4C92F

Crystal structure of the yeast lsm1-7 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
77
structure length
77
Chain Sequence
SVTTEFLSDIIGKTVNVKLASGLLYSGRLESIDGFMNVALSSATEHYESNNNKLLNKFNSDVFLRGTQVMYISEQKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 18
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92F00
3L1AA 3RIRA 4JUVA 5GAN2 2YLBA 5GAMj 4C8QC 5I21A 3SWNB 4N0AC 4NL2A 4M7AG 4J6YA 3BW1A 3V7CA 4J5YA 5GMKi 3AHUA 3HSBA 4M78E 1N9RA 3JCMb 1WNLA 2E10A 4A54A 2ZGWA 3HFOA 4M78D 4RCBA 5GAMf 4C92G 1LOJA 4M77A 5GMKl 5GAOl 4M78B 3V8KA 4M7DC 1I4K1 3V8JA 5GAN8 4M77B 4M75G 5LJ5h 1B34A 4M7DA 4M7DD 5CAIA 2DZCA 4MMKA 5DY9A 5GANe 4QVDA 3JCMX 3RERA 4PJOA 1LJOA 4M78F 5GMKh 4M7DB 1B34B 3SWNC 1M8VA 5GAMd 4M77F 3SB2A 4PJOB 3VU3C 4DQ2A 4RCCA 3INZA 4EMKA 5GAOq 5LJ3e 1I81A 1D3BA 2VC8A 1X01A 3JCMP 4M7DF 2Y90A 4HA8A 4EMKB 3JCMW 3EFRA 2HNIA 1BIAA 4PJOF 4M7AE 1D3BB 3JCMf 1KQ2A 4M77G 4M78C 3V7SA 5LJ5g 4F7UG 2E64A 1Y96A 4M7AD 2DTHA 4XTUA 3BY7A 3JB9I 4M77C 3RUXA 5GANj 1LNXA 1YCYA 2DXUA 4M78A 1Y96B 3V8LA 4C92E 2YLCA 5GAN6 3FJPA 1JRIA 4JRKA 3EFSA 1I8FA 1N9SA 3QHSA 4XU0A 4PJOG 4QVCA 4XTXA 4C92D 4EMHA 2RA2A 4XU1A 1HXDA 3JCMQ 4PJOC 4M75E 4X9DA 3JCMd 5GAMh 5GANf 4XTYA 1WQWA 4NOYA 2EJ9A 4M75D 5GAOp 2K57A 1MGQA 2E65A 5GAN4 3JB9D 4EMKC 2CGHA 2FYKA 3V7RA 3JCMV 4J6WA 3M4GA 5GAOr 1M5Q1 2DZ9A 4J6XA 5LJ3f 5GAN5 4C8QE 4HT8A 3BFMA 5GANd 4HT9A 4C8QD 2DVEA 4M78G 3PGGA 1WQ7A 5GAMg 4V2SA 3HFNA 2JN0A 2VXEA 4F7UE 3GIBA 1KQ1A 4WF2A 4M7AA 2RM4A 5GAOn 3SWNA 4EMGA 1I5LA 4XTZA 5LJ3d 3JCMh 4M7AB 5LJ5e 4M7DG 2DTOA 4C92A 2FB7A 4PNOA 3QUIA 5LJ3j 1U1SA 3RKXA 3JCMc 4C92B 4M7AF 4M75A 4OP0A 4XU3A 5GANh 5GAN7 2EJGA 4M75B 3QSUA 4XTVA 5GAN3 4C92F 3JCMg 2DKGA 3L2ZA 5LJ5j 2VXFA 1TH7A 5GMKm 5GAOm 4A53A 4C8QA 5GMKj 3JCMe 4M75F 4M7AC 4N0AA 5LJ3h 3QO3A 3RKYA 4Y91A 3JB9F 2EJFA 4M77E 4C8QB 3JCMJ 4XQ3A 3FB9A 4JLIA 4NL3A 2E41A 3JB9H 4X9CA 2RD1A 4M77D 5LJ5f 2DEQA 3BDUA 2DTIA 4MMLA 4F7UA 4C92C 5GAMe 1WPYA 5GANg 3RKWA 4M7DE 2E1HA 1JBMA 5GMKe 4F7UB 2EAYA 4C8QF 3JB9G 4PJOE 2RB6A 4M75C 4PJOD 1BIBA 2DJZA 3RESA 1HK9A 1U1TA 3JB9J 2EWNA 4XU2A 4XTWA 2DXTA 2QTXA 4JRIA 5LJ3g 1H641 4F7UF 5LJ5d 2I2LA 4C8QG 3FIFA 2YHTA
chains in the Genus database with same CATH superfamily
4JUVA 2PVOB 4N0AC 1IHWA 1C0MA 1M90R 2J6KA 3NPFA 1X6OA 1NYGA 5GAOl 5L8RE 1KD1U 4M77B 3VS2A 5GANe 1JJ2A 5KH6A 2QQAA 2IVWA 5CIUA 3EGDB 1Y71A 7AT1B 2DXBA 3H41A 4KBMB 1D3BB 1E7OA 1C6VX 3TSWA 4FSXA 1NJIR 1Q7YC 4JJBA 3META 3CBMA 1H3HA 5I11A 3PVLA 4E2FB 3SHWA 2YWWA 3L2WA 3GPLA 5HKCA 3WVDB 2DE0X 1M3AA 2DM1A 2IG0A 3QDRB 1KQ1A 5GAOn 4EMGA 4M7AB 1W70A 2DD4A 1S72A 1QVGP 1U5SA 4CI0C 3LWIA 4M75B 3NTKA 2PTKA 2KT1A 4OB3B 8AT1B 5LJ5j 3J81E 2D8JA 1AWOA 3E9GA 3X28B 2NUPB 5LJ3h 3E19A 4PLIA 1MV0B 3VRYA 3EHRA 1QQJA 1D09B 2KROA 2LX9A 4C8QF 1PNJA 2QA4Q 4CC7A 3L2UA 1JU5C 3R6NA 2PNIA 5LJ5d 2XMFA 1VQ8Q 1ZQ1A 4OMFB 3LH5A 1KG1A 3OBYA 1RAEB 2I0NA 4AG1C 3OS2A 3MCAB 3QWYA 5C6SA 2F69A 3OYJA 1VQ7Q 2ZGWA 2E70A 1HD3A 1VUBA 5GMKl 1I1JA 3G7ZA 3CEYA 2OTLQ 5KYYA 1D0XA 1M3BA 2RK2A 2DIGA 3G71Q 2Y90A 4HA8A 4M77G 2DL4A 2AKLA 4XK8E 1NE8A 1VIEA 1TSFA 2K9GA 2IPOB 4M77C 2XKOC 2DF6A 2DXUA 4D8DA 3OYKA 1OQKA 3MP6A 4C92D 2B8AA 1ABQA 2LMJA 2KDSA 3M56A 5GAMh 3DKMA 1NG2A 2RQUA 4NOYA 3PIOA 4J9CA 2E65A 3UT1A 2DNUA 2KRMA 3SDZA 2DXCA 3VS7A 5LJ3f 1OX8A 4LN2A 5FROA 4A63B 2FZKB 4HT9A 3UF4A 3HPWA 2A28A 1N8RU 1N27A 3GIBA 5CQXA 1VQLQ 3M9QA 1UGPB 4JJNK 1X6BA 2HKNA 4IUTA 2P0KA 2CZ6B 2RJCA 4X34A 4M4ZA 4C92A 3PFSA 3M58A 5FRMA 1YITT 2H3EB 2XU8A 3QXEB 4MZPA 1QCOA 2CSIA 1W2BA 3CC2A 4HCCA 4M7AC 2AT1B 1QP2A 2KK4A 4ME7A 2EJFA 2X4JA 3D7SB 4BY6B 2LCSA 1C1AA 1Q82R 4NL3A 2H3JA 4OB1B 5J39A 3VJPA 5HK3A 3BDUA 1RABB 2QEXT 2ZPEB 4M75C 5I2MA 3NTHA 1BIBA 3A98A 3UA6A 4OMLA 3FRNA 1K9MR 4C5GA 1Z9ZA 2PVGB 3CCLQ 1EZZB 1FMVA 4QW2A 4Z88A 2LQWA 1Q86U 4BUGA 3V7CA 5C0MA 5GMKi 1AEYA 4AFSC 2PU9B 3JCMb 1WNLA 1J3TA 5GAMf 4C92G 1YJ9A 1YP5A 3V8JA 4P5NA 3A8OB 5CAIA 2DZCA 2RQWA 2HQEA 1IGQA 2QEXA 2CZ7B 1NBEB 2HD0A 1AVZC 4LE9A 2FPEA 5EG2A 2VC8A 4M7DF 3L2RA 4PJOF 4QKUA 4KT0E 5LJ5g 3H0FA 4MDXA 1YCYA 5GAN6 3RNJA 1RAHB 1GCQC 4ELYC 1HXDA 2JMCA 4IUPA 1ZBXA 2HQHA 1EX4A 1M5Q1 2JTEA 1VQ6A 1RI9A 1UGRB 1JXMA 1WQ7A 2A0FB 1WXTA 2M0OA 2K5FA 1N8RC 3ZBDA 2JMAA 2AKKA 3I9QA 4Y28E 4PNOA 4BDYA 1XJWB 2MWOA 3J7AF 4RTUA 3L2VA 4JZ4A 4CRIA 2FRYA 2DKGA 5FU6B 2KYMA 1XTDA 4Z89A 2P4TA 2DRKA 1B3QA 2QA4T 4C8QB 3TCJA 4ZNXA 1XQHA 4DEYA 2DEQA 2MYSA 2RJEA 1VQ8T 4OGEA 2ATCB 3SEMA 3PVQA 4XAXB 2JVVA 3OYYA 1LPLA 2DVJA 1VQ7T 3RIRA 1K0SA 4OMOA 4AFQC 1JB0E 4BY6C 3OYIA 5I21A 4J7IA 3C4SA 2R5MA 1RADB 1PG5B 1Q86C 2OTLT 2DK3A 2LJ1A 3HFOA 4II1A 1QP3A 2MI6A 1V76A 4QT7A 4YTLA 4DOWA 2QA4A 3G71T 3DB3A 1NPRA 2KYBA 3RERA 4D6WA 2C06A 1M8VA 2HSEB 2YUQA 1X01A 3JCMP 1VQNQ 1ZBJA 1VQ7A 2X4XA 1M2VA 3I56Q 3OYLA 1IB8A 5I2SA 1JRIA 2WSEE 4LDYA 1VQKA 4V2SA 2OTLA 2EW3A 2Y4YA 4JPBW 2JM9A 4XTYA 1JO8A 3GF5A 2SEMA 2D0NA 1T0HA 4JDSA 3G71A 1AZEA 1VQLT 2FPDA 1AT1B 1M27C 3KXTA 1MMAA 2P84A 1OZ2A 2CUDA 3HL8A 1ZUKA 1GCPA 2VYTA 1WJRA 3SD4A 1Z9QA 2WSFE 1NYFA 3MJXA 1SPKA 2EYXA 4OP0A 1QWEA 3M5AA 1S72Q 2EYZA 3RMSA 2HKQB 3QIIA 3OS5A 4DOVA 3A1PA 2QI2A 1QWFA 1KQSP 1ZSZA 2CP3A 4BI3A 4JZ3A 1VQLA 3JB9F 4F04B 3EH1A 2LP5A 1BK2A 1OPKA 4N4GA 4RTXA 1OYXA 1YBYA 2JNGA 3EGXA 2ZPFB 4AG2C 2KAFA 5FU6C 4PJMA 2DX1A 4F7UF 3OB9A 1VQMA 4C8QG 3SWNA 4DEXA 5KYUB 4ZN3A 4C8QC 3PT9A 2GCXA 3EFOA 4OB0B 3CCVA 3CC4Q 1WJSA 2CP6A 4ELZC 1TG0A 2P0PA 4FCYA 4WCIA 3PTAA 2NUTA 4M7DB 2CREA 4PJOB 3O5ZA 4OF1A 2L0AA 2PVDB 1WHKA 3H8ZA 1VYUA 5FU7C 3V7SA 2LNVA 2RHIA 4MZMA 1FX7A 3LH0A 1M1KR 1Y96B 3V8LA 2CS7A 3LLRA 1H8KA 4RTTA 1WZOA 5CVIA 5A0GA 1YJWQ 3I55Q 2HL5C 2AK5A 3N5BB 4J9EA 1Q81R 1UGSB 3X24B 5KYXA 4J6WA 1G2BA 3QJYA 4B6MA 4J8OA 1G3YA 3OSSC 4M78G 2NYSA 1LCKA 2CP2A 2RM4A 1PRLC 1XNIA 4C0GA 2XHCA 5LJ3d 5LJ5e 2JTMA 3QUIA 2E5QA 1SEMA 2EJGA 3KUFA 2GFAA 4ORZA 1BU1A 1MMDA 1ZHIA 3QO3A 4FYWB 4N0AA 4Y91A 2DIQA 2ZPHB 3CC2Q 4GBQA 2HBPA 2E41A 1M9SA 2XDPA 2X4WA 4F14A 1OV3A 2ESWA 4A4KA 2O4XB 2L5QA 1SKUB 3OW2S 4JRIA 3CXCP 3MKDA 2K2MA 2DYBA 2KQWA 5GAMj 1X75C 1YN8A 4FYYB 1FWZA 5A2QE 1TUCA 1R0BG 2KNBB 1K1ZA 1K9AA 1AD5A 1GRIA 2EYYA 1YWPA 2HMAA 1YJ9Q 2YT6A 4B9WA 1VQNT 3QYGB 3JCMX 1NM7A 3GNFB 1SRLA 3E9FA 4ZGDB 1M3CA 3MP1A 5GAMd 3I56T 2QEXQ 3OY9A 4PFZA 2EBPA 3HKSA 2XI9A 2JT4A 2K3XA 3MO8A 2AIRB 4AFUC 1P92A 2GTJA 1KFZA 1QVFA 5HK0A 4C92E 2YLCA 2EGAA 4PJOG 2V8JA 2LT4A 4M7DC 5CK9A 4PJOC 2K5IA 3QDFA 2LCCA 1ZUUA 4JS4A 1TUGB 1VQNA 2DL5A 4A4HA 3EG9B 3I56A 1VQ6Q 1X27A 2B86A 4E6RA 5AT1B 3JCMh 1S72T 2LRQA 2OAWA 4R0KA 3ULRB 4E7LA 3CPWS 2VV5A 3CD6Q 5IXFA 2ZAEA 2R57A 1WFWA 1N5ZA 2HBWA 4LUEA 3CCMQ 2YRDA 1R8OB 2MPXC 1VQOA 3VUZA 3QBYA 2C0TA 1AOJA 4FT2A 2EFIA 5KYNA 3M59A 1JJ2P 2OJ2A 4M77D 2DPPB 2CZ0B 