4C8QE

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
83
structure length
83
Chain Sequence
EILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 14
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qE00
4X9DA 3QSUA 3JB9F 2FYKA 2DTHA 2VC8A 2DZ9A 3V7CA 1KQ2A 5GAOp 1U1SA 4JUVA 4XTVA 4EMGA 3VU3C 5GAN4 2Y90A 1HK9A 2YLBA 3QO3A 4MMLA 5LJ5j 5GAMh 5GAMg 3FIFA 4C92E 4C8QD 5GAN6 3JB9H 1WPYA 2FB7A 3EFRA 3JCMg 1HXDA 1TH7A 2DKGA 5LJ5d 4NL2A 4M78B 3RKYA 5LJ3e 2E64A 5GAMj 2DVEA 4PJOC 4C92C 4M78A 1I5LA 4M75C 5DY9A 3JB9J 5GMKh 4C92F 2E41A 4DQ2A 4M7DB 4C92G 4RCCA 4C8QG 1Y96B 4M77F 3JB9D 5GAOr 1I4K1 4M78C 1WNLA 4J6WA 4XTXA 4HT8A 4M7AD 5GANg 3FB9A 3V7RA 4M7AB 4A53A 3L1AA 3QHSA 3JCMd 4WF2A 5GANf 1WQWA 3BDUA 2DXTA 3JCMX 1Y96A 4OP0A 1KQ1A 4QVDA 4C8QE 2JN0A 3JB9G 3HFNA 1YCYA 1M5Q1 1BIBA 3V8LA 4JLIA 3JCMe 4M75E 4EMHA 4JRKA 2K57A 3JCMb 3JB9I 4M7AA 5GAOm 1N9RA 5GMKi 1U1TA 3M4GA 4NL3A 1I81A 2DTOA 2RM4A 5GAOn 3RIRA 1H641 5LJ5f 3AHUA 3PGGA 4XTYA 5GAN2 5GMKl 3JCMQ 1B34A 5I21A 2EJFA 3JCMc 1B34B 1WQ7A 3HFOA 4M75G 4RCBA 4XQ3A 5LJ3f 4M7DA 1LJOA 3EFSA 3QUIA 4XTUA 5LJ3d 2YLCA 1I8FA 3BFMA 2DJZA 2RD1A 1JRIA 4QVCA 4XU3A 5CAIA 1D3BA 3L2ZA 4C8QC 2E10A 2E65A 3BW1A 4EMKC 3JCMP 2EAYA 4J6XA 3RESA 2QTXA 4Y91A 2I2LA 5GAN8 4A54A 4M75D 1X01A 4M7AC 3HSBA 5LJ3h 4M77E 4PJOD 5LJ5e 4X9CA 4XU0A 4M7AF 4M78F 4M7AG 4PNOA 1BIAA 4M7DE 4M77D 4PJOE 4J6YA 4M78D 5GANh 3JCMf 5GAN3 1N9SA 4XU1A 4M7DC 4F7UF 3RKXA 1MGQA 2E1HA 2RA2A 4M77G 4F7UG 4C92D 5GAOq 4M75B 4M75F 4C92B 2HNIA 1M8VA 4M75A 3SWNB 2EJ9A 4M7AE 4EMKA 4M7DG 4PJOG 3RUXA 4V2SA 2EJGA 3V8KA 5GMKm 3RERA 2DTIA 1D3BB 4HT9A 5GAMe 3JCMh 4HA8A 4XU2A 4F7UE 5LJ3j 5GAN5 3JCMV 3SWNC 4PJOB 3SB2A 4PJOF 4M7DD 2EWNA 3V8JA 2VXEA 3GIBA 5GANe 1LNXA 4M78E 5GMKj 2RB6A 4J5YA 2DEQA 3INZA 5GAN7 5GAMf 3JCMW 4F7UB 4JRIA 2CGHA 5GMKe 3BY7A 4XTWA 4NOYA 4XTZA 3SWNA 2ZGWA 4EMKB 2DZCA 5LJ5g 5GANd 3FJPA 5LJ5h 2DXUA 3RKWA 4M78G 3V7SA 4M77A 4N0AA 4F7UA 1JBMA 4M7DF 5LJ3g 4M77C 4N0AC 2YHTA 4C92A 5GAMd 4MMKA 5GAOl 3JCMJ 4PJOA 4C8QA 5GANj 1LOJA 2VXFA 4C8QF 4C8QB 4M77B
chains in the Genus database with same CATH superfamily
3QSUA 2FRWA 2FG0A 3QXEB 2JW4A 3HP9A 4QQ6A 2RK2A 1KD1U 1K9MU 1AEYA 1M2VA 3CMAQ 5FRMA 1RADB 2K4YA 4XK8E 4OB3B 2HCKA 3JCMg 1VQPA 3EG9A 3X25B 2QEXT 4KUDK 4KULA 4M75C 3CCLT 4RTXA 3QWYA 1JJ2S 1K4US 1VYUA 2QEXA 4MZTA 2LNHB 1K76A 3GBQA 1X27A 2X35A 1RAFB 3CCSA 3CC2T 1PD0A 3JB9G 2GQVA 3HFNA 4BACA 3JCMe 1XTDA 1VQPQ 1K0SA 2K57A 5IHKA 2GNCA 1I81A 3ZEHA 3CMET 2O88A 5LJ5f 2RHIA 4J9FA 5GMKl 1VQ7Q 1WQ7A 2ESWA 1QP3A 5HK3A 2RMOA 1LJOA 3S6WA 1I8FA 2DJZA 1UJYA 1VQ4T 3L2ZA 2HL5C 4PK4A 4HXJA 1WDXA 2R58A 1O75A 2D1XA 1BI1A 2O01E 2L0AA 1UG1A 1Q86R 4PJOD 3HRSA 2R5AA 1QMCA 4M78F 2COZA 1JO8A 4C0DC 1WHGA 2K3YA 3UA7A 1N8RC 2LRQA 1MGQA 3LLRA 3DB4A 4OMLA 2FPDA 4M7DG 4LN2A 2OX7A 3EG2A 3RDVA 4J9EA 2E70A 2QDLA 5GAN5 1HSQA 3JCMV 3SWNC 1D1BA 3REBB 3V8JA 1B7TA 2DL5A 2KT8A 1YJNT 1D09B 4BE1A 4AFUC 4ZNXA 5FROA 1D0ZA 1WHKA 5GANd 1YHQQ 3NPFA 2DERA 4R56A 1VQ5Q 3MCAB 3M0QA 1RL2A 3P8HA 3M9QA 2RPNA 4OB2B 1QKXA 4JLGA 1FYNA 3OYDA 3V7CA 5J39A 4C92E 4C8QD 1FMKA 2VKNA 3EFRA 3A98A 2V26A 5LJ5d 2E64A 1VQ9Q 1XNIA 4C92C 4BB7A 1VQNT 2LCCA 4N4IA 1V29B 4C92F 2KXDA 4OMPA 4RCCA 4C8QG 4OGEA 4O6JA 4OP0A 2KQWA 3LW5E 5IXBA 2HQHA 1SG5A 4F14A 2L3SA 4M7AA 2A08A 2RI5A 1T0HA 1R8OB 1VQOT 2J05A 4AT1B 1YJWT 3OYKA 3VUBA 2ZAEA 1V76A 2XDPA 2JM9A 3CCVA 2MMPA 4JS5A 2YLCA 1H8KA 2E6NA 1M1FA 4PJMA 4E7HA 2E10A 1QVGS 1MV3A 4PKCC 4IIOA 1QKWA 4ELYC 2I2LA 2I0NA 1TSFA 2KY9A 3CCJA 1OEBA 2OTLT 4M77E 2LQNA 1JXOA 3U23A 2AIRB 3OW2P 3NHNA 3OW2A 2X3WD 3OYLA 2HNIA 5A2QE 4EMKA 4LDWA 3G71A 3RUXA 4LUEA 3CCRT 4C0DB 2LDMA 2DA9A 5KYXA 1MHNA 1VOMA 2BKDN 5GAN7 2B86A 3MO8A 3P8BB 2J06A 2KAFA 1SRLA 1TG0A 2V1RA 3CCMT 1M3BA 3G4SQ 2YSQA 2HSEB 5FW9A 4M7DF 1MMGA 5J26A 3EFOA 5LJ3g 2AHJB 2P0PA 2X3XD 1YJNA 1AWOA 4X9DA 1AWXA 3H0IA 1VQ6Q 1BU1A 3X26B 2FYKA 2LQKA 2VC8A 3MEWA 2BZXA 2CP6A 3TREA 3QJ6A 4LDYA 3FIFA 2JS0A 2RH2A 3MP8A 1ZQ1A 4M78B 5LJ3e 1VUBA 4WTOB 2E41A 4DQ2A 2EQKA 1G8XA 1QWEA 1YN8A 3CCQQ 2GTOA 3FB9A 4M7AB 3QHSA 3NFCA 4ATOA 2DEUA 1S72A 4OF1A 2EYQA 1N9RA 3GNFB 4NL3A 1WXBA 3UATA 2GQIA 3VJPA 2K5FA 1B34A 2O9VA 1ZA1B 3JCMQ 2DJQA 2CS7A 1X43A 1NE8A 1WZOA 2VWFA 1QVFS 4AMCA 2H3JA 3CD6A 4M7AC 1EFNA 1ZX6A 4XU0A 2CUDA 2DAQA 3QDFA 5IXFA 4FYYB 2DF6A 4IURA 2ECZA 3LX7A 2RHYA 3VRZA 3V8KA 3A8LB 3CBOA 2OTLQ 2A37A 4M7DD 2EWNA 1TU0B 5KCHA 1G3SA 2OTJA 4NS5A 1WHMA 4XTWA 1VQ4Q 2EKHA 3G6EA 4J9IA 4ESRA 3A8GB 3VS7A 4BE2A 1CKAA 1R77A 1MUZA 2QYZA 4DEXA 1I07A 5IT9E 3CC7T 3S3NA 2B8AA 3VS6A 4ANJA 2DYBA 1C1AA 5GJVB 4EMGA 2P0KA 2H8HA 3M54A 5LJ5j 3TCJA 2BUDA 2EYZA 2MI6A 2PVDB 1UHCA 2RI2A 3OYMA 2QQBA 1HXDA 2YUQA 3MEVA 4LXCA 5DY9A 1OOTA 2DX1A 2OJ2A 1VQ9T 4ELZC 4JS4A 2FO0A 1VQLT 2KMTA 1OQKA 1SHFA 2J6OA 1T3SA 2A36A 1FWZA 4M78C 5FWCA 4Z8AA 1PWTA 4HT8A 5GANg 1WQWA 2DD4A 2CP7A 2VGMA 8ATCB 1DJ7B 2AZSA 1MMDA 2XK0A 1M4ZA 2DVJA 2RM4A 3OYHA 1UGRB 1D1CA 5IAYA 3M59A 3QKJA 2RD1A 2K2MA 1AZGB 1M90U 3RESA 4JRQA 2YT6A 2F5TX 1NM7A 4X9CA 1X2KA 2JNGA 1OPKA 2VYTA 1KG1A 2Y4XA 1WJRA 4AFQC 4M78D 4M77G 3LH5A 1C0MA 2DRMA 2RF0A 4ZN3A 4Z02A 3JAME 1W4SA 1TTHB 1D3BB 2QG9B 1E6HA 2M02A 8AT1B 3A1PA 1PHTA 3EG0A 1OU8A 3JCMW 4JRIA 2QGFB 5D7UA 4A4FA 1WJQA 1PC0A 3OQ5A 3ZFJA 1KSWA 3V7SA 2QA4A 4E7IA 3VS3A 2WSEE 3I9QA 1YHQT 1KQSS 1PRMC 3QZ9B 2JTMA 2RQTA 2VUBA 2GGRA 1M2OA 3H8ZA 4R0KA 1VQ4A 1I1JA 3OYFA 1MMNA 1RAHB 3CCRQ 3HTRA 2P84A 4M78A 1I5LA 3AT1B 3M4YA 4HVVA 3LWIA 1PSFA 5I2MA 3ER0A 1I4K1 3REAB 4HCKA 5DLOA 3CMEA 3CD6Q 2XIDA 3CC4A 3JCMX 5DM7R 1H3HA 1K0XA 2OAWA 2LQ8A 2K3BA 3CMAA 2CZ6B 2DTOA 5HK0A 3VYHB 1VQ8Q 5GAN2 2AK5A 1KFZA 1U5SA 2OTLA 1D3BA 5KYWB 3M5AA 2EAYA 4LDUA 3OYAA 2NUTB 4OVAA 1SF9A 2X51A 3CMEQ 1WGSA 5CQYA 1OYXA 1XJWB 1VIEA 4M77D 4PJNA 2CSQA 4IUTA 5KYUB 3I5SA 2HDAA 2E1HA 1WJSA 3OMCA 2E5QA 5J3BA 3O5ZA 4E6RA 5FU6B 3CMAT 1BBZA 5GAMe 2EPDA 4LNPA 1M3AA 2H3EB 2RB6A 3FEOA 1KK7A 3M53A 5GAMf 3C0CA 1Q86C 3MPUB 3O8VA 4DBFA 5HY6A 4CRIA 2XD0A 3E9GA 3MEUA 3NTHA 2VGNA 4FW1A 2FPFA 2PVOB 4LDVA 3P8DA 2DTHA 4KGVB 1U1SA 4VUBA 4D8DA 3S3OA 1Q81U 2LJ3A 2LMJA 2AZVA 5A0GA 5GAMj 1GCQC 3DB3A 5KE2A 3EGUA 3H9NA 1RLQC 4GY5A 1IGUA 4M77F 5GAOr 2JXBA 2NLUA 5A0LA 1G2BA 3HPWA 2LQWA 3BDUA 4HVUA 1YWOA 4QVDA 2COWA 1ZUYA 1NJIU 4JJBA 5I11A 3PIOA 4JLIA 2KYBA 1O9SA 4A63B 1TUGB 2QI2A 3DKMA 2QA4T 1C6VX 3IQLA 2LTOA 2KR3A 2O4XB 4PL6A 1Z9ZA 4Z89A 2PZ1A 1EZZB 3QYGB 4J8OA 2WSFE 3CXCS 4PLIA 3JRZA 3CD6T 1JRIA 4AFSC 3QDRB 1NYGA 3EG3A 3FJ5A 2LC4A 2IIMA 2NYSA 1M8MA 2BIVA 1X69A 2DBKA 5C6SA 4R55A 2L3PA 3GPLA 3VYGA 4PJOE 3OSSC 3M57A 1RACB 2JS2A 2JJ9A 3RKXA 2RA2A 1VQMA 1XQHA 4M75A 4WCIA 5KYUA 5FU7C 3URGA 1YJ9T 1KQSP 2PQWA 5CR2A 4JJNK 1Y57A 4KH1B 4RTYA 4F16A 1BI2A 