4C8QE

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
83
structure length
83
Chain Sequence
EILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 14
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qE00
3RERA 1BIBA 5GAOp 1LJOA 3JB9J 5GAOl 4RCBA 1I8FA 5GMKh 5CAIA 1N9SA 4M75B 1TH7A 4M7DD 3PGGA 1WPYA 2E1HA 3HFOA 4M75C 3VU3C 4C92A 4QVCA 3SWNA 2VXEA 4C8QE 5GAMe 3JCMg 1Y96A 4N0AA 4HA8A 5LJ3d 3HSBA 2E64A 4XTWA 4M7AB 3SB2A 2DXTA 3V8JA 4EMGA 4M7AC 5GANg 4M78E 1D3BA 4F7UE 5GAMh 4HT8A 4JUVA 4QVDA 2E10A 3RIRA 2HNIA 4NL2A 4XU0A 3JCMc 1WNLA 2E41A 4EMKC 2FYKA 4M77F 3RKWA 5LJ5j 4J6YA 4PJOG 5I21A 2DEQA 1HXDA 5GMKl 4J5YA 5GAN7 1LNXA 4WF2A 4PJOF 3JCMP 4XU3A 3JCMV 2DVEA 2DXUA 2FB7A 2DTHA 4X9DA 5GAMf 4M7DC 2E65A 5LJ5g 4DQ2A 1X01A 4XTYA 1WQWA 5DY9A 5GAN4 3BDUA 4XTVA 5GAOq 4M77G 4C92F 2EWNA 2YLBA 3V8LA 4C92E 3JB9H 4M7AG 5LJ3j 4C92C 4V2SA 4PJOD 1HK9A 3SWNC 5GMKm 3JB9D 2ZGWA 3V8KA 4M75A 4XTZA 1YCYA 4J6WA 2I2LA 5GAMd 2DKGA 3RKYA 3QSUA 3RKXA 4JRKA 1JBMA 1B34A 3INZA 4XTXA 4A54A 4M75E 5GAN8 4M77D 1I5LA 4M7DE 3JCMd 5LJ3h 4PJOC 4M7AA 5LJ3f 3AHUA 4M77A 4RCCA 5GANd 1D3BB 2RD1A 5GANe 4NL3A 4EMKA 4PJOA 3BFMA 1M8VA 2DTOA 4C8QF 4EMHA 4F7UB 4M75G 5GMKj 2EJGA 4M7DG 3JCMe 1WQ7A 4M78F 1N9RA 4OP0A 4PNOA 3JCMX 3QUIA 5GAOr 3FJPA 2DJZA 3HFNA 2VXFA 3BW1A 3V7RA 4M7AE 4C92G 5LJ5h 4XU1A 4M77C 3GIBA 5LJ3g 3EFRA 4M77E 5GAN6 5GAN3 5GAOn 1KQ2A 4XU2A 4M77B 4MMLA 3RUXA 2EJFA 5GMKe 1JRIA 5GAMj 4M75F 3BY7A 4M78B 3QHSA 4F7UA 3FB9A 3JCMb 4M7DF 4A53A 4J6XA 5GANj 4NOYA 1BIAA 3JCMJ 2K57A 5LJ5e 4C92B 4C92D 2RB6A 5GMKi 4M7AF 3SWNB 3JCMf 3V7CA 2RM4A 3QO3A 4PJOE 5GAN5 3L1AA 3JB9G 5LJ5d 4M78C 1B34B 4N0AC 4Y91A 5GAN2 5GAOm 3EFSA 4M78D 5GANf 3V7SA 4C8QA 4M7DB 3JB9I 1U1TA 4M75D 4XTUA 4F7UG 4M78G 5LJ5f 4XQ3A 1H641 1MGQA 4M78A 2YLCA 3FIFA 4EMKB 4PJOB 4JRIA 3RESA 1I81A 2EJ9A 2JN0A 4HT9A 4C8QG 5GANh 5LJ3e 1U1SA 4JLIA 2YHTA 2QTXA 3JB9F 4C8QD 2Y90A 1LOJA 2DZCA 5GAMg 1KQ1A 2DZ9A 4C8QC 4X9CA 2VC8A 3JCMh 2CGHA 1Y96B 1I4K1 2RA2A 1M5Q1 4C8QB 4F7UF 3JCMQ 4M7DA 4M7AD 3M4GA 3L2ZA 3JCMW 2DTIA 2EAYA 4MMKA
chains in the Genus database with same CATH superfamily
3OBWA 5FLXE 1M2VA 1VQ5Q 2YWWA 3CQTA 1M4ZA 5CAIA 4M75B 1ARKA 3PGGA 4QVCA 4OB3B 1M2OA 3C12A 3CCVT 4QQGA 5LJ3d 3PVLA 1IXDA 3CCJT 1S72T 1ZX6A 3I9QA 3CMAQ 2XDPA 4PK4A 3RKWA 2QYZA 2LNVA 3CCQT 4KGXB 5GJVB 5DY9A 1R77A 2ROTA 1JJ2P 1RUWA 2QEXT 2LT4A 1BI2A 4Z89A 5GMKm 1AHJB 4BACA 2RI2A 5I2MA 4M75E 1GCQC 1D0YA 4F04B 5IHIA 2ZPBB 1Y57A 3AHUA 3UT1A 2GQVA 4ORZA 1VQ9A 1N5ZA 2L3QA 2JT4A 3ZBDA 1YIJQ 2RH2A 5GAN3 2KE9A 5GMKe 3M58A 1K1ZA 3SFMA 5FRMA 2RO0A 2JS0A 2RB6A 1VUBA 4BE1A 4B9XA 2RMOA 4JJBA 4N0AC 2DYIA 1VQOT 2BIVA 4M78G 4R55A 3CBMA 1VQKT 1VQ8T 2O9VA 2YLCA 1Y07A 3EGXB 4BI4A 5CKHA 3JB9F 3G6EA 1SEMA 4C8QC 4FM4B 4C5EA 5CCAA 3FC3A 4JS5A 1PWTA 4RTUA 2LDMA 1M1KC 2O9SA 3LGFA 2KQWA 4BY6B 3P8HA 1NJIR 4IKFA 3M53A 1NJIC 1K76A 1YITA 3OYDA 3HFOA 4ANJA 2YUPA 4R56A 3CCSQ 3S3MA 4E7ZA 3JRZA 3OYHA 1E6GA 2RI5A 1NEBA 1VOMA 2M9UA 3UA6A 1S72Q 1W2BS 1WI7A 1BI1A 2DEQA 2MI6A 3CCUA 1UGSB 1D1BA 1NPRA 3QKJA 3BDUA 3VS4A 2QAZA 3I55A 4C0DB 2DBKA 2DF6A 1YJNT 1YWPA 2YDLA 3CC4T 2ZPEB 5EC7A 4J6WA 4A54A 1I0CA 1ABOA 4XAXB 4RTWA 3JCMd 2V8IA 1RI0A 2F5KA 4PLIA 2C0TA 4M77A 4RCCA 2RK1A 4NL3A 1QWEA 3JCMe 1F1BB 4KUDK 3DKMA 2W10A 3GIBA 3EFRA 2EYQA 5J3BA 3RUXA 2X4JA 1AD5A 3CC4A 3FB9A 3QDRB 1PRMC 3QYGB 3IQLA 1RAEB 1BI0A 2HSEB 4ZTJA 4RUGA 3SWNB 4LDXA 4JJNK 3CCUQ 3SDZA 2VWFA 2XIDA 3I56Q 1FYNA 2A37A 3C95A 4II1A 2ZAEA 3CCET 1UECA 1MGQA 2QQRA 4GLKA 3VS5A 3PNWC 2EPDA 5LJ3e 2CT4A 3OW2A 4HCCA 3EG3A 2DZ9A 1YJWA 3HPWA 2JM9A 2R5AA 1VYVA 4E7KA 5IH2A 2O01E 1UG1A 3EGXA 2DILA 4DBFA 1KHIA 1NEGA 2E1HA 3VU3C 1MMNA 1E6HA 2K3YA 2FVUA 3CPFA 1VQPQ 4MZPA 1E7OA 2FG0A 2FZGB 2E10A 2CP3A 3OYCA 1V1CA 3LW5E 1FX7A 5CVIA 2RN8A 2EVRA 2DK3A 1Q95G 4X9DA 2DO3A 1X01A 2EGEA 1ZBXA 3PT9A 1ZA1B 2CP6A 1SPKA 2JJ9A 4PLLA 2AKLA 4VUBA 1OOTA 4M77G 4Z8AA 5LJ3j 3JB9D 1YI2A 1Q81R 4JLGA 3RDVA 1KSWA 2BTTA 3CMAT 5LJ3h 3HL8A 1UHCA 2XI9A 4EMKA 1QVGS 3TVTA 3I35A 5GMKj 2E6ZA 4HCZA 3FLGA 3QUIA 1D0ZA 2L3RA 3VS7A 1VQ5T 5KYYB 4MZMA 4DOWA 4M77B 2FHDA 1VQKA 4ELYC 1YJ9T 3NTIA 2LJ0A 1KIKA 2IPOB 1K73U 1WX6A 2ZPFB 3UDCA 4M78C 3OMCA 5IAYA 4M7DB 3JB9I 4LDWA 2OX7A 1VYUA 1UGRB 1MMAA 2JTEA 1P92A 3GNFB 2JMCA 2GCXA 3KUFA 4C8QG 1BI3A 2OTJQ 1JEGA 3EH2A 1W6XA 1TTHB 4DEXA 2J6KA 2GNCA 2D8JA 4IIMA 1Z9ZA 2Y4YA 2MMPA 1W2BP 2CP7A 3UATA 3G7ZA 3GOXA 1GFDA 3JB9J 5LL6S 5GAOl 4QQDA 2KYMA 2PVGB 1Q86U 1N6AA 1XOVA 2VXEA 1OYXA 3KFVA 1YWOA 2MCNA 4FYVB 2H8HA 1NJIU 2KROA 2D0QB 2L2PA 3LH5A 1Q82U 1QKXA 1M1KU 1HXDA 2DVEA 3BE3A 1WZOA 4BE2A 4JDSA 5GAN4 2DA9A 3OYNA 3KBGA 4PL6A 1K4US 4DA4A 2DD4A 1VQNQ 4LUEA 5FU6B 2KVQG 4XTZA 3OYFA 3CCEA 4FW1A 5CQYA 1PSEA 5GAN5 3INZA 1W70A 3EG9A 5KYUB 2DPPB 2V8KA 3LX7A 3L42A 4AFSC 2XKOC 1U8RA 4OF1A 4C92G 3OA6A 1N8RU 4Y28E 1VQ8A 4J9EA 3WVDB 1TUGB 1NLPC 3JCMb 3UA7A 1ZUKA 1D0XA 3FDRA 5D6XA 4C92D 3CC2A 1MHNA 1OV3A 1FXXA 1B34B 3CCJQ 4RTVA 2RQWA 1FMKA 1RAFB 4ATOA 1OEBA 1AZEA 3DB3A 1RAIB 2COWA 3CBOA 3G71A 2DXCA 1UB4A 5CR2A 1KC8C 1U1SA 4JLIA 2K3XA 1M3AA 4FT4A 1KQSP 4M7DA 1OX9A 3CBPA 2KRNA 1G83A 5FROA 2X35A 4FL6A 1NPPA 1I8FA 1W4SA 2K5LA 1N9SA 2MF2A 3CPWA 4C92A 5KYWB 4HVUA 2DMOA 3L2RA 2RI3A 4E2FB 2JW4A 3NTKA 3FRNA 2KDSA 4HCKA 1WNLA 2F2XA 2HAXA 4DBRA 3J7AF 1T3SA 2NUZA 3A8OB 1ZA2B 2FL7A 3OYEA 2KI7A 1RLQC 2ZCFB 5FW9A 1N8RR 2GBQA 1TWBA 3MP1A 1Y71A 3JB9H 3THKA 1LVKA 4FYXB 3RKYA 4XTXA 4BI3A 3HRTA 1QVFP 3TSZA 2RQVA 1SHFA 5A0GA 1Z9QA 2DL5A 4NS5A 3RR6A 1WJSA 3AT1B 1RL2A 2DTOA 3NFCA 4EMHA 4F7UB 3TREA 4Z88A 4OP0A 2L0AA 3ER0A 4CRIA 2KR3A 4OGCA 4CC7A 2NLUA 5KCOA 1B07A 1UEBA 1FMVA 2NYSA 2PNIA 2K4YA 1YJNA 3JCMJ 2RJFA 4BUGA 3GP8A 3EG2A 2JXBA 2OTJA 2QDLA 1KD1R 3S3NA 4M78D 4C8QA 1IZ6A 2K7AA 5IXBA 2CDTA 1EX4A 1OPLA 2A08A 3EHQA 3F70A 4PJOB 4JRIA 2XG8D 1GCPA 4IUUA 4J9FA 2P84A 4J83A 2E3IA 4K11A 3JCMh 1Q7YU 2FRWA 4M7AD 2VVKA 3M4GA 1MMDA 1Q82R 3EH1A 1VQMA 1SSFA 4Z02A 3UPUA 3VS2A 1R8OB 1WPYA 2DRMA 3VJPA 1N27A 2QA4Q 2CZ6B 3TQ7P 4D8DA 2E3HA 2ZZDA 1ZSZA 3PMIA 3OYIA 4EMGA 4ELZC 5HK3A 2Y4XA 1MNDA 1GXIE 2RHIA 1HSQA 2MWOA 3QYHB 5GAMh 2KGTA 2HZYA 2COZA 1QLYA 1MUZA 1D09B 2YT6A 1KD1U 1V29B 2KBTA 5KYYA 4C0GA 3G71Q 2JNGA 1XJWB 2RHUA 3M0TA 2NUTA 3CMEQ 2BZ8A 5CKDA 4YTLA 2YSQA 5IHNA 1K9AA 2PVOB 2YLBA 2H3JA 1VQPT 4ZGDB 2K2VA 2LQ8A 1YCYA 2EIFA 3S3OA 2HCKA 2M02A 2OAUA 3CC2T 1IGUA 4AG1C 2EQMA 2P0PA 5IHKA 2LJ1A 4M77C 4IUTA 2PZ1A 2HEQA 3CXCP 1M90U 2KRMA 3CD6Q 5L8RE 3QHSA 1G8XA 2KXDA 1SF9A 2E6NA 4OMNA 2P0KA 4CC2A 5LJ5e 4ZN1A 3QO3A 1FMWA 4FIBA 2ZPIB 5HY6A 4FYYB 4C0ZA 4FSXA 3ASKA 4F7UG 1B7TA 1M8MA 4DOVA 1ZHIA 4X1VA 3NGPA 3RNJA 1VQ7T 2DLPA 2F2VA 1D1AA 1Q86R 2D6FA 2LMJA 4C8QB 5ECAA 1T3LA 5AT1B 2QI2A 2EYYA 1YHQA 3A8MB 