4C8UA

Xenopus znrf3 ectodomain crystal form ii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
152
structure length
146
Chain Sequence
ETAFVEVVLFESSPNGDYKTHTTELQGRFSRAGATISAEGEIVQMHPLGLCDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGATAVIFDVSDNPDAVEQLNQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 33
structure length 146
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8uA00
5D29A 4YN3A 5ELYA 3SJFA 4C8TA 3S9LA 4NGQA 3SJXA 4OMEA 2EK9A 3D7DA 3SJEA 2XEFA 4P45A 4OC3A 4CDKA 5IB9A 3I6SA 2CIJA 1Z8LA 4C86A 4CDJA 4MCPA 2EK8A 2XEGA 4KNGE 1CX8A 1DE4C 4LQGA 5F09A 3VTAA 4NGNA 4C8CA 2JBKA 4MCQA 3IIBA 4P44A 4C84A 4C9AA 2C6PA 4JYWA 4C8PA 4MCSA 2PVVA 3D7HA 4OC0A 3BI1A 4C9VA 4C9EA 2OOTA 4TJVA 3FEEA 4X3RA 4TJXA 4JZ0A 4NGRA 4C8AA 2JBJA 3S9NA 4C8UA 4TWEA 3FECA 2XEJA 4MCRA 3BXMA 2OR4A 3IWWA 3D7FA 4C8FA 4OC1A 1V6CA 3D7GA 2C6GA 4OC4A 2PVWA 4P4EA 2XEIA 4C9RA 4P4BA 4W9YA 3RBUA 3I74A 3KASA 1WVMA 4P4IA 4NGMA 4C99A 4C85A 1XF1A 4P4JA 2C6CA 4C9UA 4NGTA 4NGSA 3EIFA 3FEDA 3FF3A 4P4FA 4OC2A 4OC5A 4P4DA 4NGPA 3SJGA 1Y9ZA 3BHXA 3ICUA 3S9MA 3BI0A
chains in the Genus database with same CATH superfamily
5D29A 2DIKA 4YN3A 3TLBA 5ELYA 3SJFA 4C8TA 4CZ1A 4CO9A 1A9XB 1VBHA 3S9LA 4NGQA 3K9TA 3SJXA 4H1HA 4OMEA 2EK9A 3D7DA 3SJEA 3EZAA 2XEFA 1J3LA 4P45A 4OC3A 4CDKA 5IB9A 5F5XA 3I6SA 1R61A 2FM4A 3TLEA 2CIJA 3TLYA 1JDEA 1Z8LA 1KC7A 4C86A 2MP0A 4CDJA 2D0PA 4MCPA 3TLCA 1CE8B 2EK8A 2XEGA 3GJZA 1CX8A 3KRVA 4J0NA 4KNGE 1EZBA 2YJTA 1DE4C 4LQGA 5F09A 3VTAA 4INJA 3T05A 4NGNA 4C8CA 4MI1A 1CS0B 2HROA 2JBKA 3TLGA 2EZCA 2HI6A 3IIBA 4MCQA 1BXRB 4E94A 1KBLA 2YJVA 4P44A 4C84A 2R82A 4C9AA 2C6PA 3K4IA 1C30B 4JYWA 4C8PA 1T36B 2GP4A 4MCSA 2PVVA 1Q5XA 3D7HA 4OC0A 3BI1A 4C9VA 3SR3A 4C9EA 2OOTA 3EZBA 4TJVA 3FEEA 4X3RA 5FD8A 4TJXA 1ZYMA 2PCNA 4JZ0A 4NGRA 4C8AA 4COBA 4M8DA 2EZAA 1ZL0A 2JBJA 3S9NA 4C8UA 4TWEA 3FECA 2XEJA 4MCRA 5JYBA 4JVOA 3TLZA 3BXMA 2OR4A 4MJXA 1VBGA 3TYXA 3IWWA 3D7FA 1NXJA 4C8FA 4E5SA 4OC1A 3T07A 1VI4A 1V6CA 2X0SA 3T5MA 3D7GA 2C6GA 2E28A 4OC4A 2C5QA 2PVWA 1KEEB 3C8OA 1M6VB 1JDBC 2XEIA 4P4EA 4C9RA 4P4BA 5F1YA 4W9YA 2D0OA 3I74A 3KASA 1WVMA 4P4IA 3RBUA 4NGMA 3T0TA 4C99A 5IR2A 4C85A 1XF1A 4P4JA 2C6CA 4IIYA 3NOJA 2HWGA 2OLSA 4IIXA 4C9UA 4NGTA 5K99A 3EZEA 4NGSA 3EIFA 3FEDA 3FF3A 4COGA 1ZRSA 3TLGB 4P4FA 3TLAA 2AUMA 5JVLA 4OC2A 4OC5A 1DIKA 2EZBA 2AUNA 4P4DA 4NGPA 3SJGA 1Y9ZA 1EZAA 4EYSA 3U1BA 3BHXA 1NBWA 1GGOA 2B0AA 3G23A 3ICUA 3S9MA 3BI0A 5F9MA 1C3OB