5DLQE 1WYXA 1YWOA 1JBMA 4F7UB 2RB6A 3DLMA 4F17A 3PMIA 3JB9J 2DXTA 5LJ3g 4JS5A 1O9SA 2HZYA 5GAN2 3CC4T 2DMOA 2NWMA 4PK4A 1JEGA 2E10A 3VV0A 2KRNA 4JJDA 3VYGA 4M77A 3MEUA 3GP8A 2R5AA 4ESRA 3SFMA 3TSZA 3OA6A 2EQMA 2KI7A 2RNAA 3EGDA 3OYGA 3OS0A 1D3BA 1WHMA 3HRUA 3JCMf 3JAME 1YJWT 3I55T 3ZL7C 3CC4A 4M7AD 5CQYA 1LNXA 5EC7A 3M0UA 3LX7A 5FWBA 1ZUYA 5HCKA 3FJPA 1N9SA 2FVUA 3QZ5B 2DO3A 2QK0A 4FU6A 1VQKQ 3E1SA 4M75D 1D0ZA 5GAN4 4PJJA 2HDAA 1QKXA 3VS5A 2ED0A 1K73R 2DZ9A 3QG1A 4J6XA 5GAN5 1MV3A 1DJ7B 1GFCA 2GFUA 2BZXA 3S6WA 5IHIA 1AWXA 2RHYA 2CKKA 3CCSQ 5GAMg 3OS1A 1ACMB 4M7AA 3THKA 1I5LA 1TOVA 3A8LB 2YUNA 1YJWA 3I55A 1UHCA 3MHXA 4E7KA 2KMTA 1U1SA 1W1FA 2L2PA 2JOYA 4RG8A 4M75A 4LD9K 1PKTA 2O9SA 2RO0A 3CC2T 2ABLA 1WIEA 4OGCA 2NUPA 5LL6S 4J9DA 4PJNA 4AT1B 1Q7YR 3P8HA 2CP7A 4FW1A 4E7HA 4DBQA 6AT1B 3JB9G 4KGVB 2DJZA 3RESA 2RPNA 1H641 3X25B 2YHTA 1PD1A 5FW9A 4AMCA 3LWHA 1VQMQ 9ATCB 3WXMB 4M7AG 3VYHB 2LJ3A 1YJ9T 2AZVA 4JRQA 2K3YA 2M9UA 3CCVQ 2MAMA 1PWTA 4LD6A 4M75G 2O88A 5DY9A 1ZX6A 3P8BB 1B34B 1BBZA 2QG9B 1AZGB 5GAOq 1I81A 3CQTA 1BIAA 3A8MB 2DTHA 4XTUA 3EFSA 2W10A 2DERA 1RAFB 2HCKA 3I5SA 2COYA 4E47A 1W2BP 2K5LA 2KBTA 1VQ6T 2O01E 1VIFA 2GGRA 4ZTJA 2CT3A 3G6EQ 1E6GA 2YUPA 2DVEA 2WSCE 3I5RA 1QVFS 3CD6T 2COWA 3QYHB 3CCMT 4QVZA 2X4YA 5A0DA 1A0NB 4BE1A 1KD1R 2RF0A 1YIJA 2QGGA 1UDLA 2L3RA 5CO7A 3U23A 4BACA 3H0HA 2R58A 1UGQB 4A53A 4EIKA 3JCMe 2OX7A 1M8MA 3JCMJ 3EG0A 3OYEA 2RD1A 5KE2A 4IIMA 2XDBA 2KR3A 2L89A 3CD6A 3FEOA 2RI3A 4HVUA 4RKUE 3CCMA 2XK0A 2BUDA 4J9HA 1AWJA 3OW2A 1QVGS 4J6YA 3BW1A 3OBWA 2QQ9A 3EAEA 1IHVA 2ZZDA 1M1FA 4J9BA 3VS3A 1G3SA 3X20B 2XD0A 2O31A 1UG1A 3V8KA 2OI3A 4CC4B 3A8GB 4QVDA 1K8AU 1ARKA 1W4SA 2RHUA 1B07A 2QYZA 2ZPIB 3PNWC 5A0LA 5LJ3e 1FMWA 2KVQG 1SSFA 2FZCB 1B7TA 2KSSA 2DLPA 1ZA2B 1VQKT 2KT8A 4C5IA 3BY7A 3RUXA 4ZGJB 2F2XA 1OOTA 5CR2A 5FU7B 4XU0A 1YNZA 4X9DA 1YHQA 4F16A 2FZGB 3MP8A 3CCST 2FYKA 3JCMV 3OSVA 2CZ1B 3TEEA 1M90U 1BYMA 2E12A 4C8QD 1QCNA 3C12A 2VVKA 5FWCA 2EGCA 2JW4A 1TU0B 1D1BA 2LT1A 1TS9A 3G4SQ 4HCBA 2FEIA 2D9TA 1F1BB 3CPWA 2VKNA 1M1GA 5IAYA 2LTOA 4Y92A 5GANh 3OYFA 5L23A 5KYWB 2V8KA 1VQOQ 3CCSA 4A4EA 5CCAA 2DFUA 4C8QA 1NJIU 1NLPC 4JLIA 2KY9A 5GAMe 1GBRA 1GL5A 2LDMA 2QQSA 2YDLA 1SSHA 4JRPA 2J06A 5KE3A 2NLUA 1VQMT 2CP5A 4IUVA 2PUKB 4NL2A 1WLPB 1GBQA 3CCVT 2M16A 4FW2A 3QJ6A 2DL7A 3NTIA 2M51A 4M78D 1N8RR 4J7FA 2LZ6B 3CPFA 3J80E 3S3OA 2O9VA 2KRSA 1MNDA 4RUGA 4RTZA 1X69A 1SHGA 3VU3C 5DLOA 1K8AC 4PKCC 2E3IA 2V1RA 4EMKB 3JCMW 2PZ1A 2KE9A 5IH2A 1UECA 2A36A 2K79A 4M78A 5D6WA 2DJQA 2D6FA 2J05A 2COZA 3QHSA 2RI2A 4QQ6A 3CCQQ 2BKDN 3OYMA 3JCMd 5GANf 3G6ET 2YRVA 2O2OA 2F1LA 3M4YA 5IXBA 3BE3A 4LDVA 1UHFA 3LYIA 4HT8A 1KC8R 1U3OA 4FSSA 4MZTA 3VS4A 1O75A 4LDWA 3CCRQ 1M90C 1Q86R 2BZ8A 1UFFA 4WF2A 4EPCA 5IT9E 1NLOC 3R6OA 3ME9A 1CKBA 1WA7A 1KJWA 1OU9A 2EQJA 5LJ3j 3H9NA 1VYTA 2EQIA 1BCOA 4XU3A 4KUIA 3G6EA 4AFZC 3OYAA 1WDXA 4C92F 4CC2A 3REAB 2X3WD 1W6XA 3OMGA 4A4FA 5AYFA 2EIFA 2K3BA 2X51A 4M77E 4RTYA 4QQDA 4XQ3A 3FB9A 1PRMC 1NJIC 2DTIA 3TVTA 2E1HA 5J3BA 1WJQA 4PJOD 1HK9A 1CKAA 1OZ3A 1U1TA 3S3MA 1ZA1B 5KYUA 4Z8AA 1OULA 2HEQA 1AWWA 4PL6A 4Z02A 2XIDA 2VGMA 3G1JA 2ECZA 5IN1A 3HTRA 3VUBA 3RMQA 2OTJQ 2XICA 1MMGA 2EKHA 3TU4K 1Y07A 1IRXA 1NPPA 2LX7A 4ATOA 4R55A 1PSFA 4M7DA 1BI2A 4PJOA 3L2QA 1BKBA 1Y57A 4DQ2A 3UATA 1LVKA 1UEBA 4N4HA 1QVPA 1Q82U 2HAXA 4M7AE 2LNHB 1YJNQ 2MOXA 4L59A 1Y96A 4O6JA 4DBRA 3JRZA 3M0QA 1I8FA 3Q1JA 3EHQA 1K9MU 2SRCA 2JXBA 4M75E 3CC7Q 2C0IA 4JLGA 4EMKC 2CGHA 4E7SA 1VA7A 3NHNA 4BE2A 1RI0A 5DM7R 3G4ST 4FIBA 2XG8D 3GOXA 2XDDA 4CC3A 4E7JA 4LDXA 3WVEB 1PKSA 5CKFA 1MMNA 2EQKA 5IHKA 2DL3A 4M7DG 4OMPA 2Y4XA 3EG3A 4A4GA 1VQOT 2E6NA 1X2KA 1UB4A 3JV3A 3OYCA 3MEAA 4HKEA 4IIOA 1YIJQ 2ENMA 2RJDA 3JCMg 3L2ZA 1VQPA 1VQ5Q 2X3XD 3RKYA 1FYNA 1WHHA 1VQ4Q 3JB9H 1ZSGA 3G4SA 2ROTA 2LVMA 2NUZA 1G83A 2E6ZA 2O4XA 2MMPA 3CBPA 3ER0A 4EDUA 1FXXA 1NZ9A 2QTXA 2EPDA 2P0QA 1PHTA 2RQRA 5GJWB 1QVFP 3HRTA 1QVGA 2PQWA 3LW5E 1V29B 2DRMA 3BDLA 3FC3A 2KXDA 3AHUA 1KQSS 1YI2Q 2LC4A 4RCBA 3PMTA 4DBFA 1PSEA 5KCHA 3RR6A 4KRTA 5IHNA 3FDRA 2Z0WA 2VASA 2RHZA 5D6YA 3X26B 4PFPA 4NS5A 5KYYB 4PLLA 2JJ9A 2VB6A 1CSKA 1MUZA 4KGXB 2GQIA 2FPFA 3CCQT 3H0IA 1Q82C 4C5HA 3EG2A 3UDCA 4HCZA 1TTHB 4QVCA 3JCMQ 1KIKA 2RA2A 1IGUA 4KULA 3M55A 3L42A 1SHFA 1WQWA 5GAOp 1K9MC 3CCRT 3JB9D 1AHJB 1YHQQ 3M4GA 1G3WA 1OX9A 3EG9A 3JSCA 1T0JA 3M0SA 2RH2A 3CBOA 4LXCA 1SRMA 2DETA 1ABOA 4FL6A 1UE9A 3CCQA 4OVAA 1BI0A 4ANJA 4OMQA 1BI3A 1QCFA 2MIOA 4FT4A 2JS2A 2VWFA 4C5EA 5ECAA 4C92B 4PFOA 2L3PA 5FLXE 3VS1A 2HL3A 1T3LA 2YUOA 3CCRA 1GFDA 2K6DA 2QASA 1KHIA 3F70A 5FRNA 1I0CA 4F7UA 3ZEHA 3NGPA 2ZPGB 1KD1C 2F2WA 4KH0B 4XTWA 2OTJT 2M1HA 3E2UA 2JTFA 2MCNA 2I2LA 1VOMA 1PM3A 3TQ7P 4GLMA 2L3SA 4DBHA 3EH2A 3CCJQ 1QW1A 1TXQA 4KUDK 4A54A 4BI4A 1LOJA 4FYVB 1E6HA 5GAN8 3M53A 1QLYA 1S1NA 3VS0A 2HSPA 4M78F 5GMKh 4IUUA 1YJNT 3CMEQ 1G3TA 4LUDA 4UC4A 1HJDA 2J7IA 1X6GA 3CXCS 2RN8A 2OTJA 2IIMA 3CC7T 1WHGA 4F7UG 2E64A 3MEVA 2CUBA 3JB9I 5GANj 2LQNA 2E5KA 2MWPA 2QXFA 1FMKA 1D1AA 4ZTFA 1EFNA 1QMCA 1GCQA 4BI8B 2A7YA 5GAOr 5CKDA 1K0XA 1Q95G 4C8QE 1Y0MA 1YCSB 2F5KA 5GANd 1YJNA 3NMZC 3HRSA 2YSQA 2DAQA 3C95A 1WI7A 2DTOA 3AT1B 3CC7A 1YIJT 2KGTA 4HCKA 4VUBA 1VQ9Q 3VRZA 1VQ5T 1KC8U 2V1QA 1VQ4T 1YITA 2K7AA 4XTVA 5GAN3 4DA4A 3UWNA 3FLGA 1RACB 1TH7A 3OQ5A 3ZFJA 1M1KU 4JJCA 3PE0A 2DYIA 2CYZB 1UGVA 3LGFA 1R77A 4R56A 4C92C 4BD3A 3OMCA 1UTIA 2JZ2A 1Q81U 2EAYA 4ZN1A 2EWNA 4XU2A 4KGZB 3M0TA 1D1CA 1H92A 1YI2T 1RAGB 1OEBA 2YLBA 1IREB 3M54A 2C0OA 1VQ5A 4X1VA 2JM8A 1VQ4A 1BCMA 1WHJA 2WACA 4M78E 2E3HA 8ATCB 3HHTB 3IQLA 2QQBA 1I4K1 3CCUQ 2RI5A 2YXYA 3TREA 1JJ2S 3DLLA 5LJ5h 1B34A 4IKFA 4HVWA 1LJOA 1X2QA 3LGLA 2RHXA 3EG1A 2L3QA 3SB2A 4OMNA 2ED1A 2D0QB 2VGNA 5D6XA 2HNIA 2YRCA 2A08A 1KQ2A 4E7ZA 1YI2A 2MK5A 1M2VB 1YHQT 5CKBA 4JRKA 5KCOA 2DEUA 2GTOA 2RQVA 3GLXA 3URGA 3CMAQ 4EMHA 1UJYA 3A8HB 4C0DB 1XOVA 1MGQA 2LJ0A 1H3ZA 3OYDA 2DD5A 1QKWA 3V7RA 3BFMA 2GBQA 3GNGA 1MNEA 1YFNA 3PGGA 4L6V5 1KK7A 3HFNA 2JN0A 4J9GA 5CKHA 3OW2P 4BB7A 2K2VA 4TVRA 1R0CB 3RKXA 2D8HA 4O5VA 2CH4A 4RG2A 3CCEQ 4L5GA 2E4HA 4OMMA 4RMOA 1KC8C 2VXFA 2QDLA 1OPLA 3ASKA 1ZSZB 1TUDA 3RBBB 2AZSA 1VQPQ 3HP9A 1M1KC 1UUEA 5LJ5f 1G8XA 3OYHA 1WPYA 5GANg 4M7DE 4PJOE 1IZ6A 4GLKA 2CT4A 3H6ZA 4PJLA 1VQ8A 1JQQA 1Q81C 3CCJT 3VKIA 3EGXB 2DBKA 2AHJB 2QTVA 2RMOA 3FIFA 3L1AA 3UPUA 3SWNB 1SG5A 2G3RA 4J5YA 3O8VA 4WTOB 3NFCA 1N9RA 1RUWA 1KQSA 3EFOB 1JXOA 4M78B 3CMET 1MHNA 2P4RA 1TWBA 4C0ZA 2NUTB 2BIVA 4M77F 4RCCA 1I5OB 3INZA 1D0YA 3CCJA 3EFRA 4J9FA 1RL2A 2M02A 4J83A 4FM4B 1HYOA 2GNCA 3CPWP 1WGSA 3QKJA 5GMKe 4XU1A 2G6FX 2J6FA 2V8IA 3QPHA 3M0PA 4N4IA 3CMEA 2KXCA 1EIFA 2BTTA 2BE9B 3KBGA 2PUOB 3M0RA 3S3NA 2BE7D 5J26A 5KYXB 2L8DA 1OU8A 