4C8QE

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
83
structure length
83
Chain Sequence
EILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qE00
5GAN2 5LJ3h 4M78C 5GANh 3JB9J 2DVEA 5LJ5h 3RIRA 3QUIA 2DXUA 5CAIA 2VXEA 4F7UF 3JCMe 3JB9I 4HT9A 1D3BA 4XTVA 4XU3A 4M7DE 4Y91A 1M8VA 3JCMd 5GAMh 4RCBA 4EMHA 4HA8A 4PJOD 3JCMc 4PJOB 1B34B 4HT8A 5LJ3g 4X9DA 4M77F 4XTWA 5GANg 3EFRA 2E10A 2YLCA 2E1HA 2EWNA 2RD1A 5LJ3f 2DTOA 4PJOG 4C8QD 1LJOA 5LJ5g 5GANf 4M78D 4NL2A 2ZGWA 4M7DC 3RKYA 2VC8A 4QVCA 1YCYA 4M75E 5GAMg 5GMKi 4C8QF 5GAN8 1HXDA 3JCMX 5GAMf 1WQ7A 3JCMP 3PGGA 4C92A 4M78F 5GAN3 2RA2A 5GMKh 3JB9H 1WNLA 4NOYA 3V8KA 3FJPA 2Y90A 1MGQA 5DY9A 4XU0A 4M75A 4QVDA 1I5LA 4J6YA 2DKGA 1D3BB 4EMKC 5I21A 2DEQA 3BW1A 4M77A 4M75C 4RCCA 4M7AE 3JCMh 2EJ9A 3JCMb 4M7DD 4M7DB 2DZ9A 1U1SA 3SWNA 4M7DG 4N0AA 2RM4A 4M7AA 3JCMJ 4C92E 3AHUA 2FYKA 2E65A 3QHSA 5LJ5e 4J6XA 4EMKB 2CGHA 4PJOF 4C92B 3JCMg 3JCMf 1I8FA 4C92G 1H641 4M7AC 4M75B 3V8LA 3RKXA 1BIBA 5GAN5 2RB6A 4XTXA 4M75G 1M5Q1 5LJ5d 4F7UA 5LJ3j 4M77E 3RESA 2EJFA 5GANj 5LJ5j 4J5YA 2YHTA 3EFSA 4MMLA 4C92C 2EJGA 5GAN4 3V7RA 5GAMd 3FB9A 5GAOl 1I4K1 2E64A 4EMGA 4MMKA 5GAMj 3SWNB 1Y96A 1HK9A 5GAOp 4M7AB 2EAYA 3HFOA 5GAOm 3JB9G 1B34A 4NL3A 3M4GA 4JUVA 3VU3C 3HSBA 4M77C 4M7AG 1JRIA 3RERA 5LJ3e 2I2LA 4C8QA 1LNXA 1I81A 3INZA 5GANe 4M7DF 4V2SA 2VXFA 4M78A 4X9CA 4C92D 4F7UE 3SWNC 3BFMA 4N0AC 4F7UB 4M75D 5GMKj 5GAOn 2DTHA 4JLIA 5GAMe 2DZCA 5LJ3d 4C92F 2JN0A 4F7UG 5GANd 1LOJA 4A54A 3BDUA 5GAOq 4PNOA 3HFNA 5GAOr 3RUXA 3QO3A 4M77D 2DXTA 4M75F 1X01A 4M77B 3V7SA 1WQWA 4A53A 3JCMQ 4DQ2A 1Y96B 2K57A 3V7CA 1JBMA 1WPYA 4M77G 4WF2A 4PJOE 2HNIA 2YLBA 4JRIA 2FB7A 3L1AA 4JRKA 3SB2A 5GAN6 4C8QE 3JB9D 1U1TA 3QSUA 1TH7A 1BIAA 4M78E 4C8QB 5GMKe 3JCMW 5LJ5f 4J6WA 1N9SA 4M7DA 4M7AD 4PJOA 4M78B 1N9RA 4XTZA 3FIFA 1KQ1A 5GMKl 4XU2A 4XU1A 3RKWA 4XQ3A 4C8QG 3JB9F 2E41A 4XTYA 4M78G 4XTUA 5GAN7 4M7AF 4OP0A 4EMKA 5GMKm 3JCMV 4PJOC 3BY7A 3V8JA 2DJZA 3L2ZA 2DTIA 2QTXA 1KQ2A 3GIBA 4C8QC
chains in the Genus database with same CATH superfamily
2E5QA 2XU8A 2DNUA 3OYGA 4Z88A 3JCMd 3M0RA 3G6ET 3I55Q 5GANg 2HD0A 1YI2Q 2DTOA 2XKOC 4NL2A 2F5TX 1IHVA 3EFOB 1YCYA 4LDUA 2X3WD 2MOXA 4LE9A 5FWBA 1R0BG 4LDXA 3FJPA 3REAB 1MGQA 1T3SA 2MCNA 2DIQA 2L5QA 2K5FA 2DKGA 1G3WA 2DO3A 3OYLA 2DAQA 2O4XA 3H0IA 3TQ7P 2AKKA 3CC7A 2XDPA 4Q5WA 3QZ9B 4RMOA 2QA4T 4N4HA 1U1SA 2KEAA 2JNGA 1VQ5Q 2J7IA 4PJOF 1RAAB 3JCMf 3J7AF 1JO8A 1K8AU 4P5NA 1V76A 2F2XA 4L6V5 2LX7A 2AZVA 3UT1A 2ZZDA 3EFSA 4MMLA 1H3HA 2F1LA 3OBYA 4FU6A 3VS4A 1OPKA 2QK0A 3LWIA 3O5ZA 1OI1A 2EAYA 5IH2A 4AFUC 2F2VA 1VQ8Q 4Z02A 1VQ7Q 3EFOA 3MEWA 1UTIA 2EYYA 2HQHA 4N4GA 2WSCE 1QVGP 4X34A 1V29B 3A8OB 5GANd 4LUEA 1RI9A 2K57A 4PJOE 2FB7A 4MDWA 3ZEHA 1WLPB 3JCMW 2DETA 2QGGA 4E7LA 1YWOA 3C0CA 2BTTA 4LN2A 5GAN7 1U8RA 1AZGB 3E1SA 2L3RA 1E6GA 1VQLA 2H3EB 3CCQQ 1UG1A 2DXUA 4IUUA 6AT1B 2LNHB 1D3BA 1Q7YC 2KYBA 1K73C 1NPPA 1IGUA 2V1RA 4HT8A 2QQ9A 1WXTA 2E1HA 2YRCA 5GANf 3PTAA 1PRLC 4OGEA 4NS5A 4CRIA 2LCLA 1IGQA 4PFOA 1VQMQ 1WHLA 1QVPA 3JCMX 4BUGA 4Z89A 1OZ3A 2CZ0B 2DF6A 1YIJA 2NUZA 3I55A 3JCMh 3L2RA 2QDYB 3CPWA 2C06A 4LDYA 1YI2A 2RNAA 4M7AA 4R56A 4C92B 2LVMA 3EHRA 2E6ZA 3EGDA 4KBMB 1BU1A 1M2VB 3ASKA 1TTHB 5GAMd 3J81E 3CXCP 2GTOA 1YP5A 2JTEA 2YUQA 5GAOp 3FDRA 1NPRA 1Y71A 4RTYA 4C8QA 2V8IA 1IXDA 4A63B 3CCLT 1ZBXA 2L2PA 2JS0A 4AT1B 2JT4A 2QQSA 2AKLA 1VQKA 3QO3A 3CBOA 1PRMC 3CCMT 4LUDA 3EH1A 2LNVA 3QYHB 2MPXC 4C5IA 3NTKA 1NJIC 5L23A 1FXXA 2KK4A 2MF2A 2GGRA 4KGXB 2D8HA 1VQ7A 4PJLA 2KXCA 4M7AF 1BI1A 4L5GA 4DBQA 4C8QC 4ATOA 3GIBA 1NG2A 3JCMe 5GANh 4GLKA 2HBPA 3OYBA 1N8RU 3NTIA 4RG2A 3LH5A 5KYXA 1Q86C 2KT8A 1YWPA 1H92A 3KFVA 3JCMc 1Y7XA 1KQSA 2FO0A 1ABQA 4RTTA 2C0OA 1K8AR 3VV0A 4C8QF 1WQ7A 2JS2A 2VUBA 3OW2A 3V8KA 5IHNA 1YJWQ 2A08A 1YN8A 3SD4A 4M75C 5C6SA 4M7AE 1ZSZA 2A0FB 4MZPA 2LX9A 4HVWA 4II1A 4OMMA 2O2OA 4E2FB 2LP5A 3VYHB 4LDVA 3TEEA 4DBRA 2KI7A 1B7TA 1ZA1B 4RTZA 1BIBA 3MEVA 3G7ZA 3ZL7C 2XIDA 2EQKA 3WVDB 3HHTB 1OYXA 1GBRA 1VQPQ 2KBTA 3HP9A 1M1KU 1UEBA 2CUBA 1AEYA 2VGNA 5GAOm 4VUBA 1U5SA 3VU3C 2HQEA 1WGSA 3CCEQ 4FSSA 3OS0A 2I2LA 5GANe 3M58A 1D0YA 5CK9A 1AWJA 4J7IA 2E6NA 3M59A 3HRSA 5IHKA 4PNOA 3G4SQ 2DXTA 2NUTB 1WHKA 2ZPGB 3CC2Q 3RDVA 3QSUA 3I5RA 4KUIA 2ED0A 4ORZA 3JAME 4PJMA 1BB9A 2IVWA 2OTJQ 3A1PA 5A0DA 1KJWA 4F14A 1K9MU 5D6WA 1JEGA 2MWOA 4OB0B 4A4FA 4FCYA 5A0GA 4KUDK 2BE7D 2VXEA 5CIUA 2F2WA 5EC7A 5DLOA 4ELYC 1X2QA 1YJ9A 3EG9A 4JRPA 2CREA 2HMAA 3I56T 2E10A 4ZGEB 4BDZA 3RMSA 1M90C 2AK5A 1VQ6A 2YUNA 3PGGA 5I2SA 4NOYA 1Q81C 4ANJA 2K2MA 1AHJB 1RACB 3OYYA 2V1QA 2QASA 2J6FA 2CP0A 4OMQA 3X25B 1RAIB 1JB0E 1MMDA 5FU6C 2BZXA 2CUDA 1VQNQ 3EGXB 2JZ2A 4C5EA 1YITA 4M75B 5FU7C 3SHWA 2KYMA 1SPKA 5GANj 1MV3A 3LH0A 2RF0A 5KYYB 1YHQQ 1SG5A 1BCMA 4MDXA 1HK9A 1IZ6A 3OQ5A 2VXFA 2HBWA 3CMEQ 1JQQA 4IUTA 3VS5A 3BDUA 3CPWP 4DA4A 1VQPA 2LCCA 1KC8R 2KXDA 3FC3A 1M3AA 1NEGA 1TH7A 3EGUA 4M7AD 5FRMA 4WCIA 2KAFA 4M78B 1KQ1A 4AG1C 3QXEB 2FPFA 2L0AA 3CCJT 1LVKA 4KH0B 2COYA 1M1GA 3EG0A 4J8OA 3MEAA 2K5IA 1AWOA 3MP8A 2VWFA 3DLMA 2IG0A 1AWXA 1VQ4T 2QEXQ 5IAYA 2JW4A 3CC2A 3QJYA 3JRZA 4RCBA 2EGAA 2X4WA 4C0ZA 1QW1A 4BI8B 2YLCA 2EWNA 5CKEA 4C8QD 4PJOG 2FZKB 2OTJA 1QP3A 4XAXB 4JS5A 2Y4XA 3EHQA 1QVFS 4M7DC 2F69A 2CH4A 1T3LA 1FMVA 4A4HA 2DERA 1NEBA 2SRCA 2KE9A 1M1KR 2SEMA 2EVRA 1ZUKA 3CMAT 1SF9A 3M54A 2P0QA 1U3OA 1NYFA 1ARKA 2DD4A 3MCAB 1IHWA 3CD6T 1TUGB 3OBWA 2FVUA 2HEQA 5EG2A 1UUEA 4HCZA 3FLGA 2ESWA 3CC7T 3UA6A 1MMNA 3HKSA 2DXCA 2JJ9A 5FU6B 1WYXA 5GAOl 4EMGA 4ZTFA 2CT4A 1RI0A 1PC0A 2JMAA 3UWNA 5FU7B 2BKDN 2VB6A 3L2VA 3VS1A 4M77C 2M51A 3G1JA 1VQNA 3PE0A 1K9MR 3M53A 1UGVA 3AT1B 1U06A 2JN0A 1VQ9Q 4BACA 2EW3A 4HVVA 1WA7A 3RUXA 4FM4B 2JMCA 1YHQA 3CEYA 2HNIA 3OS1A 3C95A 4QVZA 5CKBA 4GBQA 1N9RA 2DEUA 4XU1A 2AZSA 2RHXA 3QBYA 3PNWC 1Y57A 3OSSC 3CMEA 3DLLA 2P4RA 4OP0A 2XMFA 3A5ZB 1UFFA 1S72A 1ZA2B 1VQLQ 1ABOA 4RTUA 2NLUA 3QDRB 3CCRQ 1TUDA 2Y4YA 3OYJA 2OX7A 2JOYA 2LC4A 4KGVB 2RQVA 3M4YA 1G5VA 1QQJA 2RI2A 5HKCA 1WNLA 4FYWB 1H3ZA 5DY9A 1I5LA 1PWTA 3M55A 3QKJA 2CP3A 2QEXA 4FW1A 1IREB 2EQIA 1UHFA 1YIJQ 3CPWS 1W2BA 4M7DB 2MMPA 2DZ9A 5LL6S 2RM4A 4D8KA 1YNZA 1KHCA 1HSQA 1K0XA 1QVFA 2AHJB 4IKFA 2DE0X 1RLPC 5GAN5 3I55T 2RB6A 4F7UA 2BZ8A 1M9SA 1YI2T 2YHTA 4C92C 2QTVA 2EJGA 2MIOA 4EDUA 3CCSA 2HL5C 2K79A 3FB9A 4AG2C 1I0CA 2D0NA 1D0ZA 3EAEA 4OMPA 2AT1B 1AZEA 3M4GA 3RR6A 2GQIA 4M7AG 4HVUA 2QXFA 4ME7A 1ZSGA 2WSEE 3NMZC 1RUWA 2DZCA 2QQAA 3SEMA 5FLXE 3L2UA 3HFNA 4M77B 4OB3B 1VQ5T 2H8HA 1VQKQ 3KBGA 2MAMA 1WPYA 2XHCA 1PHTA 4BDYA 1BIAA 4M7DA 4J6WA 4IIOA 2HSEB 4C8QG 2K5LA 1D0XA 5GMKm 3TSWA 1VQ9A 2W10A 2A36A 1NE8A 2RK2A 4OMNA 3MJXA 3I9QA 5IXBA 1RAFB 4F7UF 1VQ8T 2DL5A 2KR3A 4XTVA 