4C8QE

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
83
structure length
83
Chain Sequence
b'EILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qE00
3RESA 5GANj 4C92A 2VXEA 4M7AA 4N0AA 4M78F 4XU3A 4C8QA 5LJ3g 4XU0A 3RKXA 3SWNA 5GAOp 4M78D 2E10A 4F7UG 4PJOE 3JCMh 4HT8A 2DEQA 5GMKm 4M75B 2RM4A 1JRIA 4C92C 3QSUA 4M7AC 4M77F 4PJOG 4C8QC 4M7DE 4DQ2A 1M8VA 4M77D 1WPYA 2CGHA 2EWNA 2FB7A 3BY7A 3FJPA 4JRIA 4C92B 5GMKi 3SWNB 4EMKA 4M7DG 3RKYA 2E41A 3BDUA 1KQ1A 1X01A 5LJ3e 4M78E 5I21A 3BW1A 5GAN2 3FB9A 4XTXA 4J5YA 5LJ3d 2E65A 5LJ3f 4NOYA 4EMKC 4QVCA 3INZA 5GMKe 5GAN5 1MGQA 3HSBA 5GMKl 4V2SA 1YCYA 4M78G 4JUVA 3L1AA 4M77E 4M75A 2EJFA 4OP0A 4C92F 4M7AF 1HXDA 4C8QF 4C92D 5LJ5g 4M7AD 2FYKA 3RUXA 4C8QD 5GAMh 5GAOr 2DVEA 4M77G 3V8LA 2DZCA 4XTUA 4M75C 4PNOA 5GAMj 1U1SA 1BIBA 1I81A 4J6WA 4MMLA 4N0AC 2QTXA 1BIAA 4XU1A 5GANe 3SWNC 3BFMA 3V8KA 1U1TA 3QO3A 4XTYA 3RKWA 4EMHA 4X9CA 1H641 4C92E 4M7AE 3FIFA 1M5Q1 4C8QE 5LJ5e 1WNLA 2DTIA 2DZ9A 2HNIA 2VC8A 2YLCA 5LJ5f 1LNXA 1Y96A 2E1HA 4QVDA 5LJ5d 1WQ7A 3JCMc 4C92G 3RIRA 2YHTA 4F7UB 5GAOm 4JRKA 4Y91A 3VU3C 4C8QG 5GAOq 4XTZA 3RERA 4J6YA 4M75F 2ZGWA 4X9DA 5GANg 4M75D 1TH7A 1LOJA 3JB9F 3QUIA 2RD1A 4XQ3A 3JB9D 4RCCA 2K57A 3JCMQ 1Y96B 5LJ3h 3M4GA 3HFOA 3HFNA 4M7DB 5DY9A 1B34B 3V8JA 3JCMg 5LJ3j 1N9SA 2E64A 3EFSA 2DXTA 2DJZA 2EJGA 4RCBA 5GMKj 5GAOl 3JCMP 4HT9A 2DKGA 1D3BB 2DXUA 3L2ZA 5GAOn 4M75E 4F7UA 5GAN3 4M78B 5GAN6 2EAYA 2EJ9A 4M7AG 5GANf 1WQWA 4J6XA 5GAMe 4M75G 3QHSA 5GANd 5GAN7 4PJOA 4NL2A 4EMGA 1JBMA 4M77B 3JB9G 3JCMe 4XTVA 4M7DA 3JCMd 1I4K1 4XU2A 1B34A 3JCMf 2JN0A 3SB2A 4A54A 3JCMb 5LJ5h 4PJOB 4M7DC 1D3BA 4WF2A 5GAMg 1KQ2A 5CAIA 4M78A 5LJ5j 3EFRA 4MMKA 2DTHA 5GMKh 3JCMW 3JCMX 2YLBA 3PGGA 3V7CA 3V7SA 4F7UF 4M7AB 4JLIA 4M78C 4M77A 4C8QB 4NL3A 4XTWA 2Y90A 1I5LA 4PJOF 3JB9I 2RA2A 1I8FA 3JB9J 3JB9H 5GAN4 4PJOD 5GAN8 4HA8A 4M77C 4A53A 2RB6A 5GAMd 5GAMf 4M7DF 2I2LA 3V7RA 4M7DD 4EMKB 3JCMJ 1LJOA 3JCMV 1N9RA 3AHUA 5GANh 1HK9A 2DTOA 2VXFA 4PJOC 4F7UE 3GIBA
chains in the Genus database with same CATH superfamily
3CCQQ 5FU7C 2KK4A 4M78D 4HT8A 2LNVA 2LVMA 1M1GA 2CREA 1KQSS 1AZGB 3RNJA 3D7SB 1WPYA 1M8VA 2ATCB 2EQUA 1UGPB 1IHWA 2FL7A 2CSIA 3VRZA 1UHCA 4IUVA 1AHJB 3VV0A 3UT1A 3TREA 2CP0A 1EZZB 4DEYA 4J6WA 4XU1A 4FYWB 4XK8E 5D6YA 1G3SA 1HD3A 2F2XA 3RR6A 2A37A 4BY6B 1E6HA 1U5SA 2MF2A 4C8QE 1MHNA 1ZSZC 2COWA 2HBPA 1UDLA 2E1HA 1WQ7A 2QA4Q 2QQBA 1U3OA 5IAYA 1YJ9A 2FZCB 2DAQA 1YHQQ 4K11A 2LRQA 4EDUA 3EFSA 4ZN1A 1TUCA 2DBMA 2O9SA 3QBYA 4LUEA 2QAZA 1WHGA 5GAMe 1KSWA 1K73R 3M5AA 1QP2A 3JCMe 5I2SA 2LQNA 1VYVA 3WVEB 3ZL7C 1QVGP 2HKQB 1G2BA 1YP5A 2X4XA 5LJ5j 4KUIA 5GMKh 3NTKA 2YLBA 1WHHA 2V1RA 4M78C 1M8MA 4C5IA 4BE0A 1PHTA 4OB0B 4LDUA 4IIOA 4FL6A 3JB9J 1EIFA 1W70A 2K3BA 4FYVB 2DD4A 1N9RA 3TQ7P 4C5GA 2XU8A 2BE7D 3PVQA 4OMNA 1ZSGA 3GIBA 1WI7A 3OS2A 2RI2A 4LNPA 1N27A 2OAUA 3CC4A 3H41A 9ATCB 3FJPA 2LT4A 2CP3A 3SDZA 2KROA 3OYFA 4EMKC 4NOYA 2CT3A 1K0XA 3M55A 4OP0A 4C8QF 2R57A 2H3EB 2K3YA 3A8HB 1Y57A 2DFUA 2DO3A 3UDCA 1LCKA 2KXCA 1PRMC 2DM1A 1VA7A 2Y4XA 3UWNA 4BE2A 1VQ9Q 2JNGA 5GAOm 2A36A 1ZUKA 4C8QG 4OMOA 4J9CA 4J83A 2YWWA 2F1LA 2L89A 1YJ9T 2ED1A 1OV3A 3G4SQ 1N9SA 2EIFA 3A98A 4RCBA 4RTWA 4HT9A 2KNBB 4B9WA 3CC7A 5KYWA 1WQWA 1SKUB 5CKBA 2FRYA 1JBMA 2JS0A 5CCAA 1LPLA 4Z88A 2E5KA 5KYWB 2QQAA 5GAMg 1OI1A 1ABOA 2YT6A 4IUQA 4J7FA 3QKJA 3SEMA 3V7CA 3M0UA 3ULRB 3S3OA 2GQIA 2D9TA 1VIEA 2Y90A 4A4EA 2KE9A 2L0AA 2X4WA 1G8XA 4FYXB 5HKCA 3QJ6A 1VQLQ 1G83A 2EYYA 5GANj 1C6VX 5LJ3g 1RUWA 2QQ9A 3MEUA 3CCRQ 4PJOE 2DMOA 5AT1B 1OULA 3OBWA 5KH6A 1VQMQ 1NYFA 1WZOA 3CCVA 3HRSA 3URGA 4CRIA 1VOMA 1CKAA 3EG9B 1FMKA 2C06A 2E65A 4V2SA 5KYUA 2NLUA 3EFOA 5KYYA 4JUVA 4GY5A 4ANJA 4M75A 3L2UA 1HXDA 5GAOr 2YRVA 4LD9K 3EG2A 3V8LA 1UG1A 2EPDA 2LCCA 2VB6A 2XHCA 4O5VA 5KYUB 5KYYB 1WYXA 2E70A 2L3RA 1K9MC 1AOJA 5CQXA 2K3XA 1FXXA 2FO0A 1H641 4E7IA 1B07A 3DKMA 3F70A 2YLCA 4QVDA 3VU3C 2E12A 2HD0A 4RTZA 3HKSA 1F1BB 2CH4A 1YJNA 3E19A 4M7DB 5DY9A 4QQDA 3PVLA 2A7YA 1QW1A 4HCZA 2DKGA 1D3BB 1YHQA 3EGDA 5GAN3 2NUTA 2HBWA 3LW5E 2OTJT 4LE9A 4ATOA 5ECAA 1VQ6A 1E7OA 2V8JA 3G7ZA 1RADB 3EGDB 1I4K1 3JCMf 2QG9B 1X43A 1UECA 5D7UA 3WVDB 4M7AB 1YIJQ 1YFNA 4M77A 4XTWA 2FZKB 2J6FA 1I5LA 4PJOF 3JB9I 2DL4A 2YSQA 4HCKA 5GJVB 2KMTA 2WSEE 2E6NA 4N4HA 4CC7A 1IB8A 3CEYA 4C92A 4OB2B 1H3HA 3EH2A 2PU9B 4KH0B 4PJOG 4C92B 1K9MR 1UJ0A 3CCVT 5CKHA 4ZGJB 1OQKA 3EAEA 2XG8D 4M78E 4KBMB 4GBQA 1QP3A 2L3SA 3EGUA 4MZTA 3HSBA 5GMKl 1M30A 1UGSB 3L1AA 2EJFA 2KYMA 2ROLA 3HPWA 3KFVA 2COYA 5IN1A 1O9SA 1AT1B 2MK5A 3FJ5A 5GAMh 1DJ7B 2MPXC 3CXCA 1XJWB 4E7KA 4HVWA 4PFPA 3G1JA 3ZEHA 3FEOA 3I35A 2RJDA 4J9EA 5KE3A 2DERA 1QCOA 2XK0A 5KE2A 3GF5A 3OYAA 1VQ9A 3EH1A 5LJ3h 1HJDA 1YJNT 2RF0A 1PSEA 4D6WA 5GMKj 1D0XA 3QXEB 3G4SA 2KVQG 3I5RA 4IUPA 2EYZA 1YHQT 2FZGB 1UHFA 2O01E 2DRKA 4YTLA 2ECZA 3VYHB 2DL3A 3CCLT 2ZAEA 1VQ6T 2X3WD 4E7HA 3JCMd 1B34A 4J9DA 4RKUE 3LGFA 4IUUA 1YWPA 1R0CB 1OX9A 1JEGA 3UF4A 4XAXB 3L2WA 4AFSC 1TSFA 2M1HA 4C5HA 3OYIA 3QJYA 1QVFP 4QT7A 2VYTA 2G3RA 2X4JA 1AWOA 3MP8A 1C0MA 3JRZA 5GJWB 3R6OA 3X25B 4OMFB 1BB9A 4M78F 3RKXA 3VS0A 3GNGA 3MP6A 3E9GA 2BTTA 1KQSP 3VS4A 3CCRA 1AWWA 1IGUA 1VQMA 3UPUA 4Q5WA 2M16A 1W2BA 4KUDK 2DYBA 2XMFA 4M78G 7AT1B 1UJYA 2DD5A 5HK0A 3L42A 3L2VA 3G6ET 3HRUA 1KFZA 2O31A 3H0FA 4J8OA 4C0ZA 3C4SA 3JSCA 3QWYA 1M2VA 1SEMA 5CQYA 3CCJT 4XTYA 2M51A 1WNLA 2DTIA 1NBEB 2HNIA 1PG5B 5GAOq 1RAEB 4HXJA 4M75D 5FROA 3OS1A 2AK5A 3QUIA 1QVGA 2DJQA 2LDMA 1PM3A 4RCCA 3JCMQ 1MMDA 2YRCA 3HFNA 3OYDA 4QQGA 3HP9A 1X6OA 5GAOn 1OYXA 4F7UA 1Q86U 2QDYB 4ZTFA 1QWFA 4E7LA 3M56A 2Z0WA 2LT1A 2E3IA 1PNJA 3CMEQ 4RUGA 1GXIE 1Y07A 4D8KA 3JCMb 4BDZA 4MZPA 3JAME 2OTJQ 4A4KA 1OOTA 3JCMX 3O5ZA 2KDSA 4JLIA 1VQ4A 2EQKA 2GGRA 2XKOC 1YIJA 5L8RE 1NJIU 2F5KA 3A8LB 3NHNA 2D8JA 4J9IA 1S72T 1HK9A 4PJOC 1G5VA 3OA6A 1KG1A 3VRYA 2GF7A 1NPRA 4N0AA 1FYNA 1X2QA 3VYGA 1TUDA 1Q7YU 1SSFA 4AFZC 4M77D 3NMZC 1RI9A 1UGVA 2M0OA 4X34A 2V26A 4RTVA 4J5YA 2DX1A 4QVCA 3X24B 2LJ3A 2ZPEB 4JJNK 2RHUA 2E6ZA 2JZ2A 3QDRB 3KUFA 5CO7A 4C92D 5IXFA 2QGFB 2RHYA 1K8AU 4JJCA 4M75C 3CCVQ 3TCJA 2RK1A 2FHDA 4X9CA 3A8GB 1RAAB 2CKKA 4C0DB 1JQQA 1Y96A 1AVZC 2PUOB 4OMMA 1PCXA 4J7IA 2ABLA 1JJ2S 4Y92A 1Y96B 4RTXA 1BI3A 2EQJA 2J06A 2B8AA 2RHIA 1SHGA 1IREB 3OS0A 1BKBA 5GAN6 3QPHA 2LZ6B 1OPKA 3QHSA 3VUBA 5GAN7 1GBQA 1FWZA 2BZYA 1R77A 1TXQA 1YJNQ 2X35A 2ZPIB 2RQUA 1ZLMA 2LQ8A 5J3BA 4ZGEB 4MMKA 2HDAA 3CCLQ 3UATA 3CBMA 4C8QB 1M3CA 1VQ6Q 3PIOA 3DLLA 1PD0A 3OYEA 4RG2A 1VQ4T 1I8FA 1LVKA 1BK2A 5GAN8 4HA8A 4M77C 3DB3A 1K9AA 2WSCE 1MMGA 1YIJT 2DYIA 3ZBDA 1X69A 1EX4A 1SG5A 3DLMA 3QYGB 1NYGA 1X6GA 4LUDA 2AKLA 5GMKm 2QGGA 4A4HA 4C92C 1WJSA 4BB7A 2CGHA 2C0TA 5CIUA 3OYHA 1SPKA 