 2XI9A 1M4ZA 2EVRA 3GOXA 1YHQQ 2VC8A 1WIEA 5GAN6 3EG2A 5CKEA 5HKCA 2XICA 1TXQA 4A4EA 4LDUA 1M1KU 5DLOA 3GLXA 4CC3A 2K79A 3OYYA 4M77A 1NPPA 1RADB 1QVGS 1QVGA 1RAGB 1JXMA 1QQJA 1YITA 4IIMA 1VQ6A 2DAQA 4Y28E 3GPLA 4C0DC 1OU8A 3PT9A 1YI2A 4PKCC 5FROA 1JQQA 2KYBA 4IUVA 1QVFA 2E41A 2VYTA 1T3LA 5A2QE 2RD1A 4C92A 4HXJA 2FZKB 4FL6A 2EBPA 1RLPC 5LJ3j 3INZA 2KNBB 3FEOA 2O9VA 4C5IA 3JB9H 2X4WA 1SRLA 3SHWA 2D0NA 2F5TX 4E7JA 4XTUA 5LJ3e 4PJLA 3JCMP 2F2XA 2RF0A 4O5VA 4CC4B 4OMMA 3V8KA 2NLUA 3QSUA 2E4HA 3DKMA 4F7UG 2JT4A 2E6NA 3M0TA 2HL3A 1PNJA 2VGMA 1GL5A 3LWIA 4IKFA 4M75C 3EGDB 4A54A 3VYGA 2DLPA 3P8BB 4ANJA 1H92A 3T9NA 4N4IA 3RKXA 3CC2A 3J81E 4RUGA 1VQLA 4A53A 1VYVA 3ER0A 4RTTA 1UDLA 2KRSA 4OMNA 1LNXA 1AEYA 3SWNB 2C06A 5L8RE 2XK0A 1Y7XA 3CD6T 2E5QA 4QKUA 1OPLA 5M9OA 4HCZA 2E12A 3KBGA 2KT8A 5LJ5f 4FYYB 1KC8R 3I35A 4RCCA 3FJPA 1YWPA 2EYWA 1OEBA 1AD5A 3PIOA 3TREA 1QVGP 1VQLT 1T0JA 2JXBA 1WPYA 1LJOA 3CPFA 4M7AB 3MHXA 2CKKA 1VQPA 2OTLQ 1FWZA 3THKA 1UEBA 2VV5A 4LDWA 4EMHA 3JCMV 4E47A 2KYMA 4ZGJB 2LJ0A 2NWMA 2K2VA 3NHNA 2VVKA 2AKKA 2ZPHB 1JO8A 4QVDA 2EGAA 2XD0A 2DMOA 2QEXQ 1S72A 2ZPFB 2WSCE 1M2VB 3MP6A 4M78G 2MWOA 1KD1U 3E19A 2FVUA 1V1CA 2YDLA 3OYNA 2AZSA 2MF2A 3CC4Q 2P0PA 1X69A 1QLYA 3UPUA 3HFOA 2VXFA 2KAFA 4PNOA 4C8QG 4BE2A 2DRMA 2YUPA 4PJOF 1V76A 4J9HA 1MV3A 3JCMb 3CCJA 1IO6A 4EMGA 3VV0A 4E7ZA 1PM3A 5FLXE 4KGZB 1IB8A 1U06A 1WZOA 3M59A 3TQ7P 4C0DB 4OMFB 3N5BB 1YCYA 3M58A 3MJXA 4N0AA 2M9UA 4IUPA 2AZVA 2K3XA 1QVFS 4P5NA 1D0YA 2CREA 2GF7A 3TSWA 3M0SA 3ME9A 2X4JA 5D6WA 5KYUB 1AWOA 2CH4W 4M77F 1BB9A 1X43A 3L2UA 4XTYA 4PJOB 2LVMA 1OI1A 5FU6C 2YWWA 4NL2A 4A4GA 3BDLA 2DZCA 2D6FA 2YLBA 2K3BA 2QTXA 2DBMA 4JS5A 3EFOA 1I07A 4QVCA 1ZUYA 2X4XA 4JZ3A 2H8HA 3QPHA 1KD1R 1SF9A 1D0XA 2FB7A 2RJDA 2RK1A 3SDZA 3CBOA 1KHIA 2DA9A 4PK4A 1Q81U 2ED1A 2EWNA 1YHQA 4MZMA 4M7DB 4EPCA 1OX9A 1TOVA 3H41A 1YJ9A 4QQ6A 1VQ4Q 3PE0A 4PJOD 1H8KA 4J9EA 3CPWP 3SWNC 5KCOA 1WI7A 4N0AC 2V8JA 3OYDA 2FZCB 1NM7A 1VA7A 2ATCB 1G3YA 2DL5A 1PSFA 1HXDA 4FW2A 1I1JA 4RG2A 2EW3A 1SG5A 2PTKA 3MKDA 3G6ET 3G1JA 1N8RR 2FZGB 4JLIA 3MEVA 5GMKl 1I5LA 4OB1B 3HHTB 2QTVA 3G4ST 1VQMA 2DPPB 1N27A 4MDXA 4M7DF 1X75C 3HL8A 3I5SA 2YRCA 3OBWA 5EG2A 3OY9A 4V2SA 4AG1C 4HVUA 5CKBA 4JDSA 3GP8A 1ABQA 1NBEB 4KULA 2AKLA 3JB9J 2RJCA 4J6WA 2KE9A 4CRIA 1YN8A 2KBTA 1QVPA 5GANj 3CEYA 1BIBA 3A8MB 2JS2A 1W2BP 2BTTA 4FYVB 1XQHA 4X9DA 5AT1B 3CCMT 4FCYA 5GJVB 3QYGB 5I21A 4BY6B 1G3SA 1ABOA 1AVZC 4B6MA 1KQSP 1YNZA 2RA2A 2JMAA 2ZPEB 3CBMA 2C0TA 2E6ZA 1QCFA 1WLPB 5DLQE 2EYZA 1GCQA 4M7DE 1Y96A 3LGLA 4LD6A 1QP2A 3LGFA 4JS4A 3DLLA 3GBQA 4C92F 4RTWA 1ZHIA 3A1PA 4BDYA 2PU9B 3G4SA 2GTOA 1UGQB 3CCMA 1RACB 3IQLA 1NLPC 1VQ8T 2RHZA 3CMAQ 4M78B 2VKNA 1KQSS 5CKDA 2RM4A 1M1GA 2DK3A 2D8HA 3OSSC 1B34A 2KXDA 5ECAA 4Z02A 1D1CA 2JTMA 1WA7A 1N9SA 1G5VA 2MK5A 5GANf 2HKNA 2QQ9A 3VYHB 2MWPA 2FHDA 2GQIA 1N8RU 3OYMA 4RTZA 3CCVT 1WFWA 2ABLA 4LUDA 1ZA2B 1YCSB 5GAOm 2CP3A 4BY6C 1UGSB 2DTOA 5GAN5 1MMDA 2RI3A 5LJ3d 2E3HA 1RI0A 2EAYA 4Q5WA 4M77B 1K73C 3QWYA 2MCNA 3V8JA 2DXUA 1VQ7A 4IUTA 1E6HA 1XNIA 2IIMA 2DX1A 1VYTA 1H3ZA 1Q7YU 5CO7A 2CZ0B 2RJEA 2RHUA 4XU3A 2LCLA 3EG9B 4F7UA 4MZPA 4J9BA 3UA6A 7AT1B 1VQ9A 3OB9A 2XIDA 3CCVA 3CCMQ 3S3OA 4AG2C 3CCUT 3Q1JA 3CCRA 4FSXA 1GCPA 2RNAA 2M51A 5D7UA 3M4YA 3QYHB 2ZPGB 3A5ZB 4BACA 1YITT 2KQWA 3UDCA 3OMCA 3I55A 5LJ5j 2HSPA 1HK9A 2DRKA 1RAHB 1E7OA 4M7AE 2X3XD 2ZPIB 4M75A 4ZN3A 2P0KA 5GAMj 3M56A 2K2MA 2RK2A 1R0CB 4DEYA 2RQTA 2QEXA 3TU4K 1FMVA 3RNJA 1G8XA 1BCMA 2A3LA 1B07A 4EMKA 4EDUA 2LNHB 2D8JA 3TEEA 2P84A 1K76A 1D1AA 4BI8B 1AZEA 1M90R 1B7TA 2A0FB 5I11A 4M4ZA 2RI2A 4RTXA 1YJWT 1CKBA 2Y4YA 4M78D 1BI2A 3H0HA 3R6OA 2V26A 4C8QC 2V1RA 3JCMe 4GY5A 4Y91A 2DERA 3CCLQ 4A4HA 4MDWA 5A0DA 5GAOr 1VQ9T 2PNIA 2DILA 2EJGA 4OGEA 1Q82U 1RLQC 2QEXT 2QQRA 1EIFA 4KH1B 3MCAB 3CMAA 1IGUA 2OTJQ 4HT8A 2LX9A 1OULA 1MMAA 4ZNXA 3VUBA 4A4KA 5GMKe 3JRZA 2JJ9A 5GAOq 3L1AA 2DFUA 2V1QA 3CCUQ 1PD1A 1BI3A 3PMIA 1KFZA 5L23A 4M7DC 3PMTA 1U5SA 1PD0A 1LOJA 3FB9A 4XTZA 5CR2A 2JNGA 2QI2A 4D6WA 4O6JA 5DY9A 1WHJA 4C92G 1VQ4A 2OX7A 2M0YA 2VWFA 1WQWA 2E5KA 3BW1A 1R0BG 2DO3A 4BI3A 2XMFA 2DYBA 4NL3A 1LPLA 3SFMA 5IHKA 1M90C 3BY7A 1WGSA 1ACMB 3JCMc 3HP9A 2HSEB 1KJWA 1IZ6A 1X2KA 1HSQA 1TTHB 4KH0B 1KC8U 2P0QA 2W10A 2CP7A 4E7KA 4ZGEB 1VQMT 2R5AA 3CCQA 4LDXA 4XU1A 3I9QA 2CT3A 5I2MA 3ULRB 2JOYA 4QQGA 4ELYC 2FYKA 2HCKA 2DVEA 4PJOG 2GQVA 2ZGWA 2HEQA 2RO0A 1UFFA 4C0FA 2DL7A 4E7SA 2PVOB 1Q82C 2MMPA 4R0KA 3REAB 2YUNA 2V8IA 2CSQA 1QVFP 2C0IA 1FXXA 1TWBA 1VQ8A 2MI6A 2X4YA 3LH0A 1Z9QA 3GIBA 1UHCA 4FT4A 1GFDA 4EMKC 3OS1A 1BBZA 1D09B 3GNGA 3WVEB 3CD6Q 2K9GA 2LQ8A 1YITQ 3QUIA 1WHLA 3CCEQ 4PJMA 2ZAEA 1Y71A 4E7LA 1WXUA 3CMEA 2ENMA 1YWOA 3EG9A 4F7UB 1AZGB 1IHVA 1WHGA 4J6XA 3E2UA 1X01A 2BZYA 3A8LB 2CSIA 1ZSZC 4ME7A 3EFRA 4PLLA 2LJ1A 4F17A 5KYNA 4AFUC 1VQOT 1W4SA 4KUIA 1XTDA 2EQUA 2CDTA 5CVIA 2BZXA 3M54A 2L89A 3PTAA 1NG2A 1ZBXA 1Y07A 3L2ZA 2C0OA 3JSCA 1R77A 4J7FA 3ZBDA 1FMKA 4M75B 2WACA 3HRSA 2QGGA 1K4US 1SEMA 2EIFA 2IVWA 3CC7A 1Y57A 3MEAA 3OYEA 2X35A 1ZA1B 3PGGA 1M90U 1VQ5Q 2LNVA 3VS0A 1RUWA 2FO0A 5KCHA 4L5GA 2EQIA 4CC2A 4EMKB 3NTIA 1ZLMA 3CC4T 1AOJA 2M1HA 4OVAA 5FU6B 4PFZA 4D8DA 4JRQA 2LC4A 3X25B 2H3JA 1MMGA 3OQ5A 5FRMA 1U1SA 1JXOA 2EYXA 2OJ2A 3L2QA 1GBRA 1S1NA 1MNEA 2DIQA 1D0ZA 2DF6A 2L0AA 1BIAA 1C6VX 1NPRA 3OYGA 3EGXB 2JVVA 1U3OA 3FRNA 2HBPA 2X3WD 3KXTA 2O4XB 5EC7A 6AT1B 1VQOA 2W0ZA 2K5LA 2OTLT 2GNCA 3NTKA 5J26A 3META 5CQXA 2NYSA 1VQNQ 4XTWA 2YXYA 3MP1A 2NUTA 3C0CA 2DD4A 4RKUE 4F7UE 1YHQT 1VQKT 1UJ0A 4PLIA 2FEIA 5GJWB 1K9MR 2J6OA 5LJ3g 4HCKA 1UG1A 1YJNA 3WVDB 4M78C 1RI9A 3PNWC 2R58A 3E9GA 4HA8A 4E7HA 3F70A 1U1TA 3RKWA 3OW2P 2OTJA 3M55A 4EIKA 4JPBW 1UTIA 1AHJB 1D3BA 4DQ2A 1YIJQ 4LD9K 4M75E 4ATOA 1M2OA 4OGCA 2YRDA 2HNIA 2O31A 2RQUA 2PUKB 1JJ2P 1W1FA 2P4TA 1UGVA 2PZ1A 2QQBA 2CZ7B 3TVTA 3UWNA 1TSFA 3CMET 3UT1A 1M2VA 1SHFA 4J5YA 4DBRA 3OS2A 2LQWA 2F1LA 2LJ3A 3M57A 3E1SA 3CCSQ 5GAN4 4M78A 3CC2T 1H641 2COYA 3JB9I 5GAOl 4C5EA 1UGPB 2PVGB 3I55Q 3SD4A 1PRLC 1QP3A 4OMPA 5KYWA 3CXCA 3HKSA 4RTUA 1GRIA 2HL5C 3MP8A 4JZ4A 4JLGA 1K73R 1G3WA 3JCMJ 1X6BA 3V7CA 1GBQA 4LDYA 4XU2A 4DBFA 2F69A 3SEMA 4KUDK 4PJOA 1KSWA 4IURA 5GAN3 4PJJA 1TUDA 3X28B 4DOVA 4M7AF 2KI7A 3OS0A 1QCNA 2GFAA 1IGQA 2ZCFB 2KT1A 1M3CA 3OYFA 2VGNA 1QWEA 1PCXA 3NGPA 3FDRA 4M7DG 1RAIB 5GAMe 1C1AA 3HRTA 4KGXB 1RL2A 1PKTA 2EFIA 3NMZC 2DNUA 3VU3C 