4BI3A 3G71Q 3X26B 4RUGA 4PFPA 1VQ7T 1GBQA 4EMHA 2LMJA 1UGPB 3LX7A 2PNIA 1KQSS 2DM1A 2ROTA 2YUPA 2VC8A 1K8AC 1O75A 4J9FA 5GAMg 4E7IA 1VYTA 1OZ2A 3OW2S 1TSFA 4OF1A 4ZGDB 3VYGA 4PFZA 1WHHA 4ELZC 3CCRA 4M77A 3OYCA 4RKUE 3ME9A 2GBQA 2ENMA 2VVKA 5IHIA 3GPLA 1UHCA 3D7SB 3CCQT 2XI9A 1ZUUA 1Z9QA 5D6YA 3KXTA 3M0UA 3OYHA 2LTOA 1M5Q1 2RI3A 2HCKA 1WZOA 1VQMT 3JSCA 4FT4A 2BIVA 3RERA 2PTKA 1A0NB 4J9EA 2DIGA 2PUKB 4N4IA 1LCKA 2DILA 2MYSA 4DQ2A 1TWBA 3C4SA 4A4EA 2K4YA 1M30A 2JTFA 2M9UA 4J9HA 2HL3A 2YDLA 1IRXA 4ZNXA 4DEXA 5IXFA 3ULRB 2DA9A 2QA4A 4LXCA 2AIRB 5GJVB 2XG8D 3QUIA 2K9GA 1JJ2A 1X43A 1J3TA 4XU3A 2C0TA 4Y92A 4WTOB 1OQKA 2CS7A 2BUDA 4DOVA 3EG3A 1NZ9A 1YJ9Q 2G3RA 2RD1A 2PQWA 1VQOQ 1PKTA 1WXUA 2OTLQ 3OMGA 3JV3A 4QVCA 1JXMA 2CP5A 4GLMA 2C0IA 1HXDA 5GAMf 4IUQA 4RTXA 3UDCA 4C92A 1VQ6Q 2P84A 1YJ9T 2ZPIB 1SRMA 2J6KA 3S3OA 5DLQE 1M2VA 3G71A 1UECA 2NUPB 4EIKA 3QWYA 2MWPA 1KC8U 2FEIA 4AFZC 4ZN1A 2KQWA 1OPLA 1RADB 2CZ7B 2VASA 2LT1A 2MI6A 4ZN3A 4MZTA 3E2UA 1YITQ 2DXBA 2B86A 5LJ5d 3RESA 2DD5A 1WX6A 2LT4A 2LJ3A 4FSXA 4OB1B 2V8KA 4KT0E 5GJWB 4NL3A 3QG1A 4HXJA 1YJWT 1R8OB 3NHNA 3M57A 2WACA 2HKNA 2YUOA 2D0QB 1N8RC 4C92F 2QQBA 2VV5A 3CCVQ 1B3QA 2FRWA 5A0LA 2K3XA 1WQWA 3EG2A 1KC8C 2CT3A 1EIFA 2O9SA 1SHFA 4C8QE 3RMQA 5LJ5f 1QVFP 4LD9K 1WDXA 2LJ1A 1YFNA 5GMKl 2KNBB 4XU2A 1GCQC 5FW9A 2E41A 4A4KA 4X1VA 3BY7A 1VQPT 1BK2A 2DPPB 1BI0A 3LW5E 3VRZA 2CZ6B 4M78C 4DBFA 2X9HA 3CCET 3VUZA 4FL6A 3JB9I 1S1NA 1CSKA 3PT9A 2RQTA 5GAMh 2J05A 3A98A 4HCBA 4X9DA 2QG9B 1P92A 1CKBA 3BDLA 1ZX6A 3G4ST 5I11A 3J80E 3E19A 3CC2T 4XU0A 4IUPA 2DMOA 1M1KC 2FL7A 4BY6C 5HK3A 4HCCA 2OTJT 1KSWA 2P0PA 2EJ9A 1MMAA 2KDSA 4CC2A 4M7DD 1AWWA 1VQOA 5CQXA 3Q1JA 2RO0A 3CCMA 1M8MA 1OU8A 2OTLA 3R6NA 1MUZA 2X4JA 2DL8A 1FWZA 3FEOA 5KYNA 5KYWB 3OY9A 2DBMA 4O6JA 4QQ6A 3PIOA 1AOJA 4LNPA 4ZGJB 4J5YA 1Q82R 3RNJA 4K11A 1I4K1 2E64A 1X6BA 4MZMA 2NUTA 1KFZA 1G8XA 4R0KA 1MNDA 1BYMA 2R58A 5CKDA 4F04B 1H8KA 1I1JA 1WHGA 2LQNA 2LCSA 3L42A 2CP2A 1K9MC 2OI3A 1D1AA 4O5VA 2DTHA 4JLIA 5GAMe 3OYMA 5AYFA 2OAUA 4M77D 5CCAA 1MMGA 1BBZA 1VQNT 4OGCA 1UGSB 3SB2A 1X27A 2HZYA 1Y07A 2DYBA 1WXBA 2KVQG 3ER0A 3LWHA 4FYYB 1D1CA 5KYWA 4PJOC 2JVVA 3VS3A 1M4ZA 1YHQT 3P8HA 3CCVA 4EPCA 1N6AA 3PFSA 4XK8E 1S72Q 1QVGA 1JXOA 2BE9B 2RHIA 3PVLA 3CMET 2D1XA 2A37A 3TSZA 1RAEB 2JM8A 2YRDA 4PJNA 1LJOA 1UJ0A 1ZQ1A 2ATCB 5CQYA 5GAN8 3URGA 5GAN3 3EGXA 2O31A 4M75A 4AFQC 3QPHA 1GXIE 2ZPHB 3REBB 1EX4A 2GF7A 2X4XA 3H41A 1W2BS 5KYYA 2A3LA 4BE0A 2ZAEA 3MP1A 5CR2A 5LJ5e 2CSIA 4RTWA 2QDLA 1GRIA 3THKA 2XDBA 1RL2A 4BY6B 1H641 2QEXT 4XTXA 1WIEA 2EJFA 3FRNA 5IN1A 3V7RA 4RTVA 2V26A 3P8BB 3CCSQ 1MNEA 1GCQA 5GAMj 3SWNB 2RI5A 2LQWA 3MO8A 3HFOA 2ED1A 3UF4A 1NBEB 5ECAA 4M78A 4C92D 3I56A 1RABB 5KYUB 2RHUA 4N0AC 4IUVA 5GAOn 1XQHA 5KCHA 3MKDA 3VS6A 1CKAA 4F7UG 2VGMA 4A54A 4M75F 1X01A 1Y96B 3A8LB 4A4GA 4E7JA 1YJNA 1WHJA 1KQSP 5I2MA 2YLBA 4JRKA 2HQXA 1U1TA 4D6WA 1SSFA 3S3MA 5HK0A 3OYKA 3JB9F 2RJFA 4XTYA 3OW2P 1LPLA 3CC4Q 3JCMV 2P0KA 1OX8A 1TS9A 1SKUB 2M16A 4AMCA 3X20B 4B9XA 1OOTA 2GQVA 3FJ5A 7AT1B 2KRNA 3VUBA 1I07A 4HT9A 4Y91A 1AD5A 1KD1U 1D1BA 1KK7A 1YBYA 4JDSA 1OULA 4PJOB 3TREA 1VIFA 4D8DA 4KULA 1VQ9T 4BD3A 2L3QA 2DRMA 2EYZA 4M75E 2JTMA 3JCMP 2O9VA 1C1AA 4M78F 2DJQA 3OYNA 3QYGB 4R55A 4QVDA 5FROA 4J9CA 5CVIA 1KIKA 3QWXX 2HSPA 3HL8A 2DX1A 3P8DA 2E65A 3CCUQ 1VQLT 1BKBA 2CGHA 3IQLA 2RN8A 2OAWA 1Q95G 1AT1B 2KROA 4M7AC 4OMOA 2PVGB 3CCRT 3TU4K 1K4US 2PUOB 2O4XB 3A8GB 1UDLA 1NM7A 5GAN4 4J9IA 4MMKA 1BI2A 1UGRB 5FWCA 3CPFA 1VQ4A 2BZYA 3GNGA 4Y28E 5J26A 2E5KA 4DOWA 3G6EQ 1XOVA 4C0DB 4IURA 2M1HA 2V8JA 1YIJT 1LOJA 2QAZA 3L2WA 1FX7A 1ZUYA 2QI2A 4FYXB 2ZPEB 4LDWA 1N9SA 3OYIA 3ZBDA 2YXYA 3H6ZA 1GCPA 3CMAA 5D7UA 2QA4Q 2LZ6B 5KE3A 1ZBJA 1KQ2A 1GL5A 4C0GA 4PLIA 2RQRA 3CD6A 2FZCB 5CAIA 3LGLA 1JJ2S 1M3BA 2E70A 1QLYA 5HY6A 1B34B 4XTWA 2GNCA 3EFRA 1SSHA 2W0ZA 3LYIA 3RKYA 3CC4A 3R6OA 2PU9B 3UA7A 2YRVA 2XDDA 1VQKT 2RA2A 1K9AA 4BI4A 1BCOA 1D3BB 4HKEA 1QCOA 1G2BA 1FMWA 4RCCA 2FG0A 1PKSA 2KT1A 1Q7YU 1IB8A 1SHGA 2ABLA 4DBHA 1K73U 4N0AA 1ZSZC 3L2QA 8AT1B 3JCMJ 4TVRA 3MP6A 3G71T 4C92G 4PK4A 3RKXA 1C0MA 2FRYA 2LQ8A 4UC4A 3NFCA 1GFDA 3OYEA 2DL7A 4E7SA 4IIMA 4E7ZA 2FHDA 1OEBA 1PG5B 3VS2A 2ZPFB 1X6OA 4M7AB 9ATCB 1B34A 2I0NA 1JRIA 3CCUA 2CP7A 3META 4M7DF 1VIEA 3SDZA 3EGDB 3LGFA 2KGTA 4F7UE 4GY5A 1D09B 1TG0A 1VOMA 2RPNA 2YSQA 4M75D 3VKIA 3GF5A 5GAOq 2FPEA 3TCJA 1KD1R 3V7SA 3JCMQ 1JBMA 2WSFE 2E4HA 3JB9D 4C8QB 2HAXA 2XD0A 4ZTJA 2HDAA 2L3PA 1W4SA 3RKWA 1K0SA 3G6EA 1Z9ZA 3U23A 2M02A 1NLPC 2DTIA 2QTXA 1R77A 1PD0A 3MEUA 2X35A 2XICA 1DJ7B 1O9SA 1HD3A 3GP8A 4M7DE 2EGCA 1UJYA 1QP2A 1Q82U 1RAHB 4PLLA 5LJ3g 4M77F 1Y0MA 2R5AA 4BB7A 5LJ5g 2LDMA 4M78D 3OYDA 1NJIU 4FW2A 1ZLMA 1QCFA 1UB4A 3I5SA 3N5BB 2CZ1B 5D6XA 2EQJA 3WVEB 2F5KA 5KYXB 1G3YA 3NPFA 3CCLQ 3QDFA 2KRMA 1JU5C 2DFUA 2L89A 4OMLA 1B07A 2E3IA 1KG1A 1UE9A 1Q86U 1VQ5A 3E9FA 2M0YA 2COWA 2FYKA 3QHSA 3CCMQ 3AHUA 4QQDA 2PZ1A 2DRKA 3VS0A 4KH1B 4M77E 1Q82C 2H3JA 2RQWA 5L8RE 1VQOT 2KSSA 2PVDB 3GOXA 1ZSZB 2OTLT 1VYUA 1TXQA 3PVQA 2K3BA 1T0JA 5I22A 1W70A 2EPDA 1VQ8A 1VQ6T 4QW2A 4BE2A 1E6HA 1X2KA 1LNXA 3INZA 3MHXA 3H9NA 4J7FA 2IIMA 5LJ3d 5IT9E 3NGPA 1VYVA 5A2QE 4WF2A 1PM3A 5AT1B 1VA7A 1M2OA 1QCNA 1PCXA 2R5MA 1YITT 4XTZA 1HYOA 1WHMA 4XTUA 1OU9A 2E12A 2XK0A 2KRSA 2RH2A 3OB9A 3CCQA 2QGFB 3MPUB 1PSFA 3JB9J 1VUBA 2DVEA 2RHYA 4M4ZA 2EYXA 1QVGS 4LD6A 4QKUA 1W2BP 2GTJA 1Q7YR 2CKKA 1K73R 4PJOD 2NUPA 3OYFA 5LJ3f 1R0CB 1QKXA 2R57A 1WFWA 4F17A 2ZCFB 1VQMA 2CSQA 3CCVT 1IO6A 3UATA 4CC4B 4JRQA 2O01E 4J9BA 2A28A 5GMKh 1OX9A 1OV3A 3E9GA 2Y90A 5KH6A 4J6YA 4EMKC 5I21A 4FIBA 2DEQA 2JUFA 2L3SA 4OB2B 3EG9B 3KUFA 4JJNK 1TOVA 2CH4W 2K7AA 4PL6A 2X4YA 3EH2A 2P4TA 4C92E 5FRNA 3OYAA 4BE1A 1I8FA 5KE2A 3OA6A 1M90U 1RLQC 4M75G 1FYNA 3CCLA 1SEMA 2MK5A 3GNFB 3O8VA 1Q81U 1MV0B 3LLRA 3ZFJA 1SRLA 2FZGB 3HRUA 3JB9G 4PKCC 1FMKA 4JUVA 1X69A 2J6OA 1G83A 2RJCA 4HCKA 1WJRA 2X51A 3GLXA 4CC3A 3SWNC 1QWFA 5J39A 3I56Q 4PJJA 3F70A 1N5ZA 1UGQB 3M0TA 2DK3A 1AVZC 3A8HB 3TVTA 4JRIA 2LRQA 1PSEA 2EYQA 3DKMA 3L1AA 3QZ5B 5DM7R 4E7HA 1YJNQ 1W1FA 1NJIR 5GMKe 4Z8AA 3CXCS 2QYZA 4CC7A 2LQKA 4M78G 2ZPBB 5KCOA 2K2VA 3V8JA 2DJZA 3M0SA 2QQRA 1YJNT 5GAN2 5LJ3h 2EYWA 2IPOB 4CI0C 5LJ5h 2RHZA 3VS7A 3VRYA 2YT6A 1W6XA 2JXBA 2DVJA 8ATCB 1Q86R 5CKFA 4HA8A 3DB4A 3PMTA 1QMCA 2EGEA 1M27C 2PVOB 3H0HA 2O88A 2CYZB 5GMKi 3PMIA 1YJWA 4KRTA 4QT7A 3T9NA 2D6FA 4J9DA 1XJWB 1V1CA 2D9TA 3CQTA 2DBKA 5HCKA 1XTDA 3JCMb 4JLGA 1M3CA 2KMTA 3X28B 4J6XA 4EMKB 2ROLA 1S72T 2EKHA 3M56A 3WXMB 3HTRA 4B6MA 3V8LA 1N8RR 2CDTA 4DEYA 2VYTA 1G3SA 3CCJQ 4C5GA 4OVAA 2NWMA 4J83A 3CCEA 1BI3A 1ACMB 2DL4A 2DLPA 2OJ2A 3HSBA 4E6RA 2CP6A 4OMFB 5LJ3e 1VQ4Q 3QIIA 1PD1A 1PNJA 