4C92G

Crystal structure of the yeast lsm1-7 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
75
Chain Sequence
b'AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSISKNARKLGLTVIRGTILVSLSSAEGSDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 11
structure length 75
sequence length 85
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92G00
4XTZA 4JLIA 1D3BB 4M7AE 3BY7A 4QVDA 4M78C 3JCMh 3L2ZA 2E1HA 2RB6A 1KQ2A 3JB9G 1I8FA 4PNOA 4M7DB 2YHTA 5GMKm 4N0AA 4C8QD 4C8QG 4EMKC 1JBMA 4XU0A 4JRKA 3JCMf 4M7AC 1I4K1 1TH7A 4J6WA 4C92C 4DQ2A 4PJOF 3V8LA 5LJ5h 3RERA 1YCYA 4C8QE 4J6YA 2E64A 3BFMA 4M78A 4M77F 5GANf 4M75F 5GAOp 2DTOA 5GAMf 4WF2A 3JCMW 3FB9A 4M7DD 1D3BA 4M7DG 2DJZA 2DTIA 5LJ3h 4EMKA 3RKWA 4PJOB 4V2SA 1M8VA 5GAMe 3JCMQ 3QUIA 2DXTA 4JRIA 2DKGA 4RCBA 4X9CA 4C8QC 4M7AA 1HXDA 4M77B 4C92A 4M75B 4M7DE 4F7UF 2VXEA 1WNLA 2Y90A 5GAOn 1U1TA 1WQWA 3RESA 4C92E 5CAIA 3RIRA 3V7RA 2YLBA 2RM4A 2EJ9A 3RKXA 3QO3A 4XTVA 3QHSA 4F7UB 3L1AA 4PJOD 4M7DC 1B34A 5I21A 3JB9J 4PJOG 4C8QA 1HK9A 5GMKj 2FB7A 2RD1A 3SWNB 4NL3A 4M77D 1Y96B 4XU2A 4M75D 4M77G 3V8JA 5GAOl 4M75G 4XQ3A 3JCMe 5GMKe 3HSBA 2I2LA 2CGHA 2HNIA 1N9RA 4PJOE 4J6XA 3VU3C 4Y91A 5GAN2 2RA2A 2QTXA 3RUXA 3JCMg 5GAMj 5GANj 4HT9A 1X01A 5DY9A 4QVCA 5LJ5f 5GAN4 1H641 3INZA 4M77E 5GMKi 4M75E 5GANe 3GIBA 4XTXA 4M7DA 1M5Q1 4F7UG 2E41A 3JCMd 5GANg 1MGQA 5LJ5e 3HFNA 3SB2A 5GAMg 3JB9I 3JB9H 1LOJA 4PJOC 1U1SA 4MMLA 5LJ3f 1JRIA 3V7CA 4M77C 4F7UE 5GANd 1I81A 4M75C 2E65A 5GAMd 2K57A 5GAOr 4X9DA 1WQ7A 3FJPA 2DVEA 4XTUA 4M78F 3V7SA 3BW1A 5LJ5d 2DTHA 1LJOA 5GAN5 1N9SA 4J5YA 5GAN7 3EFSA 2YLCA 2ZGWA 5GAN6 3V8KA 1BIAA 3EFRA 2DEQA 3FIFA 4PJOA 2JN0A 4MMKA 2DXUA 3JCMc 4HA8A 4M7AF 1LNXA 4M78B 2FYKA 3M4GA 4M77A 4M75A 3SWNC 2EWNA 5GAOm 3HFOA 5GMKl 4HT8A 3QSUA 5LJ5j 4EMKB 2EJFA 2E10A 5GMKh 3JB9D 1WPYA 3AHUA 4M7AB 3JCMJ 3JCMb 4C92B 3JB9F 2EAYA 3BDUA 1BIBA 4F7UA 5LJ5g 4EMHA 5LJ3j 3JCMP 1I5LA 4C8QF 3JCMX 3RKYA 5GANh 5GAMh 5GAN8 4RCCA 4M78D 3SWNA 4XU3A 4M78G 1Y96A 5LJ3e 4NOYA 4XTWA 4EMGA 5GAN3 2VXFA 5LJ3g 2EJGA 2DZCA 2VC8A 2DZ9A 1B34B 4NL2A 4XU1A 4C8QB 4M78E 4N0AC 4JUVA 4XTYA 4M7AD 4C92D 1KQ1A 5GAOq 4M7AG 4C92G 3PGGA 5LJ3d 4A53A 4OP0A 4M7DF 4A54A 4C92F 3JCMV