2HBWA 3VS5A 2QXFA 4JUVA 2RQVA 3NTHA 4BD3A 1S72Q 2JW4A 3RBBB 5GANd 2K7AA 5GAN2 2E10A 1VIEA 1BCOA 3QXEB 3L2VA 2K3YA 2JZ2A 2VB6A 2FG0A 1PG5B 3RESA 2LCSA 3CMEQ 2O9SA 4BB7A 2EQKA 1R8OB 3ZL7C 1O75A 4M75F 2A36A 2LCCA 4KBMB 1H3HA 3PFSA 3KUFA 3A98A 2EYQA 3SB2A 5HY6A 3CCJT 4HVVA 4PJOC 1K8AC 2CUDA 2JN0A 3G4SQ 3EGXA 2YSQA 1KQ2A 4N4HA 5A0LA 1UGRB 2XHCA 4BE1A 2KY9A 3MEWA 2QAZA 2DL8A 2MOXA 2P4RA 4IIOA 5CKHA 2PVDB 2YHTA 3G6EQ 3FJ5A 2L3SA 3VKIA 1T3SA 3X20B 2CH4A 1YIJT 3DB3A 4GLMA 4RCBA 5DM7R 3QDRB 2HZYA 2K5FA 2I0NA 3RUXA 2CS7A 3CCQQ 3M0PA 1GXIE 1Q86U 3C4SA 3MO8A 3L2RA 2ESWA 2RQWA 2FL7A 4OMLA 3J7AF 2DJZA 3RKYA 3MEUA 3JB9G 2AT1B 2NUPB 3EAEA 2RMOA 1KC8C 1WJSA 4NOYA 1VQKQ 2DXCA 4M7AA 2YT6A 3TCJA 3S3NA 2LZ6B 2JTFA 3O8VA 2BE7D 3OYJA 2OAWA 3CCRT 1MUZA 3JV3A 1N9RA 1OYXA 3CCST 2QK0A 4RMOA 3I5RA 4L6V5 1XOVA 1K8AR 1C0MA 2FPFA 1KHCA 2L3QA 4J9IA 1SRMA 1W70A 4FIBA 4C8QF 2K6DA 3I56Q 1M9SA 3RDVA 4F04B 2BZ8A 4LE9A 4DBHA 5IXBA 1T0HA 5C0MA 1YIJA 3M53A 1M5Q1 3CCJQ 1AWWA 2KROA 4ELZC 2HQHA 1ZQ1A 2QA4A 3QDFA 2J7IA 2RH2A 3M5AA 1Q95G 1Q82R 3CCSA 3VS6A 4FYXB 5GAMf 2G3RA 4HKEA 3FIFA 3REBB 4C5GA 4CI0C 5GAMd 1YJNT 4BDZA 4OB3B 2D1XA 5J39A 1VQLQ 2DL4A 1LVKA 4Y92A 3JB9D 2X9HA 1OZ2A 3BDUA 1WHHA 3ZEHA 2YUOA 3NPFA 5FWBA 3OYIA 1S72T 3TSZA 4ZGDB 2DTIA 3D7SB 2J6FA 2PQWA 2YUQA 2DTHA 1ZUUA 3S3MA 5FRNA 4C0GA 2EKOA 2XDBA 3I56T 3CD6A 1WJQA 4C8QE 1AWXA 5GAN8 3CCEA 2F2WA 2M16A 3OW2A 5D6YA 9ATCB 4WTOB 3EFOB 2DE0X 2RQRA 4DBQA 1KIKA 3WXMB 5CIUA 4C92B 3O5ZA 2EPDA 4OB0B 4R55A 1ZBJA 3QIIA 3URGA 4OP0A 1KD1C 1NJIU 1BI0A 2JMCA 2ZZDA 2EYYA 3EGUA 4C8QA 1JJ2A 3CXCS 2LDMA 2KVQG 2KRNA 2LT1A 2QA4T 3L2WA 2VASA 1MGQA 4PJOE 1FX7A 2CP2A 4DOWA 2MYSA 3JB9F 1PRMC 5IH2A 2L2PA 1X6OA 2RPNA 4F14A 4MZTA 1HJDA 5FU7B 1PHTA 3JCMd 3CC7T 1QCOA 4PFPA 1ARKA 3HFNA 2HQEA 2E64A 3CC7Q 3H0IA 1TS9A 4M7AD 1UECA 1B3QA 2KDSA 2V8KA 1E6GA 1WNLA 3H9NA 1TH7A 1KK7A 3M9QA 4Z89A 1GFCA 3A8GB 3LH5A 5KYYA 4FYWB 4C92C 2DEUA 2DETA 2NUZA 4XTXA 2DXTA 4C8QD 1Q86C 1N8RC 5C6SA 1X2QA 2CYZB 2FPDA 3EGDA 3VS1A 2QQSA 2LRQA 1BK2A 2K4YA 1QWFA 3LWHA 1W6XA 2AHJB 4JJDA 2XDDA 4IUQA 2ZPBB 1K9MC 2MAMA 2BUDA 5GAOn 1M30A 2EJFA 1JU5C 3OSVA 2BIVA 2EQMA 1LCKA 1V29B 2OTLA 1BYMA 1VQMQ 1VYUA 2RJFA 5GAN7 3G6EA 5LJ5d 3KFVA 2O01E 2COZA 3OA6A 2XU8A 2ECZA 2D9TA 4J7IA 2J05A 2QGFB 4M75G 1KG1A 1YJ9Q 1U8RA 3P8DA 1NYGA 1CKAA 4HCCA 4M7DD 2MIOA 4B9WA 1WDXA 4LN2A 1O9SA 2YRVA 2O88A 3M0UA 4N4GA 1VUBA 4E7IA 3E9FA 1YBYA 1M27C 3GF5A 5KE3A 5HK3A 2QG9B 2RHYA 3HSBA 1OU9A 2OAUA 2J6KA 4JJBA 1VQNA 2GCXA 1VQ8Q 5LJ5h 2HKQB 4RTVA 2XG8D 1MNDA 4XU0A 3VUZA 4M7AG 1K9MU 1ZSZA 2QYZA 3OS5A 4M75D 3BE3A 2RB6A 2KXCA 4HCBA 1I81A 2KRMA 2BKDN 2R57A 2SEMA 3OYAA 2WSFE 3CCUA 1TUGB 1B34B 2JM9A 1QMCA 1SHGA 1M1KC 3HPWA 3V7SA 1OV3A 1VQ7Q 1VQNT 2LQKA 1M1FA 4J9GA 2GTJA 1IREB 2HQXA 3PIPA 1K0SA 3JCMX 3HRUA 2EGEA 2K5IA 1WXBA 3X26B 2AIRB 4M77D 3EG1A 2EQJA 3CCQT 4OF1A 3JCMf 4QT7A 3OYBA 5GMKj 2HAXA 1VQ4T 3UA7A 2RN8A 2HMAA 2IPOB 4E6RA 1N5ZA 1EX4A 4AFQC 3VRYA 1NZ9A 2QDYB 2OI3A 1UB4A 4C8QB 2ED0A 3H6ZA 1MMNA 1JB0E 1P92A 4FT2A 5GAOp 1G2BA 2GBQA 2DD5A 5IHIA 1NJIC 2DL3A 1RABB 1IRXA 4ZN1A 3CCET 1VQ5T 3M0RA 2ROLA 4HT9A 2EJ9A 1KQ1A 2E3IA 4DEXA 1DJ7B 1RAAB 3H0FA 2KGTA 4AMCA 3VS2A 1VQ7T 1NLOC 1VQPQ 3CXCP 3G7ZA 2Y90A 8AT1B 2H3EB 2LTOA 3CMAT 8ATCB 1WQ7A 3VS3A 1JRIA 1BI1A 4M7DA 1KQSA 1W2BS 4Z8AA 2L5QA 1SPKA 4IUUA 2Z0WA 3RMQA 4JRKA 1OPKA 3C12A 1YJWQ 2JTEA 2CT4A 5HCKA 3RERA 1UUEA 3QJYA 2LP5A 1M8VA 1EFNA 3I56A 2CGHA 5IHNA 2PUOB 3CBPA 1OX8A 4UC4A 5CK9A 4PJNA 1FMWA 1QKXA 3V8LA 3JCMg 3EG3A 5IT9E 5LJ5g 3HTRA 1WYXA 1YJNQ 1G3TA 3A8OB 5CQYA 1NEBA 2VUBA 1I0CA 4J83A 3G71T 2ROTA 1ZUKA 4YTLA 3JAME 2DZ9A 2VXEA 3SWNA 1NJIR 1M3AA 3CPWA 2KR3A 4C5HA 1UE9A 2RHIA 3VRZA 2NUTB 3MPUB 3LYIA 1VQPT 3OYLA 1J3TA 4R56A 4AFSC 1UHFA 1VIFA 1QW1A 3OMGA 4ESRA 2B8AA 5GMKi 5J3BA 4XTVA 3CPWS 4ZTFA 2LQNA 3RIRA 4B9XA 3PVQA 4AFZC 2BE9B 4ORZA 3P8HA 3H8ZA 1RAEB 4DA4A 3A8HB 4BE0A 1M3BA 2HD0A 5D6XA 1FYNA 1IHWA 2CZ1B 3QZ5B 1Q81C 2DM1A 4E2FB 4WF2A 1I8FA 4J9DA 1WHMA 1VQ9Q 2AK5A 1VQ6T 3DLMA 3EH1A 1ZX6A 1PC0A 4RTYA 1VQ5A 4K11A 3LX7A 3EG0A 4BUGA 1ZSZB 1N6AA 4M77C 1PWTA 1Y96B 2A08A 1NE8A 4OMQA 4C0ZA 1NEGA 2D0QB 1VQOQ 4JJCA 2DVJA 1JEGA 5A0GA 1BKBA 4J9FA 1W2BA 1SSFA 2A28A 4JJNK 2CP6A 5GAMg 2DJQA 1YI2Q 4GLKA 1WX6A 4FU6A 2CP5A 3QHSA 3OYHA 5GMKh 1ZSGA 2M02A 1Z9ZA 2CP0A 4MMKA 2LX7A 5KE2A 1UJYA 1HYOA 1Q7YR 2A7YA 4F16A 4JRIA 5LJ5e 3RR6A 1JJ2S 2GFUA 2QDLA 4FSSA 5GAMh 1AWJA 2IG0A 2LT4A 1GCQC 4D8KA 2DXBA 3LW5E 2SRCA 4X1VA 2Y4XA 4X9CA 1K1ZA 5FW9A 2JUFA 4XK8E 1WXTA 3QZ9B 2DYIA 1K9AA 3OW2S 1Q81R 1TG0A 3JCMW 1A0NB 4LXCA 4FM4B 2KMTA 3FLGA 2JS0A 2XDPA 3CQTA 2FPEA 3QBYA 3EH2A 3CCRQ 1RAFB 5GANe 1TUCA 2WSEE 5KYUA 3CCVQ 1IXDA 4GBQA 2I2LA 1M8MA 3I55T 2X51A 4M78E 1SKUB 4OMOA 2XKOC 1D1BA 1YJ9T 2CUBA 2KK4A 3ASKA 2QQAA 1VQ6Q 4BI4A 1YP5A 2DIGA 3EFSA 3QKJA 1PKSA 2QASA 4KRTA 1Y0MA 2F2VA 4ZTJA 2E70A 4PFOA 3C94A 4AT1B 1X6GA 2COWA 1Q7YC 4FW1A 4PL6A 2DBKA 1WJRA 2O2OA 4C92E 1JBMA 5CCAA 4XQ3A 3FC3A 1YI2T 3PVLA 1K73U 3QWXX 1MHNA 1PSEA 2G6FX 2YLCA 5I22A 2HDAA 3V7RA 3EHRA 5KYYB 2KEAA 3UATA 3C95A 4M7AC 4QVZA 3OYKA 2GGRA 3U23A 2EGCA 1Q86R 4LUEA 4LDVA 3NFCA 5IN1A 2O4XA 3LLRA 3VS7A 4JRPA 1MV0B 4A4FA 3JCMQ 4X34A 4QW2A 2OTJT 2J06A 3J80E 3G71Q 3M4GA 4OB2B 4Z88A 1OQKA 2QA4Q 3GNFB 2CZ6B 3CCLT 4KGVB 3DB4A 3ZFJA 3VS4A 4QQDA 3R6NA 5GANg 4J8OA 3L42A 1OZ3A 4RG8A 5LJ3f 2L3PA 2R5MA 3S6WA 4M77G 1TU0B 2MPXC 3QJ6A 4CC7A 1F1BB 5CAIA 1QKWA 3AT1B 3JCMh 3EHQA 2RI5A 3QG1A 1K8AU 2B86A 3CC2Q 5IAYA 1YFNA 1HD3A 1D3BB 2A37A 4VUBA 5FU7C 2NUPA 5KH6A 1G83A 2EKHA 2FRWA 5FWCA 5GANh 1OOTA 1K0XA 4II1A 4KT0E 5LL6S 3OYCA 1I4K1
chains in the Genus database with same CATH topology