2MYSA 2XG8D 4MDWA 4FYVB 2RO0A 1JJ2A 3I55T 3CCJQ 2W0ZA 4NOYA 4EIKA 2CKKA 5I22A 2ZGWA 4KH0B 4FU6A 1BB9A 1SPKA 2X4JA 1CSKA 3VV0A 1WLPB 4C0ZA 3A8HB 1MMAA 2EVRA 3JB9F 2DMOA 2EQIA 3M0TA 2CZ1B 3I35A 1AZEA 1GCQA 1FXXA 1BCMA 4J9HA 3KBGA 2WACA 5IN1A 4PJOC 2Y4YA 2CT3A 1X6GA 3META 3SDZA 3A5ZB 4PJLA 1VQNA 1KC8R 4J6WA 2E3IA 2DM1A 1BYMA 2QXFA 3VS0A 1UECA 3ME9A 1NYFA 3VS2A 2CZ7B 3V8LA 4E7KA 2DPPB 3PE0A 3JCMb 2FPEA 4E7JA 3VS4A 1ABQA 1JXMA 1KD1C 1K9MC 1NG2A 3CCQA 5CKDA 3QPHA 4FW2A 3JCMc 5LJ3d 4QVCA 1ZSZC 5KCOA 3TSWA 1PNJA 1TWBA 3OS5A 1QW1A 3MJXA 4BI8B 3I56Q 4QKUA 4JZ3A 3TQ7P 4M7AG 2LT1A 2YRCA 3I55Q 3CCJT 3NGPA 2DIGA 5GAOq 3PT9A 4C92D 4C92B 4FCYA 3GOXA 4YTLA 3H6ZA 1N6AA 2D8HA 5IHIA 4IUVA 2C06A 3CCRA 1RAGB 4E2FB 3I5RA 1BKBA 2PTKA 1OZ2A 4M78E 4CC2A 1G3TA 1VA7A 1VQ6A 3EFOB 1YCSB 2DZCA 1M1KC 1W2BP 1Q82R 3RKWA 2RK1A 2K5LA 1PKSA 3JV3A 6AT1B 1Q86U 4Y92A 5HKCA 1VQPT 1N8RU 4C5EA 4MZMA 4CC7A 4PFZA 1Q7YU 2DZ9A 2GFAA 2ED0A 4GLMA 3X20B 3G6EQ 1TXQA 5GAOp 4XTVA 4QVZA 3CC4Q 5GAN4 2L3QA 3E1SA 5GAN6 5CIUA 3MHXA 3NTKA 4KUIA 4II1A 2YUPA 3RKYA 1QQJA 3E2UA 4BDZA 3FLGA 2CSIA 4FL6A 3CCVQ 4GBQA 1TS9A 1K9AA 1Q81R 3V7RA 1T3LA 2DXTA 2MWPA 4X34A 3CPWA 1ABOA 1QVFA 2J7IA 3EGDA 2E5KA 2EBPA 1W6XA 5GMKi 1U1TA 3LH0A 2DRKA 3RIRA 4RMOA 5KYWA 1BCOA 4N4GA 1X2QA 2XHCA 2DL3A 1TUDA 3SD4A 4M7DA 1M27C 4XTUA 3CXCA 2HKNA 2CREA 1AWJA 2E65A 4J7IA 3TU4K 1KC8U 2EGCA 2XI9A 4OB1B 3HSBA 5LJ3h 1W1FA 3HRUA 4E47A 1K1ZA 2KRMA 5EG2A 2JMAA 4LE9A 1WXTA 2DL7A 1ARKA 4M75B 4M75F 1K8AU 3FC3A 2EW3A 2BTTA 4L5GA 4A4GA 3CC7A 4ZTFA 1NEBA 1PD1A 4BD3A 4PJOG 2RJDA 2MOXA 2GTJA 1OX9A 1VQ8A 3M55A 4HT9A 2JMCA 2QQAA 3M0PA 1HYOA 2RQRA 3SB2A 1N8RR 3GIBA 1VQ8T 1JQQA 2KNBB 2RNAA 3L2QA 5GMKe 3EAEA 3I56A 4FSXA 1YIJA 2LCSA 1YI2Q 4N0AA 1JBMA 4ME7A 1IXDA 4FSSA 4FYWB 3THKA 3X28B 4C8QA 2RHUA 2DXCA 5M9OA 2XKOC 3L2VA 2OI3A 3ULRB 2YUNA 4XAXB 1PRLC 2ZPBB 3OBWA 2M9UA 2NWMA 2JTFA 2LX9A 1WI7A 4DOVA 3PMTA 5CKBA 1QCFA 2F1LA 4FT4A 2O4XA 1KC8C 1Q82C 2KSSA 2F5KA 2YXYA 2V1QA 1FMVA 2EQJA 3CCST 4RG8A 1YIJQ 1SSHA 1D1AA 1VQ5A 4XTXA 3CCUA 3L1AA 2M51A 2NUZA 4HCBA 1S72T 2EFIA 2VV5A 1VQMT 2O2OA 3NMZC 2COYA 3EHQA 4M75E 3CCEA 1RI9A 5GAOm 1SSFA 1GCPA 1GBQA 1ZSGA 2A3LA 1YP5A 5DLQE 3EFSA 3J81E 3BFMA 2AT1B 2KRNA 1EX4A 4PLLA 1WX6A 4EMKC 4J7FA 3CC2Q 2NUPA 1X01A 3R6OA 2BE9B 3OYYA 4RTWA 4QT7A 1WHJA 4M7DE 4HKEA 2LNVA 2EQUA 4EDUA 5GAN3 1VQ7T 2K3XA 1S72Q 1QVGA 1M8VA 1QVPA 4M7AE 3CPWS 1X6OA 1AWWA 1P92A 1Q7YR 2PNIA 3JCMh 3VUZA 1QP2A 4PJOF 4IIMA 4IKFA 2CYZB 2KDSA 4J5YA 2HZYA 3INZA 2LJ1A 1JEGA 2GCXA 1W2BS 3H0FA 1JB0E 2WSCE 1K73C 4M77A 1OX8A 2QEXQ 2GFUA 2L8DA 1A0NB 5GANj 2YDLA 4OGCA 3CC4T 4HCZA 1QCOA 1KQ2A 3PTAA 2ZCFB 3DLLA 1K8AR 5D6XA 1EIFA 4OB0B 2CP0A 2ZPIB 3PMIA 4O5VA 2FB7A 2X9HA 2F2XA 1SRMA 2PU9B 2RJEA 2DVEA 1M9SA 1YI2A 1U06A 2ENMA 4C92G 2V8IA 4CI0C 2LT4A 2W10A 1VQLQ 2DYIA 3JCMd 4IUQA 5GANf 4WF2A 2XU8A 2ZPEB 1BI0A 2EGAA 2E12A 2XDBA 1M5Q1 4ZTJA 4D8KA 1M2VB 4M4ZA 1F1BB 3GP8A 4HVWA 1ZA2B 4L59A 3BDLA 4XTYA 2IG0A 2JUFA 4Y28E 5I21A 1UGPB 4OMQA 4RCBA 2NUPB 2NUTA 1RLPC 3CC7Q 3EGXB 1ZUKA 2ZZDA 5GAN8 1AT1B 2KI7A 1IGQA 3J80E 3NTIA 1VQKQ 1YITQ 4RTTA 5FRNA 2DLPA 4M7DC 2M16A 4F7UG 2MWOA 4J83A 2SEMA 2MIOA 2EGEA 2P4RA 3OMGA 4JJDA 4XU2A 1BI3A 1UFFA 3QYHB 1X75C 2JZ2A 4A4HA 9ATCB 5FLXE 1G5VA 4BI3A 3G1JA 1KIKA 1MNDA 1UHFA 2D0NA 4IUUA 4F7UB 3CXCP 4RUGA 2CGHA 3FDRA 3BY7A 1B3QA 2ROTA 4XTZA 4TVRA 4EMKB 2SRCA 5L8RE 3VS5A 5D6WA 2ZPGB 1SHGA 2YHTA 2J6KA 4JZ4A 2RHZA 3QJYA 3JCMJ 1QCNA 2VXFA 1IHVA 2V8KA 3PVQA 1ZSZB 3ZBDA 4LUDA 4PJJA 4JUVA 2FZKB 5GAMg 2L3RA 2MCNA 2CH4W 2YRDA 2HEQA 1ACMB 4FIBA 7AT1B 1ZSZA 5FU7B 3OYBA 2ABLA 1V1CA 2C0TA 4P5NA 4AG1C 3VKIA 3CCQT 2PUOB 5KYYA 2AKKA 1GXIE 1UEBA 3FRNA 1BIBA 2A28A 4JRKA 3CC2A 4J9BA 4OMNA 4BY6C 3WVEB 2QQ9A 5I2SA 2VASA 2YWWA 1H641 2PUKB 3PGGA 2DFUA 1OU9A 1RI0A 2F69A 1UGQB 2HL3A 3CBMA 3OW2S 2YRVA 2V8JA 1N27A 3ZL7C 1KQSA 4QQGA 4M7AF 3CCVT 4FM4B 1E6GA 3EGXA 2EYYA 2F2VA 1WHLA 1NJIR 3M0RA 1PG5B 1QVGP 2JTEA 4OMFB 1GBRA 3PFSA 4MZPA 1D0XA 2JT4A 3H41A 3GNGA 4V2SA 1R0BG 1J3TA 4C5GA 2P0QA 3OY9A 4HA8A 4RKUE 4DBQA 1Q81C 2VVKA 2CDTA 2QQRA 3CBPA 2FEIA 2KRSA 3M0SA 4KGZB 1D0YA 2DL8A 1MNEA 2JM8A 3CCUQ 3RNJA 4EPCA 3CQTA 5GAMd 5GAOl 2BZYA 1LOJA 1VQLA 3LGLA 2K7AA 3C95A 2QGGA 1IRXA 2O31A 2LCLA 1HD3A 2F2WA 2OTJT 1VIFA 2YLBA 1YJ9A 3MEAA 5HCKA 2J6FA 2QA4Q 2DKGA 1TH7A 4NL2A 2RQUA 2HBPA 4B9XA 4JRPA 3JB9J 5GMKh 2HQXA 2BZ8A 1VQKT 2KXCA 1NPPA 5A0DA 1U3OA 4Z88A 1KJWA 1YCYA 4JPBW 4E7ZA 1JJ2P 2JOYA 1AHJB 2RN8A 1I5OB 3I56T 1VQOA 5LJ3f 2EYXA 1VQKA 4XQ3A 1OULA 2K5IA 4UC4A 4BUGA 1Q82U 2D6FA 4Y91A 5EC7A 2G6FX 3GLXA 4GLKA 2RQVA 4OMMA 2A7YA 4C5IA 2EKOA 4PNOA 1OPLA 2R5MA 2D9TA 1RAAB 2QTVA 1UTIA 2DETA 2DBMA 3KFVA 1W70A 2DL4A 4AG2C 3HHTB 2FRYA 3SHWA 1RUWA 5IHNA 5LJ3j 3UWNA 4JDSA 5GANe 3PVLA 3OYIA 3G4ST 3EH1A 2CT4A 2P4TA 4F17A 2X4XA 2QASA 4C0GA 1NLOC 4RTZA 1U8RA 4KBMB 3PNWC 2KT1A 2L89A 4ZGDB 2CH4A 4IUPA 3QO3A 4MMLA 1FX7A 1QLYA 2K6DA 3OBYA 4ZGJB 3OYCA 3D7SB 4KRTA 1KHCA 1WHHA 3KXTA 1YITT 4ZGEB 3R6NA 2EIFA 5GJWB 1Q95G 3PIPA 1YITA 3EHRA 1KQ1A 2JN0A 1NJIC 1R0CB 2M0OA 4LD6A 2M1HA 1RABB 2FZGB 5GAOn 1CKBA 1W2BA 4RG2A 2K79A 4KGXB 1WYXA 1B34B 3HFOA 4M75G 4RTVA 3QUIA 3RR6A 2RI3A 1JU5C 3QIIA 4J9GA 2C0OA 5KYNA 2OTJQ 3KUFA 1UE9A 4M75D 2AKLA 3TVTA 3WXMB 1VQNQ 4PFPA 1YJWQ 3RBBB 1YIJT 4LD9K 3JCMf 4E7SA 4XU1A 1UJ0A 2DIQA 3A8OB 2D8JA 4PFOA 4D6WA 3UT1A 3C12A 5GMKm 2C0IA 2L5QA 3RERA 2CP2A 2QQSA 1N5ZA 1K73U 4PJOB 3CCMA 3M58A 1LNXA 3BE3A 5C0MA 2DEQA 1IO6A 2Z0WA 3MP6A 3CPWP 3L42A 2K9GA 4K11A 3UF4A 3FJPA 2DXUA 5CO7A 1OV3A 1M30A 1UGSB 1RAIB 2KYMA 2O9SA 4MMKA 4PJOA 2VB6A 1M1GA 4LDXA 3HL8A 3UPUA 2QAZA 3JSCA 2MK5A 1VQ5T 1LPLA 1QWFA 1FMWA 3QG1A 2QK0A 1ZBXA 3OS0A 2Y90A 5ECAA 1UGVA 3TEEA 1VQ7A 4ORZA 1IREB 2KEAA 3MKDA 3RMSA 2R57A 2CUBA 1GL5A 3RMQA 3T9NA 3CCEQ 1NPRA 2DO3A 3OA6A 1M90R 3OS2A 3CCLA 1KD1R 1K9MR 2E6ZA 4M7AD 2HBWA 2A0FB 3OYGA 2HSPA 1WA7A 3CCUT 2QDYB 3VRYA 1T0JA 3H0HA 3M56A 4EMHA 3JB9I 2FL7A 4F04B 2PVGB 3M4GA 3OS1A 3CCET 4B9WA 3UDCA 2MF2A 4BY6B 4XU3A 1IZ6A 1GFCA 4C8QC 3BW1A 1UUEA 2QTXA 2ZPHB 1M1KU 3LYIA 3G71T 3CCLQ 4QQDA 4C0FA 2KE9A 1BIAA 2X4WA 5D6YA 3CCSQ 2E4HA 3UA6A 1MV0B 1NBEB 5GANh 2HKQB 2M0YA 3QWXX 1ZHIA 5KE3A 2K2VA 1BK2A 3CPFA 4DOWA 5AYFA 1ZLMA 2DTIA 3EG1A 3OSVA 3SFMA 5KYXB 1YJ9Q 4F7UE 3E19A 1SKUB 3L2UA 3G6ET 1Y0MA 3GF5A 2ATCB 3WVDB 4KT0E 4BI4A 1KHIA 1YJWA 2IVWA 4CC4B 1PCXA 1YI2T 1I0CA 1OZ3A 2FVUA 1YBYA 1E7OA 3CEYA 2CP5A 2DK3A 2RJCA 4J9DA 2HD0A 3VU3C 2LP5A 4DA4A 2XDDA 2XICA 4ZN1A 5CQXA 2G3RA 1QVFP 1Y71A 3SEMA 3J7AF 4M7DB 5FU6C 1WFWA 4CC3A 2BE7D 3JB9D 4BE0A 2CP3A 1TUCA 3EGDB 1Y96A 5AT1B 3QZ5B 4B6MA 3N5BB 2DE0X 2OAUA 4C5HA 3A8MB 2FHDA 5KH6A 1VYVA 2ED1A 1PM3A 3AHUA 3OYJA 1YNZA 2EJFA 5KYYB 5CAIA 1AVZC 5FWBA 