1M1FA 3HPWA 2EKOA 5GMKj 2FPDA 1JJ2P 3G4SA 4YTLA 1QWEA 2COZA 2DYIA 2EIFA 2YWWA 1F1BB 4A53A 4E47A 2Z0WA 4C0DC 3RBBB 5GAN6 4JPBW 1T0HA 2RMOA 1G3TA 3OMCA 1QKWA 3DB3A 2K6DA 2HKQB 2D8JA 4EMKA 2KY9A 4JJDA 3CMAQ 3M5AA 3CCST 1NYGA 1YCSB 1N27A 3RIRA 1X75C 2E3HA 4C0FA 3CD6Q 3C94A 1I5OB 1M8VA 1K76A 3NTHA 2JM9A 4AFSC 2EQUA 3CC7Q 1NLOC 3H0FA 1EFNA 2RK1A 1E7OA 2ZGWA 3OS5A 3CXCA 2GFAA 2J06A 3I35A 1M90R 2EBPA 1WJQA 2GCXA 4JZ3A 3JB9H 2RQUA 3OSVA 1ZHIA 2A7YA 1Q81R 3UPUA 2L8DA 3S3NA 3BW1A 4FT2A 3CC4T 1HJDA 3M0QA 4L59A 4C5HA 3GBQA 2RJDA 3SWNA 4M7DG 1TUCA 4FYVB 2RJEA 1X6GA 3SFMA 1GFCA 4KGZB 2M0OA 5CKHA 3JCMg 3PIPA 1WI7A 2ECZA 5KYUA 3QJ6A 4JJCA 2NYSA 5LJ3j 5LJ5j 4JJBA 2GFUA 1WJSA 4JZ4A 2X3XD 3VJPA 1Y96A 3H8ZA 2EFIA 5C0MA 5J3BA 3A8MB 4V2SA 1I81A 4B9WA 3OS2A 2B8AA 4X9CA 1XNIA 3BFMA 3M0PA 4F7UB 4JS4A 3S6WA 3CBMA 3C12A 1EZZB 3CCJA 2DL3A 1KD1C 4E7KA 5GAOr 3CBPA 3CCUT 3V7CA 3BE3A 4M77G 3X24B 4M78E 2G6FX 4F16A 2LJ0A 3HRTA 2EQMA 4PJOA 1K1ZA 5M9OA 3FIFA 4XQ3A 1KHIA 2K3YA 4QQGA 3EG1A 5CO7A 3M9QA 1MHNA 4J9GA 2VKNA 4ESRA 3L2ZA 1C6VX 1TU0B 4RG8A 1RAGB
chains in the Genus database with same CATH topology
4PJOA 2E5QA 2K5IA 4M78C 3MP8A 3DLMA 3MEUA 2IG0A 2X35A 2XU8A 4FL6A 3VUZA 3JB9I 3CCET 2XICA 3OYGA 1DJ7B 1O9SA 3PT9A 3GP8A 1VQ4T 4M7DE 3JCMd 5IAYA 5GAMh 1QP2A 3CC2A 3QJYA 3JRZA 4RCBA 3G6ET 1Q82U 4PLLA 4HCBA 2X4WA 4X9DA 4M77F 4C0ZA 1QW1A 2R5AA 4BI8B 2HD0A 2YLCA 4BB7A 2EWNA 5CKEA 4C8QD 2DTOA 4PJOG 5LJ5g 2OTJA 1P92A 1QP3A 2LDMA 2XKOC 3BDLA 4M78D 4NL2A 2F5TX 4XAXB 4LDUA 1YCYA 5DM7R 3OYDA 2Y4XA 3G4ST 4JS5A 1NJIU 1QVFS 3J80E 4M7DC 2F69A 1UB4A 3N5BB 2CZ1B 3E19A 4LDXA 3FJPA 5D6XA 1MGQA 2EQJA 4XU0A 4A4HA 3WVEB 2F5KA 2DIQA 2L5QA 2K5FA 3CC2T 4IUPA 2DKGA 1G3WA 2DO3A 3OYLA 1G3YA 1M1KC 2FL7A 4BY6C 2DAQA 2O4XA 5HK3A 4HCCA 2OTJT 3CC7A 2P0PA 2EJ9A 2KDSA 2L89A 2XDPA 3QZ9B 4Q5WA 4RMOA 4N4HA 2QA4T 4M7DD 1VQOA 3CMAT 5CQXA 1U1SA 2RO0A 3M54A 3Q1JA 3CCMA 1Q86U 1VQ5A 1KG1A 2P0QA 2OTLA 3E9FA 2X4JA 2JNGA 3AHUA 2FYKA 3QHSA 1FWZA 3FEOA 4PJOF 2DD4A 4QQDA 3MCAB 3CD6T 3JCMf 3OY9A 3J7AF 3OBWA 2FVUA 1K8AU 4O6JA 4P5NA 4QQ6A 3PIOA 5EG2A 3CC7T 4HCZA 3FLGA 4M77E 4L6V5 2H3JA 1Q82C 4ZGJB 3UT1A 3HKSA 2ZZDA 4J5YA 2KSSA 2PVDB 3EFSA 2DXCA 4MMLA 5L8RE 3GOXA 2OTLT 5FU6B 3OBYA 4FU6A 5GAOl 1I4K1 2E64A 4EMGA 4ZTFA 4MZMA 3LWIA 1RI0A 3UWNA 1OI1A 1VQ8A 2EAYA 2R58A 5FU7B 2BKDN 1VQ6T 1BYMA 5CKDA 3L2VA 4QW2A 4M77C 4BE2A 3L42A 1K9MC 1VQNA 1LNXA 3INZA 4Z02A 3MHXA 3M53A 4J7FA 3MEWA 4O5VA 4N4GA 2WSCE 2DTHA 4JLIA 1V29B 4X34A 5AYFA 5LJ3d 5GAMe 2JN0A 3A8OB 5GANd 5IT9E 4BACA 2OAUA 3RUXA 4M77D 5CCAA 4FM4B 5A2QE 1YHQA 2K57A 4PJOE 4WF2A 1VQNT 4OGCA 3CEYA 1UGSB 2HNIA 3OS1A 2FB7A 4MDWA 3SB2A 3ZEHA 3C95A 4QVZA 5CKBA 1Y07A 3JCMW 1YITT 2R5MA 1N9RA 4XTZA 4E7LA 2KVQG 4XU1A 2RHXA 3ER0A 3QBYA 3LWHA 3PNWC 4XTUA 3OSSC 5GAN7 3CMEA 3DLLA 4OP0A 1U8RA 3E1SA 4PJOC 2E12A 2L3RA 2XK0A 2JVVA 2RH2A 3OB9A 1M4ZA 3CCQA 1YHQT 3A5ZB 3P8HA 1VQLA 3OYMA 1S72A 3CCVA 1PSFA 1N6AA 4EPCA 3JB9J 3PFSA 1VUBA 2DVEA 4XK8E 2RHYA 2DXUA 1QVGA 1QVGS 4LD6A 4IUUA 1D3BA 1Q7YC 2RHIA 1K73C 2CKKA 2NLUA 1NPPA 3QDRB 1VQOT 2Y4YA 4PJOD 3CMET 3OYJA 4HT8A 2QQ9A 3OYFA 5LJ3f 2E1HA 2JOYA 2R57A 2LC4A 5GANf 3PTAA 1LJOA 4OGEA 2ZCFB 1VQMA 1ZQ1A 4NS5A 3M4YA 4CRIA 2LCLA 3CCVT 4JRQA 1G5VA 5CQYA 5GAN8 2RI2A 3JCMX 1QVPA 2O01E 3URGA 5GAN3 5GMKh 5HKCA 1WNLA 3E9GA 1H3ZA 2Y90A 5DY9A 5KH6A 4M75A 1I5LA 4J6YA 4EMKC 5I21A 4FIBA 4BUGA 2DEQA 1OZ3A 3M55A 2JUFA 3QKJA 2CZ0B 2QEXA 3QPHA 4OB2B 1YIJA 1GXIE 1IREB 3KUFA 2ZPHB 3I55A 3JCMh 4JJNK 3L2RA 2GF7A 2QDYB 2X4XA 3CPWS 3CPWA 4LDYA 2MMPA 1W2BS 1W2BA 2C06A 2A3LA 2DZ9A 4PL6A 2X4YA 4BE0A 1YI2A 2P4TA 5LL6S 5CR2A 2RM4A 3MP1A 4M7AA 4C92E 1KHCA 5LJ5e 4R56A 5FRNA 4C92B 3OYAA 2LVMA 2XDBA 1RL2A 2AHJB 2E6ZA 4BY6B 4IKFA 4BE1A 1QVFA 1I8FA 1H641 2QEXT 4KBMB 5KE2A 3OA6A 5GAN5 3I55T 1M90U 2RB6A 4XTXA 4M75G 4F7UA 2EJFA 3FRNA 1M9SA 3CCLA 1YI2T 2YHTA 3ASKA 5IN1A 4C92C 3GNFB 3O8VA 2EJGA 1Q81U 4EDUA 3CCSA 3V7RA 3LLRA 5GAMd 3FB9A 3P8BB 3J81E 3ZFJA 5GAMj 3SWNB 2RI5A 3MO8A 3EAEA 5GAOp 3HRUA 3HFOA 3JB9G 4PKCC 3FDRA 3M4GA 4JUVA 4M7AG 1NPRA 2RJCA 1Y71A 4C8QA 1WJRA 2QXFA 2V8IA 4JRIA 4M78A 4C92D 3I56A 3CCLT 3GLXA 4E7HA 1ZBXA 2RHUA 4ME7A 3SWNC 4N0AC 5J39A 4IUVA 2WSEE 5GAOn 1XQHA 5KCHA 2DZCA 2QQAA 2QQSA 4F7UG 2VGMA 4A54A 5FLXE 3L2UA 3F70A 3HFNA 1VQKA 3QO3A 3CBOA 4M75F 4M77B 1X01A 4OB3B 1UGQB 3CCMT 1VQ5T 2DK3A 1Y96B 3A8LB 2LNVA 2MAMA 1WPYA 3KBGA 3QYHB 3A8HB 4A4GA 4E7JA 5I2MA 2YLBA 2LRQA 1PSEA 2EYQA 2XHCA 3DKMA 3L1AA 3NTKA 2HQXA 3QZ5B 4JRKA 1U1TA 4BDYA 1FXXA 4D6WA 1NJIC 1BIAA 4M7DA 5GMKe 1SSFA 2KK4A 2MF2A 4J6WA 3S3MA 5HK0A 3CXCS 3OYKA 4C8QG 3JB9F 1VQ7A 2RJFA 2K5LA 4XTYA 2LQKA 4M78G 4M7AF 2ZPBB 5KCOA 1BI1A 2K2VA 4L5GA 3JCMV 5GMKm 2P0KA 3V8JA 2DJZA 2QQRA 1VQ9A 4ATOA 3GIBA 3JCMe 1YJNT 5GAN2 1NE8A 2M16A 5LJ3h 2RK2A 5GANh 4CI0C 5LJ5h 3X20B 4GLKA 2HBPA 2RHZA 3OYBA 4B9XA 3NTIA 4F7UF 1N8RU 2GQVA 1VQ8T 4RG2A 4HT9A 4XTVA 3VUBA 4BI3A 4Y91A 1Q86C 3X26B 1KD1U 1VQ7T 5CKFA 1YBYA 4JDSA 4EMHA 4HA8A 3DB4A 3JCMc 3PMTA 4PJOB 3TREA 1UGPB 1Y7XA 3LX7A 1KQSA 1KQSS 1VIFA 4KULA 1VQ9T 1BI0A 2PVOB 4BD3A 2VC8A 1K8AC 1O75A 2CYZB 4M75E 2JTMA 3VV0A 5GMKi 5GAMg 4C8QF 4E7IA 3JCMP 1WQ7A 3PMIA 4M78F 1YJWA 1OZ2A 2VUBA 3OW2A 3OYNA 3OW2S 3QYGB 4OF1A 3V8KA 3T9NA 3VYGA 4ZGDB 2D6FA 4R55A 4QVDA 5FROA 5CVIA 2D9TA 4ELZC 3SD4A 3CCRA 4M77A 4M75C 5C6SA 4M7AE 1XTDA 3JCMb 3OYCA 4MZPA 2LX9A 4RKUE 3ME9A 4II1A 3HL8A 4JLGA 3GPLA 2KMTA 3P8DA 3CCQT 3X28B 2E65A 2XI9A 4J6XA 3VYHB 4EMKB 1BKBA 2CGHA 1S72T 1VQLT 4LDVA 3TEEA 3M56A 3WXMB 5D6YA 3KXTA 4M7AC 3OYHA 2PVGB 4RG8A 3V8LA 5LJ3g 3CCRT 3TU4K 1BIBA 2LTOA 2PUOB 1M5Q1 3G7ZA 2XIDA 2EQKA 3MEVA 2VYTA 3WVDB 1G3SA 2O4XB 3A8GB 2RI3A 4C5GA 3HHTB 1OYXA 5GAN4 4OVAA 4MMKA 1BI2A 1VQMT 3HP9A 3JSCA 1UGRB 1M1KU 4J83A 3CCEA 1BI3A 1UEBA 2VGNA 5GAOm 4FT4A 4VUBA 3CPFA 3VU3C 2HQEA 1WGSA 1VQ4A 2BIVA 3HSBA 4OMFB 3RERA 5LJ3e 3OS0A 2I2LA 5GANe 3M58A 3GNGA 4Y28E 5J26A 3QIIA 4DOWA 2DIGA 2PUKB 5CK9A 1XOVA 1M1FA 4C0DB 4IURA 3HPWA 2EKOA 2M1HA 4N4IA 2V8JA 4J7IA 5GMKj 2E6NA 1YIJT 3M59A 3HRSA 3G4SA 1LOJA 4YTLA 2EIFA 4PNOA 3L2WA 2DXTA 4C5IA 4A53A 4E47A 4C0DC 4DQ2A 3C4SA 1FX7A 2QI2A 4A4EA 2ZPGB 2K4YA 5GAN6 3QSUA 2JTFA 2M9UA 2ZPEB 1G3TA 4LDWA 1N9SA 4KUIA 3OYIA 3ZBDA 3JAME 3OMCA 3DB3A 2IVWA 3H6ZA 2QA4A 3CMAA 4EMKA 2KY9A 4M7DB 5A0DA 5KE3A 1K9MU 3M5AA 5D6WA 3CCST 1KQ2A 2XG8D 2MWOA 4OB0B 4A4FA 1N27A 4C0GA 4PLIA 5A0GA 4KUDK 3CD6A 3RIRA 1X75C 3QUIA 5CAIA 2VXEA 3LGLA 5CIUA 4C0FA 1JJ2S 1JJ2A 3C94A 5DLOA 1M8VA 4XU3A 4ELYC 3NTHA 2E70A 1YJ9A 2CS7A 2EQUA 5HY6A 4JRPA 2BUDA 1B34B 4DOVA 4XTWA 3I56T 1NZ9A 3EFRA 2E10A 2RK1A 2G3RA 2RD1A 2PQWA 4ZGEB 5GANg 4BDZA 2ZGWA 3LYIA 3OMGA 3OS5A 3RKYA 4QVCA 3RMSA 3CXCA 3CC4A 3R6OA 2GFAA 2PU9B 