3P8DA 1D3BA 4C92D 4DQ2A 3QYGB 4HCCA 4M7DD 4F7UF 5I21A 4BY6B 4LD9K 4B9WA 1G3SA 4M77E 4M75E 2M0OA 1O9SA 2YRVA 3VJPA 4ATOA 2RA2A 4L59A 4OGCA 4J6YA 4N4GA 1VUBA 2HNIA 2ZPEB 3CBMA 5I2SA 4E7IA 2K57A 2PUKB 1YBYA 3E9FA 2E6ZA 1VQKA 5DLQE 3CC4A 3GF5A 5KE3A 5HK3A 2P4TA 4M7DE 5GMKm 1Y96A 4MMLA 5HK0A 2E1HA 3LGLA 4LD6A 1QP2A 3LGFA 4JS4A 3DLLA 2RHYA 4C92F 3HSBA 1ZHIA 2OAUA 1VQNA 2QQBA 2CZ7B 4M78F 2L8DA 5CKFA 4XAXB 4BDYA 2GCXA 2PU9B 4NS5A 3G4SA 3UWNA 5LJ5h 3BFMA 1UGQB 5AYFA 2L3RA 3CCMA 3QO3A 2XG8D 4XU0A 3VUZA 4M7AG 1VQ8T 3CMET 1K9MU 3UT1A 2RHZA 3OBYA 4J5YA 2RHXA 4M78B 1KQSS 3G71A 3OS2A 5CKDA 2RM4A 3CCLA 1M1GA 3OS5A 3AHUA 2DK3A 4M75D 2DEQA 3M57A 2RB6A 3E1SA 3OSSC 4TVRA 3RMSA 3X24B 1B34A 5GAN4 1YJWA 4HCBA 1I81A 2E65A 2BKDN 4Z02A 2JTMA 4M78A 2R57A 1N9SA 1G5VA 3CC2T 1H641 5GANf 2QQ9A 5LJ3h 3VYHB 3OYAA 2MWPA 3JB9I 2FHDA 2WSFE 1N8RU 5GAOl 3CCUA 3OYMA 1B34B 4C5EA 3CCVT 1M1KC 2KSSA 3HPWA 1UGPB 3V7SA 2PVGB 2DKGA 3SD4A 5GAOm 1VQNT 2LQKA 1QP3A 1M1FA 4BY6C 2F5KA 1UGSB 3CXCA 2DTOA 3HKSA 2XI9A 3MP8A 5GAN5 1IREB 1M4ZA 2HQXA 4JLGA 3PIPA 3GOXA 3JCMX 2RI3A 2VC8A 5LJ3d 1RI0A 1G3WA 2EAYA 5GAN6 4Q5WA 3JCMJ 3HRUA 5CKEA 4M77B 5HKCA 2XICA 3V7CA 2K5IA 4A4EA 1K73C 4LDYA 4LDUA 4XU2A 5DLOA 1M1KU 3GLXA 2F69A 3V8JA 1VQ7A 2DXUA 3X26B 4KUDK 4IUTA 4PJOA 1XNIA 3OYYA 4IURA 1H3ZA 5GAN3 1Q7YU 4M77D 2CZ0B 5CO7A 2EQJA 3X28B 3CCQT 4M77A 4DOVA 4OF1A 1NPPA 2RJEA 3JCMf 2RHUA 4XU3A 4M7AF 1QVGS 3OS0A 3OYBA 5GMKj 2GFAA 2LCLA 4F7UA 1QVGA 4MZPA 2ZCFB 1YITA 2HAXA 1VQ4T 1VQ9A 3OYFA 3OB9A 2VGNA 2DAQA 1VQ6A 2XIDA 4Y28E 3CCVA 3GPLA 3S3OA 3CCUT 3Q1JA 3CCRA 3FDRA 4C0DC 1NZ9A 2QDYB 4M7DG 4FSXA 3PT9A 1UB4A 4C8QB 1YI2A 3CC2A 3H6ZA 4PKCC 5GAMe 5FROA 3M4YA 3HRTA 4IUVA 3QYHB 1QVFA 2E41A 2VYTA 1JB0E 5A2QE 1P92A 2RD1A 4FT2A 5GAOp 2ZPGB 1RL2A 4C92A 2EFIA 4FL6A 3A5ZB 4BACA 2DD5A 3VU3C 1NJIC 5LJ3j 1YITT 2KQWA 3INZA 3OMCA 3UDCA 4ZN1A 3I55A 1VQ5T 3CCET 2QXFA 4JUVA 3FEOA 3NTHA 4BD3A 5LJ5j 4HT9A 1HK9A 2EJ9A 1KQ1A 4C5IA 4M7AE 5GANd 1DJ7B 3JB9H 2ZPIB 4M75A 5GAN2 4ZN3A 2X4WA 1VQ7T 2P0KA 2E10A 1VIEA 5GAMj 3M56A 3QXEB 3L2VA 2K3YA 2F5TX 2JZ2A 2RK2A 4E7JA 3G7ZA 4XTUA 3RESA 2Y90A 2LTOA 3CMAT 5LJ3e 3JCMP 4BB7A 1WQ7A 1JRIA 2QEXA 3TU4K 2OTJT 1BI1A 4M7DA 2EQKA 1W2BS 1KQSA 1R8OB 1O75A 4O5VA 4M75F 2L5QA 3V8KA 2NLUA 4IUUA 2A3LA 2LCCA 4KBMB 3QSUA 3PFSA 4EMKA 4EDUA 3KUFA 4JRKA 3RMQA 3C12A 3TEEA 3DKMA 2EYQA 3SB2A 5HY6A 4F7UG 3CCJT 2E6NA 4BI8B 4PJOC 3RERA 1K8AC 2JN0A 3QJYA 2RI2A 2VGMA 1M8VA 1KQ2A 1YJWT 3LWIA 2Y4YA 4M78D 4N4HA 5A0LA 1UGRB 3I56A 2CGHA 2XHCA 4M75C 4IKFA 4BE1A 1BI2A 2PUOB 3CBPA 3R6OA 2KY9A 3MEWA 3VYGA 4A54A 3P8BB 4C8QC 3JCMe 4GY5A 4Y91A 4UC4A 5CK9A 5CKHA 3V8LA 2PVDB 2YHTA 3JCMg 3T9NA 4N4IA 5IT9E 4A4HA 4MDWA 5A0DA 3RKXA 3VKIA 5LJ5g 3J81E 5GAOr 1VQ9T 2EJGA 3ER0A 3X20B 4A53A 3DB3A 4OGEA 1YIJT 1Q82U 1G3TA 4RCBA 5DM7R 1LNXA 3A8OB 3QDRB 2QQRA 1EIFA 2K5FA 3MCAB 5CQYA 3SWNB 2QEXT 3CMAA 2C06A 2VUBA 5L8RE 3RUXA 2CS7A 2XK0A 4HT8A 4J83A 3G71T 4YTLA 1Y7XA 3JAME 3CD6T 2DZ9A 2E5QA 2LX9A 2VXEA 3SWNA 1GXIE 3CPWA 1Q86U 4C5HA 3VUBA 4A4KA 5M9OA 3C4SA 3MO8A 5GMKe 2RHIA 3L2RA 3JRZA 2E12A 3KBGA 4HCZA 5LJ5f 5GAOq 3L1AA 2FL7A 3J7AF 2DJZA 3RKYA 4RCCA 3MEUA 3FJPA 1BI3A 3LYIA 3PMIA 3JB9G 1VQPT 3OYLA 3EAEA 1KC8C 1WJSA 4NOYA 4M7DC 2DXCA 4R56A 3PMTA 3PIOA 3TREA 1LOJA 3FB9A 1VIFA 1QW1A 4M7AA 3OMGA 4XTZA 3TCJA 2B8AA 2JNGA 5GMKi 5CR2A 3S3NA 1VQLT 2JTFA 2QI2A 4XTVA 5J3BA 3O8VA 4D6WA 3CPWS 4O6JA 5DY9A 3RIRA 4ZTFA 4B9XA 4C92G 3OYJA 1WPYA 3CCRT 1VQ4A 1LJOA 3CPFA 4M7AB 3MHXA 1WQWA 2CKKA 1VQPA 1FWZA 3BW1A 1UEBA 2VV5A 3P8HA 3H8ZA 2DO3A 4LDWA 4EMHA 1N9RA 1OYXA 4DA4A 3CCST 4BI3A 3A8HB 4BE0A 4NL3A 3JCMV 4E47A 4RMOA 3SFMA 4L6V5 2HD0A 1XOVA 5D6XA 4ZGJB 1M90C 3BY7A 2CZ1B 3QZ5B 1WGSA 1Q81C 2K2VA 3JCMc 1KHCA 1I8FA 3HP9A 4WF2A 2ZPHB 4FIBA 1IZ6A 1VQ6T 3DLMA 4C8QF 4QVDA 1KC8U 2P0QA 1VQ5A 2XD0A 1M9SA 3LX7A 1S72A 4E7KA 2ZPFB 4ZGEB 1VQMT 2WSCE 2R5AA 3CCQA 4BUGA 3MP6A 4M78G 1N6AA 2MWOA 4M77C 4XU1A 1Y96B 1KD1U 4LDXA 5I2MA 3E19A 2FVUA 2JOYA 5C0MA 1NE8A 4C0ZA 4QQGA 1YIJA 4ELYC 2FYKA 3M53A 3OYNA 2DVEA 1M5Q1 2D0QB 2MF2A 4PJOG 4ELZC 2GQVA 5A0GA 2ZGWA 1ZQ1A 1BKBA 2QA4A 2P0PA 2RH2A 1W2BA 3M5AA 3UPUA 1SSFA 2RO0A 3HFOA 2VXFA 4C0FA 3CCSA 4JJNK 2KAFA 4PNOA 5GAMf 2G3RA 2PVOB 4HKEA 5GAMg 3FIFA 4C8QG 4C5GA 4BE2A 4CI0C 5GAMd 4GLKA 2MMPA 1Q82C 1I4K1 4PJOF 4FU6A 1YJNT 4BDZA 4OB3B 3JCMb 3CCJA 3QHSA 3OYHA 2V8IA 5GMKh 5J39A 4EMGA 3VV0A 1FXXA 5FLXE 1VQ8A 3JB9D 4MMKA 5KE2A 2MI6A 2X4YA 1OZ2A 3BDUA 3LH0A 3ZEHA 3GIBA 2A7YA 4FT4A 3M59A 4C0DB 4JRIA 4EMKC 3OS1A 5LJ5e 1JJ2S 2GFUA 4OMFB 5GAMh 3GNGA 3N5BB 1YCYA 2IG0A 2LT4A 3M58A 4N0AA 3WVEB 3OYIA 2M9UA 4IUPA 2DXBA 1S72T 2LQ8A 4ZGDB 3QUIA 3LW5E 2DTIA 2K3XA 1QVFS 1Y71A 4E7LA 2PQWA 2Y4XA 4P5NA 3CMEA 2DTHA 4X9CA 2GF7A 3S3MA 2JUFA 4C0GA 5FRNA 4XK8E 4F7UB 3QZ9B 2EKOA 3ME9A 2X4JA 4J6XA 5D6WA 2XDBA 1X01A 3I56T 3OW2S 3CD6A 3A8LB 1WJQA 4C8QE 4M77F 3JCMW 5GAN8 3L2UA 3CCEA 4XTYA 4FM4B 4PJOB 2KMTA 2LVMA 1OI1A 2M16A 3EFRA 2XDPA 3FLGA 4ME7A 5D6YA 4PLLA 3OW2A 3QBYA 5GANe 5FU6C 1VQOT 2WSEE 3WXMB 4NL2A 5CIUA 1W4SA 4KUIA 4C92B 4A4GA 3BDLA 2DZCA 1XTDA 2D6FA 2YLBA 4OB0B 2EQUA 4R55A 2QTXA 4JS5A 5CVIA 3QIIA 2I2LA 3M54A 2L89A 3PTAA 3URGA 4OP0A 4QVCA 1ZBXA 3I55T 1Y07A 1KD1C 4M78E 1NJIU 1BI0A 2ZZDA 3JSCA 2X4XA 2XKOC 3L2ZA 4J7FA 4C8QA 1YJ9T 2KK4A 3ASKA 4M75B 3ZBDA 3CXCS 2LDMA 2KVQG 2QQAA 2WACA 2LT1A 4BI4A 3EFSA 2DIGA 3HRSA 3QPHA 3L2WA 2QA4T 1MGQA 4PJOE 2FB7A 2EIFA 2IVWA 2RJDA 1FX7A 2RK1A 3SDZA 4DOWA 3CBOA 3QKJA 3CC7A 1JJ2A 1KHIA 3MEAA 3OYEA 2X35A 2EWNA 1Q81U 1YHQA 3JB9F 4MZMA 3PGGA 1M90U 4ZTJA 2E70A 1X6OA 4M7DB 2LNVA 4EPCA 3C94A 5KCHA 1YJ9A 4L5GA 4QQ6A 4MZTA 4PJOD 4EMKB 5FU7B 3NTIA 1Q7YC 3CC4T 3JCMd 2M1HA 3SWNC 4PL6A 1WJRA 4C92E 5KCOA 1JBMA 4N0AC 5CCAA 2V8JA 3CC7T 4XQ3A 3FC3A 4OVAA 1YI2T 1K73U 3OYDA 5FU6B 1MHNA 1PSEA 3HFNA 2YLCA 4JRQA 2LC4A 2HQEA 3X25B 2H3JA 1G3YA 2E64A 3V7RA 1PSFA 1HXDA 4M7AD 3C95A 3OQ5A 2KDSA 4RG2A 1U1SA 5FRMA 4M7AC 2V8KA 4QVZA 1WNLA 3OYKA 3G6ET 1TH7A 3L2QA 3M9QA 2DIQA 1VQLA 3A8GB 4JLIA 4LDVA 3NFCA 4C92C 3MEVA 5GMKl 5IN1A 2O4XA 4XTXA 1I5LA 2DXTA 4OB1B 3LLRA 4JRPA 4C8QD 4A4FA 1BIAA 3JCMQ 1NPRA 4X34A 3HHTB 2JVVA 5C6SA 3OYGA 4QW2A 3G4ST 1Q86C 3J80E 1N8RC 1VQMA 2DPPB 1N27A 2HBPA 2CYZB 3FRNA 3M4GA 3KXTA 4M7DF 4MDXA 4OB2B 1X75C 3HL8A 2O4XB 2QQSA 3OBWA 5EG2A 3OY9A 1VQOA 4V2SA 2K5LA 2OTLT 3NTKA 2LRQA 3META 5CQXA 2K4YA 5J26A 3GNFB 5CKBA 2AHJB 3LWHA 2CZ6B 4JDSA 4XTWA 3CCLT 3GP8A 2XDDA 4IUQA 2ZPBB 3MP1A 3DB4A 1K9MC 2MAMA 3ZFJA 2BUDA 2DD4A 4KULA 4RKUE 4QQDA 4F7UE 1YHQT 5GAOn 1VQKT 5GANg 3JB9J 4PLIA 2EJFA 3OSVA 2RJCA 4J8OA 2BIVA 3L42A 2EQMA 1OZ3A 1V29B 4J6WA 4RG8A 5LJ3g 5LJ3f 3WVDB 2R5MA 4M78C 3S6WA 4M77G 1YJNA 3QJ6A 2OTLA 1BYMA 3PNWC 4CRIA 2R58A 5CAIA 2RJFA 5GAN7 3G6EA 5LJ5d 3E9GA 2O01E 1QVPA 2RI5A 3QG1A 3CEYA 3JCMh 5GANj 1K8AU 5IAYA 4HA8A 3OA6A 1BIBA 2XU8A 4E7HA 3A8MB 3F70A 2D9TA 1D3BB 4VUBA 5KH6A 5FU7C 4J7IA 1XQHA 4X9DA 1U1TA 5GANh 3RKWA 4M75G 2OTJA 4II1A 4KT0E 3M55A 3CCMT 1KG1A 5LL6S 1U8RA 3OYCA 1AHJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QVC A;  2RD1 A;  1D3B A;  4M78 E;  4C92 D;  4DQ2 A;  5GAO p;  3BW1 A;  4C92 A;  