2EQKA 3VUBA 1BCOA 1CKBA 2KSSA 2QK0A 4LDVA 2LCLA 3HSBA 2HKQB 2WSCE 3V8JA 3PIPA 1WGSA 2RHYA 3OQ5A 1G3TA 1D3BA 4HT8A 4QVDA 4C5IA 3JSCA 1YHQQ 3VKIA 2HBPA 5LJ5j 1ACMB 2CH4W 1VQLT 5GMKl 2JMAA 2DAQA 2FO0A 4AFUC 2DXUA 4M7DC 1X2KA 3I55Q 2ZPGB 2HMAA 2A7YA 4XTYA 2CZ1B 1TXQA 5GAOq 3MPUB 2LVMA 2KY9A 1T0JA 3OB9A 2RNAA 2J6OA 1IREB 2C06A 1JBMA 2LQWA 4M7AA 3A8LB 1J3TA 2JOYA 3L2QA 4F16A 2BZXA 4JS4A 3E9FA 1WXBA 3PIOA 2OTJT 1M30A 2BE9B 4M78F 1RAGB 2NUPB 5I11A 1GL5A 3BW1A 2PU9B 1YJWT 4QT7A 5GAN6 1H92A 4RG8A 1K73R 4MMLA 2QGGA 1W2BA 2EYXA 2DERA 4A53A 3I5RA 4KULA 4NOYA 5GANj 1K9MC 1BBZA 5CKBA 2PVDB 3QBYA 5CK9A 4Q5WA 4C92B 2AT1B 4PJOE 2RM4A 1I1JA 3OYYA 5KYXB 2EW3A 4BDYA 2F5TX 1ABQA 2QG9B 1CKAA 3MCAB 1NG2A 3CD6T 4PFZA 2EJ9A 3WVEB 1AWXA 5GANh 2QTXA 4E47A 1LOJA 2RPNA 2QGFB 2KRSA 3L2ZA 1NZ9A 5KYNA 1LJOA 3I56T 3L2WA 4PJNA 1X6GA 5GMKh 4IUVA 2X4WA 1TH7A 2YUQA 2R58A 2G3RA 1GBRA 3M55A 1M27C 3Q1JA 4N0AA 3G6ET 4L59A 3HKSA 2DD5A 2CP0A 4M78E 1K8AU 4HCBA 1UTIA 1VQMQ 4XU0A 3JCMc 1YJWQ 5I21A 3M54A 4UC4A 1LNXA 4WF2A 1UFFA 2L89A 3WXMB 1RACB 2O4XB 5C0MA 1WJQA 1U06A 1KC8U 2WSFE 1QVGA 4CI0C 2C0OA 2EWNA 1M2VB 2XMFA 3EAEA 4M75A 1H3HA 1WYXA 1I5LA 5GAN8 5LJ3f 1RABB 1KD1C 1EFNA 1OULA 2K5FA 2EYWA 2K79A 4M75G 3CC4Q 2EJGA 1XNIA 1N9RA 5CIUA 5GAOr 1OQKA 3G1JA 3X25B 4OMPA 1YN8A 2CZ0B 2EJFA 8AT1B 2XU8A 2GFAA 4IIOA 3L2VA 1T0HA 1LCKA 2NUPA 2CYZB 4PFPA 1YITT 1ZSZB 1UDLA 2RHXA 2R5MA 3SEMA 2A3LA 3CCLA 2HQEA 4XQ3A 1H641 1OX8A 4BE0A 2DRKA 3RESA 2JN0A 3LLRA 5IT9E 3QDFA 4GY5A 1KQ1A 4X9CA 3RMQA 1VQ4A 1Y96B 1I4K1 4KRTA 2H3EB 5KYXA 2DFUA 4QVZA 3M0QA 2VGNA 2D9TA 2QQBA 1U5SA 2MAMA 4LDUA 3EG1A 4M7DD 1AEYA 3N5BB 2LP5A 2LT1A 4ME7A 3CCSA 2FPFA 2HL3A 2KMTA 3CD6A 1TG0A 3BDLA 2GQIA 1PG5B 2KAFA 4JUVA 3D7SB 4E7SA 5L23A 2DEUA 1SG5A 3EHRA 4C0DC 3PE0A 4PJJA 4D6WA 5GAN7 2LCSA 3JV3A 4LUDA 1OU9A 4DQ2A 3QXEB 1YIJT 1DJ7B 3REAB 4LD9K 2GTJA 2JTMA 3LWHA 4WTOB 4A4KA 2ESWA 1D1CA 1HK9A 2WSEE 2EGCA 3V8KA 3E9GA 2DKGA 2O4XA 5D7UA 3VS0A 3X26B 4E7JA 2L3PA 4LD6A 4KH0B 3UWNA 2ENMA 4C8QF 2M51A 1WFWA 4PNOA 2XDBA 2C0IA 4PJLA 5FWCA 2JM8A 2E70A 3MP6A 1BU1A 1WHHA 3FJ5A 5C6SA 2CUDA 1M9SA 4A4FA 2PTKA 3GPLA 3CC7T 4O5VA 2P4TA 1VQNA 2OTLQ 2F69A 5KCHA 4QW2A 1BKBA 2DNUA 3MO8A 1H3ZA 3CCEQ 2M1HA 1YHQT 3V7SA 4XTUA 1QP2A 1ZUYA 4E7LA 3I56A 5HK0A 2XD0A 4N4GA 5FU6C 4AT1B 1VIFA 2ATCB 1KQSS 4HT9A 2YHTA 1VIEA 2Y90A 4AG2C 4RTTA 4OMLA 3MKDA 4PKCC 2EKHA 1X27A 2MK5A 2J7IA 4LE9A 1IHWA 5GAOp 1VQLA 2DETA 2HBWA 2HSPA 3M9QA 4RTYA 4B6MA 3CCMA 1MNEA 1BCMA 3JCMg 2VV5A 4XTWA 1C1AA 4KT0E 3CCQQ 1PKSA 1GBQA 2E41A 4ZNXA 1QCFA 2V8JA 1ZSZC 1UUEA 4PJOF 4KGZB 1O75A 2QQ9A 2NWMA 4F17A 2DIQA 5LJ5g 3QWYA 3OYAA 2QTVA 1VQLQ 2CS7A 4RTXA 1HD3A 5IN1A 3CCVQ 3NMZC 1YFNA 3M4YA 4F14A 5HKCA 4C92C 3X24B 2XICA 4FSSA 2ZGWA 3PMTA 1S72A 3QSUA 1XTDA 2J6FA 1WLPB 3RKXA 2K2MA 2DBMA 1UE9A 2O31A 2QXFA 4KH1B 1SSHA 3A98A 1M8VA 1S1NA 2XDDA 3QG1A 2EQIA 3JCMX 4MZTA 1KQSA 2DXBA 4AMCA 1WJRA 1VQ6A 4J9IA 2CKKA 3M57A 3HRUA 1YNZA 1M1KR 2FZCB 4JJCA 1YI2Q 2X4YA 2RHZA 5FU7B 5GAOm 4BD3A 5CKFA 4J9HA 3A8GB 5LJ5f 1G5VA 3CCQA 1PHTA 3EGDB 1SHGA 1G3YA 2PUKB 1SRMA 5M9OA 3CCJA 5DM7R 4F7UF 2OTLT 1PKTA 3OYGA 2CP5A 1QWFA 4E7HA 2B86A 2LNHB 3GLXA 3RERA 2AZSA 3A5ZB 2OJ2A 3QJ6A 4XK8E 4E6RA 2RQRA 2EQUA 3ZEHA 1K8AC 1GFCA 2FRYA 5GAMe 1KJWA 5FWBA 2DL4A 2E64A 2EKOA 4O6JA 3MHXA 2X51A 4DBQA 4L5GA 4FCYA 1X2QA 3CMET 1X75C 4XU3A 3I5SA 2A28A 2VB6A 2QQSA 4N4IA 3O5ZA 2B8AA 3CC7A 1VQNT 2A36A 3VYHB 1M3CA 2LZ6B 1Q81C 1G3WA 2EQJA 2I2LA 4M7DE 2LX7A 3GBQA 4BB7A 2YRVA 1BK2A 1IHVA 3R6OA 1OI1A 2HD0A 3H0FA 1YP5A 3L2UA 3V7RA 2K5IA 4M7AE 4RTZA 5CO7A 2LX9A 2GFUA 3EG9B 3LWIA 4TVRA 4RMOA 4IURA 2ED1A 1YI2T 2FPDA 1BIAA 1PRLC 2PUOB 3VS3A 4M7AF 2BUDA 3QJYA 1IRXA 3OYBA 5AYFA 4M75D 3OYLA 3MP8A 2DVJA 3G4SA 1K8AR 3MJXA 2DL7A 3OYMA 2E5QA 3CCST 5GAMg 2AZVA 1QCOA 2L8DA 4HKEA 4WCIA 2AIRB 2BZYA 3ZL7C 1NYFA 2KXCA 3C0CA 4OB1B 1Q82C 4JRQA 2J05A 1BIBA 3EGDA 1YJ9Q 4RCBA 2SRCA 3TSWA 1QKWA 1OZ2A 4ZN3A 2BKDN 1K0SA 3OYJA 1C0MA 5GANg 2A0FB 3H0IA 1VQKQ 2P4RA 4LN2A 3CCVA 5I22A 3CCLQ 1AWOA 1RLPC 1VQOQ 4A4GA 4PJOG 5KYWA 1NBEB 2E65A 1K0XA 1WXUA 1AVZC 1G2BA 5J26A 4ZGJB 3OS5A 2RF0A 1BB9A 1Q81U 1WDXA 3V8LA 2AK5A 1WXTA 3CPWP 1M90C 1RADB 3H6ZA 1PC0A 3OMGA 4JRKA 4MDXA 1Q7YR 2WACA 3NTHA 4M77D 4A4HA 1WA7A 1Q7YC 4PJOC 1TU0B 5EG2A 1NE8A 5GANd 3H41A 5IXFA 3CMEA 3BFMA 1TUCA 2Z0WA 4OMFB 2L3SA 4RKUE 1AT1B 2YUNA 1SKUB 2GF7A 4X34A 1M1FA 1UJ0A 4KGVB 3RMSA 5LJ3g 2D0NA 1RAAB 4KBMB 5GAMj 4M75F 1I5OB 4M78B 4F7UA 1ZSGA 2QEXA 1PSFA 1QQJA 1UGPB 2QA4A 4B9WA 1QVFS 2O88A 5GANf 1U3OA 2VASA 4JRPA 1QCNA 3DLLA 2CREA 3S6WA 3M5AA 2VC8A 1GCQA 1WHGA 1M3BA 3RBBB 2VKNA 1M5Q1 2W0ZA 2E5KA 2KT8A 3MEVA 2IVWA 3E19A 1NLOC 1KFZA 3CMAA 1NYGA 3CCUT 2DM1A 3EGUA 3O8VA 1WHKA 4DEYA 3OS1A 2ED0A 1UGQB 2D8HA 3SB2A 1M90R 3LGLA 3MEUA 4F7UE 4NL2A 1VQ5A 2LTOA 3MEWA 4EIKA 2JVVA 1IO6A 5I2SA 3URGA 2DX1A 1MMGA 1HJDA 2DIGA 1VA7A 2M0OA 2BE7D 4XTVA 2RJDA 5KYUA 2SEMA 2KK4A 3JAME 4PJOD 3ULRB 2E12A 2VUBA 3SWNC 6AT1B 1AZGB 1WHLA 1B34A 1AOJA 2XK0A 2NUTB 1IB8A 1JJ2S 2X9HA 8ATCB 3OBYA 3TCJA 4BI8B 4E7IA 2ABLA 2VGMA 4OMOA 5GANe 2JUFA 2O2OA 4C5GA 1VQ4Q 3HFNA 2COYA 4FYWB 2LRQA 3ZFJA 1JXOA 5GAOn 3CCRA 2MWPA 1KC8R 2V26A 3G4ST 2RQUA 5HCKA 1JRIA 4DBHA 2EGAA 4PJMA 5D6WA 1R0CB 2KEAA 1VQMT 2K57A 3SD4A 2EFIA 5GMKi 2DYBA 3UF4A 3L1AA 3JB9G 4OMQA 2M0YA 3G6EQ 1XQHA 3NPFA 3P8BB 4C5HA 1TOVA 3CPWS 1O9SA 1WIEA 1VYTA 4M78A 5J39A 3FEOA 3FIFA 2K6DA 3QIIA 2FZKB 2MPXC 5FRNA 5KE3A 1W1FA 3CXCA 1UHFA 5CKEA 3OYKA 4J9CA 2XHCA 5GJWB 2CT3A 2DTIA 2ROLA 2RQTA 1WHJA 2IG0A 1TSFA 1V76A 4BDZA 1ZLMA 2EYZA 2HL5C 3M0PA 4OB0B 1MV3A 3CC2Q 1UJYA 3M59A 2HDAA 5FU7C 2DXTA 4M7AC 1VQ9Q 4FT2A 3NHNA 1YIJA 1M1GA 4EMKC 3H8ZA 4M77F 2RK2A 3JCMP 1SRLA 3JCMV 5KE2A 1KK7A 4JZ4A 2AKKA 2KNBB 4EDUA 1R0BG 2YUOA 1QMCA 5A0LA 2ECZA 1HYOA 3E1SA 4M4ZA 4C92F 4ZTFA 5DLOA 4M7AG 1H8KA 4CC3A 4BY6C 3G71T 2QEXQ 4LNPA 2AHJB 1K9MR 2JTFA 1JU5C 1QW1A 4C0FA 3TEEA 1D3BB 2RD1A 3R6NA 3VRYA 4MDWA 1NM7A 4PJOA 2QA4T 4M7DG 1WQ7A 3FJPA 2VXFA 4FU6A 3QWXX 4LXCA 2EBPA 1YJNQ 4FW2A 3DLMA 4J8OA 1PD1A 3M0SA 1WHMA 3BY7A 4M7DF 2V1QA 2JZ2A 1X6OA 2F2WA 2CH4A 1K9MU 3V7CA 5LJ5d 3EFSA 2MYSA 1U1TA 3T9NA 3HTRA 5A2QE 1JO8A 1EZZB 2LC4A 1I81A 2K3BA 4PFOA 3QPHA 2DZCA 2YRDA 2CGHA 2ZPHB 1PM3A 1Q86C 4QKUA 4EPCA 3VYGA 5DLQE 3VRZA 3VV0A 2IIMA 4MMKA 4ZGEB 4A63B 3CCMT 3CCRQ 1QVGP 3PVQA 1VQ7Q 4JJDA 3TU4K 4M75C 3OY9A 4HA8A 4IUQA 4N4HA 1VQ4T 1OU8A 2L5QA 1K73C 3EFOB 1VQ7A 2LCCA 2E4HA 3A1PA 3REBB 3OW2P 4HVVA 1AWWA 1MV0B 4J5YA 3H9NA 3CCLT 2M16A 1QP3A 3OS0A 4J7IA 2DTHA 2V1RA 3VUZA 1KHCA 1WQWA 3C4SA 1N8RC 2OAWA 4J9DA 4C92E 4V2SA 3ME9A 1OPKA 3M0UA 3CCMQ 3CCRT 4CC4B 2GTOA 3P8DA 3J81E 2HKNA 4OMMA 1PD0A 2DJQA 3C94A 1YBYA 2VYTA 2CUBA 3DB4A 3LYIA 4IUPA 3HP9A 