3RKYA 2AZVA 2P84A 4PJNA 4MDWA 1D1AA 5LJ3e 5GAN2 4XTXA 4JRQA 1MGQA 1QKXA 5DLOA 3QG1A 2J6KA 2RJFA 2CSQA 1R8OB 4KH1B 4II1A 1D0ZA 2DVJA 3OW2A 4FT4A 5I2MA 2NUZA 3LWIA 4C0FA 2MWOA 1YJWT 1I5OB 1BIBA 3CMAT 4GLKA 3MCAB 1U1TA 3CCET 3VJPA 3X26B 1KD1U 3ASKA 1U8RA 1XNIA 3G6EQ 2BE9B 2K6DA 3BDLA 4AMCA 3QDFA 3HHTB 4C0GA 2F69A 1W4SA 3TSZA 3CCJQ 3VUZA 1UE9A 2LNHB 4DOWA 2JUFA 4J6XA 2GBQA 1ZUYA 2B86A 3THKA 4IURA 5M9OA 2K5IA 3M9QA 1NLOC 1WXBA 3CMEA 3G71A 3LX7A 2F2VA 2P4RA 3NTHA 1VQOT 5DLQE 1VQ8A 4HVUA 2A0FB 4AFUC 4ZNXA 4MZMA 2GNCA 4DBFA 2OTJA 2AHJB 2GFUA 1RLPC 1YWOA 2RQTA 2H8HA 4CC4B 2DTOA 2JM8A 2VXFA 1YNZA 3HTRA 2V1QA 2P0PA 2FG0A 5CKFA 2RM4A 2RPNA 4CI0C 1S72Q 1W2BS 4JPBW 2KAFA 1UB4A 1Q86C 1D1BA 4OMLA 4PJLA 2RN8A 3PNWC 1YCYA 5CK9A 1N8RC 2PUKB 2RHXA 5LJ5g 2O4XA 1X6BA 2DZCA 5FU6B 3EG9A 5GANe 3SWNC 2D8HA 2O4XB 1NE8A 2DE0X 3V8KA 2PVGB 3QO3A 2O88A 3VS2A 4BI8B 2JT4A 3LH5A 4WCIA 2EYWA 2RH2A 4X9DA 2M0YA 2L2PA 1NJIC 3EG0A 4XQ3A 2ESWA 1ACMB 2BIVA 2MWPA 1C1AA 1WHJA 3X20B 4PFZA 3H0HA 2QEXA 2DXTA 3OSSC 3ZFJA 5D6WA 3P8HA 4M75E 3NPFA 3OQ5A 2JM9A 2LMJA 3U23A 3H9NA 1IO6A 1Q7YC 1QVFA 3LLRA 1JO8A 1YCSB 5I22A 1UUEA 1W1FA 4M7DA 4XU2A 3T9NA 4R56A 3SB2A 1ZA2B 2MCNA 2YDLA 1D3BA 5FU7B 1QWEA 3CMET 3G71T 3HRTA 2A08A 1XTDA 1Y71A 2MIOA 2ZPGB 1ABQA 1KQSA 2Y4YA 1T3SA 1K8AC 2COZA 1VQ8T 2R5AA 1GFCA 2HQEA 2EGCA 2HQHA 3E1SA 2K9GA 3CCLA 4BI4A 5GAMf 1G3TA 1Q86R 1M2OA 3M0SA 1IRXA 3AHUA 2GTJA 5A0LA 1N8RR 3RESA 4M7AA 5LL6S 2VASA 1VQ4Q 3QSUA 1XOVA 3M0RA 1ZSZA 3VS1A 3CPWS 2FB7A 3CCUT 1D1CA 4BD3A 3OBYA 3M59A 3BW1A 1ZSZB 3TU4K 5LJ3f 1BCMA 2K2VA 3Q1JA 1GBRA 2LQKA 4M77E 1KHIA 2RNAA 1NJIR 4QVZA 4OMQA 3EHRA 2ROTA 4PFOA 1WA7A 2DL8A 2F5TX 4HCBA 1UEBA 2ENMA 2CUBA 4AFQC 1IGQA 1WHMA 4C92E 3EGXB 5KCOA 3N5BB 5C0MA 1Q7YR 5FLXE 3OYYA 4M75F 2M9UA 5GANg 2GTOA 3UA6A 1YJWQ 3CMAQ 3G6EA 1WDXA 1UTIA 3CCEQ 2DRMA 1NPPA 2K79A 2QEXT 2DXUA 3L2ZA 3CCJA 1K8AR 4M78B 4BY6C 4JRPA 2MMPA 2PVOB 1UGRB 3TSWA 4R55A 5FRNA 1VQNT 4M75G 3M4YA 1BU1A 1P92A 3R6NA 2HL3A 4JS4A 4A63B 2CH4W 2D1XA 5LJ5h 2KI7A 1WJRA 3QZ9B 1MNEA 2KYBA 3JV3A 4FIBA 3NFCA 2DBKA 3PGGA 2VKNA 4E6RA 3OS5A 3M0QA 4N4GA 2RHZA 2AT1B 5GAN4 1U06A 2OTLT 5GAMd 3GPLA 3I55T 2ZPFB 1ZX6A 2I0NA 3OSVA 4EMKB 1MUZA 3MKDA 4KGZB 4Z02A 1KD1C 1Y0MA 1VQOQ 2O9VA 4ORZA 2EQIA 4XU0A 4KT0E 2CZ7B 2RI3A 2LQWA 2IVWA 4M77F 2LX7A 3VS7A 2YUPA 2EWNA 4TVRA 1KK7A 2FRWA 1OX8A 2BZXA 2E41A 1KQ1A 2GQVA 5HCKA 5FW9A 4DBRA 2YUNA 5LJ3d 1R0BG 1RLQC 1S72A 1BI1A 2IPOB 2QI2A 4C92F 3OW2S 3OYGA 4F17A 3A1PA 1VYUA 2HSPA 4M77G 3HL8A 3C0CA 4OVAA 3FDRA 2H3JA 5CR2A 2VWFA 1TG0A 4FYYB 2QTXA 1BIAA 4FM4B 3MEAA 1M5Q1 1HYOA 2MI6A 1Q81U 4C92G 2YHTA 4PJMA 4XTZA 1ARKA 2LJ0A 5A0DA 4QKUA 3A5ZB 1I07A 1JJ2P 3J7AF 2YUOA 2M02A 2X3XD 3E9FA 1TS9A 3A8OB 2E64A 4KGXB 4JZ4A 1T3LA 2DETA 3EHQA 4DBQA 1N5ZA 2DIQA 1K1ZA 2L5QA 3GLXA 1NZ9A 4FW1A 4JDSA 1VIFA 3MP1A 1D0YA 4BACA 1TUGB 4RTTA 2WACA 1KIKA 2CP5A 1KD1R 2RMOA 2PVDB 2FPDA 1KQ2A 4DEXA 4L59A 3PT9A 5FWBA 1Z9ZA 2QYZA 2FEIA 2DXCA 3P8DA 1OZ2A 2JMAA 4FU6A 4RTUA 1M27C 2CP6A 4IUTA 3ME9A 3REBB 1N8RU 3V7RA 1VQKT 4LDYA 4M7DD 3JCMJ 4ELYC 5GANh 3G71Q 4F7UE 2JJ9A 2W10A 4M4ZA 4XU3A 1VQ8Q 2DL7A 2E5QA 2LJ1A 1UFFA 2VV5A 4OB1B 4F16A 3VS3A 3E2UA 1QCFA 1X01A 5I21A 1M9SA 3I9QA 5J26A 4EPCA 1NLPC 1Q82C 2NYSA 3QIIA 1VQ7A 1ZQ1A 4M7AD 3CCUQ 4OF1A 2RJEA 1G3YA 2X9HA 3O8VA 5A2QE 1I81A 1WGSA 2FVUA 5GANd 4EMHA 3QYHB 4MDXA 5IHKA 1PSFA 2PNIA 3OYKA 4Y91A 4PLIA 1IHVA 3J81E 4ESRA 1KC8C 1LOJA 3OYLA 1YI2T 3JB9D 4E7SA 1YN8A 4AG2C 1YJWA 2CP2A 2LX9A 3CMAA 5HK3A 3UA7A 1QKWA 3CCEA 1M4ZA 2HKNA 5J39A 4E7JA 1KHCA 4JS5A 4L6V5 4PK4A 2AIRB 2FPFA 5HY6A 2V8IA 2QEXQ 4M7DC 1WFWA 2D0NA 2L3QA 4E2FB 1VQNQ 4F7UF 3RMQA 1JB0E 1NEGA 2YXYA 1T0HA 2K2MA 1W6XA 2JXBA 2EYQA 2RA2A 4FT2A 2AZSA 1MV0B 2LP5A 2RB6A 2VVKA 2BZ8A 1RAFB 1M1KU 1Q82R 5DM7R 2HQXA 2QK0A 4C8QA 1BCOA 1RAHB 4F7UG 2DEQA 1VQOA 1Q95G 1WXTA 2C0IA 4M7AC 3OY9A 4J9BA 4OGCA 2OTLQ 3BY7A 2EBPA 3I55Q 2HAXA 4F04B 3C94A 3OMGA 3FLGA 3OB9A 1W2BP 4F14A 2EW3A 3PMIA 1VQ5T 5CKEA 3CC2Q 2LCLA 3S3NA 4L5GA 2DA9A 1RABB 1KC8R 1VQ7T 1M3AA 1M90R 2DVEA 1FMVA 5GAMj 4BI3A 4FSXA 2O2OA 2KRSA 4DOVA 2KXDA 4LDWA 3BFMA 3DB4A 3RKWA 5LJ5e 2DZ9A 4ZTJA 3CD6A 1LNXA 3RIRA 2QTVA 1A0NB 2CT4A 5KCHA 5C6SA 3PTAA 3HFOA 3CXCS 1J3TA 2XDDA 5LJ3j 1YITT 3I56T 2DJZA 1GCQA 3OYJA 2ZCFB 2LC4A 4BE1A 2D0QB 1WX6A 3OYBA 2K5LA 2VGMA 3GBQA 4E7ZA 3TVTA 2MYSA 2FPEA 2IG0A 3CCSQ 4Z89A 2XDPA 1WHLA 1BI0A 5CAIA 3FC3A 3EFRA 2DTHA 2PTKA 1GL5A 3ER0A 1JXMA 2F2WA 2IIMA 2L3PA 3CCMA 4OGEA 4FCYA 1Q81C 1OZ3A 2A3LA 1WXUA 4C5EA 4RMOA 1QCNA 3MEWA 2HEQA 1FX7A 3MJXA 3CPWP 1FMWA 1VQKQ 3BDUA 1IXDA 4KRTA 2DEUA 2A28A 3FB9A 1OEBA 3I5SA 1NM7A 1PKSA 2VGNA 2MAMA 1AEYA 3NGPA 4XTUA 3MO8A 4VUBA 2P4TA 4QW2A 3CCUA 1IZ6A 4PJJA 2QXFA 1GCPA 2J7IA 3OYMA 2KBTA 2AKKA 3CD6T 4JRKA 3X28B 4J6YA 1TH7A 3L2RA 2ED0A 3TEEA 2CS7A 1VQPA 3MEVA 2OJ2A 4LDXA 3JCMg 2SEMA 3KXTA 2PQWA 4RG8A 1JU5C 1ZBJA 3L2QA 4PLLA 2EAYA 4QQ6A 1ZBXA 2NWMA 1ZHIA 4PJOA 3C12A 1YI2Q 4HKEA 4XTVA 1K4US 3PIPA 4FSSA 1Q81R 1QVGS 3M0PA 4PJOB 2BKDN 2DNUA 1V76A 1B3QA 4WF2A 2JW4A 2HZYA 2EKOA 3PMTA 2QDLA 3GNFB 4BDYA 3CCQA 3JCMW 2RQWA 3V7SA 3M0TA 5IT9E 3CC4T 4KULA 2J05A 1D09B 2XI9A 1VQNA 2EFIA 1Q82U 5KYXA 5KYNA 1I1JA 1M1FA 3CCMT 2GFAA 5EG2A 4JJBA 4P5NA 2JOYA 1ZA1B 5KYXB 3CBPA 3CQTA 5A0GA 1BBZA 1H92A 3EFOB 1UGQB 4M75B 3J80E 1QVPA 1V29B 4M7DE 1O75A 4DQ2A 5GMKi 4HCCA 3RDVA 2R58A 2P0QA 4PKCC 1I0CA 2HCKA 3LGLA 3REAB 2OTLA 2LTOA 4R0KA 2G6FX 2RK2A 3MPUB 2KY9A 3I55A 5GAN5 1KC8U 1KJWA 2C0OA 2KRNA 1M90U 2SRCA 1K0SA 2LCSA 2XD0A 1JJ2A 3OW2P 2QA4A 4DA4A 3H6ZA 4C8QD 3CC2A 1MMAA 4LDVA 1AD5A 2KSSA 4PNOA 1Z9QA 1AWXA 1K73U 3S6WA 5AYFA 4EIKA 4ME7A 4KGVB 4MMLA 2EGAA 4N0AC 1VQ5Q 2E3HA 3PE0A 2JS2A 3CC7T 1MNDA 4M7AE 2OX7A 4J9GA 2DK3A 5LJ5f 5GAOp 1VQ7Q 1PKTA 4AT1B 3RERA 5IXBA 2NUTB 1OU9A 4CC2A 1WIEA 3C95A 1X2KA 1K76A 1V1CA 2BUDA 3M4GA 4WTOB 1M1KC 1VQPT 3IQLA 2E4HA 3EGXA 2W0ZA 3JCMP 2GCXA 4JLGA 1RI0A 4NS5A 3M53A 4C0DC 3META 8ATCB 3NTIA 4GLMA 2D6FA 3VKIA 4M77B 3BE3A 5D6XA 1YITQ 1MV3A 3I56Q 5CVIA 2EKHA 3SHWA 3H8ZA 3VS5A 4A54A 2DPPB 4M78A 2DL5A 3CCSA 3RMSA 1T0JA 2YUQA 3CCQT 3OMCA 1PWTA 4NL3A 5IHNA 2HSEB 3MHXA 3JB9H 4M7DF 4PL6A 2CZ6B 2EVRA 5IHIA 3LYIA 2RI5A 3A8MB 1YBYA 2OAWA 2VXEA 5FRMA 3JCMh 2JTEA 4RTYA 1JRIA 4AG1C 4C8QC 2CP7A 2RQRA 4X1VA 8AT1B 4EMKA 4M7DG 1OPLA 2KQWA 4B9XA 1RACB 2DIGA 5GMKe 1VQKA 1XQHA 1TTHB 1SRLA 3M57A 2MOXA 2XICA 3P8BB 4M7AF 1BI2A 2QQSA 5IH2A 2FYKA 2QA4T 1B7TA 1M1KR 1U1SA 3EG3A 4JZ3A 3CC2T 1E6GA 1H3ZA 3FRNA 3FIFA 2JVVA 5LJ5d 4A4FA 1YJ9Q 2WSFE 3JCMc 4M7AG 4DBHA 2X4YA 4D8DA 2ZGWA 4JJDA 2V8KA 3JB9F 4FW2A 4J9HA 2K57A 4ZN3A 2CYZB 2JTMA 1B34B 3V8JA 1Y7XA 1X75C 3WXMB 1H8KA 2EJGA 5GAOl 3CPFA 2JTFA 3CD6Q 2J6OA 4Z8AA 2ZZDA 2EJ9A 1QQJA 