chains in the Genus database with same CATH topology
5D29A 4YN3A 5ELYA 3SJFA 4C8TA 3S9LA 4NGQA 3K9TA 3SJXA 4OMEA 2EK9A 3D7DA 3SJEA 2XEFA 4P45A 4OC3A 4CDKA 5IB9A 3I6SA 2CIJA 1Z8LA 4C86A 4CDJA 4MCPA 2EK8A 2XEGA 4KNGE 1CX8A 1DE4C 4LQGA 5F09A 3VTAA 4NGNA 4C8CA 2JBKA 4MCQA 3IIBA 4P44A 4C84A 4C9AA 2C6PA 4JYWA 4C8PA 2GP4A 4MCSA 2PVVA 3D7HA 4OC0A 3BI1A 4C9VA 4C9EA 2OOTA 4TJVA 3FEEA 4X3RA 4TJXA 4JZ0A 4NGRA 4C8AA 2JBJA 3S9NA 4C8UA 4TWEA 3FECA 2XEJA 4MCRA 3BXMA 2OR4A 3IWWA 3D7FA 4C8FA 4OC1A 1V6CA 3D7GA 2C6GA 4OC4A 2C5QA 2PVWA 4P4EA 2XEIA 4C9RA 4P4BA 4W9YA 3RBUA 3I74A 3KASA 1WVMA 4P4IA 4NGMA 4C99A 5IR2A 4C85A 1XF1A 4P4JA 2C6CA 4C9UA 4NGTA 4NGSA 3EIFA 3FEDA 3FF3A 4P4FA 4OC2A 4OC5A 4P4DA 4NGPA 3SJGA 1Y9ZA 3BHXA 3ICUA 3S9MA 3BI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D29 A;  4YN3 A;  5ELY A;  3SJF A;  4C8T A;  3S9L A;  4NGQ A;  3SJX A;  4OME A;  2EK9 A;  3D7D A;  3SJE A;  2XEF A;  4P45 A;  4OC3 A;  4CDK A;  5IB9 A;  3I6S A;  2CIJ A;  1Z8L A;  4C86 A;  4CDJ A;  4MCP A;  2EK8 A;  2XEG A;  4KNG E;  1CX8 A;  1DE4 C;  4LQG A;  5F09 A;  3VTA A;  4NGN A;  4C8C A;  2JBK A;  4MCQ A;  3IIB A;  4P44 A;  4C84 A;  4C9A A;  2C6P A;  4JYW A;  4C8P A;  4MCS A;  2PVV A;  3D7H A;  4OC0 A;  3BI1 A;  4C9V A;  4C9E A;  2OOT A;  4TJV A;  3FEE A;  4X3R A;  4TJX A;  4JZ0 A;  4NGR A;  4C8A A;  2JBJ A;  3S9N A;  4C8U A;  4TWE A;  3FEC A;  2XEJ A;  4MCR A;  3BXM A;  2OR4 A;  3IWW A;  3D7F A;  4C8F A;  4OC1 A;  1V6C A;  3D7G A;  2C6G A;  4OC4 A;  2PVW A;  4P4E A;  2XEI A;  4C9R A;  4P4B A;  4W9Y A;  3RBU A;  3I74 A;  3KAS A;  1WVM A;  4P4I A;  4NGM A;  4C99 A;  4C85 A;  1XF1 A;  4P4J A;  2C6C A;  4C9U A;  4NGT A;  4NGS A;  3EIF A;  3FED A;  3FF3 A;  4P4F A;  4OC2 A;  4OC5 A;  4P4D A;  4NGP A;  3SJG A;  1Y9Z A;  3BHX A;  3ICU A;  3S9M A;  3BI0 A; 
#chains in the Genus database with same CATH topology
 5D29 A;  2DIK A;  4YN3 A;  3TLB A;  5ELY A;  3SJF A;  4C8T A;  4CZ1 A;  4CO9 A;  1A9X B;  1VBH A;  3S9L A;  4NGQ A;  3K9T A;  3SJX A;  4H1H A;  4OME A;  2EK9 A;  3D7D A;  3SJE A;  3EZA A;  2XEF A;  1J3L A;  4P45 A;  4OC3 A;  4CDK A;  5IB9 A;  5F5X A;  3I6S A;  1R61 A;  2FM4 A;  3TLE A;  2CIJ A;  3TLY A;  1JDE A;  1Z8L A;  1KC7 A;  4C86 A;  2MP0 A;  4CDJ A;  2D0P A;  4MCP A;  3TLC A;  1CE8 B;  2EK8 A;  2XEG A;  3GJZ A;  1CX8 A;  3KRV A;  4J0N A;  4KNG E;  1EZB A;  2YJT A;  1DE4 C;  4LQG A;  5F09 A;  3VTA A;  4INJ A;  3T05 A;  4NGN A;  4C8C A;  4MI1 A;  1CS0 B;  2HRO A;  2JBK A;  3TLG A;  2EZC A;  