3OSSC 3PTAA 5LJ5h 4XU1A 4AFZC 1FWZA 1PNJA 1IGQA 2P0QA 5A0DA 1VQPA 1RAHB 1VQ8Q 4GBQA 1ZBJA 5KH6A 3VS6A 1YCSB 1VQ9T 3JCMf 1QVFA 2YRCA 2K9GA 3J80E 2X4XA 3OSVA 2LQKA 2KT1A 1JXMA 1OZ3A 1RI9A 2D1XA 2CSIA 1UGVA 1VQ6T 2OTLA 3CC7Q 3M0RA 3X28B 4C8QD 3OW2S 3M56A 3GNGA 3OS2A 2QASA 2RA2A 4OVAA 3JCMW 9ATCB 2DE0X 2EAYA 4J9GA 3SHWA 3GF5A 1X43A 2X3XD 4KUIA 2HQXA 4HXJA 4R0KA 3META 3SWNA 4C8QE 2QDYB 2GGRA 1Y96A 1Y7XA 4L6V5 4M7AB 2LJ3A 2MIOA 1JQQA 3RIRA 2J06A 2HNIA 1CSKA 3HHTB 3CXCS 4HVWA 2FYKA 4J6YA 3MEAA 1GRIA 3H0HA 4QQ6A 2FB7A 1G3SA 5GAMf 1B3QA 2F1LA 2G6FX 3A8HB 3KXTA 4P5NA 2MOXA 3EFOA 4J9BA 4A4EA 1X69A 2YXYA 1QVPA 2LQNA 1EIFA 4OGEA 1KG1A 3EG0A 5GAMd 3HRSA 2I0NA 1I07A 4ESRA 2PQWA 2JS2A 2CP2A 3QZ9B 1VQ6Q 4RG2A 1LPLA 1VQOA 2FEIA 3LH0A 3I55T 1ZQ1A 2DL3A 2OI3A 1ZUUA 2RJCA 1TS9A 2DJZA 2X3WD 2QQAA 3E2UA 1YJ9A 1A0NB 4M77E 1KQ2A 1JB0E 4J7FA 4XU2A 1JJ2A 3U23A 4JPBW 4J6XA 2HQHA 3X20B 2DL8A 2CSQA 1BYMA 4AFQC 1YITQ 4Y91A 5GAN2 1C6VX 3PFSA 4JZ3A 2FPEA 1X6BA 1Y0MA 1AWJA 3CEYA 4Y92A 4D8KA 2RJEA 4EMKB 4LDYA 1TUDA 3G4SQ 5CQXA 3VS1A 4OB2B 4GLMA 7AT1B 5D6YA 3JCMQ 2CZ7B 2KYBA 1PCXA 3QZ5B 2R57A
chains in the Genus database with same CATH topology
3MEVA 2QQBA 3OBWA 5FLXE 2IVWA 3E19A 5FROA 2X35A 3CMAA 4FL6A 1M4ZA 2MAMA 1NPPA 1I8FA 1W4SA 2K5LA 3CCUT 5CAIA 1N9SA 2MF2A 4M75B 4LDUA 4M7DD 3PGGA 4QVCA 3CPWA 3N5BB 3O8VA 4OB3B 4C92A 3OS1A 3C12A 3CCVT 2LT1A 4ME7A 4QQGA 5LJ3d 1UGQB 3CCSA 3CCJT 3SB2A 1S72T 3LGLA 2KMTA 2RI3A 3L2RA 3MEUA 3CD6A 4F7UE 3BDLA 4JUVA 2KAFA 4NL2A 3NTKA 2XDPA 3FRNA 2KDSA 2LTOA 1VQ5A 1WNLA 4C0DC 3MEWA 2HAXA 3RKWA 4D6WA 3J7AF 2LNVA 5GAN7 2JVVA 3A8OB 3CCQT 5I2SA 2FL7A 3URGA 3OYEA 4DQ2A 3QXEB 2DIGA 1YIJT 1DJ7B 2M0OA 5DY9A 2ZCFB 4LD9K 2JTMA 4XTVA 2RJDA 3MP1A 3LWHA 1Y71A 2KK4A 4A4KA 2QEXT 3JB9H 3JAME 2LT4A 1BI2A 2E12A 1HK9A 2VUBA 2WSEE 3SWNC 5GMKm 4PJOD 3V8KA 1AHJB 4BACA 3E9GA 2DKGA 3RKYA 2RI2A 1B34A 4XTXA 2O4XA 3HRTA 5I2MA 4M75E 2XK0A 4BI3A 5A0GA 3X26B 1JJ2S 4NS5A 4E7JA 2ZPBB 3AHUA 3UT1A 3OBYA 3TCJA 4BI8B 4LD6A 1WJSA 4E7IA 2VGMA 5GANe 2GQVA 1RL2A 3UWNA 2JUFA 2DTOA 3NFCA 4C8QF 4EMHA 4F7UB 3TREA 1VQ9A 4C5GA 4PNOA 4OP0A 2XDBA 3ER0A 3HFNA 4CRIA 3ZBDA 2LRQA 4OGCA 3ZFJA 2NLUA 2RH2A 2E70A 5GAOn 3CCRA 5GAN3 2MWPA 1UEBA 5KCOA 3MP6A 3G4ST 5GMKe 1JRIA 3M58A 2K4YA 5D6WA 5C6SA 1YJNA 1M9SA 4A4FA 3JCMJ 3SFMA 1VQMT 2RJFA 4BUGA 2K57A 3GP8A 2RO0A 5FRMA 3SD4A 3GPLA 3CC7T 2RB6A 1VUBA 2EFIA 4O5VA 5GMKi 2P4TA 2OTJA 4BE1A 1VQNA 4B9XA 2F69A 3L1AA 3JB9G 5KCHA 4QW2A 1BKBA 4N0AC 1VQOT 3MO8A 3S3NA 1H3ZA 4M78D 2M1HA 1YHQT 1XQHA 3P8BB 3V7SA 4C5HA 4C8QA 2BIVA 1IZ6A 4XTUA 3CPWS 1QP2A 4M78G 1O9SA 4R55A 4E7LA 3CBMA 4M78A 1VQKT 3I56A 1VQ8T 5J39A 5HK0A 3FEOA 2YLCA 3FIFA 3QIIA 1Y07A 3F70A 2XD0A 4PJOB 4JRIA 4N4GA 5FU6C 1VIFA 1KQSS 4HT9A 2XG8D 5FRNA 4IUUA 4BI4A 2YHTA 5CKHA 3JB9F 1VIEA 2Y90A 3G6EA 4J83A 4C8QC 4FM4B 3JCMh 5KE3A 4C5EA 5CCAA 3FC3A 3CXCA 4JS5A 1Q7YU 5CKEA 3OYKA 2LDMA 4M7AD 3M4GA 4PKCC 2XHCA 1M1KC 2DTIA 2IG0A 3LGFA 1VQMA 5GAOp 1SSFA 2KQWA 4Z02A 3P8HA 4BY6B 4BDZA 3M53A 3UPUA 1NJIC 1VQLA 4IKFA 1YITA 3OYDA 1R8OB 1WPYA 3HFOA 4OB0B 3M9QA 1N27A 3VJPA 4R56A 3CCMA 2CZ6B 3JCMg 3S3MA 3JRZA 3M59A 2VV5A 3OYHA 2ZZDA 3PMIA 5FU7C 4XTWA 3OYIA 2DXTA 4EMGA 4ELZC 2RI5A 4M7AC 5HK3A 2Y4XA 1GXIE 2RHIA 5GAMh 2MWOA 3QYHB 4FT2A 4KT0E 2M9UA 2E41A 1YIJA 1M1GA 4EMKC 3H8ZA 4M77F 1W2BS 1BI1A 2DEQA 2V8JA 2RK2A 2MI6A 4PJOF 3JCMP 3JCMV 5KE2A 1V29B 1O75A 2QQ9A 3CCUA 1KD1U 1UGSB 2DIQA 1NPRA 4C0GA 5LJ5g 2JNGA 2RHUA 3OYAA 3QKJA 2CS7A 4EDUA 3BDUA 5CKDA 4YTLA 5IN1A 5A0LA 3I55A 4C0DB 3E1SA 4ZTFA 4C92F 2PVOB 2YLBA 5DLOA 1YJNT 3M4YA 5HKCA 3CC4T 4M7AG 4C92C 2H3JA 1VQPT 4ZGDB 2K2VA 3X24B 2XICA 2ZPEB 2ZGWA 2LQ8A 1YCYA 2EIFA 3PMTA 4J6WA 3S3OA 1S72A 1XTDA 3QSUA 3RKXA 4A54A 4BY6C 3G71T 4XAXB 2QXFA 1N8RC 2AHJB 3JCMd 2V8IA 2JTFA 1RI0A 2F5KA 4PLIA 1QW1A 4M77A 4RCCA 4C0FA 3TEEA 1D3BB 2RD1A 2RK1A 4NL3A 4MDWA 4PJOA 1M8VA 2XDDA 2OAUA 3QG1A 2QA4T 3CC2T 4M7DG 3JCMe 1WQ7A 3JCMX 4KUDK 3FJPA 4MZTA 3DKMA 2EQMA 2VXFA 2P0PA 4FU6A 4M77C 4IUTA 1KQSA 3GIBA 3EFRA 1M90U 2EYQA 3DLMA 4J8OA 2DXBA 5J3BA 3RUXA 1WJRA 2X4JA 1VQ6A 2CKKA 3CC4A 3BY7A 3M57A 3QHSA 5L8RE 3FB9A 4M7DF 2JZ2A 3QDRB 3QYGB 1X6OA 3HRUA 1BI0A 2E6NA 2P0KA 4ZTJA 5LJ5e 4ZN1A 1K9MU 2X4YA 3SWNB 3V7CA 4LDXA 3QO3A 4JJNK 2RHZA 5FU7B 4FIBA 5LJ5d 3SDZA 5GAOm 2XIDA 2ZPIB 5HY6A 3EFSA 4BD3A 5CKFA 4C0ZA 4FSXA 1U1TA 3ASKA 3A8GB 3C95A 4II1A 3T9NA 4F7UG 5LJ5f 1G5VA 5A2QE 4DOVA 1MGQA 1ZHIA 3CCQA 3CCET 2LC4A 2QQRA 4GLKA 1VQ7T 1I81A 3PNWC 1G3YA 5LJ3e 2PUKB 3OW2A 3QPHA 4HCCA 2DZCA 2DZ9A 5M9OA 3CCJA 1YJWA 2CGHA 2ZPHB 5DM7R 2D6FA 3HPWA 1Q86C 4EPCA 4C8QB 4F7UF 3VYGA 2OTLT 2R5AA 5DLQE 3OYGA 3VV0A 4E7HA 4MMKA 4ZGEB 2QI2A 3CCMT 4E7KA 1YHQA 2O01E 3GLXA 3RERA 3A8MB 3A5ZB 2EQKA 3QJ6A 4XK8E 3TU4K 2EQUA 3ZEHA 1KHIA 3VUBA 1K8AC 2E1HA 3VU3C 4M75C 2KSSA 3OY9A 2K3YA 5GAMe 2FVUA 3CPFA 4LDVA 2LCLA 4HA8A 4IUQA 4N4HA 3HSBA 2WSCE 2E64A 3V8JA 2EKOA 3PIPA 1WGSA 2RHYA 3OQ5A 1VQ4T 1G3TA 4MZPA 1D3BA 2L5QA 4O6JA 1K73C 3MHXA 4QVDA 2E10A 4HT8A 4C5IA 3JSCA 3OYCA 3LW5E 1VQ7A 4L5GA 2LCCA 1FX7A 5CVIA 3VKIA 2HBPA 5LJ5j 3CMET 1VQLT 5GMKl 2DK3A 4J5YA 3CCLT 2DAQA 1QP3A 1X75C 2M16A 4J7IA 2DXUA 4XU3A 2DTHA 4X9DA 3OS0A 4M7DC 2ZPGB 2DO3A 1X01A 1KHCA 1WQWA 2A7YA 2QQSA 3C4SA 1ZBXA 2CZ1B 4N4IA 2B8AA 4XTYA 3PT9A 3CC7A 5GAOq 4PLLA 1VQNT 3VYHB 2LVMA 4VUBA 4M77G 2KY9A 3OB9A 4C92E 5LJ3j 3ME9A 4V2SA 3JB9D 1YI2A 1Q81C 1G3WA 4JLGA 1IREB 2EQJA 2I2LA 2C06A 1JBMA 3CCRT 4M7DE 3CMAT 3VUZA 5LJ3h 3P8DA 4M7AA 3A8LB 4BB7A 3J81E 3HL8A 2YRVA 2XI9A 2JOYA 3L2QA 4EMKA 1QVGS 3C94A 1YBYA 2VYTA 5GMKj 3DB4A 3E9FA 2E6ZA 3LYIA 4IUPA 3PIOA 3R6OA 4JS4A 2OTJT 4M78F 4HCZA 1OI1A 2HD0A 3FLGA 3QUIA 3HP9A 3OSSC 3PTAA 2L3RA 3L2UA 3BW1A 3V7RA 2K5IA 2PU9B 1YJWT 1VQ5T 4M7AE 5LJ5h 4XU1A 2LX9A 4MZMA 2GFUA 1FWZA 5CO7A 5GAN6 4DOWA 2P0QA 4RG8A 3LWIA 4M77B 4MMLA 2FHDA 4IURA 4TVRA 5A0DA 4RMOA 1VQKA 1W2BA 1VQPA 4ELYC 1YJ9T 4A53A 3NTIA 5GANj 4KULA 4NOYA 1BIAA 1YI2T 1K9MC 5CKBA 2PUOB 2PVDB 3QBYA 5CK9A 5KH6A 4Q5WA 4C92B 1VQ9T 4M7AF 1K73U 2BUDA 3JCMf 2RM4A 1QVFA 3QJYA 4PJOE 2ZPFB 3J80E 3UDCA 4M78C 2X4XA 3OSVA 2LQKA 3OYBA 3OYYA 1OZ3A 5AYFA 3OMCA 5IAYA 4M7DB 4BDYA 2F5TX 4M75D 3JB9I 3OYLA 4LDWA 3MP8A 3G4SA 1UGRB 3MCAB 3OYMA 1P92A 2E5QA 3GNFB 3CD6T 2GCXA 3KUFA 1VQ6T 2EJ9A 3WVEB 2OTLA 4C8QG 5GANh 1BI3A 2QTXA 3CCST 3X28B 4C8QD 1LOJA 4E47A 5GAMg 3OW2S 3M56A 3GNGA 3OS2A 2RA2A 2L8DA 4HKEA 4OVAA 2Y4YA 3JCMW 3L2ZA 2MMPA 2EAYA 4OB1B 1Q82C 3GF5A 4JRQA 3G7ZA 1NZ9A 1BIBA 3I56T 1LJOA 3L2WA 3GOXA 4KUIA 5LL6S 5GAOl 4RCBA 3JB9J 4QQDA 2HQXA 5GMKh 4IUVA 2X4WA 2PVGB 1TH7A 1Q86U 1N6AA 1OZ2A 4ZN3A 2R58A 2G3RA 1XOVA 3META 3SWNA 2BKDN 2VXEA 4C8QE 2QDYB 1Y96A 3M55A 3Q1JA 4N0AA 1OYXA 3G6ET 1Y7XA 4L6V5 4M7AB 4L59A 