1GCQC 2CZ1B 5GANf 3M58A 4NL2A 1QMCA 3JB9G 1HSQA 1X27A 1RL2A 3RBBB 4IKFA 2ZPHB 1YI2A 1AZEA 3OYNA 1WLPB 1VQLA 4OMPA 3EG1A 3H0IA 2KGTA 3CCST 4OB3B 2K5FA 4ELZC 3GP8A 3VS6A 2HL5C 1N6AA 2P0KA 2PZ1A 4PJOD 4B6MA 2X51A 1JXOA 2I2LA 3QZ5B 1GRIA 2EGEA 2CZ0B 3CC4Q 3SWNA 3AT1B 1TOVA 2E10A 5I11A 4LD6A 1OU8A 4HVVA 1PC0A 1EFNA 3SD4A 4JRIA 1CSKA 3CCMQ 1BYMA 3SWNB 1VYTA 1M3BA 2QASA 1PD1A 4A4GA 3LH0A 1SHFA 2HMAA 2KR3A 2XDBA 2KT1A 1M2VB 3INZA 4J9FA 2QQRA 1VQ9T 3M54A 1MMNA 4UC4A 3RUXA 4E47A 4LXCA 5EC7A 1SRMA 2DILA 2DF6A 3G4ST 1NG2A 2ZPBB 6AT1B 1VQ5A 2VC8A 2YRDA 2DLPA 1WHKA 2K7AA 4F7UB 1PRLC 2DXBA 2JMCA 2RQVA 1TU0B 2KT8A 4CC3A 3QWXX 2RD1A 1SSHA 3CXCP 4Y28E 1SF9A 1CKBA 2OI3A 3CC7Q 5FU6C 1AWJA 4LN2A 2KRMA 3OYCA 2EQMA 3LWHA 1VUBA 3PFSA 3GOXA 4EMGA 5L23A 2XIDA 4N4IA 1S1NA 1VQPQ 4O6JA 3KBGA 2JN0A 3SFMA 2K4YA 1M90C 2NUPA 1K9MU 1RAIB 4BUGA 4ZGDB 1YITA 3I56A 1ZUUA 1VQLT 1TWBA 1GFDA 3CPWA 5FWCA 3CCRT 2CUDA 2NUPB 4IIMA 2RO0A 1QLYA 1G3WA 1K73C 1VQMT 2VUBA 1QVFS 2RJCA 3S3MA 1RAGB 4A53A 2KEAA 1WJQA 2L8DA 5CKDA 2R5MA 1NEBA 3CBOA 1LJOA 2EYXA 2CDTA 3JCMV
chains in the Genus database with same CATH topology
3RESA 4M7AA 5FU7C 4M78F 5LL6S 2KK4A 3RKXA 4M78D 4C5EA 4RMOA 4HT8A 3GNGA 3MP6A 3E9GA 2LNVA 1XOVA 3QSUA 2LVMA 1M1GA 3MEWA 1KQSS 1FX7A 1M8VA 3CPWS 1WPYA 2FB7A 3CCRA 3CCUT 2EQUA 1UGPB 1VQMA 4BD3A 3UPUA 4Q5WA 2M16A 3BDUA 2FL7A 1W2BA 3OBYA 3M59A 4KUDK 3BW1A 3FB9A 3TU4K 5LJ3f 4IUVA 2VGNA 2K2VA 3Q1JA 4M78G 2MAMA 2LQKA 1AHJB 4M77E 3VV0A 1KHIA 3UT1A 2DD5A 4QVZA 5HK0A 3L42A 3L2VA 3TREA 3G6ET 3HRUA 4XTUA 4J8OA 3MO8A 2F5TX 4HCBA 1UEBA 4VUBA 4C0ZA 4J6WA 2P4TA 3C4SA 4QW2A 3JSCA 3CCUA 4XU1A 1IZ6A 2QXFA 4XK8E 5CQYA 5D6YA 4XTYA 1G3SA 3CCJT 4C92E 4BY6B 2MF2A 3N5BB 4C8QE 5KCOA 3OYMA 1MHNA 1WNLA 2DTIA 2HBPA 2HNIA 5FLXE 5C0MA 2E1HA 1WQ7A 3CD6T 4JRKA 2QQBA 5GAOq 3OYYA 3X28B 4J6YA 4M75F 2M9UA 5GANg 4M75D 5FROA 5IAYA 3OS1A 1TH7A 3L2RA 1YJ9A 3QUIA 1QVGA 2LDMA 3TEEA 2CS7A 4RCCA 3JCMQ 1VQPA 2DAQA 3MEVA 3G6EA 3HFNA 4LDXA 3JCMg 1NPPA 2LRQA 4EDUA 3KXTA 2PQWA 3EFSA 4ZN1A 3OYDA 4QQGA 2QEXT 3HP9A 1X6OA 3QBYA 2DXUA 4RG8A 3L2ZA 1OYXA 5GAOn 4F7UA 3CCJA 1Q86U 2QDYB 4M78B 4BY6C 3L2QA 4PLLA 4JRPA 2EAYA 4QQ6A 2MMPA 2PVOB 1UGRB 1ZBXA 4ZTFA 5GAMe 4R55A 4E7LA 5FRNA 1VQNT 1ZHIA 3M4YA 3M5AA 3C12A 1QP2A 3M56A 4M75G 4PJOA 1P92A 4HKEA 3JCMe 2LT1A 4XTVA 5I2SA 4JS4A 1GXIE 3PIPA 1Y07A 3WVEB 1QVGS 4PJOB 3JCMb 5LJ5h 2BKDN 1WJRA 3QZ9B 4WF2A 4BDZA 2X4XA 2EKOA 3PMTA 5LJ5j 4KUIA 3GNFB 4BDYA 4MZPA 5GMKh 3CCQA 3JAME 3NTKA 4FIBA 4A4KA 3JCMW 3NFCA 3JCMX 2YLBA 3PGGA 3V7SA 2KDSA 5IT9E 4JLIA 4M78C 3CC4T 4KULA 3OS5A 4N4GA 1VQ4A 4C5IA 2RHZA 4BE0A 4OB0B 4LDUA 2XI9A 4FL6A 2EFIA 1EIFA 3JB9J 5GAN4 2EQKA 2XKOC 1Q82U 1VQNA 1YIJA 5L8RE 1NJIU 2OTLT 5GAMd 2DD4A 3GPLA 1M1FA 2F5KA 3I55T 2ZPFB 3CCMT 3A8LB 3OSVA 4EMKB 4Z02A 2GFAA 5EG2A 1N9RA 1S72T 1KD1C 4P5NA 1HK9A 2JOYA 2XU8A 4C5GA 4PJOC 1G5VA 3OA6A 3GIBA 1KG1A 2GF7A 1NPRA 3CBPA 4N0AA 4XU0A 5A0GA 3OS2A 2RI2A 3VYGA 4KT0E 1UGQB 2CZ7B 2RI3A 4M75B 1N27A 3J80E 1QVPA 1V29B 1Q7YU 2IVWA 4M77F 1O75A 1SSFA 4M7DE 2OAUA 4DQ2A 3CC4A 4M77D 4TVRA 2EWNA 3FJPA 5GMKi 4HCCA 2LT4A 2R58A 3SDZA 2P0QA 4PKCC 3LGLA 2E41A 3OYFA 1KQ1A 2GQVA 2M0OA 2LTOA 2OTLA 2RK2A 4X34A 2KY9A 5LJ3d 4J5YA 4EMKC 4QVCA 5GAN5 4NOYA 3X24B 3I55A 1KC8U 1M90U 2ZPEB 4JJNK 1S72A 2RHUA 1BI1A 2QI2A 2XD0A 2E6ZA 2JZ2A 3QDRB 1JJ2A 3M55A 4OP0A 4C92F 3KUFA 3OYGA 2QA4A 4C8QF 5CO7A 4C92D 2R57A 3OW2S 3H6ZA 4DA4A 2RHYA 4C8QD 4M77G 2K3YA 1K8AU 3A8HB 3HL8A 4OVAA 4M75C 4LDVA 3FDRA 2H3JA 2KSSA 4PNOA 5CR2A 3CC2A 3TCJA 1K73U 3S6WA 2DO3A 5AYFA 4ME7A 4MMLA 4N0AC 3UDCA 2QTXA 1BIAA 2RK1A 2FHDA 4FM4B 3MEAA 3CC7T 2Y4XA 4X9CA 3A8GB 4M7AE 2CKKA 1M5Q1 4C0DB 3UWNA 4BE2A 2MI6A 2DK3A 1Q81U 2JNGA 5LJ5f 1Y96A 5GAOp 5GAOm 4C92G 2YHTA 3RERA 4C8QG 2PUOB 4XTZA 5A0DA 4J7IA 3A5ZB 4J83A 1JJ2S 2L89A 3J7AF 3C95A 1YJ9T 1Y96B 1M1KC 2BUDA 1BI3A 2EQJA 3M4GA 2B8AA 1VQPT 3E9FA 3A8OB 2RHIA 1N9SA 2E64A 2EIFA 4RCBA 2GCXA 4JLGA 3JCMP 1RI0A 4NS5A 4OMFB 4HT9A 1IREB 3M53A 3OS0A 1BKBA 4B9WA 3CC7A 4C0DC 5GAN6 3META 3QPHA 2DIQA 1WQWA 2L5QA 3GLXA 3NTIA 1NZ9A 4JDSA 3QHSA 5CKBA 3VUBA 1VIFA 5GAN7 2D6FA 3VKIA 1JBMA 1FWZA 4M77B 3MP1A 5CCAA 5D6XA 4BACA 2WACA 2QQAA 2X35A 5CVIA 2PVDB 3H8ZA 2ZPIB 4A54A 2DPPB 5GAMg 1OI1A 1KQ2A 2LQ8A 4L59A 4M78A 5J3BA 4ZGEB 3CCSA 4MMKA 3RMSA 4IUQA 4J7FA 3PT9A 3QKJA 3CCQT 3V7CA 3OMCA 2DXCA 3CBMA 1OZ2A 3P8DA 4C8QB 3S3OA 4NL3A 3PIOA 3DLLA 2D9TA 3OYEA 1VIEA 2Y90A 4FU6A 4A4EA 4RG2A 1VQ4T 3MHXA 1I8FA 3JB9H 2X4WA 4IUTA 5GAN8 4HA8A 4M77C 3DB3A 3ME9A 2WSCE 1N8RU 4M7DF 4PL6A 2CZ6B 3V7RA 1YIJT 1VQKT 4LDYA 4M7DD 3JCMJ 4ELYC 3ZBDA 3LYIA 2RI5A 5GANh 5HKCA 3A8MB 3QJ6A 4F7UE 1YBYA 5GANj 2VXEA 3DLMA 4XU3A 5LJ3g 2QQ9A 3QYGB 3MEUA 5FRMA 4PJOE 3JCMh 5KH6A 3OBWA 5GMKm 2E5QA 1JRIA 4A4HA 4C92C 4C8QC 2VV5A 1WJSA 4BB7A 2CGHA 4OB1B 3CCVA 5CIUA 3OYHA 3HRSA 3URGA 4CRIA 4EMKA 4M7DG 2KQWA 3RKYA 4B9XA 4MDWA 1X01A 5LJ3e 5I21A 5GAN2 1M9SA 4XTXA 2DIGA 2E65A 5GMKe 2C06A 5J26A 4JRQA 1XQHA 1VQKA 4V2SA 1MGQA 4EPCA 1Q82C 2NLUA 4JUVA 5DLOA 4GY5A 3QG1A 2RJFA 3M57A 2XICA 1R8OB 3P8BB 3QIIA 4M75A 1HXDA 4II1A 3L2UA 1VQ7A 4M7AF 1BI2A 1ZQ1A 2QQSA 4FT4A 3OW2A 2FYKA 5I2MA 4M7AD 2QA4T 5GAOr 3LWIA 2YRVA 4LD9K 3V8LA 4OF1A 2LCCA 2XHCA 4O5VA 4C0FA 2RJEA 1G3YA 1U1SA 2E70A 3CC2T 2MWOA 1YJWT 3O8VA 5A2QE 1BIBA 1I81A 2L3RA 3CMAT 1K9MC 1WGSA 4GLKA 5CQXA 2FVUA 5GANd 2K3XA 1U1TA 3MCAB 3QYHB 1FXXA 4EMHA 3CCET 1H641 4E7IA 3FRNA 3FIFA 3VJPA 3X26B 1KD1U 3DKMA 2JVVA 3ASKA 3F70A 5LJ5d 4MDXA 2YLCA 1PSFA 4A4FA 1U8RA 4QVDA 2WSFE 3OYKA 3JCMc 4M7AG 3VU3C 4Y91A 2X4YA 1XNIA 2E12A 2HD0A 4PLIA 3J81E 2ZGWA 3BDLA 3HKSA 1KC8C 2V8KA 3HHTB 1LOJA 3JB9F 3OYLA 1YI2T 4C0GA 3JB9D 1YJNA 2F69A 2K57A 4ZN3A 3E19A 2CYZB 2JTMA 1W4SA 4M7DB 5DY9A 1B34B 3V8JA 3VUZA 1Y7XA 4QQDA 1YJWA 1X75C 2A7YA 3WXMB 2LX9A 2EJGA 5GAOl 1QW1A 3CPFA 3CMAA 4HCZA 5HK3A 2DKGA 1D3BB 1YHQA 2JTFA 5GAN3 1M4ZA 3CCEA 2ZZDA 2EJ9A 3LW5E 2CZ1B 5GANf 4DOWA 2JUFA 4J6XA 3M58A 5J39A 4E7JA 2OTJT 1KHCA 4ATOA 1VQ6A 4JS5A 2V8JA 4NL2A 3G7ZA 4L6V5 3JB9G 1I4K1 5HY6A 3JCMf 1RL2A 4IKFA 4IURA 2V8IA 2ZPHB 5M9OA 1YI2A 2K5IA 3M9QA 3OYNA 4M7DC 3CMEA 3G71A 1VQLA 3LX7A 3NTHA 1VQOT 3CCST 4OB3B 2K5FA 5DLQE 1VQ8A 3WVDB 4ELZC 4F7UF 4M7AB 3RMQA 1JB0E 4M77A 3GP8A 4MZMA 4XTWA 2OTJA 1I5LA 4PJOF 2EYQA 3JB9I 2RA2A 2AHJB 2GFUA 4FT2A 1N6AA 2P0KA 4PJOD 2RB6A 2I2LA 3QZ5B 2KMTA 2WSEE 2E6NA 4N4HA 1M1KU 3CEYA 2DTOA 5DM7R 2VXFA 2HQXA 2CZ0B 4C92A 4OB2B 4C8QA 2P0PA 3SWNA 4F7UG 2E10A 2PU9B 2DEQA 5CKFA 1VQOA 2RM4A 4LD6A 4M7AC 4PJOG 3OY9A 4OGCA 3BY7A 4C92B 3SD4A 4JRIA 2HAXA 1BYMA 3CCVT 3SWNB 3C94A 3OMGA 3FLGA 4CI0C 3OB9A 5CKHA 4ZGJB 1W2BS 3EAEA 2XG8D 3PMIA 1VQ5T 2KAFA 4M78E 4KBMB 1UB4A 3LH0A 4A4GA 1QP3A 1Q86C 2XDBA 3PNWC 