3UA7A 2RJFA 2EKOA 1BI1A 1RLPC 1KSWA 1VQ9T 2JUFA 4E7IA 1RAIB 4XTZA 4C0DC 3CCLT 2FG0A 4HVVA 2CH4W 2KEAA 2M0YA 1N6AA 2FB7A 1G5VA 3EGUA 2D1XA 4LNPA 3T9NA 4M7AF 1IO6A 1BB9A 1M30A 1PD0A 2FHDA 5GJVB 3QSUA 5KYWA 3QWXX 1W2BS 2QGFB 3PIPA 5GAOm 4M75F 3OYBA 2HQXA 2LQ8A 2CSQA 2ROLA 1NEBA 1WX6A 4MMLA 2GQVA 3RKWA 2A3LA 1VQ9A 2JS0A 1OI1A 4BE0A 2X35A 4RTWA 2DBMA 1K73U 3CCLA 2W0ZA 4B9XA 2QDYB 3DB4A 1ZSZC 5CKEA 4C0FA 2LQKA 1PC0A 3CCUT 4RTVA 4IURA 4Q5WA 3HSBA 1UJ0A 3C0CA 1ZLMA 4K11A 1KHCA 1T3SA 2FRWA 3M57A 2DL8A 4M7DD 4MMKA 5M9OA 1Y7XA 3SWNC 1GXIE 1U06A 2RK1A 4HXJA 2BZYA 4EMKA 3QZ9B 1V1CA 1K4US 2X9HA 5D7UA 2ZCFB 4IUQA 3CMAT 1Q7YU 1WHLA 3MEWA 4M78C 3CXCA 2A37A 2QQRA 2CP0A 2H8HA 3P8DA 2EGEA 2FO0A 3FJ5A 3CCUA 1IXDA 2EYWA 3VS6A 4QQGA 4OB2B 1K76A 4XTXA 1U8RA 2F5TX 3GBQA 3MPUB 2K4YA 2EJ9A 2K57A 1NEGA 1RAAB 2LCLA 4LDUA 2FL7A 5I22A 1M4ZA 2QAZA 3C94A 2CDTA 2VXEA 4F7UE 3I35A 1I07A 2VUBA 2EYQA 1PCXA 2EVRA 4KH1B 3CCET 3CMAA 2V26A 4MDWA 2OAUA 3A5ZB 2RQTA 3JCMc 1SF9A 2DA9A 1RLQC 5GAN7 1HSQA 1VQPT 1M2OA 4ZGEB 4BDZA 1K8AR 1WXUA 1YITQ 5GMKm 1WXBA 2GF7A 4D8KA 5GMKj 1X43A 3KFVA 2EQUA 5HY6A 2F2VA 4GY5A 2DILA 4X9CA 2ZPBB 4FYXB 4J9IA 2MF2A 3CCEA 3RDVA 3REBB 1VYVA 2J6OA 3OYNA 1K73C
chains in the Genus database with same CATH topology
4JUVA 4ZN3A 4C8QC 2PVOB 4N0AC 4J6YA 3BW1A 3OBWA 1QW1A 3PT9A 2QQ9A 4KUDK 3EAEA 2ZZDA 3X20B 1M1FA 2GCXA 2XD0A 1G3SA 1X6OA 4OB0B 4A54A 4BI4A 3CCVA 1WJSA 1LOJA 5GAOl 5L8RE 3V8KA 4ELZC 1KD1U 2P0PA 5GAN8 4M77B 3M53A 3A8GB 5GANe 4QVDA 3PTAA 1JJ2A 5KH6A 4M78F 5GMKh 1K8AU 4M7DB 4IUUA 2QQAA 1YJNT 2IVWA 4PJOB 1G3TA 1W4SA 2RHUA 5CIUA 4UC4A 1Y71A 2ZPIB 4OF1A 2DXBA 3PNWC 2PVDB 5A0LA 5LJ3e 2KVQG 3CXCS 1SSFA 2OTJA 3H8ZA 4KBMB 5FU7C 1D3BB 2KSSA 3V7SA 3CC7T 1VQKT 4F7UG 2E64A 2LNVA 4FSXA 3MEVA 4C5IA 3BY7A 2RHIA 4MZMA 1FX7A 3RUXA 4ZGJB 3JB9I 5GANj 3LH0A 1Q7YC 1Y96B 3META 3CBMA 3V8LA 5CR2A 2CS7A 3LLRA 5FU7B 2MWPA 4XU0A 2QXFA 5A0GA 5CVIA 4ZTFA 4X9DA 1YHQA 3N5BB 3MP8A 4BI8B 1UGSB 3L2WA 2A7YA 3CCST 2FYKA 3X24B 3GPLA 1K73C 3JCMV 4J6WA 5CKDA 3OSVA 5GAOr 3QJYA 3WVDB 2CZ1B 5HKCA 3TEEA 1M90U 4C8QE 1BYMA 2F5KA 5GANd 2E12A 4J8OA 1G3YA 3OSSC 4C8QD 2IG0A 3C12A 4M78G 1YJNA 3HRSA 3QDRB 1KQ1A 2RM4A 5GAOn 2DAQA 2LT1A 3C95A 4EMGA 1XNIA 4C0GA 2XHCA 5LJ3d 4M7AB 5LJ5e 2JTMA 2DTOA 4HCBA 3CC7A 1YIJT 2D9TA 2DD4A 3QUIA 1S72A 4VUBA 3CPWA 2E5QA 1VQ5T 1KC8U 1M1GA 5IAYA 2LTOA 4CI0C 5GANh 2EJGA 4M75B 3OYFA 3NTKA 3LWIA 1VQ4T 1YITA 4XTVA 5GAN3 3KUFA 4DA4A 4OB3B 3UWNA 5LJ5j 2V8KA 3FLGA 2GFAA 3J81E 1TH7A 4A4EA 5CCAA 3CCSA 3E9GA 3X28B 3OQ5A 3ZFJA 4C8QA 1NJIU 4N0AA 1ZHIA 3QO3A 5LJ3h 1M1KU 4Y91A 2DIQA 2ZPHB 3E19A 4PLIA 4JLIA 2HBPA 2E41A 1M9SA 2CYZB 2KY9A 3LGFA 2XDPA 5GAMe 4R56A 2X4WA 4BD3A 3OMCA 4C92C 2LDMA 2LX9A 2QQSA 2JZ2A 4A4KA 2EAYA 4C8QF 4ZN1A 4JRPA 1Q81U 2O4XB 2L5QA 5KE3A 2NLUA 1VQMT 2EWNA 4XU2A 3L2UA 3OW2S 4JRIA 5LJ5d 1YI2T 1ZQ1A 4OMFB 1KG1A 2YLBA 2KQWA 4IUVA 1IREB 3M54A 1X75C 5GAMj 2PUKB 1FWZA 5A2QE 4NL2A 1VQ5A 3OBYA 3CCVT 1VQ4A 2WACA 2M16A 3OS2A 3MCAB 4M78E 3QJ6A 5C6SA 2F69A 3NTIA 3OYJA 2ZGWA 4M78D 2E70A 1VUBA 4J7FA 3HHTB 5GMKl 2QQBA 1I4K1 3CPFA 3J80E 2RI5A 3TREA 1JJ2S 3S3OA 3DLLA 3G7ZA 5LJ5h 1B34A 3CEYA 4B9WA 4IKFA 3QYGB 3JCMX 1VQNT 1LJOA 2RK2A 3GNFB 3E9FA 4ZGDB 3LGLA 2RHXA 3MP1A 5GAMd 3I56T 3SB2A 2DIGA 3VU3C 5DLOA 1K8AC 4PKCC 3OY9A 2D0QB 2VGNA 2Y90A 4HA8A 5D6XA 4EMKB 3JCMW 2HNIA 3HKSA 1KQ2A 2XI9A 2K3XA 4M77G 3MO8A 1YI2A 4XK8E 1NE8A 1P92A 1VIEA 4M77C 1QVFA 2XKOC 2DXUA 3OYKA 4M78A 3MP6A 5HK0A 1YHQT 5D6WA 2YLCA 4C92E 2D6FA 5CKBA 4JRKA 4PJOG 3QHSA 2V8JA 2LT4A 3URGA 2RI2A 3GLXA 4QQ6A 4C92D 2B8AA 4EMHA 5CK9A 4M7DC 4PJOC 2KDSA 2BKDN 2K5IA 3M56A 3DKMA 3JCMd 5GAMh 5GANf 2YRVA 3A8HB 3OYMA 3G6ET 4C0DB 2LCCA 3M4YA 4NOYA 3PIOA 1XOVA 1MGQA 2E65A 1H3ZA 3UT1A 3OYDA 2DD5A 3V7RA 4JS4A 4LDVA 3SDZA 2DXCA 1VQNA 5LJ3f 3LYIA 4A4HA 4HT8A 5FROA 3BFMA 3GNGA 4HT9A 3HPWA 3I56A 4MZTA 3PGGA 1O75A 4LDWA 1N8RU 4L6V5 1M90C 3HFNA 2JN0A 3OB9A 1N27A 3GIBA 5CQXA 4WF2A 4EPCA 5IT9E 3M9QA 1UGPB 3R6OA 3ME9A 3JCMh 4JJNK 1S72T 2LRQA 5CKHA 4IUTA 2P0KA 2CZ6B 2RJCA 4X34A 4E7LA 4BB7A 4C92A 3CPWS 3PFSA 2K2VA 2VV5A 3M58A 2EQJA 4TVRA 5LJ3j 1YITT 5FRMA 3RKXA 2R57A 4O5VA 4RG2A 2XU8A 1R8OB 3QXEB 4L5GA 4XU3A 1VQOA 4KUIA 3G6EA 4MZPA 3VUZA 3QBYA 3OYAA 4C92F 4RMOA 1KC8C 1W2BA 2VXFA 4A4FA 3OMGA 3CC2A 5AYFA 4HCCA 2EIFA 3ASKA 4FT2A 2EFIA 4M7AC 1QP2A 2KK4A 3M59A 4ME7A 2EJFA 2X4JA 4M77E 4BY6B 4QQDA 4XQ3A 3FB9A 4NL3A 2H3JA 4OB1B 5J39A 3HP9A 3VJPA 5HK3A 1NJIC 1M1KC 4M77D 2DPPB 2CZ0B 3BDUA 2DTIA 5DLQE 5LJ5f 3OYHA 1WPYA 5GANg 2QEXT 4M7DE 2E1HA 2ZPEB 1JBMA 4PJOE 1IZ6A 4F7UB 4GLKA 2RB6A 3DLMA 5J3BA 4M75C 1WJQA 5I2MA 3NTHA 4PJOD 1BIBA 3H6ZA 1HK9A 1OZ3A 1U1TA 3FRNA 3PMIA 3JB9J 1VQ8A 4C5GA 3S3MA 2DXTA 1Q81C 3CCJT 2PVGB 5LJ3g 3VKIA 4JS5A 1O9SA 2AHJB 3FIFA 3L1AA 4PL6A 4QW2A 5GAN2 3CC4T 4Z02A 3UPUA 1Q86U 2XIDA 4BUGA 2VGMA 3SWNB 5IN1A 3VUBA 3V7CA 5C0MA 2G3RA 4J5YA 3O8VA 5GMKi 3NFCA 3RMQA 2XICA 1N9RA 2PU9B 3JCMb 1WNLA 2E10A 3VV0A 5GAMf 3TU4K 4C92G 3VYGA 1KQSA 1Y07A 4M77A 3MEUA 3GP8A 4M78B 1NPPA 3CMET 1YJ9A 1MHNA 2R5AA 3V8JA 4R55A 4ATOA 3SFMA 4P5NA 1PSFA 3A8OB 4M7DA 3OA6A 1BI2A 5CAIA 2DZCA 2HQEA 4PJOA 2QEXA 2CZ7B 3L2QA 2EQMA 4C0ZA 1BKBA 2HD0A 2BIVA 4M77F 3OYGA 4DQ2A 4RCCA 3INZA 3OS0A 5EG2A 1D3BA 2VC8A 4M7DF 3L2RA 3CCJA 1UEBA 4N4HA 1QVPA 3EFRA 4PJOF 1Q82U 2HAXA 3HRUA 3JCMf 1RL2A 3JAME 1YJWT 3I55T 4J83A 4M7AE 4FM4B 4KT0E 4L59A 1Y96A 5LJ5g 3CC4A 4M7AD 4MDXA 4O6JA 5CQYA 1LNXA 1YCYA 3JRZA 1WGSA 3LX7A 5GAN6 3FJPA 3QKJA 1I8FA 1N9SA 2FVUA 3Q1JA 3QZ5B 2DO3A 5GMKe 1K9MU 4XU1A 4ELYC 1HXDA 4FU6A 4M75E 4IUPA 3E1SA 1ZBXA 2V8IA 3QPHA 4N4IA 4M75D 3CMEA 1EIFA 5GAN4 4JLGA 3KBGA 2CGHA 2PUOB 4EMKC 4BE2A 3S3NA 1M5Q1 1RI0A 2DZ9A 3QG1A 4J6XA 5J26A 5DM7R 5GAN5 1VQ6A 1UGRB 1DJ7B 2L8DA 2GFUA 3G4ST 2RJFA 3S6WA 2EKOA 2XG8D 4FIBA 1WQ7A 1BI1A 2RHYA 3GOXA 2CKKA 2XDDA 5GAMg 4E7JA 4LDXA 3WVEB 3OS1A 5CKFA 1VQ9T 4M7AA 2JUFA 2M0OA 4E7IA 2EQKA 1I5LA 2K5FA 4XTZA 3A8LB 1N8RC 4C0DC 3CCLT 4M7DG 1YJWA 3I55A 2Y4XA 3MHXA 3ZBDA 1N6AA 2FB7A 4A4GA 4E7KA 1G5VA 4Y28E 4PNOA 2KMTA 1U1SA 4RG8A 3T9NA 2JOYA 2MWOA 2E6NA 4BDYA 1VQOT 3J7AF 4M7AF 3L2VA 4M75A 1UB4A 3OYCA 1QVGS 4LD9K 3MEAA 4HKEA 2FHDA 2RO0A 4CRIA 3CC2T 3QSUA 1W2BS 2RJDA 4OGCA 3JCMg 2DKGA 3L2ZA 5FU6B 3PIPA 5GAOm 1XTDA 2P4TA 1VQPA 4M75F 3OYBA 2HQXA 2LQ8A 3RKYA 5LL6S 2QA4T 4C8QB 3JB9H 3P8HA 3TCJA 3G4SA 1XQHA 2DEQA 2LVMA 4MMLA 2GQVA 2E6ZA 4E7HA 2O4XA 3RKWA 2RJEA 1VQ8T 2MMPA 2A3LA 3CBPA 1VQ9A 4OGEA 3JB9G 3ER0A 1OI1A 4BE0A 2X35A 4EDUA 2DJZA 3RESA 1FXXA 1K73U 1NZ9A 3CCLA 4XAXB 4B9XA 2JVVA 2QTXA 1H641 2P0QA 3OYYA 3X25B 2QDYB 1VQ7T 2YHTA 3DB4A 5CKEA 3RIRA 4C0FA 3HRTA 1JB0E 3LWHA 4BY6C 2LQKA 3OYIA 5I21A 4J7IA 1QVGA 2PQWA 3LW5E 3C4SA 3WXMB 1V29B 3CCUT 3VYHB 4M7AG 