4C8UA

Xenopus znrf3 ectodomain crystal form ii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
152
structure length
146
Chain Sequence
ETAFVEVVLFESSPNGDYKTHTTELQGRFSRAGATISAEGEIVQMHPLGLCDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGATAVIFDVSDNPDAVEQLNQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 33
structure length 146
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8uA00
3D7GA 4P4JA 4C9EA 5ELYA 4P4IA 1Z8LA 3KASA 2XEGA 3FEEA 4MCPA 3FF3A 4NGSA 4C8UA 1XF1A 4LQGA 3D7FA 3ICUA 4P4DA 4OC0A 2JBJA 4C8TA 4C99A 2PVVA 3S9MA 4C9VA 3SJXA 5D29A 2XEJA 4OC5A 4YN3A 3S9LA 2CIJA 3BI1A 3VTAA 3FECA 4NGRA 4KNGE 2XEFA 3D7HA 5IB9A 2PVWA 4C8CA 4C86A 1Y9ZA 1CX8A 3BXMA 4NGMA 4NGQA 4C84A 3I6SA 4C8PA 4TJVA 4P45A 4X3RA 2XEIA 4C8AA 3FEDA 4MCRA 1DE4C 4OC1A 4JYWA 3RBUA 4P4FA 4TWEA 4W9YA 4NGTA 4C9AA 4JZ0A 3SJEA 4OC4A 1WVMA 2OOTA 3BI0A 4P4EA 3IWWA 4NGNA 3SJFA 4C8FA 4C9UA 3I74A 3EIFA 2C6CA 1V6CA 4TJXA 3SJGA 2EK9A 4MCQA 4P44A 2EK8A 3BHXA 4OC3A 4CDKA 4NGPA 3D7DA 4MCSA 4C85A 3S9NA 3IIBA 2JBKA 2OR4A 5F09A 4OC2A 2C6PA 2C6GA 4P4BA 4CDJA 4C9RA 4OMEA
chains in the Genus database with same CATH superfamily
3D7GA 3TLGB 1ZYMA 4P4JA 4C9EA 5ELYA 2DIKA 3TLYA 4P4IA 1Z8LA 3KASA 2XEGA 3FEEA 4MCPA 3FF3A 4NGSA 4MJXA 5F9MA 4C8UA 4EYSA 1KEEB 3TLBA 1XF1A 4LQGA 3D7FA 3ICUA 4P4DA 4IIYA 4MI1A 4OC0A 4J0NA 3EZEA 1R61A 2JBJA 1KBLA 4C8TA 2YJVA 2B0AA 2PVVA 4C99A 3S9MA 3G23A 4C9VA 4IIXA 3SJXA 5D29A 1C30B 1CS0B 2XEJA 4OC5A 3T5MA 4YN3A 3S9LA 2CIJA 3C8OA 2MP0A 2R82A 2X0SA 3BI1A 2PCNA 1VI4A 3VTAA 3FECA 4NGRA 4KNGE 5K99A 2XEFA 3D7HA 5IB9A 1CE8B 2PVWA 4H1HA 4C8CA 4C86A 1Y9ZA 1GGOA 1CX8A 2D0PA 3BXMA 4NGMA 4NGQA 3T0TA 4E5SA 4M8DA 1J3LA 1ZL0A 5F5XA 1EZBA 4C84A 3GJZA 3I6SA 3KRVA 4C8PA 4TJVA 4P45A 4X3RA 2XEIA 4C8AA 3FEDA 4MCRA 1DE4C 4OC1A 2E28A 4INJA 4JYWA 3K9TA 3RBUA 3TYXA 1M6VB 3K4IA 3TLEA 4P4FA 3EZAA 4TWEA 3TLAA 4W9YA 4NGTA 1EZAA 2AUMA 4E94A 3U1BA 2D0OA 4C9AA 2FM4A 3TLZA 2OLSA 4JZ0A 3SJEA 4OC4A 1KC7A 1NBWA 1WVMA 2OOTA 4JVOA 3BI0A 1VBGA 4P4EA 4COBA 3NOJA 3EZBA 1NXJA 1JDBC 2EZBA 3IWWA 4NGNA 3SJFA 4C8FA 1Q5XA 1BXRB 3T05A 4C9UA 3I74A 3EIFA 5JVLA 5FD8A 2C6CA 1JDEA 2EZAA 1V6CA 4TJXA 5IR2A 1T36B 3SJGA 2C5QA 5F1YA 3SR3A 1DIKA 2EK9A 4MCQA 2EZCA 4P44A 2EK8A 3BHXA 1C3OB 3TLGA 4OC3A 4CDKA 4COGA 2AUNA 4NGPA 3D7DA 4MCSA 2HROA 4C85A 1A9XB 3IIBA 3S9NA 2GP4A 2HWGA 5JYBA 3T07A 2JBKA 3TLCA 2OR4A 4CO9A 5F09A 2HI6A 4OC2A 4CZ1A 2C6PA 2C6GA 4P4BA 4CDJA 1VBHA 1ZRSA 4C9RA 2YJTA 4OMEA