4MZTA 3INZA 5CKEA 5GMKl 1UGSB 3HSBA 1YCYA 2QQRA 3L1AA 5CK9A 2LCLA 2PUKB 2EJFA 3S3NA 1VQ9T 1N8RC 3HPWA 2RHXA 4L5GA 5LJ5g 5IN1A 1VQ7T 1O9SA 2O4XA 3M54A 4UC4A 3RUXA 5GAMh 2DVEA 1DJ7B 4E47A 2DZCA 3CXCA 4E7KA 5GAMj 4BI3A 1H3ZA 5FU6B 4FSXA 4DOVA 5GANe 3SWNC 3G4ST 2O4XB 1NE8A 4LDWA 3ZEHA 3BFMA 3DB4A 2PVGB 3FEOA 3QO3A 3RKWA 2RJDA 3V8KA 5KE3A 2ZPBB 5LJ5e 4BI8B 1VQ5A 2DZ9A 4ZTJA 2VC8A 3CD6A 1LNXA 3RIRA 4F7UB 2DXBA 2XK0A 5KE2A 3GF5A 3OYAA 2RH2A 4X9DA 1VQ9A 5KCHA 1NJIC 5C6SA 2RD1A 4XQ3A 3PTAA 2BIVA 5LJ3h 2MWPA 3HFOA 1YJNT 3CXCS 4Y28E 3X20B 2XDDA 5FU6C 5LJ3j 1YITT 3I56T 1PSEA 4D6WA 2DXTA 2QEXA 2DJZA 5GMKj 3OYCA 3OSSC 3ZFJA 5D6WA 3QXEB 3OYJA 3G4SA 3P8HA 2KVQG 2EQMA 2LC4A 2ZCFB 4IUPA 1VUBA 3OQ5A 4M75E 2D0QB 3LWHA 4BE1A 1YHQT 3OYBA 2O01E 3PFSA 2K5LA 2VGMA 3GOXA 1Q7YC 4YTLA 1QVFA 3VYHB 3LLRA 3CCLT 4EMGA 1VQ6T 2XIDA 4N4IA 4E7HA 4M7DA 3JCMd 2IG0A 1B34A 4O6JA 4XU2A 3KBGA 3T9NA 2JN0A 4RKUE 3SFMA 4R56A 3SB2A 2K4YA 3LGFA 2XDPA 4IUUA 1M90C 1D3BA 1BI0A 5CAIA 4BUGA 1K9MU 5FU7B 3FC3A 4ZGDB 3EFRA 1YITA 3I56A 3CMET 2DTHA 3HRTA 3G71T 4XAXB 1XTDA 1Y71A 1VQLT 3L2WA 2ZPGB 1KQSA 2Y4YA 3ER0A 1K8AC 3CPWA 1VQ8T 2M1HA 3CCRT 2R5AA 4C5HA 2HQEA 3OYIA 2RO0A 1K73C 1G3WA 3QJYA 3E1SA 1VQMT 2VUBA 1QVFS 2RJCA 3S3MA 3CCLA 4BI4A 2VYTA 2G3RA 4OGEA 4A53A 3CCMA 1WJQA 5GAMf 1G3TA 2X4JA 2L8DA 3MP8A 3JRZA 5CKDA 2R5MA 3CBOA 1LJOA 3JCMV 3R6OA 3X25B 3AHUA 1Q81C 1OZ3A 5A0LA 2A3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RES A;  5GAN j;  4C92 A;  2VXE A;  4M7A A;  4N0A A;  4M78 F;  4XU3 A;  4C8Q A;  5LJ3 g;  4XU0 A;  3RKX A;  3SWN A;  5GAO p;  4M78 D;  2E10 A;  4F7U G;  4PJO E;  3JCM h;  4HT8 A;  2DEQ A;  5GMK m;  4M75 B;  2RM4 A;  1JRI A;  4C92 C;  3QSU A;  4M7A C;  4M77 F;  4PJO G;  4C8Q C;  4M7D E;  4DQ2 A;  1M8V A;  4M77 D;  1WPY A;  2CGH A;  2EWN A;  2FB7 A;  3BY7 A;  3FJP A;  4JRI A;  4C92 B;  5GMK i;  3SWN B;  4EMK A;  4M7D G;  3RKY A;  2E41 A;  3BDU A;  1KQ1 A;  1X01 A;  5LJ3 e;  4M78 E;  5I21 A;  3BW1 A;  5GAN 2;  3FB9 A;  4XTX A;  4J5Y A;  5LJ3 d;  2E65 A;  5LJ3 f;  4NOY A;  4EMK C;  4QVC A;  3INZ A;  5GMK e;  5GAN 5;  1MGQ A;  3HSB A;  5GMK l;  4V2S A;  1YCY A;  4M78 G;  4JUV A;  3L1A A;  4M77 E;  4M75 A;  2EJF A;  4OP0 A;  4C92 F;  4M7A F;  1HXD A;  4C8Q F;  4C92 D;  5LJ5 g;  4M7A D;  2FYK A;  3RUX A;  4C8Q D;  5GAM h;  5GAO r;  2DVE A;  4M77 G;  3V8L A;  2DZC A;  4XTU A;  4M75 C;  4PNO A;  5GAM j;  1U1S A;  1BIB A;  1I81 A;  4J6W A;  4MML A;  4N0A C;  2QTX A;  1BIA A;  4XU1 A;  5GAN e;  3SWN C;  3BFM A;  3V8K A;  1U1T A;  3QO3 A;  4XTY A;  3RKW A;  4EMH A;  4X9C A;  1H64 1;  4C92 E;  4M7A E;  3FIF A;  1M5Q 1;  4C8Q E;  5LJ5 e;  1WNL A;  2DTI A;  2DZ9 A;  2HNI A;  2VC8 A;  2YLC A;  5LJ5 f;  1LNX A;  1Y96 A;  2E1H A;  4QVD A;  5LJ5 d;  1WQ7 A;  3JCM c;  4C92 G;  3RIR A;  2YHT A;  4F7U B;  5GAO m;  4JRK A;  4Y91 A;  3VU3 C;  4C8Q G;  5GAO q;  4XTZ A;  3RER A;  4J6Y A;  4M75 F;  2ZGW A;  4X9D A;  5GAN g;  4M75 D;  1TH7 A;  1LOJ A;  3JB9 F;  3QUI A;  2RD1 A;  4XQ3 A;  3JB9 D;  4RCC A;  2K57 A;  3JCM Q;  1Y96 B;  5LJ3 h;  3M4G A;  3HFO A;  3HFN A;  4M7D B;  5DY9 A;  1B34 B;  3V8J A;  3JCM g;  5LJ3 j;  1N9S A;  2E64 A;  3EFS A;  2DXT A;  2DJZ A;  2EJG A;  4RCB A;  5GMK j;  5GAO l;  3JCM P;  4HT9 A;  2DKG A;  1D3B B;  2DXU A;  3L2Z A;  5GAO n;  4M75 E;  4F7U A;  5GAN 3;  4M78 B;  5GAN 6;  2EAY A;  2EJ9 A;  4M7A G;  5GAN f;  1WQW A;  4J6X A;  5GAM e;  4M75 G;  3QHS A;  5GAN d;  5GAN 7;  4PJO A;  4NL2 A;  4EMG A;  1JBM A;  4M77 B;  3JB9 G;  3JCM e;  4XTV A;  4M7D A;  3JCM d;  1I4K 1;  4XU2 A;  1B34 A;  3JCM f;  2JN0 A;  3SB2 A;  4A54 A;  3JCM b;  5LJ5 h;  4PJO B;  4M7D C;  1D3B A;  4WF2 A;  5GAM g;  1KQ2 A;  5CAI A;  4M78 A;  5LJ5 j;  3EFR A;  4MMK A;  2DTH A;  5GMK h;  3JCM W;  3JCM X;  2YLB A;  3PGG A;  3V7C A;  3V7S A;  4F7U F;  4M7A B;  4JLI A;  4M78 C;  4M77 A;  4C8Q B;  4NL3 A;  4XTW A;  2Y90 A;  1I5L A;  4PJO F;  3JB9 I;  2RA2 A;  1I8F A;  3JB9 J;  3JB9 H;  5GAN 4;  4PJO D;  5GAN 8;  4HA8 A;  4M77 C;  4A53 A;  2RB6 A;  5GAM d;  5GAM f;  4M7D F;  2I2L A;  3V7R A;  4M7D D;  4EMK B;  3JCM J;  1LJO A;  3JCM V;  1N9R A;  3AHU A;  5GAN h;  1HK9 A;  2DTO A;  2VXF A;  4PJO C;  4F7U E;  3GIB A; 
#chains in the Genus database with same CATH topology
 3CCQ Q;  5FU7 C;  2KK4 A;  4M78 D;  4HT8 A;  2LNV A;  2LVM A;  1M1G A;  2CRE A;  1KQS S;  1AZG B;  3RNJ A;  3D7S B;  1WPY A;  1M8V A;  2ATC B;  2EQU A;  1UGP B;  1IHW A;  2FL7 A;  2CSI A;  3VRZ A;  1UHC A;  4IUV A;  1AHJ B;  3VV0 A;  3UT1 A;  3TRE A;  2CP0 A;  1EZZ B;  4DEY A;  4J6W A;  4XU1 A;  4FYW B;  4XK8 E;  5D6Y A;  1G3S A;  1HD3 A;  2F2X A;  3RR6 A;  2A37 A;  4BY6 B;  1E6H A;  1U5S A;  2MF2 A;  4C8Q E;  1MHN A;  1ZSZ C;  2COW A;  2HBP A;  1UDL A;  2E1H A;  1WQ7 A;  2QA4 Q;  2QQB A;  1U3O A;  5IAY A;  1YJ9 A;  2FZC B;  2DAQ A;  1YHQ Q;  4K11 A;  2LRQ A;  4EDU A;  3EFS A;  4ZN1 A;  1TUC A;  2DBM A;  2O9S A;  3QBY A;  4LUE A;  2QAZ A;  1WHG A;  5GAM e;  1KSW A;  1K73 R;  3M5A A;  1QP2 A;  3JCM e;  5I2S A;  2LQN A;  1VYV A;  3WVE B;  3ZL7 C;  1QVG P;  2HKQ B;  1G2B A;  1YP5 A;  2X4X A;  5LJ5 j;  4KUI A;  5GMK h;  3NTK A;  2YLB A;  1WHH A;  2V1R A;  4M78 C;  1M8M A;  4C5I A;  4BE0 A;  1PHT A;  4OB0 B;  4LDU A;  4IIO A;  4FL6 A;  3JB9 J;  1EIF A;  1W70 A;  2K3B A;  4FYV B;  2DD4 A;  1N9R A;  3TQ7 P;  4C5G A;  2XU8 A;  2BE7 D;  3PVQ A;  4OMN A;  1ZSG A;  3GIB A;  1WI7 A;  3OS2 A;  2RI2 A;  4LNP A;  1N27 A;  2OAU A;  3CC4 A;  3H41 A;  9ATC B;  3FJP A;  2LT4 A;  2CP3 A;  3SDZ A;  2KRO A;  3OYF A;  4EMK C;  4NOY A;  2CT3 A;  1K0X A;  3M55 A;  4OP0 A;  4C8Q F;  2R57 A;  2H3E B;  2K3Y A;  3A8H B;  1Y57 A;  2DFU A;  2DO3 A;  3UDC A;  1LCK A;  2KXC A;  1PRM C;  2DM1 A;  1VA7 A;  2Y4X A;  3UWN A;  4BE2 A;  1VQ9 Q;  2JNG A;  5GAO m;  2A36 A;  1ZUK A;  4C8Q G;  4OMO A;  4J9C A;  4J83 A;  2YWW A;  2F1L A;  2L89 A;  1YJ9 T;  2ED1 A;  1OV3 A;  3G4S Q;  1N9S A;  2EIF A;  3A98 A;  4RCB A;  4RTW A;  4HT9 A;  2KNB B;  4B9W A;  3CC7 A;  5KYW A;  1WQW A;  1SKU B;  5CKB A;  2FRY A;  1JBM A;  2JS0 A;  5CCA A;  1LPL A;  4Z88 A;  2E5K A;  5KYW B;  2QQA A;  5GAM g;  1OI1 A;  1ABO A;  2YT6 A;  4IUQ A;  4J7F A;  3QKJ A;  3SEM A;  3V7C A;  3M0U A;  3ULR B;  3S3O A;  2GQI A;  2D9T A;  1VIE A;  2Y90 A;  4A4E A;  2KE9 A;  2L0A A;  2X4W A;  1G8X A;  4FYX B;  5HKC A;  3QJ6 A;  1VQL Q;  1G83 A;  2EYY A;  5GAN j;  1C6V X;  5LJ3 g;  1RUW A;  2QQ9 A;  3MEU A;  3CCR Q;  4PJO E;  2DMO A;  5AT1 B;  1OUL A;  3OBW A;  5KH6 A;  1VQM Q;  1NYF A;  1WZO A;  3CCV A;  3HRS A;  3URG A;  4CRI A;  1VOM A;  1CKA A;  3EG9 B;  1FMK A;  2C06 A;  2E65 A;  4V2S A;  