chains in the Genus database with same CATH superfamily
4JLIA 2HKQB 2A37A 2KBTA 2AZSA 4ELYC 2RK2A 1YWOA 2EYZA 4CC7A 1VIFA 3FJ5A 1Q7YC 1UDLA 4LE9A 1YFNA 1TH7A 1N8RC 1FMKA 2DL4A 4C8QE 4MZPA 5ECAA 4KGXB 3H0IA 2QA4Q 4ZN1A 1Q86R 3ZFJA 2JNGA 1YNZA 5LJ3h 2QGGA 3RKWA 3S3OA 3MHXA 3OMGA 2LJ3A 4M7AA 4C8QC 1YJ9T 4FL6A 5LL6S 1IGUA 2I0NA 2FHDA 3S3MA 5CAIA 2CZ1B 1PSFA 3MEVA 2RM4A 2QDLA 2O01E 4AFUC 1K4US 2KE9A 2COWA 4WTOB 5IXBA 2CT3A 2NUZA 5CK9A 1Q82R 1O9SA 4RTYA 1D09B 3E2UA 4FW2A 1SSHA 1G3YA 1X75C 2LQNA 4FU6A 2EFIA 2EQKA 2DFUA 2E41A 3JB9I 3WXMB 2KXDA 2XMFA 2KR3A 5FRMA 2QQRA 2KXCA 5LJ5d 4OGCA 2DAQA 4KUIA 1X69A 1LCKA 2RJFA 3VJPA 1RACB 1X2KA 2ZCFB 3LWIA 2K3YA 3JB9D 2C0OA 2CDTA 3EHQA 1SG5A 2D1XA 2CP6A 1BU1A 3REAB 1U06A 1UHFA 1D0YA 2R5MA 1TUDA 5J39A 4E2FB 3HRSA 2BKDN 5GJVB 5M9OA 1SHGA 4M78E 3CCUA 4OB3B 4A53A 4BD3A 1UG1A 3I55Q 3LGFA 3OW2S 2ATCB 3OQ5A 1VQKA 3VV0A 2RQVA 1G8XA 4M78C 1KQ2A 1GFCA 4XK8E 2RO0A 5J26A 2FO0A 5KYUA 1JBMA 3M0PA 2RI5A 1QVFA 2XHCA 2ZPFB 1JEGA 3L2WA 3A8OB 4OB0B 3L2QA 2FPDA 4V2SA 2PQWA 3DB4A 3NTIA 4F7UF 3LX7A 3SHWA 1VQ5Q 2LRQA 1ZHIA 3MEAA 2O88A 1MNEA 2AHJB 3RKXA 3OYEA 1YITT 3QHSA 5AYFA 1NYGA 3NTHA 3M56A 1WJSA 1FMVA 2VGMA 1MHNA 4RMOA 1VA7A 4M75G 3JCMe 1GRIA 1VQPA 3JCMg 1KD1R 1QP3A 2HMAA 2DA9A 4LDWA 2DO3A 4C0DC 1M5Q1 3QKJA 5GAMg 3JSCA 2DE0X 2K3BA 2JTFA 4OB1B 3N5BB 2P0KA 4AFSC 3OYFA 1AEYA 4J5YA 3H6ZA 2YLCA 1J3TA 3OBWA 2RHUA 1M3AA 1UFFA 3C4SA 4HCBA 3M4GA 2VV5A 3CPWS 2OAUA 5FU6C 3CCRQ 3QSUA 2KMTA 2EJFA 4J9HA 3T9NA 1QCNA 2OX7A 4F7UA 2C0TA 3U23A 5LJ5g 1AVZC 1JXMA 3RKYA 3OS2A 4BB7A 4XU3A 2FG0A 2K9GA 4C5GA 4A4KA 2DZ9A 1SRMA 2FL7A 3G1JA 5GAOq 1AT1B 3VUZA 3RBBB 2RJDA 1S72Q 2LQ8A 1WI7A 2HL5C 