chains in the Genus database with same CATH topology
3D7GA 4P4JA 4C9EA 5ELYA 4P4IA 1Z8LA 3KASA 2XEGA 3FEEA 4MCPA 3FF3A 4NGSA 4C8UA 1XF1A 4LQGA 3D7FA 3ICUA 4P4DA 4OC0A 2JBJA 4C8TA 4C99A 2PVVA 3S9MA 4C9VA 3SJXA 5D29A 2XEJA 4OC5A 4YN3A 3S9LA 2CIJA 3BI1A 3VTAA 3FECA 4NGRA 4KNGE 2XEFA 3D7HA 5IB9A 2PVWA 4C8CA 4C86A 1Y9ZA 1CX8A 3BXMA 4NGMA 4NGQA 4C84A 3I6SA 4C8PA 4TJVA 4P45A 4X3RA 2XEIA 4C8AA 3FEDA 4MCRA 1DE4C 4OC1A 4JYWA 3K9TA 3RBUA 4P4FA 4TWEA 4W9YA 4NGTA 4C9AA 4JZ0A 3SJEA 4OC4A 1WVMA 2OOTA 3BI0A 4P4EA 3IWWA 4NGNA 3SJFA 4C8FA 4C9UA 3I74A 3EIFA 2C6CA 1V6CA 4TJXA 5IR2A 3SJGA 2C5QA 2EK9A 4MCQA 4P44A 2EK8A 3BHXA 4OC3A 4CDKA 4NGPA 3D7DA 4MCSA 4C85A 3S9NA 3IIBA 2GP4A 2JBKA 2OR4A 5F09A 4OC2A 2C6PA 2C6GA 4P4BA 4CDJA 4C9RA 4OMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D7G A;  4P4J A;  4C9E A;  5ELY A;  4P4I A;  1Z8L A;  3KAS A;  2XEG A;  3FEE A;  4MCP A;  3FF3 A;  4NGS A;  4C8U A;  1XF1 A;  4LQG A;  3D7F A;  3ICU A;  4P4D A;  4OC0 A;  2JBJ A;  4C8T A;  4C99 A;  2PVV A;  3S9M A;  4C9V A;  3SJX A;  5D29 A;  2XEJ A;  4OC5 A;  4YN3 A;  3S9L A;  2CIJ A;  3BI1 A;  3VTA A;  3FEC A;  4NGR A;  4KNG E;  2XEF A;  3D7H A;  5IB9 A;  2PVW A;  4C8C A;  4C86 A;  1Y9Z A;  1CX8 A;  3BXM A;  4NGM A;  4NGQ A;  4C84 A;  3I6S A;  4C8P A;  4TJV A;  4P45 A;  4X3R A;  2XEI A;  4C8A A;  3FED A;  4MCR A;  1DE4 C;  4OC1 A;  4JYW A;  3RBU A;  4P4F A;  4TWE A;  4W9Y A;  4NGT A;  4C9A A;  4JZ0 A;  3SJE A;  4OC4 A;  1WVM A;  2OOT A;  3BI0 A;  4P4E A;  3IWW A;  4NGN A;  3SJF A;  4C8F A;  4C9U A;  3I74 A;  3EIF A;  2C6C A;  1V6C A;  4TJX A;  3SJG A;  2EK9 A;  4MCQ A;  4P44 A;  2EK8 A;  3BHX A;  4OC3 A;  4CDK A;  4NGP A;  3D7D A;  4MCS A;  4C85 A;  3S9N A;  3IIB A;  2JBK A;  2OR4 A;  5F09 A;  4OC2 A;  2C6P A;  2C6G A;  4P4B A;  4CDJ A;  4C9R A;  4OME A; 
#chains in the Genus database with same CATH topology
 3D7G A;  3TLG B;  1ZYM A;  4P4J A;  4C9E A;  5ELY A;  2DIK A;  3TLY A;  4P4I A;  1Z8L A;  3KAS A;  2XEG A;  3FEE A;  4MCP A;  3FF3 A;  4NGS A;  4MJX A;  5F9M A;  4C8U A;  4EYS A;  1KEE B;  3TLB A;  1XF1 A;  4LQG A;  3D7F A;  3ICU A;  4P4D A;  4IIY A;  4MI1 A;  4OC0 A;  4J0N A;  3EZE A;  1R61 A;  2JBJ A;  1KBL A;  4C8T A;  2YJV A;  2B0A A;  2PVV A;  4C99 A;  3S9M A;  3G23 A;  4C9V A;  4IIX A;  3SJX A;  5D29 A;  1C30 B;  1CS0 B;  2XEJ A;  4OC5 A;  3T5M A;  4YN3 A;  3S9L A;  2CIJ A;  3C8O A;  2MP0 A;  2R82 A;  2X0S A;  3BI1 A;  2PCN A;  1VI4 A;  3VTA A;  3FEC A;  4NGR A;  4KNG E;  5K99 A;  2XEF A;  