2KK4A 2MPXC 3JCMP 4J6XA 4DEYA 4A54A 3C94A 5LJ5e 1S1NA 3CCMQ 1NLPC 2GF7A 4J6YA 4AFZC 5CK9A 4FT2A 1N9SA 1YJNQ 2HAXA 2GBQA 1VYTA 2EJ9A 2HQEA 3DLMA 4Q5WA 3ASKA 3HRTA 4MDXA 4DBHA 1UB4A 3E9FA 3LGFA 3MP1A 2VXEA 2FZCB 5GMKj 2YUOA 2D0QB 2DD5A 1M3CA 1G83A 3VS1A 1UDLA 3F70A 4X1VA 5CVIA 5LJ5g 4FYXB 5LJ5h 3M0UA 4M78G 4F7UA 3G71Q 2DILA 4N0AC 2L2PA 2LVMA 1IB8A 1PKTA 2ZPFB 4BDYA 5IH2A 1RAEB 1HJDA 3EH2A 3LWHA 1HK9A 5GAMh 1B07A 1IHWA 3JB9H 3G4SA 1YFNA 1WPYA 1PSEA 3G7ZA 1XOVA 4DBRA 4HCCA 2MAMA 2DNUA 2X4YA 1K8AC 1YHQA 1NEGA 2LX7A 1Y96B 2DXBA 2LZ6B 1TOVA 3TSZA 1WNLA 3Q1JA 4A53A 4N4HA 1H3ZA 5CKEA 4A4EA 4C8QE 1VQ9A 1SEMA 2EQMA 2JVVA 2KBTA 5L23A 1YWPA 1H92A 3EG9B 1Q7YC 3I55A 4A4KA 3X24B 1WIEA 2KVQG 2ROLA 1X6BA 4JJCA 4L6V5 3HKSA 4QW2A 3L2WA 2XMFA 2CZ0B 3OYEA 1M90C 1ZBJA 2RHXA 1K73R 5CKFA 1NZ9A 5LL6S 1Z9QA 1VQOQ 2E3HA 1G3YA 4E7LA 1Y07A 1GFDA 5CCAA 1LCKA 1WXUA 3C4SA 1AD5A 4F7UF 2RJFA 2LJ0A 1Y7XA 3SWNB 3OB9A 2EJGA 1M1KR 4RTUA 2KGTA 3QBYA 2EYWA 4J9CA 3S3MA 4OMOA 1ZUUA 1OI1A 2RQWA 3SWNA 1AOJA 2HMAA 3L2RA 1LVKA 3OYNA 2KROA 1G3WA 1VQMQ 1GRIA 5CKHA 4M77C 4C92A 2IPOB 4C8QF 1VQ6T 4C8QB 4M77B
chains in the Genus database with same CATH topology
3L2VA 1U8RA 3QSUA 3H8ZA 4KBMB 3QXEB 1VQ4A 3HP9A 4QQ6A 4XAXB 3OYFA 3PNWC 2RK2A 2ZPBB 3OBWA 2L89A 2M9UA 4ZGDB 1KD1U 1K9MU 2JTFA 2LX9A 4DOVA 3PMTA 4IUPA 3QO3A 5CKBA 4MMLA 1FX7A 4FT4A 5FRMA 2K4YA 4XK8E 4OB3B 2O4XA 3JCMg 1VQPA 3X25B 1KC8C 3OBYA 1Q82C 2QEXT 4KUDK 2KSSA 4ZGJB 4KULA 4M78A 1I5LA 2F5KA 4M75C 3CCLT 3OYCA 3M4YA 5M9OA 3LWIA 2EQJA 1KHCA 1JJ2S 3KXTA 4RG8A 1PSFA 5I2MA 3CCST 1YITT 2QEXA 3ER0A 4MZTA 1I4K1 5DLOA 4ZGEB 1VQ5A 3CMEA 4XTXA 3CCUA 3L1AA 2EIFA 2XIDA 3CC4A 2X35A 3JCMX 3PIPA 3CCSA 1YITA 4HCBA 1KQ1A 1YJ9A 1S72T 2EFIA 2JN0A 5DM7R 2GQVA 2VV5A 3HFNA 4BACA 3JB9G 1NJIC 2M0OA 1VQMT 3JCMe 1XTDA 4LD6A 4M75E 2LQ8A 2K57A 3CCEA 2M1HA 5GAOm 3CMAA 2CZ6B 1I81A 2DTOA 3ZEHA 5GAOn 3CMET 5LJ5f 2RHIA 1SSFA 3VYHB 5HK0A 5GAN2 4RG2A 5GMKl 1W2BA 1B34B 1WQ7A 1QP3A 2A3LA 3HFOA 4M75G 5HK3A 1LJOA 3EFSA 3QUIA 5DLQE 3S6WA 3BFMA 1I8FA 3J81E 2DJZA 1VQ4T 2OTLA 2RI3A 1D3BA 4PLLA 3L2ZA 3QIIA 3M5AA 4EMKC 2R58A 4J7FA 2EAYA 1O75A 3KUFA 4LDUA 3OYAA 1BI1A 2O01E 4M75D 4OVAA 1X01A 3R6OA 3WXMB 4PJOD 3HRSA 2R5AA 3OYYA 1WGSA 5CQYA 1OYXA 4M78F 1VIEA 4M7DE 4M77D 1YIJT 4HKEA 2LNVA 4LD9K 2EQUA 3JCMf 4IUTA 2K3YA 4XU1A 4C0DC 4EDUA 5GAN3 1N8RC 1VQ7T 2LRQA 1MGQA 2E1HA 1WJSA 3LLRA 2K3XA 2DIQA 3A8OB 3OMCA 1QVGA 3DB4A 1M8VA 1QVPA 4D6WA 4M7AE 2E5QA 5J3BA 3CPWS 4M7DG 1X6OA 3UT1A 3C12A 5GMKm 2L5QA 1P92A 3RERA 5FU6B 3CMAT 2QQSA 2E70A 5GAMe 3JCMh 5GAN5 1K73U 3VUZA 1QP2A 3JCMV 3SWNC 4PJOB 3CCMA 4PJOF 3V8JA 3M58A 1LNXA 2CYZB 2KDSA 2RB6A 3FEOA 4J5YA 2DEQA 3INZA 5C0MA 3M53A 5GAMf 1YJNT 3MP6A 4BE1A 2GCXA 3L42A 1W2BS 1JB0E 1Q86C 2WSCE 3O8VA 1K73C 4IKFA 5FROA 5GANd 5HY6A 3FJPA 4CRIA 2DXUA 2XD0A 3E9GA 3MEUA 4M77A 5CO7A 3NTHA 2VGNA 2GFUA 2L8DA 1UGSB 4MMKA 4PJOA 4R56A 3MCAB 5GANj 2PVOB 1M1GA 4LDXA 3HL8A 4OGCA 3UPUA 1RL2A 3P8HA 3M9QA 4LDVA 4OB2B 3JSCA 3CC4T 4JLGA 1VQ5T 4HCZA 3P8DA 2DTHA 3OYDA 3V7CA 1KQ2A 3QG1A 3PTAA 1U1SA 2ZCFB 1ZBXA 4VUBA 5J39A 3DLLA 3S3OA 1Q81U 3OS0A 5D6XA 1EIFA 2Y90A 4OB0B 5A0GA 2ZPIB 3TEEA 3PMIA 1IREB 4O5VA 4C8QD 4C92E 1VQ7A 2FB7A 3RMSA 3EFRA 2R57A 5LJ5d 2PU9B 5GAMj 2E64A 2RJEA 2DVEA 1M9SA 1XNIA 3DB3A 4BB7A 4C92C 2LCCA 4N4IA 3RMQA 5KE2A 1YI2A 1VQNT 1V29B 3T9NA 4C92F 1NPRA 4C92G 4GY5A 2V8IA 2DO3A 4CI0C 3OA6A 4RCCA 4C8QG 4M77F 2LT4A 4OGEA 3OS2A 5GAOr 2NLUA 3CCLA 5A0LA 4O6JA 2E6ZA 4M7AD 3HPWA 3JCMd 4IUQA 5GANf 4WF2A 3OYGA 2XU8A 3BDUA 2ZPEB 1BI0A 4OP0A 3CCUT 2QDYB 2KQWA 4QVDA 3LW5E 1NJIU 2E12A 2XDBA 3PIOA 1M5Q1 4JLIA 3M56A 4EMHA 3JB9I 4ZTJA 4M7AA 1O9SA 2FL7A 2QA4T 2QI2A 2RI5A 3DKMA 3GP8A 3OS1A 2PVGB 1R8OB 3M4GA 2LTOA 2O4XB 4PL6A 4L59A 1VQOT 3CCET 3BDLA 1YJWT 1JJ2A 4B9WA 3OYKA 4XTYA 3UDCA 2IG0A 2JUFA 4Y28E 3VUBA 5I21A 2XDPA 3QYGB 1UGPB 4RCBA 4J8OA 2MF2A 2WSFE 2MMPA 3CCVA 4JS5A 3CXCS 4PLIA 3JRZA 4BY6B 2YLCA 3CD6T 1JRIA 2E6NA 4XU3A 1M1FA 1IZ6A 3QDRB 4E7HA 4C8QC 2E10A 3BW1A 1QVGS 4PKCC 2QTXA 2ZPHB 4ELYC 2LC4A 2I2LA 2ZZDA 5GAN8 1M1KU 2BIVA 2KY9A 3LYIA 3G71T 4M77E 3CCJA 2OTLT 4QQDA 4C0FA 3NTIA 5C6SA 3J80E 4R55A 3GPLA 1BIAA 2X4WA 5D6YA 3OSSC 3VYGA 4PJOE 3M57A 5GANh 5FRNA 4M7DC 2M16A 3RKXA 2RA2A 4F7UG 3OW2A 3OYLA 2MWOA 2HNIA 1VQMA 1ZHIA 1XQHA 4M75A 5KE3A 5A2QE 2K2VA 4J83A 4LDWA 3CPFA 4DOWA 3RUXA 5AYFA 4EMKA 3G71A 5FU7C 3URGA 2DTIA 3CCRT 1YJ9T 3OSVA 3SFMA 4C0DB 2PQWA 5CR2A 4JJNK 2LDMA 3OMGA 4XU2A 4F7UE 3E19A 1BI3A 3QYHB 1MHNA 1X75C 2JZ2A 4A4HA 3L2UA 5FLXE 3G6ET 1G5VA 1BI2A 4BI3A 3GF5A 2XG8D 4MDWA 2BKDN 3WVDB 4IUUA 5GAN7 3MO8A 2RO0A 3P8BB 4KT0E 2KAFA 4F7UB 2CGHA 3FDRA 3BY7A 4BI4A 3I55T 4NOYA 1KHIA 4XTZA 2CKKA 1YJWA 4TVRA 3CCMT 2ZGWA 4EMKB 2IVWA 4FU6A 5L8RE 4M7DF 2X4JA 5D6WA 5J26A 2ZPGB 3VV0A 5LJ3g 1YI2T 2YHTA 2AHJB 2P0PA 2RHZA 3QJYA 3JCMJ 4C0ZA 1OZ3A 2VXFA 2V8KA 1YJNA 3A8HB 2FVUA 4X9DA 1YBYA 3JB9F 3X26B 2FYKA 3ZBDA 2LQKA 3CEYA 2DK3A 2RJCA 2VC8A 3MEWA 2CZ1B 3TREA 4JUVA 2HD0A 3QJ6A 4LDYA 3VU3C 1FXXA 3CC2T 5GAMg 2L3RA 3FIFA 4DA4A 2XDDA 2XICA 2RH2A 4ZN1A 3KBGA 3MP8A 1ZQ1A 2WACA 5CQXA 4FIBA 4M78B 5IN1A 5LJ3e 4PJOC 2G3RA 2Y4YA 1Y71A 1VUBA 3J7AF 2E41A 4DQ2A 4M7DB 2EQKA 3META 5FU6C 3SDZA 5FU7B 3A5ZB 3OYBA 3JB9D 4P5NA 1VQNA 3VKIA 4BE0A 3CCQT 2PUOB 4J6WA 3FB9A 4M7AB 3QHSA 1BYMA 2QXFA 1Y96A 1GXIE 3QZ5B 1UEBA 3NFCA 3ME9A 3FRNA 3N5BB 2CZ7B 4ATOA 3V8LA 1BIBA 2OAUA 2DPPB 4C5HA 3JCMb 4E7JA 4JRKA 4OF1A 4E7KA 1S72A 3CC2A 3A8MB 2FHDA 2EYQA 1N9RA 3GNFB 4BY6C 3WVEB 4NL3A 2QQ9A 5I2SA 1KD1C 1K9MC 5KH6A 3CCQA 3AHUA 1H641 2PUKB 5CKDA 3VJPA 3PGGA 3OYJA 2K5FA 3QPHA 1B34A 2EJFA 3JCMc 1RI0A 2F69A 3JCMQ 1UGQB 5LJ3d 4QVCA 5CAIA 2CS7A 3CBMA 3OW2S 5KCOA 2KK4A 3JCMP 4J6XA 2YRVA 1NE8A 1QVFS 3OS5A 2H3JA 2V8JA 1QW1A 4A54A 1N27A 3CD6A 3C94A 4M7AC 4BI8B 1KQSA 5LJ5e 4QQGA 4XU0A 4M7AF 3CCVT 4FM4B 4M7AG 2DAQA 2LT1A 2GF7A 4J6YA 5CK9A 4OMFB 4IURA 4FT2A 1N9SA 3CCJT 3PFSA 2DIGA 4MZPA 5GAOq 3PT9A 2HAXA 4C92D 3LX7A 4C92B 3GOXA 2EJ9A 2HQEA 3DLMA 3GNGA 4V2SA 2RHYA 4Q5WA 3H6ZA 1N6AA 4YTLA 3A8LB 3ASKA 3V8KA 3HRTA 4C5GA 2P0QA 4MDXA 1UB4A 3OY9A 4IUVA 3CBOA 3E9FA 4HA8A 4RKUE 3LGFA 2C06A 3CCRA 1Q81C 3MP1A 1BKBA 2EWNA 4M7DD 2VXEA 2QQRA 3CBPA 1OZ2A 5KCHA 4M78E 5GMKj 1G3TA 1G3SA 2D0QB 1VQ6A 2OTJA 2DD5A 4NS5A 4XTWA 3G6EA 3F70A 2DZCA 5CVIA 5LJ5g 1M1KC 5LJ5h 3A8GB 2RK1A 4M78G 3RKWA 2K5LA 4F7UA 4BE2A 5GAMh 4N0AC 2LVMA 4EPCA 5GAMd 5GAOl 1Q86U 5HKCA 5IT9E 3CC7T 1LOJA 3S3NA 1VQPT 1VQLA 1N8RU 2B8AA 4C5EA 4MZMA 3LGLA 3C95A 2ZPFB 1Q7YU 2DZ9A 2GFAA 3X20B 4BDYA 5GAOp 2LCLA 4XTVA 4QVZA 4EMGA 2OTJT 5GAN4 3LWHA 2P0KA 1VIFA 1HK9A 2YLBA 3M54A 3MEAA 2BUDA 3E1SA 3TCJA 5LJ5j 2MI6A 5GAN6 5CIUA 3JB9H 2PVDB 3G4SA 2RI2A 3MHXA 3NTKA 1WPYA 4KUIA 3OYMA 