2D0QB 5GMKm 2R58A 1PD1A 1YP5A 4EPCA 1VQ4T 1BI3A 4EDUA 4A4GA 5KCHA 2VVKA 5DLOA 1QW1A 1MMDA 5CKDA 1VIEA 2K5FA 4QQDA 4M7DG 4J9EA 1BI1A 4PJOB 2JTMA 3HP9A 4JRIA 2RQUA 2P4TA 2L3PA 1WNLA 1KC8U 2RI2A 2HZYA 2KEAA 3O8VA 2JVVA 1WXBA 2E6NA 3CCUT 3M58A 4M75D 1G5VA 2DVJA 3CCLA 3CCVQ 1AZGB 1VQKT 5DY9A 3GIBA 1QWEA 5KYWB 3HHTB 4IUVA 2AIRB 2F5TX 5LJ3f 1D1AA 2P0QA 1XJWB 2PVOB 2V8KA 5DLQE 4BACA 2O4XB 5CCAA 1K9MR 2KNBB 1N8RU 3I56Q 1RAHB 4E47A 3E9FA 1K8AR 2EYYA 2V1QA 4HT8A 1IREB 1U8RA 1Y57A 2D9TA 3CCEQ 5CQXA 2PTKA 3G6EQ 2C0IA 2LP5A 4KH1B 1YI2Q 3VS7A 3J7AF 4TVRA 1IXDA 3OYCA 3MP6A 3QXEB 1AWXA 1VQPT 2GQIA 1BYMA 4C8QB 2J6OA 4JJNK 4J7IA 3VS4A 1B07A 1HSQA 1V29B 2ED1A 2D0NA 4E7HA 3OMCA 2FZCB 3QWYA 4E7SA 2XKOC 2F1LA 2M0YA 1VYVA 1VQMA 4GLKA 3X28B 1QCOA 2DTOA 2H3JA 1WHLA 3LGLA 4WF2A 4M7DD 3H9NA 1YJWQ 3RNJA 3CCSQ 2GFAA 3KBGA 1VQOQ 3EGDA 2PVDB 3WVDB 5FLXE 1VQLA 1ZBXA 2ZAEA 1M2VB 2MWPA 4BDYA 4M77G 1H92A 3VU3C 5I22A 3RUXA 2JM9A 1OX9A 1RABB 2GTJA 2EQIA 4VUBA 4DBQA 1MGQA 3SB2A 5FWBA 3OYJA 6AT1B 3CXCS 2RK1A 2RQTA 4QW2A 1JRIA 4FW1A 3V7CA 5GAOr 3SFMA 3OW2A 4RTVA 2ROTA 4HCKA 4AT1B 3EFOA 3M53A 3P8DA 2MIOA 2DL8A 2DXUA 1PNJA 4M78B 2X35A 4OGEA 1G83A 1OU9A 4BDZA 1Q86C 1ZSZA 4A4HA 2DEUA 2K6DA 5LJ3j 2LX7A 1R77A 1XTDA 3QDRB 4RCCA 1K73R 3CCLT 1G3TA 4DA4A 5GAN3 2DZCA 2V8IA 4OMFB 5I11A 3EG9A 4C0ZA 4ZTFA 3CBOA 1Q82C 4M7AE 1UGSB 1WA7A 2GBQA 3SEMA 2EBPA 4CRIA 4FT4A 2PUKB 4JS5A 1FYNA 1R0BG 8AT1B 3TREA 2RQWA 4M7AC 2DL7A 2GGRA 4J6WA 1M1KR 1VYTA 3URGA 2B86A 4RUGA 4BY6C 3BFMA 2HQXA 3HPWA 1NEBA 2E3HA 4C0DB 1GBQA 3OYBA 1YHQQ 1VQ8Q 2NUPB 1WLPB 3G4SQ 2DKGA 4C92A 1RL2A 1SPKA 3CD6A 2CH4W 3CC2Q 4LDYA 1MV3A 4N4HA 3CPWA 1ARKA 3S3NA 2YRDA 1WHJA 1N6AA 3GP8A 1Q81R 3MEUA 4M77D 2GF7A 5FU6B 3X24B 1KG1A 4AG2C 5D7UA 3D7SB 3M0QA 2MK5A 3P8HA 3C94A 4JPBW 3FLGA 5GMKi 1PD0A 3C95A 3MP1A 2FZGB 2NUTB 2K79A 1VQNQ 1SKUB 1VQMT 4J9CA 2F69A 1OZ3A 4X9DA 1WQ7A 1YWPA 2DVEA 2LTOA 3BW1A 3TQ7P 1SRLA 1JU5C 4Z88A 1ZLMA 1T0HA 