3HKSA 5GANg 2DD5A 3OYJA 4M78E 1NJIU 3RIRA 2HNIA 1K8AU 4HCBA 3HHTB 2D0QB 3CXCS 3CCVA 4XU0A 3JCMc 1Q82U 2FYKA 4A4GA 1M1KU 4J6YA 4PJOG 3M54A 5I21A 3MEAA 1HXDA 4UC4A 1LNXA 4WF2A 4QQ6A 2DVEA 2FB7A 2L89A 3WXMB 1G3SA 5GAMf 2E65A 2O4XB 4JDSA 3A8HB 5C0MA 4BE2A 1WJQA 3KXTA 5GAN4 1KC8U 5J26A 2WSFE 4P5NA 4ZGJB 1QVGA 3OS5A 4CI0C 3OYNA 3KBGA 1Q81U 2EWNA 4PL6A 4A4EA 3V8LA 1QVPA 4DA4A 1EIFA 2DD4A 4OGEA 1M90C 3EAEA 2KVQG 5FU6B 3H6ZA 4M75A 4XTZA 3OYFA 1KG1A 5GAMd 3CCEA 3OMGA 5CQYA 3HRSA 1PSEA 4JRKA 3INZA 5GAN5 4MDXA 1I5LA 5GAN8 2WACA 2PQWA 3NTHA 4M77D 4A4HA 1Q7YC 4PJOC 3QZ9B 5LJ3f 5EG2A 4RG2A 1VQOA 1KD1C 1NE8A 5GANd 2DPPB 3CMEA 2K5FA 3LH0A 3I55T 3BFMA 1ZQ1A 2V8KA 4M75G 3LX7A 2EJGA 3L42A 4OMFB 4RKUE 1XNIA 1N9RA 5CIUA 2XKOC 5GAOr 2RJCA 1U8RA 2DJZA 4OF1A 3X25B 2QQAA 2GF7A 4X34A 1YJ9A 4C92G 1M1FA 3OA6A 3RMSA 5LJ3g 4M77E 2CZ0B 1N8RU 4Y28E 1VQ8A 1JB0E 4J7FA 1KQ2A 4XU2A 2EJFA 3WVDB 2XU8A 1JJ2A 4KBMB 5GAMj 4M75F 2GFAA 4M78B 4F7UA 3JCMb 3L2VA 2QEXA 1PSFA 4J6XA 1UGPB 3X20B 3FDRA 5D6XA 4C92D 2QA4A 3CC2A 1BYMA 1MHNA 2CYZB 1YITT 4B9WA 1QVFS 1FXXA 1B34B 4Y91A 5GAN2 3PFSA 2RHXA 5GANf 2R5MA 3CEYA 2A3LA 3CCLA 2HQEA 4XQ3A 1H641 4ATOA 2RJEA 3DB3A 4EMKB 3CBOA 4LDYA 3G71A 4BE0A 4JRPA 2DXCA 1UB4A 3RESA 2JN0A 3LLRA 3DLLA 5IT9E 4GY5A 5CR2A 1KC8C 1U1SA 4JLIA 5CQXA 3S6WA 2K3XA 1KQ1A 4OB2B 3M5AA 4X9CA 2VC8A 3RMQA 4FT4A 1VQ4A 1Y96B 5D6YA 1I4K1 1M5Q1 4M7DA 3JCMQ 2CZ7B 4QVZA 3QZ5B 3CBPA 2R57A 2VGNA 2D9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RER A;  1BIB A;  5GAO p;  1LJO A;  3JB9 J;  5GAO l;  4RCB A;  1I8F A;  5GMK h;  5CAI A;  1N9S A;  4M75 B;  1TH7 A;  4M7D D;  3PGG A;  1WPY A;  2E1H A;  3HFO A;  4M75 C;  3VU3 C;  4C92 A;  4QVC A;  3SWN A;  2VXE A;  4C8Q E;  5GAM e;  3JCM g;  1Y96 A;  4N0A A;  4HA8 A;  5LJ3 d;  3HSB A;  2E64 A;  4XTW A;  4M7A B;  3SB2 A;  2DXT A;  3V8J A;  4EMG A;  4M7A C;  5GAN g;  4M78 E;  1D3B A;  4F7U E;  5GAM h;  4HT8 A;  4JUV A;  4QVD A;  2E10 A;  3RIR A;  2HNI A;  4NL2 A;  4XU0 A;  3JCM c;  1WNL A;  2E41 A;  4EMK C;  2FYK A;  4M77 F;  3RKW A;  5LJ5 j;  4J6Y A;  4PJO G;  5I21 A;  2DEQ A;  1HXD A;  5GMK l;  4J5Y A;  5GAN 7;  1LNX A;  4WF2 A;  4PJO F;  3JCM P;  4XU3 A;  3JCM V;  2DVE A;  2DXU A;  2FB7 A;  2DTH A;  4X9D A;  5GAM f;  4M7D C;  2E65 A;  5LJ5 g;  4DQ2 A;  1X01 A;  4XTY A;  1WQW A;  5DY9 A;  5GAN 4;  3BDU A;  4XTV A;  5GAO q;  4M77 G;  4C92 F;  2EWN A;  2YLB A;  3V8L A;  4C92 E;  3JB9 H;  4M7A G;  5LJ3 j;  4C92 C;  4V2S A;  4PJO D;  1HK9 A;  3SWN C;  5GMK m;  3JB9 D;  2ZGW A;  3V8K A;  4M75 A;  4XTZ A;  1YCY A;  4J6W A;  2I2L A;  5GAM d;  2DKG A;  3RKY A;  3QSU A;  3RKX A;  4JRK A;  1JBM A;  1B34 A;  3INZ A;  4XTX A;  4A54 A;  4M75 E;  5GAN 8;  4M77 D;  1I5L A;  4M7D E;  3JCM d;  5LJ3 h;  4PJO C;  4M7A A;  5LJ3 f;  3AHU A;  4M77 A;  4RCC A;  5GAN d;  1D3B B;  2RD1 A;  5GAN e;  4NL3 A;  4EMK A;  4PJO A;  3BFM A;  1M8V A;  2DTO A;  4C8Q F;  4EMH A;  4F7U B;  4M75 G;  5GMK j;  2EJG A;  4M7D G;  3JCM e;  1WQ7 A;  4M78 F;  1N9R A;  4OP0 A;  4PNO A;  3JCM X;  3QUI A;  5GAO r;  3FJP A;  2DJZ A;  3HFN A;  2VXF A;  3BW1 A;  3V7R A;  4M7A E;  4C92 G;  5LJ5 h;  4XU1 A;  4M77 C;  3GIB A;  5LJ3 g;  3EFR A;  4M77 E;  5GAN 6;  5GAN 3;  5GAO n;  1KQ2 A;  4XU2 A;  4M77 B;  4MML A;  3RUX A;  2EJF A;  5GMK e;  1JRI A;  5GAM j;  4M75 F;  3BY7 A;  4M78 B;  3QHS A;  4F7U A;  3FB9 A;  3JCM b;  4M7D F;  4A53 A;  4J6X A;  5GAN j;  4NOY A;  1BIA A;  3JCM J;  2K57 A;  5LJ5 e;  4C92 B;  4C92 D;  2RB6 A;  5GMK i;  4M7A F;  3SWN B;  3JCM f;  3V7C A;  2RM4 A;  3QO3 A;  4PJO E;  5GAN 5;  3L1A A;  3JB9 G;  5LJ5 d;  4M78 C;  1B34 B;  4N0A C;  4Y91 A;  5GAN 2;  5GAO m;  3EFS A;  4M78 D;  5GAN f;  3V7S A;  4C8Q A;  4M7D B;  3JB9 I;  1U1T A;  4M75 D;  4XTU A;  4F7U G;  4M78 G;  5LJ5 f;  4XQ3 A;  1H64 1;  1MGQ A;  4M78 A;  2YLC A;  3FIF A;  4EMK B;  4PJO B;  4JRI A;  3RES A;  1I81 A;  2EJ9 A;  2JN0 A;  4HT9 A;  4C8Q G;  5GAN h;  5LJ3 e;  1U1S A;  4JLI A;  2YHT A;  2QTX A;  3JB9 F;  4C8Q D;  2Y90 A;  1LOJ A;  2DZC A;  5GAM g;  1KQ1 A;  2DZ9 A;  4C8Q C;  4X9C A;  2VC8 A;  3JCM h;  2CGH A;  1Y96 B;  1I4K 1;  2RA2 A;  1M5Q 1;  4C8Q B;  4F7U F;  3JCM Q;  4M7D A;  4M7A D;  3M4G A;  3L2Z A;  3JCM W;  2DTI A;  2EAY A;  4MMK A; 
#chains in the Genus database with same CATH topology
 3OBW A;  5FLX E;  1M2V A;  1VQ5 Q;  2YWW A;  3CQT A;  1M4Z A;  5CAI A;  4M75 B;  1ARK A;  3PGG A;  4QVC A;  4OB3 B;  1M2O A;  3C12 A;  3CCV T;  4QQG A;  5LJ3 d;  3PVL A;  1IXD A;  3CCJ T;  1S72 T;  1ZX6 A;  3I9Q A;  3CMA Q;  2XDP A;  4PK4 A;  3RKW A;  2QYZ A;  2LNV A;  3CCQ T;  4KGX B;  5GJV B;  5DY9 A;  1R77 A;  2ROT A;  1JJ2 P;  1RUW A;  2QEX T;  2LT4 A;  1BI2 A;  4Z89 A;  5GMK m;  1AHJ B;  4BAC A;  2RI2 A;  5I2M A;  4M75 E;  1GCQ C;  1D0Y A;  4F04 B;  5IHI A;  2ZPB B;  1Y57 A;  3AHU A;  3UT1 A;  2GQV A;  4ORZ A;  1VQ9 A;  1N5Z A;  2L3Q A;  2JT4 A;  3ZBD A;  1YIJ Q;  2RH2 A;  5GAN 3;  2KE9 A;  5GMK e;  3M58 A;  1K1Z A;  3SFM A;  5FRM A;  2RO0 A;  2JS0 A;  2RB6 A;  1VUB A;  4BE1 A;  4B9X A;  2RMO A;  4JJB A;  4N0A C;  2DYI A;  1VQO T;  2BIV A;  4M78 G;  4R55 A;  3CBM A;  1VQK T;  1VQ8 T;  2O9V A;  2YLC A;  1Y07 A;  3EGX B;  4BI4 A;  5CKH A;  3JB9 F;  3G6E A;  1SEM A;  4C8Q C;  4FM4 B;  4C5E A;  5CCA A;  3FC3 A;  4JS5 A;  1PWT A;  4RTU A;  2LDM A;  1M1K C;  2O9S A;  3LGF A;  2KQW A;  4BY6 B;  3P8H A;  1NJI R;  4IKF A;  3M53 A;  1NJI C;  1K76 A;  1YIT A;  3OYD A;  3HFO A;  4ANJ A;  2YUP A;  4R56 A;  3CCS Q;  3S3M A;  4E7Z A;  3JRZ A;  3OYH A;  1E6G A;  2RI5 A;  1NEB A;  1VOM A;  2M9U A;  3UA6 A;  1S72 Q;  1W2B S;  1WI7 A;  1BI1 A;  2DEQ A;  2MI6 A;  3CCU A;  1UGS B;  1D1B A;  1NPR A;  3QKJ A;  3BDU A;  3VS4 A;  2QAZ A;  3I55 A;  4C0D B;  2DBK A;  2DF6 A;  1YJN T;  1YWP A;  2YDL A;  3CC4 T;  2ZPE B;  5EC7 A;  4J6W A;  4A54 A;  1I0C A;  1ABO A;  4XAX B;  4RTW A;  3JCM d;  2V8I A;  1RI0 A;  2F5K A;  4PLI A;  2C0T A;  4M77 A;  4RCC A;  2RK1 A;  4NL3 A;  1QWE A;  3JCM e;  1F1B B;  4KUD K;  3DKM A;  2W10 A;  3GIB A;  3EFR A;  2EYQ A;  5J3B A;  3RUX A;  2X4J A;  1AD5 A;  3CC4 A;  3FB9 A;  3QDR B;  1PRM C;  3QYG B;  3IQL A;  1RAE B;  1BI0 A;  2HSE B;  4ZTJ A;  4RUG A;  3SWN B;  4LDX A;  4JJN K;  3CCU Q;  3SDZ A;  2VWF A;  2XID A;  3I56 Q;  1FYN A;  2A37 A;  3C95 A;  4II1 A;  2ZAE A;  3CCE T;  1UEC A;  1MGQ A;  2QQR A;  4GLK A;  3VS5 A;  3PNW C;  2EPD A;  5LJ3 e;  2CT4 A;  3OW2 A;  4HCC A;  3EG3 A;  2DZ9 A;  1YJW A;  3HPW A;  2JM9 A;  2R5A A;  1VYV A;  4E7K A;  5IH2 A;  2O01 E;  1UG1 A;  3EGX A;  2DIL A;  4DBF A;  1KHI A;  1NEG A;  2E1H A;  3VU3 C;  1MMN A;  1E6H A;  2K3Y A;  2FVU A;  3CPF