1PSEA 2QQBA 1HXDA 1TH7A 2DKGA 3G7ZA 1XOVA 4II1A 4NL2A 3RKYA 2HBPA 3MEVA 5DY9A 4B9XA 4JRPA 3JB9J 4HCCA 5GMKh 1VQ9T 2MAMA 2X4YA 2HQXA 1YHQA 4ELZC 4JS4A 4BDZA 3FLGA 1K8AC 4FL6A 1VQKT 1VQLT 1Y96B 2KMTA 2DXBA 4M78C 1FWZA 1WNLA 3Q1JA 4HT8A 5GANg 3V7RA 4A53A 1NPPA 4N4HA 1WQWA 2DD4A 2DXTA 5A0DA 1H3ZA 5CKEA 2MWPA 2VGMA 4A4EA 4C8QE 4X34A 1VQ9A 1YCYA 1DJ7B 3CPWA 2EQMA 2JVVA 2XK0A 1M4ZA 1QVFA 2JOYA 1AHJB 5GMKi 1U1TA 2RM4A 3LH0A 3OYHA 1UGRB 3RIRA 4RMOA 3I56T 5IAYA 3M59A 1Q7YC 3QKJA 4N4GA 4C8QF 3I55A 1VQOA 4A4KA 2XHCA 3X24B 2KVQG 4C8QB 5LJ3f 1VQKA 4XQ3A 3SD4A 4M7DA 4XTUA 4L6V5 3CXCA 2K5IA 3HKSA 4UC4A 2RD1A 4QW2A 2E65A 4BUGA 3L2WA 1Q82U 2D6FA 4J7IA 1M90U 2CZ0B 3RESA 4Y91A 3OYEA 3TU4K 1M90C 4JRQA 1KC8U 2XI9A 4OB1B 2F5TX 2RHXA 3HSBA 5LJ3h 3GLXA 4GLKA 5CKFA 1NZ9A 4X9CA 2A7YA 4C5IA 5LL6S 2EKOA 2JNGA 3HRUA 4PNOA 2VYTA 2R5MA 4E47A 1KG1A 2D9TA 1G3YA 1WJRA 2Y4XA 4E7LA 1Y07A 4M78D 5EG2A 5CCAA 3C4SA 4F7UF 2RJFA 4M77G 4M75B 4M75F 1K8AU 3FC3A 1Y7XA 4L5GA 4A4GA 3SWNB 3OB9A 3CC7A 4BD3A 3HHTB 4ZN3A 4PJOG 4ZTFA 2RJDA 4Z02A 3JAME 2EJGA 1W4SA 1VQ8A 3M55A 1D3BB 4HT9A 5LJ3j 2QQAA 3UWNA 3SB2A 3GIBA 4JDSA 5GANe 3OYIA 3QBYA 3S3MA 1VQ8T 3JCMW 1OI1A 4JRIA 3L2QA 5GMKe 3G4ST 4A4FA 1WJQA 3EAEA 3I56A 3SWNA 4FSXA 3OQ5A 3L2RA 1YIJA 3ZFJA 3OYNA 1G3WA 2P4TA 3V7SA 2QA4A 4E7IA 4N0AA 1JBMA 2WSEE 1YHQT 4ME7A 5CKHA 1KQSS 2X4XA 3QZ9B 4M77C 4C92A 2JTMA 3X28B 2VUBA 4C8QA 2RHUA 4C0GA 2DXCA 1VQ6T 2XKOC 4M77B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X9D A;  3QSU A;  3JB9 F;  2FYK A;  2DTH A;  2VC8 A;  2DZ9 A;  3V7C A;  1KQ2 A;  5GAO p;  1U1S A;  4JUV A;  4XTV A;  4EMG A;  3VU3 C;  5GAN 4;  2Y90 A;  1HK9 A;  2YLB A;  3QO3 A;  4MML A;  5LJ5 j;  5GAM h;  5GAM g;  3FIF A;  4C92 E;  4C8Q D;  5GAN 6;  3JB9 H;  1WPY A;  2FB7 A;  3EFR A;  3JCM g;  1HXD A;  1TH7 A;  2DKG A;  5LJ5 d;  4NL2 A;  4M78 B;  3RKY A;  5LJ3 e;  2E64 A;  5GAM j;  2DVE A;  4PJO C;  4C92 C;  4M78 A;  1I5L A;  4M75 C;  5DY9 A;  3JB9 J;  5GMK h;  4C92 F;  2E41 A;  4DQ2 A;  4M7D B;  4C92 G;  4RCC A;  4C8Q G;  1Y96 B;  4M77 F;  3JB9 D;  5GAO r;  1I4K 1;  4M78 C;  1WNL A;  4J6W A;  4XTX A;  4HT8 A;  4M7A D;  5GAN g;  3FB9 A;  3V7R A;  4M7A B;  4A53 A;  3L1A A;  3QHS A;  3JCM d;  4WF2 A;  5GAN f;  1WQW A;  3BDU A;  2DXT A;  3JCM X;  1Y96 A;  4OP0 A;  1KQ1 A;  4QVD A;  4C8Q E;  2JN0 A;  3JB9 G;  3HFN A;  1YCY A;  1M5Q 1;  1BIB A;  3V8L A;  4JLI A;  3JCM e;  4M75 E;  4EMH A;  4JRK A;  2K57 A;  3JCM b;  3JB9 I;  4M7A A;  5GAO m;  1N9R A;  5GMK i;  1U1T A;  3M4G A;  4NL3 A;  1I81 A;  2DTO A;  2RM4 A;  5GAO n;  3RIR A;  1H64 1;  5LJ5 f;  3AHU A;  3PGG A;  4XTY A;  5GAN 2;  5GMK l;  3JCM Q;  1B34 A;  5I21 A;  2EJF A;  3JCM c;  1B34 B;  1WQ7 A;  3HFO A;  4M75 G;  4RCB A;  4XQ3 A;  5LJ3 f;  4M7D A;  1LJO A;  3EFS A;  3QUI A;  4XTU A;  5LJ3 d;  2YLC A;  1I8F A;  3BFM A;  2DJZ A;  2RD1 A;  1JRI A;  4QVC A;  4XU3 A;  5CAI A;  1D3B A;  3L2Z A;  4C8Q C;  2E10 A;  2E65 A;  3BW1 A;  4EMK C;  3JCM P;  2EAY A;  4J6X A;  3RES A;  2QTX A;  4Y91 A;  2I2L A;  5GAN 8;  4A54 A;  4M75 D;  1X01 A;  4M7A C;  3HSB A;  5LJ3 h;  4M77 E;  4PJO D;  5LJ5 e;  4X9C A;  4XU0 A;  4M7A F;  4M78 F;  4M7A G;  4PNO A;  1BIA A;  4M7D E;  4M77 D;  4PJO E;  4J6Y A;  4M78 D;  5GAN h;  3JCM f;  5GAN 3;  1N9S A;  4XU1 A;  4M7D C;  4F7U F;  3RKX A;  1MGQ A;  2E1H A;  2RA2 A;  4M77 G;  4F7U G;  4C92 D;  5GAO q;  4M75 B;  4M75 F;  4C92 B;  2HNI A;  1M8V A;  4M75 A;  3SWN B;  2EJ9 A;  4M7A E;  4EMK A;  4M7D G;  4PJO G;  3RUX A;  4V2S A;  2EJG A;  3V8K A;  5GMK m;  3RER A;  2DTI A;  1D3B B;  4HT9 A;  5GAM e;  3JCM h;  4HA8 A;  4XU2 A;  4F7U E;  5LJ3 j;  5GAN 5;  3JCM V;  3SWN C;  4PJO B;  3SB2 A;  4PJO F;  4M7D D;  2EWN A;  3V8J A;  2VXE A;  3GIB A;  5GAN e;  1LNX A;  4M78 E;  5GMK j;  2RB6 A;  4J5Y A;  2DEQ A;  3INZ A;  5GAN 7;  5GAM f;  3JCM W;  4F7U B;  4JRI A;  2CGH A;  5GMK e;  3BY7 A;  4XTW A;  4NOY A;  4XTZ A;  3SWN A;  2ZGW A;  4EMK B;  2DZC A;  5LJ5 g;  5GAN d;  3FJP A;  5LJ5 h;  2DXU A;  3RKW A;  4M78 G;  3V7S A;  4M77 A;  4N0A A;  4F7U A;  1JBM A;  4M7D F;  5LJ3 g;  4M77 C;  4N0A C;  2YHT A;  4C92 A;  5GAM d;  4MMK A;  5GAO l;  3JCM J;  4PJO A;  4C8Q A;  5GAN j;  1LOJ A;  2VXF A;  4C8Q F;  4C8Q B;  4M77 B; 
#chains in the Genus database with same CATH topology
 3QSU A;  2FRW A;  2FG0 A;  3QXE B;  2JW4 A;  3HP9 A;  4QQ6 A;  2RK2 A;  1KD1 U;  1K9M U;  1AEY A;  1M2V A;  3CMA Q;  5FRM A;  1RAD B;  2K4Y A;  4XK8 E;  4OB3 B;  2HCK A;  3JCM g;  1VQP A;  3EG9 A;  3X25 B;  2QEX T;  4KUD K;  4KUL A;  4M75 C;  3CCL T;  4RTX A;  3QWY A;  1JJ2 S;  1K4U S;  1VYU A;  2QEX A;  4MZT A;  2LNH B;  1K76 A;  3GBQ A;  1X27 A;  2X35 A;  1RAF B;  3CCS A;  3CC2 T;  1PD0 A;  3JB9 G;  2GQV A;  3HFN A;  4BAC A;  3JCM e;  1XTD A;  1VQP Q;  1K0S A;  2K57 A;  5IHK A;  2GNC A;  1I81 A;  3ZEH A;  3CME T;  2O88 A;  5LJ5 f;  2RHI A;  4J9F A;  5GMK l;  1VQ7 Q;  1WQ7 A;  2ESW A;  1QP3 A;  5HK3 A;  2RMO A;  1LJO A;  3S6W A;  1I8F A;  2DJZ A;  1UJY A;  1VQ4 T;  3L2Z A;  2HL5 C;  4PK4 A;  4HXJ A;  1WDX A;  2R58 A;  1O75 A;  2D1X A;  1BI1 A;  2O01 E;  2L0A A;  1UG1 A;  1Q86 R;  4PJO D;  3HRS A;  2R5A A;  1QMC A;  4M78 F;  2COZ A;  1JO8 A;  4C0D C;  1WHG A;  2K3Y A;  3UA7 A;  1N8R C;  2LRQ A;  1MGQ A;  3LLR A;  3DB4 A;  4OML A;  2FPD A;  4M7D G;  4LN2 A;  2OX7 A;  3EG2 A;  3RDV A;  4J9E A;  2E70 A;  2QDL A;  5GAN 5;  1HSQ A;  3JCM V;  3SWN C;  1D1B A;  3REB B;  3V8J A;  1B7T A;  2DL5 A;  2KT8 A;  1YJN T;  1D09 B;  4BE1 A;  4AFU C;  4ZNX A;  5FRO A;  1D0Z A;  1WHK A;  5GAN d;  1YHQ Q;  3NPF A;  2DER A;  4R56 A;  1VQ5 Q;  3MCA B;  3M0Q A;  1RL2 A;  3P8H A;  3M9Q A;  2RPN A;  4OB2 B;  1QKX A;  4JLG A;  1FYN A;  3OYD A;  3V7C A;  5J39 A;  4C92 E;  4C8Q D;  1FMK A;  2VKN A;  3EFR A;  3A98 A;  2V26 A;  5LJ5 d;  2E64 A;  1VQ9 Q;  1XNI A;  4C92 C;  4BB7 A;  1VQN T;  2LCC A;  4N4I A;  1V29 B;  4C92 F;  2KXD A;  4OMP A;  4RCC A;  4C8Q G;  4OGE A;  4O6J A;  4OP0 A;  2KQW A;  3LW5 E;  5IXB A;  2HQH A;  1SG5 A;  4F14 A;  2L3S A;  4M7A A;  2A08 A;  2RI5 A;  1T0H A;  1R8O B;  1VQO T;  2J05 A;  4AT1 B;  1YJW T;  3OYK A;  3VUB A;  2ZAE A;  1V76 A;  2XDP A;  2JM9 A;  3CCV A;  2MMP A;  4JS5 A;  2YLC A;  1H8K A;  2E6N A;  1M1F A;  4PJM A;  4E7H A;  2E10 A;  1QVG S;  1MV3 A;  4PKC C;  4IIO A;  1QKW A;  4ELY C;  2I2L A;  2I0N A;  1TSF A;  2KY9 A;  3CCJ A;  1OEB A;  2OTL T;  4M77 E;  2LQN A;  1JXO A;  3U23 A;  2AIR B;  3OW2 P;  3NHN A;  3OW2 A;  2X3W D;  3OYL A;  2HNI A;  5A2Q E;  4EMK A;  4LDW A;  3G71 A;  3RUX A;  4LUE A;  3CCR T;  4C0D B;  2LDM A;  2DA9 A;  5KYX A;  1MHN A;  1VOM A;  2BKD N;  5GAN 