1M90C 1VQ6A 2YRVA 1HXDA 5GAMf 1WJQA 2GCXA 3PGGA 4IUQA 3UDCA 4C92A 2RA2A 2XDDA 5I2SA 1VQKT 3JB9H 4NOYA 3OSVA 1Q81C 4BI4A 1ZHIA 2A7YA 1AHJB 1YJ9T 2ZPIB 3UPUA 3OYYA 1D3BB 3S3OA 5DLQE 2L8DA 3G71A 3S3NA 4HKEA 3BW1A 4FT2A 3X25B 4RCCA 3CC4T 2MWPA 4L59A 1Q7YU 4C5HA 1KC8U 3SWNA 2RJDA 1K73U 1JB0E 4N0AA 4M7DG 3L2QA 3JCMJ 5FU6C 2RJEA 4TVRA 4ZN1A 3SFMA 2KQWA 3MP6A 2M0OA 5CKHA 2CZ7B 3JCMg 2JZ2A 3G71T 4C5EA 2LT1A 4C92G 3PIPA 4M75B 1YITA 5FU7C 1YJNA 3RKXA 2MI6A 4ZN3A 4MZTA 3QJ6A 2DXBA 5LJ5d 5LJ3j 2LQ8A 4UC4A 3RESA 5GANj 3NFCA 2DD5A 5LJ5j 3OYEA 2GFUA 1WJSA 2LT4A 3LH0A 4FSXA 2FHDA 2V8KA 4OB1B 2ZPFB 3VJPA 1X6OA 1Y96A 1HK9A 3H8ZA 4KT0E 2EFIA 4M7AB 1IZ6A 5C0MA 4MDXA 1B34A 3OQ5A 4NL3A 3QG1A 5J3BA 1JRIA 3CCUA 1YJWT 1R8OB 3A8MB 3META 1I81A 4M7DF 4B9WA 1VIEA 3OS2A 4V2SA 2B8AA 2VXFA 4X9CA 3M57A 3SDZA 1XNIA 3LGFA 4F7UE 2WACA 3BFMA 4GY5A 4F7UB 2D0QB 4IUTA 4JS4A 4M75D 3S6WA 3VKIA 1N8RC 3CBMA 3GF5A 4C92F 2QQBA 3C12A 3CCJA 2VV5A 3BDUA 3TCJA 5GAOq 4E7KA 1KD1C 5GAOr 4DA4A 3V7SA 5A0LA 3JCMQ 2K3XA 1WQWA 1VQPA 3CBPA 2LCCA 1KC8C 3CCUT 3V7CA 1JBMA 4M77G 3FC3A 2WSFE 1EIFA 3JB9D 3X24B 4C8QE 1TH7A 3RMQA 4M78E 4C8QB 2HAXA 5FRMA 5LJ5f 4M7AD 2KAFA 2EQMA 3HRTA 4M78B 4LD9K 4ZTJA 5M9OA 3FIFA 1KQ1A 5GMKl 2XD0A 3QXEB 4XU2A 1W4SA 4XQ3A 3RKWA 1KHIA 2E41A 4A4KA 3CCJT 3G6EA 2K3YA 4QQGA 5CO7A 3M9QA 1M1GA 1MHNA 3BY7A 1VQPT 2DPPB 3L2ZA 2DTIA 2QTXA 3LW5E 4J8OA 2CZ6B 3MEAA 4C8QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN 2;  5LJ3 h;  4M78 C;  5GAN h;  3JB9 J;  2DVE A;  5LJ5 h;  3RIR A;  3QUI A;  2DXU A;  5CAI A;  2VXE A;  4F7U F;  3JCM e;  3JB9 I;  4HT9 A;  1D3B A;  4XTV A;  4XU3 A;  4M7D E;  4Y91 A;  1M8V A;  3JCM d;  5GAM h;  4RCB A;  4EMH A;  4HA8 A;  4PJO D;  3JCM c;  4PJO B;  1B34 B;  4HT8 A;  5LJ3 g;  4X9D A;  4M77 F;  4XTW A;  5GAN g;  3EFR A;  2E10 A;  2YLC A;  2E1H A;  2EWN A;  2RD1 A;  5LJ3 f;  2DTO A;  4PJO G;  4C8Q D;  1LJO A;  5LJ5 g;  5GAN f;  4M78 D;  4NL2 A;  2ZGW A;  4M7D C;  3RKY A;  2VC8 A;  4QVC A;  1YCY A;  4M75 E;  5GAM g;  5GMK i;  4C8Q F;  5GAN 8;  1HXD A;  3JCM X;  5GAM f;  1WQ7 A;  3JCM P;  3PGG A;  4C92 A;  4M78 F;  5GAN 3;  2RA2 A;  5GMK h;  3JB9 H;  1WNL A;  4NOY A;  3V8K A;  3FJP A;  2Y90 A;  1MGQ A;  5DY9 A;  4XU0 A;  4M75 A;  4QVD A;  1I5L A;  4J6Y A;  2DKG A;  1D3B B;  4EMK C;  5I21 A;  2DEQ A;  3BW1 A;  4M77 A;  4M75 C;  4RCC A;  4M7A E;  3JCM h;  2EJ9 A;  3JCM b;  4M7D D;  4M7D B;  2DZ9 A;  1U1S A;  3SWN A;  4M7D G;  4N0A A;  2RM4 A;  4M7A A;  3JCM J;  4C92 E;  3AHU A;  2FYK A;  2E65 A;  3QHS A;  5LJ5 e;  4J6X A;  4EMK B;  2CGH A;  4PJO F;  4C92 B;  3JCM g;  3JCM f;  1I8F A;  4C92 G;  1H64 1;  4M7A C;  4M75 B;  3V8L A;  3RKX A;  1BIB A;  5GAN 5;  2RB6 A;  4XTX A;  4M75 G;  1M5Q 1;  5LJ5 d;  4F7U A;  5LJ3 j;  4M77 E;  3RES A;  2EJF A;  5GAN j;  5LJ5 j;  4J5Y A;  2YHT A;  3EFS A;  4MML A;  4C92 C;  2EJG A;  5GAN 4;  3V7R A;  5GAM d;  3FB9 A;  5GAO l;  1I4K 1;  2E64 A;  4EMG A;  4MMK A;  5GAM j;  3SWN B;  1Y96 A;  1HK9 A;  5GAO p;  4M7A B;  2EAY A;  3HFO A;  5GAO m;  3JB9 G;  1B34 A;  4NL3 A;  3M4G A;  4JUV A;  3VU3 C;  3HSB A;  4M77 C;  4M7A G;  1JRI A;  3RER A;  5LJ3 e;  2I2L A;  4C8Q A;  1LNX A;  1I81 A;  3INZ A;  5GAN e;  4M7D F;  4V2S A;  2VXF A;  4M78 A;  4X9C A;  4C92 D;  4F7U E;  3SWN C;  3BFM A;  4N0A C;  4F7U B;  4M75 D;  5GMK j;  5GAO n;  2DTH A;  4JLI A;  5GAM e;  2DZC A;  5LJ3 d;  4C92 F;  2JN0 A;  4F7U G;  5GAN d;  1LOJ A;  4A54 A;  3BDU A;  5GAO q;  4PNO A;  3HFN A;  5GAO r;  3RUX A;  3QO3 A;  4M77 D;  2DXT A;  4M75 F;  1X01 A;  4M77 B;  3V7S A;  1WQW A;  4A53 A;  3JCM Q;  4DQ2 A;  1Y96 B;  2K57 A;  3V7C A;  1JBM A;  1WPY A;  4M77 G;  4WF2 A;  4PJO E;  2HNI A;  2YLB A;  4JRI A;  2FB7 A;  3L1A A;  4JRK A;  3SB2 A;  5GAN 6;  4C8Q E;  3JB9 D;  1U1T A;  3QSU A;  1TH7 A;  1BIA A;  4M78 E;  4C8Q B;  5GMK e;  3JCM W;  5LJ5 f;  4J6W A;  1N9S A;  4M7D A;  4M7A D;  4PJO A;  4M78 B;  1N9R A;  4XTZ A;  3FIF A;  1KQ1 A;  5GMK l;  4XU2 A;  4XU1 A;  3RKW A;  4XQ3 A;  4C8Q G;  3JB9 F;  2E41 A;  4XTY A;  4M78 G;  4XTU A;  5GAN 7;  4M7A F;  4OP0 A;  4EMK A;  5GMK m;  3JCM V;  4PJO C;  3BY7 A;  3V8J A;  2DJZ A;  3L2Z A;  2DTI A;  2QTX A;  1KQ2 A;  3GIB A;  4C8Q C; 
#chains in the Genus database with same CATH topology
 2E5Q A;  2XU8 A;  2DNU A;  3OYG A;  4Z88 A;  3JCM d;  3M0R A;  3G6E T;  3I55 Q;  5GAN g;  2HD0 A;  1YI2 Q;  2DTO A;  2XKO C;  4NL2 A;  2F5T X;  1IHV A;  3EFO B;  1YCY A;  4LDU A;  2X3W D;  2MOX A;  4LE9 A;  5FWB A;  1R0B G;  4LDX A;  3FJP A;  3REA B;  1MGQ A;  1T3S A;  2MCN A;  2DIQ A;  2L5Q A;  2K5F A;  2DKG A;  1G3W A;  2DO3 A;  3OYL A;  2DAQ A;  2O4X A;  3H0I A;  3TQ7 P;  2AKK A;  3CC7 A;  2XDP A;  4Q5W A;  3QZ9 B;  4RMO A;  2QA4 T;  4N4H A;  1U1S A;  2KEA A;  2JNG A;  1VQ5 Q;  2J7I A;  4PJO F;  1RAA B;  3JCM f;  3J7A F;  1JO8 A;  1K8A U;  4P5N A;  1V76 A;  2F2X A;  4L6V 5;  2LX7 A;  2AZV A;  3UT1 A;  2ZZD A;  3EFS A;  4MML A;  1H3H A;  2F1L A;  3OBY A;  4FU6 A;  3VS4 A;  1OPK A;  2QK0 A;  3LWI A;  3O5Z A;  1OI1 A;  2EAY A;  5IH2 A;  4AFU C;  2F2V A;  1VQ8 Q;  4Z02 A;  1VQ7 Q;  3EFO A;  3MEW A;  1UTI A;  2EYY A;  2HQH A;  4N4G A;  2WSC E;  1QVG P;  4X34 A;  1V29 B;  3A8O B;  5GAN d;  4LUE A;  1RI9 A;  2K57 A;  4PJO E;  2FB7 A;  4MDW A;  3ZEH A;  1WLP B;  3JCM W;  2DET A;  2QGG A;  4E7L A;  1YWO A;  3C0C A;  2BTT A;  4LN2 A;  5GAN 7;  1U8R A;  1AZG B;  3E1S A;  2L3R A;  1E6G A;  1VQL A;  2H3E B;  3CCQ Q;  1UG1 A;  2DXU A;  4IUU A;  6AT1 B;  2LNH B;  1D3B A;  1Q7Y C;  2KYB A;  1K73 C;  1NPP A;  1IGU A;  2V1R A;  4HT8 A;  2QQ9 A;  1WXT A;  2E1H A;  2YRC A;  5GAN f;  3PTA A;  1PRL C;  4OGE A;  4NS5 A;  4CRI A;  2LCL A;  1IGQ A;  4PFO A;  1VQM Q;  1WHL A;  1QVP A;  3JCM X;  4BUG A;  4Z89 A;  1OZ3 A;  2CZ0 B;  2DF6 A;  1YIJ A;  2NUZ A;  3I55 A;  3JCM h;  3L2R A;  2QDY B;  3CPW A;  2C06 A;  4LDY A;  1YI2 A;  2RNA A;  4M7A A;  4R56 A;  4C92 B;  2LVM A;  3EHR A;  2E6Z A;  3EGD A;  4KBM B;  1BU1 A;  1M2V B;  3ASK A;  1TTH B;  5GAM d;  3J81 E;  3CXC P;  2GTO A;  1YP5 A;  2JTE A;  2YUQ A;  5GAO p;  3FDR A;  1NPR A;  1Y71 A;  4RTY A;  4C8Q A;  2V8I A;  1IXD A;  4A63 B;  3CCL T;  1ZBX A;  2L2P A;  2JS0 A;  4AT1 B;  2JT4 A;  2QQS A;  2AKL A;  1VQK A;  3QO3 A;  3CBO A;  1PRM C;  3CCM T;  4LUD A;  3EH1 A;  2LNV A;  3QYH B;  2MPX C;  4C5I A;  3NTK A;  1NJI C;  5L23 A;  1FXX A;  2KK4 A;  2MF2 A;  2GGR A;  4KGX B;  2D8H A;  1VQ7 A;  4PJL A;  2KXC A;  4M7A F;  1BI1 A;  4L5G A;  4DBQ A;  4C8Q C;  4ATO A;  3GIB A;  1NG2 A;  3JCM e;  5GAN h;  4GLK A;  2HBP A;  3OYB A;  1N8R U;  3NTI A;  4RG2 A;  3LH5 A;  5KYX A;  1Q86 C;  2KT8 A;  