3L2Z A;  4M7D D;  4F7U F;  4EMH A;  3VU3 C;  1N9R A;  4C8Q A;  5I21 A;  5LJ3 j;  3INZ A;  4M75 B;  4M77 E;  4NL3 A;  5LJ5 j;  4JUV A;  3EFS A;  4M75 E;  3JCM V;  4HT9 A;  1HK9 A;  2EJ9 A;  1KQ1 A;  2RA2 A;  1MGQ A;  4PJO E;  2FB7 A;  3BY7 A;  4J6Y A;  4M7A E;  2HNI A;  5GAN d;  3JB9 H;  2K57 A;  3JCM c;  4WF2 A;  1I8F A;  4M75 A;  5GAN 2;  1WQW A;  2EWN A;  3JB9 F;  2E10 A;  3PGG A;  5GAM j;  4M7D E;  5GMK m;  1Y96 A;  4MML A;  2E1H A;  4C8Q F;  4QVD A;  4M7D B;  4XTU A;  3RES A;  4C92 F;  3HSB A;  2Y90 A;  4M78 F;  5LJ3 e;  5GAN h;  4EMK B;  3JCM P;  4PJO D;  1WQ7 A;  4M78 G;  4XU1 A;  4M77 C;  1JRI A;  5LJ5 h;  1Y96 B;  3JCM d;  3BFM A;  3SWN C;  4M7D A;  4C92 E;  1JBM A;  4N0A C;  3QO3 A;  2FYK A;  4M75 F;  4XQ3 A;  2DVE A;  4XU0 A;  1M5Q 1;  3V8K A;  3HFN A;  4M7A G;  2YLC A;  4PJO G;  3QSU A;  2ZGW A;  4EMK A;  4JRK A;  4J5Y A;  4M78 B;  2E64 A;  3V7R A;  3SB2 A;  1HXD A;  2RM4 A;  4F7U G;  3HFO A;  2VXF A;  4M7A D;  3AHU A;  4M75 D;  2DEQ A;  2RB6 A;  1U1S A;  4PNO A;  5GAM f;  5GAM g;  3RER A;  2JN0 A;  4M7A C;  4PJO C;  3FIF A;  1B34 A;  1WNL A;  4C8Q G;  1I81 A;  1TH7 A;  2E65 A;  5GAM d;  5GAN 4;  1M8V A;  1KQ2 A;  4M78 A;  1I4K 1;  4M78 D;  1N9S A;  4PJO F;  2CGH A;  1H64 1;  4M75 C;  4JLI A;  5LJ3 h;  4C92 C;  3JCM b;  5GAN f;  4A54 A;  3QHS A;  5GMK l;  3JB9 I;  1I5L A;  4XTX A;  5GMK h;  5GAO l;  4C8Q C;  3JCM e;  2DXT A;  4Y91 A;  1B34 B;  4C8Q D;  4EMG A;  1BIA A;  3JCM Q;  3V8L A;  2YHT A;  3JCM g;  3JB9 D;  4MMK A;  3V7S A;  5GAO r;  3M4G A;  2DKG A;  3RKX A;  3BDU A;  5LJ5 g;  5GAO m;  4M7D F;  2EJG A;  4A53 A;  3GIB A;  4EMK C;  4JRI A;  4RCB A;  5LJ5 e;  4V2S A;  2DTO A;  1LNX A;  3SWN B;  5GAM h;  1YCY A;  4N0A A;  5GAN 5;  3JCM X;  3QUI A;  4XTW A;  2VC8 A;  3RUX A;  5LJ3 d;  2DTI A;  4HT8 A;  2EAY A;  5GAN 6;  3JCM J;  4M77 B;  2DZ9 A;  3V7C A;  2DTH A;  2VXE A;  4X9C A;  3SWN A;  4F7U E;  4XU2 A;  5GAO n;  4F7U B;  5GAN g;  3V8J A;  3JB9 J;  2DXU A;  2EJF A;  5GMK e;  4PJO A;  5LJ5 f;  5GAO q;  4J6X A;  3L1A A;  5GAN 3;  1X01 A;  4M77 D;  4J6W A;  2DJZ A;  5LJ3 g;  5LJ3 f;  3RKY A;  4M77 A;  4M78 C;  4RCC A;  4M77 G;  3FJP A;  3JB9 G;  3JCM f;  4XU3 A;  4C8Q E;  4M77 F;  4M7A F;  5CAI A;  5GMK j;  3JCM W;  4F7U A;  5GAN 8;  5GAN 7;  5LJ5 d;  4XTY A;  4NOY A;  3JCM h;  5GAN j;  4PJO B;  4M7D C;  3EFR A;  4HA8 A;  1BIB A;  1LOJ A;  3FB9 A;  4M7A A;  5GAN e;  4XTZ A;  1D3B B;  4NL2 A;  5GMK i;  4C92 B;  4XTV A;  4M7D G;  4X9D A;  2DZC A;  1U1T A;  5DY9 A;  2YLB A;  3RIR A;  4M75 G;  3RKW A;  2QTX A;  4C8Q B;  1WPY A;  4C92 G;  5GAM e;  1LJO A;  2I2L A;  4M7A B;  2E41 A;  4OP0 A; 
#chains in the Genus database with same CATH topology
 4A63 B;  4C92 D;  1CSK A;  4J9C A;  4F7U F;  5KYX A;  4M77 E;  3UF4 A;  2M0O A;  3VJP A;  1EZZ B;  4L59 A;  4J6Y A;  5KYX B;  5I2S A;  2K57 A;  4WCI A;  1VQK A;  2LMJ A;  3CC4 A;  1WHK A;  5GMK m;  4MML A;  5HK0 A;  2E1H A;  4M78 F;  2L8D A;  5CKF A;  4XAX B;  4NS5 A;  2JM8 A;  3BFM A;  5AYF A;  2L3R A;  3QO3 A;  3OBY A;  2RHX A;  3G71 A;  3CCL A;  1I5O B;  2FRY A;  5IXF A;  3AHU A;  2DEQ A;  4TVR A;  3RMS A;  3X24 B;  1AT1 B;  1YJW A;  1NYF A;  2E65 A;  1X27 A;  1M1K R;  5LJ3 h;  1XJW B;  4HVW A;  1BU1 A;  5KYW B;  2KSS A;  1SSH A;  1VOM A;  2DKG A;  3M0Q A;  2F5K A;  4LNP A;  2XI9 A;  1M4Z A;  2EVR A;  3GOX A;  1YHQ Q;  2VC8 A;  1WIE A;  5GAN 6;  3EG2 A;  5CKE A;  5HKC A;  2XIC A;  1TXQ A;  4A4E A;  4LDU A;  1M1K U;  5DLO A;  3GLX A;  4CC3 A;  2K79 A;  3OYY A;  4M77 A;  1NPP A;  1RAD B;  1QVG S;  1QVG A;  1RAG B;  1JXM A;  1QQJ A;  1YIT A;  4IIM A;  1VQ6 A;  2DAQ A;  4Y28 E;  3GPL A;  4C0D C;  1OU8 A;  3PT9 A;  1YI2 A;  4PKC C;  5FRO A;  1JQQ A;  2KYB A;  4IUV A;  1QVF A;  2E41 A;  2VYT A;  1T3L A;  5A2Q E;  2RD1 A;  4C92 A;  4HXJ A;  2FZK B;  4FL6 A;  2EBP A;  1RLP C;  5LJ3 j;  3INZ A;  2KNB B;  3FEO A;  2O9V A;  4C5I A;  3JB9 H;  2X4W A;  1SRL A;  3SHW A;  2D0N A;  2F5T X;  4E7J A;  4XTU A;  5LJ3 e;  4PJL A;  3JCM P;  2F2X A;  2RF0 A;  4O5V A;  4CC4 B;  4OMM A;  3V8K A;  2NLU A;  3QSU A;  2E4H A;  3DKM A;  4F7U G;  2JT4 A;  2E6N A;  3M0T A;  2HL3 A;  1PNJ A;  2VGM A;  1GL5 A;  3LWI A;  4IKF A;  4M75 C;  3EGD B;  4A54 A;  3VYG A;  2DLP A;  3P8B B;  4ANJ A;  1H92 A;  3T9N A;  4N4I A;  3RKX A;  3CC2 A;  3J81 E;  4RUG A;  1VQL A;  4A53 A;  1VYV A;  3ER0 A;  4RTT A;  1UDL A;  2KRS A;  4OMN A;  1LNX A;  1AEY A;  3SWN B;  2C06 A;  5L8R E;  2XK0 A;  1Y7X A;  3CD6 T;  2E5Q A;  4QKU A;  1OPL A;  5M9O A;  4HCZ A;  2E12 A;  3KBG A;  2KT8 A;  5LJ5 f;  4FYY B;  1KC8 R;  3I35 A;  4RCC A;  3FJP A;  1YWP A;  2EYW A;  1OEB A;  1AD5 A;  3PIO A;  3TRE A;  1QVG P;  1VQL T;  1T0J A;  2JXB A;  1WPY A;  1LJO A;  3CPF A;  4M7A B;  3MHX A;  2CKK A;  1VQP A;  2OTL Q;  1FWZ A;  3THK A;  1UEB A;  2VV5 A;  4LDW A;  4EMH A;  3JCM V;  4E47 A;  2KYM A;  4ZGJ B;  2LJ0 A;  2NWM A;  2K2V A;  3NHN A;  2VVK A;  2AKK A;  2ZPH B;  1JO8 A;  4QVD A;  2EGA A;  2XD0 A;  2DMO A;  2QEX Q;  1S72 A;  2ZPF B;  2WSC E;  1M2V B;  3MP6 A;  4M78 G;  2MWO A;  1KD1 U;  3E19 A;  2FVU A;  1V1C A;  2YDL A;  3OYN A;  2AZS A;  2MF2 A;  3CC4 Q;  2P0P A;  1X69 A;  1QLY A;  3UPU A;  3HFO A;  2VXF A;  2KAF A;  4PNO A;  4C8Q G;  4BE2 A;  2DRM A;  2YUP A;  4PJO F;  1V76 A;  4J9H A;  1MV3 A;  3JCM b;  3CCJ A;  1IO6 A;  4EMG A;  3VV0 A;  4E7Z A;  1PM3 A;  5FLX E;  4KGZ B;  1IB8 A;  1U06 A;  1WZO A;  3M59 A;  3TQ7 P;  4C0D B;  4OMF B;  3N5B B;  1YCY A;  3M58 A;  3MJX A;  4N0A A;  2M9U A;  4IUP A;  2AZV A;  2K3X A;  1QVF S;  4P5N A;  1D0Y A;  2CRE A;  2GF7 A;  3TSW A;  3M0S A;  3ME9 A;  2X4J A;  5D6W A;  5KYU B;  1AWO A;  2CH4 W;  4M77 F;  1BB9 A;  1X43 A;  3L2U A;  4XTY A;  4PJO B;  2LVM A;  1OI1 A;  5FU6 C;  2YWW A;  4NL2 A;  4A4G A;  3BDL A;  2DZC A;  2D6F A;  2YLB A;  2K3B A;  2QTX A;  2DBM A;  4JS5 A;  3EFO A;  1I07 A;  4QVC A;  1ZUY A;  2X4X A;  4JZ3 A;  2H8H A;  3QPH A;  1KD1 R;  1SF9 A;  1D0X A;  2FB7 A;  2RJD A;  2RK1 A;  3SDZ A;  3CBO A;  1KHI A;  2DA9 A;  4PK4 A;  1Q81 U;  2ED1 A;  2EWN A;  1YHQ A;  4MZM A;  4M7D B;  4EPC A;  1OX9 A;  1TOV A;  3H41 A;  1YJ9 A;  4QQ6 A;  1VQ4 Q;  3PE0 A;  4PJO D;  1H8K A;  4J9E A;  3CPW P;  3SWN C;  5KCO A;  1WI7 A;  4N0A C;  2V8J A;  3OYD A;  2FZC B;  1NM7 A;  1VA7 A;  2ATC B;  1G3Y A;  