7;  2B86 A;  3MO8 A;  3P8B B;  2J06 A;  2KAF A;  1SRL A;  1TG0 A;  2V1R A;  3CCM T;  1M3B A;  3G4S Q;  2YSQ A;  2HSE B;  5FW9 A;  4M7D F;  1MMG A;  5J26 A;  3EFO A;  5LJ3 g;  2AHJ B;  2P0P A;  2X3X D;  1YJN A;  1AWO A;  4X9D A;  1AWX A;  3H0I A;  1VQ6 Q;  1BU1 A;  3X26 B;  2FYK A;  2LQK A;  2VC8 A;  3MEW A;  2BZX A;  2CP6 A;  3TRE A;  3QJ6 A;  4LDY A;  3FIF A;  2JS0 A;  2RH2 A;  3MP8 A;  1ZQ1 A;  4M78 B;  5LJ3 e;  1VUB A;  4WTO B;  2E41 A;  4DQ2 A;  2EQK A;  1G8X A;  1QWE A;  1YN8 A;  3CCQ Q;  2GTO A;  3FB9 A;  4M7A B;  3QHS A;  3NFC A;  4ATO A;  2DEU A;  1S72 A;  4OF1 A;  2EYQ A;  1N9R A;  3GNF B;  4NL3 A;  1WXB A;  3UAT A;  2GQI A;  3VJP A;  2K5F A;  1B34 A;  2O9V A;  1ZA1 B;  3JCM Q;  2DJQ A;  2CS7 A;  1X43 A;  1NE8 A;  1WZO A;  2VWF A;  1QVF S;  4AMC A;  2H3J A;  3CD6 A;  4M7A C;  1EFN A;  1ZX6 A;  4XU0 A;  2CUD A;  2DAQ A;  3QDF A;  5IXF A;  4FYY B;  2DF6 A;  4IUR A;  2ECZ A;  3LX7 A;  2RHY A;  3VRZ A;  3V8K A;  3A8L B;  3CBO A;  2OTL Q;  2A37 A;  4M7D D;  2EWN A;  1TU0 B;  5KCH A;  1G3S A;  2OTJ A;  4NS5 A;  1WHM A;  4XTW A;  1VQ4 Q;  2EKH A;  3G6E A;  4J9I A;  4ESR A;  3A8G B;  3VS7 A;  4BE2 A;  1CKA A;  1R77 A;  1MUZ A;  2QYZ A;  4DEX A;  1I07 A;  5IT9 E;  3CC7 T;  3S3N A;  2B8A A;  3VS6 A;  4ANJ A;  2DYB A;  1C1A A;  5GJV B;  4EMG A;  2P0K A;  2H8H A;  3M54 A;  5LJ5 j;  3TCJ A;  2BUD A;  2EYZ A;  2MI6 A;  2PVD B;  1UHC A;  2RI2 A;  3OYM A;  2QQB A;  1HXD A;  2YUQ A;  3MEV A;  4LXC A;  5DY9 A;  1OOT A;  2DX1 A;  2OJ2 A;  1VQ9 T;  4ELZ C;  4JS4 A;  2FO0 A;  1VQL T;  2KMT A;  1OQK A;  1SHF A;  2J6O A;  1T3S A;  2A36 A;  1FWZ A;  4M78 C;  5FWC A;  4Z8A A;  1PWT A;  4HT8 A;  5GAN g;  1WQW A;  2DD4 A;  2CP7 A;  2VGM A;  8ATC B;  1DJ7 B;  2AZS A;  1MMD A;  2XK0 A;  1M4Z A;  2DVJ A;  2RM4 A;  3OYH A;  1UGR B;  1D1C A;  5IAY A;  3M59 A;  3QKJ A;  2RD1 A;  2K2M A;  1AZG B;  1M90 U;  3RES A;  4JRQ A;  2YT6 A;  2F5T X;  1NM7 A;  4X9C A;  1X2K A;  2JNG A;  1OPK A;  2VYT A;  1KG1 A;  2Y4X A;  1WJR A;  4AFQ C;  4M78 D;  4M77 G;  3LH5 A;  1C0M A;  2DRM A;  2RF0 A;  4ZN3 A;  4Z02 A;  3JAM E;  1W4S A;  1TTH B;  1D3B B;  2QG9 B;  1E6H A;  2M02 A;  8AT1 B;  3A1P A;  1PHT A;  3EG0 A;  1OU8 A;  3JCM W;  4JRI A;  2QGF B;  5D7U A;  4A4F A;  1WJQ A;  1PC0 A;  3OQ5 A;  3ZFJ A;  1KSW A;  3V7S A;  2QA4 A;  4E7I A;  3VS3 A;  2WSE E;  3I9Q A;  1YHQ T;  1KQS S;  1PRM C;  3QZ9 B;  2JTM A;  2RQT A;  2VUB A;  2GGR A;  1M2O A;  3H8Z A;  4R0K A;  1VQ4 A;  1I1J A;  3OYF A;  1MMN A;  1RAH B;  3CCR Q;  3HTR A;  2P84 A;  4M78 A;  1I5L A;  3AT1 B;  3M4Y A;  4HVV A;  3LWI A;  1PSF A;  5I2M A;  3ER0 A;  1I4K 1;  3REA B;  4HCK A;  5DLO A;  3CME A;  3CD6 Q;  2XID A;  3CC4 A;  3JCM X;  5DM7 R;  1H3H A;  1K0X A;  2OAW A;  2LQ8 A;  2K3B A;  3CMA A;  2CZ6 B;  2DTO A;  5HK0 A;  3VYH B;  1VQ8 Q;  5GAN 2;  2AK5 A;  1KFZ A;  1U5S A;  2OTL A;  1D3B A;  5KYW B;  3M5A A;  2EAY A;  4LDU A;  3OYA A;  2NUT B;  4OVA A;  1SF9 A;  2X51 A;  3CME Q;  1WGS A;  5CQY A;  1OYX A;  1XJW B;  1VIE A;  4M77 D;  4PJN A;  2CSQ A;  4IUT A;  5KYU B;  3I5S A;  2HDA A;  2E1H A;  1WJS A;  3OMC A;  2E5Q A;  5J3B A;  3O5Z A;  4E6R A;  5FU6 B;  3CMA T;  1BBZ A;  5GAM e;  2EPD A;  4LNP A;  1M3A A;  2H3E B;  2RB6 A;  3FEO A;  1KK7 A;  3M53 A;  5GAM f;  3C0C A;  1Q86 C;  3MPU B;  3O8V A;  4DBF A;  5HY6 A;  4CRI A;  2XD0 A;  3E9G A;  3MEU A;  3NTH A;  2VGN A;  4FW1 A;  2FPF A;  2PVO B;  4LDV A;  3P8D A;  2DTH A;  4KGV B;  1U1S A;  4VUB A;  4D8D A;  3S3O A;  1Q81 U;  2LJ3 A;  2LMJ A;  2AZV A;  5A0G A;  5GAM j;  1GCQ C;  3DB3 A;  5KE2 A;  3EGU A;  3H9N A;  1RLQ C;  4GY5 A;  1IGU A;  4M77 F;  5GAO r;  2JXB A;  2NLU A;  5A0L A;  1G2B A;  3HPW A;  2LQW A;  3BDU A;  4HVU A;  1YWO A;  4QVD A;  2COW A;  1ZUY A;  1NJI U;  4JJB A;  5I11 A;  3PIO A;  4JLI A;  2KYB A;  1O9S A;  4A63 B;  1TUG B;  2QI2 A;  3DKM A;  2QA4 T;  1C6V X;  3IQL A;  2LTO A;  2KR3 A;  2O4X B;  4PL6 A;  1Z9Z A;  4Z89 A;  2PZ1 A;  1EZZ B;  3QYG B;  4J8O A;  2WSF E;  3CXC S;  4PLI A;  3JRZ A;  3CD6 T;  1JRI A;  4AFS C;  3QDR B;  1NYG A;  3EG3 A;  3FJ5 A;  2LC4 A;  2IIM A;  2NYS A;  1M8M A;  2BIV A;  1X69 A;  2DBK A;  5C6S A;  4R55 A;  2L3P A;  3GPL A;  3VYG A;  4PJO E;  3OSS C;  3M57 A;  1RAC B;  2JS2 A;  2JJ9 A;  3RKX A;  2RA2 A;  1VQM A;  1XQH A;  4M75 A;  4WCI A;  5KYU A;  5FU7 C;  3URG A;  1YJ9 T;  1KQS P;  2PQW A;  5CR2 A;  4JJN K;  1Y57 A;  4KH1 B;  4RTY A;  4F16 A;  1BI2 A;  2MYS A;  2XG8 D;  4MDW A;  4FYV B;  2RO0 A;  1JJ2 A;  3I55 T;  3CCJ Q;  2W0Z A;  4NOY A;  4EIK A;  2CKK A;  5I22 A;  2ZGW A;  4KH0 B;  4FU6 A;  1BB9 A;  1SPK A;  2X4J A;  1CSK A;  3VV0 A;  1WLP B;  4C0Z A;  3A8H B;  1MMA A;  2EVR A;  3JB9 F;  2DMO A;  2EQI A;  3M0T A;  2CZ1 B;  3I35 A;  1AZE A;  1GCQ A;  1FXX A;  1BCM A;  4J9H A;  3KBG A;  2WAC A;  5IN1 A;  4PJO C;  2Y4Y A;  2CT3 A;  1X6G A;  3MET A;  3SDZ A;  3A5Z B;  4PJL A;  1VQN A;  1KC8 R;  4J6W A;  2E3I A;  2DM1 A;  1BYM A;  2QXF A;  3VS0 A;  1UEC A;  3ME9 A;  1NYF A;  3VS2 A;  2CZ7 B;  3V8L A;  4E7K A;  2DPP B;  3PE0 A;  3JCM b;  2FPE A;  4E7J A;  3VS4 A;  1ABQ A;  1JXM A;  1KD1 C;  1K9M C;  1NG2 A;  3CCQ A;  5CKD A;  3QPH A;  4FW2 A;  3JCM c;  5LJ3 d;  4QVC A;  1ZSZ C;  5KCO A;  3TSW A;  1PNJ A;  1TWB A;  3OS5 A;  1QW1 A;  3MJX A;  4BI8 B;  3I56 Q;  4QKU A;  4JZ3 A;  3TQ7 P;  4M7A G;  2LT1 A;  2YRC A;  3I55 Q;  3CCJ T;  3NGP A;  2DIG A;  5GAO q;  3PT9 A;  4C92 D;  4C92 B;  4FCY A;  3GOX A;  4YTL A;  3H6Z A;  1N6A A;  2D8H A;  5IHI A;  4IUV A;  2C06 A;  3CCR A;  1RAG B;  4E2F B;  3I5R A;  1BKB A;  2PTK A;  1OZ2 A;  4M78 E;  4CC2 A;  1G3T A;  1VA7 A;  1VQ6 A;  3EFO B;  1YCS B;  2DZC A;  1M1K C;  1W2B P;  1Q82 R;  3RKW A;  2RK1 A;  2K5L A;  1PKS A;  3JV3 A;  6AT1 B;  1Q86 U;  4Y92 A;  5HKC A;  1VQP T;  1N8R U;  4C5E A;  4MZM A;  4CC7 A;  4PFZ A;  1Q7Y U;  2DZ9 A;  2GFA A;  2ED0 A;  4GLM A;  3X20 B;  3G6E Q;  1TXQ A;  5GAO p;  4XTV A;  4QVZ A;  3CC4 Q;  5GAN 4;  2L3Q A;  3E1S A;  5GAN 6;  5CIU A;  3MHX A;  3NTK A;  4KUI A;  4II1 A;  2YUP A;  3RKY A;  1QQJ A;  3E2U A;  4BDZ A;  3FLG A;  2CSI A;  4FL6 A;  3CCV Q;  4GBQ A;  1TS9 A;  1K9A A;  1Q81 R;  3V7R A;  1T3L A;  2DXT A;  2MWP A;  4X34 A;  3CPW A;  1ABO A;  1QVF A;  2J7I A;  3EGD A;  2E5K A;  2EBP A;  1W6X A;  5GMK i;  1U1T A;  3LH0 A;  2DRK A;  3RIR A;  4RMO A;  5KYW A;  1BCO A;  4N4G A;  1X2Q A;  2XHC A;  2DL3 A;  1TUD A;  3SD4 A;  4M7D A;  1M27 C;  4XTU A;  3CXC A;  2HKN A;  2CRE A;  1AWJ A;  2E65 A;  4J7I A;  3TU4 K;  1KC8 U;  2EGC A;  2XI9 A;  4OB1 B;  3HSB A;  5LJ3 h;  1W1F A;  3HRU A;  4E47 A;  1K1Z A;  2KRM A;  5EG2 A;  2JMA A;  4LE9 A;  1WXT