1YWP A;  1H92 A;  3KFV A;  3JCM c;  1Y7X A;  1KQS A;  2FO0 A;  1ABQ A;  4RTT A;  2C0O A;  1K8A R;  3VV0 A;  4C8Q F;  1WQ7 A;  2JS2 A;  2VUB A;  3OW2 A;  3V8K A;  5IHN A;  1YJW Q;  2A08 A;  1YN8 A;  3SD4 A;  4M75 C;  5C6S A;  4M7A E;  1ZSZ A;  2A0F B;  4MZP A;  2LX9 A;  4HVW A;  4II1 A;  4OMM A;  2O2O A;  4E2F B;  2LP5 A;  3VYH B;  4LDV A;  3TEE A;  4DBR A;  2KI7 A;  1B7T A;  1ZA1 B;  4RTZ A;  1BIB A;  3MEV A;  3G7Z A;  3ZL7 C;  2XID A;  2EQK A;  3WVD B;  3HHT B;  1OYX A;  1GBR A;  1VQP Q;  2KBT A;  3HP9 A;  1M1K U;  1UEB A;  2CUB A;  1AEY A;  2VGN A;  5GAO m;  4VUB A;  1U5S A;  3VU3 C;  2HQE A;  1WGS A;  3CCE Q;  4FSS A;  3OS0 A;  2I2L A;  5GAN e;  3M58 A;  1D0Y A;  5CK9 A;  1AWJ A;  4J7I A;  2E6N A;  3M59 A;  3HRS A;  5IHK A;  4PNO A;  3G4S Q;  2DXT A;  2NUT B;  1WHK A;  2ZPG B;  3CC2 Q;  3RDV A;  3QSU A;  3I5R A;  4KUI A;  2ED0 A;  4ORZ A;  3JAM E;  4PJM A;  1BB9 A;  2IVW A;  2OTJ Q;  3A1P A;  5A0D A;  1KJW A;  4F14 A;  1K9M U;  5D6W A;  1JEG A;  2MWO A;  4OB0 B;  4A4F A;  4FCY A;  5A0G A;  4KUD K;  2BE7 D;  2VXE A;  5CIU A;  2F2W A;  5EC7 A;  5DLO A;  4ELY C;  1X2Q A;  1YJ9 A;  3EG9 A;  4JRP A;  2CRE A;  2HMA A;  3I56 T;  2E10 A;  4ZGE B;  4BDZ A;  3RMS A;  1M90 C;  2AK5 A;  1VQ6 A;  2YUN A;  3PGG A;  5I2S A;  4NOY A;  1Q81 C;  4ANJ A;  2K2M A;  1AHJ B;  1RAC B;  3OYY A;  2V1Q A;  2QAS A;  2J6F A;  2CP0 A;  4OMQ A;  3X25 B;  1RAI B;  1JB0 E;  1MMD A;  5FU6 C;  2BZX A;  2CUD A;  1VQN Q;  3EGX B;  2JZ2 A;  4C5E A;  1YIT A;  4M75 B;  5FU7 C;  3SHW A;  2KYM A;  1SPK A;  5GAN j;  1MV3 A;  3LH0 A;  2RF0 A;  5KYY B;  1YHQ Q;  1SG5 A;  1BCM A;  4MDX A;  1HK9 A;  1IZ6 A;  3OQ5 A;  2VXF A;  2HBW A;  3CME Q;  1JQQ A;  4IUT A;  3VS5 A;  3BDU A;  3CPW P;  4DA4 A;  1VQP A;  2LCC A;  1KC8 R;  2KXD A;  3FC3 A;  1M3A A;  1NEG A;  1TH7 A;  3EGU A;  4M7A D;  5FRM A;  4WCI A;  2KAF A;  4M78 B;  1KQ1 A;  4AG1 C;  3QXE B;  2FPF A;  2L0A A;  3CCJ T;  1LVK A;  4KH0 B;  2COY A;  1M1G A;  3EG0 A;  4J8O A;  3MEA A;  2K5I A;  1AWO A;  3MP8 A;  2VWF A;  3DLM A;  2IG0 A;  1AWX A;  1VQ4 T;  2QEX Q;  5IAY A;  2JW4 A;  3CC2 A;  3QJY A;  3JRZ A;  4RCB A;  2EGA A;  2X4W A;  4C0Z A;  1QW1 A;  4BI8 B;  2YLC A;  2EWN A;  5CKE A;  4C8Q D;  4PJO G;  2FZK B;  2OTJ A;  1QP3 A;  4XAX B;  4JS5 A;  2Y4X A;  3EHQ A;  1QVF S;  4M7D C;  2F69 A;  2CH4 A;  1T3L A;  1FMV A;  4A4H A;  2DER A;  1NEB A;  2SRC A;  2KE9 A;  1M1K R;  2SEM A;  2EVR A;  1ZUK A;  3CMA T;  1SF9 A;  3M54 A;  2P0Q A;  1U3O A;  1NYF A;  1ARK A;  2DD4 A;  3MCA B;  1IHW A;  3CD6 T;  1TUG B;  3OBW A;  2FVU A;  2HEQ A;  5EG2 A;  1UUE A;  4HCZ A;  3FLG A;  2ESW A;  3CC7 T;  3UA6 A;  1MMN A;  3HKS A;  2DXC A;  2JJ9 A;  5FU6 B;  1WYX A;  5GAO l;  4EMG A;  4ZTF A;  2CT4 A;  1RI0 A;  1PC0 A;  2JMA A;  3UWN A;  5FU7 B;  2BKD N;  2VB6 A;  3L2V A;  3VS1 A;  4M77 C;  2M51 A;  3G1J A;  1VQN A;  3PE0 A;  1K9M R;  3M53 A;  1UGV A;  3AT1 B;  1U06 A;  2JN0 A;  1VQ9 Q;  4BAC A;  2EW3 A;  4HVV A;  1WA7 A;  3RUX A;  4FM4 B;  2JMC A;  1YHQ A;  3CEY A;  2HNI A;  3OS1 A;  3C95 A;  4QVZ A;  5CKB A;  4GBQ A;  1N9R A;  2DEU A;  4XU1 A;  2AZS A;  2RHX A;  3QBY A;  3PNW C;  1Y57 A;  3OSS C;  3CME A;  3DLL A;  2P4R A;  4OP0 A;  2XMF A;  3A5Z B;  1UFF A;  1S72 A;  1ZA2 B;  1VQL Q;  1ABO A;  4RTU A;  2NLU A;  3QDR B;  3CCR Q;  1TUD A;  2Y4Y A;  3OYJ A;  2OX7 A;  2JOY A;  2LC4 A;  4KGV B;  2RQV A;  3M4Y A;  1G5V A;  1QQJ A;  2RI2 A;  5HKC A;  1WNL A;  4FYW B;  1H3Z A;  5DY9 A;  1I5L A;  1PWT A;  3M55 A;  3QKJ A;  2CP3 A;  2QEX A;  4FW1 A;  1IRE B;  2EQI A;  1UHF A;  1YIJ Q;  3CPW S;  1W2B A;  4M7D B;  2MMP A;  2DZ9 A;  5LL6 S;  2RM4 A;  4D8K A;  1YNZ A;  1KHC A;  1HSQ A;  1K0X A;  1QVF A;  2AHJ B;  4IKF A;  2DE0 X;  1RLP C;  5GAN 5;  3I55 T;  2RB6 A;  4F7U A;  2BZ8 A;  1M9S A;  1YI2 T;  2YHT A;  4C92 C;  2QTV A;  2EJG A;  2MIO A;  4EDU A;  3CCS A;  2HL5 C;  2K79 A;  3FB9 A;  4AG2 C;  1I0C A;  2D0N A;  1D0Z A;  3EAE A;  4OMP A;  2AT1 B;  1AZE A;  3M4G A;  3RR6 A;  2GQI A;  4M7A G;  4HVU A;  2QXF A;  4ME7 A;  1ZSG A;  2WSE E;  3NMZ C;  1RUW A;  2DZC A;  2QQA A;  3SEM A;  5FLX E;  3L2U A;  3HFN A;  4M77 B;  4OB3 B;  1VQ5 T;  2H8H A;  1VQK Q;  3KBG A;  2MAM A;  1WPY A;  2XHC A;  1PHT A;  4BDY A;  1BIA A;  4M7D A;  4J6W A;  4IIO A;  2HSE B;  4C8Q G;  2K5L A;  1D0X A;  5GMK m;  3TSW A;  1VQ9 A;  2W10 A;  2A36 A;  1NE8 A;  2RK2 A;  4OMN A;  3MJX A;  3I9Q A;  5IXB A;  1RAF B;  4F7U F;  1VQ8 T;  2DL5 A;  2KR3 A;  4XTV A;  4BI3 A;  3G71 Q;  3X26 B;  4RUG A;  4PFP A;  1VQ7 T;  1GBQ A;  4EMH A;  2LMJ A;  1UGP B;  3LX7 A;  2PNI A;  1KQS S;  2DM1 A;  2ROT A;  2YUP A;  2VC8 A;  1K8A C;  1O75 A;  4J9F A;  5GAM g;  4E7I A;  1VYT A;  1OZ2 A;  3OW2 S;  1TSF A;  4OF1 A;  4ZGD B;  3VYG A;  4PFZ A;  1WHH A;  4ELZ C;  3CCR A;  4M77 A;  3OYC A;  4RKU E;  3ME9 A;  2GBQ A;  2ENM A;  2VVK A;  5IHI A;  3GPL A;  1UHC A;  3D7S B;  3CCQ T;  2XI9 A;  1ZUU A;  1Z9Q A;  5D6Y A;  3KXT A;  3M0U A;  3OYH A;  2LTO A;  1M5Q 1;  2RI3 A;  2HCK A;  1WZO A;  1VQM T;  3JSC A;  4FT4 A;  2BIV A;  3RER A;  2PTK A;  1A0N B;  4J9E A;  2DIG A;  2PUK B;  4N4I A;  1LCK A;  2DIL A;  2MYS A;  4DQ2 A;  1TWB A;  3C4S A;  4A4E A;  2K4Y A;  1M30 A;  2JTF A;  2M9U A;  4J9H A;  2HL3 A;  2YDL A;  1IRX A;  4ZNX A;  4DEX A;  5IXF A;  3ULR B;  2DA9 A;  2QA4 A;  4LXC A;  2AIR B;  5GJV B;  2XG8 D;  3QUI A;  2K9G A;  1JJ2 A;  1X43 A;  1J3T A;  4XU3 A;  2C0T A;  4Y92 A;  4WTO B;  1OQK A;  2CS7 A;  2BUD A;  4DOV A;  3EG3 A;  1NZ9 A;  1YJ9 Q;  2G3R A;  2RD1 A;  2PQW A;  1VQO Q;  1PKT A;  1WXU A;  2OTL Q;  3OMG A;  3JV3 A;  4QVC A;  1JXM A;  2CP5 A;  4GLM A;  2C0I A;  1HXD A;  5GAM f;  4IUQ A;  4RTX A;  3UDC A;  4C92 A;  1VQ6 Q;  2P84 A;  1YJ9 T;  2ZPI B;  1SRM A;  2J6K A;  3S3O A;  5DLQ E;  1M2V A;  3G71 A;  1UEC A;  2NUP B;  4EIK A;  3QWY A;  2MWP A;  1KC8 U;  2FEI A;  4AFZ C;  4ZN1 A;  2KQW A;  1OPL A;  1RAD B;  2CZ7 B;  2VAS A;  2LT1 A;  2MI6 A;  4ZN3 A;  4MZT A;  3E2U A;  1YIT Q;  2DXB A;  2B86 A;  5LJ5 d;  3RES A;  2DD5 A;  1WX6 A;  2LT4 A;  2LJ3 A;  4FSX A;  4OB1 B;  2V8K A;  4KT0 E;  5GJW B;  4NL3 A;  3QG1 A;  4HXJ A;  1YJW T;  1R8O B;  3NHN A;  3M57 A;  2WAC A;  2HKN A;  2YUO A;  2D0Q B;  1N8R C;  4C92 F;  2QQB A;  2VV5 A;  3CCV Q;  1B3Q A;  2FRW A;  5A0L A;  2K3X A;  1WQW A;  3EG2 A;  1KC8 C;  2CT3 A;  1EIF A;  2O9S A;  1SHF A;  4C8Q E;  3RMQ A;  5LJ5 f;  1QVF P;  4LD9 K;  1WDX A;  2LJ1 A;  1YFN A;  5GMK l;  2KNB B;  4XU2 A;  1GCQ C;  5FW9 A;  2E41 A;  4A4K A;  4X1V A;  3BY7 A;  1VQP T;  1BK2 A;  2DPP B;  1BI0 A;  3LW5 E;  3VRZ A;  2CZ6 B;  4M78 C;  4DBF A;  2X9H A;  3CCE