4IURA 3BDLA 2R5MA 4Q5WA 3FC3A 3AHUA 3HSBA 1YJ9T 1Q86C 2OTLT 1KQSS 4JRQA 2DK3A 2LC4A 3HFOA 4RCBA 3PMTA 1QP3A 4II1A 2K3YA 2MI6A 1PSEA 1KHCA 5KCHA 4YTLA 4DOWA 2M9UA 2MAMA 2QA4A 4LD6A 4M75G 3G71T 3DB3A 3M57A 1NPRA 3FDRA 4MMKA 5DY9A 4M7DD 3RERA 2RHZA 3P8BB 5D6YA 3X26B 5M9OA 1B34B 1Y7XA 4NS5A 3SWNC 4D6WA 2C06A 1M8VA 4PLLA 1GXIE 2RK1A 4EMKA 3QZ9B 5GAOq 1I81A 1X01A 3JCMP 2ZCFB 4IUQA 3CCQT 1BIAA 3CMAT 1Q7YU 1VQ7A 2X4XA 3MEWA 4M78C 3CXCA 3A8MB 2QQRA 2DTHA 4XTUA 3OYLA 3P8DA 1Q82C 5I2SA 4C5HA 3CCUA 3UDCA 1JRIA 2WSEE 4HCZA 3EFSA 4LDYA 4OB2B 4QQGA 4QVCA 1VQKA 3JCMQ 4XTXA 2OTLA 4V2SA 2RA2A 1U8RA 4KULA 2Y4YA 3M55A 3L42A 2F5TX 2K4YA 4XTYA 4E47A 3GF5A 1WQWA 2K5LA 2EJ9A 5GAOp 1K9MC 2K57A 1VQ6T 4JDSA 3CCRT 3JB9D 1AHJB 2O01E 3G71A 1VIFA 3M4GA 1VQLT 1G3WA 2LCLA 4LDUA 3JSCA 4ZTJA 3KXTA 2FL7A 2RH2A 3CBOA 1OZ2A 1M4ZA 2DVEA 3C94A 2WSCE 3HL8A 1QVFS 3CD6T 2VXEA 4F7UE 2VYTA 1WJRA 2VUBA 3QYHB 2EYQA 4FL6A 3SD4A 3CCET 2WSFE 3CCQA 4OVAA 1BI0A 3CMAA 3CCMT 1BI3A 4MDWA 4QVZA 2X4YA 2OAUA 4FT4A 5A0DA 3A5ZB 4C5EA 4BE1A 3JCMc 4C92B 1YIJA 4OP0A 2L3RA 3M5AA 5CO7A 3RMSA 5GAN7 3QIIA 1VQPT 3OS5A 5FLXE 4ZGEB 4BDZA 4BACA 4DOVA 2R58A 2QI2A 4BI3A 1UGQB 3CCRA 5GMKm 4A53A 2GF7A 5GMKj 3JCMe 1VQLA 3JB9F 2EQUA 5HY6A 3JCMJ 4GY5A 5KCOA 1KHIA 3OYEA 4X9CA 3F70A 2RD1A 5KE2A 5FRNA 4F7UA 3ZEHA 2XDBA 2L89A 3CD6A 4N4GA 3FEOA 2RI3A 1OYXA 1YBYA 2ZPBB 2ZPGB 4RKUE 2JNGA 2MF2A 1KD1C 3CCEA 3CCMA 2ZPFB 4XTWA 2XK0A 2BUDA 2KAFA 5FU6C 2OTJT 2M1HA 4F7UF 3OYNA 2JTFA 3OW2A 2I2LA 1VQMA 4C8QG 3SWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L1A A;  3RIR A;  4JUV A;  5GAN 2;  2YLB A;  5GAM j;  4C8Q C;  5I21 A;  3SWN B;  4N0A C;  4NL2 A;  4M7A G;  4J6Y A;  3BW1 A;  3V7C A;  4J5Y A;  5GMK i;  3AHU A;  3HSB A;  4M78 E;  1N9R A;  3JCM b;  1WNL A;  2E10 A;  4A54 A;  2ZGW A;  3HFO A;  4M78 D;  4RCB A;  5GAM f;  4C92 G;  1LOJ A;  4M77 A;  5GMK l;  5GAO l;  4M78 B;  3V8K A;  4M7D C;  1I4K 1;  3V8J A;  5GAN 8;  4M77 B;  4M75 G;  5LJ5 h;  1B34 A;  4M7D A;  4M7D D;  5CAI A;  2DZC A;  4MMK A;  5DY9 A;  5GAN e;  4QVD A;  3JCM X;  3RER A;  4PJO A;  1LJO A;  4M78 F;  5GMK h;  4M7D B;  1B34 B;  3SWN C;  1M8V A;  5GAM d;  4M77 F;  3SB2 A;  4PJO B;  3VU3 C;  4DQ2 A;  4RCC A;  3INZ A;  4EMK A;  5GAO q;  5LJ3 e;  1I81 A;  1D3B A;  2VC8 A;  1X01 A;  3JCM P;  4M7D F;  2Y90 A;  4HA8 A;  4EMK B;  3JCM W;  3EFR A;  2HNI A;  1BIA A;  4PJO F;  4M7A E;  1D3B B;  3JCM f;  1KQ2 A;  4M77 G;  4M78 C;  3V7S A;  5LJ5 g;  4F7U G;  2E64 A;  1Y96 A;  4M7A D;  2DTH A;  4XTU A;  3BY7 A;  3JB9 I;  4M77 C;  3RUX A;  5GAN j;  1LNX A;  1YCY A;  2DXU A;  4M78 A;  1Y96 B;  3V8L A;  4C92 E;  2YLC A;  5GAN 6;  3FJP A;  1JRI A;  4JRK A;  3EFS A;  1I8F A;  1N9S A;  3QHS A;  4XU0 A;  4PJO G;  4QVC A;  4XTX A;  4C92 D;  4EMH A;  2RA2 A;  4XU1 A;  1HXD A;  3JCM Q;  4PJO C;  4M75 E;  4X9D A;  3JCM d;  5GAM h;  5GAN f;  4XTY A;  1WQW A;  4NOY A;  2EJ9 A;  4M75 D;  5GAO p;  2K57 A;  1MGQ A;  2E65 A;  5GAN 4;  3JB9 D;  4EMK C;  2CGH A;  2FYK A;  3V7R A;  3JCM V;  4J6W A;  3M4G A;  5GAO r;  1M5Q 1;  2DZ9 A;  4J6X A;  5LJ3 f;  5GAN 5;  4C8Q E;  4HT8 A;  3BFM A;  5GAN d;  4HT9 A;  4C8Q D;  2DVE A;  4M78 G;  3PGG A;  1WQ7 A;  5GAM g;  4V2S A;  3HFN A;  2JN0 A;  2VXE A;  4F7U E;  3GIB A;  1KQ1 A;  4WF2 A;  4M7A A;  2RM4 A;  5GAO n;  3SWN A;  4EMG A;  1I5L A;  4XTZ A;  5LJ3 d;  3JCM h;  4M7A B;  5LJ5 e;  4M7D G;  2DTO A;  4C92 A;  2FB7 A;  4PNO A;  3QUI A;  5LJ3 j;  1U1S A;  3RKX A;  3JCM c;  4C92 B;  4M7A F;  4M75 A;  4OP0 A;  4XU3 A;  5GAN h;  5GAN 7;  2EJG A;  4M75 B;  3QSU A;  4XTV A;  5GAN 3;  4C92 F;  3JCM g;  2DKG A;  3L2Z A;  5LJ5 j;  2VXF A;  1TH7 A;  5GMK m;  5GAO m;  4A53 A;  4C8Q A;  5GMK j;  3JCM e;  4M75 F;  4M7A C;  4N0A A;  5LJ3 h;  3QO3 A;  3RKY A;  4Y91 A;  3JB9 F;  2EJF A;  4M77 E;  4C8Q B;  3JCM J;  4XQ3 A;  3FB9 A;  4JLI A;  4NL3 A;  2E41 A;  3JB9 H;  4X9C A;  2RD1 A;  4M77 D;  5LJ5 f;  2DEQ A;  3BDU A;  2DTI A;  4MML A;  4F7U A;  4C92 C;  5GAM e;  1WPY A;  5GAN g;  3RKW A;  4M7D E;  2E1H A;  1JBM A;  5GMK e;  4F7U B;  2EAY A;  4C8Q F;  3JB9 G;  4PJO E;  2RB6 A;  4M75 C;  4PJO D;  1BIB A;  2DJZ A;  3RES A;  1HK9 A;  1U1T A;  3JB9 J;  2EWN A;  4XU2 A;  4XTW A;  2DXT A;  2QTX A;  4JRI A;  5LJ3 g;  1H64 1;  4F7U F;  5LJ5 d;  2I2L A;  4C8Q G;  3FIF A;  2YHT A; 
#chains in the Genus database with same CATH topology
 4JUV A;  2PVO B;  4N0A C;  1IHW A;  1C0M A;  1M90 R;  2J6K A;  3NPF A;  1X6O A;  1NYG A;  5GAO l;  5L8R E;  1KD1 U;  4M77 B;  3VS2 A;  5GAN e;  1JJ2 A;  5KH6 A;  2QQA A;  2IVW A;  5CIU A;  3EGD B;  1Y71 A;  7AT1 B;  2DXB A;  3H41 A;  4KBM B;  1D3B B;  1E7O A;  1C6V X;  3TSW A;  4FSX A;  1NJI R;  1Q7Y C;  4JJB A;  3MET A;  3CBM A;  1H3H A;  5I11 A;  3PVL A;  4E2F B;  3SHW A;  2YWW A;  3L2W A;  3GPL A;  5HKC A;  3WVD B;  2DE0 X;  1M3A A;  2DM1 A;  2IG0 A;  3QDR B;  1KQ1 A;  5GAO n;  4EMG A;  4M7A B;  1W70 A;  2DD4 A;  1S72 A;  1QVG P;  1U5S A;  4CI0 C;  3LWI A;  4M75 B;  3NTK A;  2PTK A;  2KT1 A;  4OB3 B;  8AT1 B;  5LJ5 j;  3J81 E;  2D8J A;  1AWO A;  3E9G A;  3X28 B;  2NUP B;  5LJ3 h;  3E19 A;  4PLI A;  1MV0 B;  3VRY A;  3EHR A;  1QQJ A;  1D09 B;  2KRO A;  2LX9 A;  4C8Q F;  1PNJ A;  2QA4 Q;  4CC7 A;  3L2U A;  1JU5 C;  3R6N A;  2PNI A;  5LJ5 d;  2XMF A;  1VQ8 Q;  1ZQ1 A;  4OMF B;  3LH5 A;  1KG1 A;  3OBY A;  1RAE B;  2I0N A;  4AG1 C;  3OS2 A;  3MCA B;  3QWY A;  5C6S A;  2F69 A;  3OYJ A;  1VQ7 Q;  2ZGW A;  2E70 A;  1HD3 A;  1VUB A;  5GMK l;  1I1J A;  3G7Z A;  3CEY A;  2OTL Q;  5KYY A;  1D0X A;  1M3B A;  2RK2 A;  2DIG A;  3G71 Q;  2Y90 A;  4HA8 A;  4M77 G;  2DL4 A;  2AKL A;  4XK8 E;  1NE8 A;  1VIE A;  1TSF A;  2K9G A;  2IPO B;  4M77 C;  2XKO C;  2DF6 A;  2DXU A;  4D8D A;  3OYK A;  1OQK A;  3MP6 A;  4C92 D;  2B8A A;  1ABQ A;  2LMJ A;  2KDS A;  3M56 A;  5GAM h;  3DKM A;  1NG2 A;  2RQU A;  4NOY A;  3PIO A;  4J9C A;  2E65 A;  3UT1 A;  2DNU A;  2KRM A;  3SDZ A;  2DXC A;  3VS7 A;  5LJ3 f;  1OX8 A;  4LN2 A;  5FRO A;  4A63 B;  2FZK B;  4HT9 A;  3UF4 A;  3HPW A;  2A28 A;  1N8R U;  1N27 A;  3GIB A;  5CQX A;  1VQL Q;  3M9Q A;  1UGP B;  4JJN K;  1X6B A;  2HKN A;  4IUT A;  2P0K A;  2CZ6 B;  2RJC A;  4X34 A;  4M4Z A;  4C92 A;  3PFS A;  3M58 A;  5FRM A;  1YIT T;  2H3E B;  2XU8 A;  3QXE B;  4MZP A;  1QCO A;  2CSI A;  1W2B A;  3CC2 A;  4HCC A;  4M7A C;  2AT1 B;  1QP2 A;  2KK4 A;  4ME7 A;  2EJF A;  2X4J A;  3D7S B;  4BY6 B;  2LCS A;  1C1A A;  1Q82 R;  4NL3 A;  2H3J A;  4OB1 B;  5J39 A;  3VJP A;  5HK3 A;  3BDU A;  1RAB B;  2QEX T;  2ZPE B;  4M75 C;  5I2M A;  3NTH A;  1BIB A;  3A98 A;  3UA6 A;  4OML A;  3FRN A;  1K9M R;  4C5G A;  1Z9Z A;  2PVG B;  3CCL