A;  2DL7 A;  1ARK A;  4M75 B;  4M75 F;  1K8A U;  3FC3 A;  2EW3 A;  2BTT A;  4L5G A;  4A4G A;  3CC7 A;  4ZTF A;  1NEB A;  1PD1 A;  4BD3 A;  4PJO G;  2RJD A;  2MOX A;  2GTJ A;  1OX9 A;  1VQ8 A;  3M55 A;  4HT9 A;  2JMC A;  2QQA A;  3M0P A;  1HYO A;  2RQR A;  3SB2 A;  1N8R R;  3GIB A;  1VQ8 T;  1JQQ A;  2KNB B;  2RNA A;  3L2Q A;  5GMK e;  3EAE A;  3I56 A;  4FSX A;  1YIJ A;  2LCS A;  1YI2 Q;  4N0A A;  1JBM A;  4ME7 A;  1IXD A;  4FSS A;  4FYW B;  3THK A;  3X28 B;  4C8Q A;  2RHU A;  2DXC A;  5M9O A;  2XKO C;  3L2V A;  2OI3 A;  3ULR B;  2YUN A;  4XAX B;  1PRL C;  2ZPB B;  3OBW A;  2M9U A;  2NWM A;  2JTF A;  2LX9 A;  1WI7 A;  4DOV A;  3PMT A;  5CKB A;  1QCF A;  2F1L A;  4FT4 A;  2O4X A;  1KC8 C;  1Q82 C;  2KSS A;  2F5K A;  2YXY A;  2V1Q A;  1FMV A;  2EQJ A;  3CCS T;  4RG8 A;  1YIJ Q;  1SSH A;  1D1A A;  1VQ5 A;  4XTX A;  3CCU A;  3L1A A;  2M51 A;  2NUZ A;  4HCB A;  1S72 T;  2EFI A;  2VV5 A;  1VQM T;  2O2O A;  3NMZ C;  2COY A;  3EHQ A;  4M75 E;  3CCE A;  1RI9 A;  5GAO m;  1SSF A;  1GCP A;  1GBQ A;  1ZSG A;  2A3L A;  1YP5 A;  5DLQ E;  3EFS A;  3J81 E;  3BFM A;  2AT1 B;  2KRN A;  1EX4 A;  4PLL A;  1WX6 A;  4EMK C;  4J7F A;  3CC2 Q;  2NUP A;  1X01 A;  3R6O A;  2BE9 B;  3OYY A;  4RTW A;  4QT7 A;  1WHJ A;  4M7D E;  4HKE A;  2LNV A;  2EQU A;  4EDU A;  5GAN 3;  1VQ7 T;  2K3X A;  1S72 Q;  1QVG A;  1M8V A;  1QVP A;  4M7A E;  3CPW S;  1X6O A;  1AWW A;  1P92 A;  1Q7Y R;  2PNI A;  3JCM h;  3VUZ A;  1QP2 A;  4PJO F;  4IIM A;  4IKF A;  2CYZ B;  2KDS A;  4J5Y A;  2HZY A;  3INZ A;  2LJ1 A;  1JEG A;  2GCX A;  1W2B S;  3H0F A;  1JB0 E;  2WSC E;  1K73 C;  4M77 A;  1OX8 A;  2QEX Q;  2GFU A;  2L8D A;  1A0N B;  5GAN j;  2YDL A;  4OGC A;  3CC4 T;  4HCZ A;  1QCO A;  1KQ2 A;  3PTA A;  2ZCF B;  3DLL A;  1K8A R;  5D6X A;  1EIF A;  4OB0 B;  2CP0 A;  2ZPI B;  3PMI A;  4O5V A;  2FB7 A;  2X9H A;  2F2X A;  1SRM A;  2PU9 B;  2RJE A;  2DVE A;  1M9S A;  1YI2 A;  1U06 A;  2ENM A;  4C92 G;  2V8I A;  4CI0 C;  2LT4 A;  2W10 A;  1VQL Q;  2DYI A;  3JCM d;  4IUQ A;  5GAN f;  4WF2 A;  2XU8 A;  2ZPE B;  1BI0 A;  2EGA A;  2E12 A;  2XDB A;  1M5Q 1;  4ZTJ A;  4D8K A;  1M2V B;  4M4Z A;  1F1B B;  3GP8 A;  4HVW A;  1ZA2 B;  4L59 A;  3BDL A;  4XTY A;  2IG0 A;  2JUF A;  4Y28 E;  5I21 A;  1UGP B;  4OMQ A;  4RCB A;  2NUP B;  2NUT A;  1RLP C;  3CC7 Q;  3EGX B;  1ZUK A;  2ZZD A;  5GAN 8;  1AT1 B;  2KI7 A;  1IGQ A;  3J80 E;  3NTI A;  1VQK Q;  1YIT Q;  4RTT A;  5FRN A;  2DLP A;  4M7D C;  2M16 A;  4F7U G;  2MWO A;  4J83 A;  2SEM A;  2MIO A;  2EGE A;  2P4R A;  3OMG A;  4JJD A;  4XU2 A;  1BI3 A;  1UFF A;  3QYH B;  1X75 C;  2JZ2 A;  4A4H A;  9ATC B;  5FLX E;  1G5V A;  4BI3 A;  3G1J A;  1KIK A;  1MND A;  1UHF A;  2D0N A;  4IUU A;  4F7U B;  3CXC P;  4RUG A;  2CGH A;  3FDR A;  3BY7 A;  1B3Q A;  2ROT A;  4XTZ A;  4TVR A;  4EMK B;  2SRC A;  5L8R E;  3VS5 A;  5D6W A;  2ZPG B;  1SHG A;  2YHT A;  2J6K A;  4JZ4 A;  2RHZ A;  3QJY A;  3JCM J;  1QCN A;  2VXF A;  1IHV A;  2V8K A;  3PVQ A;  1ZSZ B;  3ZBD A;  4LUD A;  4PJJ A;  4JUV A;  2FZK B;  5GAM g;  2L3R A;  2MCN A;  2CH4 W;  2YRD A;  2HEQ A;  1ACM B;  4FIB A;  7AT1 B;  1ZSZ A;  5FU7 B;  3OYB A;  2ABL A;  1V1C A;  2C0T A;  4P5N A;  4AG1 C;  3VKI A;  3CCQ T;  2PUO B;  5KYY A;  2AKK A;  1GXI E;  1UEB A;  3FRN A;  1BIB A;  2A28 A;  4JRK A;  3CC2 A;  4J9B A;  4OMN A;  4BY6 C;  3WVE B;  2QQ9 A;  5I2S A;  2VAS A;  2YWW A;  1H64 1;  2PUK B;  3PGG A;  2DFU A;  1OU9 A;  1RI0 A;  2F69 A;  1UGQ B;  2HL3 A;  3CBM A;  3OW2 S;  2YRV A;  2V8J A;  1N27 A;  3ZL7 C;  1KQS A;  4QQG A;  4M7A F;  3CCV T;  4FM4 B;  1E6G A;  3EGX A;  2EYY A;  2F2V A;  1WHL A;  1NJI R;  3M0R A;  1PG5 B;  1QVG P;  2JTE A;  4OMF B;  1GBR A;  3PFS A;  4MZP A;  1D0X A;  2JT4 A;  3H41 A;  3GNG A;  4V2S A;  1R0B G;  1J3T A;  4C5G A;  2P0Q A;  3OY9 A;  4HA8 A;  4RKU E;  4DBQ A;  1Q81 C;  2VVK A;  2CDT A;  2QQR A;  3CBP A;  2FEI A;  2KRS A;  3M0S A;  4KGZ B;  1D0Y A;  2DL8 A;  1MNE A;  2JM8 A;  3CCU Q;  3RNJ A;  4EPC A;  3CQT A;  5GAM d;  5GAO l;  2BZY A;  1LOJ A;  1VQL A;  3LGL A;  2K7A A;  3C95 A;  2QGG A;  1IRX A;  2O31 A;  2LCL A;  1HD3 A;  2F2W A;  2OTJ T;  1VIF A;  2YLB A;  1YJ9 A;  3MEA A;  5HCK A;  2J6F A;  2QA4 Q;  2DKG A;  1TH7 A;  4NL2 A;  2RQU A;  2HBP A;  4B9X A;  4JRP A;  3JB9 J;  5GMK h;  2HQX A;  2BZ8 A;  1VQK T;  2KXC A;  1NPP A;  5A0D A;  1U3O A;  4Z88 A;  1KJW A;  1YCY A;  4JPB W;  4E7Z A;  1JJ2 P;  2JOY A;  1AHJ B;  2RN8 A;  1I5O B;  3I56 T;  1VQO A;  5LJ3 f;  2EYX A;  1VQK A;  4XQ3 A;  1OUL A;  2K5I A;  4UC4 A;  4BUG A;  1Q82 U;  2D6F A;  4Y91 A;  5EC7 A;  2G6F X;  3GLX A;  4GLK A;  2RQV A;  4OMM A;  2A7Y A;  4C5I A;  2EKO A;  4PNO A;  1OPL A;  2R5M A;  2D9T A;  1RAA B;  2QTV A;  1UTI A;  2DET A;  2DBM A;  3KFV A;  1W70 A;  2DL4 A;  4AG2 C;  3HHT B;  2FRY A;  3SHW A;  1RUW A;  5IHN A;  5LJ3 j;  3UWN A;  4JDS A;  5GAN e;  3PVL A;  3OYI A;  3G4S T;  3EH1 A;  2CT4 A;  2P4T A;  4F17 A;  2X4X A;  2QAS A;  4C0G A;  1NLO C;  4RTZ A;  1U8R A;  4KBM B;  3PNW C;  2KT1 A;  2L89 A;  4ZGD B;  2CH4 A;  4IUP A;  3QO3 A;  4MML A;  1FX7 A;  1QLY A;  2K6D A;  3OBY A;  4ZGJ B;  3OYC A;  3D7S B;  4KRT A;  1KHC A;  1WHH A;  3KXT A;  1YIT T;  4ZGE B;  3R6N A;  2EIF A;  5GJW B;  1Q95 G;  3PIP A;  1YIT A;  3EHR A;  1KQ1 A;  2JN0 A;  1NJI C;  1R0C B;  2M0O A;  4LD6 A;  2M1H A;  1RAB B;  2FZG B;  5GAO n;  1CKB A;  1W2B A;  4RG2 A;  2K79 A;  4KGX B;  1WYX A;  1B34 B;  3HFO A;  4M75 G;  4RTV A;  3QUI A;  3RR6 A;  2RI3 A;  1JU5 C;  3QII A;  4J9G A;  2C0O A;  5KYN A;  2OTJ Q;  3KUF A;  1UE9 A;  4M75 D;  2AKL A;  3TVT A;  3WXM B;  1VQN Q;  4PFP A;  1YJW Q;  3RBB B;  1YIJ T;  4LD9 K;  3JCM f;  4E7S A;  4XU1 A;  1UJ0 A;  2DIQ A;  3A8O B;  2D8J A;  4PFO A;  4D6W A;  3UT1 A;  3C12 A;  5GMK m;  2C0I A;  2L5Q A;  3RER A;  2CP2 A;  2QQS A;  1N5Z A;  1K73 U;  4PJO B;  3CCM A;  3M58 A;  1LNX A;  3BE3 A;  5C0M A;  2DEQ A;  1IO6 A;  2Z0W A;  3MP6 A;  3CPW P;  3L42 A;  2K9G A;  4K11 A;  3UF4 A;  3FJP A;  2DXU A;  5CO7 A;  1OV3 A;  1M30 A;  1UGS B;  1RAI B;  2KYM A;  2O9S A;  4MMK A;  4PJO A;  2VB6 A;  1M1G A;  4LDX A;  3HL8 A;  3UPU A;  2QAZ A;  3JSC A;  2MK5 A;  1VQ5 T;  1LPL A;  1QWF A;  1FMW A;  3QG1 A;  2QK0 A;  1ZBX A;  3OS0 A;  2Y90 A;  5ECA A;  1UGV A;  3TEE A;  1VQ7 A;  4ORZ A;  1IRE B;  2KEA A;  3MKD A;  3RMS A;  2R57 A;  2CUB A;  1GL5 A;  3RMQ A;  3T9N A;  3CCE Q;  1NPR A;  2DO3 A;  3OA6 A;  1M90 R;  3OS2 A;  3CCL A;  1KD1 R;  1K9M R;  2E6Z A;  4M7A D;  2HBW A;  2A0F B;  3OYG A;  2HSP A;  1WA7 A;  3CCU T;  2QDY B;  3VRY A;  1T0J A;  3H0H A;  3M56 A;  4EMH A;  3JB9 I;  2FL7 A;  4F04 B;  2PVG B;  3M4G A;  