A;  1VQP Q;  4MZP A;  1E7O A;  2FG0 A;  2FZG B;  2E10 A;  2CP3 A;  3OYC A;  1V1C A;  3LW5 E;  1FX7 A;  5CVI A;  2RN8 A;  2EVR A;  2DK3 A;  1Q95 G;  4X9D A;  2DO3 A;  1X01 A;  2EGE A;  1ZBX A;  3PT9 A;  1ZA1 B;  2CP6 A;  1SPK A;  2JJ9 A;  4PLL A;  2AKL A;  4VUB A;  1OOT A;  4M77 G;  4Z8A A;  5LJ3 j;  3JB9 D;  1YI2 A;  1Q81 R;  4JLG A;  3RDV A;  1KSW A;  2BTT A;  3CMA T;  5LJ3 h;  3HL8 A;  1UHC A;  2XI9 A;  4EMK A;  1QVG S;  3TVT A;  3I35 A;  5GMK j;  2E6Z A;  4HCZ A;  3FLG A;  3QUI A;  1D0Z A;  2L3R A;  3VS7 A;  1VQ5 T;  5KYY B;  4MZM A;  4DOW A;  4M77 B;  2FHD A;  1VQK A;  4ELY C;  1YJ9 T;  3NTI A;  2LJ0 A;  1KIK A;  2IPO B;  1K73 U;  1WX6 A;  2ZPF B;  3UDC A;  4M78 C;  3OMC A;  5IAY A;  4M7D B;  3JB9 I;  4LDW A;  2OX7 A;  1VYU A;  1UGR B;  1MMA A;  2JTE A;  1P92 A;  3GNF B;  2JMC A;  2GCX A;  3KUF A;  4C8Q G;  1BI3 A;  2OTJ Q;  1JEG A;  3EH2 A;  1W6X A;  1TTH B;  4DEX A;  2J6K A;  2GNC A;  2D8J A;  4IIM A;  1Z9Z A;  2Y4Y A;  2MMP A;  1W2B P;  2CP7 A;  3UAT A;  3G7Z A;  3GOX A;  1GFD A;  3JB9 J;  5LL6 S;  5GAO l;  4QQD A;  2KYM A;  2PVG B;  1Q86 U;  1N6A A;  1XOV A;  2VXE A;  1OYX A;  3KFV A;  1YWO A;  2MCN A;  4FYV B;  2H8H A;  1NJI U;  2KRO A;  2D0Q B;  2L2P A;  3LH5 A;  1Q82 U;  1QKX A;  1M1K U;  1HXD A;  2DVE A;  3BE3 A;  1WZO A;  4BE2 A;  4JDS A;  5GAN 4;  2DA9 A;  3OYN A;  3KBG A;  4PL6 A;  1K4U S;  4DA4 A;  2DD4 A;  1VQN Q;  4LUE A;  5FU6 B;  2KVQ G;  4XTZ A;  3OYF A;  3CCE A;  4FW1 A;  5CQY A;  1PSE A;  5GAN 5;  3INZ A;  1W70 A;  3EG9 A;  5KYU B;  2DPP B;  2V8K A;  3LX7 A;  3L42 A;  4AFS C;  2XKO C;  1U8R A;  4OF1 A;  4C92 G;  3OA6 A;  1N8R U;  4Y28 E;  1VQ8 A;  4J9E A;  3WVD B;  1TUG B;  1NLP C;  3JCM b;  3UA7 A;  1ZUK A;  1D0X A;  3FDR A;  5D6X A;  4C92 D;  3CC2 A;  1MHN A;  1OV3 A;  1FXX A;  1B34 B;  3CCJ Q;  4RTV A;  2RQW A;  1FMK A;  1RAF B;  4ATO A;  1OEB A;  1AZE A;  3DB3 A;  1RAI B;  2COW A;  3CBO A;  3G71 A;  2DXC A;  1UB4 A;  5CR2 A;  1KC8 C;  1U1S A;  4JLI A;  2K3X A;  1M3A A;  4FT4 A;  1KQS P;  4M7D A;  1OX9 A;  3CBP A;  2KRN A;  1G83 A;  5FRO A;  2X35 A;  4FL6 A;  1NPP A;  1I8F A;  1W4S A;  2K5L A;  1N9S A;  2MF2 A;  3CPW A;  4C92 A;  5KYW B;  4HVU A;  2DMO A;  3L2R A;  2RI3 A;  4E2F B;  2JW4 A;  3NTK A;  3FRN A;  2KDS A;  4HCK A;  1WNL A;  2F2X A;  2HAX A;  4DBR A;  3J7A F;  1T3S A;  2NUZ A;  3A8O B;  1ZA2 B;  2FL7 A;  3OYE A;  2KI7 A;  1RLQ C;  2ZCF B;  5FW9 A;  1N8R R;  2GBQ A;  1TWB A;  3MP1 A;  1Y71 A;  3JB9 H;  3THK A;  1LVK A;  4FYX B;  3RKY A;  4XTX A;  4BI3 A;  3HRT A;  1QVF P;  3TSZ A;  2RQV A;  1SHF A;  5A0G A;  1Z9Q A;  2DL5 A;  4NS5 A;  3RR6 A;  1WJS A;  3AT1 B;  1RL2 A;  2DTO A;  3NFC A;  4EMH A;  4F7U B;  3TRE A;  4Z88 A;  4OP0 A;  2L0A A;  3ER0 A;  4CRI A;  2KR3 A;  4OGC A;  4CC7 A;  2NLU A;  5KCO A;  1B07 A;  1UEB A;  1FMV A;  2NYS A;  2PNI A;  2K4Y A;  1YJN A;  3JCM J;  2RJF A;  4BUG A;  3GP8 A;  3EG2 A;  2JXB A;  2OTJ A;  2QDL A;  1KD1 R;  3S3N A;  4M78 D;  4C8Q A;  1IZ6 A;  2K7A A;  5IXB A;  2CDT A;  1EX4 A;  1OPL A;  2A08 A;  3EHQ A;  3F70 A;  4PJO B;  4JRI A;  2XG8 D;  1GCP A;  4IUU A;  4J9F A;  2P84 A;  4J83 A;  2E3I A;  4K11 A;  3JCM h;  1Q7Y U;  2FRW A;  4M7A D;  2VVK A;  3M4G A;  1MMD A;  1Q82 R;  3EH1 A;  1VQM A;  1SSF A;  4Z02 A;  3UPU A;  3VS2 A;  1R8O B;  1WPY A;  2DRM A;  3VJP A;  1N27 A;  2QA4 Q;  2CZ6 B;  3TQ7 P;  4D8D A;  2E3H A;  2ZZD A;  1ZSZ A;  3PMI A;  3OYI A;  4EMG A;  4ELZ C;  5HK3 A;  2Y4X A;  1MND A;  1GXI E;  2RHI A;  1HSQ A;  2MWO A;  3QYH B;  5GAM h;  2KGT A;  2HZY A;  2COZ A;  1QLY A;  1MUZ A;  1D09 B;  2YT6 A;  1KD1 U;  1V29 B;  2KBT A;  5KYY A;  4C0G A;  3G71 Q;  2JNG A;  1XJW B;  2RHU A;  3M0T A;  2NUT A;  3CME Q;  2BZ8 A;  5CKD A;  4YTL A;  2YSQ A;  5IHN A;  1K9A A;  2PVO B;  2YLB A;  2H3J A;  1VQP T;  4ZGD B;  2K2V A;  2LQ8 A;  1YCY A;  2EIF A;  3S3O A;  2HCK A;  2M02 A;  2OAU A;  3CC2 T;  1IGU A;  4AG1 C;  2EQM A;  2P0P A;  5IHK A;  2LJ1 A;  4M77 C;  4IUT A;  2PZ1 A;  2HEQ A;  3CXC P;  1M90 U;  2KRM A;  3CD6 Q;  5L8R E;  3QHS A;  1G8X A;  2KXD A;  1SF9 A;  2E6N A;  4OMN A;  2P0K A;  4CC2 A;  5LJ5 e;  4ZN1 A;  3QO3 A;  1FMW A;  4FIB A;  2ZPI B;  5HY6 A;  4FYY B;  4C0Z A;  4FSX A;  3ASK A;  4F7U G;  1B7T A;  1M8M A;  4DOV A;  1ZHI A;  4X1V A;  3NGP A;  3RNJ A;  1VQ7 T;  2DLP A;  2F2V A;  1D1A A;  1Q86 R;  2D6F A;  2LMJ A;  4C8Q B;  5ECA A;  1T3L A;  5AT1 B;  2QI2 A;  2EYY A;  1YHQ A;  3A8M B;  2EQK A;  3VUB A;  1BCO A;  1CKB A;  2KSS A;  2QK0 A;  4LDV A;  2LCL A;  3HSB A;  2HKQ B;  2WSC E;  3V8J A;  3PIP A;  1WGS A;  2RHY A;  3OQ5 A;  1G3T A;  1D3B A;  4HT8 A;  4QVD A;  4C5I A;  3JSC A;  1YHQ Q;  3VKI A;  2HBP A;  5LJ5 j;  1ACM B;  2CH4 W;  1VQL T;  5GMK l;  2JMA A;  2DAQ A;  2FO0 A;  4AFU C;  2DXU A;  4M7D C;  1X2K A;  3I55 Q;  2ZPG B;  2HMA A;  2A7Y A;  4XTY A;  2CZ1 B;  1TXQ A;  5GAO q;  3MPU B;  2LVM A;  2KY9 A;  1T0J A;  3OB9 A;  2RNA A;  2J6O A;  1IRE B;  2C06 A;  1JBM A;  2LQW A;  4M7A A;  3A8L B;  1J3T A;  2JOY A;  3L2Q A;  4F16 A;  2BZX A;  4JS4 A;  3E9F A;  1WXB A;  3PIO A;  2OTJ T;  1M30 A;  2BE9 B;  4M78 F;  1RAG B;  2NUP B;  5I11 A;  1GL5 A;  3BW1 A;  2PU9 B;  1YJW T;  4QT7 A;  5GAN 6;  1H92 A;  4RG8 A;  1K73 R;  4MML A;  2QGG A;  1W2B A;  2EYX A;  2DER A;  4A53 A;  3I5R A;  4KUL A;  4NOY A;  5GAN j;  1K9M C;  1BBZ A;  5CKB A;  2PVD B;  3QBY A;  5CK9 A;  4Q5W A;  4C92 B;  2AT1 B;  4PJO E;  2RM4 A;  1I1J A;  3OYY A;  5KYX B;  2EW3 A;  4BDY A;  2F5T X;  1ABQ A;  2QG9 B;  1CKA A;  3MCA B;  1NG2 A;  3CD6 T;  4PFZ A;  2EJ9 A;  3WVE B;  1AWX A;  5GAN h;  2QTX A;  4E47 A;  1LOJ A;  2RPN A;  2QGF B;  2KRS A;  3L2Z A;  1NZ9 A;  5KYN A;  1LJO A;  3I56 T;  3L2W A;  4PJN A;  1X6G A;  5GMK h;  4IUV A;  2X4W A;  1TH7 A;  2YUQ A;  2R58 A;  2G3R A;  1GBR A;  3M55 A;  1M27 C;  3Q1J A;  4N0A A;  3G6E T;  4L59 A;  3HKS A;  2DD5 A;  2CP0 A;  4M78 E;  1K8A U;  4HCB A;  1UTI A;  1VQM Q;  4XU0 A;  3JCM c;  1YJW Q;  5I21 A;  3M54 A;  4UC4 A;  1LNX A;  4WF2 A;  1UFF A;  2L89 A;  3WXM B;  1RAC B;  2O4X B;  5C0M A;  1WJQ A;  1U06 A;  1KC8 U;  2WSF E;  1QVG A;  4CI0 C;  2C0O A;  2EWN A;  1M2V B;  2XMF A;  3EAE A;  4M75 A;  1H3H A;  1WYX A;  1I5L A;  5GAN 8;  5LJ3 f;  1RAB B;  1KD1 C;  1EFN A;  1OUL A;  2K5F A;  2EYW A;  2K79 A;  4M75 G;  3CC4 Q;  2EJG A;  1XNI A;  1N9R A;  5CIU A;  5GAO r;  1OQK A;  3G1J A;  3X25 B;  4OMP A;  1YN8 A;  2CZ0 B;  2EJF A;  8AT1 B;  2XU8 A;  2GFA A;  4IIO A;  3L2V A;  1T0H A;  1LCK A;  2NUP A;  2CYZ B;  4PFP A;  1YIT T;  1ZSZ B;  1UDL A;  2RHX A;  2R5M A;  3SEM A;  2A3L A;  3CCL A;  2HQE A;  4XQ3 A;  1H64 1;  1OX8 A;  4BE0 A;  