Q;  1EZZ B;  1FMV A;  4QW2 A;  4Z88 A;  2LQW A;  1Q86 U;  4BUG A;  3V7C A;  5C0M A;  5GMK i;  1AEY A;  4AFS C;  2PU9 B;  3JCM b;  1WNL A;  1J3T A;  5GAM f;  4C92 G;  1YJ9 A;  1YP5 A;  3V8J A;  4P5N A;  3A8O B;  5CAI A;  2DZC A;  2RQW A;  2HQE A;  1IGQ A;  2QEX A;  2CZ7 B;  1NBE B;  2HD0 A;  1AVZ C;  4LE9 A;  2FPE A;  5EG2 A;  2VC8 A;  4M7D F;  3L2R A;  4PJO F;  4QKU A;  4KT0 E;  5LJ5 g;  3H0F A;  4MDX A;  1YCY A;  5GAN 6;  3RNJ A;  1RAH B;  1GCQ C;  4ELY C;  1HXD A;  2JMC A;  4IUP A;  1ZBX A;  2HQH A;  1EX4 A;  1M5Q 1;  2JTE A;  1VQ6 A;  1RI9 A;  1UGR B;  1JXM A;  1WQ7 A;  2A0F B;  1WXT A;  2M0O A;  2K5F A;  1N8R C;  3ZBD A;  2JMA A;  2AKK A;  3I9Q A;  4Y28 E;  4PNO A;  4BDY A;  1XJW B;  2MWO A;  3J7A F;  4RTU A;  3L2V A;  4JZ4 A;  4CRI A;  2FRY A;  2DKG A;  5FU6 B;  2KYM A;  1XTD A;  4Z89 A;  2P4T A;  2DRK A;  1B3Q A;  2QA4 T;  4C8Q B;  3TCJ A;  4ZNX A;  1XQH A;  4DEY A;  2DEQ A;  2MYS A;  2RJE A;  1VQ8 T;  4OGE A;  2ATC B;  3SEM A;  3PVQ A;  4XAX B;  2JVV A;  3OYY A;  1LPL A;  2DVJ A;  1VQ7 T;  3RIR A;  1K0S A;  4OMO A;  4AFQ C;  1JB0 E;  4BY6 C;  3OYI A;  5I21 A;  4J7I A;  3C4S A;  2R5M A;  1RAD B;  1PG5 B;  1Q86 C;  2OTL T;  2DK3 A;  2LJ1 A;  3HFO A;  4II1 A;  1QP3 A;  2MI6 A;  1V76 A;  4QT7 A;  4YTL A;  4DOW A;  2QA4 A;  3G71 T;  3DB3 A;  1NPR A;  2KYB A;  3RER A;  4D6W A;  2C06 A;  1M8V A;  2HSE B;  2YUQ A;  1X01 A;  3JCM P;  1VQN Q;  1ZBJ A;  1VQ7 A;  2X4X A;  1M2V A;  3I56 Q;  3OYL A;  1IB8 A;  5I2S A;  1JRI A;  2WSE E;  4LDY A;  1VQK A;  4V2S A;  2OTL A;  2EW3 A;  2Y4Y A;  4JPB W;  2JM9 A;  4XTY A;  1JO8 A;  3GF5 A;  2SEM A;  2D0N A;  1T0H A;  4JDS A;  3G71 A;  1AZE A;  1VQL T;  2FPD A;  1AT1 B;  1M27 C;  3KXT A;  1MMA A;  2P84 A;  1OZ2 A;  2CUD A;  3HL8 A;  1ZUK A;  1GCP A;  2VYT A;  1WJR A;  3SD4 A;  1Z9Q A;  2WSF E;  1NYF A;  3MJX A;  1SPK A;  2EYX A;  4OP0 A;  1QWE A;  3M5A A;  1S72 Q;  2EYZ A;  3RMS A;  2HKQ B;  3QII A;  3OS5 A;  4DOV A;  3A1P A;  2QI2 A;  1QWF A;  1KQS P;  1ZSZ A;  2CP3 A;  4BI3 A;  4JZ3 A;  1VQL A;  3JB9 F;  4F04 B;  3EH1 A;  2LP5 A;  1BK2 A;  1OPK A;  4N4G A;  4RTX A;  1OYX A;  1YBY A;  2JNG A;  3EGX A;  2ZPF B;  4AG2 C;  2KAF A;  5FU6 C;  4PJM A;  2DX1 A;  4F7U F;  3OB9 A;  1VQM A;  4C8Q G;  3SWN A;  4DEX A;  5KYU B;  4ZN3 A;  4C8Q C;  3PT9 A;  2GCX A;  3EFO A;  4OB0 B;  3CCV A;  3CC4 Q;  1WJS A;  2CP6 A;  4ELZ C;  1TG0 A;  2P0P A;  4FCY A;  4WCI A;  3PTA A;  2NUT A;  4M7D B;  2CRE A;  4PJO B;  3O5Z A;  4OF1 A;  2L0A A;  2PVD B;  1WHK A;  3H8Z A;  1VYU A;  5FU7 C;  3V7S A;  2LNV A;  2RHI A;  4MZM A;  1FX7 A;  3LH0 A;  1M1K R;  1Y96 B;  3V8L A;  2CS7 A;  3LLR A;  1H8K A;  4RTT A;  1WZO A;  5CVI A;  5A0G A;  1YJW Q;  3I55 Q;  2HL5 C;  2AK5 A;  3N5B B;  4J9E A;  1Q81 R;  1UGS B;  3X24 B;  5KYX A;  4J6W A;  1G2B A;  3QJY A;  4B6M A;  4J8O A;  1G3Y A;  3OSS C;  4M78 G;  2NYS A;  1LCK A;  2CP2 A;  2RM4 A;  1PRL C;  1XNI A;  4C0G A;  2XHC A;  5LJ3 d;  5LJ5 e;  2JTM A;  3QUI A;  2E5Q A;  1SEM A;  2EJG A;  3KUF A;  2GFA A;  4ORZ A;  1BU1 A;  1MMD A;  1ZHI A;  3QO3 A;  4FYW B;  4N0A A;  4Y91 A;  2DIQ A;  2ZPH B;  3CC2 Q;  4GBQ A;  2HBP A;  2E41 A;  1M9S A;  2XDP A;  2X4W A;  4F14 A;  1OV3 A;  2ESW A;  4A4K A;  2O4X B;  2L5Q A;  1SKU B;  3OW2 S;  4JRI A;  3CXC P;  3MKD A;  2K2M A;  2DYB A;  2KQW A;  5GAM j;  1X75 C;  1YN8 A;  4FYY B;  1FWZ A;  5A2Q E;  1TUC A;  1R0B G;  2KNB B;  1K1Z A;  1K9A A;  1AD5 A;  1GRI A;  2EYY A;  1YWP A;  2HMA A;  1YJ9 Q;  2YT6 A;  4B9W A;  1VQN T;  3QYG B;  3JCM X;  1NM7 A;  3GNF B;  1SRL A;  3E9F A;  4ZGD B;  1M3C A;  3MP1 A;  5GAM d;  3I56 T;  2QEX Q;  3OY9 A;  4PFZ A;  2EBP A;  3HKS A;  2XI9 A;  2JT4 A;  2K3X A;  3MO8 A;  2AIR B;  4AFU C;  1P92 A;  2GTJ A;  1KFZ A;  1QVF A;  5HK0 A;  4C92 E;  2YLC A;  2EGA A;  4PJO G;  2V8J A;  2LT4 A;  4M7D C;  5CK9 A;  4PJO C;  2K5I A;  3QDF A;  2LCC A;  1ZUU A;  4JS4 A;  1TUG B;  1VQN A;  2DL5 A;  4A4H A;  3EG9 B;  3I56 A;  1VQ6 Q;  1X27 A;  2B86 A;  4E6R A;  5AT1 B;  3JCM h;  1S72 T;  2LRQ A;  2OAW A;  4R0K A;  3ULR B;  4E7L A;  3CPW S;  2VV5 A;  3CD6 Q;  5IXF A;  2ZAE A;  2R57 A;  1WFW A;  1N5Z A;  2HBW A;  4LUE A;  3CCM Q;  2YRD A;  1R8O B;  2MPX C;  1VQO A;  3VUZ A;  3QBY A;  2C0T A;  1AOJ A;  4FT2 A;  2EFI A;  5KYN A;  3M59 A;  1JJ2 P;  2OJ2 A;  4M77 D;  2DPP B;  2CZ0 B;  5DLQ E;  1WYX A;  1YWO A;  1JBM A;  4F7U B;  2RB6 A;  3DLM A;  4F17 A;  3PMI A;  3JB9 J;  2DXT A;  5LJ3 g;  4JS5 A;  1O9S A;  2HZY A;  5GAN 2;  3CC4 T;  2DMO A;  2NWM A;  4PK4 A;  1JEG A;  2E10 A;  3VV0 A;  2KRN A;  4JJD A;  3VYG A;  4M77 A;  3MEU A;  3GP8 A;  2R5A A;  4ESR A;  3SFM A;  3TSZ A;  3OA6 A;  2EQM A;  2KI7 A;  2RNA A;  3EGD A;  3OYG A;  3OS0 A;  1D3B A;  1WHM A;  3HRU A;  3JCM f;  3JAM E;  1YJW T;  3I55 T;  3ZL7 C;  3CC4 A;  4M7A D;  5CQY A;  1LNX A;  5EC7 A;  3M0U A;  3LX7 A;  5FWB A;  1ZUY A;  5HCK A;  3FJP A;  1N9S A;  2FVU A;  3QZ5 B;  2DO3 A;  2QK0 A;  4FU6 A;  1VQK Q;  3E1S A;  4M75 D;  1D0Z A;  5GAN 4;  4PJJ A;  2HDA A;  1QKX A;  3VS5 A;  2ED0 A;  1K73 R;  2DZ9 A;  3QG1 A;  4J6X A;  5GAN 5;  1MV3 A;  1DJ7 B;  1GFC A;  2GFU A;  2BZX A;  3S6W A;  5IHI A;  1AWX A;  2RHY A;  2CKK A;  3CCS Q;  5GAM g;  3OS1 A;  1ACM B;  4M7A A;  3THK A;  1I5L A;  1TOV A;  3A8L B;  2YUN A;  1YJW A;  3I55 A;  1UHC A;  3MHX A;  4E7K A;  2KMT A;  1U1S A;  1W1F A;  2L2P A;  2JOY A;  4RG8 A;  4M75 A;  4LD9 K;  1PKT A;  2O9S A;  2RO0 A;  3CC2 T;  2ABL A;  1WIE A;  4OGC A;  2NUP A;  5LL6 S;  4J9D A;  4PJN A;  4AT1 B;  1Q7Y R;  3P8H A;  2CP7 A;  4FW1 A;  4E7H A;  4DBQ A;  6AT1 B;  3JB9 G;  4KGV B;  2DJZ A;  3RES A;  2RPN A;  1H64 1;  3X25 B;  2YHT A;  1PD1 A;  5FW9 A;  4AMC A;  3LWH A;  1VQM Q;  9ATC B;  3WXM B;  4M7A G;  3VYH B;  2LJ3 A;  1YJ9 T;  2AZV A;  4JRQ A;  2K3Y A;  2M9U A;  3CCV Q;  2MAM A;  1PWT A;  4LD6 A;  4M75 G;  2O88 A;  5DY9 A;  1ZX6 A;  3P8B B;  1B34 B;  1BBZ A;  2QG9 B;  1AZG B;  5GAO q;  1I81 A;  3CQT A;  1BIA A;  3A8M B;  2DTH A;  4XTU A;  3EFS A;  2W10 A;  2DER A;  1RAF B;  2HCK A;  3I5S A;  2COY A;  4E47 A;  1W2B P;  2K5L A;  2KBT A;  1VQ6 T;  2O01 E;  1VIF A;  2GGR A;  4ZTJ A;  2CT3 A;  3G6E Q;  1E6G A;  2YUP A;  2DVE A;  2WSC E;  3I5R A;  1QVF S;  3CD6 T;  2COW A;  3QYH B;  3CCM T;  4QVZ A;  2X4Y A;  5A0D A;  1A0N B;  4BE1 A;  1KD1 R;  2RF0 A;  1YIJ A;  2QGG A;  1UDL A;  2L3R A;  5CO7 A;  3U23 A;  4BAC A;  3H0H A;  2R58 A;  1UGQ B;  4A53 A;  4EIK A;  3JCM e;  2OX7 A;  1M8M A;  3JCM J;  3EG0 A;  3OYE A;  2RD1 A;  5KE2 A;  4IIM A;  2XDB A;  2KR3 A;  2L89 A;  3CD6 A;  3FEO A;  2RI3 A;  4HVU A;  4RKU E;  3CCM A;  2XK0 A;  2BUD A;  4J9H A;  1AWJ A;  3OW2 