3OS1 A;  3CCE T;  4B9W A;  3UDC A;  2MF2 A;  4BY6 B;  4XU3 A;  1IZ6 A;  1GFC A;  4C8Q C;  3BW1 A;  1UUE A;  2QTX A;  2ZPH B;  1M1K U;  3LYI A;  3G71 T;  3CCL Q;  4QQD A;  4C0F A;  2KE9 A;  1BIA A;  2X4W A;  5D6Y A;  3CCS Q;  2E4H A;  3UA6 A;  1MV0 B;  1NBE B;  5GAN h;  2HKQ B;  2M0Y A;  3QWX X;  1ZHI A;  5KE3 A;  2K2V A;  1BK2 A;  3CPF A;  4DOW A;  5AYF A;  1ZLM A;  2DTI A;  3EG1 A;  3OSV A;  3SFM A;  5KYX B;  1YJ9 Q;  4F7U E;  3E19 A;  1SKU B;  3L2U A;  3G6E T;  1Y0M A;  3GF5 A;  2ATC B;  3WVD B;  4KT0 E;  4BI4 A;  1KHI A;  1YJW A;  2IVW A;  4CC4 B;  1PCX A;  1YI2 T;  1I0C A;  1OZ3 A;  2FVU A;  1YBY A;  1E7O A;  3CEY A;  2CP5 A;  2DK3 A;  2RJC A;  4J9D A;  2HD0 A;  3VU3 C;  2LP5 A;  4DA4 A;  2XDD A;  2XIC A;  4ZN1 A;  5CQX A;  2G3R A;  1QVF P;  1Y71 A;  3SEM A;  3J7A F;  4M7D B;  5FU6 C;  1WFW A;  4CC3 A;  2BE7 D;  3JB9 D;  4BE0 A;  2CP3 A;  1TUC A;  3EGD B;  1Y96 A;  5AT1 B;  3QZ5 B;  4B6M A;  3N5B B;  2DE0 X;  2OAU A;  4C5H A;  3A8M B;  2FHD A;  5KH6 A;  1VYV A;  2ED1 A;  1PM3 A;  3AHU A;  3OYJ A;  1YNZ A;  2EJF A;  5KYY B;  5CAI A;  1AVZ C;  5FWB A;  2KK4 A;  2MPX C;  3JCM P;  4J6X A;  4DEY A;  4A54 A;  3C94 A;  5LJ5 e;  1S1N A;  3CCM Q;  1NLP C;  2GF7 A;  4J6Y A;  4AFZ C;  5CK9 A;  4FT2 A;  1N9S A;  1YJN Q;  2HAX A;  2GBQ A;  1VYT A;  2EJ9 A;  2HQE A;  3DLM A;  4Q5W A;  3ASK A;  3HRT A;  4MDX A;  4DBH A;  1UB4 A;  3E9F A;  3LGF A;  3MP1 A;  2VXE A;  2FZC B;  5GMK j;  2YUO A;  2D0Q B;  2DD5 A;  1M3C A;  1G83 A;  3VS1 A;  1UDL A;  3F70 A;  4X1V A;  5CVI A;  5LJ5 g;  4FYX B;  5LJ5 h;  3M0U A;  4M78 G;  4F7U A;  3G71 Q;  2DIL A;  4N0A C;  2L2P A;  2LVM A;  1IB8 A;  1PKT A;  2ZPF B;  4BDY A;  5IH2 A;  1RAE B;  1HJD A;  3EH2 A;  3LWH A;  1HK9 A;  5GAM h;  1B07 A;  1IHW A;  3JB9 H;  3G4S A;  1YFN A;  1WPY A;  1PSE A;  3G7Z A;  1XOV A;  4DBR A;  4HCC A;  2MAM A;  2DNU A;  2X4Y A;  1K8A C;  1YHQ A;  1NEG A;  2LX7 A;  1Y96 B;  2DXB A;  2LZ6 B;  1TOV A;  3TSZ A;  1WNL A;  3Q1J A;  4A53 A;  4N4H A;  1H3Z A;  5CKE A;  4A4E A;  4C8Q E;  1VQ9 A;  1SEM A;  2EQM A;  2JVV A;  2KBT A;  5L23 A;  1YWP A;  1H92 A;  3EG9 B;  1Q7Y C;  3I55 A;  4A4K A;  3X24 B;  1WIE A;  2KVQ G;  2ROL A;  1X6B A;  4JJC A;  4L6V 5;  3HKS A;  4QW2 A;  3L2W A;  2XMF A;  2CZ0 B;  3OYE A;  1M90 C;  1ZBJ A;  2RHX A;  1K73 R;  5CKF A;  1NZ9 A;  5LL6 S;  1Z9Q A;  1VQO Q;  2E3H A;  1G3Y A;  4E7L A;  1Y07 A;  1GFD A;  5CCA A;  1LCK A;  1WXU A;  3C4S A;  1AD5 A;  4F7U F;  2RJF A;  2LJ0 A;  1Y7X A;  3SWN B;  3OB9 A;  2EJG A;  1M1K R;  4RTU A;  2KGT A;  3QBY A;  2EYW A;  4J9C A;  3S3M A;  4OMO A;  1ZUU A;  1OI1 A;  2RQW A;  3SWN A;  1AOJ A;  2HMA A;  3L2R A;  1LVK A;  3OYN A;  2KRO A;  1G3W A;  1VQM Q;  1GRI A;  5CKH A;  4M77 C;  4C92 A;  2IPO B;  4C8Q F;  1VQ6 T;  4C8Q B;  4M77 B; 
#chains in the Genus database with same CATH homology
 3L2V A;  1U8R A;  3QSU A;  3H8Z A;  4KBM B;  3QXE B;  1VQ4 A;  3HP9 A;  4QQ6 A;  4XAX B;  3OYF A;  3PNW C;  2RK2 A;  2ZPB B;  3OBW A;  2L89 A;  2M9U A;  4ZGD B;  1KD1 U;  1K9M U;  2JTF A;  2LX9 A;  4DOV A;  3PMT A;  4IUP A;  3QO3 A;  5CKB A;  4MML A;  1FX7 A;  4FT4 A;  5FRM A;  2K4Y A;  4XK8 E;  4OB3 B;  2O4X A;  3JCM g;  1VQP A;  3X25 B;  1KC8 C;  3OBY A;  1Q82 C;  2QEX T;  4KUD K;  2KSS A;  4ZGJ B;  4KUL A;  4M78 A;  1I5L A;  2F5K A;  4M75 C;  3CCL T;  3OYC A;  3M4Y A;  5M9O A;  3LWI A;  2EQJ A;  1KHC A;  1JJ2 S;  3KXT A;  4RG8 A;  1PSF A;  5I2M A;  3CCS T;  1YIT T;  2QEX A;  3ER0 A;  4MZT A;  1I4K 1;  5DLO A;  4ZGE B;  1VQ5 A;  3CME A;  4XTX A;  3CCU A;  3L1A A;  2EIF A;  2XID A;  3CC4 A;  2X35 A;  3JCM X;  3PIP A;  3CCS A;  1YIT A;  4HCB A;  1KQ1 A;  1YJ9 A;  1S72 T;  2EFI A;  2JN0 A;  5DM7 R;  2GQV A;  2VV5 A;  3HFN A;  4BAC A;  3JB9 G;  1NJI C;  2M0O A;  1VQM T;  3JCM e;  1XTD A;  4LD6 A;  4M75 E;  2LQ8 A;  2K57 A;  3CCE A;  2M1H A;  5GAO m;  3CMA A;  2CZ6 B;  1I81 A;  2DTO A;  3ZEH A;  5GAO n;  3CME T;  5LJ5 f;  2RHI A;  1SSF A;  3VYH B;  5HK0 A;  5GAN 2;  4RG2 A;  5GMK l;  1W2B A;  1B34 B;  1WQ7 A;  1QP3 A;  2A3L A;  3HFO A;  4M75 G;  5HK3 A;  1LJO A;  3EFS A;  3QUI A;  5DLQ E;  3S6W A;  3BFM A;  1I8F A;  3J81 E;  2DJZ A;  1VQ4 T;  2OTL A;  2RI3 A;  1D3B A;  4PLL A;  3L2Z A;  3QII A;  3M5A A;  4EMK C;  2R58 A;  4J7F A;  2EAY A;  1O75 A;  3KUF A;  4LDU A;  3OYA A;  1BI1 A;  2O01 E;  4M75 D;  4OVA A;  1X01 A;  3R6O A;  3WXM B;  4PJO D;  3HRS A;  2R5A A;  3OYY A;  1WGS A;  5CQY A;  1OYX A;  4M78 F;  1VIE A;  4M7D E;  4M77 D;  1YIJ T;  4HKE A;  2LNV A;  4LD9 K;  2EQU A;  3JCM f;  4IUT A;  2K3Y A;  4XU1 A;  4C0D C;  4EDU A;  5GAN 3;  1N8R C;  1VQ7 T;  2LRQ A;  1MGQ A;  2E1H A;  1WJS A;  3LLR A;  2K3X A;  2DIQ A;  3A8O B;  3OMC A;  1QVG A;  3DB4 A;  1M8V A;  1QVP A;  4D6W A;  4M7A E;  2E5Q A;  5J3B A;  3CPW S;  4M7D G;  1X6O A;  3UT1 A;  3C12 A;  5GMK m;  2L5Q A;  1P92 A;  3RER A;  5FU6 B;  3CMA T;  2QQS A;  2E70 A;  5GAM e;  3JCM h;  5GAN 5;  1K73 U;  3VUZ A;  1QP2 A;  3JCM V;  3SWN C;  4PJO B;  3CCM A;  4PJO F;  3V8J A;  3M58 A;  1LNX A;  2CYZ B;  2KDS A;  2RB6 A;  3FEO A;  4J5Y A;  2DEQ A;  3INZ A;  5C0M A;  3M53 A;  5GAM f;  1YJN T;  3MP6 A;  4BE1 A;  2GCX A;  3L42 A;  1W2B S;  1JB0 E;  1Q86 C;  2WSC E;  3O8V A;  1K73 C;  4IKF A;  5FRO A;  5GAN d;  5HY6 A;  3FJP A;  4CRI A;  2DXU A;  2XD0 A;  3E9G A;  3MEU A;  4M77 A;  5CO7 A;  3NTH A;  2VGN A;  2GFU A;  2L8D A;  1UGS B;  4MMK A;  4PJO A;  4R56 A;  3MCA B;  5GAN j;  2PVO B;  1M1G A;  4LDX A;  3HL8 A;  4OGC A;  3UPU A;  1RL2 A;  3P8H A;  3M9Q A;  4LDV A;  4OB2 B;  3JSC A;  3CC4 T;  4JLG A;  1VQ5 T;  4HCZ A;  3P8D A;  2DTH A;  3OYD A;  3V7C A;  1KQ2 A;  3QG1 A;  3PTA A;  1U1S A;  2ZCF B;  1ZBX A;  4VUB A;  5J39 A;  3DLL A;  3S3O A;  1Q81 U;  3OS0 A;  5D6X A;  1EIF A;  2Y90 A;  4OB0 B;  5A0G A;  2ZPI B;  3TEE A;  3PMI A;  1IRE B;  4O5V A;  4C8Q D;  4C92 E;  1VQ7 A;  2FB7 A;  3RMS A;  3EFR A;  2R57 A;  5LJ5 d;  2PU9 B;  5GAM j;  2E64 A;  2RJE A;  2DVE A;  1M9S A;  1XNI A;  3DB3 A;  4BB7 A;  4C92 C;  2LCC A;  4N4I A;  3RMQ A;  5KE2 A;  1YI2 A;  1VQN T;  1V29 B;  3T9N A;  4C92 F;  1NPR A;  4C92 G;  4GY5 A;  2V8I A;  2DO3 A;  4CI0 C;  3OA6 A;  4RCC A;  4C8Q G;  4M77 F;  2LT4 A;  4OGE A;  3OS2 A;  5GAO r;  2NLU A;  3CCL A;  5A0L A;  4O6J A;  2E6Z A;  4M7A D;  3HPW A;  3JCM d;  4IUQ A;  5GAN f;  4WF2 A;  3OYG A;  2XU8 A;  3BDU A;  2ZPE B;  1BI0 A;  4OP0 A;  3CCU T;  2QDY B;  2KQW A;  4QVD A;  3LW5 E;  1NJI U;  2E12 A;  2XDB A;  3PIO A;  1M5Q 1;  4JLI A;  3M56 A;  4EMH A;  3JB9 I;  4ZTJ A;  4M7A A;  1O9S A;  2FL7 A;  2QA4 T;  2QI2 A;  2RI5 A;  3DKM A;  3GP8 A;  3OS1 A;  2PVG B;  