2DRK A;  3RES A;  2JN0 A;  3LLR A;  5IT9 E;  3QDF A;  4GY5 A;  1KQ1 A;  4X9C A;  3RMQ A;  1VQ4 A;  1Y96 B;  1I4K 1;  4KRT A;  2H3E B;  5KYX A;  2DFU A;  4QVZ A;  3M0Q A;  2VGN A;  2D9T A;  2QQB A;  1U5S A;  2MAM A;  4LDU A;  3EG1 A;  4M7D D;  1AEY A;  3N5B B;  2LP5 A;  2LT1 A;  4ME7 A;  3CCS A;  2FPF A;  2HL3 A;  2KMT A;  3CD6 A;  1TG0 A;  3BDL A;  2GQI A;  1PG5 B;  2KAF A;  4JUV A;  3D7S B;  4E7S A;  5L23 A;  2DEU A;  1SG5 A;  3EHR A;  4C0D C;  3PE0 A;  4PJJ A;  4D6W A;  5GAN 7;  2LCS A;  3JV3 A;  4LUD A;  1OU9 A;  4DQ2 A;  3QXE B;  1YIJ T;  1DJ7 B;  3REA B;  4LD9 K;  2GTJ A;  2JTM A;  3LWH A;  4WTO B;  4A4K A;  2ESW A;  1D1C A;  1HK9 A;  2WSE E;  2EGC A;  3V8K A;  3E9G A;  2DKG A;  2O4X A;  5D7U A;  3VS0 A;  3X26 B;  4E7J A;  2L3P A;  4LD6 A;  4KH0 B;  3UWN A;  2ENM A;  4C8Q F;  2M51 A;  1WFW A;  4PNO A;  2XDB A;  2C0I A;  4PJL A;  5FWC A;  2JM8 A;  2E70 A;  3MP6 A;  1BU1 A;  1WHH A;  3FJ5 A;  5C6S A;  2CUD A;  1M9S A;  4A4F A;  2PTK A;  3GPL A;  3CC7 T;  4O5V A;  2P4T A;  1VQN A;  2OTL Q;  2F69 A;  5KCH A;  4QW2 A;  1BKB A;  2DNU A;  3MO8 A;  1H3Z A;  3CCE Q;  2M1H A;  1YHQ T;  3V7S A;  4XTU A;  1QP2 A;  1ZUY A;  4E7L A;  3I56 A;  5HK0 A;  2XD0 A;  4N4G A;  5FU6 C;  4AT1 B;  1VIF A;  2ATC B;  1KQS S;  4HT9 A;  2YHT A;  1VIE A;  2Y90 A;  4AG2 C;  4RTT A;  4OML A;  3MKD A;  4PKC C;  2EKH A;  1X27 A;  2MK5 A;  2J7I A;  4LE9 A;  1IHW A;  5GAO p;  1VQL A;  2DET A;  2HBW A;  2HSP A;  3M9Q A;  4RTY A;  4B6M A;  3CCM A;  1MNE A;  1BCM A;  3JCM g;  2VV5 A;  4XTW A;  1C1A A;  4KT0 E;  3CCQ Q;  1PKS A;  1GBQ A;  2E41 A;  4ZNX A;  1QCF A;  2V8J A;  1ZSZ C;  1UUE A;  4PJO F;  4KGZ B;  1O75 A;  2QQ9 A;  2NWM A;  4F17 A;  2DIQ A;  5LJ5 g;  3QWY A;  3OYA A;  2QTV A;  1VQL Q;  2CS7 A;  4RTX A;  1HD3 A;  5IN1 A;  3CCV Q;  3NMZ C;  1YFN A;  3M4Y A;  4F14 A;  5HKC A;  4C92 C;  3X24 B;  2XIC A;  4FSS A;  2ZGW A;  3PMT A;  1S72 A;  3QSU A;  1XTD A;  2J6F A;  1WLP B;  3RKX A;  2K2M A;  2DBM A;  1UE9 A;  2O31 A;  2QXF A;  4KH1 B;  1SSH A;  3A98 A;  1M8V A;  1S1N A;  2XDD A;  3QG1 A;  2EQI A;  3JCM X;  4MZT A;  1KQS A;  2DXB A;  4AMC A;  1WJR A;  1VQ6 A;  4J9I A;  2CKK A;  3M57 A;  3HRU A;  1YNZ A;  1M1K R;  2FZC B;  4JJC A;  1YI2 Q;  2X4Y A;  2RHZ A;  5FU7 B;  5GAO m;  4BD3 A;  5CKF A;  4J9H A;  3A8G B;  5LJ5 f;  1G5V A;  3CCQ A;  1PHT A;  3EGD B;  1SHG A;  1G3Y A;  2PUK B;  1SRM A;  5M9O A;  3CCJ A;  5DM7 R;  4F7U F;  2OTL T;  1PKT A;  3OYG A;  2CP5 A;  1QWF A;  4E7H A;  2B86 A;  2LNH B;  3GLX A;  3RER A;  2AZS A;  3A5Z B;  2OJ2 A;  3QJ6 A;  4XK8 E;  4E6R A;  2RQR A;  2EQU A;  3ZEH A;  1K8A C;  1GFC A;  2FRY A;  5GAM e;  1KJW A;  5FWB A;  2DL4 A;  2E64 A;  2EKO A;  4O6J A;  3MHX A;  2X51 A;  4DBQ A;  4L5G A;  4FCY A;  1X2Q A;  3CME T;  1X75 C;  4XU3 A;  3I5S A;  2A28 A;  2VB6 A;  2QQS A;  4N4I A;  3O5Z A;  2B8A A;  3CC7 A;  1VQN T;  2A36 A;  3VYH B;  1M3C A;  2LZ6 B;  1Q81 C;  1G3W A;  2EQJ A;  2I2L A;  4M7D E;  2LX7 A;  3GBQ A;  4BB7 A;  2YRV A;  1BK2 A;  1IHV A;  3R6O A;  1OI1 A;  2HD0 A;  3H0F A;  1YP5 A;  3L2U A;  3V7R A;  2K5I A;  4M7A E;  4RTZ A;  5CO7 A;  2LX9 A;  2GFU A;  3EG9 B;  3LWI A;  4TVR A;  4RMO A;  4IUR A;  2ED1 A;  1YI2 T;  2FPD A;  1BIA A;  1PRL C;  2PUO B;  3VS3 A;  4M7A F;  2BUD A;  3QJY A;  1IRX A;  3OYB A;  5AYF A;  4M75 D;  3OYL A;  3MP8 A;  2DVJ A;  3G4S A;  1K8A R;  3MJX A;  2DL7 A;  3OYM A;  2E5Q A;  3CCS T;  5GAM g;  2AZV A;  1QCO A;  2L8D A;  4HKE A;  4WCI A;  2AIR B;  2BZY A;  3ZL7 C;  1NYF A;  2KXC A;  3C0C A;  4OB1 B;  1Q82 C;  4JRQ A;  2J05 A;  1BIB A;  3EGD A;  1YJ9 Q;  4RCB A;  2SRC A;  3TSW A;  1QKW A;  1OZ2 A;  4ZN3 A;  2BKD N;  1K0S A;  3OYJ A;  1C0M A;  5GAN g;  2A0F B;  3H0I A;  1VQK Q;  2P4R A;  4LN2 A;  3CCV A;  5I22 A;  3CCL Q;  1AWO A;  1RLP C;  1VQO Q;  4A4G A;  4PJO G;  5KYW A;  1NBE B;  2E65 A;  1K0X A;  1WXU A;  1AVZ C;  1G2B A;  5J26 A;  4ZGJ B;  3OS5 A;  2RF0 A;  1BB9 A;  1Q81 U;  1WDX A;  3V8L A;  2AK5 A;  1WXT A;  3CPW P;  1M90 C;  1RAD B;  3H6Z A;  1PC0 A;  3OMG A;  4JRK A;  4MDX A;  1Q7Y R;  2WAC A;  3NTH A;  4M77 D;  4A4H A;  1WA7 A;  1Q7Y C;  4PJO C;  1TU0 B;  5EG2 A;  1NE8 A;  5GAN d;  3H41 A;  5IXF A;  3CME A;  3BFM A;  1TUC A;  2Z0W A;  4OMF B;  2L3S A;  4RKU E;  1AT1 B;  2YUN A;  1SKU B;  2GF7 A;  4X34 A;  1M1F A;  1UJ0 A;  4KGV B;  3RMS A;  5LJ3 g;  2D0N A;  1RAA B;  4KBM B;  5GAM j;  4M75 F;  1I5O B;  4M78 B;  4F7U A;  1ZSG A;  2QEX A;  1PSF A;  1QQJ A;  1UGP B;  2QA4 A;  4B9W A;  1QVF S;  2O88 A;  5GAN f;  1U3O A;  2VAS A;  4JRP A;  1QCN A;  3DLL A;  2CRE A;  3S6W A;  3M5A A;  2VC8 A;  1GCQ A;  1WHG A;  1M3B A;  3RBB B;  2VKN A;  1M5Q 1;  2W0Z A;  2E5K A;  2KT8 A;  3MEV A;  2IVW A;  3E19 A;  1NLO C;  1KFZ A;  3CMA A;  1NYG A;  3CCU T;  2DM1 A;  3EGU A;  3O8V A;  1WHK A;  4DEY A;  3OS1 A;  2ED0 A;  1UGQ B;  2D8H A;  3SB2 A;  1M90 R;  3LGL A;  3MEU A;  4F7U E;  4NL2 A;  1VQ5 A;  2LTO A;  3MEW A;  4EIK A;  2JVV A;  1IO6 A;  5I2S A;  3URG A;  2DX1 A;  1MMG A;  1HJD A;  2DIG A;  1VA7 A;  2M0O A;  2BE7 D;  4XTV A;  2RJD A;  5KYU A;  2SEM A;  2KK4 A;  3JAM E;  4PJO D;  3ULR B;  2E12 A;  2VUB A;  3SWN C;  6AT1 B;  1AZG B;  1WHL A;  1B34 A;  1AOJ A;  2XK0 A;  2NUT B;  1IB8 A;  1JJ2 S;  2X9H A;  8ATC B;  3OBY A;  3TCJ A;  4BI8 B;  4E7I A;  2ABL A;  2VGM A;  4OMO A;  5GAN e;  2JUF A;  2O2O A;  4C5G A;  1VQ4 Q;  3HFN A;  2COY A;  4FYW B;  2LRQ A;  3ZFJ A;  1JXO A;  5GAO n;  3CCR A;  2MWP A;  1KC8 R;  2V26 A;  3G4S T;  2RQU A;  5HCK A;  1JRI A;  4DBH A;  2EGA A;  4PJM A;  5D6W A;  1R0C B;  2KEA A;  1VQM T;  2K57 A;  3SD4 A;  2EFI A;  5GMK i;  2DYB A;  3UF4 A;  3L1A A;  3JB9 G;  4OMQ A;  2M0Y A;  3G6E Q;  1XQH A;  3NPF A;  3P8B B;  4C5H A;  1TOV A;  3CPW S;  1O9S A;  1WIE A;  1VYT A;  4M78 A;  5J39 A;  3FEO A;  3FIF A;  2K6D A;  3QII A;  2FZK B;  2MPX C;  5FRN A;  5KE3 A;  1W1F A;  3CXC A;  1UHF A;  5CKE A;  3OYK A;  4J9C A;  2XHC A;  5GJW B;  2CT3 A;  2DTI A;  2ROL A;  2RQT A;  1WHJ A;  2IG0 A;  1TSF A;  1V76 A;  4BDZ A;  1ZLM A;  2EYZ A;  2HL5 C;  3M0P A;  4OB0 B;  1MV3 A;  3CC2 Q;  1UJY A;  3M59 A;  2HDA A;  5FU7 C;  2DXT A;  4M7A C;  1VQ9 Q;  4FT2 A;  3NHN A;  1YIJ A;  1M1G A;  4EMK C;  3H8Z A;  4M77 F;  2RK2 A;  3JCM P;  1SRL A;  3JCM V;  5KE2 A;  1KK7 A;  4JZ4 A;  2AKK A;  2KNB B;  4EDU A;  1R0B G;  2YUO A;  1QMC A;  5A0L A;  2ECZ A;  1HYO A;  3E1S A;  4M4Z A;  4C92 F;  4ZTF A;  5DLO A;  4M7A G;  1H8K A;  4CC3 A;  4BY6 C;  3G71 T;  2QEX Q;  4LNP A;  2AHJ B;  1K9M R;  2JTF A;  1JU5 C;  1QW1 A;  4C0F A;  3TEE A;  1D3B B;  2RD1 A;  3R6N A;  3VRY A;  4MDW A;  1NM7 A;  4PJO A;  2QA4 