2HI6 A;  3IIB A;  4MCQ A;  1BXR B;  4E94 A;  1KBL A;  2YJV A;  4P44 A;  4C84 A;  2R82 A;  4C9A A;  2C6P A;  3K4I A;  1C30 B;  4JYW A;  4C8P A;  1T36 B;  2GP4 A;  4MCS A;  2PVV A;  1Q5X A;  3D7H A;  4OC0 A;  3BI1 A;  4C9V A;  3SR3 A;  4C9E A;  2OOT A;  3EZB A;  4TJV A;  3FEE A;  4X3R A;  5FD8 A;  4TJX A;  1ZYM A;  2PCN A;  4JZ0 A;  4NGR A;  4C8A A;  4COB A;  4M8D A;  2EZA A;  1ZL0 A;  2JBJ A;  3S9N A;  4C8U A;  4TWE A;  3FEC A;  2XEJ A;  4MCR A;  5JYB A;  4JVO A;  3TLZ A;  3BXM A;  2OR4 A;  4MJX A;  1VBG A;  3TYX A;  3IWW A;  3D7F A;  1NXJ A;  4C8F A;  4E5S A;  4OC1 A;  3T07 A;  1VI4 A;  1V6C A;  2X0S A;  3T5M A;  3D7G A;  2C6G A;  2E28 A;  4OC4 A;  2C5Q A;  2PVW A;  1KEE B;  3C8O A;  1M6V B;  1JDB C;  2XEI A;  4P4E A;  4C9R A;  4P4B A;  5F1Y A;  4W9Y A;  2D0O A;  3I74 A;  3KAS A;  1WVM A;  4P4I A;  3RBU A;  4NGM A;  3T0T A;  4C99 A;  5IR2 A;  4C85 A;  1XF1 A;  4P4J A;  2C6C A;  4IIY A;  3NOJ A;  2HWG A;  2OLS A;  4IIX A;  4C9U A;  4NGT A;  5K99 A;  3EZE A;  4NGS A;  3EIF A;  3FED A;  3FF3 A;  4COG A;  1ZRS A;  3TLG B;  4P4F A;  3TLA A;  2AUM A;  5JVL A;  4OC2 A;  4OC5 A;  1DIK A;  2EZB A;  2AUN A;  4P4D A;  4NGP A;  3SJG A;  1Y9Z A;  1EZA A;  4EYS A;  3U1B A;  3BHX A;  1NBW A;  1GGO A;  2B0A A;  3G23 A;  3ICU A;  3S9M A;  3BI0 A;  5F9M A;  1C3O B; 
#chains in the Genus database with same CATH homology
 5D29 A;  4YN3 A;  5ELY A;  3SJF A;  4C8T A;  3S9L A;  4NGQ A;  3K9T A;  3SJX A;  4OME A;  2EK9 A;  3D7D A;  3SJE A;  2XEF A;  4P45 A;  4OC3 A;  4CDK A;  5IB9 A;  3I6S A;  2CIJ A;  1Z8L A;  4C86 A;  4CDJ A;  4MCP A;  2EK8 A;  2XEG A;  4KNG E;  1CX8 A;  1DE4 C;  4LQG A;  5F09 A;  3VTA A;  4NGN A;  4C8C A;  2JBK A;  4MCQ A;  3IIB A;  4P44 A;  4C84 A;  4C9A A;  2C6P A;  4JYW A;  4C8P A;  2GP4 A;  4MCS A;  2PVV A;  3D7H A;  4OC0 A;  3BI1 A;  4C9V A;  4C9E A;  2OOT A;  4TJV A;  3FEE A;  4X3R A;  4TJX A;  4JZ0 A;  4NGR A;  4C8A A;  2JBJ A;  3S9N A;  4C8U A;  4TWE A;  3FEC A;  2XEJ A;  4MCR A;  3BXM A;  2OR4 A;  3IWW A;  3D7F A;  4C8F A;  4OC1 A;  1V6C A;  3D7G A;  2C6G A;  4OC4 A;  2C5Q A;  2PVW A;  4P4E A;  2XEI A;  4C9R A;  4P4B A;  4W9Y A;  3RBU A;  3I74 A;  3KAS A;  1WVM A;  4P4I A;  4NGM A;  4C99 A;  5IR2 A;  4C85 A;  1XF1 A;  4P4J A;  2C6C A;  4C9U A;  4NGT A;  4NGS A;  3EIF A;  3FED A;  3FF3 A;  4P4F A;  4OC2 A;  4OC5 A;  4P4D A;  4NGP A;  3SJG A;  1Y9Z A;  3BHX A;  3ICU A;  3S9M A;  3BI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...