A;  1QVG S;  4J6Y A;  3BW1 A;  3OBW A;  2QQ9 A;  3EAE A;  1IHV A;  2ZZD A;  1M1F A;  4J9B A;  3VS3 A;  1G3S A;  3X20 B;  2XD0 A;  2O31 A;  1UG1 A;  3V8K A;  2OI3 A;  4CC4 B;  3A8G B;  4QVD A;  1K8A U;  1ARK A;  1W4S A;  2RHU A;  1B07 A;  2QYZ A;  2ZPI B;  3PNW C;  5A0L A;  5LJ3 e;  1FMW A;  2KVQ G;  1SSF A;  2FZC B;  1B7T A;  2KSS A;  2DLP A;  1ZA2 B;  1VQK T;  2KT8 A;  4C5I A;  3BY7 A;  3RUX A;  4ZGJ B;  2F2X A;  1OOT A;  5CR2 A;  5FU7 B;  4XU0 A;  1YNZ A;  4X9D A;  1YHQ A;  4F16 A;  2FZG B;  3MP8 A;  3CCS T;  2FYK A;  3JCM V;  3OSV A;  2CZ1 B;  3TEE A;  1M90 U;  1BYM A;  2E12 A;  4C8Q D;  1QCN A;  3C12 A;  2VVK A;  5FWC A;  2EGC A;  2JW4 A;  1TU0 B;  1D1B A;  2LT1 A;  1TS9 A;  3G4S Q;  4HCB A;  2FEI A;  2D9T A;  1F1B B;  3CPW A;  2VKN A;  1M1G A;  5IAY A;  2LTO A;  4Y92 A;  5GAN h;  3OYF A;  5L23 A;  5KYW B;  2V8K A;  1VQO Q;  3CCS A;  4A4E A;  5CCA A;  2DFU A;  4C8Q A;  1NJI U;  1NLP C;  4JLI A;  2KY9 A;  5GAM e;  1GBR A;  1GL5 A;  2LDM A;  2QQS A;  2YDL A;  1SSH A;  4JRP A;  2J06 A;  5KE3 A;  2NLU A;  1VQM T;  2CP5 A;  4IUV A;  2PUK B;  4NL2 A;  1WLP B;  1GBQ A;  3CCV T;  2M16 A;  4FW2 A;  3QJ6 A;  2DL7 A;  3NTI A;  2M51 A;  4M78 D;  1N8R R;  4J7F A;  2LZ6 B;  3CPF A;  3J80 E;  3S3O A;  2O9V A;  2KRS A;  1MND A;  4RUG A;  4RTZ A;  1X69 A;  1SHG A;  3VU3 C;  5DLO A;  1K8A C;  4PKC C;  2E3I A;  2V1R A;  4EMK B;  3JCM W;  2PZ1 A;  2KE9 A;  5IH2 A;  1UEC A;  2A36 A;  2K79 A;  4M78 A;  5D6W A;  2DJQ A;  2D6F A;  2J05 A;  2COZ A;  3QHS A;  2RI2 A;  4QQ6 A;  3CCQ Q;  2BKD N;  3OYM A;  3JCM d;  5GAN f;  3G6E T;  2YRV A;  2O2O A;  2F1L A;  3M4Y A;  5IXB A;  3BE3 A;  4LDV A;  1UHF A;  3LYI A;  4HT8 A;  1KC8 R;  1U3O A;  4FSS A;  4MZT A;  3VS4 A;  1O75 A;  4LDW A;  3CCR Q;  1M90 C;  1Q86 R;  2BZ8 A;  1UFF A;  4WF2 A;  4EPC A;  5IT9 E;  1NLO C;  3R6O A;  3ME9 A;  1CKB A;  1WA7 A;  1KJW A;  1OU9 A;  2EQJ A;  5LJ3 j;  3H9N A;  1VYT A;  2EQI A;  1BCO A;  4XU3 A;  4KUI A;  3G6E A;  4AFZ C;  3OYA A;  1WDX A;  4C92 F;  4CC2 A;  3REA B;  2X3W D;  1W6X A;  3OMG A;  4A4F A;  5AYF A;  2EIF A;  2K3B A;  2X51 A;  4M77 E;  4RTY A;  4QQD A;  4XQ3 A;  3FB9 A;  1PRM C;  1NJI C;  2DTI A;  3TVT A;  2E1H A;  5J3B A;  1WJQ A;  4PJO D;  1HK9 A;  1CKA A;  1OZ3 A;  1U1T A;  3S3M A;  1ZA1 B;  5KYU A;  4Z8A A;  1OUL A;  2HEQ A;  1AWW A;  4PL6 A;  4Z02 A;  2XID A;  2VGM A;  3G1J A;  2ECZ A;  5IN1 A;  3HTR A;  3VUB A;  3RMQ A;  2OTJ Q;  2XIC A;  1MMG A;  2EKH A;  3TU4 K;  1Y07 A;  1IRX A;  1NPP A;  2LX7 A;  4ATO A;  4R55 A;  1PSF A;  4M7D A;  1BI2 A;  4PJO A;  3L2Q A;  1BKB A;  1Y57 A;  4DQ2 A;  3UAT A;  1LVK A;  1UEB A;  4N4H A;  1QVP A;  1Q82 U;  2HAX A;  4M7A E;  2LNH B;  1YJN Q;  2MOX A;  4L59 A;  1Y96 A;  4O6J A;  4DBR A;  3JRZ A;  3M0Q A;  1I8F A;  3Q1J A;  3EHQ A;  1K9M U;  2SRC A;  2JXB A;  4M75 E;  3CC7 Q;  2C0I A;  4JLG A;  4EMK C;  2CGH A;  4E7S A;  1VA7 A;  3NHN A;  4BE2 A;  1RI0 A;  5DM7 R;  3G4S T;  4FIB A;  2XG8 D;  3GOX A;  2XDD A;  4CC3 A;  4E7J A;  4LDX A;  3WVE B;  1PKS A;  5CKF A;  1MMN A;  2EQK A;  5IHK A;  2DL3 A;  4M7D G;  4OMP A;  2Y4X A;  3EG3 A;  4A4G A;  1VQO T;  2E6N A;  1X2K A;  1UB4 A;  3JV3 A;  3OYC A;  3MEA A;  4HKE A;  4IIO A;  1YIJ Q;  2ENM A;  2RJD A;  3JCM g;  3L2Z A;  1VQP A;  1VQ5 Q;  2X3X D;  3RKY A;  1FYN A;  1WHH A;  1VQ4 Q;  3JB9 H;  1ZSG A;  3G4S A;  2ROT A;  2LVM A;  2NUZ A;  1G83 A;  2E6Z A;  2O4X A;  2MMP A;  3CBP A;  3ER0 A;  4EDU A;  1FXX A;  1NZ9 A;  2QTX A;  2EPD A;  2P0Q A;  1PHT A;  2RQR A;  5GJW B;  1QVF P;  3HRT A;  1QVG A;  2PQW A;  3LW5 E;  1V29 B;  2DRM A;  3BDL A;  3FC3 A;  2KXD A;  3AHU A;  1KQS S;  1YI2 Q;  2LC4 A;  4RCB A;  3PMT A;  4DBF A;  1PSE A;  5KCH A;  3RR6 A;  4KRT A;  5IHN A;  3FDR A;  2Z0W A;  2VAS A;  2RHZ A;  5D6Y A;  3X26 B;  4PFP A;  4NS5 A;  5KYY B;  4PLL A;  2JJ9 A;  2VB6 A;  1CSK A;  1MUZ A;  4KGX B;  2GQI A;  2FPF A;  3CCQ T;  3H0I A;  1Q82 C;  4C5H A;  3EG2 A;  3UDC A;  4HCZ A;  1TTH B;  4QVC A;  3JCM Q;  1KIK A;  2RA2 A;  1IGU A;  4KUL A;  3M55 A;  3L42 A;  1SHF A;  1WQW A;  5GAO p;  1K9M C;  3CCR T;  3JB9 D;  1AHJ B;  1YHQ Q;  3M4G A;  1G3W A;  1OX9 A;  3EG9 A;  3JSC A;  1T0J A;  3M0S A;  2RH2 A;  3CBO A;  4LXC A;  1SRM A;  2DET A;  1ABO A;  4FL6 A;  1UE9 A;  3CCQ A;  4OVA A;  1BI0 A;  4ANJ A;  4OMQ A;  1BI3 A;  1QCF A;  2MIO A;  4FT4 A;  2JS2 A;  2VWF A;  4C5E A;  5ECA A;  4C92 B;  4PFO A;  2L3P A;  5FLX E;  3VS1 A;  2HL3 A;  1T3L A;  2YUO A;  3CCR A;  1GFD A;  2K6D A;  2QAS A;  1KHI A;  3F70 A;  5FRN A;  1I0C A;  4F7U A;  3ZEH A;  3NGP A;  2ZPG B;  1KD1 C;  2F2W A;  4KH0 B;  4XTW A;  2OTJ T;  2M1H A;  3E2U A;  2JTF A;  2MCN A;  2I2L A;  1VOM A;  1PM3 A;  3TQ7 P;  4GLM A;  2L3S A;  4DBH A;  3EH2 A;  3CCJ Q;  1QW1 A;  1TXQ A;  4KUD K;  4A54 A;  4BI4 A;  1LOJ A;  4FYV B;  1E6H A;  5GAN 8;  3M53 A;  1QLY A;  1S1N A;  3VS0 A;  2HSP A;  4M78 F;  5GMK h;  4IUU A;  1YJN T;  3CME Q;  1G3T A;  4LUD A;  4UC4 A;  1HJD A;  2J7I A;  1X6G A;  3CXC S;  2RN8 A;  2OTJ A;  2IIM A;  3CC7 T;  1WHG A;  4F7U G;  2E64 A;  3MEV A;  2CUB A;  3JB9 I;  5GAN j;  2LQN A;  2E5K A;  2MWP A;  2QXF A;  1FMK A;  1D1A A;  4ZTF A;  1EFN A;  1QMC A;  1GCQ A;  4BI8 B;  2A7Y A;  5GAO r;  5CKD A;  1K0X A;  1Q95 G;  4C8Q E;  1Y0M A;  1YCS B;  2F5K A;  5GAN d;  1YJN A;  3NMZ C;  3HRS A;  2YSQ A;  2DAQ A;  3C95 A;  1WI7 A;  2DTO A;  3AT1 B;  3CC7 A;  1YIJ T;  2KGT A;  4HCK A;  4VUB A;  1VQ9 Q;  3VRZ A;  1VQ5 T;  1KC8 U;  2V1Q A;  1VQ4 T;  1YIT A;  2K7A A;  4XTV A;  5GAN 3;  4DA4 A;  3UWN A;  3FLG A;  1RAC B;  1TH7 A;  3OQ5 A;  3ZFJ A;  1M1K U;  4JJC A;  3PE0 A;  2DYI A;  2CYZ B;  1UGV A;  3LGF A;  1R77 A;  4R56 A;  4C92 C;  4BD3 A;  3OMC A;  1UTI A;  2JZ2 A;  1Q81 U;  2EAY A;  4ZN1 A;  2EWN A;  4XU2 A;  4KGZ B;  3M0T A;  1D1C A;  1H92 A;  1YI2 T;  1RAG B;  1OEB A;  2YLB A;  1IRE B;  3M54 A;  2C0O A;  1VQ5 A;  4X1V A;  2JM8 A;  1VQ4 A;  1BCM A;  1WHJ A;  2WAC A;  4M78 E;  2E3H A;  8ATC B;  3HHT B;  3IQL A;  2QQB A;  1I4K 1;  3CCU Q;  2RI5 A;  2YXY A;  3TRE A;  1JJ2 S;  3DLL A;  5LJ5 h;  1B34 A;  4IKF A;  4HVW A;  1LJO A;  1X2Q A;  3LGL A;  2RHX A;  3EG1 A;  2L3Q A;  3SB2 A;  4OMN A;  2ED1 A;  2D0Q B;  2VGN A;  5D6X A;  2HNI A;  2YRC A;  2A08 A;  1KQ2 A;  4E7Z A;  1YI2 A;  2MK5 A;  1M2V B;  1YHQ T;  5CKB A;  4JRK A;  5KCO A;  2DEU A;  2GTO A;  2RQV A;  3GLX A;  3URG A;  3CMA Q;  4EMH A;  1UJY A;  3A8H B;  4C0D B;  1XOV A;  1MGQ A;  2LJ0 A;  1H3Z A;  3OYD A;  2DD5 A;  1QKW A;  3V7R A;  3BFM A;  2GBQ A;  3GNG A;  1MNE A;  1YFN A;  3PGG A;  4L6V 5;  1KK7 A;  3HFN A;  2JN0 A;  4J9G A;  5CKH A;  3OW2 P;  4BB7 A;  2K2V A;  4TVR