T;  3VUZ A;  4FL6 A;  3JB9 I;  1S1N A;  1CSK A;  3PT9 A;  2RQT A;  5GAM h;  2J05 A;  3A98 A;  4HCB A;  4X9D A;  2QG9 B;  1P92 A;  1CKB A;  3BDL A;  1ZX6 A;  3G4S T;  5I11 A;  3J80 E;  3E19 A;  3CC2 T;  4XU0 A;  4IUP A;  2DMO A;  1M1K C;  2FL7 A;  4BY6 C;  5HK3 A;  4HCC A;  2OTJ T;  1KSW A;  2P0P A;  2EJ9 A;  1MMA A;  2KDS A;  4CC2 A;  4M7D D;  1AWW A;  1VQO A;  5CQX A;  3Q1J A;  2RO0 A;  3CCM A;  1M8M A;  1OU8 A;  2OTL A;  3R6N A;  1MUZ A;  2X4J A;  2DL8 A;  1FWZ A;  3FEO A;  5KYN A;  5KYW B;  3OY9 A;  2DBM A;  4O6J A;  4QQ6 A;  3PIO A;  1AOJ A;  4LNP A;  4ZGJ B;  4J5Y A;  1Q82 R;  3RNJ A;  4K11 A;  1I4K 1;  2E64 A;  1X6B A;  4MZM A;  2NUT A;  1KFZ A;  1G8X A;  4R0K A;  1MND A;  1BYM A;  2R58 A;  5CKD A;  4F04 B;  1H8K A;  1I1J A;  1WHG A;  2LQN A;  2LCS A;  3L42 A;  2CP2 A;  1K9M C;  2OI3 A;  1D1A A;  4O5V A;  2DTH A;  4JLI A;  5GAM e;  3OYM A;  5AYF A;  2OAU A;  4M77 D;  5CCA A;  1MMG A;  1BBZ A;  1VQN T;  4OGC A;  1UGS B;  3SB2 A;  1X27 A;  2HZY A;  1Y07 A;  2DYB A;  1WXB A;  2KVQ G;  3ER0 A;  3LWH A;  4FYY B;  1D1C A;  5KYW A;  4PJO C;  2JVV A;  3VS3 A;  1M4Z A;  1YHQ T;  3P8H A;  3CCV A;  4EPC A;  1N6A A;  3PFS A;  4XK8 E;  1S72 Q;  1QVG A;  1JXO A;  2BE9 B;  2RHI A;  3PVL A;  3CME T;  2D1X A;  2A37 A;  3TSZ A;  1RAE B;  2JM8 A;  2YRD A;  4PJN A;  1LJO A;  1UJ0 A;  1ZQ1 A;  2ATC B;  5CQY A;  5GAN 8;  3URG A;  5GAN 3;  3EGX A;  2O31 A;  4M75 A;  4AFQ C;  3QPH A;  1GXI E;  2ZPH B;  3REB B;  1EX4 A;  2GF7 A;  2X4X A;  3H41 A;  1W2B S;  5KYY A;  2A3L A;  4BE0 A;  2ZAE A;  3MP1 A;  5CR2 A;  5LJ5 e;  2CSI A;  4RTW A;  2QDL A;  1GRI A;  3THK A;  2XDB A;  1RL2 A;  4BY6 B;  1H64 1;  2QEX T;  4XTX A;  1WIE A;  2EJF A;  3FRN A;  5IN1 A;  3V7R A;  4RTV A;  2V26 A;  3P8B B;  3CCS Q;  1MNE A;  1GCQ A;  5GAM j;  3SWN B;  2RI5 A;  2LQW A;  3MO8 A;  3HFO A;  2ED1 A;  3UF4 A;  1NBE B;  5ECA A;  4M78 A;  4C92 D;  3I56 A;  1RAB B;  5KYU B;  2RHU A;  4N0A C;  4IUV A;  5GAO n;  1XQH A;  5KCH A;  3MKD A;  3VS6 A;  1CKA A;  4F7U G;  2VGM A;  4A54 A;  4M75 F;  1X01 A;  1Y96 B;  3A8L B;  4A4G A;  4E7J A;  1YJN A;  1WHJ A;  1KQS P;  5I2M A;  2YLB A;  4JRK A;  2HQX A;  1U1T A;  4D6W A;  1SSF A;  3S3M A;  5HK0 A;  3OYK A;  3JB9 F;  2RJF A;  4XTY A;  3OW2 P;  1LPL A;  3CC4 Q;  3JCM V;  2P0K A;  1OX8 A;  1TS9 A;  1SKU B;  2M16 A;  4AMC A;  3X20 B;  4B9X A;  1OOT A;  2GQV A;  3FJ5 A;  7AT1 B;  2KRN A;  3VUB A;  1I07 A;  4HT9 A;  4Y91 A;  1AD5 A;  1KD1 U;  1D1B A;  1KK7 A;  1YBY A;  4JDS A;  1OUL A;  4PJO B;  3TRE A;  1VIF A;  4D8D A;  4KUL A;  1VQ9 T;  4BD3 A;  2L3Q A;  2DRM A;  2EYZ A;  4M75 E;  2JTM A;  3JCM P;  2O9V A;  1C1A A;  4M78 F;  2DJQ A;  3OYN A;  3QYG B;  4R55 A;  4QVD A;  5FRO A;  4J9C A;  5CVI A;  1KIK A;  3QWX X;  2HSP A;  3HL8 A;  2DX1 A;  3P8D A;  2E65 A;  3CCU Q;  1VQL T;  1BKB A;  2CGH A;  3IQL A;  2RN8 A;  2OAW A;  1Q95 G;  1AT1 B;  2KRO A;  4M7A C;  4OMO A;  2PVG B;  3CCR T;  3TU4 K;  1K4U S;  2PUO B;  2O4X B;  3A8G B;  1UDL A;  1NM7 A;  5GAN 4;  4J9I A;  4MMK A;  1BI2 A;  1UGR B;  5FWC A;  3CPF A;  1VQ4 A;  2BZY A;  3GNG A;  4Y28 E;  5J26 A;  2E5K A;  4DOW A;  3G6E Q;  1XOV A;  4C0D B;  4IUR A;  2M1H A;  2V8J A;  1YIJ T;  1LOJ A;  2QAZ A;  3L2W A;  1FX7 A;  1ZUY A;  2QI2 A;  4FYX B;  2ZPE B;  4LDW A;  1N9S A;  3OYI A;  3ZBD A;  2YXY A;  3H6Z A;  1GCP A;  3CMA A;  5D7U A;  2QA4 Q;  2LZ6 B;  5KE3 A;  1ZBJ A;  1KQ2 A;  1GL5 A;  4C0G A;  4PLI A;  2RQR A;  3CD6 A;  2FZC B;  5CAI A;  3LGL A;  1JJ2 S;  1M3B A;  2E70 A;  1QLY A;  5HY6 A;  1B34 B;  4XTW A;  2GNC A;  3EFR A;  1SSH A;  2W0Z A;  3LYI A;  3RKY A;  3CC4 A;  3R6O A;  2PU9 B;  3UA7 A;  2YRV A;  2XDD A;  1VQK T;  2RA2 A;  1K9A A;  4BI4 A;  1BCO A;  1D3B B;  4HKE A;  1QCO A;  1G2B A;  1FMW A;  4RCC A;  2FG0 A;  1PKS A;  2KT1 A;  1Q7Y U;  1IB8 A;  1SHG A;  2ABL A;  4DBH A;  1K73 U;  4N0A A;  1ZSZ C;  3L2Q A;  8AT1 B;  3JCM J;  4TVR A;  3MP6 A;  3G71 T;  4C92 G;  4PK4 A;  3RKX A;  1C0M A;  2FRY A;  2LQ8 A;  4UC4 A;  3NFC A;  1GFD A;  3OYE A;  2DL7 A;  4E7S A;  4IIM A;  4E7Z A;  2FHD A;  1OEB A;  1PG5 B;  3VS2 A;  2ZPF B;  1X6O A;  4M7A B;  9ATC B;  1B34 A;  2I0N A;  1JRI A;  3CCU A;  2CP7 A;  3MET A;  4M7D F;  1VIE A;  3SDZ A;  3EGD B;  3LGF A;  2KGT A;  4F7U E;  4GY5 A;  1D09 B;  1TG0 A;  1VOM A;  2RPN A;  2YSQ A;  4M75 D;  3VKI A;  3GF5 A;  5GAO q;  2FPE A;  3TCJ A;  1KD1 R;  3V7S A;  3JCM Q;  1JBM A;  2WSF E;  2E4H A;  3JB9 D;  4C8Q B;  2HAX A;  2XD0 A;  4ZTJ A;  2HDA A;  2L3P A;  1W4S A;  3RKW A;  1K0S A;  3G6E A;  1Z9Z A;  3U23 A;  2M02 A;  1NLP C;  2DTI A;  2QTX A;  1R77 A;  1PD0 A;  3MEU A;  2X35 A;  2XIC A;  1DJ7 B;  1O9S A;  1HD3 A;  3GP8 A;  4M7D E;  2EGC A;  1UJY A;  1QP2 A;  1Q82 U;  1RAH B;  4PLL A;  5LJ3 g;  4M77 F;  1Y0M A;  2R5A A;  4BB7 A;  5LJ5 g;  2LDM A;  4M78 D;  3OYD A;  1NJI U;  4FW2 A;  1ZLM A;  1QCF A;  1UB4 A;  3I5S A;  3N5B B;  2CZ1 B;  5D6X A;  2EQJ A;  3WVE B;  2F5K A;  5KYX B;  1G3Y A;  3NPF A;  3CCL Q;  3QDF A;  2KRM A;  1JU5 C;  2DFU A;  2L89 A;  4OML A;  1B07 A;  2E3I A;  1KG1 A;  1UE9 A;  1Q86 U;  1VQ5 A;  3E9F A;  2M0Y A;  2COW A;  2FYK A;  3QHS A;  3CCM Q;  3AHU A;  4QQD A;  2PZ1 A;  2DRK A;  3VS0 A;  4KH1 B;  4M77 E;  1Q82 C;  2H3J A;  2RQW A;  5L8R E;  1VQO T;  2KSS A;  2PVD B;  3GOX A;  1ZSZ B;  2OTL T;  1VYU A;  1TXQ A;  3PVQ A;  2K3B A;  1T0J A;  5I22 A;  1W70 A;  2EPD A;  1VQ8 A;  1VQ6 T;  4QW2 A;  4BE2 A;  1E6H A;  1X2K A;  1LNX A;  3INZ A;  3MHX A;  3H9N A;  4J7F A;  2IIM A;  5LJ3 d;  5IT9 E;  3NGP A;  1VYV A;  5A2Q E;  4WF2 A;  1PM3 A;  5AT1 B;  1VA7 A;  1M2O A;  1QCN A;  1PCX A;  2R5M A;  1YIT T;  4XTZ A;  1HYO A;  1WHM A;  4XTU A;  1OU9 A;  2E12 A;  2XK0 A;  2KRS A;  2RH2 A;  3OB9 A;  3CCQ A;  2QGF B;  3MPU B;  1PSF A;  3JB9 J;  1VUB A;  2DVE A;  2RHY A;  4M4Z A;  2EYX A;  1QVG S;  4LD6 A;  4QKU A;  1W2B P;  2GTJ A;  1Q7Y R;  2CKK A;  1K73 R;  4PJO D;  2NUP A;  3OYF A;  5LJ3 f;  1R0C B;  1QKX A;  2R57 A;  1WFW A;  4F17 A;  2ZCF B;  1VQM A;  2CSQ A;  3CCV T;  1IO6 A;  3UAT A;  4CC4 B;  4JRQ A;  2O01 E;  4J9B A;  2A28 A;  5GMK h;  1OX9 A;  1OV3 A;  3E9G A;  2Y90 A;  5KH6 A;  4J6Y A;  4EMK C;  5I21 A;  4FIB A;  2DEQ A;  2JUF A;  2L3S A;  4OB2 B;  3EG9 B;  3KUF A;  4JJN K;  1TOV A;  2CH4 W;  2K7A A;  4PL6 A;  2X4Y A;  3EH2 A;  2P4T A;  4C92 E;  5FRN A;  3OYA A;  4BE1 A;  1I8F A;  5KE2 A;  3OA6 A;  1M90 U;  1RLQ C;  4M75 G;  1FYN A;  3CCL A;  1SEM A;  2MK5 A;  3GNF B;  3O8V A;  1Q81 U;  1MV0 B;  3LLR A;  3ZFJ A;  1SRL A;  2FZG B;  3HRU A;  3JB9 G;  4PKC C;  1FMK A;  4JUV A;  1X69 A;  2J6O A;  1G83 A;  2RJC A;  4HCK A;  1WJR