4C8UA

Xenopus znrf3 ectodomain crystal form ii
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
152
structure length
146
Chain Sequence
ETAFVEVVLFESSPNGDYKTHTTELQGRFSRAGATISAEGEIVQMHPLGLCDLYEYGWVGVVKLEQPEMDPKPCLTVLGKAKRAVQRGATAVIFDVSDNPDAVEQLNQGLEDPLKRPVVYMKGMDAIKLMNIVNKQKGARARIQHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Ligase
total genus 33
structure length 146
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c8uA00
2OOTA 4C8UA 3IIBA 4NGNA 4P44A 4MCSA 4JZ0A 3SJGA 4TWEA 3RBUA 1XF1A 4P4BA 3ICUA 3FF3A 4MCPA 4C8CA 4JYWA 3BI0A 4NGMA 4P4JA 4C86A 4CDJA 4KNGE 4OC5A 3D7HA 4NGPA 2EK9A 4C9VA 4C8AA 4NGTA 4C84A 4C8FA 4P4DA 3BI1A 4MCRA 3VTAA 4YN3A 4C8PA 4C99A 4CDKA 1CX8A 3S9NA 3BHXA 2JBJA 3D7GA 4MCQA 3FECA 3SJFA 2XEGA 4X3RA 4C9UA 4C9EA 3S9LA 2XEIA 4TJXA 4OC0A 2PVVA 3SJEA 1WVMA 4OC4A 4P4IA 4OC1A 3D7FA 4C9AA 5D29A 3BXMA 3I74A 3SJXA 2XEFA 2CIJA 1Y9ZA 2EK8A 5F09A 3KASA 2OR4A 4NGRA 4C85A 1Z8LA 2PVWA 3IWWA 2C6PA 2XEJA 5ELYA 3EIFA 3D7DA 3FEEA 1DE4C 3FEDA 4TJVA 4OMEA 2C6CA 4LQGA 4P4FA 1V6CA 4P45A 4P4EA 3S9MA 4NGQA 4OC2A 4NGSA 3I6SA 4C8TA 4OC3A 2C6GA 5IB9A 2JBKA 4W9YA 4C9RA
chains in the Genus database with same CATH superfamily
2OOTA 3TLGB 4C8UA 3IIBA 4NGNA 4P44A 4MCSA 4JZ0A 3SJGA 4TWEA 3RBUA 5K99A 1JDBC 1XF1A 4P4BA 5F5XA 4COGA 2GP4A 3FF3A 3ICUA 4MCPA 4C8CA 4H1HA 4JYWA 3BI0A 5F1YA 4NGMA 4P4JA 4C86A 1VBHA 1ZL0A 4CDJA 4J0NA 2HWGA 4JVOA 1CS0B 4KNGE 4OC5A 4E94A 5F9MA 3D7HA 2EZAA 3KRVA 4NGPA 2EK9A 4C9VA 4C8AA 4NGTA 4IIYA 4C84A 3TLAA 4EYSA 1A9XB 1GGOA 4C8FA 4P4DA 3BI1A 1JDEA 2MP0A 4MCRA 3TLGA 3VTAA 4YN3A 4COBA 2EZBA 4C99A 4C8PA 1CX8A 4CDKA 2D0PA 3S9NA 3BHXA 3GJZA 2HROA 2JBJA 5JVLA 3D7GA 3TLZA 3K9TA 4MCQA 3FECA 3G23A 1KBLA 3SJFA 2HI6A 2XEGA 3TLCA 5JYBA 4M8DA 4X3RA 4MI1A 4C9UA 1Q5XA 2D0OA 3SR3A 2E28A 4C9EA 4E5SA 3S9LA 2R82A 2XEIA 3TLYA 2YJTA 1BXRB 4TJXA 2YJVA 1EZAA 3C8OA 2PVVA 2B0AA 4OC0A 3SJEA 2DIKA 3T07A 1WVMA 1C30B 4OC4A 1J3LA 2C5QA 1VBGA 4P4IA 4IIXA 2PCNA 3K4IA 4OC1A 1ZRSA 1NBWA 3D7FA 4C9AA 5D29A 3BXMA 2AUMA 3I74A 5IR2A 3SJXA 1KEEB 1ZYMA 2XEFA 1DIKA 2CIJA 1Y9ZA 2AUNA 1M6VB 2EK8A 5F09A 3KASA 2OR4A 3U1BA 4NGRA 1T36B 1VI4A 4C85A 1Z8LA 2PVWA 4MJXA 3IWWA 1C3OB 2C6PA 3EZBA 3TLBA 2XEJA 3EZAA 5ELYA 3EIFA 3T5MA 3D7DA 5FD8A 3FEEA 3TLEA 2X0SA 1DE4C 1NXJA 3FEDA 4TJVA 3EZEA 4OMEA 3T05A 1EZBA 2C6CA 4LQGA 4P4FA 1V6CA 4CO9A 1R61A 1KC7A 4P45A 4P4EA 3S9MA 4NGQA 4OC2A 4NGSA 3I6SA 4C8TA 4OC3A 1CE8B 3T0TA 2C6GA 2EZCA 4INJA 4CZ1A 2OLSA 2FM4A 5IB9A 3NOJA 2JBKA 4W9YA 3TYXA 4C9RA