1R8O B;  3M4G A;  2LTO A;  2O4X B;  4PL6 A;  4L59 A;  1VQO T;  3CCE T;  3BDL A;  1YJW T;  1JJ2 A;  4B9W A;  3OYK A;  4XTY A;  3UDC A;  2IG0 A;  2JUF A;  4Y28 E;  3VUB A;  5I21 A;  2XDP A;  3QYG B;  1UGP B;  4RCB A;  4J8O A;  2MF2 A;  2WSF E;  2MMP A;  3CCV A;  4JS5 A;  3CXC S;  4PLI A;  3JRZ A;  4BY6 B;  2YLC A;  3CD6 T;  1JRI A;  2E6N A;  4XU3 A;  1M1F A;  1IZ6 A;  3QDR B;  4E7H A;  4C8Q C;  2E10 A;  3BW1 A;  1QVG S;  4PKC C;  2QTX A;  2ZPH B;  4ELY C;  2LC4 A;  2I2L A;  2ZZD A;  5GAN 8;  1M1K U;  2BIV A;  2KY9 A;  3LYI A;  3G71 T;  4M77 E;  3CCJ A;  2OTL T;  4QQD A;  4C0F A;  3NTI A;  5C6S A;  3J80 E;  4R55 A;  3GPL A;  1BIA A;  2X4W A;  5D6Y A;  3OSS C;  3VYG A;  4PJO E;  3M57 A;  5GAN h;  5FRN A;  4M7D C;  2M16 A;  3RKX A;  2RA2 A;  4F7U G;  3OW2 A;  3OYL A;  2MWO A;  2HNI A;  1VQM A;  1ZHI A;  1XQH A;  4M75 A;  5KE3 A;  5A2Q E;  2K2V A;  4J83 A;  4LDW A;  3CPF A;  4DOW A;  3RUX A;  5AYF A;  4EMK A;  3G71 A;  5FU7 C;  3URG A;  2DTI A;  3CCR T;  1YJ9 T;  3OSV A;  3SFM A;  4C0D B;  2PQW A;  5CR2 A;  4JJN K;  2LDM A;  3OMG A;  4XU2 A;  4F7U E;  3E19 A;  1BI3 A;  3QYH B;  1MHN A;  1X75 C;  2JZ2 A;  4A4H A;  3L2U A;  5FLX E;  3G6E T;  1G5V A;  1BI2 A;  4BI3 A;  3GF5 A;  2XG8 D;  4MDW A;  2BKD N;  3WVD B;  4IUU A;  5GAN 7;  3MO8 A;  2RO0 A;  3P8B B;  4KT0 E;  2KAF A;  4F7U B;  2CGH A;  3FDR A;  3BY7 A;  4BI4 A;  3I55 T;  4NOY A;  1KHI A;  4XTZ A;  2CKK A;  1YJW A;  4TVR A;  3CCM T;  2ZGW A;  4EMK B;  2IVW A;  4FU6 A;  5L8R E;  4M7D F;  2X4J A;  5D6W A;  5J26 A;  2ZPG B;  3VV0 A;  5LJ3 g;  1YI2 T;  2YHT A;  2AHJ B;  2P0P A;  2RHZ A;  3QJY A;  3JCM J;  4C0Z A;  1OZ3 A;  2VXF A;  2V8K A;  1YJN A;  3A8H B;  2FVU A;  4X9D A;  1YBY A;  3JB9 F;  3X26 B;  2FYK A;  3ZBD A;  2LQK A;  3CEY A;  2DK3 A;  2RJC A;  2VC8 A;  3MEW A;  2CZ1 B;  3TRE A;  4JUV A;  2HD0 A;  3QJ6 A;  4LDY A;  3VU3 C;  1FXX A;  3CC2 T;  5GAM g;  2L3R A;  3FIF A;  4DA4 A;  2XDD A;  2XIC A;  2RH2 A;  4ZN1 A;  3KBG A;  3MP8 A;  1ZQ1 A;  2WAC A;  5CQX A;  4FIB A;  4M78 B;  5IN1 A;  5LJ3 e;  4PJO C;  2G3R A;  2Y4Y A;  1Y71 A;  1VUB A;  3J7A F;  2E41 A;  4DQ2 A;  4M7D B;  2EQK A;  3MET A;  5FU6 C;  3SDZ A;  5FU7 B;  3A5Z B;  3OYB A;  3JB9 D;  4P5N A;  1VQN A;  3VKI A;  4BE0 A;  3CCQ T;  2PUO B;  4J6W A;  3FB9 A;  4M7A B;  3QHS A;  1BYM A;  2QXF A;  1Y96 A;  1GXI E;  3QZ5 B;  1UEB A;  3NFC A;  3ME9 A;  3FRN A;  3N5B B;  2CZ7 B;  4ATO A;  3V8L A;  1BIB A;  2OAU A;  2DPP B;  4C5H A;  3JCM b;  4E7J A;  4JRK A;  4OF1 A;  4E7K A;  1S72 A;  3CC2 A;  3A8M B;  2FHD A;  2EYQ A;  1N9R A;  3GNF B;  4BY6 C;  3WVE B;  4NL3 A;  2QQ9 A;  5I2S A;  1KD1 C;  1K9M C;  5KH6 A;  3CCQ A;  3AHU A;  1H64 1;  2PUK B;  5CKD A;  3VJP A;  3PGG A;  3OYJ A;  2K5F A;  3QPH A;  1B34 A;  2EJF A;  3JCM c;  1RI0 A;  2F69 A;  3JCM Q;  1UGQ B;  5LJ3 d;  4QVC A;  5CAI A;  2CS7 A;  3CBM A;  3OW2 S;  5KCO A;  2KK4 A;  3JCM P;  4J6X A;  2YRV A;  1NE8 A;  1QVF S;  3OS5 A;  2H3J A;  2V8J A;  1QW1 A;  4A54 A;  1N27 A;  3CD6 A;  3C94 A;  4M7A C;  4BI8 B;  1KQS A;  5LJ5 e;  4QQG A;  4XU0 A;  4M7A F;  3CCV T;  4FM4 B;  4M7A G;  2DAQ A;  2LT1 A;  2GF7 A;  4J6Y A;  5CK9 A;  4OMF B;  4IUR A;  4FT2 A;  1N9S A;  3CCJ T;  3PFS A;  2DIG A;  4MZP A;  5GAO q;  3PT9 A;  2HAX A;  4C92 D;  3LX7 A;  4C92 B;  3GOX A;  2EJ9 A;  2HQE A;  3DLM A;  3GNG A;  4V2S A;  2RHY A;  4Q5W A;  3H6Z A;  1N6A A;  4YTL A;  3A8L B;  3ASK A;  3V8K A;  3HRT A;  4C5G A;  2P0Q A;  4MDX A;  1UB4 A;  3OY9 A;  4IUV A;  3CBO A;  3E9F A;  4HA8 A;  4RKU E;  3LGF A;  2C06 A;  3CCR A;  1Q81 C;  3MP1 A;  1BKB A;  2EWN A;  4M7D D;  2VXE A;  2QQR A;  3CBP A;  1OZ2 A;  5KCH A;  4M78 E;  5GMK j;  1G3T A;  1G3S A;  2D0Q B;  1VQ6 A;  2OTJ A;  2DD5 A;  4NS5 A;  4XTW A;  3G6E A;  3F70 A;  2DZC A;  5CVI A;  5LJ5 g;  1M1K C;  5LJ5 h;  3A8G B;  2RK1 A;  4M78 G;  3RKW A;  2K5L A;  4F7U A;  4BE2 A;  5GAM h;  4N0A C;  2LVM A;  4EPC A;  5GAM d;  5GAO l;  1Q86 U;  5HKC A;  5IT9 E;  3CC7 T;  1LOJ A;  3S3N A;  1VQP T;  1VQL A;  1N8R U;  2B8A A;  4C5E A;  4MZM A;  3LGL A;  3C95 A;  2ZPF B;  1Q7Y U;  2DZ9 A;  2GFA A;  3X20 B;  4BDY A;  5GAO p;  2LCL A;  4XTV A;  4QVZ A;  4EMG A;  2OTJ T;  5GAN 4;  3LWH A;  2P0K A;  1VIF A;  1HK9 A;  2YLB A;  3M54 A;  3MEA A;  2BUD A;  3E1S A;  3TCJ A;  5LJ5 j;  2MI6 A;  5GAN 6;  5CIU A;  3JB9 H;  2PVD B;  3G4S A;  2RI2 A;  3MHX A;  3NTK A;  1WPY A;  4KUI A;  3OYM A;  1PSE A;  2QQB A;  1HXD A;  1TH7 A;  2DKG A;  3G7Z A;  1XOV A;  4II1 A;  4NL2 A;  3RKY A;  2HBP A;  3MEV A;  5DY9 A;  4B9X A;  4JRP A;  3JB9 J;  4HCC A;  5GMK h;  1VQ9 T;  2MAM A;  2X4Y A;  2HQX A;  1YHQ A;  4ELZ C;  4JS4 A;  4BDZ A;  3FLG A;  1K8A C;  4FL6 A;  1VQK T;  1VQL T;  1Y96 B;  2KMT A;  2DXB A;  4M78 C;  1FWZ A;  1WNL A;  3Q1J A;  4HT8 A;  5GAN g;  3V7R A;  4A53 A;  1NPP A;  4N4H A;  1WQW A;  2DD4 A;  2DXT A;  5A0D A;  1H3Z A;  5CKE A;  2MWP A;  2VGM A;  4A4E A;  4C8Q E;  4X34 A;  1VQ9 A;  1YCY A;  1DJ7 B;  3CPW A;  2EQM A;  2JVV A;  2XK0 A;  1M4Z A;  1QVF A;  2JOY A;  1AHJ B;  5GMK i;  1U1T A;  2RM4 A;  3LH0 A;  3OYH A;  1UGR B;  3RIR A;  4RMO A;  3I56 T;  5IAY A;  3M59 A;  1Q7Y C;  3QKJ A;  4N4G A;  4C8Q F;  3I55 A;  1VQO A;  4A4K A;  2XHC A;  3X24 B;  2KVQ G;  4C8Q B;  5LJ3 f;  1VQK A;  4XQ3 A;  3SD4 A;  4M7D A;  4XTU A;  4L6V 5;  3CXC A;  2K5I A;  3HKS A;  4UC4 A;  2RD1 A;  4QW2 A;  2E65 A;  4BUG A;  3L2W A;  1Q82 U;  2D6F A;  4J7I A;  1M90 U;  2CZ0 B;  3RES A;  4Y91 A;  3OYE A;  3TU4 K;  1M90 C;  4JRQ A;  1KC8 U;  2XI9 A;  4OB1 B;  2F5T X;  2RHX A;  3HSB A;  5LJ3 h;  3GLX A;  4GLK A;  5CKF A;  1NZ9 A;  4X9C A;  2A7Y A;  4C5I A;  5LL6 S;  2EKO A;  2JNG A;  3HRU A;  4PNO A;  2VYT A;  2R5M A;  4E47 A;  1KG1 A;  2D9T A;  1G3Y A;  1WJR A;  2Y4X A;  4E7L A;  1Y07 A;  4M78 D;  5EG2 A;  5CCA A;  3C4S A;  4F7U F;  2RJF A;  4M77 G;  4M75 B;  4M75 F;  1K8A U;  3FC3 A;  1Y7X A;  4L5G A;  4A4G A;  3SWN B;  3OB9 A;  3CC7 A;  4BD3 A;  3HHT B;  4ZN3 A;  4PJO G;  4ZTF A;  2RJD A;  4Z02 A;  3JAM E;  2EJG A;  1W4S A;  1VQ8 A;  3M55 A;  1D3B B;  4HT9 A;  5LJ3 j;  2QQA A;  3UWN A;  3SB2 A;  3GIB A;  4JDS A;  5GAN e;  3OYI A;  3QBY A;  3S3M A;  1VQ8 T;  3JCM W;  1OI1 A;  4JRI A;  3L2Q A;  5GMK e;  3G4S T;  4A4F A;  1WJQ A;  3EAE A;  3I56 A;  3SWN A;  4FSX A;  3OQ5 A;  3L2R A;  1YIJ A;  3ZFJ A;  3OYN A;  1G3W A;  2P4T A;  3V7S A;  2QA4 A;  4E7I A;  4N0A A;  1JBM A;  2WSE E;  1YHQ T;  4ME7 A;  5CKH A;  1KQS S;  2X4X A;  3QZ9 B;  4M77 C;  4C92 A;  2JTM A;  3X28 B;  2VUB A;  4C8Q A;  2RHU A;  4C0G A;  2DXC A;  1VQ6 T;  2XKO C;  4M77 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...