A;  2X51 A;  3GLX A;  4CC3 A;  3SWN C;  1QWF A;  5J39 A;  3I56 Q;  4PJJ A;  3F70 A;  1N5Z A;  1UGQ B;  3M0T A;  2DK3 A;  1AVZ C;  3A8H B;  3TVT A;  4JRI A;  2LRQ A;  1PSE A;  2EYQ A;  3DKM A;  3L1A A;  3QZ5 B;  5DM7 R;  4E7H A;  1YJN Q;  1W1F A;  1NJI R;  5GMK e;  4Z8A A;  3CXC S;  2QYZ A;  4CC7 A;  2LQK A;  4M78 G;  2ZPB B;  5KCO A;  2K2V A;  3V8J A;  2DJZ A;  3M0S A;  2QQR A;  1YJN T;  5GAN 2;  5LJ3 h;  2EYW A;  2IPO B;  4CI0 C;  5LJ5 h;  2RHZ A;  3VS7 A;  3VRY A;  2YT6 A;  1W6X A;  2JXB A;  2DVJ A;  8ATC B;  1Q86 R;  5CKF A;  4HA8 A;  3DB4 A;  3PMT A;  1QMC A;  2EGE A;  1M27 C;  2PVO B;  3H0H A;  2O88 A;  2CYZ B;  5GMK i;  3PMI A;  1YJW A;  4KRT A;  4QT7 A;  3T9N A;  2D6F A;  4J9D A;  1XJW B;  1V1C A;  2D9T A;  3CQT A;  2DBK A;  5HCK A;  1XTD A;  3JCM b;  4JLG A;  1M3C A;  2KMT A;  3X28 B;  4J6X A;  4EMK B;  2ROL A;  1S72 T;  2EKH A;  3M56 A;  3WXM B;  3HTR A;  4B6M A;  3V8L A;  1N8R R;  2CDT A;  4DEY A;  2VYT A;  1G3S A;  3CCJ Q;  4C5G A;  4OVA A;  2NWM A;  4J83 A;  3CCE A;  1BI3 A;  1ACM B;  2DL4 A;  2DLP A;  2OJ2 A;  3HSB A;  4E6R A;  2CP6 A;  4OMF B;  5LJ3 e;  1VQ4 Q;  3QII A;  1PD1 A;  1PNJ A;  1M1F A;  3HPW A;  2EKO A;  5GMK j;  2FPD A;  1JJ2 P;  3G4S A;  4YTL A;  1QWE A;  2COZ A;  2DYI A;  2EIF A;  2YWW A;  1F1B B;  4A53 A;  4E47 A;  2Z0W A;  4C0D C;  3RBB B;  5GAN 6;  4JPB W;  1T0H A;  2RMO A;  1G3T A;  3OMC A;  1QKW A;  3DB3 A;  2K6D A;  2HKQ B;  2D8J A;  4EMK A;  2KY9 A;  4JJD A;  3CMA Q;  3M5A A;  3CCS T;  1NYG A;  1YCS B;  1N27 A;  3RIR A;  1X75 C;  2E3H A;  4C0F A;  3CD6 Q;  3C94 A;  1I5O B;  1M8V A;  1K76 A;  3NTH A;  2JM9 A;  4AFS C;  2EQU A;  3CC7 Q;  1NLO C;  3H0F A;  1EFN A;  2RK1 A;  1E7O A;  2ZGW A;  3OS5 A;  3CXC A;  2GFA A;  2J06 A;  3I35 A;  1M90 R;  2EBP A;  1WJQ A;  2GCX A;  4JZ3 A;  3JB9 H;  2RQU A;  3OSV A;  1ZHI A;  2A7Y A;  1Q81 R;  3UPU A;  2L8D A;  3S3N A;  3BW1 A;  4FT2 A;  3CC4 T;  1HJD A;  3M0Q A;  4L59 A;  4C5H A;  3GBQ A;  2RJD A;  3SWN A;  4M7D G;  1TUC A;  4FYV B;  2RJE A;  1X6G A;  3SFM A;  1GFC A;  4KGZ B;  2M0O A;  5CKH A;  3JCM g;  3PIP A;  1WI7 A;  2ECZ A;  5KYU A;  3QJ6 A;  4JJC A;  2NYS A;  5LJ3 j;  5LJ5 j;  4JJB A;  2GFU A;  1WJS A;  4JZ4 A;  2X3X D;  3VJP A;  1Y96 A;  3H8Z A;  2EFI A;  5C0M A;  5J3B A;  3A8M B;  4V2S A;  1I81 A;  4B9W A;  3OS2 A;  2B8A A;  4X9C A;  1XNI A;  3BFM A;  3M0P A;  4F7U B;  4JS4 A;  3S6W A;  3CBM A;  3C12 A;  1EZZ B;  3CCJ A;  2DL3 A;  1KD1 C;  4E7K A;  5GAO r;  3CBP A;  3CCU T;  3V7C A;  3BE3 A;  4M77 G;  3X24 B;  4M78 E;  2G6F X;  4F16 A;  2LJ0 A;  3HRT A;  2EQM A;  4PJO A;  1K1Z A;  5M9O A;  3FIF A;  4XQ3 A;  1KHI A;  2K3Y A;  4QQG A;  3EG1 A;  5CO7 A;  3M9Q A;  1MHN A;  4J9G A;  2VKN A;  4ESR A;  3L2Z A;  1C6V X;  1TU0 B;  4RG8 A;  1RAG B; 
#chains in the Genus database with same CATH homology
 4PJO A;  2E5Q A;  2K5I A;  4M78 C;  3MP8 A;  3DLM A;  3MEU A;  2IG0 A;  2X35 A;  2XU8 A;  4FL6 A;  3VUZ A;  3JB9 I;  3CCE T;  2XIC A;  3OYG A;  1DJ7 B;  1O9S A;  3PT9 A;  3GP8 A;  1VQ4 T;  4M7D E;  3JCM d;  5IAY A;  5GAM h;  1QP2 A;  3CC2 A;  3QJY A;  3JRZ A;  4RCB A;  3G6E T;  1Q82 U;  4PLL A;  4HCB A;  2X4W A;  4X9D A;  4M77 F;  4C0Z A;  1QW1 A;  2R5A A;  4BI8 B;  2HD0 A;  2YLC A;  4BB7 A;  2EWN A;  5CKE A;  4C8Q D;  2DTO A;  4PJO G;  5LJ5 g;  2OTJ A;  1P92 A;  1QP3 A;  2LDM A;  2XKO C;  3BDL A;  4M78 D;  4NL2 A;  2F5T X;  4XAX B;  4LDU A;  1YCY A;  5DM7 R;  3OYD A;  2Y4X A;  3G4S T;  4JS5 A;  1NJI U;  1QVF S;  3J80 E;  4M7D C;  2F69 A;  1UB4 A;  3N5B B;  2CZ1 B;  3E19 A;  4LDX A;  3FJP A;  5D6X A;  1MGQ A;  2EQJ A;  4XU0 A;  4A4H A;  3WVE B;  2F5K A;  2DIQ A;  2L5Q A;  2K5F A;  3CC2 T;  4IUP A;  2DKG A;  1G3W A;  2DO3 A;  3OYL A;  1G3Y A;  1M1K C;  2FL7 A;  4BY6 C;  2DAQ A;  2O4X A;  5HK3 A;  4HCC A;  2OTJ T;  3CC7 A;  2P0P A;  2EJ9 A;  2KDS A;  2L89 A;  2XDP A;  3QZ9 B;  4Q5W A;  4RMO A;  4N4H A;  2QA4 T;  4M7D D;  1VQO A;  3CMA T;  5CQX A;  1U1S A;  2RO0 A;  3M54 A;  3Q1J A;  3CCM A;  1Q86 U;  1VQ5 A;  1KG1 A;  2P0Q A;  2OTL A;  3E9F A;  2X4J A;  2JNG A;  3AHU A;  2FYK A;  3QHS A;  1FWZ A;  3FEO A;  4PJO F;  2DD4 A;  4QQD A;  3MCA B;  3CD6 T;  3JCM f;  3OY9 A;  3J7A F;  3OBW A;  2FVU A;  1K8A U;  4O6J A;  4P5N A;  4QQ6 A;  3PIO A;  5EG2 A;  3CC7 T;  4HCZ A;  3FLG A;  4M77 E;  4L6V 5;  2H3J A;  1Q82 C;  4ZGJ B;  3UT1 A;  3HKS A;  2ZZD A;  4J5Y A;  2KSS A;  2PVD B;  3EFS A;  2DXC A;  4MML A;  5L8R E;  3GOX A;  2OTL T;  5FU6 B;  3OBY A;  4FU6 A;  5GAO l;  1I4K 1;  2E64 A;  4EMG A;  4ZTF A;  4MZM A;  3LWI A;  1RI0 A;  3UWN A;  1OI1 A;  1VQ8 A;  2EAY A;  2R58 A;  5FU7 B;  2BKD N;  1VQ6 T;  1BYM A;  5CKD A;  3L2V A;  4QW2 A;  4M77 C;  4BE2 A;  3L42 A;  1K9M C;  1VQN A;  1LNX A;  3INZ A;  4Z02 A;  3MHX A;  3M53 A;  4J7F A;  3MEW A;  4O5V A;  4N4G A;  2WSC E;  2DTH A;  4JLI A;  1V29 B;  4X34 A;  5AYF A;  5LJ3 d;  5GAM e;  2JN0 A;  3A8O B;  5GAN d;  5IT9 E;  4BAC A;  2OAU A;  3RUX A;  4M77 D;  5CCA A;  4FM4 B;  5A2Q E;  1YHQ A;  2K57 A;  4PJO E;  4WF2 A;  1VQN T;  4OGC A;  3CEY A;  1UGS B;  2HNI A;  3OS1 A;  2FB7 A;  4MDW A;  3SB2 A;  3ZEH A;  3C95 A;  4QVZ A;  5CKB A;  1Y07 A;  3JCM W;  1YIT T;  2R5M A;  1N9R A;  4XTZ A;  4E7L A;  2KVQ G;  4XU1 A;  2RHX A;  3ER0 A;  3QBY A;  3LWH A;  3PNW C;  4XTU A;  3OSS C;  5GAN 7;  3CME A;  3DLL A;  4OP0 A;  1U8R A;  3E1S A;  4PJO C;  2E12 A;  2L3R A;  2XK0 A;  2JVV A;  2RH2 A;  3OB9 A;  1M4Z A;  3CCQ A;  1YHQ T;  3A5Z B;  3P8H A;  1VQL A;  3OYM A;  1S72 A;  3CCV A;  1PSF A;  1N6A A;  4EPC A;  3JB9 J;  3PFS A;  1VUB A;  2DVE A;  4XK8 E;  2RHY A;  2DXU A;  1QVG A;  1QVG S;  4LD6 A;  4IUU A;  1D3B A;  1Q7Y C;  2RHI A;  1K73 C;  2CKK A;  2NLU A;  1NPP A;  3QDR B;  1VQO T;  2Y4Y A;  4PJO D;  3CME T;  3OYJ A;  4HT8 A;  2QQ9 A;  3OYF A;  5LJ3 f;  2E1H A;  2JOY A;  2R57 A;  2LC4 A;  5GAN f;  3PTA A;  1LJO A;  4OGE A;  2ZCF B;  1VQM A;  1ZQ1 A;  4NS5 A;  3M4Y A;  4CRI A;  2LCL A;  3CCV T;  4JRQ A;  1G5V A;  5CQY A;  5GAN 8;  2RI2 A;  3JCM X;  1QVP A;  2O01 E;  3URG A;  5GAN 3;  5GMK h;  5HKC A;  1WNL A;  3E9G A;  1H3Z A;  2Y90 A;  5DY9 A;  5KH6 A;  4M75 A;  1I5L A;  4J6Y A;  4EMK C;  5I21 A;  4FIB A;  4BUG A;  2DEQ A;  1OZ3 A;  3M55 A;  2JUF A;  3QKJ A;  2CZ0 B;  2QEX A;  3QPH A;  4OB2 B;  1YIJ A;  1GXI E;  1IRE B;  3KUF A;  2ZPH B;  3I55 A;  3JCM h;  4JJN K;  3L2R A;  2GF7 A;  2QDY B;  2X4X A;  3CPW S;  3CPW A;  4LDY A;  2MMP A;  1W2B S;  1W2B A;  2C06 A;  2A3L A;  2DZ9 A;  4PL6 A;  2X4Y A;  4BE0 A;  1YI2 A;  2P4T A;  5LL6 S;  5CR2 A;  2RM4 A;  3MP1 A;  4M7A A;  4C92 E;  1KHC A;  5LJ5 e;  4R56 A;  5FRN A;  