T;  4M7D G;  1WQ7 A;  3FJP A;  2VXF A;  4FU6 A;  3QWX X;  4LXC A;  2EBP A;  1YJN Q;  4FW2 A;  3DLM A;  4J8O A;  1PD1 A;  3M0S A;  1WHM A;  3BY7 A;  4M7D F;  2V1Q A;  2JZ2 A;  1X6O A;  2F2W A;  2CH4 A;  1K9M U;  3V7C A;  5LJ5 d;  3EFS A;  2MYS A;  1U1T A;  3T9N A;  3HTR A;  5A2Q E;  1JO8 A;  1EZZ B;  2LC4 A;  1I81 A;  2K3B A;  4PFO A;  3QPH A;  2DZC A;  2YRD A;  2CGH A;  2ZPH B;  1PM3 A;  1Q86 C;  4QKU A;  4EPC A;  3VYG A;  5DLQ E;  3VRZ A;  3VV0 A;  2IIM A;  4MMK A;  4ZGE B;  4A63 B;  3CCM T;  3CCR Q;  1QVG P;  3PVQ A;  1VQ7 Q;  4JJD A;  3TU4 K;  4M75 C;  3OY9 A;  4HA8 A;  4IUQ A;  4N4H A;  1VQ4 T;  1OU8 A;  2L5Q A;  1K73 C;  3EFO B;  1VQ7 A;  2LCC A;  2E4H A;  3A1P A;  3REB B;  3OW2 P;  4HVV A;  1AWW A;  1MV0 B;  4J5Y A;  3H9N A;  3CCL T;  2M16 A;  1QP3 A;  3OS0 A;  4J7I A;  2DTH A;  2V1R A;  3VUZ A;  1KHC A;  1WQW A;  3C4S A;  1N8R C;  2OAW A;  4J9D A;  4C92 E;  4V2S A;  3ME9 A;  1OPK A;  3M0U A;  3CCM Q;  3CCR T;  4CC4 B;  2GTO A;  3P8D A;  3J81 E;  2HKN A;  4OMM A;  1PD0 A;  2DJQ A;  3C94 A;  1YBY A;  2VYT A;  2CUB A;  3DB4 A;  3LYI A;  4IUP A;  3HP9 A;  3OSS C;  3PTA A;  5LJ5 h;  4XU1 A;  4AFZ C;  1FWZ A;  1PNJ A;  1IGQ A;  2P0Q A;  5A0D A;  1VQP A;  1RAH B;  1VQ8 Q;  4GBQ A;  1ZBJ A;  5KH6 A;  3VS6 A;  1YCS B;  1VQ9 T;  3JCM f;  1QVF A;  2YRC A;  2K9G A;  3J80 E;  2X4X A;  3OSV A;  2LQK A;  2KT1 A;  1JXM A;  1OZ3 A;  1RI9 A;  2D1X A;  2CSI A;  1UGV A;  1VQ6 T;  2OTL A;  3CC7 Q;  3M0R A;  3X28 B;  4C8Q D;  3OW2 S;  3M56 A;  3GNG A;  3OS2 A;  2QAS A;  2RA2 A;  4OVA A;  3JCM W;  9ATC B;  2DE0 X;  2EAY A;  4J9G A;  3SHW A;  3GF5 A;  1X43 A;  2X3X D;  4KUI A;  2HQX A;  4HXJ A;  4R0K A;  3MET A;  3SWN A;  4C8Q E;  2QDY B;  2GGR A;  1Y96 A;  1Y7X A;  4L6V 5;  4M7A B;  2LJ3 A;  2MIO A;  1JQQ A;  3RIR A;  2J06 A;  2HNI A;  1CSK A;  3HHT B;  3CXC S;  4HVW A;  2FYK A;  4J6Y A;  3MEA A;  1GRI A;  3H0H A;  4QQ6 A;  2FB7 A;  1G3S A;  5GAM f;  1B3Q A;  2F1L A;  2G6F X;  3A8H B;  3KXT A;  4P5N A;  2MOX A;  3EFO A;  4J9B A;  4A4E A;  1X69 A;  2YXY A;  1QVP A;  2LQN A;  1EIF A;  4OGE A;  1KG1 A;  3EG0 A;  5GAM d;  3HRS A;  2I0N A;  1I07 A;  4ESR A;  2PQW A;  2JS2 A;  2CP2 A;  3QZ9 B;  1VQ6 Q;  4RG2 A;  1LPL A;  1VQO A;  2FEI A;  3LH0 A;  3I55 T;  1ZQ1 A;  2DL3 A;  2OI3 A;  1ZUU A;  2RJC A;  1TS9 A;  2DJZ A;  2X3W D;  2QQA A;  3E2U A;  1YJ9 A;  1A0N B;  4M77 E;  1KQ2 A;  1JB0 E;  4J7F A;  4XU2 A;  1JJ2 A;  3U23 A;  4JPB W;  4J6X A;  2HQH A;  3X20 B;  2DL8 A;  2CSQ A;  1BYM A;  4AFQ C;  1YIT Q;  4Y91 A;  5GAN 2;  1C6V X;  3PFS A;  4JZ3 A;  2FPE A;  1X6B A;  1Y0M A;  1AWJ A;  3CEY A;  4Y92 A;  4D8K A;  2RJE A;  4EMK B;  4LDY A;  1TUD A;  3G4S Q;  5CQX A;  3VS1 A;  4OB2 B;  4GLM A;  7AT1 B;  5D6Y A;  3JCM Q;  2CZ7 B;  2KYB A;  1PCX A;  3QZ5 B;  2R57 A; 
#chains in the Genus database with same CATH homology
 3MEV A;  2QQB A;  3OBW A;  5FLX E;  2IVW A;  3E19 A;  5FRO A;  2X35 A;  3CMA A;  4FL6 A;  1M4Z A;  2MAM A;  1NPP A;  1I8F A;  1W4S A;  2K5L A;  3CCU T;  5CAI A;  1N9S A;  2MF2 A;  4M75 B;  4LDU A;  4M7D D;  3PGG A;  4QVC A;  3CPW A;  3N5B B;  3O8V A;  4OB3 B;  4C92 A;  3OS1 A;  3C12 A;  3CCV T;  2LT1 A;  4ME7 A;  4QQG A;  5LJ3 d;  1UGQ B;  3CCS A;  3CCJ T;  3SB2 A;  1S72 T;  3LGL A;  2KMT A;  2RI3 A;  3L2R A;  3MEU A;  3CD6 A;  4F7U E;  3BDL A;  4JUV A;  2KAF A;  4NL2 A;  3NTK A;  2XDP A;  3FRN A;  2KDS A;  2LTO A;  1VQ5 A;  1WNL A;  4C0D C;  3MEW A;  2HAX A;  3RKW A;  4D6W A;  3J7A F;  2LNV A;  5GAN 7;  2JVV A;  3A8O B;  3CCQ T;  5I2S A;  2FL7 A;  3URG A;  3OYE A;  4DQ2 A;  3QXE B;  2DIG A;  1YIJ T;  1DJ7 B;  2M0O A;  5DY9 A;  2ZCF B;  4LD9 K;  2JTM A;  4XTV A;  2RJD A;  3MP1 A;  3LWH A;  1Y71 A;  2KK4 A;  4A4K A;  2QEX T;  3JB9 H;  3JAM E;  2LT4 A;  1BI2 A;  2E12 A;  1HK9 A;  2VUB A;  2WSE E;  3SWN C;  5GMK m;  4PJO D;  3V8K A;  1AHJ B;  4BAC A;  3E9G A;  2DKG A;  3RKY A;  2RI2 A;  1B34 A;  4XTX A;  2O4X A;  3HRT A;  5I2M A;  4M75 E;  2XK0 A;  4BI3 A;  5A0G A;  3X26 B;  1JJ2 S;  4NS5 A;  4E7J A;  2ZPB B;  3AHU A;  3UT1 A;  3OBY A;  3TCJ A;  4BI8 B;  4LD6 A;  1WJS A;  4E7I A;  2VGM A;  5GAN e;  2GQV A;  1RL2 A;  3UWN A;  2JUF A;  2DTO A;  3NFC A;  4C8Q F;  4EMH A;  4F7U B;  3TRE A;  1VQ9 A;  4C5G A;  4PNO A;  4OP0 A;  2XDB A;  3ER0 A;  3HFN A;  4CRI A;  3ZBD A;  2LRQ A;  4OGC A;  3ZFJ A;  2NLU A;  2RH2 A;  2E70 A;  5GAO n;  3CCR A;  5GAN 3;  2MWP A;  1UEB A;  5KCO A;  3MP6 A;  3G4S T;  5GMK e;  1JRI A;  3M58 A;  2K4Y A;  5D6W A;  5C6S A;  1YJN A;  1M9S A;  4A4F A;  3JCM J;  3SFM A;  1VQM T;  2RJF A;  4BUG A;  2K57 A;  3GP8 A;  2RO0 A;  5FRM A;  3SD4 A;  3GPL A;  3CC7 T;  2RB6 A;  1VUB A;  2EFI A;  4O5V A;  5GMK i;  2P4T A;  2OTJ A;  4BE1 A;  1VQN A;  4B9X A;  2F69 A;  3L1A A;  3JB9 G;  5KCH A;  4QW2 A;  1BKB A;  4N0A C;  1VQO T;  3MO8 A;  3S3N A;  1H3Z A;  4M78 D;  2M1H A;  1YHQ T;  1XQH A;  3P8B B;  3V7S A;  4C5H A;  4C8Q A;  2BIV A;  1IZ6 A;  4XTU A;  3CPW S;  1QP2 A;  4M78 G;  1O9S A;  4R55 A;  4E7L A;  3CBM A;  4M78 A;  1VQK T;  3I56 A;  1VQ8 T;  5J39 A;  5HK0 A;  3FEO A;  2YLC A;  3FIF A;  3QII A;  1Y07 A;  3F70 A;  2XD0 A;  4PJO B;  4JRI A;  4N4G A;  5FU6 C;  1VIF A;  1KQS S;  4HT9 A;  2XG8 D;  5FRN A;  4IUU A;  4BI4 A;  2YHT A;  5CKH A;  3JB9 F;  1VIE A;  2Y90 A;  3G6E A;  4J83 A;  4C8Q C;  4FM4 B;  3JCM h;  5KE3 A;  4C5E A;  5CCA A;  3FC3 A;  3CXC A;  4JS5 A;  1Q7Y U;  5CKE A;  3OYK A;  2LDM A;  4M7A D;  3M4G A;  4PKC C;  2XHC A;  1M1K C;  2DTI A;  2IG0 A;  3LGF A;  1VQM A;  5GAO p;  1SSF A;  2KQW A;  4Z02 A;  3P8H A;  4BY6 B;  4BDZ A;  3M53 A;  3UPU A;  1NJI C;  1VQL A;  4IKF A;  1YIT A;  3OYD A;  1R8O B;  1WPY A;  3HFO A;  4OB0 B;  3M9Q A;  1N27 A;  3VJP A;  4R56 A;  3CCM A;  2CZ6 B;  3JCM g;  3S3M A;  3JRZ A;  3M59 A;  2VV5 A;  3OYH A;  2ZZD A;  3PMI A;  5FU7 C;  4XTW A;  3OYI A;  2DXT A;  4EMG A;  4ELZ C;  2RI5 A;  4M7A C;  5HK3 A;  2Y4X A;  1GXI E;  2RHI A;  5GAM h;  2MWO A;  3QYH B;  4FT2 A;  4KT0 E;  2M9U A;  2E41 A;  1YIJ A;  1M1G A;  4EMK C;  3H8Z A;  4M77 F;  1W2B S;  1BI1 A;  2DEQ A;  2V8J A;  2RK2 A;  2MI6 A;  4PJO F;  3JCM P;  3JCM V;  5KE2 A;  1V29 B;  1O75 A;  2QQ9 A;  3CCU A;  1KD1 U;  1UGS B;  2DIQ A;  1NPR A;  4C0G A;  5LJ5 g;  2JNG A;  2RHU A;  3OYA A;  3QKJ A;  2CS7 A;  4EDU A;  3BDU A;  5CKD A;  4YTL A;  5IN1 A;  5A0L A;  3I55 A;  4C0D B;  3E1S A;  4ZTF A;  4C92 F;  2PVO B;  2YLB A;  5DLO A;  1YJN T;  3M4Y A;  5HKC A;  3CC4 T;  4M7A G;  4C92 C;  2H3J A;  1VQP T;  4ZGD B;  2K2V A;  3X24 B;  2XIC A;  2ZPE B;  2ZGW A;  2LQ8 A;  1YCY A;  2EIF A;  3PMT A;  4J6W A;  3S3O A;  1S72 A;  1XTD A;  3QSU A;  