5KYU A;  2NLU A;  3EFO A;  5KYY A;  4JUV A;  4GY5 A;  4ANJ A;  4M75 A;  3L2U A;  1HXD A;  5GAO r;  2YRV A;  4LD9 K;  3EG2 A;  3V8L A;  1UG1 A;  2EPD A;  2LCC A;  2VB6 A;  2XHC A;  4O5V A;  5KYU B;  5KYY B;  1WYX A;  2E70 A;  2L3R A;  1K9M C;  1AOJ A;  5CQX A;  2K3X A;  1FXX A;  2FO0 A;  1H64 1;  4E7I A;  1B07 A;  3DKM A;  3F70 A;  2YLC A;  4QVD A;  3VU3 C;  2E12 A;  2HD0 A;  4RTZ A;  3HKS A;  1F1B B;  2CH4 A;  1YJN A;  3E19 A;  4M7D B;  5DY9 A;  4QQD A;  3PVL A;  2A7Y A;  1QW1 A;  4HCZ A;  2DKG A;  1D3B B;  1YHQ A;  3EGD A;  5GAN 3;  2NUT A;  2HBW A;  3LW5 E;  2OTJ T;  4LE9 A;  4ATO A;  5ECA A;  1VQ6 A;  1E7O A;  2V8J A;  3G7Z A;  1RAD B;  3EGD B;  1I4K 1;  3JCM f;  2QG9 B;  1X43 A;  1UEC A;  5D7U A;  3WVD B;  4M7A B;  1YIJ Q;  1YFN A;  4M77 A;  4XTW A;  2FZK B;  2J6F A;  1I5L A;  4PJO F;  3JB9 I;  2DL4 A;  2YSQ A;  4HCK A;  5GJV B;  2KMT A;  2WSE E;  2E6N A;  4N4H A;  4CC7 A;  1IB8 A;  3CEY A;  4C92 A;  4OB2 B;  1H3H A;  3EH2 A;  2PU9 B;  4KH0 B;  4PJO G;  4C92 B;  1K9M R;  1UJ0 A;  3CCV T;  5CKH A;  4ZGJ B;  1OQK A;  3EAE A;  2XG8 D;  4M78 E;  4KBM B;  4GBQ A;  1QP3 A;  2L3S A;  3EGU A;  4MZT A;  3HSB A;  5GMK l;  1M30 A;  1UGS B;  3L1A A;  2EJF A;  2KYM A;  2ROL A;  3HPW A;  3KFV A;  2COY A;  5IN1 A;  1O9S A;  1AT1 B;  2MK5 A;  3FJ5 A;  5GAM h;  1DJ7 B;  2MPX C;  3CXC A;  1XJW B;  4E7K A;  4HVW A;  4PFP A;  3G1J A;  3ZEH A;  3FEO A;  3I35 A;  2RJD A;  4J9E A;  5KE3 A;  2DER A;  1QCO A;  2XK0 A;  5KE2 A;  3GF5 A;  3OYA A;  1VQ9 A;  3EH1 A;  5LJ3 h;  1HJD A;  1YJN T;  2RF0 A;  1PSE A;  4D6W A;  5GMK j;  1D0X A;  3QXE B;  3G4S A;  2KVQ G;  3I5R A;  4IUP A;  2EYZ A;  1YHQ T;  2FZG B;  1UHF A;  2O01 E;  2DRK A;  4YTL A;  2ECZ A;  3VYH B;  2DL3 A;  3CCL T;  2ZAE A;  1VQ6 T;  2X3W D;  4E7H A;  3JCM d;  1B34 A;  4J9D A;  4RKU E;  3LGF A;  4IUU A;  1YWP A;  1R0C B;  1OX9 A;  1JEG A;  3UF4 A;  4XAX B;  3L2W A;  4AFS C;  1TSF A;  2M1H A;  4C5H A;  3OYI A;  3QJY A;  1QVF P;  4QT7 A;  2VYT A;  2G3R A;  2X4J A;  1AWO A;  3MP8 A;  1C0M A;  3JRZ A;  5GJW B;  3R6O A;  3X25 B;  4OMF B;  1BB9 A;  4M78 F;  3RKX A;  3VS0 A;  3GNG A;  3MP6 A;  3E9G A;  2BTT A;  1KQS P;  3VS4 A;  3CCR A;  1AWW A;  1IGU A;  1VQM A;  3UPU A;  4Q5W A;  2M16 A;  1W2B A;  4KUD K;  2DYB A;  2XMF A;  4M78 G;  7AT1 B;  1UJY A;  2DD5 A;  5HK0 A;  3L42 A;  3L2V A;  3G6E T;  3HRU A;  1KFZ A;  2O31 A;  3H0F A;  4J8O A;  4C0Z A;  3C4S A;  3JSC A;  3QWY A;  1M2V A;  1SEM A;  5CQY A;  3CCJ T;  4XTY A;  2M51 A;  1WNL A;  2DTI A;  1NBE B;  2HNI A;  1PG5 B;  5GAO q;  1RAE B;  4HXJ A;  4M75 D;  5FRO A;  3OS1 A;  2AK5 A;  3QUI A;  1QVG A;  2DJQ A;  2LDM A;  1PM3 A;  4RCC A;  3JCM Q;  1MMD A;  2YRC A;  3HFN A;  3OYD A;  4QQG A;  3HP9 A;  1X6O A;  5GAO n;  1OYX A;  4F7U A;  1Q86 U;  2QDY B;  4ZTF A;  1QWF A;  4E7L A;  3M56 A;  2Z0W A;  2LT1 A;  2E3I A;  1PNJ A;  3CME Q;  4RUG A;  1GXI E;  1Y07 A;  4D8K A;  3JCM b;  4BDZ A;  4MZP A;  3JAM E;  2OTJ Q;  4A4K A;  1OOT A;  3JCM X;  3O5Z A;  2KDS A;  4JLI A;  1VQ4 A;  2EQK A;  2GGR A;  2XKO C;  1YIJ A;  5L8R E;  1NJI U;  2F5K A;  3A8L B;  3NHN A;  2D8J A;  4J9I A;  1S72 T;  1HK9 A;  4PJO C;  1G5V A;  3OA6 A;  1KG1 A;  3VRY A;  2GF7 A;  1NPR A;  4N0A A;  1FYN A;  1X2Q A;  3VYG A;  1TUD A;  1Q7Y U;  1SSF A;  4AFZ C;  4M77 D;  3NMZ C;  1RI9 A;  1UGV A;  2M0O A;  4X34 A;  2V26 A;  4RTV A;  4J5Y A;  2DX1 A;  4QVC A;  3X24 B;  2LJ3 A;  2ZPE B;  4JJN K;  2RHU A;  2E6Z A;  2JZ2 A;  3QDR B;  3KUF A;  5CO7 A;  4C92 D;  5IXF A;  2QGF B;  2RHY A;  1K8A U;  4JJC A;  4M75 C;  3CCV Q;  3TCJ A;  2RK1 A;  2FHD A;  4X9C A;  3A8G B;  1RAA B;  2CKK A;  4C0D B;  1JQQ A;  1Y96 A;  1AVZ C;  2PUO B;  4OMM A;  1PCX A;  4J7I A;  2ABL A;  1JJ2 S;  4Y92 A;  1Y96 B;  4RTX A;  1BI3 A;  2EQJ A;  2J06 A;  2B8A A;  2RHI A;  1SHG A;  1IRE B;  3OS0 A;  1BKB A;  5GAN 6;  3QPH A;  2LZ6 B;  1OPK A;  3QHS A;  3VUB A;  5GAN 7;  1GBQ A;  1FWZ A;  2BZY A;  1R77 A;  1TXQ A;  1YJN Q;  2X35 A;  2ZPI B;  2RQU A;  1ZLM A;  2LQ8 A;  5J3B A;  4ZGE B;  4MMK A;  2HDA A;  3CCL Q;  3UAT A;  3CBM A;  4C8Q B;  1M3C A;  1VQ6 Q;  3PIO A;  3DLL A;  1PD0 A;  3OYE A;  4RG2 A;  1VQ4 T;  1I8F A;  1LVK A;  1BK2 A;  5GAN 8;  4HA8 A;  4M77 C;  3DB3 A;  1K9A A;  2WSC E;  1MMG A;  1YIJ T;  2DYI A;  3ZBD A;  1X69 A;  1EX4 A;  1SG5 A;  3DLM A;  3QYG B;  1NYG A;  1X6G A;  4LUD A;  2AKL A;  5GMK m;  2QGG A;  4A4H A;  4C92 C;  1WJS A;  4BB7 A;  2CGH A;  2C0T A;  5CIU A;  3OYH A;  1SPK A;  3RKY A;  2AZV A;  2P84 A;  4PJN A;  4MDW A;  1D1A A;  5LJ3 e;  5GAN 2;  4XTX A;  4JRQ A;  1MGQ A;  1QKX A;  5DLO A;  3QG1 A;  2J6K A;  2RJF A;  2CSQ A;  1R8O B;  4KH1 B;  4II1 A;  1D0Z A;  2DVJ A;  3OW2 A;  4FT4 A;  5I2M A;  2NUZ A;  3LWI A;  4C0F A;  2MWO A;  1YJW T;  1I5O B;  1BIB A;  3CMA T;  4GLK A;  3MCA B;  1U1T A;  3CCE T;  3VJP A;  3X26 B;  1KD1 U;  3ASK A;  1U8R A;  1XNI A;  3G6E Q;  2BE9 B;  2K6D A;  3BDL A;  4AMC A;  3QDF A;  3HHT B;  4C0G A;  2F69 A;  1W4S A;  3TSZ A;  3CCJ Q;  3VUZ A;  1UE9 A;  2LNH B;  4DOW A;  2JUF A;  4J6X A;  2GBQ A;  1ZUY A;  2B86 A;  3THK A;  4IUR A;  5M9O A;  2K5I A;  3M9Q A;  1NLO C;  1WXB A;  3CME A;  3G71 A;  3LX7 A;  2F2V A;  2P4R A;  3NTH A;  1VQO T;  5DLQ E;  1VQ8 A;  4HVU A;  2A0F B;  4AFU C;  4ZNX A;  4MZM A;  2GNC A;  4DBF A;  2OTJ A;  2AHJ B;  2GFU A;  1RLP C;  1YWO A;  2RQT A;  2H8H A;  4CC4 B;  2DTO A;  2JM8 A;  2VXF A;  1YNZ A;  3HTR A;  2V1Q A;  2P0P A;  2FG0 A;  5CKF A;  2RM4 A;  2RPN A;  4CI0 C;  1S72 Q;  1W2B S;  4JPB W;  2KAF A;  1UB4 A;  1Q86 C;  1D1B A;  4OML A;  4PJL A;  2RN8 A;  3PNW C;  1YCY A;  5CK9 A;  1N8R C;  2PUK B;  2RHX A;  5LJ5 g;  2O4X A;  1X6B A;  2DZC A;  5FU6 B;  3EG9 A;  5GAN e;  3SWN C;  2D8H A;  2O4X B;  1NE8 A;  2DE0 X;  3V8K A;  2PVG B;  3QO3 A;  2O88 A;  3VS2 A;  4BI8 B;  2JT4 A;  3LH5 A;  4WCI A;  2EYW A;  2RH2 A;  4X9D A;  2M0Y A;  2L2P A;  1NJI C;  3EG0 A;  4XQ3 A;  2ESW A;  1ACM B;  2BIV A;  2MWP A;  1C1A A;  1WHJ A;  3X20 B;  4PFZ A;  3H0H A;  2QEX A;  2DXT A;  3OSS C;  3ZFJ A;  5D6W A;  3P8H A;  4M75 E;  3NPF A;  3OQ5 A;  2JM9 A;  2LMJ A;  3U23 A;  3H9N A;  1IO6 A;  1Q7Y C;  1QVF A;  3LLR A;  1JO8 A;  1YCS B;  5I22 A;  1UUE A;  1W1F A;  4M7D A;  4XU2 A;  3T9N A;  4R56 A;  3SB2 A;  1ZA2 B;  2MCN A;  2YDL A;  1D3B A;  5FU7 B;  1QWE A;  3CME T;  3G71 T;  3HRT A;  2A08 A;  1XTD A;  1Y71 A;  2MIO A;  2ZPG B;  1ABQ A;  1KQS A;  2Y4Y A;  1T3S A;  1K8A C;  2COZ A;  1VQ8 T;  2R5A A;  1GFC A;  2HQE A;  2EGC A;  2HQH A;  3E1S A;  2K9G A;  3CCL A;  4BI4 A;  5GAM f;  1G3T A;  1Q86 R;  1M2O A;  3M0S A;  1IRX A;  3AHU A;  2GTJ A;  5A0L