2DL5 A;  1PSF A;  1HXD A;  4FW2 A;  1I1J A;  4RG2 A;  2EW3 A;  1SG5 A;  2PTK A;  3MKD A;  3G6E T;  3G1J A;  1N8R R;  2FZG B;  4JLI A;  3MEV A;  5GMK l;  1I5L A;  4OB1 B;  3HHT B;  2QTV A;  3G4S T;  1VQM A;  2DPP B;  1N27 A;  4MDX A;  4M7D F;  1X75 C;  3HL8 A;  3I5S A;  2YRC A;  3OBW A;  5EG2 A;  3OY9 A;  4V2S A;  4AG1 C;  4HVU A;  5CKB A;  4JDS A;  3GP8 A;  1ABQ A;  1NBE B;  4KUL A;  2AKL A;  3JB9 J;  2RJC A;  4J6W A;  2KE9 A;  4CRI A;  1YN8 A;  2KBT A;  1QVP A;  5GAN j;  3CEY A;  1BIB A;  3A8M B;  2JS2 A;  1W2B P;  2BTT A;  4FYV B;  1XQH A;  4X9D A;  5AT1 B;  3CCM T;  4FCY A;  5GJV B;  3QYG B;  5I21 A;  4BY6 B;  1G3S A;  1ABO A;  1AVZ C;  4B6M A;  1KQS P;  1YNZ A;  2RA2 A;  2JMA A;  2ZPE B;  3CBM A;  2C0T A;  2E6Z A;  1QCF A;  1WLP B;  5DLQ E;  2EYZ A;  1GCQ A;  4M7D E;  1Y96 A;  3LGL A;  4LD6 A;  1QP2 A;  3LGF A;  4JS4 A;  3DLL A;  3GBQ A;  4C92 F;  4RTW A;  1ZHI A;  3A1P A;  4BDY A;  2PU9 B;  3G4S A;  2GTO A;  1UGQ B;  3CCM A;  1RAC B;  3IQL A;  1NLP C;  1VQ8 T;  2RHZ A;  3CMA Q;  4M78 B;  2VKN A;  1KQS S;  5CKD A;  2RM4 A;  1M1G A;  2DK3 A;  2D8H A;  3OSS C;  1B34 A;  2KXD A;  5ECA A;  4Z02 A;  1D1C A;  2JTM A;  1WA7 A;  1N9S A;  1G5V A;  2MK5 A;  5GAN f;  2HKN A;  2QQ9 A;  3VYH B;  2MWP A;  2FHD A;  2GQI A;  1N8R U;  3OYM A;  4RTZ A;  3CCV T;  1WFW A;  2ABL A;  4LUD A;  1ZA2 B;  1YCS B;  5GAO m;  2CP3 A;  4BY6 C;  1UGS B;  2DTO A;  5GAN 5;  1MMD A;  2RI3 A;  5LJ3 d;  2E3H A;  1RI0 A;  2EAY A;  4Q5W A;  4M77 B;  1K73 C;  3QWY A;  2MCN A;  3V8J A;  2DXU A;  1VQ7 A;  4IUT A;  1E6H A;  1XNI A;  2IIM A;  2DX1 A;  1VYT A;  1H3Z A;  1Q7Y U;  5CO7 A;  2CZ0 B;  2RJE A;  2RHU A;  4XU3 A;  2LCL A;  3EG9 B;  4F7U A;  4MZP A;  4J9B A;  3UA6 A;  7AT1 B;  1VQ9 A;  3OB9 A;  2XID A;  3CCV A;  3CCM Q;  3S3O A;  4AG2 C;  3CCU T;  3Q1J A;  3CCR A;  4FSX A;  1GCP A;  2RNA A;  2M51 A;  5D7U A;  3M4Y A;  3QYH B;  2ZPG B;  3A5Z B;  4BAC A;  1YIT T;  2KQW A;  3UDC A;  3OMC A;  3I55 A;  5LJ5 j;  2HSP A;  1HK9 A;  2DRK A;  1RAH B;  1E7O A;  4M7A E;  2X3X D;  2ZPI B;  4M75 A;  4ZN3 A;  2P0K A;  5GAM j;  3M56 A;  2K2M A;  2RK2 A;  1R0C B;  4DEY A;  2RQT A;  2QEX A;  3TU4 K;  1FMV A;  3RNJ A;  1G8X A;  1BCM A;  2A3L A;  1B07 A;  4EMK A;  4EDU A;  2LNH B;  2D8J A;  3TEE A;  2P84 A;  1K76 A;  1D1A A;  4BI8 B;  1AZE A;  1M90 R;  1B7T A;  2A0F B;  5I11 A;  4M4Z A;  2RI2 A;  4RTX A;  1YJW T;  1CKB A;  2Y4Y A;  4M78 D;  1BI2 A;  3H0H A;  3R6O A;  2V26 A;  4C8Q C;  2V1R A;  3JCM e;  4GY5 A;  4Y91 A;  2DER A;  3CCL Q;  4A4H A;  4MDW A;  5A0D A;  5GAO r;  1VQ9 T;  2PNI A;  2DIL A;  2EJG A;  4OGE A;  1Q82 U;  1RLQ C;  2QEX T;  2QQR A;  1EIF A;  4KH1 B;  3MCA B;  3CMA A;  1IGU A;  2OTJ Q;  4HT8 A;  2LX9 A;  1OUL A;  1MMA A;  4ZNX A;  3VUB A;  4A4K A;  5GMK e;  3JRZ A;  2JJ9 A;  5GAO q;  3L1A A;  2DFU A;  2V1Q A;  3CCU Q;  1PD1 A;  1BI3 A;  3PMI A;  1KFZ A;  5L23 A;  4M7D C;  3PMT A;  1U5S A;  1PD0 A;  1LOJ A;  3FB9 A;  4XTZ A;  5CR2 A;  2JNG A;  2QI2 A;  4D6W A;  4O6J A;  5DY9 A;  1WHJ A;  4C92 G;  1VQ4 A;  2OX7 A;  2M0Y A;  2VWF A;  1WQW A;  2E5K A;  3BW1 A;  1R0B G;  2DO3 A;  4BI3 A;  2XMF A;  2DYB A;  4NL3 A;  1LPL A;  3SFM A;  5IHK A;  1M90 C;  3BY7 A;  1WGS A;  1ACM B;  3JCM c;  3HP9 A;  2HSE B;  1KJW A;  1IZ6 A;  1X2K A;  1HSQ A;  1TTH B;  4KH0 B;  1KC8 U;  2P0Q A;  2W10 A;  2CP7 A;  4E7K A;  4ZGE B;  1VQM T;  2R5A A;  3CCQ A;  4LDX A;  4XU1 A;  3I9Q A;  2CT3 A;  5I2M A;  3ULR B;  2JOY A;  4QQG A;  4ELY C;  2FYK A;  2HCK A;  2DVE A;  4PJO G;  2GQV A;  2ZGW A;  2HEQ A;  2RO0 A;  1UFF A;  4C0F A;  2DL7 A;  4E7S A;  2PVO B;  1Q82 C;  2MMP A;  4R0K A;  3REA B;  2YUN A;  2V8I A;  2CSQ A;  1QVF P;  2C0I A;  1FXX A;  1TWB A;  1VQ8 A;  2MI6 A;  2X4Y A;  3LH0 A;  1Z9Q A;  3GIB A;  1UHC A;  4FT4 A;  1GFD A;  4EMK C;  3OS1 A;  1BBZ A;  1D09 B;  3GNG A;  3WVE B;  3CD6 Q;  2K9G A;  2LQ8 A;  1YIT Q;  3QUI A;  1WHL A;  3CCE Q;  4PJM A;  2ZAE A;  1Y71 A;  4E7L A;  1WXU A;  3CME A;  2ENM A;  1YWO A;  3EG9 A;  4F7U B;  1AZG B;  1IHV A;  1WHG A;  4J6X A;  3E2U A;  1X01 A;  2BZY A;  3A8L B;  2CSI A;  1ZSZ C;  4ME7 A;  3EFR A;  4PLL A;  2LJ1 A;  4F17 A;  5KYN A;  4AFU C;  1VQO T;  1W4S A;  4KUI A;  1XTD A;  2EQU A;  2CDT A;  5CVI A;  2BZX A;  3M54 A;  2L89 A;  3PTA A;  1NG2 A;  1ZBX A;  1Y07 A;  3L2Z A;  2C0O A;  3JSC A;  1R77 A;  4J7F A;  3ZBD A;  1FMK A;  4M75 B;  2WAC A;  3HRS A;  2QGG A;  1K4U S;  1SEM A;  2EIF A;  2IVW A;  3CC7 A;  1Y57 A;  3MEA A;  3OYE A;  2X35 A;  1ZA1 B;  3PGG A;  1M90 U;  1VQ5 Q;  2LNV A;  3VS0 A;  1RUW A;  2FO0 A;  5KCH A;  4L5G A;  2EQI A;  4CC2 A;  4EMK B;  3NTI A;  1ZLM A;  3CC4 T;  1AOJ A;  2M1H A;  4OVA A;  5FU6 B;  4PFZ A;  4D8D A;  4JRQ A;  2LC4 A;  3X25 B;  2H3J A;  1MMG A;  3OQ5 A;  5FRM A;  1U1S A;  1JXO A;  2EYX A;  2OJ2 A;  3L2Q A;  1GBR A;  1S1N A;  1MNE A;  2DIQ A;  1D0Z A;  2DF6 A;  2L0A A;  1BIA A;  1C6V X;  1NPR A;  3OYG A;  3EGX B;  2JVV A;  1U3O A;  3FRN A;  2HBP A;  2X3W D;  3KXT A;  2O4X B;  5EC7 A;  6AT1 B;  1VQO A;  2W0Z A;  2K5L A;  2OTL T;  2GNC A;  3NTK A;  5J26 A;  3MET A;  5CQX A;  2NYS A;  1VQN Q;  4XTW A;  2YXY A;  3MP1 A;  2NUT A;  3C0C A;  2DD4 A;  4RKU E;  4F7U E;  1YHQ T;  1VQK T;  1UJ0 A;  4PLI A;  2FEI A;  5GJW B;  1K9M R;  2J6O A;  5LJ3 g;  4HCK A;  1UG1 A;  1YJN A;  3WVD B;  4M78 C;  1RI9 A;  3PNW C;  2R58 A;  3E9G A;  4HA8 A;  4E7H A;  3F70 A;  1U1T A;  3RKW A;  3OW2 P;  2OTJ A;  3M55 A;  4EIK A;  4JPB W;  1UTI A;  1AHJ B;  1D3B A;  4DQ2 A;  1YIJ Q;  4LD9 K;  4M75 E;  4ATO A;  1M2O A;  4OGC A;  2YRD A;  2HNI A;  2O31 A;  2RQU A;  2PUK B;  1JJ2 P;  1W1F A;  2P4T A;  1UGV A;  2PZ1 A;  2QQB A;  2CZ7 B;  3TVT A;  3UWN A;  1TSF A;  3CME T;  3UT1 A;  1M2V A;  1SHF A;  4J5Y A;  4DBR A;  3OS2 A;  2LQW A;  2F1L A;  2LJ3 A;  3M57 A;  3E1S A;  3CCS Q;  5GAN 4;  4M78 A;  3CC2 T;  1H64 1;  2COY A;  3JB9 I;  5GAO l;  4C5E A;  1UGP B;  2PVG B;  3I55 Q;  3SD4 A;  1PRL C;  1QP3 A;  4OMP A;  5KYW A;  3CXC A;  3HKS A;  4RTU A;  1GRI A;  2HL5 C;  3MP8 A;  4JZ4 A;  4JLG A;  1K73 R;  1G3W A;  3JCM J;  1X6B A;  3V7C A;  1GBQ A;  4LDY A;  4XU2 A;  4DBF A;  2F69 A;  3SEM A;  4KUD K;  4PJO A;  1KSW A;  4IUR A;  5GAN 3;  4PJJ A;  1TUD A;  3X28 B;  4DOV A;  4M7A F;  2KI7 A;  3OS0 A;  1QCN A;  2GFA A;  1IGQ A;  2ZCF B;  2KT1 A;  