chains in the Genus database with same CATH topology
2OOTA 4C8UA 3IIBA 4NGNA 4P44A 4MCSA 4JZ0A 3SJGA 4TWEA 3RBUA 1XF1A 4P4BA 2GP4A 3FF3A 3ICUA 4MCPA 4C8CA 4JYWA 3BI0A 4NGMA 4P4JA 4C86A 4CDJA 4KNGE 4OC5A 3D7HA 4NGPA 2EK9A 4C9VA 4C8AA 4NGTA 4C84A 4C8FA 4P4DA 3BI1A 4MCRA 3VTAA 4YN3A 4C8PA 4C99A 4CDKA 1CX8A 3S9NA 3BHXA 2JBJA 3D7GA 3K9TA 4MCQA 3FECA 3SJFA 2XEGA 4X3RA 4C9UA 4C9EA 3S9LA 2XEIA 4TJXA 4OC0A 2PVVA 3SJEA 1WVMA 4OC4A 2C5QA 4P4IA 4OC1A 3D7FA 4C9AA 5D29A 3BXMA 3I74A 5IR2A 3SJXA 2XEFA 2CIJA 1Y9ZA 2EK8A 5F09A 3KASA 2OR4A 4NGRA 4C85A 1Z8LA 2PVWA 3IWWA 2C6PA 2XEJA 5ELYA 3EIFA 3D7DA 3FEEA 1DE4C 3FEDA 4TJVA 4OMEA 2C6CA 4LQGA 4P4FA 1V6CA 4P45A 4P4EA 3S9MA 4NGQA 4OC2A 4NGSA 3I6SA 4C8TA 4OC3A 2C6GA 5IB9A 2JBKA 4W9YA 4C9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOT A;  4C8U A;  3IIB A;  4NGN A;  4P44 A;  4MCS A;  4JZ0 A;  3SJG A;  4TWE A;  3RBU A;  1XF1 A;  4P4B A;  3ICU A;  3FF3 A;  4MCP A;  4C8C A;  4JYW A;  3BI0 A;  4NGM A;  4P4J A;  4C86 A;  4CDJ A;  4KNG E;  4OC5 A;  3D7H A;  4NGP A;  2EK9 A;  4C9V A;  4C8A A;  4NGT A;  4C84 A;  4C8F A;  4P4D A;  3BI1 A;  4MCR A;  3VTA A;  4YN3 A;  4C8P A;  4C99 A;  4CDK A;  1CX8 A;  3S9N A;  3BHX A;  2JBJ A;  3D7G A;  4MCQ A;  3FEC A;  3SJF A;  2XEG A;  4X3R A;  4C9U A;  4C9E A;  3S9L A;  2XEI A;  4TJX A;  4OC0 A;  2PVV A;  3SJE A;  1WVM A;  4OC4 A;  4P4I A;  4OC1 A;  3D7F A;  4C9A A;  5D29 A;  3BXM A;  3I74 A;  3SJX A;  2XEF A;  2CIJ A;  1Y9Z A;  2EK8 A;  5F09 A;  3KAS A;  2OR4 A;  4NGR A;  4C85 A;  1Z8L A;  2PVW A;  3IWW A;  2C6P A;  2XEJ A;  5ELY A;  3EIF A;  3D7D A;  3FEE A;  1DE4 C;  3FED A;  4TJV A;  4OME A;  2C6C A;  4LQG A;  4P4F A;  1V6C A;  4P45 A;  4P4E A;  3S9M A;  4NGQ A;  4OC2 A;  4NGS A;  3I6S A;  4C8T A;  4OC3 A;  2C6G A;  5IB9 A;  2JBK A;  4W9Y A;  4C9R A; 
#chains in the Genus database with same CATH topology
 2OOT A;  3TLG B;  4C8U A;  3IIB A;  4NGN A;  4P44 A;  4MCS A;  4JZ0 A;  3SJG A;  4TWE A;  3RBU A;  5K99 A;  1JDB C;  1XF1 A;  4P4B A;  5F5X A;  4COG A;  2GP4 A;  3FF3 A;  3ICU A;  4MCP A;  4C8C A;  4H1H A;  4JYW A;  3BI0 A;  5F1Y A;  4NGM A;  4P4J A;  4C86 A;  1VBH A;  1ZL0 A;  4CDJ A;  4J0N A;  2HWG A;  4JVO A;  1CS0 B;  4KNG E;  4OC5 A;  4E94 A;  5F9M A;  3D7H A;  2EZA A;  3KRV A;  4NGP A;  2EK9 A;  4C9V A;  4C8A A;  4NGT A;  4IIY A;  4C84 A;  3TLA A;  4EYS A;  1A9X B;  1GGO A;  4C8F A;  4P4D A;  3BI1 A;  1JDE A;  2MP0 A;  4MCR A;  3TLG A;  3VTA A;  4YN3 A;  4COB A;  2EZB A;  4C99 