A;  1N8R R;  3RES A;  4M7A A;  5LL6 S;  2VAS A;  1VQ4 Q;  3QSU A;  1XOV A;  3M0R A;  1ZSZ A;  3VS1 A;  3CPW S;  2FB7 A;  3CCU T;  1D1C A;  4BD3 A;  3OBY A;  3M59 A;  3BW1 A;  1ZSZ B;  3TU4 K;  5LJ3 f;  1BCM A;  2K2V A;  3Q1J A;  1GBR A;  2LQK A;  4M77 E;  1KHI A;  2RNA A;  1NJI R;  4QVZ A;  4OMQ A;  3EHR A;  2ROT A;  4PFO A;  1WA7 A;  2DL8 A;  2F5T X;  4HCB A;  1UEB A;  2ENM A;  2CUB A;  4AFQ C;  1IGQ A;  1WHM A;  4C92 E;  3EGX B;  5KCO A;  3N5B B;  5C0M A;  1Q7Y R;  5FLX E;  3OYY A;  4M75 F;  2M9U A;  5GAN g;  2GTO A;  3UA6 A;  1YJW Q;  3CMA Q;  3G6E A;  1WDX A;  1UTI A;  3CCE Q;  2DRM A;  1NPP A;  2K79 A;  2QEX T;  2DXU A;  3L2Z A;  3CCJ A;  1K8A R;  4M78 B;  4BY6 C;  4JRP A;  2MMP A;  2PVO B;  1UGR B;  3TSW A;  4R55 A;  5FRN A;  1VQN T;  4M75 G;  3M4Y A;  1BU1 A;  1P92 A;  3R6N A;  2HL3 A;  4JS4 A;  4A63 B;  2CH4 W;  2D1X A;  5LJ5 h;  2KI7 A;  1WJR A;  3QZ9 B;  1MNE A;  2KYB A;  3JV3 A;  4FIB A;  3NFC A;  2DBK A;  3PGG A;  2VKN A;  4E6R A;  3OS5 A;  3M0Q A;  4N4G A;  2RHZ A;  2AT1 B;  5GAN 4;  1U06 A;  2OTL T;  5GAM d;  3GPL A;  3I55 T;  2ZPF B;  1ZX6 A;  2I0N A;  3OSV A;  4EMK B;  1MUZ A;  3MKD A;  4KGZ B;  4Z02 A;  1KD1 C;  1Y0M A;  1VQO Q;  2O9V A;  4ORZ A;  2EQI A;  4XU0 A;  4KT0 E;  2CZ7 B;  2RI3 A;  2LQW A;  2IVW A;  4M77 F;  2LX7 A;  3VS7 A;  2YUP A;  2EWN A;  4TVR A;  1KK7 A;  2FRW A;  1OX8 A;  2BZX A;  2E41 A;  1KQ1 A;  2GQV A;  5HCK A;  5FW9 A;  4DBR A;  2YUN A;  5LJ3 d;  1R0B G;  1RLQ C;  1S72 A;  1BI1 A;  2IPO B;  2QI2 A;  4C92 F;  3OW2 S;  3OYG A;  4F17 A;  3A1P A;  1VYU A;  2HSP A;  4M77 G;  3HL8 A;  3C0C A;  4OVA A;  3FDR A;  2H3J A;  5CR2 A;  2VWF A;  1TG0 A;  4FYY B;  2QTX A;  1BIA A;  4FM4 B;  3MEA A;  1M5Q 1;  1HYO A;  2MI6 A;  1Q81 U;  4C92 G;  2YHT A;  4PJM A;  4XTZ A;  1ARK A;  2LJ0 A;  5A0D A;  4QKU A;  3A5Z B;  1I07 A;  1JJ2 P;  3J7A F;  2YUO A;  2M02 A;  2X3X D;  3E9F A;  1TS9 A;  3A8O B;  2E64 A;  4KGX B;  4JZ4 A;  1T3L A;  2DET A;  3EHQ A;  4DBQ A;  1N5Z A;  2DIQ A;  1K1Z A;  2L5Q A;  3GLX A;  1NZ9 A;  4FW1 A;  4JDS A;  1VIF A;  3MP1 A;  1D0Y A;  4BAC A;  1TUG B;  4RTT A;  2WAC A;  1KIK A;  2CP5 A;  1KD1 R;  2RMO A;  2PVD B;  2FPD A;  1KQ2 A;  4DEX A;  4L59 A;  3PT9 A;  5FWB A;  1Z9Z A;  2QYZ A;  2FEI A;  2DXC A;  3P8D A;  1OZ2 A;  2JMA A;  4FU6 A;  4RTU A;  1M27 C;  2CP6 A;  4IUT A;  3ME9 A;  3REB B;  1N8R U;  3V7R A;  1VQK T;  4LDY A;  4M7D D;  3JCM J;  4ELY C;  5GAN h;  3G71 Q;  4F7U E;  2JJ9 A;  2W10 A;  4M4Z A;  4XU3 A;  1VQ8 Q;  2DL7 A;  2E5Q A;  2LJ1 A;  1UFF A;  2VV5 A;  4OB1 B;  4F16 A;  3VS3 A;  3E2U A;  1QCF A;  1X01 A;  5I21 A;  1M9S A;  3I9Q A;  5J26 A;  4EPC A;  1NLP C;  1Q82 C;  2NYS A;  3QII A;  1VQ7 A;  1ZQ1 A;  4M7A D;  3CCU Q;  4OF1 A;  2RJE A;  1G3Y A;  2X9H A;  3O8V A;  5A2Q E;  1I81 A;  1WGS A;  2FVU A;  5GAN d;  4EMH A;  3QYH B;  4MDX A;  5IHK A;  1PSF A;  2PNI A;  3OYK A;  4Y91 A;  4PLI A;  1IHV A;  3J81 E;  4ESR A;  1KC8 C;  1LOJ A;  3OYL A;  1YI2 T;  3JB9 D;  4E7S A;  1YN8 A;  4AG2 C;  1YJW A;  2CP2 A;  2LX9 A;  3CMA A;  5HK3 A;  3UA7 A;  1QKW A;  3CCE A;  1M4Z A;  2HKN A;  5J39 A;  4E7J A;  1KHC A;  4JS5 A;  4L6V 5;  4PK4 A;  2AIR B;  2FPF A;  5HY6 A;  2V8I A;  2QEX Q;  4M7D C;  1WFW A;  2D0N A;  2L3Q A;  4E2F B;  1VQN Q;  4F7U F;  3RMQ A;  1JB0 E;  1NEG A;  2YXY A;  1T0H A;  2K2M A;  1W6X A;  2JXB A;  2EYQ A;  2RA2 A;  4FT2 A;  2AZS A;  1MV0 B;  2LP5 A;  2RB6 A;  2VVK A;  2BZ8 A;  1RAF B;  1M1K U;  1Q82 R;  5DM7 R;  2HQX A;  2QK0 A;  4C8Q A;  1BCO A;  1RAH B;  4F7U G;  2DEQ A;  1VQO A;  1Q95 G;  1WXT A;  2C0I A;  4M7A C;  3OY9 A;  4J9B A;  4OGC A;  2OTL Q;  3BY7 A;  2EBP A;  3I55 Q;  2HAX A;  4F04 B;  3C94 A;  3OMG A;  3FLG A;  3OB9 A;  1W2B P;  4F14 A;  2EW3 A;  3PMI A;  1VQ5 T;  5CKE A;  3CC2 Q;  2LCL A;  3S3N A;  4L5G A;  2DA9 A;  1RAB B;  1KC8 R;  1VQ7 T;  1M3A A;  1M90 R;  2DVE A;  1FMV A;  5GAM j;  4BI3 A;  4FSX A;  2O2O A;  2KRS A;  4DOV A;  2KXD A;  4LDW A;  3BFM A;  3DB4 A;  3RKW A;  5LJ5 e;  2DZ9 A;  4ZTJ A;  3CD6 A;  1LNX A;  3RIR A;  2QTV A;  1A0N B;  2CT4 A;  5KCH A;  5C6S A;  3PTA A;  3HFO A;  3CXC S;  1J3T A;  2XDD A;  5LJ3 j;  1YIT T;  3I56 T;  2DJZ A;  1GCQ A;  3OYJ A;  2ZCF B;  2LC4 A;  4BE1 A;  2D0Q B;  1WX6 A;  3OYB A;  2K5L A;  2VGM A;  3GBQ A;  4E7Z A;  3TVT A;  2MYS A;  2FPE A;  2IG0 A;  3CCS Q;  4Z89 A;  2XDP A;  1WHL A;  1BI0 A;  5CAI A;  3FC3 A;  3EFR A;  2DTH A;  2PTK A;  1GL5 A;  3ER0 A;  1JXM A;  2F2W A;  2IIM A;  2L3P A;  3CCM A;  4OGE A;  4FCY A;  1Q81 C;  1OZ3 A;  2A3L A;  1WXU A;  4C5E A;  4RMO A;  1QCN A;  3MEW A;  2HEQ A;  1FX7 A;  3MJX A;  3CPW P;  1FMW A;  1VQK Q;  3BDU A;  1IXD A;  4KRT A;  2DEU A;  2A28 A;  3FB9 A;  1OEB A;  3I5S A;  1NM7 A;  1PKS A;  2VGN A;  2MAM A;  1AEY A;  3NGP A;  4XTU A;  3MO8 A;  4VUB A;  2P4T A;  4QW2 A;  3CCU A;  1IZ6 A;  4PJJ A;  2QXF A;  1GCP A;  2J7I A;  3OYM A;  2KBT A;  2AKK A;  3CD6 T;  4JRK A;  3X28 B;  4J6Y A;  1TH7 A;  3L2R A;  2ED0 A;  3TEE A;  2CS7 A;  1VQP A;  3MEV A;  2OJ2 A;  4LDX A;  3JCM g;  2SEM A;  3KXT A;  2PQW A;  4RG8 A;  1JU5 C;  1ZBJ A;  3L2Q A;  4PLL A;  2EAY A;  4QQ6 A;  1ZBX A;  2NWM A;  1ZHI A;  4PJO A;  3C12 A;  1YI2 Q;  4HKE A;  4XTV A;  1K4U S;  3PIP A;  4FSS A;  1Q81 R;  1QVG S;  3M0P A;  4PJO B;  2BKD N;  2DNU A;  1V76 A;  1B3Q A;  4WF2 A;  2JW4 A;  2HZY A;  2EKO A;  3PMT A;  2QDL A;  3GNF B;  4BDY A;  3CCQ A;  3JCM W;  2RQW A;  3V7S A;  3M0T A;  5IT9 E;  3CC4 T;  4KUL A;  2J05 A;  1D09 B;  2XI9 A;  1VQN A;  2EFI A;  1Q82 U;  5KYX A;  5KYN A;  1I1J A;  1M1F A;  3CCM T;  2GFA A;  5EG2 A;  4JJB A;  4P5N A;  2JOY A;  1ZA1 B;  5KYX B;  3CBP A;  3CQT A;  5A0G A;  1BBZ A;  1H92 A;  3EFO B;  1UGQ B;  4M75 B;  3J80 E;  1QVP A;  1V29 B;  4M7D E;  1O75 A;  4DQ2 A;  5GMK i;  4HCC A;  3RDV A;  2R58 A;  2P0Q A;  4PKC C;  1I0C A;  2HCK A;  3LGL A;  3REA B;  2OTL A;  2LTO A;  4R0K A;  2G6F X;  2RK2 A;  3MPU B;  2KY9 A;  3I55 A;  5GAN 5;  1KC8 U;  1KJW A;  2C0O A;  2KRN A;  1M90 U;  2SRC A;  1K0S A;  2LCS A;  2XD0 A;  1JJ2 A;  3OW2 P;  2QA4 A;  4DA4 A;  3H6Z A;  4C8Q D;  3CC2 A;  1MMA A;  4LDV A;  1AD5 A;  2KSS A;  4PNO A;  1Z9Q A;  1AWX A;  1K73 U;  3S6W A;  5AYF A;  4EIK A;  4ME7 A;  4KGV B;  4MML A;  2EGA A;  4N0A C;  1VQ5 Q;  2E3H A;  3PE0 A;  2JS2 A;  3CC7 T;  1MND A;  4M7A E;  2OX7 A;  4J9G A;  2DK3 A;  5LJ5 f;  5GAO p;  1VQ7 Q;  1PKT A;  4AT1 B;  3RER A;  5IXB A;  2NUT B;  1OU9 A;  4CC2 A;  1WIE A;  3C95 A;  1X2K A;  1K76 A;  1V1C A;  2BUD A;  3M4G A;  4WTO B;  1M1K C;  1VQP T;  3IQL A;  2E4H A;  3EGX A;  2W0Z A;  3JCM P;  2GCX A;  4JLG A;  1RI0 A;  4NS5 A;  