3RKX A;  4A54 A;  4BY6 C;  3G71 T;  4XAX B;  2QXF A;  1N8R C;  2AHJ B;  3JCM d;  2V8I A;  2JTF A;  1RI0 A;  2F5K A;  4PLI A;  1QW1 A;  4M77 A;  4RCC A;  4C0F A;  3TEE A;  1D3B B;  2RD1 A;  2RK1 A;  4NL3 A;  4MDW A;  4PJO A;  1M8V A;  2XDD A;  2OAU A;  3QG1 A;  2QA4 T;  3CC2 T;  4M7D G;  3JCM e;  1WQ7 A;  3JCM X;  4KUD K;  3FJP A;  4MZT A;  3DKM A;  2EQM A;  2VXF A;  2P0P A;  4FU6 A;  4M77 C;  4IUT A;  1KQS A;  3GIB A;  3EFR A;  1M90 U;  2EYQ A;  3DLM A;  4J8O A;  2DXB A;  5J3B A;  3RUX A;  1WJR A;  2X4J A;  1VQ6 A;  2CKK A;  3CC4 A;  3BY7 A;  3M57 A;  3QHS A;  5L8R E;  3FB9 A;  4M7D F;  2JZ2 A;  3QDR B;  3QYG B;  1X6O A;  3HRU A;  1BI0 A;  2E6N A;  2P0K A;  4ZTJ A;  5LJ5 e;  4ZN1 A;  1K9M U;  2X4Y A;  3SWN B;  3V7C A;  4LDX A;  3QO3 A;  4JJN K;  2RHZ A;  5FU7 B;  4FIB A;  5LJ5 d;  3SDZ A;  5GAO m;  2XID A;  2ZPI B;  5HY6 A;  3EFS A;  4BD3 A;  5CKF A;  4C0Z A;  4FSX A;  1U1T A;  3ASK A;  3A8G B;  3C95 A;  4II1 A;  3T9N A;  4F7U G;  5LJ5 f;  1G5V A;  5A2Q E;  4DOV A;  1MGQ A;  1ZHI A;  3CCQ A;  3CCE T;  2LC4 A;  2QQR A;  4GLK A;  1VQ7 T;  1I81 A;  3PNW C;  1G3Y A;  5LJ3 e;  2PUK B;  3OW2 A;  3QPH A;  4HCC A;  2DZC A;  2DZ9 A;  5M9O A;  3CCJ A;  1YJW A;  2CGH A;  2ZPH B;  5DM7 R;  2D6F A;  3HPW A;  1Q86 C;  4EPC A;  4C8Q B;  4F7U F;  3VYG A;  2OTL T;  2R5A A;  5DLQ E;  3OYG A;  3VV0 A;  4E7H A;  4MMK A;  4ZGE B;  2QI2 A;  3CCM T;  4E7K A;  1YHQ A;  2O01 E;  3GLX A;  3RER A;  3A8M B;  3A5Z B;  2EQK A;  3QJ6 A;  4XK8 E;  3TU4 K;  2EQU A;  3ZEH A;  1KHI A;  3VUB A;  1K8A C;  2E1H A;  3VU3 C;  4M75 C;  2KSS A;  3OY9 A;  2K3Y A;  5GAM e;  2FVU A;  3CPF A;  4LDV A;  2LCL A;  4HA8 A;  4IUQ A;  4N4H A;  3HSB A;  2WSC E;  2E64 A;  3V8J A;  2EKO A;  3PIP A;  1WGS A;  2RHY A;  3OQ5 A;  1VQ4 T;  1G3T A;  4MZP A;  1D3B A;  2L5Q A;  4O6J A;  1K73 C;  3MHX A;  4QVD A;  2E10 A;  4HT8 A;  4C5I A;  3JSC A;  3OYC A;  3LW5 E;  1VQ7 A;  4L5G A;  2LCC A;  1FX7 A;  5CVI A;  3VKI A;  2HBP A;  5LJ5 j;  3CME T;  1VQL T;  5GMK l;  2DK3 A;  4J5Y A;  3CCL T;  2DAQ A;  1QP3 A;  1X75 C;  2M16 A;  4J7I A;  2DXU A;  4XU3 A;  2DTH A;  4X9D A;  3OS0 A;  4M7D C;  2ZPG B;  2DO3 A;  1X01 A;  1KHC A;  1WQW A;  2A7Y A;  2QQS A;  3C4S A;  1ZBX A;  2CZ1 B;  4N4I A;  2B8A A;  4XTY A;  3PT9 A;  3CC7 A;  5GAO q;  4PLL A;  1VQN T;  3VYH B;  2LVM A;  4VUB A;  4M77 G;  2KY9 A;  3OB9 A;  4C92 E;  5LJ3 j;  3ME9 A;  4V2S A;  3JB9 D;  1YI2 A;  1Q81 C;  1G3W A;  4JLG A;  1IRE B;  2EQJ A;  2I2L A;  2C06 A;  1JBM A;  3CCR T;  4M7D E;  3CMA T;  3VUZ A;  5LJ3 h;  3P8D A;  4M7A A;  3A8L B;  4BB7 A;  3J81 E;  3HL8 A;  2YRV A;  2XI9 A;  2JOY A;  3L2Q A;  4EMK A;  1QVG S;  3C94 A;  1YBY A;  2VYT A;  5GMK j;  3DB4 A;  3E9F A;  2E6Z A;  3LYI A;  4IUP A;  3PIO A;  3R6O A;  4JS4 A;  2OTJ T;  4M78 F;  4HCZ A;  1OI1 A;  2HD0 A;  3FLG A;  3QUI A;  3HP9 A;  3OSS C;  3PTA A;  2L3R A;  3L2U A;  3BW1 A;  3V7R A;  2K5I A;  2PU9 B;  1YJW T;  1VQ5 T;  4M7A E;  5LJ5 h;  4XU1 A;  2LX9 A;  4MZM A;  2GFU A;  1FWZ A;  5CO7 A;  5GAN 6;  4DOW A;  2P0Q A;  4RG8 A;  3LWI A;  4M77 B;  4MML A;  2FHD A;  4IUR A;  4TVR A;  5A0D A;  4RMO A;  1VQK A;  1W2B A;  1VQP A;  4ELY C;  1YJ9 T;  4A53 A;  3NTI A;  5GAN j;  4KUL A;  4NOY A;  1BIA A;  1YI2 T;  1K9M C;  5CKB A;  2PUO B;  2PVD B;  3QBY A;  5CK9 A;  5KH6 A;  4Q5W A;  4C92 B;  1VQ9 T;  4M7A F;  1K73 U;  2BUD A;  3JCM f;  2RM4 A;  1QVF A;  3QJY A;  4PJO E;  2ZPF B;  3J80 E;  3UDC A;  4M78 C;  2X4X A;  3OSV A;  2LQK A;  3OYB A;  3OYY A;  1OZ3 A;  5AYF A;  3OMC A;  5IAY A;  4M7D B;  4BDY A;  2F5T X;  4M75 D;  3JB9 I;  3OYL A;  4LDW A;  3MP8 A;  3G4S A;  1UGR B;  3MCA B;  3OYM A;  1P92 A;  2E5Q A;  3GNF B;  3CD6 T;  2GCX A;  3KUF A;  1VQ6 T;  2EJ9 A;  3WVE B;  2OTL A;  4C8Q G;  5GAN h;  1BI3 A;  2QTX A;  3CCS T;  3X28 B;  4C8Q D;  1LOJ A;  4E47 A;  5GAM g;  3OW2 S;  3M56 A;  3GNG A;  3OS2 A;  2RA2 A;  2L8D A;  4HKE A;  4OVA A;  2Y4Y A;  3JCM W;  3L2Z A;  2MMP A;  2EAY A;  4OB1 B;  1Q82 C;  3GF5 A;  4JRQ A;  3G7Z A;  1NZ9 A;  1BIB A;  3I56 T;  1LJO A;  3L2W A;  3GOX A;  4KUI A;  5LL6 S;  5GAO l;  4RCB A;  3JB9 J;  4QQD A;  2HQX A;  5GMK h;  4IUV A;  2X4W A;  2PVG B;  1TH7 A;  1Q86 U;  1N6A A;  1OZ2 A;  4ZN3 A;  2R58 A;  2G3R A;  1XOV A;  3MET A;  3SWN A;  2BKD N;  2VXE A;  4C8Q E;  2QDY B;  1Y96 A;  3M55 A;  3Q1J A;  4N0A A;  1OYX A;  3G6E T;  1Y7X A;  4L6V 5;  4M7A B;  4L59 A;  3HKS A;  5GAN g;  2DD5 A;  3OYJ A;  4M78 E;  1NJI U;  3RIR A;  2HNI A;  1K8A U;  4HCB A;  3HHT B;  2D0Q B;  3CXC S;  3CCV A;  4XU0 A;  3JCM c;  1Q82 U;  2FYK A;  4A4G A;  1M1K U;  4J6Y A;  4PJO G;  3M54 A;  5I21 A;  3MEA A;  1HXD A;  4UC4 A;  1LNX A;  4WF2 A;  4QQ6 A;  2DVE A;  2FB7 A;  2L89 A;  3WXM B;  1G3S A;  5GAM f;  2E65 A;  2O4X B;  4JDS A;  3A8H B;  5C0M A;  4BE2 A;  1WJQ A;  3KXT A;  5GAN 4;  1KC8 U;  5J26 A;  2WSF E;  4P5N A;  4ZGJ B;  1QVG A;  3OS5 A;  4CI0 C;  3OYN A;  3KBG A;  1Q81 U;  2EWN A;  4PL6 A;  4A4E A;  3V8L A;  1QVP A;  4DA4 A;  1EIF A;  2DD4 A;  4OGE A;  1M90 C;  3EAE A;  2KVQ G;  5FU6 B;  3H6Z A;  4M75 A;  4XTZ A;  3OYF A;  1KG1 A;  5GAM d;  3CCE A;  3OMG A;  5CQY A;  3HRS A;  1PSE A;  4JRK A;  3INZ A;  5GAN 5;  4MDX A;  1I5L A;  5GAN 8;  2WAC A;  2PQW A;  3NTH A;  4M77 D;  4A4H A;  1Q7Y C;  4PJO C;  3QZ9 B;  5LJ3 f;  5EG2 A;  4RG2 A;  1VQO A;  1KD1 C;  1NE8 A;  5GAN d;  2DPP B;  3CME A;  2K5F A;  3LH0 A;  3I55 T;  3BFM A;  1ZQ1 A;  2V8K A;  4M75 G;  3LX7 A;  2EJG A;  3L42 A;  4OMF B;  4RKU E;  1XNI A;  1N9R A;  5CIU A;  2XKO C;  5GAO r;  2RJC A;  1U8R A;  2DJZ A;  4OF1 A;  3X25 B;  2QQA A;  2GF7 A;  4X34 A;  1YJ9 A;  4C92 G;  1M1F A;  3OA6 A;  3RMS A;  5LJ3 g;  4M77 E;  2CZ0 B;  1N8R U;  4Y28 E;  1VQ8 A;  1JB0 E;  4J7F A;  1KQ2 A;  4XU2 A;  2EJF A;  3WVD B;  2XU8 A;  1JJ2 A;  4KBM B;  5GAM j;  4M75 F;  2GFA A;  4M78 B;  4F7U A;  3JCM b;  3L2V A;  2QEX A;  1PSF A;  4J6X A;  1UGP B;  3X20 B;  3FDR A;  5D6X A;  4C92 D;  2QA4 A;  3CC2 A;  1BYM A;  1MHN A;  2CYZ B;  1YIT T;  4B9W A;  1QVF S;  1FXX A;  1B34 B;  4Y91 A;  5GAN 2;  3PFS A;  2RHX A;  5GAN f;  2R5M A;  3CEY A;  2A3L A;  3CCL A;  2HQE A;  4XQ3 A;  1H64 1;  4ATO A;  2RJE A;  3DB3 A;  4EMK B;  3CBO A;  4LDY A;  3G71 A;  4BE0 A;  4JRP A;  2DXC A;  1UB4 A;  3RES A;  2JN0 A;  3LLR A;  3DLL A;  5IT9 E;  4GY5 A;  5CR2 A;  1KC8 C;  1U1S A;  4JLI A;  5CQX A;  3S6W A;  2K3X A;  1KQ1 A;  4OB2 B;  3M5A A;  4X9C A;  2VC8 A;  3RMQ A;  4FT4 A;  1VQ4 A;  1Y96 B;  5D6Y A;  1I4K 1;  1M5Q 1;  4M7D A;  3JCM Q;  2CZ7 B;  4QVZ A;  3QZ5 B;  3CBP A;  2R57 A;  2VGN A;  2D9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...