A;  1R0C B;  3RKX A;  2D8H A;  4O5V A;  2CH4 A;  4RG2 A;  3CCE Q;  4L5G A;  2E4H A;  4OMM A;  4RMO A;  1KC8 C;  2VXF A;  2QDL A;  1OPL A;  3ASK A;  1ZSZ B;  1TUD A;  3RBB B;  2AZS A;  1VQP Q;  3HP9 A;  1M1K C;  1UUE A;  5LJ5 f;  1G8X A;  3OYH A;  1WPY A;  5GAN g;  4M7D E;  4PJO E;  1IZ6 A;  4GLK A;  2CT4 A;  3H6Z A;  4PJL A;  1VQ8 A;  1JQQ A;  1Q81 C;  3CCJ T;  3VKI A;  3EGX B;  2DBK A;  2AHJ B;  2QTV A;  2RMO A;  3FIF A;  3L1A A;  3UPU A;  3SWN B;  1SG5 A;  2G3R A;  4J5Y A;  3O8V A;  4WTO B;  3NFC A;  1N9R A;  1RUW A;  1KQS A;  3EFO B;  1JXO A;  4M78 B;  3CME T;  1MHN A;  2P4R A;  1TWB A;  4C0Z A;  2NUT B;  2BIV A;  4M77 F;  4RCC A;  1I5O B;  3INZ A;  1D0Y A;  3CCJ A;  3EFR A;  4J9F A;  1RL2 A;  2M02 A;  4J83 A;  4FM4 B;  1HYO A;  2GNC A;  3CPW P;  1WGS A;  3QKJ A;  5GMK e;  4XU1 A;  2G6F X;  2J6F A;  2V8I A;  3QPH A;  3M0P A;  4N4I A;  3CME A;  2KXC A;  1EIF A;  2BTT A;  2BE9 B;  3KBG A;  2PUO B;  3M0R A;  3S3N A;  2BE7 D;  5J26 A;  5KYX B;  2L8D A;  1OU8 A;  3UA7 A;  2RJF A;  2EKO A;  1BI1 A;  1RLP C;  1KSW A;  1VQ9 T;  2JUF A;  4E7I A;  1RAI B;  4XTZ A;  4C0D C;  3CCL T;  2FG0 A;  4HVV A;  2CH4 W;  2KEA A;  2M0Y A;  1N6A A;  2FB7 A;  1G5V A;  3EGU A;  2D1X A;  4LNP A;  3T9N A;  4M7A F;  1IO6 A;  1BB9 A;  1M30 A;  1PD0 A;  2FHD A;  5GJV B;  3QSU A;  5KYW A;  3QWX X;  1W2B S;  2QGF B;  3PIP A;  5GAO m;  4M75 F;  3OYB A;  2HQX A;  2LQ8 A;  2CSQ A;  2ROL A;  1NEB A;  1WX6 A;  4MML A;  2GQV A;  3RKW A;  2A3L A;  1VQ9 A;  2JS0 A;  1OI1 A;  4BE0 A;  2X35 A;  4RTW A;  2DBM A;  1K73 U;  3CCL A;  2W0Z A;  4B9X A;  2QDY B;  3DB4 A;  1ZSZ C;  5CKE A;  4C0F A;  2LQK A;  1PC0 A;  3CCU T;  4RTV A;  4IUR A;  4Q5W A;  3HSB A;  1UJ0 A;  3C0C A;  1ZLM A;  4K11 A;  1KHC A;  1T3S A;  2FRW A;  3M57 A;  2DL8 A;  4M7D D;  4MMK A;  5M9O A;  1Y7X A;  3SWN C;  1GXI E;  1U06 A;  2RK1 A;  4HXJ A;  2BZY A;  4EMK A;  3QZ9 B;  1V1C A;  1K4U S;  2X9H A;  5D7U A;  2ZCF B;  4IUQ A;  3CMA T;  1Q7Y U;  1WHL A;  3MEW A;  4M78 C;  3CXC A;  2A37 A;  2QQR A;  2CP0 A;  2H8H A;  3P8D A;  2EGE A;  2FO0 A;  3FJ5 A;  3CCU A;  1IXD A;  2EYW A;  3VS6 A;  4QQG A;  4OB2 B;  1K76 A;  4XTX A;  1U8R A;  2F5T X;  3GBQ A;  3MPU B;  2K4Y A;  2EJ9 A;  2K57 A;  1NEG A;  1RAA B;  2LCL A;  4LDU A;  2FL7 A;  5I22 A;  1M4Z A;  2QAZ A;  3C94 A;  2CDT A;  2VXE A;  4F7U E;  3I35 A;  1I07 A;  2VUB A;  2EYQ A;  1PCX A;  2EVR A;  4KH1 B;  3CCE T;  3CMA A;  2V26 A;  4MDW A;  2OAU A;  3A5Z B;  2RQT A;  3JCM c;  1SF9 A;  2DA9 A;  1RLQ C;  5GAN 7;  1HSQ A;  1VQP T;  1M2O A;  4ZGE B;  4BDZ A;  1K8A R;  1WXU A;  1YIT Q;  5GMK m;  1WXB A;  2GF7 A;  4D8K A;  5GMK j;  1X43 A;  3KFV A;  2EQU A;  5HY6 A;  2F2V A;  4GY5 A;  2DIL A;  4X9C A;  2ZPB B;  4FYX B;  4J9I A;  2MF2 A;  3CCE A;  3RDV A;  3REB B;  1VYV A;  2J6O A;  3OYN A;  1K73 C; 
#chains in the Genus database with same CATH homology
 4JUV A;  4ZN3 A;  4C8Q C;  2PVO B;  4N0A C;  4J6Y A;  3BW1 A;  3OBW A;  1QW1 A;  3PT9 A;  2QQ9 A;  4KUD K;  3EAE A;  2ZZD A;  3X20 B;  1M1F A;  2GCX A;  2XD0 A;  1G3S A;  1X6O A;  4OB0 B;  4A54 A;  4BI4 A;  3CCV A;  1WJS A;  1LOJ A;  5GAO l;  5L8R E;  3V8K A;  4ELZ C;  1KD1 U;  2P0P A;  5GAN 8;  4M77 B;  3M53 A;  3A8G B;  5GAN e;  4QVD A;  3PTA A;  1JJ2 A;  5KH6 A;  4M78 F;  5GMK h;  1K8A U;  4M7D B;  4IUU A;  2QQA A;  1YJN T;  2IVW A;  4PJO B;  1G3T A;  1W4S A;  2RHU A;  5CIU A;  4UC4 A;  1Y71 A;  2ZPI B;  4OF1 A;  2DXB A;  3PNW C;  2PVD B;  5A0L A;  5LJ3 e;  2KVQ G;  3CXC S;  1SSF A;  2OTJ A;  3H8Z A;  4KBM B;  5FU7 C;  1D3B B;  2KSS A;  3V7S A;  3CC7 T;  1VQK T;  4F7U G;  2E64 A;  2LNV A;  4FSX A;  3MEV A;  4C5I A;  3BY7 A;  2RHI A;  4MZM A;  1FX7 A;  3RUX A;  4ZGJ B;  3JB9 I;  5GAN j;  3LH0 A;  1Q7Y C;  1Y96 B;  3MET A;  3CBM A;  3V8L A;  5CR2 A;  2CS7 A;  3LLR A;  5FU7 B;  2MWP A;  4XU0 A;  2QXF A;  5A0G A;  5CVI A;  4ZTF A;  4X9D A;  1YHQ A;  3N5B B;  3MP8 A;  4BI8 B;  1UGS B;  3L2W A;  2A7Y A;  3CCS T;  2FYK A;  3X24 B;  3GPL A;  1K73 C;  3JCM V;  4J6W A;  5CKD A;  3OSV A;  5GAO r;  3QJY A;  3WVD B;  2CZ1 B;  5HKC A;  3TEE A;  1M90 U;  4C8Q E;  1BYM A;  2F5K A;  5GAN d;  2E12 A;  4J8O A;  1G3Y A;  3OSS C;  4C8Q D;  2IG0 A;  3C12 A;  4M78 G;  1YJN A;  3HRS A;  3QDR B;  1KQ1 A;  2RM4 A;  5GAO n;  2DAQ A;  2LT1 A;  3C95 A;  4EMG A;  1XNI A;  4C0G A;  2XHC A;  5LJ3 d;  4M7A B;  5LJ5 e;  2JTM A;  2DTO A;  4HCB A;  3CC7 A;  1YIJ T;  2D9T A;  2DD4 A;  3QUI A;  1S72 A;  4VUB A;  3CPW A;  2E5Q A;  1VQ5 T;  1KC8 U;  1M1G A;  5IAY A;  2LTO A;  4CI0 C;  5GAN h;  2EJG A;  4M75 B;  3OYF A;  3NTK A;  3LWI A;  1VQ4 T;  1YIT A;  4XTV A;  5GAN 3;  3KUF A;  4DA4 A;  4OB3 B;  3UWN A;  5LJ5 j;  2V8K A;  3FLG A;  2GFA A;  3J81 E;  1TH7 A;  4A4E A;  5CCA A;  3CCS A;  3E9G A;  3X28 B;  3OQ5 A;  3ZFJ A;  4C8Q A;  1NJI U;  4N0A A;  1ZHI A;  3QO3 A;  5LJ3 h;  1M1K U;  4Y91 A;  2DIQ A;  2ZPH B;  3E19 A;  4PLI A;  4JLI A;  2HBP A;  2E41 A;  1M9S A;  2CYZ B;  2KY9 A;  3LGF A;  2XDP A;  5GAM e;  4R56 A;  2X4W A;  4BD3 A;  3OMC A;  4C92 C;  2LDM A;  2LX9 A;  2QQS A;  2JZ2 A;  4A4K A;  2EAY A;  4C8Q F;  4ZN1 A;  4JRP A;  1Q81 U;  2O4X B;  2L5Q A;  5KE3 A;  2NLU A;  1VQM T;  2EWN A;  4XU2 A;  3L2U A;  3OW2 S;  4JRI A;  5LJ5 d;  1YI2 T;  1ZQ1 A;  4OMF B;  1KG1 A;  2YLB A;  2KQW A;  4IUV A;  1IRE B;  3M54 A;  1X75 C;  5GAM j;  2PUK B;  1FWZ A;  5A2Q E;  4NL2 A;  1VQ5 A;  3OBY A;  3CCV T;  1VQ4 A;  2WAC A;  2M16 A;  3OS2 A;  3MCA B;  4M78 E;  3QJ6 A;  5C6S A;  2F69 A;  3NTI A;  3OYJ A;  2ZGW A;  4M78 D;  2E70 A;  1VUB A;  4J7F A;  3HHT B;  5GMK l;  2QQB A;  1I4K 1;  3CPF A;  3J80 E;  2RI5 A;  3TRE A;  1JJ2 S;  3S3O A;  3DLL A;  3G7Z A;  5LJ5 h;  1B34 A;  3CEY A;  4B9W A;  4IKF A;  3QYG B;  3JCM X;  1VQN T;  1LJO A;  2RK2 A;  3GNF B;  3E9F A;  4ZGD B;  3LGL A;  2RHX A;  3MP1 A;  5GAM d;  3I56 T;  3SB2 A;  2DIG A;  3VU3 C;  5DLO A;  1K8A C;  4PKC C;  3OY9 A;  2D0Q B;  2VGN A;  2Y90 A;  4HA8 A;  5D6X A;  4EMK B;  3JCM W;  2HNI A;  3HKS A;  1KQ2 A;  2XI9 A;  2K3X A;  4M77 G;  3MO8 A;  1YI2 A;  4XK8 E;  1NE8 A;  1P92 A;  1VIE A;  4M77 C;  1QVF A;  2XKO C;  2DXU A;  3OYK A;  4M78 A;  3MP6 A;  5HK0 A;  1YHQ T;  5D6W A;  2YLC A;  4C92 E;  2D6F A;  5CKB A;  4JRK A;  4PJO G;  3QHS A;  2V8J A;  2LT4 A;  3URG A;  2RI2 A;  3GLX A;  4QQ6 A;  4C92 D;  2B8A A;  4EMH A;  5CK9 A;  4M7D C;  4PJO C;  2KDS A;  2BKD N;  2K5I A;  3M56 A;  3DKM A;  3JCM d;  5GAM h;  5GAN f;  2YRV A;  3A8H B;  3OYM A;  3G6E T;  4C0D B;  2LCC A;  3M4Y A;  4NOY A;  3PIO A;  1XOV A;  1MGQ A;  2E65 A;  1H3Z A;  3UT1 A;  3OYD A;  2DD5 A;  3V7R A;  4JS4 A;  4LDV A;  3SDZ A;  2DXC A;  1VQN