4C92 B;  3OYA A;  2LVM A;  2XDB A;  1RL2 A;  2AHJ B;  2E6Z A;  4BY6 B;  4IKF A;  4BE1 A;  1QVF A;  1I8F A;  1H64 1;  2QEX T;  4KBM B;  5KE2 A;  3OA6 A;  5GAN 5;  3I55 T;  1M90 U;  2RB6 A;  4XTX A;  4M75 G;  4F7U A;  2EJF A;  3FRN A;  1M9S A;  3CCL A;  1YI2 T;  2YHT A;  3ASK A;  5IN1 A;  4C92 C;  3GNF B;  3O8V A;  2EJG A;  1Q81 U;  4EDU A;  3CCS A;  3V7R A;  3LLR A;  5GAM d;  3FB9 A;  3P8B B;  3J81 E;  3ZFJ A;  5GAM j;  3SWN B;  2RI5 A;  3MO8 A;  3EAE A;  5GAO p;  3HRU A;  3HFO A;  3JB9 G;  4PKC C;  3FDR A;  3M4G A;  4JUV A;  4M7A G;  1NPR A;  2RJC A;  1Y71 A;  4C8Q A;  1WJR A;  2QXF A;  2V8I A;  4JRI A;  4M78 A;  4C92 D;  3I56 A;  3CCL T;  3GLX A;  4E7H A;  1ZBX A;  2RHU A;  4ME7 A;  3SWN C;  4N0A C;  5J39 A;  4IUV A;  2WSE E;  5GAO n;  1XQH A;  5KCH A;  2DZC A;  2QQA A;  2QQS A;  4F7U G;  2VGM A;  4A54 A;  5FLX E;  3L2U A;  3F70 A;  3HFN A;  1VQK A;  3QO3 A;  3CBO A;  4M75 F;  4M77 B;  1X01 A;  4OB3 B;  1UGQ B;  3CCM T;  1VQ5 T;  2DK3 A;  1Y96 B;  3A8L B;  2LNV A;  2MAM A;  1WPY A;  3KBG A;  3QYH B;  3A8H B;  4A4G A;  4E7J A;  5I2M A;  2YLB A;  2LRQ A;  1PSE A;  2EYQ A;  2XHC A;  3DKM A;  3L1A A;  3NTK A;  2HQX A;  3QZ5 B;  4JRK A;  1U1T A;  4BDY A;  1FXX A;  4D6W A;  1NJI C;  1BIA A;  4M7D A;  5GMK e;  1SSF A;  2KK4 A;  2MF2 A;  4J6W A;  3S3M A;  5HK0 A;  3CXC S;  3OYK A;  4C8Q G;  3JB9 F;  1VQ7 A;  2RJF A;  2K5L A;  4XTY A;  2LQK A;  4M78 G;  4M7A F;  2ZPB B;  5KCO A;  1BI1 A;  2K2V A;  4L5G A;  3JCM V;  5GMK m;  2P0K A;  3V8J A;  2DJZ A;  2QQR A;  1VQ9 A;  4ATO A;  3GIB A;  3JCM e;  1YJN T;  5GAN 2;  1NE8 A;  2M16 A;  5LJ3 h;  2RK2 A;  5GAN h;  4CI0 C;  5LJ5 h;  3X20 B;  4GLK A;  2HBP A;  2RHZ A;  3OYB A;  4B9X A;  3NTI A;  4F7U F;  1N8R U;  2GQV A;  1VQ8 T;  4RG2 A;  4HT9 A;  4XTV A;  3VUB A;  4BI3 A;  4Y91 A;  1Q86 C;  3X26 B;  1KD1 U;  1VQ7 T;  5CKF A;  1YBY A;  4JDS A;  4EMH A;  4HA8 A;  3DB4 A;  3JCM c;  3PMT A;  4PJO B;  3TRE A;  1UGP B;  1Y7X A;  3LX7 A;  1KQS A;  1KQS S;  1VIF A;  4KUL A;  1VQ9 T;  1BI0 A;  2PVO B;  4BD3 A;  2VC8 A;  1K8A C;  1O75 A;  2CYZ B;  4M75 E;  2JTM A;  3VV0 A;  5GMK i;  5GAM g;  4C8Q F;  4E7I A;  3JCM P;  1WQ7 A;  3PMI A;  4M78 F;  1YJW A;  1OZ2 A;  2VUB A;  3OW2 A;  3OYN A;  3OW2 S;  3QYG B;  4OF1 A;  3V8K A;  3T9N A;  3VYG A;  4ZGD B;  2D6F A;  4R55 A;  4QVD A;  5FRO A;  5CVI A;  2D9T A;  4ELZ C;  3SD4 A;  3CCR A;  4M77 A;  4M75 C;  5C6S A;  4M7A E;  1XTD A;  3JCM b;  3OYC A;  4MZP A;  2LX9 A;  4RKU E;  3ME9 A;  4II1 A;  3HL8 A;  4JLG A;  3GPL A;  2KMT A;  3P8D A;  3CCQ T;  3X28 B;  2E65 A;  2XI9 A;  4J6X A;  3VYH B;  4EMK B;  1BKB A;  2CGH A;  1S72 T;  1VQL T;  4LDV A;  3TEE A;  3M56 A;  3WXM B;  5D6Y A;  3KXT A;  4M7A C;  3OYH A;  2PVG B;  4RG8 A;  3V8L A;  5LJ3 g;  3CCR T;  3TU4 K;  1BIB A;  2LTO A;  2PUO B;  1M5Q 1;  3G7Z A;  2XID A;  2EQK A;  3MEV A;  2VYT A;  3WVD B;  1G3S A;  2O4X B;  3A8G B;  2RI3 A;  4C5G A;  3HHT B;  1OYX A;  5GAN 4;  4OVA A;  4MMK A;  1BI2 A;  1VQM T;  3HP9 A;  3JSC A;  1UGR B;  1M1K U;  4J83 A;  3CCE A;  1BI3 A;  1UEB A;  2VGN A;  5GAO m;  4FT4 A;  4VUB A;  3CPF A;  3VU3 C;  2HQE A;  1WGS A;  1VQ4 A;  2BIV A;  3HSB A;  4OMF B;  3RER A;  5LJ3 e;  3OS0 A;  2I2L A;  5GAN e;  3M58 A;  3GNG A;  4Y28 E;  5J26 A;  3QII A;  4DOW A;  2DIG A;  2PUK B;  5CK9 A;  1XOV A;  1M1F A;  4C0D B;  4IUR A;  3HPW A;  2EKO A;  2M1H A;  4N4I A;  2V8J A;  4J7I A;  5GMK j;  2E6N A;  1YIJ T;  3M59 A;  3HRS A;  3G4S A;  1LOJ A;  4YTL A;  2EIF A;  4PNO A;  3L2W A;  2DXT A;  4C5I A;  4A53 A;  4E47 A;  4C0D C;  4DQ2 A;  3C4S A;  1FX7 A;  2QI2 A;  4A4E A;  2ZPG B;  2K4Y A;  5GAN 6;  3QSU A;  2JTF A;  2M9U A;  2ZPE B;  1G3T A;  4LDW A;  1N9S A;  4KUI A;  3OYI A;  3ZBD A;  3JAM E;  3OMC A;  3DB3 A;  2IVW A;  3H6Z A;  2QA4 A;  3CMA A;  4EMK A;  2KY9 A;  4M7D B;  5A0D A;  5KE3 A;  1K9M U;  3M5A A;  5D6W A;  3CCS T;  1KQ2 A;  2XG8 D;  2MWO A;  4OB0 B;  4A4F A;  1N27 A;  4C0G A;  4PLI A;  5A0G A;  4KUD K;  3CD6 A;  3RIR A;  1X75 C;  3QUI A;  5CAI A;  2VXE A;  3LGL A;  5CIU A;  4C0F A;  1JJ2 S;  1JJ2 A;  3C94 A;  5DLO A;  1M8V A;  4XU3 A;  4ELY C;  3NTH A;  2E70 A;  1YJ9 A;  2CS7 A;  2EQU A;  5HY6 A;  4JRP A;  2BUD A;  1B34 B;  4DOV A;  4XTW A;  3I56 T;  1NZ9 A;  3EFR A;  2E10 A;  2RK1 A;  2G3R A;  2RD1 A;  2PQW A;  4ZGE B;  5GAN g;  4BDZ A;  2ZGW A;  3LYI A;  3OMG A;  3OS5 A;  3RKY A;  4QVC A;  3RMS A;  3CXC A;  3CC4 A;  3R6O A;  2GFA A;  2PU9 B;  1M90 C;  1VQ6 A;  2YRV A;  1HXD A;  5GAM f;  1WJQ A;  2GCX A;  3PGG A;  4IUQ A;  3UDC A;  4C92 A;  2RA2 A;  2XDD A;  5I2S A;  1VQK T;  3JB9 H;  4NOY A;  3OSV A;  1Q81 C;  4BI4 A;  1ZHI A;  2A7Y A;  1AHJ B;  1YJ9 T;  2ZPI B;  3UPU A;  3OYY A;  1D3B B;  3S3O A;  5DLQ E;  2L8D A;  3G71 A;  3S3N A;  4HKE A;  3BW1 A;  4FT2 A;  3X25 B;  4RCC A;  3CC4 T;  2MWP A;  4L59 A;  1Q7Y U;  4C5H A;  1KC8 U;  3SWN A;  2RJD A;  1K73 U;  1JB0 E;  4N0A A;  4M7D G;  3L2Q A;  3JCM J;  5FU6 C;  2RJE A;  4TVR A;  4ZN1 A;  3SFM A;  2KQW A;  3MP6 A;  2M0O A;  5CKH A;  2CZ7 B;  3JCM g;  2JZ2 A;  3G71 T;  4C5E A;  2LT1 A;  4C92 G;  3PIP A;  4M75 B;  1YIT A;  5FU7 C;  1YJN A;  3RKX A;  2MI6 A;  4ZN3 A;  4MZT A;  3QJ6 A;  2DXB A;  5LJ5 d;  5LJ3 j;  2LQ8 A;  4UC4 A;  3RES A;  5GAN j;  3NFC A;  2DD5 A;  5LJ5 j;  3OYE A;  2GFU A;  1WJS A;  2LT4 A;  3LH0 A;  4FSX A;  2FHD A;  2V8K A;  4OB1 B;  2ZPF B;  3VJP A;  1X6O A;  1Y96 A;  1HK9 A;  3H8Z A;  4KT0 E;  2EFI A;  4M7A B;  1IZ6 A;  5C0M A;  4MDX A;  1B34 A;  3OQ5 A;  4NL3 A;  3QG1 A;  5J3B A;  1JRI A;  3CCU A;  1YJW T;  1R8O B;  3A8M B;  3MET A;  1I81 A;  4M7D F;  4B9W A;  1VIE A;  3OS2 A;  4V2S A;  2B8A A;  2VXF A;  4X9C A;  3M57 A;  3SDZ A;  1XNI A;  3LGF A;  4F7U E;  2WAC A;  3BFM A;  4GY5 A;  4F7U B;  2D0Q B;  4IUT A;  4JS4 A;  4M75 D;  3S6W A;  3VKI A;  1N8R C;  3CBM A;  3GF5 A;  4C92 F;  2QQB A;  3C12 A;  3CCJ A;  2VV5 A;  3BDU A;  3TCJ A;  5GAO q;  4E7K A;  1KD1 C;  5GAO r;  4DA4 A;  3V7S A;  5A0L A;  3JCM Q;  2K3X A;  1WQW A;  1VQP A;  3CBP A;  2LCC A;  1KC8 C;  3CCU T;  3V7C A;  1JBM A;  4M77 G;  3FC3 A;  2WSF E;  1EIF A;  3JB9 D;  3X24 B;  4C8Q E;  1TH7 A;  3RMQ A;  4M78 E;  4C8Q B;  2HAX A;  5FRM A;  5LJ5 f;  4M7A D;  2KAF A;  2EQM A;  3HRT A;  4M78 B;  4LD9 K;  4ZTJ A;  5M9O A;  3FIF A;  1KQ1 A;  5GMK l;  2XD0 A;  3QXE B;  4XU2 A;  1W4S A;  4XQ3 A;  3RKW A;  1KHI A;  2E41 A;  4A4K A;  3CCJ T;  3G6E A;  2K3Y A;  4QQG A;  5CO7 A;  3M9Q A;  1M1G A;  1MHN A;  3BY7 A;  1VQP T;  2DPP B;  3L2Z A;  2DTI A;  2QTX A;  3LW5 E;  4J8O A;  2CZ6 B;  3MEA A;  4C8Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...