3D7H A;  5IB9 A;  1CE8 B;  2PVW A;  4H1H A;  4C8C A;  4C86 A;  1Y9Z A;  1GGO A;  1CX8 A;  2D0P A;  3BXM A;  4NGM A;  4NGQ A;  3T0T A;  4E5S A;  4M8D A;  1J3L A;  1ZL0 A;  5F5X A;  1EZB A;  4C84 A;  3GJZ A;  3I6S A;  3KRV A;  4C8P A;  4TJV A;  4P45 A;  4X3R A;  2XEI A;  4C8A A;  3FED A;  4MCR A;  1DE4 C;  4OC1 A;  2E28 A;  4INJ A;  4JYW A;  3K9T A;  3RBU A;  3TYX A;  1M6V B;  3K4I A;  3TLE A;  4P4F A;  3EZA A;  4TWE A;  3TLA A;  4W9Y A;  4NGT A;  1EZA A;  2AUM A;  4E94 A;  3U1B A;  2D0O A;  4C9A A;  2FM4 A;  3TLZ A;  2OLS A;  4JZ0 A;  3SJE A;  4OC4 A;  1KC7 A;  1NBW A;  1WVM A;  2OOT A;  4JVO A;  3BI0 A;  1VBG A;  4P4E A;  4COB A;  3NOJ A;  3EZB A;  1NXJ A;  1JDB C;  2EZB A;  3IWW A;  4NGN A;  3SJF A;  4C8F A;  1Q5X A;  1BXR B;  3T05 A;  4C9U A;  3I74 A;  3EIF A;  5JVL A;  5FD8 A;  2C6C A;  1JDE A;  2EZA A;  1V6C A;  4TJX A;  5IR2 A;  1T36 B;  3SJG A;  2C5Q A;  5F1Y A;  3SR3 A;  1DIK A;  2EK9 A;  4MCQ A;  2EZC A;  4P44 A;  2EK8 A;  3BHX A;  1C3O B;  3TLG A;  4OC3 A;  4CDK A;  4COG A;  2AUN A;  4NGP A;  3D7D A;  4MCS A;  2HRO A;  4C85 A;  1A9X B;  3IIB A;  3S9N A;  2GP4 A;  2HWG A;  5JYB A;  3T07 A;  2JBK A;  3TLC A;  2OR4 A;  4CO9 A;  5F09 A;  2HI6 A;  4OC2 A;  4CZ1 A;  2C6P A;  2C6G A;  4P4B A;  4CDJ A;  1VBH A;  1ZRS A;  4C9R A;  2YJT A;  4OME A; 
#chains in the Genus database with same CATH homology
 3D7G A;  4P4J A;  4C9E A;  5ELY A;  4P4I A;  1Z8L A;  3KAS A;  2XEG A;  3FEE A;  4MCP A;  3FF3 A;  4NGS A;  4C8U A;  1XF1 A;  4LQG A;  3D7F A;  3ICU A;  4P4D A;  4OC0 A;  2JBJ A;  4C8T A;  4C99 A;  2PVV A;  3S9M A;  4C9V A;  3SJX A;  5D29 A;  2XEJ A;  4OC5 A;  4YN3 A;  3S9L A;  2CIJ A;  3BI1 A;  3VTA A;  3FEC A;  4NGR A;  4KNG E;  2XEF A;  3D7H A;  5IB9 A;  2PVW A;  4C8C A;  4C86 A;  1Y9Z A;  1CX8 A;  3BXM A;  4NGM A;  4NGQ A;  4C84 A;  3I6S A;  4C8P A;  4TJV A;  4P45 A;  4X3R A;  2XEI A;  4C8A A;  3FED A;  4MCR A;  1DE4 C;  4OC1 A;  4JYW A;  3K9T A;  3RBU A;  4P4F A;  4TWE A;  4W9Y A;  4NGT A;  4C9A A;  4JZ0 A;  3SJE A;  4OC4 A;  1WVM A;  2OOT A;  3BI0 A;  4P4E A;  3IWW A;  4NGN A;  3SJF A;  4C8F A;  4C9U A;  3I74 A;  3EIF A;  2C6C A;  1V6C A;  4TJX A;  5IR2 A;  3SJG A;  2C5Q A;  2EK9 A;  4MCQ A;  4P44 A;  2EK8 A;  3BHX A;  4OC3 A;  4CDK A;  4NGP A;  3D7D A;  4MCS A;  4C85 A;  3S9N A;  3IIB A;  2GP4 A;  2JBK A;  2OR4 A;  5F09 A;  4OC2 A;  2C6P A;  2C6G A;  4P4B A;  4CDJ A;  4C9R A;  4OME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...