1M3C A;  3OYF A;  2VGN A;  1QWE A;  1PCX A;  3NGP A;  3FDR A;  4M7D G;  1RAI B;  5GAM e;  1C1A A;  3HRT A;  4KGX B;  1RL2 A;  1PKT A;  2EFI A;  3NMZ C;  2DNU A;  3VU3 C;  2HBW A;  3VS5 A;  2QXF A;  4JUV A;  2RQV A;  3NTH A;  4BD3 A;  1S72 Q;  2JW4 A;  3RBB B;  5GAN d;  2K7A A;  5GAN 2;  2E10 A;  1VIE A;  1BCO A;  3QXE B;  3L2V A;  2K3Y A;  2JZ2 A;  2VB6 A;  2FG0 A;  1PG5 B;  3RES A;  2LCS A;  3CME Q;  2O9S A;  4BB7 A;  2EQK A;  1R8O B;  3ZL7 C;  1O75 A;  4M75 F;  2A36 A;  2LCC A;  4KBM B;  1H3H A;  3PFS A;  3KUF A;  3A98 A;  2EYQ A;  3SB2 A;  5HY6 A;  3CCJ T;  4HVV A;  4PJO C;  1K8A C;  2CUD A;  2JN0 A;  3G4S Q;  3EGX A;  2YSQ A;  1KQ2 A;  4N4H A;  5A0L A;  1UGR B;  2XHC A;  4BE1 A;  2KY9 A;  3MEW A;  2QAZ A;  2DL8 A;  2MOX A;  2P4R A;  4IIO A;  5CKH A;  2PVD B;  2YHT A;  3G6E Q;  3FJ5 A;  2L3S A;  3VKI A;  1T3S A;  3X20 B;  2CH4 A;  1YIJ T;  3DB3 A;  4GLM A;  4RCB A;  5DM7 R;  3QDR B;  2HZY A;  2K5F A;  2I0N A;  3RUX A;  2CS7 A;  3CCQ Q;  3M0P A;  1GXI E;  1Q86 U;  3C4S A;  3MO8 A;  3L2R A;  2ESW A;  2RQW A;  2FL7 A;  4OML A;  3J7A F;  2DJZ A;  3RKY A;  3MEU A;  3JB9 G;  2AT1 B;  2NUP B;  3EAE A;  2RMO A;  1KC8 C;  1WJS A;  4NOY A;  1VQK Q;  2DXC A;  4M7A A;  2YT6 A;  3TCJ A;  3S3N A;  2LZ6 B;  2JTF A;  3O8V A;  2BE7 D;  3OYJ A;  2OAW A;  3CCR T;  1MUZ A;  3JV3 A;  1N9R A;  1OYX A;  3CCS T;  2QK0 A;  4RMO A;  3I5R A;  4L6V 5;  1XOV A;  1K8A R;  1C0M A;  2FPF A;  1KHC A;  2L3Q A;  4J9I A;  1SRM A;  1W70 A;  4FIB A;  4C8Q F;  2K6D A;  3I56 Q;  1M9S A;  3RDV A;  4F04 B;  2BZ8 A;  4LE9 A;  4DBH A;  5IXB A;  1T0H A;  5C0M A;  1YIJ A;  3M53 A;  1M5Q 1;  3CCJ Q;  1AWW A;  2KRO A;  4ELZ C;  2HQH A;  1ZQ1 A;  2QA4 A;  3QDF A;  2J7I A;  2RH2 A;  3M5A A;  1Q95 G;  1Q82 R;  3CCS A;  3VS6 A;  4FYX B;  5GAM f;  2G3R A;  4HKE A;  3FIF A;  3REB B;  4C5G A;  4CI0 C;  5GAM d;  1YJN T;  4BDZ A;  4OB3 B;  2D1X A;  5J39 A;  1VQL Q;  2DL4 A;  1LVK A;  4Y92 A;  3JB9 D;  2X9H A;  1OZ2 A;  3BDU A;  1WHH A;  3ZEH A;  2YUO A;  3NPF A;  5FWB A;  3OYI A;  1S72 T;  3TSZ A;  4ZGD B;  2DTI A;  3D7S B;  2J6F A;  2PQW A;  2YUQ A;  2DTH A;  1ZUU A;  3S3M A;  5FRN A;  4C0G A;  2EKO A;  2XDB A;  3I56 T;  3CD6 A;  1WJQ A;  4C8Q E;  1AWX A;  5GAN 8;  3CCE A;  2F2W A;  2M16 A;  3OW2 A;  5D6Y A;  9ATC B;  4WTO B;  3EFO B;  2DE0 X;  2RQR A;  4DBQ A;  1KIK A;  3WXM B;  5CIU A;  4C92 B;  3O5Z A;  2EPD A;  4OB0 B;  4R55 A;  1ZBJ A;  3QII A;  3URG A;  4OP0 A;  1KD1 C;  1NJI U;  1BI0 A;  2JMC A;  2ZZD A;  2EYY A;  3EGU A;  4C8Q A;  1JJ2 A;  3CXC S;  2LDM A;  2KVQ G;  2KRN A;  2LT1 A;  2QA4 T;  3L2W A;  2VAS A;  1MGQ A;  4PJO E;  1FX7 A;  2CP2 A;  4DOW A;  2MYS A;  3JB9 F;  1PRM C;  5IH2 A;  2L2P A;  1X6O A;  2RPN A;  4F14 A;  4MZT A;  1HJD A;  5FU7 B;  1PHT A;  3JCM d;  3CC7 T;  1QCO A;  4PFP A;  1ARK A;  3HFN A;  2HQE A;  2E64 A;  3CC7 Q;  3H0I A;  1TS9 A;  4M7A D;  1UEC A;  1B3Q A;  2KDS A;  2V8K A;  1E6G A;  1WNL A;  3H9N A;  1TH7 A;  1KK7 A;  3M9Q A;  4Z89 A;  1GFC A;  3A8G B;  3LH5 A;  5KYY A;  4FYW B;  4C92 C;  2DEU A;  2DET A;  2NUZ A;  4XTX A;  2DXT A;  4C8Q D;  1Q86 C;  1N8R C;  5C6S A;  1X2Q A;  2CYZ B;  2FPD A;  3EGD A;  3VS1 A;  2QQS A;  2LRQ A;  1BK2 A;  2K4Y A;  1QWF A;  3LWH A;  1W6X A;  2AHJ B;  4JJD A;  2XDD A;  4IUQ A;  2ZPB B;  1K9M C;  2MAM A;  2BUD A;  5GAO n;  1M30 A;  2EJF A;  1JU5 C;  3OSV A;  2BIV A;  2EQM A;  1LCK A;  1V29 B;  2OTL A;  1BYM A;  1VQM Q;  1VYU A;  2RJF A;  5GAN 7;  3G6E A;  5LJ5 d;  3KFV A;  2O01 E;  2COZ A;  3OA6 A;  2XU8 A;  2ECZ A;  2D9T A;  4J7I A;  2J05 A;  2QGF B;  4M75 G;  1KG1 A;  1YJ9 Q;  1U8R A;  3P8D A;  1NYG A;  1CKA A;  4HCC A;  4M7D D;  2MIO A;  4B9W A;  1WDX A;  4LN2 A;  1O9S A;  2YRV A;  2O88 A;  3M0U A;  4N4G A;  1VUB A;  4E7I A;  3E9F A;  1YBY A;  1M27 C;  3GF5 A;  5KE3 A;  5HK3 A;  2QG9 B;  2RHY A;  3HSB A;  1OU9 A;  2OAU A;  2J6K A;  4JJB A;  1VQN A;  2GCX A;  1VQ8 Q;  5LJ5 h;  2HKQ B;  4RTV A;  2XG8 D;  1MND A;  4XU0 A;  3VUZ A;  4M7A G;  1K9M U;  1ZSZ A;  2QYZ A;  3OS5 A;  4M75 D;  3BE3 A;  2RB6 A;  2KXC A;  4HCB A;  1I81 A;  2KRM A;  2BKD N;  2R57 A;  2SEM A;  3OYA A;  2WSF E;  3CCU A;  1TUG B;  1B34 B;  2JM9 A;  1QMC A;  1SHG A;  1M1K C;  3HPW A;  3V7S A;  1OV3 A;  1VQ7 Q;  1VQN T;  2LQK A;  1M1F A;  4J9G A;  2GTJ A;  1IRE B;  2HQX A;  3PIP A;  1K0S A;  3JCM X;  3HRU A;  2EGE A;  2K5I A;  1WXB A;  3X26 B;  2AIR B;  4M77 D;  3EG1 A;  2EQJ A;  3CCQ T;  4OF1 A;  3JCM f;  4QT7 A;  3OYB A;  5GMK j;  2HAX A;  1VQ4 T;  3UA7 A;  2RN8 A;  2HMA A;  2IPO B;  4E6R A;  1N5Z A;  1EX4 A;  4AFQ C;  3VRY A;  1NZ9 A;  2QDY B;  2OI3 A;  1UB4 A;  4C8Q B;  2ED0 A;  3H6Z A;  1MMN A;  1JB0 E;  1P92 A;  4FT2 A;  5GAO p;  1G2B A;  2GBQ A;  2DD5 A;  5IHI A;  1NJI C;  2DL3 A;  1RAB B;  1IRX A;  4ZN1 A;  3CCE T;  1VQ5 T;  3M0R A;  2ROL A;  4HT9 A;  2EJ9 A;  1KQ1 A;  2E3I A;  4DEX A;  1DJ7 B;  1RAA B;  3H0F A;  2KGT A;  4AMC A;  3VS2 A;  1VQ7 T;  1NLO C;  1VQP Q;  3CXC P;  3G7Z A;  2Y90 A;  8AT1 B;  2H3E B;  2LTO A;  3CMA T;  8ATC B;  1WQ7 A;  3VS3 A;  1JRI A;  1BI1 A;  4M7D A;  1KQS A;  1W2B S;  4Z8A A;  2L5Q A;  1SPK A;  4IUU A;  2Z0W A;  3RMQ A;  4JRK A;  1OPK A;  3C12 A;  1YJW Q;  2JTE A;  2CT4 A;  5HCK A;  3RER A;  1UUE A;  3QJY A;  2LP5 A;  1M8V A;  1EFN A;  3I56 A;  2CGH A;  5IHN A;  2PUO B;  3CBP A;  1OX8 A;  4UC4 A;  5CK9 A;  4PJN A;  1FMW A;  1QKX A;  3V8L A;  3JCM g;  3EG3 A;  5IT9 E;  5LJ5 g;  3HTR A;  1WYX A;  1YJN Q;  1G3T A;  3A8O B;  5CQY A;  1NEB A;  2VUB A;  1I0C A;  4J83 A;  3G71 T;  2ROT A;  1ZUK A;  4YTL A;  3JAM E;  2DZ9 A;  2VXE A;  3SWN A;  1NJI R;  1M3A A;  3CPW A;  2KR3 A;  4C5H A;  1UE9 A;  2RHI A;  3VRZ A;  2NUT B;  3MPU B;  3LYI A;  1VQP T;  3OYL A;  1J3T A;  4R56 A;  4AFS C;  1UHF A;  1VIF A;  1QW1 A;  3OMG A;  4ESR A;  2B8A A;  5GMK i;  5J3B A;  4XTV A;  3CPW S;  4ZTF A;  2LQN A;  3RIR A;  4B9X A;  3PVQ A;  4AFZ C;  2BE9 B;  4ORZ A;  3P8H A;  3H8Z A;  1RAE B;  4DA4 A;  3A8H B;  4BE0 A;  1M3B A;  2HD0 A;  5D6X A;  1FYN A;  1IHW A;  2CZ1 B;  3QZ5 B;  1Q81 C;  2DM1 A;  4E2F B;  4WF2 A;  1I8F A;  4J9D A;  1WHM A;  1VQ9 Q;  2AK5 A;  1VQ6 T;  3DLM A;  3EH1 A;  1ZX6 A;  1PC0 A;  4RTY A;  1VQ5 A;  4K11 A;  3LX7 A;  3EG0 A;  4BUG A;  1ZSZ B;  1N6A A;  4M77 C;  1PWT A;  1Y96 B;  2A08 A;  1NE8 A;  4OMQ A;  