A;  4C8P A;  1CX8 A;  4CDK A;  2D0P A;  3S9N A;  3BHX A;  3GJZ A;  2HRO A;  2JBJ A;  5JVL A;  3D7G A;  3TLZ A;  3K9T A;  4MCQ A;  3FEC A;  3G23 A;  1KBL A;  3SJF A;  2HI6 A;  2XEG A;  3TLC A;  5JYB A;  4M8D A;  4X3R A;  4MI1 A;  4C9U A;  1Q5X A;  2D0O A;  3SR3 A;  2E28 A;  4C9E A;  4E5S A;  3S9L A;  2R82 A;  2XEI A;  3TLY A;  2YJT A;  1BXR B;  4TJX A;  2YJV A;  1EZA A;  3C8O A;  2PVV A;  2B0A A;  4OC0 A;  3SJE A;  2DIK A;  3T07 A;  1WVM A;  1C30 B;  4OC4 A;  1J3L A;  2C5Q A;  1VBG A;  4P4I A;  4IIX A;  2PCN A;  3K4I A;  4OC1 A;  1ZRS A;  1NBW A;  3D7F A;  4C9A A;  5D29 A;  3BXM A;  2AUM A;  3I74 A;  5IR2 A;  3SJX A;  1KEE B;  1ZYM A;  2XEF A;  1DIK A;  2CIJ A;  1Y9Z A;  2AUN A;  1M6V B;  2EK8 A;  5F09 A;  3KAS A;  2OR4 A;  3U1B A;  4NGR A;  1T36 B;  1VI4 A;  4C85 A;  1Z8L A;  2PVW A;  4MJX A;  3IWW A;  1C3O B;  2C6P A;  3EZB A;  3TLB A;  2XEJ A;  3EZA A;  5ELY A;  3EIF A;  3T5M A;  3D7D A;  5FD8 A;  3FEE A;  3TLE A;  2X0S A;  1DE4 C;  1NXJ A;  3FED A;  4TJV A;  3EZE A;  4OME A;  3T05 A;  1EZB A;  2C6C A;  4LQG A;  4P4F A;  1V6C A;  4CO9 A;  1R61 A;  1KC7 A;  4P45 A;  4P4E A;  3S9M A;  4NGQ A;  4OC2 A;  4NGS A;  3I6S A;  4C8T A;  4OC3 A;  1CE8 B;  3T0T A;  2C6G A;  2EZC A;  4INJ A;  4CZ1 A;  2OLS A;  2FM4 A;  5IB9 A;  3NOJ A;  2JBK A;  4W9Y A;  3TYX A;  4C9R A; 
#chains in the Genus database with same CATH homology
 2OOT A;  4C8U A;  3IIB A;  4NGN A;  4P44 A;  4MCS A;  4JZ0 A;  3SJG A;  4TWE A;  3RBU A;  1XF1 A;  4P4B A;  2GP4 A;  3FF3 A;  3ICU A;  4MCP A;  4C8C A;  4JYW A;  3BI0 A;  4NGM A;  4P4J A;  4C86 A;  4CDJ A;  4KNG E;  4OC5 A;  3D7H A;  4NGP A;  2EK9 A;  4C9V A;  4C8A A;  4NGT A;  4C84 A;  4C8F A;  4P4D A;  3BI1 A;  4MCR A;  3VTA A;  4YN3 A;  4C8P A;  4C99 A;  4CDK A;  1CX8 A;  3S9N A;  3BHX A;  2JBJ A;  3D7G A;  3K9T A;  4MCQ A;  3FEC A;  3SJF A;  2XEG A;  4X3R A;  4C9U A;  4C9E A;  3S9L A;  2XEI A;  4TJX A;  4OC0 A;  2PVV A;  3SJE A;  1WVM A;  4OC4 A;  2C5Q A;  4P4I A;  4OC1 A;  3D7F A;  4C9A A;  5D29 A;  3BXM A;  3I74 A;  5IR2 A;  3SJX A;  2XEF A;  2CIJ A;  1Y9Z A;  2EK8 A;  5F09 A;  3KAS A;  2OR4 A;  4NGR A;  4C85 A;  1Z8L A;  2PVW A;  3IWW A;  2C6P A;  2XEJ A;  5ELY A;  3EIF A;  3D7D A;  3FEE A;  1DE4 C;  3FED A;  4TJV A;  4OME A;  2C6C A;  4LQG A;  4P4F A;  1V6C A;  4P45 A;  4P4E A;  3S9M A;  4NGQ A;  4OC2 A;  4NGS A;  3I6S A;  4C8T A;  4OC3 A;  2C6G A;  5IB9 A;  2JBK A;  4W9Y A;  4C9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...