A;  5LJ3 f;  3LYI A;  4A4H A;  4HT8 A;  5FRO A;  3BFM A;  3GNG A;  4HT9 A;  3HPW A;  3I56 A;  4MZT A;  3PGG A;  1O75 A;  4LDW A;  1N8R U;  4L6V 5;  1M90 C;  3HFN A;  2JN0 A;  3OB9 A;  1N27 A;  3GIB A;  5CQX A;  4WF2 A;  4EPC A;  5IT9 E;  3M9Q A;  1UGP B;  3R6O A;  3ME9 A;  3JCM h;  4JJN K;  1S72 T;  2LRQ A;  5CKH A;  4IUT A;  2P0K A;  2CZ6 B;  2RJC A;  4X34 A;  4E7L A;  4BB7 A;  4C92 A;  3CPW S;  3PFS A;  2K2V A;  2VV5 A;  3M58 A;  2EQJ A;  4TVR A;  5LJ3 j;  1YIT T;  5FRM A;  3RKX A;  2R57 A;  4O5V A;  4RG2 A;  2XU8 A;  1R8O B;  3QXE B;  4L5G A;  4XU3 A;  1VQO A;  4KUI A;  3G6E A;  4MZP A;  3VUZ A;  3QBY A;  3OYA A;  4C92 F;  4RMO A;  1KC8 C;  1W2B A;  2VXF A;  4A4F A;  3OMG A;  3CC2 A;  5AYF A;  4HCC A;  2EIF A;  3ASK A;  4FT2 A;  2EFI A;  4M7A C;  1QP2 A;  2KK4 A;  3M59 A;  4ME7 A;  2EJF A;  2X4J A;  4M77 E;  4BY6 B;  4QQD A;  4XQ3 A;  3FB9 A;  4NL3 A;  2H3J A;  4OB1 B;  5J39 A;  3HP9 A;  3VJP A;  5HK3 A;  1NJI C;  1M1K C;  4M77 D;  2DPP B;  2CZ0 B;  3BDU A;  2DTI A;  5DLQ E;  5LJ5 f;  3OYH A;  1WPY A;  5GAN g;  2QEX T;  4M7D E;  2E1H A;  2ZPE B;  1JBM A;  4PJO E;  1IZ6 A;  4F7U B;  4GLK A;  2RB6 A;  3DLM A;  5J3B A;  4M75 C;  1WJQ A;  5I2M A;  3NTH A;  4PJO D;  1BIB A;  3H6Z A;  1HK9 A;  1OZ3 A;  1U1T A;  3FRN A;  3PMI A;  3JB9 J;  1VQ8 A;  4C5G A;  3S3M A;  2DXT A;  1Q81 C;  3CCJ T;  2PVG B;  5LJ3 g;  3VKI A;  4JS5 A;  1O9S A;  2AHJ B;  3FIF A;  3L1A A;  4PL6 A;  4QW2 A;  5GAN 2;  3CC4 T;  4Z02 A;  3UPU A;  1Q86 U;  2XID A;  4BUG A;  2VGM A;  3SWN B;  5IN1 A;  3VUB A;  3V7C A;  5C0M A;  2G3R A;  4J5Y A;  3O8V A;  5GMK i;  3NFC A;  3RMQ A;  2XIC A;  1N9R A;  2PU9 B;  3JCM b;  1WNL A;  2E10 A;  3VV0 A;  5GAM f;  3TU4 K;  4C92 G;  3VYG A;  1KQS A;  1Y07 A;  4M77 A;  3MEU A;  3GP8 A;  4M78 B;  1NPP A;  3CME T;  1YJ9 A;  1MHN A;  2R5A A;  3V8J A;  4R55 A;  4ATO A;  3SFM A;  4P5N A;  1PSF A;  3A8O B;  4M7D A;  3OA6 A;  1BI2 A;  5CAI A;  2DZC A;  2HQE A;  4PJO A;  2QEX A;  2CZ7 B;  3L2Q A;  2EQM A;  4C0Z A;  1BKB A;  2HD0 A;  2BIV A;  4M77 F;  3OYG A;  4DQ2 A;  4RCC A;  3INZ A;  3OS0 A;  5EG2 A;  1D3B A;  2VC8 A;  4M7D F;  3L2R A;  3CCJ A;  1UEB A;  4N4H A;  1QVP A;  3EFR A;  4PJO F;  1Q82 U;  2HAX A;  3HRU A;  3JCM f;  1RL2 A;  3JAM E;  1YJW T;  3I55 T;  4J83 A;  4M7A E;  4FM4 B;  4KT0 E;  4L59 A;  1Y96 A;  5LJ5 g;  3CC4 A;  4M7A D;  4MDX A;  4O6J A;  5CQY A;  1LNX A;  1YCY A;  3JRZ A;  1WGS A;  3LX7 A;  5GAN 6;  3FJP A;  3QKJ A;  1I8F A;  1N9S A;  2FVU A;  3Q1J A;  3QZ5 B;  2DO3 A;  5GMK e;  1K9M U;  4XU1 A;  4ELY C;  1HXD A;  4FU6 A;  4M75 E;  4IUP A;  3E1S A;  1ZBX A;  2V8I A;  3QPH A;  4N4I A;  4M75 D;  3CME A;  1EIF A;  5GAN 4;  4JLG A;  3KBG A;  2CGH A;  2PUO B;  4EMK C;  4BE2 A;  3S3N A;  1M5Q 1;  1RI0 A;  2DZ9 A;  3QG1 A;  4J6X A;  5J26 A;  5DM7 R;  5GAN 5;  1VQ6 A;  1UGR B;  1DJ7 B;  2L8D A;  2GFU A;  3G4S T;  2RJF A;  3S6W A;  2EKO A;  2XG8 D;  4FIB A;  1WQ7 A;  1BI1 A;  2RHY A;  3GOX A;  2CKK A;  2XDD A;  5GAM g;  4E7J A;  4LDX A;  3WVE B;  3OS1 A;  5CKF A;  1VQ9 T;  4M7A A;  2JUF A;  2M0O A;  4E7I A;  2EQK A;  1I5L A;  2K5F A;  4XTZ A;  3A8L B;  1N8R C;  4C0D C;  3CCL T;  4M7D G;  1YJW A;  3I55 A;  2Y4X A;  3MHX A;  3ZBD A;  1N6A A;  2FB7 A;  4A4G A;  4E7K A;  1G5V A;  4Y28 E;  4PNO A;  2KMT A;  1U1S A;  4RG8 A;  3T9N A;  2JOY A;  2MWO A;  2E6N A;  4BDY A;  1VQO T;  3J7A F;  4M7A F;  3L2V A;  4M75 A;  1UB4 A;  3OYC A;  1QVG S;  4LD9 K;  3MEA A;  4HKE A;  2FHD A;  2RO0 A;  4CRI A;  3CC2 T;  3QSU A;  1W2B S;  2RJD A;  4OGC A;  3JCM g;  2DKG A;  3L2Z A;  5FU6 B;  3PIP A;  5GAO m;  1XTD A;  2P4T A;  1VQP A;  4M75 F;  3OYB A;  2HQX A;  2LQ8 A;  3RKY A;  5LL6 S;  2QA4 T;  4C8Q B;  3JB9 H;  3P8H A;  3TCJ A;  3G4S A;  1XQH A;  2DEQ A;  2LVM A;  4MML A;  2GQV A;  2E6Z A;  4E7H A;  2O4X A;  3RKW A;  2RJE A;  1VQ8 T;  2MMP A;  2A3L A;  3CBP A;  1VQ9 A;  4OGE A;  3JB9 G;  3ER0 A;  1OI1 A;  4BE0 A;  2X35 A;  4EDU A;  2DJZ A;  3RES A;  1FXX A;  1K73 U;  1NZ9 A;  3CCL A;  4XAX B;  4B9X A;  2JVV A;  2QTX A;  1H64 1;  2P0Q A;  3OYY A;  3X25 B;  2QDY B;  1VQ7 T;  2YHT A;  3DB4 A;  5CKE A;  3RIR A;  4C0F A;  3HRT A;  1JB0 E;  3LWH A;  4BY6 C;  2LQK A;  3OYI A;  5I21 A;  4J7I A;  1QVG A;  2PQW A;  3LW5 E;  3C4S A;  3WXM B;  1V29 B;  3CCU T;  3VYH B;  4M7A G;  4IUR A;  3BDL A;  2R5M A;  4Q5W A;  3FC3 A;  3AHU A;  3HSB A;  1YJ9 T;  1Q86 C;  2OTL T;  1KQS S;  4JRQ A;  2DK3 A;  2LC4 A;  3HFO A;  4RCB A;  3PMT A;  1QP3 A;  4II1 A;  2K3Y A;  2MI6 A;  1PSE A;  1KHC A;  5KCH A;  4YTL A;  4DOW A;  2M9U A;  2MAM A;  2QA4 A;  4LD6 A;  4M75 G;  3G71 T;  3DB3 A;  3M57 A;  1NPR A;  3FDR A;  4MMK A;  5DY9 A;  4M7D D;  3RER A;  2RHZ A;  3P8B B;  5D6Y A;  3X26 B;  5M9O A;  1B34 B;  1Y7X A;  4NS5 A;  3SWN C;  4D6W A;  2C06 A;  1M8V A;  4PLL A;  1GXI E;  2RK1 A;  4EMK A;  3QZ9 B;  5GAO q;  1I81 A;  1X01 A;  3JCM P;  2ZCF B;  4IUQ A;  3CCQ T;  1BIA A;  3CMA T;  1Q7Y U;  1VQ7 A;  2X4X A;  3MEW A;  4M78 C;  3CXC A;  3A8M B;  2QQR A;  2DTH A;  4XTU A;  3OYL A;  3P8D A;  1Q82 C;  5I2S A;  4C5H A;  3CCU A;  3UDC A;  1JRI A;  2WSE E;  4HCZ A;  3EFS A;  4LDY A;  4OB2 B;  4QQG A;  4QVC A;  1VQK A;  3JCM Q;  4XTX A;  2OTL A;  4V2S A;  2RA2 A;  1U8R A;  4KUL A;  2Y4Y A;  3M55 A;  3L42 A;  2F5T X;  2K4Y A;  4XTY A;  4E47 A;  3GF5 A;  1WQW A;  2K5L A;  2EJ9 A;  5GAO p;  1K9M C;  2K57 A;  1VQ6 T;  4JDS A;  3CCR T;  3JB9 D;  1AHJ B;  2O01 E;  3G71 A;  1VIF A;  3M4G A;  1VQL T;  1G3W A;  2LCL A;  4LDU A;  3JSC A;  4ZTJ A;  3KXT A;  2FL7 A;  2RH2 A;  3CBO A;  1OZ2 A;  1M4Z A;  2DVE A;  3C94 A;  2WSC E;  3HL8 A;  1QVF S;  3CD6 T;  2VXE A;  4F7U E;  2VYT A;  1WJR A;  2VUB A;  3QYH B;  2EYQ A;  4FL6 A;  3SD4 A;  3CCE T;  2WSF E;  3CCQ A;  4OVA A;  1BI0 A;  3CMA A;  3CCM T;  1BI3 A;  4MDW A;  4QVZ A;  2X4Y A;  2OAU A;  4FT4 A;  5A0D A;  3A5Z B;  4C5E A;  4BE1 A;  3JCM c;  4C92 B;  1YIJ A;  4OP0 A;  2L3R A;  3M5A A;  5CO7 A;  3RMS A;  5GAN 7;  3QII A;  1VQP T;  3OS5 A;  5FLX E;  4ZGE B;  4BDZ A;  4BAC A;  4DOV A;  2R58 A;  2QI2 A;  4BI3 A;  1UGQ B;  3CCR A;  5GMK m;  4A53 A;  2GF7 A;  5GMK j;  3JCM e;  1VQL A;  3JB9 F;  2EQU A;  5HY6 A;  3JCM J;  4GY5 A;  5KCO A;  1KHI A;  3OYE A;  4X9C A;  3F70 A;  2RD1 A;  5KE2 A;  5FRN A;  4F7U A;  3ZEH A;  2XDB A;  2L89 A;  3CD6 A;  4N4G A;  3FEO A;  2RI3 A;  1OYX A;  1YBY A;  2ZPB B;  2ZPG B;  4RKU E;  2JNG A;  2MF2 A;  1KD1 C;  3CCE A;  3CCM A;  2ZPF B;  4XTW A;  2XK0 A;  2BUD A;  2KAF A;  5FU6 C;  2OTJ T;  2M1H A;  4F7U F;  3OYN A;  2JTF A;  3OW2 A;  2I2L A;  1VQM A;  4C8Q G;  3SWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...