4C0Z A;  1NEG A;  2D0Q B;  1VQO Q;  4JJC A;  2DVJ A;  1JEG A;  5A0G A;  1BKB A;  4J9F A;  1W2B A;  1SSF A;  2A28 A;  4JJN K;  2CP6 A;  5GAM g;  2DJQ A;  1YI2 Q;  4GLK A;  1WX6 A;  4FU6 A;  2CP5 A;  3QHS A;  3OYH A;  5GMK h;  1ZSG A;  2M02 A;  1Z9Z A;  2CP0 A;  4MMK A;  2LX7 A;  5KE2 A;  1UJY A;  1HYO A;  1Q7Y R;  2A7Y A;  4F16 A;  4JRI A;  5LJ5 e;  3RR6 A;  1JJ2 S;  2GFU A;  2QDL A;  4FSS A;  5GAM h;  1AWJ A;  2IG0 A;  2LT4 A;  1GCQ C;  4D8K A;  2DXB A;  3LW5 E;  2SRC A;  4X1V A;  2Y4X A;  4X9C A;  1K1Z A;  5FW9 A;  2JUF A;  4XK8 E;  1WXT A;  3QZ9 B;  2DYI A;  1K9A A;  3OW2 S;  1Q81 R;  1TG0 A;  3JCM W;  1A0N B;  4LXC A;  4FM4 B;  2KMT A;  3FLG A;  2JS0 A;  2XDP A;  3CQT A;  2FPE A;  3QBY A;  3EH2 A;  3CCR Q;  1RAF B;  5GAN e;  1TUC A;  2WSE E;  5KYU A;  3CCV Q;  1IXD A;  4GBQ A;  2I2L A;  1M8M A;  3I55 T;  2X51 A;  4M78 E;  1SKU B;  4OMO A;  2XKO C;  1D1B A;  1YJ9 T;  2CUB A;  2KK4 A;  3ASK A;  2QQA A;  1VQ6 Q;  4BI4 A;  1YP5 A;  2DIG A;  3EFS A;  3QKJ A;  1PKS A;  2QAS A;  4KRT A;  1Y0M A;  2F2V A;  4ZTJ A;  2E70 A;  4PFO A;  3C94 A;  4AT1 B;  1X6G A;  2COW A;  1Q7Y C;  4FW1 A;  4PL6 A;  2DBK A;  1WJR A;  2O2O A;  4C92 E;  1JBM A;  5CCA A;  4XQ3 A;  3FC3 A;  1YI2 T;  3PVL A;  1K73 U;  3QWX X;  1MHN A;  1PSE A;  2G6F X;  2YLC A;  5I22 A;  2HDA A;  3V7R A;  3EHR A;  5KYY B;  2KEA A;  3UAT A;  3C95 A;  4M7A C;  4QVZ A;  3OYK A;  2GGR A;  3U23 A;  2EGC A;  1Q86 R;  4LUE A;  4LDV A;  3NFC A;  5IN1 A;  2O4X A;  3LLR A;  3VS7 A;  4JRP A;  1MV0 B;  4A4F A;  3JCM Q;  4X34 A;  4QW2 A;  2OTJ T;  2J06 A;  3J80 E;  3G71 Q;  3M4G A;  4OB2 B;  4Z88 A;  1OQK A;  2QA4 Q;  3GNF B;  2CZ6 B;  3CCL T;  4KGV B;  3DB4 A;  3ZFJ A;  3VS4 A;  4QQD A;  3R6N A;  5GAN g;  4J8O A;  3L42 A;  1OZ3 A;  4RG8 A;  5LJ3 f;  2L3P A;  2R5M A;  3S6W A;  4M77 G;  1TU0 B;  2MPX C;  3QJ6 A;  4CC7 A;  1F1B B;  5CAI A;  1QKW A;  3AT1 B;  3JCM h;  3EHQ A;  2RI5 A;  3QG1 A;  1K8A U;  2B86 A;  3CC2 Q;  5IAY A;  1YFN A;  1HD3 A;  1D3B B;  2A37 A;  4VUB A;  5FU7 C;  2NUP A;  5KH6 A;  1G83 A;  2EKH A;  2FRW A;  5FWC A;  5GAN h;  1OOT A;  1K0X A;  4II1 A;  4KT0 E;  5LL6 S;  3OYC A;  1I4K 1; 
#chains in the Genus database with same CATH homology
 3P8D A;  1D3B A;  4C92 D;  4DQ2 A;  3QYG B;  4HCC A;  4M7D D;  4F7U F;  5I21 A;  4BY6 B;  4LD9 K;  4B9W A;  1G3S A;  4M77 E;  4M75 E;  2M0O A;  1O9S A;  2YRV A;  3VJP A;  4ATO A;  2RA2 A;  4L59 A;  4OGC A;  4J6Y A;  4N4G A;  1VUB A;  2HNI A;  2ZPE B;  3CBM A;  5I2S A;  4E7I A;  2K57 A;  2PUK B;  1YBY A;  3E9F A;  2E6Z A;  1VQK A;  5DLQ E;  3CC4 A;  3GF5 A;  5KE3 A;  5HK3 A;  2P4T A;  4M7D E;  5GMK m;  1Y96 A;  4MML A;  5HK0 A;  2E1H A;  3LGL A;  4LD6 A;  1QP2 A;  3LGF A;  4JS4 A;  3DLL A;  2RHY A;  4C92 F;  3HSB A;  1ZHI A;  2OAU A;  1VQN A;  2QQB A;  2CZ7 B;  4M78 F;  2L8D A;  5CKF A;  4XAX B;  4BDY A;  2GCX A;  2PU9 B;  4NS5 A;  3G4S A;  3UWN A;  5LJ5 h;  3BFM A;  1UGQ B;  5AYF A;  2L3R A;  3CCM A;  3QO3 A;  2XG8 D;  4XU0 A;  3VUZ A;  4M7A G;  1VQ8 T;  3CME T;  1K9M U;  3UT1 A;  2RHZ A;  3OBY A;  4J5Y A;  2RHX A;  4M78 B;  1KQS S;  3G71 A;  3OS2 A;  5CKD A;  2RM4 A;  3CCL A;  1M1G A;  3OS5 A;  3AHU A;  2DK3 A;  4M75 D;  2DEQ A;  3M57 A;  2RB6 A;  3E1S A;  3OSS C;  4TVR A;  3RMS A;  3X24 B;  1B34 A;  5GAN 4;  1YJW A;  4HCB A;  1I81 A;  2E65 A;  2BKD N;  4Z02 A;  2JTM A;  4M78 A;  2R57 A;  1N9S A;  1G5V A;  3CC2 T;  1H64 1;  5GAN f;  2QQ9 A;  5LJ3 h;  3VYH B;  3OYA A;  2MWP A;  3JB9 I;  2FHD A;  2WSF E;  1N8R U;  5GAO l;  3CCU A;  3OYM A;  1B34 B;  4C5E A;  3CCV T;  1M1K C;  2KSS A;  3HPW A;  1UGP B;  3V7S A;  2PVG B;  2DKG A;  3SD4 A;  5GAO m;  1VQN T;  2LQK A;  1QP3 A;  1M1F A;  4BY6 C;  2F5K A;  1UGS B;  3CXC A;  2DTO A;  3HKS A;  2XI9 A;  3MP8 A;  5GAN 5;  1IRE B;  1M4Z A;  2HQX A;  4JLG A;  3PIP A;  3GOX A;  3JCM X;  2RI3 A;  2VC8 A;  5LJ3 d;  1RI0 A;  1G3W A;  2EAY A;  5GAN 6;  4Q5W A;  3JCM J;  3HRU A;  5CKE A;  4M77 B;  5HKC A;  2XIC A;  3V7C A;  2K5I A;  4A4E A;  1K73 C;  4LDY A;  4LDU A;  4XU2 A;  5DLO A;  1M1K U;  3GLX A;  2F69 A;  3V8J A;  1VQ7 A;  2DXU A;  3X26 B;  4KUD K;  4IUT A;  4PJO A;  1XNI A;  3OYY A;  4IUR A;  1H3Z A;  5GAN 3;  1Q7Y U;  4M77 D;  2CZ0 B;  5CO7 A;  2EQJ A;  3X28 B;  3CCQ T;  4M77 A;  4DOV A;  4OF1 A;  1NPP A;  2RJE A;  3JCM f;  2RHU A;  4XU3 A;  4M7A F;  1QVG S;  3OS0 A;  3OYB A;  5GMK j;  2GFA A;  2LCL A;  4F7U A;  1QVG A;  4MZP A;  2ZCF B;  1YIT A;  2HAX A;  1VQ4 T;  1VQ9 A;  3OYF A;  3OB9 A;  2VGN A;  2DAQ A;  1VQ6 A;  2XID A;  4Y28 E;  3CCV A;  3GPL A;  3S3O A;  3CCU T;  3Q1J A;  3CCR A;  3FDR A;  4C0D C;  1NZ9 A;  2QDY B;  4M7D G;  4FSX A;  3PT9 A;  1UB4 A;  4C8Q B;  1YI2 A;  3CC2 A;  3H6Z A;  4PKC C;  5GAM e;  5FRO A;  3M4Y A;  3HRT A;  4IUV A;  3QYH B;  1QVF A;  2E41 A;  2VYT A;  1JB0 E;  5A2Q E;  1P92 A;  2RD1 A;  4FT2 A;  5GAO p;  2ZPG B;  1RL2 A;  4C92 A;  2EFI A;  4FL6 A;  3A5Z B;  4BAC A;  2DD5 A;  3VU3 C;  1NJI C;  5LJ3 j;  1YIT T;  2KQW A;  3INZ A;  3OMC A;  3UDC A;  4ZN1 A;  3I55 A;  1VQ5 T;  3CCE T;  2QXF A;  4JUV A;  3FEO A;  3NTH A;  4BD3 A;  5LJ5 j;  4HT9 A;  1HK9 A;  2EJ9 A;  1KQ1 A;  4C5I A;  4M7A E;  5GAN d;  1DJ7 B;  3JB9 H;  2ZPI B;  4M75 A;  5GAN 2;  4ZN3 A;  2X4W A;  1VQ7 T;  2P0K A;  2E10 A;  1VIE A;  5GAM j;  3M56 A;  3QXE B;  3L2V A;  2K3Y A;  2F5T X;  2JZ2 A;  2RK2 A;  4E7J A;  3G7Z A;  4XTU A;  3RES A;  2Y90 A;  2LTO A;  3CMA T;  5LJ3 e;  3JCM P;  4BB7 A;  1WQ7 A;  1JRI A;  2QEX A;  3TU4 K;  2OTJ T;  1BI1 A;  4M7D A;  2EQK A;  1W2B S;  1KQS A;  1R8O B;  1O75 A;  4O5V A;  4M75 F;  2L5Q A;  3V8K A;  2NLU A;  4IUU A;  2A3L A;  2LCC A;  4KBM B;  3QSU A;  3PFS A;  4EMK A;  4EDU A;  3KUF A;  4JRK A;  3RMQ A;  3C12 A;  3TEE A;  3DKM A;  2EYQ A;  3SB2 A;  5HY6 A;  4F7U G;  3CCJ T;  2E6N A;  4BI8 B;  4PJO C;  3RER A;  1K8A C;  2JN0 A;  3QJY A;  2RI2 A;  2VGM A;  1M8V A;  1KQ2 A;  1YJW T;  3LWI A;  2Y4Y A;  4M78 D;  4N4H A;  5A0L A;  1UGR B;  3I56 A;  2CGH A;  2XHC A;  4M75 C;  4IKF A;  4BE1 A;  1BI2 A;  2PUO B;  3CBP A;  3R6O A;  2KY9 A;  3MEW A;  3VYG A;  4A54 A;  3P8B B;  4C8Q C;  3JCM e;  4GY5 A;  4Y91 A;  4UC4 A;  5CK9 A;  5CKH A;  3V8L A;  2PVD B;  2YHT A;  3JCM g;  3T9N A;  4N4I A;  5IT9 E;  4A4H A;  4MDW A;  5A0D A;  3RKX A;  3VKI A;  5LJ5 g;  3J81 E;  5GAO