3M53 A;  4C0D C;  3MET A;  8ATC B;  3NTI A;  4GLM A;  2D6F A;  3VKI A;  4M77 B;  3BE3 A;  5D6X A;  1YIT Q;  1MV3 A;  3I56 Q;  5CVI A;  2EKH A;  3SHW A;  3H8Z A;  3VS5 A;  4A54 A;  2DPP B;  4M78 A;  2DL5 A;  3CCS A;  3RMS A;  1T0J A;  2YUQ A;  3CCQ T;  3OMC A;  1PWT A;  4NL3 A;  5IHN A;  2HSE B;  3MHX A;  3JB9 H;  4M7D F;  4PL6 A;  2CZ6 B;  2EVR A;  5IHI A;  3LYI A;  2RI5 A;  3A8M B;  1YBY A;  2OAW A;  2VXE A;  5FRM A;  3JCM h;  2JTE A;  4RTY A;  1JRI A;  4AG1 C;  4C8Q C;  2CP7 A;  2RQR A;  4X1V A;  8AT1 B;  4EMK A;  4M7D G;  1OPL A;  2KQW A;  4B9X A;  1RAC B;  2DIG A;  5GMK e;  1VQK A;  1XQH A;  1TTH B;  1SRL A;  3M57 A;  2MOX A;  2XIC A;  3P8B B;  4M7A F;  1BI2 A;  2QQS A;  5IH2 A;  2FYK A;  2QA4 T;  1B7T A;  1M1K R;  1U1S A;  3EG3 A;  4JZ3 A;  3CC2 T;  1E6G A;  1H3Z A;  3FRN A;  3FIF A;  2JVV A;  5LJ5 d;  4A4F A;  1YJ9 Q;  2WSF E;  3JCM c;  4M7A G;  4DBH A;  2X4Y A;  4D8D A;  2ZGW A;  4JJD A;  2V8K A;  3JB9 F;  4FW2 A;  4J9H A;  2K57 A;  4ZN3 A;  2CYZ B;  2JTM A;  1B34 B;  3V8J A;  1Y7X A;  1X75 C;  3WXM B;  1H8K A;  2EJG A;  5GAO l;  3CPF A;  2JTF A;  3CD6 Q;  2J6O A;  4Z8A A;  2ZZD A;  2EJ9 A;  1QQJ A;  1GCQ C;  2CZ1 B;  5GAN f;  3M58 A;  4NL2 A;  1QMC A;  3JB9 G;  1HSQ A;  1X27 A;  1RL2 A;  3RBB B;  4IKF A;  2ZPH B;  1YI2 A;  1AZE A;  3OYN A;  1WLP B;  1VQL A;  4OMP A;  3EG1 A;  3H0I A;  2KGT A;  3CCS T;  4OB3 B;  2K5F A;  4ELZ C;  3GP8 A;  3VS6 A;  2HL5 C;  1N6A A;  2P0K A;  2PZ1 A;  4PJO D;  4B6M A;  2X51 A;  1JXO A;  2I2L A;  3QZ5 B;  1GRI A;  2EGE A;  2CZ0 B;  3CC4 Q;  3SWN A;  3AT1 B;  1TOV A;  2E10 A;  5I11 A;  4LD6 A;  1OU8 A;  4HVV A;  1PC0 A;  1EFN A;  3SD4 A;  4JRI A;  1CSK A;  3CCM Q;  1BYM A;  3SWN B;  1VYT A;  1M3B A;  2QAS A;  1PD1 A;  4A4G A;  3LH0 A;  1SHF A;  2HMA A;  2KR3 A;  2XDB A;  2KT1 A;  1M2V B;  3INZ A;  4J9F A;  2QQR A;  1VQ9 T;  3M54 A;  1MMN A;  4UC4 A;  3RUX A;  4E47 A;  4LXC A;  5EC7 A;  1SRM A;  2DIL A;  2DF6 A;  3G4S T;  1NG2 A;  2ZPB B;  6AT1 B;  1VQ5 A;  2VC8 A;  2YRD A;  2DLP A;  1WHK A;  2K7A A;  4F7U B;  1PRL C;  2DXB A;  2JMC A;  2RQV A;  1TU0 B;  2KT8 A;  4CC3 A;  3QWX X;  2RD1 A;  1SSH A;  3CXC P;  4Y28 E;  1SF9 A;  1CKB A;  2OI3 A;  3CC7 Q;  5FU6 C;  1AWJ A;  4LN2 A;  2KRM A;  3OYC A;  2EQM A;  3LWH A;  1VUB A;  3PFS A;  3GOX A;  4EMG A;  5L23 A;  2XID A;  4N4I A;  1S1N A;  1VQP Q;  4O6J A;  3KBG A;  2JN0 A;  3SFM A;  2K4Y A;  1M90 C;  2NUP A;  1K9M U;  1RAI B;  4BUG A;  4ZGD B;  1YIT A;  3I56 A;  1ZUU A;  1VQL T;  1TWB A;  1GFD A;  3CPW A;  5FWC A;  3CCR T;  2CUD A;  2NUP B;  4IIM A;  2RO0 A;  1QLY A;  1G3W A;  1K73 C;  1VQM T;  2VUB A;  1QVF S;  2RJC A;  3S3M A;  1RAG B;  4A53 A;  2KEA A;  1WJQ A;  2L8D A;  5CKD A;  2R5M A;  1NEB A;  3CBO A;  1LJO A;  2EYX A;  2CDT A;  3JCM V; 
#chains in the Genus database with same CATH homology
 3RES A;  4M7A A;  5FU7 C;  4M78 F;  5LL6 S;  2KK4 A;  3RKX A;  4M78 D;  4C5E A;  4RMO A;  4HT8 A;  3GNG A;  3MP6 A;  3E9G A;  2LNV A;  1XOV A;  3QSU A;  2LVM A;  1M1G A;  3MEW A;  1KQS S;  1FX7 A;  1M8V A;  3CPW S;  1WPY A;  2FB7 A;  3CCR A;  3CCU T;  2EQU A;  1UGP B;  1VQM A;  4BD3 A;  3UPU A;  4Q5W A;  2M16 A;  3BDU A;  2FL7 A;  1W2B A;  3OBY A;  3M59 A;  4KUD K;  3BW1 A;  3FB9 A;  3TU4 K;  5LJ3 f;  4IUV A;  2VGN A;  2K2V A;  3Q1J A;  4M78 G;  2MAM A;  2LQK A;  1AHJ B;  4M77 E;  3VV0 A;  1KHI A;  3UT1 A;  2DD5 A;  4QVZ A;  5HK0 A;  3L42 A;  3L2V A;  3TRE A;  3G6E T;  3HRU A;  4XTU A;  4J8O A;  3MO8 A;  2F5T X;  4HCB A;  1UEB A;  4VUB A;  4C0Z A;  4J6W A;  2P4T A;  3C4S A;  4QW2 A;  3JSC A;  3CCU A;  4XU1 A;  1IZ6 A;  2QXF A;  4XK8 E;  5CQY A;  5D6Y A;  4XTY A;  1G3S A;  3CCJ T;  4C92 E;  4BY6 B;  2MF2 A;  3N5B B;  4C8Q E;  5KCO A;  3OYM A;  1MHN A;  1WNL A;  2DTI A;  2HBP A;  2HNI A;  5FLX E;  5C0M A;  2E1H A;  1WQ7 A;  3CD6 T;  4JRK A;  2QQB A;  5GAO q;  3OYY A;  3X28 B;  4J6Y A;  4M75 F;  2M9U A;  5GAN g;  4M75 D;  5FRO A;  5IAY A;  3OS1 A;  1TH7 A;  3L2R A;  1YJ9 A;  3QUI A;  1QVG A;  2LDM A;  3TEE A;  2CS7 A;  4RCC A;  3JCM Q;  1VQP A;  2DAQ A;  3MEV A;  3G6E A;  3HFN A;  4LDX A;  3JCM g;  1NPP A;  2LRQ A;  4EDU A;  3KXT A;  2PQW A;  3EFS A;  4ZN1 A;  3OYD A;  4QQG A;  2QEX T;  3HP9 A;  1X6O A;  3QBY A;  2DXU A;  4RG8 A;  3L2Z A;  1OYX A;  5GAO n;  4F7U A;  3CCJ A;  1Q86 U;  2QDY B;  4M78 B;  4BY6 C;  3L2Q A;  4PLL A;  4JRP A;  2EAY A;  4QQ6 A;  2MMP A;  2PVO B;  1UGR B;  1ZBX A;  4ZTF A;  5GAM e;  4R55 A;  4E7L A;  5FRN A;  1VQN T;  1ZHI A;  3M4Y A;  3M5A A;  3C12 A;  1QP2 A;  3M56 A;  4M75 G;  4PJO A;  1P92 A;  4HKE A;  3JCM e;  2LT1 A;  4XTV A;  5I2S A;  4JS4 A;  1GXI E;  3PIP A;  1Y07 A;  3WVE B;  1QVG S;  4PJO B;  3JCM b;  5LJ5 h;  2BKD N;  1WJR A;  3QZ9 B;  4WF2 A;  4BDZ A;  2X4X A;  2EKO A;  3PMT A;  5LJ5 j;  4KUI A;  3GNF B;  4BDY A;  4MZP A;  5GMK h;  3CCQ A;  3JAM E;  3NTK A;  4FIB A;  4A4K A;  3JCM W;  3NFC A;  3JCM X;  2YLB A;  3PGG A;  3V7S A;  2KDS A;  5IT9 E;  4JLI A;  4M78 C;  3CC4 T;  4KUL A;  3OS5 A;  4N4G A;  1VQ4 A;  4C5I A;  2RHZ A;  4BE0 A;  4OB0 B;  4LDU A;  2XI9 A;  4FL6 A;  2EFI A;  1EIF A;  3JB9 J;  5GAN 4;  2EQK A;  2XKO C;  1Q82 U;  1VQN A;  1YIJ A;  5L8R E;  1NJI U;  2OTL T;  5GAM d;  2DD4 A;  3GPL A;  1M1F A;  2F5K A;  3I55 T;  2ZPF B;  3CCM T;  3A8L B;  3OSV A;  4EMK B;  4Z02 A;  2GFA A;  5EG2 A;  1N9R A;  1S72 T;  1KD1 C;  4P5N A;  1HK9 A;  2JOY A;  2XU8 A;  4C5G A;  4PJO C;  1G5V A;  3OA6 A;  3GIB A;  1KG1 A;  2GF7 A;  1NPR A;  3CBP A;  4N0A A;  4XU0 A;  5A0G A;  3OS2 A;  2RI2 A;  3VYG A;  4KT0 E;  1UGQ B;  2CZ7 B;  2RI3 A;  4M75 B;  1N27 A;  3J80 E;  1QVP A;  1V29 B;  1Q7Y U;  2IVW A;  4M77 F;  1O75 A;  1SSF A;  4M7D E;  2OAU A;  4DQ2 A;  3CC4 A;  4M77 D;  4TVR A;  2EWN A;  3FJP A;  5GMK i;  4HCC A;  2LT4 A;  2R58 A;  3SDZ A;  2P0Q A;  4PKC C;  3LGL A;  2E41 A;  3OYF A;  1KQ1 A;  2GQV A;  2M0O A;  2LTO A;  2OTL A;  2RK2 A;  4X34 A;  2KY9 A;  5LJ3 d;  4J5Y A;  4EMK C;  4QVC A;  5GAN 5;  4NOY A;  3X24 B;  3I55 A;  1KC8 U;  1M90 U;  2ZPE B;  4JJN K;  1S72 A;  2RHU A;  1BI1 A;  2QI2 A;  2XD0 A;  2E6Z A;  2JZ2 A;  3QDR B;  1JJ2 A;  3M55 A;  4OP0 A;  4C92 F;  3KUF A;  3OYG A;  2QA4 A;  4C8Q F;  5CO7 A;  4C92 D;  2R57 A;  3OW2 S;  3H6Z A;  4DA4 A;  2RHY A;  4C8Q D;  4M77 G;  2K3Y A;  1K8A U;  3A8H B;  3HL8 A;  4OVA A;  4M75 C;  4LDV A;  3FDR A;  2H3J A;  2KSS A;  4PNO A;  5CR2 A;  3CC2 A;  3TCJ A;  1K73 U;  3S6W A;  2DO3 A;  5AYF A;  4ME7 A;  4MML A;  4N0A C;  3UDC A;  2QTX A;  1BIA A;  2RK1 A;  2FHD A;  4FM4 B;  3MEA A;  3CC7 T;  2Y4X A;  4X9C A;  3A8G B;  4M7A E;  2CKK A;  1M5Q 1;  4C0D B;  3UWN A;  