r;  1VQ9 T;  2EJG A;  3ER0 A;  3X20 B;  4A53 A;  3DB3 A;  4OGE A;  1YIJ T;  1Q82 U;  1G3T A;  4RCB A;  5DM7 R;  1LNX A;  3A8O B;  3QDR B;  2QQR A;  1EIF A;  2K5F A;  3MCA B;  5CQY A;  3SWN B;  2QEX T;  3CMA A;  2C06 A;  2VUB A;  5L8R E;  3RUX A;  2CS7 A;  2XK0 A;  4HT8 A;  4J83 A;  3G71 T;  4YTL A;  1Y7X A;  3JAM E;  3CD6 T;  2DZ9 A;  2E5Q A;  2LX9 A;  2VXE A;  3SWN A;  1GXI E;  3CPW A;  1Q86 U;  4C5H A;  3VUB A;  4A4K A;  5M9O A;  3C4S A;  3MO8 A;  5GMK e;  2RHI A;  3L2R A;  3JRZ A;  2E12 A;  3KBG A;  4HCZ A;  5LJ5 f;  5GAO q;  3L1A A;  2FL7 A;  3J7A F;  2DJZ A;  3RKY A;  4RCC A;  3MEU A;  3FJP A;  1BI3 A;  3LYI A;  3PMI A;  3JB9 G;  1VQP T;  3OYL A;  3EAE A;  1KC8 C;  1WJS A;  4NOY A;  4M7D C;  2DXC A;  4R56 A;  3PMT A;  3PIO A;  3TRE A;  1LOJ A;  3FB9 A;  1VIF A;  1QW1 A;  4M7A A;  3OMG A;  4XTZ A;  3TCJ A;  2B8A A;  2JNG A;  5GMK i;  5CR2 A;  3S3N A;  1VQL T;  2JTF A;  2QI2 A;  4XTV A;  5J3B A;  3O8V A;  4D6W A;  3CPW S;  4O6J A;  5DY9 A;  3RIR A;  4ZTF A;  4B9X A;  4C92 G;  3OYJ A;  1WPY A;  3CCR T;  1VQ4 A;  1LJO A;  3CPF A;  4M7A B;  3MHX A;  1WQW A;  2CKK A;  1VQP A;  1FWZ A;  3BW1 A;  1UEB A;  2VV5 A;  3P8H A;  3H8Z A;  2DO3 A;  4LDW A;  4EMH A;  1N9R A;  1OYX A;  4DA4 A;  3CCS T;  4BI3 A;  3A8H B;  4BE0 A;  4NL3 A;  3JCM V;  4E47 A;  4RMO A;  3SFM A;  4L6V 5;  2HD0 A;  1XOV A;  5D6X A;  4ZGJ B;  1M90 C;  3BY7 A;  2CZ1 B;  3QZ5 B;  1WGS A;  1Q81 C;  2K2V A;  3JCM c;  1KHC A;  1I8F A;  3HP9 A;  4WF2 A;  2ZPH B;  4FIB A;  1IZ6 A;  1VQ6 T;  3DLM A;  4C8Q F;  4QVD A;  1KC8 U;  2P0Q A;  1VQ5 A;  2XD0 A;  1M9S A;  3LX7 A;  1S72 A;  4E7K A;  2ZPF B;  4ZGE B;  1VQM T;  2WSC E;  2R5A A;  3CCQ A;  4BUG A;  3MP6 A;  4M78 G;  1N6A A;  2MWO A;  4M77 C;  4XU1 A;  1Y96 B;  1KD1 U;  4LDX A;  5I2M A;  3E19 A;  2FVU A;  2JOY A;  5C0M A;  1NE8 A;  4C0Z A;  4QQG A;  1YIJ A;  4ELY C;  2FYK A;  3M53 A;  3OYN A;  2DVE A;  1M5Q 1;  2D0Q B;  2MF2 A;  4PJO G;  4ELZ C;  2GQV A;  5A0G A;  2ZGW A;  1ZQ1 A;  1BKB A;  2QA4 A;  2P0P A;  2RH2 A;  1W2B A;  3M5A A;  3UPU A;  1SSF A;  2RO0 A;  3HFO A;  2VXF A;  4C0F A;  3CCS A;  4JJN K;  2KAF A;  4PNO A;  5GAM f;  2G3R A;  2PVO B;  4HKE A;  5GAM g;  3FIF A;  4C8Q G;  4C5G A;  4BE2 A;  4CI0 C;  5GAM d;  4GLK A;  2MMP A;  1Q82 C;  1I4K 1;  4PJO F;  4FU6 A;  1YJN T;  4BDZ A;  4OB3 B;  3JCM b;  3CCJ A;  3QHS A;  3OYH A;  2V8I A;  5GMK h;  5J39 A;  4EMG A;  3VV0 A;  1FXX A;  5FLX E;  1VQ8 A;  3JB9 D;  4MMK A;  5KE2 A;  2MI6 A;  2X4Y A;  1OZ2 A;  3BDU A;  3LH0 A;  3ZEH A;  3GIB A;  2A7Y A;  4FT4 A;  3M59 A;  4C0D B;  4JRI A;  4EMK C;  3OS1 A;  5LJ5 e;  1JJ2 S;  2GFU A;  4OMF B;  5GAM h;  3GNG A;  3N5B B;  1YCY A;  2IG0 A;  2LT4 A;  3M58 A;  4N0A A;  3WVE B;  3OYI A;  2M9U A;  4IUP A;  2DXB A;  1S72 T;  2LQ8 A;  4ZGD B;  3QUI A;  3LW5 E;  2DTI A;  2K3X A;  1QVF S;  1Y71 A;  4E7L A;  2PQW A;  2Y4X A;  4P5N A;  3CME A;  2DTH A;  4X9C A;  2GF7 A;  3S3M A;  2JUF A;  4C0G A;  5FRN A;  4XK8 E;  4F7U B;  3QZ9 B;  2EKO A;  3ME9 A;  2X4J A;  4J6X A;  5D6W A;  2XDB A;  1X01 A;  3I56 T;  3OW2 S;  3CD6 A;  3A8L B;  1WJQ A;  4C8Q E;  4M77 F;  3JCM W;  5GAN 8;  3L2U A;  3CCE A;  4XTY A;  4FM4 B;  4PJO B;  2KMT A;  2LVM A;  1OI1 A;  2M16 A;  3EFR A;  2XDP A;  3FLG A;  4ME7 A;  5D6Y A;  4PLL A;  3OW2 A;  3QBY A;  5GAN e;  5FU6 C;  1VQO T;  2WSE E;  3WXM B;  4NL2 A;  5CIU A;  1W4S A;  4KUI A;  4C92 B;  4A4G A;  3BDL A;  2DZC A;  1XTD A;  2D6F A;  2YLB A;  4OB0 B;  2EQU A;  4R55 A;  2QTX A;  4JS5 A;  5CVI A;  3QII A;  2I2L A;  3M54 A;  2L89 A;  3PTA A;  3URG A;  4OP0 A;  4QVC A;  1ZBX A;  3I55 T;  1Y07 A;  1KD1 C;  4M78 E;  1NJI U;  1BI0 A;  2ZZD A;  3JSC A;  2X4X A;  2XKO C;  3L2Z A;  4J7F A;  4C8Q A;  1YJ9 T;  2KK4 A;  3ASK A;  4M75 B;  3ZBD A;  3CXC S;  2LDM A;  2KVQ G;  2QQA A;  2WAC A;  2LT1 A;  4BI4 A;  3EFS A;  2DIG A;  3HRS A;  3QPH A;  3L2W A;  2QA4 T;  1MGQ A;  4PJO E;  2FB7 A;  2EIF A;  2IVW A;  2RJD A;  1FX7 A;  2RK1 A;  3SDZ A;  4DOW A;  3CBO A;  3QKJ A;  3CC7 A;  1JJ2 A;  1KHI A;  3MEA A;  3OYE A;  2X35 A;  2EWN A;  1Q81 U;  1YHQ A;  3JB9 F;  4MZM A;  3PGG A;  1M90 U;  4ZTJ A;  2E70 A;  1X6O A;  4M7D B;  2LNV A;  4EPC A;  3C94 A;  5KCH A;  1YJ9 A;  4L5G A;  4QQ6 A;  4MZT A;  4PJO D;  4EMK B;  5FU7 B;  3NTI A;  1Q7Y C;  3CC4 T;  3JCM d;  2M1H A;  3SWN C;  4PL6 A;  1WJR A;  4C92 E;  5KCO A;  1JBM A;  4N0A C;  5CCA A;  2V8J A;  3CC7 T;  4XQ3 A;  3FC3 A;  4OVA A;  1YI2 T;  1K73 U;  3OYD A;  5FU6 B;  1MHN A;  1PSE A;  3HFN A;  2YLC A;  4JRQ A;  2LC4 A;  2HQE A;  3X25 B;  2H3J A;  1G3Y A;  2E64 A;  3V7R A;  1PSF A;  1HXD A;  4M7A D;  3C95 A;  3OQ5 A;  2KDS A;  4RG2 A;  1U1S A;  5FRM A;  4M7A C;  2V8K A;  4QVZ A;  1WNL A;  3OYK A;  3G6E T;  1TH7 A;  3L2Q A;  3M9Q A;  2DIQ A;  1VQL A;  3A8G B;  4JLI A;  4LDV A;  3NFC A;  4C92 C;  3MEV A;  5GMK l;  5IN1 A;  2O4X A;  4XTX A;  1I5L A;  2DXT A;  4OB1 B;  3LLR A;  4JRP A;  4C8Q D;  4A4F A;  1BIA A;  3JCM Q;  1NPR A;  4X34 A;  3HHT B;  2JVV A;  5C6S A;  3OYG A;  4QW2 A;  3G4S T;  1Q86 C;  3J80 E;  1N8R C;  1VQM A;  2DPP B;  1N27 A;  2HBP A;  2CYZ B;  3FRN A;  3M4G A;  3KXT A;  4M7D F;  4MDX A;  4OB2 B;  1X75 C;  3HL8 A;  2O4X B;  2QQS A;  3OBW A;  5EG2 A;  3OY9 A;  1VQO A;  4V2S A;  2K5L A;  2OTL T;  3NTK A;  2LRQ A;  3MET A;  5CQX A;  2K4Y A;  5J26 A;  3GNF B;  5CKB A;  2AHJ B;  3LWH A;  2CZ6 B;  4JDS A;  4XTW A;  3CCL T;  3GP8 A;  2XDD A;  4IUQ A;  2ZPB B;  3MP1 A;  3DB4 A;  1K9M C;  2MAM A;  3ZFJ A;  2BUD A;  2DD4 A;  4KUL A;  4RKU E;  4QQD A;  4F7U E;  1YHQ T;  5GAO n;  1VQK T;  5GAN g;  3JB9 J;  4PLI A;  2EJF A;  3OSV A;  2RJC A;  4J8O A;  2BIV A;  3L42 A;  2EQM A;  1OZ3 A;  1V29 B;  4J6W A;  4RG8 A;  5LJ3 g;  5LJ3 f;  3WVD B;  2R5M A;  4M78 C;  3S6W A;  4M77 G;  1YJN A;  3QJ6 A;  2OTL A;  1BYM A;  3PNW C;  4CRI A;  2R58 A;  5CAI A;  2RJF A;  5GAN 7;  3G6E A;  5LJ5 d;  3E9G A;  2O01 E;  1QVP A;  2RI5 A;  3QG1 A;  3CEY A;  3JCM h;  5GAN j;  1K8A U;  5IAY A;  4HA8 A;  3OA6 A;  1BIB A;  2XU8 A;  4E7H A;  3A8M B;  3F70 A;  2D9T A;  1D3B B;  4VUB A;  5KH6 A;  5FU7 C;  4J7I A;  1XQH A;  4X9D A;  1U1T A;  5GAN h;  3RKW A;  4M75 G;  2OTJ A;  4II1 A;  4KT0 E;  3M55 A;  3CCM T;  1KG1 A;  5LL6 S;  1U8R A;  3OYC A;  1AHJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...