4BE2 A;  2MI6 A;  2DK3 A;  1Q81 U;  2JNG A;  5LJ5 f;  1Y96 A;  5GAO p;  5GAO m;  4C92 G;  2YHT A;  3RER A;  4C8Q G;  2PUO B;  4XTZ A;  5A0D A;  4J7I A;  3A5Z B;  4J83 A;  1JJ2 S;  2L89 A;  3J7A F;  3C95 A;  1YJ9 T;  1Y96 B;  1M1K C;  2BUD A;  1BI3 A;  2EQJ A;  3M4G A;  2B8A A;  1VQP T;  3E9F A;  3A8O B;  2RHI A;  1N9S A;  2E64 A;  2EIF A;  4RCB A;  2GCX A;  4JLG A;  3JCM P;  1RI0 A;  4NS5 A;  4OMF B;  4HT9 A;  1IRE B;  3M53 A;  3OS0 A;  1BKB A;  4B9W A;  3CC7 A;  4C0D C;  5GAN 6;  3MET A;  3QPH A;  2DIQ A;  1WQW A;  2L5Q A;  3GLX A;  3NTI A;  1NZ9 A;  4JDS A;  3QHS A;  5CKB A;  3VUB A;  1VIF A;  5GAN 7;  2D6F A;  3VKI A;  1JBM A;  1FWZ A;  4M77 B;  3MP1 A;  5CCA A;  5D6X A;  4BAC A;  2WAC A;  2QQA A;  2X35 A;  5CVI A;  2PVD B;  3H8Z A;  2ZPI B;  4A54 A;  2DPP B;  5GAM g;  1OI1 A;  1KQ2 A;  2LQ8 A;  4L59 A;  4M78 A;  5J3B A;  4ZGE B;  3CCS A;  4MMK A;  3RMS A;  4IUQ A;  4J7F A;  3PT9 A;  3QKJ A;  3CCQ T;  3V7C A;  3OMC A;  2DXC A;  3CBM A;  1OZ2 A;  3P8D A;  4C8Q B;  3S3O A;  4NL3 A;  3PIO A;  3DLL A;  2D9T A;  3OYE A;  1VIE A;  2Y90 A;  4FU6 A;  4A4E A;  4RG2 A;  1VQ4 T;  3MHX A;  1I8F A;  3JB9 H;  2X4W A;  4IUT A;  5GAN 8;  4HA8 A;  4M77 C;  3DB3 A;  3ME9 A;  2WSC E;  1N8R U;  4M7D F;  4PL6 A;  2CZ6 B;  3V7R A;  1YIJ T;  1VQK T;  4LDY A;  4M7D D;  3JCM J;  4ELY C;  3ZBD A;  3LYI A;  2RI5 A;  5GAN h;  5HKC A;  3A8M B;  3QJ6 A;  4F7U E;  1YBY A;  5GAN j;  2VXE A;  3DLM A;  4XU3 A;  5LJ3 g;  2QQ9 A;  3QYG B;  3MEU A;  5FRM A;  4PJO E;  3JCM h;  5KH6 A;  3OBW A;  5GMK m;  2E5Q A;  1JRI A;  4A4H A;  4C92 C;  4C8Q C;  2VV5 A;  1WJS A;  4BB7 A;  2CGH A;  4OB1 B;  3CCV A;  5CIU A;  3OYH A;  3HRS A;  3URG A;  4CRI A;  4EMK A;  4M7D G;  2KQW A;  3RKY A;  4B9X A;  4MDW A;  1X01 A;  5LJ3 e;  5I21 A;  5GAN 2;  1M9S A;  4XTX A;  2DIG A;  2E65 A;  5GMK e;  2C06 A;  5J26 A;  4JRQ A;  1XQH A;  1VQK A;  4V2S A;  1MGQ A;  4EPC A;  1Q82 C;  2NLU A;  4JUV A;  5DLO A;  4GY5 A;  3QG1 A;  2RJF A;  3M57 A;  2XIC A;  1R8O B;  3P8B B;  3QII A;  4M75 A;  1HXD A;  4II1 A;  3L2U A;  1VQ7 A;  4M7A F;  1BI2 A;  1ZQ1 A;  2QQS A;  4FT4 A;  3OW2 A;  2FYK A;  5I2M A;  4M7A D;  2QA4 T;  5GAO r;  3LWI A;  2YRV A;  4LD9 K;  3V8L A;  4OF1 A;  2LCC A;  2XHC A;  4O5V A;  4C0F A;  2RJE A;  1G3Y A;  1U1S A;  2E70 A;  3CC2 T;  2MWO A;  1YJW T;  3O8V A;  5A2Q E;  1BIB A;  1I81 A;  2L3R A;  3CMA T;  1K9M C;  1WGS A;  4GLK A;  5CQX A;  2FVU A;  5GAN d;  2K3X A;  1U1T A;  3MCA B;  3QYH B;  1FXX A;  4EMH A;  3CCE T;  1H64 1;  4E7I A;  3FRN A;  3FIF A;  3VJP A;  3X26 B;  1KD1 U;  3DKM A;  2JVV A;  3ASK A;  3F70 A;  5LJ5 d;  4MDX A;  2YLC A;  1PSF A;  4A4F A;  1U8R A;  4QVD A;  2WSF E;  3OYK A;  3JCM c;  4M7A G;  3VU3 C;  4Y91 A;  2X4Y A;  1XNI A;  2E12 A;  2HD0 A;  4PLI A;  3J81 E;  2ZGW A;  3BDL A;  3HKS A;  1KC8 C;  2V8K A;  3HHT B;  1LOJ A;  3JB9 F;  3OYL A;  1YI2 T;  4C0G A;  3JB9 D;  1YJN A;  2F69 A;  2K57 A;  4ZN3 A;  3E19 A;  2CYZ B;  2JTM A;  1W4S A;  4M7D B;  5DY9 A;  1B34 B;  3V8J A;  3VUZ A;  1Y7X A;  4QQD A;  1YJW A;  1X75 C;  2A7Y A;  3WXM B;  2LX9 A;  2EJG A;  5GAO l;  1QW1 A;  3CPF A;  3CMA A;  4HCZ A;  5HK3 A;  2DKG A;  1D3B B;  1YHQ A;  2JTF A;  5GAN 3;  1M4Z A;  3CCE A;  2ZZD A;  2EJ9 A;  3LW5 E;  2CZ1 B;  5GAN f;  4DOW A;  2JUF A;  4J6X A;  3M58 A;  5J39 A;  4E7J A;  2OTJ T;  1KHC A;  4ATO A;  1VQ6 A;  4JS5 A;  2V8J A;  4NL2 A;  3G7Z A;  4L6V 5;  3JB9 G;  1I4K 1;  5HY6 A;  3JCM f;  1RL2 A;  4IKF A;  4IUR A;  2V8I A;  2ZPH B;  5M9O A;  1YI2 A;  2K5I A;  3M9Q A;  3OYN A;  4M7D C;  3CME A;  3G71 A;  1VQL A;  3LX7 A;  3NTH A;  1VQO T;  3CCS T;  4OB3 B;  2K5F A;  5DLQ E;  1VQ8 A;  3WVD B;  4ELZ C;  4F7U F;  4M7A B;  3RMQ A;  1JB0 E;  4M77 A;  3GP8 A;  4MZM A;  4XTW A;  2OTJ A;  1I5L A;  4PJO F;  2EYQ A;  3JB9 I;  2RA2 A;  2AHJ B;  2GFU A;  4FT2 A;  1N6A A;  2P0K A;  4PJO D;  2RB6 A;  2I2L A;  3QZ5 B;  2KMT A;  2WSE E;  2E6N A;  4N4H A;  1M1K U;  3CEY A;  2DTO A;  5DM7 R;  2VXF A;  2HQX A;  2CZ0 B;  4C92 A;  4OB2 B;  4C8Q A;  2P0P A;  3SWN A;  4F7U G;  2E10 A;  2PU9 B;  2DEQ A;  5CKF A;  1VQO A;  2RM4 A;  4LD6 A;  4M7A C;  4PJO G;  3OY9 A;  4OGC A;  3BY7 A;  4C92 B;  3SD4 A;  4JRI A;  2HAX A;  1BYM A;  3CCV T;  3SWN B;  3C94 A;  3OMG A;  3FLG A;  4CI0 C;  3OB9 A;  5CKH A;  4ZGJ B;  1W2B S;  3EAE A;  2XG8 D;  3PMI A;  1VQ5 T;  2KAF A;  4M78 E;  4KBM B;  1UB4 A;  3LH0 A;  4A4G A;  1QP3 A;  1Q86 C;  2XDB A;  3PNW C;  4MZT A;  3INZ A;  5CKE A;  5GMK l;  1UGS B;  3HSB A;  1YCY A;  2QQR A;  3L1A A;  5CK9 A;  2LCL A;  2PUK B;  2EJF A;  3S3N A;  1VQ9 T;  1N8R C;  3HPW A;  2RHX A;  4L5G A;  5LJ5 g;  5IN1 A;  1VQ7 T;  1O9S A;  2O4X A;  3M54 A;  4UC4 A;  3RUX A;  5GAM h;  2DVE A;  1DJ7 B;  4E47 A;  2DZC A;  3CXC A;  4E7K A;  5GAM j;  4BI3 A;  1H3Z A;  5FU6 B;  4FSX A;  4DOV A;  5GAN e;  3SWN C;  3G4S T;  2O4X B;  1NE8 A;  4LDW A;  3ZEH A;  3BFM A;  3DB4 A;  2PVG B;  3FEO A;  3QO3 A;  3RKW A;  2RJD A;  3V8K A;  5KE3 A;  2ZPB B;  5LJ5 e;  4BI8 B;  1VQ5 A;  2DZ9 A;  4ZTJ A;  2VC8 A;  3CD6 A;  1LNX A;  3RIR A;  4F7U B;  2DXB A;  2XK0 A;  5KE2 A;  3GF5 A;  3OYA A;  2RH2 A;  4X9D A;  1VQ9 A;  5KCH A;  1NJI C;  5C6S A;  2RD1 A;  4XQ3 A;  3PTA A;  2BIV A;  5LJ3 h;  2MWP A;  3HFO A;  1YJN T;  3CXC S;  4Y28 E;  3X20 B;  2XDD A;  5FU6 C;  5LJ3 j;  1YIT T;  3I56 T;  1PSE A;  4D6W A;  2DXT A;  2QEX A;  2DJZ A;  5GMK j;  3OYC A;  3OSS C;  3ZFJ A;  5D6W A;  3QXE B;  3OYJ A;  3G4S A;  3P8H A;  2KVQ G;  2EQM A;  2LC4 A;  2ZCF B;  4IUP A;  1VUB A;  3OQ5 A;  4M75 E;  2D0Q B;  3LWH A;  4BE1 A;  1YHQ T;  3OYB A;  2O01 E;  3PFS A;  2K5L A;  2VGM A;  3GOX A;  1Q7Y C;  4YTL A;  1QVF A;  3VYH B;  3LLR A;  3CCL T;  4EMG A;  1VQ6 T;  2XID A;  4N4I A;  4E7H A;  4M7D A;  3JCM d;  2IG0 A;  1B34 A;  4O6J A;  4XU2 A;  3KBG A;  3T9N A;  2JN0 A;  4RKU E;  3SFM A;  4R56 A;  3SB2 A;  2K4Y A;  3LGF A;  2XDP A;  4IUU A;  1M90 C;  1D3B A;  1BI0 A;  5CAI A;  4BUG A;  1K9M U;  5FU7 B;  3FC3 A;  4ZGD B;  3EFR A;  1YIT A;  3I56 A;  3CME T;  2DTH A;  3HRT A;  3G71 T;  4XAX B;  1XTD A;  1Y71 A;  1VQL T;  3L2W A;  2ZPG B;  1KQS A;  2Y4Y A;  3ER0 A;  1K8A C;  3CPW A;  1VQ8 T;  2M1H A;  3CCR T;  2R5A A;  4C5H A;  2HQE A;  3OYI A;  2RO0 A;  1K73 C;  1G3W A;  3QJY A;  3E1S A;  1VQM T;  2VUB A;  1QVF S;  2RJC A;  3S3M A;  3CCL A;  4BI4 A;  2VYT A;  2G3R A;  4OGE A;  4A53 A;  3CCM A;  1WJQ A;  5GAM f;  1G3T A;  2X4J A;  2L8D A;  3MP8 A;  3JRZ A;  5CKD A;  2R5M A;  3CBO A;  1LJO A;  3JCM V;  3R6O A;  3X25 B;  3AHU A;  1Q81 C;  1OZ3 A;  5A0L A;  2A3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...