3KFVA 2JN0A 1S1NA 3PVLA 2QA4A 2X4XA 1OULA 2EVRA 4A63B 1M9SA 1PRLC 5GMKl 5HY6A 2R5AA 3QWXX 5GMKh 1WHKA 1WPYA 2XD0A 2DILA 1QP2A 1VQLT 2EAYA 3SD4A 1VQ7A 4J7FA 3E1SA 3HRUA 4J9DA 2HBPA 4Q5WA 1Y96A 4IUUA 1M4ZA 1M3CA 2HL3A 3HL8A 1XOVA 1Y7XA 3THKA 2XDBA 5D6YA 4FIBA 1KD1C 3CPFA 3JB9G 1UECA 1K9AA 3FRNA 4XU0A 1RADB 3UA6A 2GFUA 3I9QA 3VYHB 2KGTA 2HSPA 2QI2A 3QPHA 1RAIB 3CBMA 3JCMW 3GOXA 1Q95G 2AKLA 2CZ6B 2QQAA 3RESA 4J9IA 1ZBJA 2MWOA 1UJ0A 4JRQA 3DLLA 3L1AA 2LNVA 1PCXA 2RD1A 1YIJA 4O6JA 3EHRA 2VASA 4BI3A 1BBZA 1VQ6A 3LLRA 1GFDA 2DD4A 1QKWA 1N9RA 1ZUYA 4J6XA 1YJNQ 1NM7A 4LXCA 1FXXA 2A36A 2COYA 2ZPHB 5C6SA 3JCMd 2YWWA 3HFNA 4ORZA 4LNPA 1QVGS 4F7UE 4OMMA 5GAMd 2E65A 2K57A 4RTTA 2JMCA 4ZGDB 2ED0A 1VUBA 1YCSB 1V76A 4PJJA 3CD6T 2KT1A 2VYTA 2EWNA 3QJYA 5J3BA 3QBYA 2KT8A 5KYYB 5HKCA 1T0JA 1VQ5A 2QEXA 2J05A 2LMJA 3FC3A 1E6GA 2JW4A 1B34B 2O9SA 1VQ4A 3PMTA 4NL2A 4RKUE 3CC4A 2HBWA 4PK4A 2WSFE 4LD6A 2L3RA 1H3HA 3KXTA 3EG2A 4QVDA 1BCOA 4PNOA 2OTLQ 3OYAA 2CP3A 4JRKA 4Y92A 1IRXA 4FCYA 5KE2A 2QA4T 3LWHA 1JJ2A 1Z9QA 3QDFA 4M75F 4N4IA 2XDDA 1KSWA 4MZMA 1RAAB 2LCCA 4X9CA 3OBYA 1K9MC 1K0XA 1VQ7T 1PSEA 5KYXB 3CCRA 3FEOA 1K8AC 1C0MA 3V7RA 1M1FA 3QO3A 1CKAA 4XTVA 3BDLA 3JB9J 3NFCA 4PJOG 1M2OA 2QQBA 2EQJA 2FB7A 5CKEA 3X25B 3CQTA 1TTHB 2SRCA 1X6BA 2QTXA 4B9XA 1GCPA 4QVCA 3CCJA 1OU8A 2G3RA 3CCMA 5GANe 1M90U 2VUBA 3A8GB 4F17A 1BCMA 5GANg 1S72A 1LOJA 3NGPA 2HCKA 2DIGA 2ROLA 1Q82U 2ZPEB 5FRNA 2IPOB 2ENMA 3UATA 3V7SA 2DTHA 3J80E 2GNCA 1N9SA 4DOWA 4LN2A 3JAME 1K76A 3CMEA 2RH2A 3I5SA 3PFSA 4M75A 4II1A 5GAOm 2A08A 2YRCA 2HAXA 2JXBA 3AHUA 4M7AB 3PIOA 3G7ZA 2D8HA 2BZYA 2CZ7B 2EIFA 4B9WA 4BY6B 1I5LA 4AMCA 1YIJT 4F16A 4ESRA 5GAMh 5GAN8 3RR6A 1VQ6T 1KC8R 2VXFA 1QMCA 4JUVA 4FM4B 4M7DF 3MO8A 4XAXB 1RI0A 3EH2A 4A4FA 1D3BB 2EGAA 2RJEA 2B8AA 2XI9A 3OA6A 1W70A 1PC0A 4FYWB 5IHIA 4C8QG 2V1RA 2YUNA 4EIKA 5LJ5h 2LDMA 2CREA 2BZ8A 2E64A 3L42A 2AZVA 4J9FA 1A0NB 4PFOA 2YT6A 1AWOA 4EMKA 3X20B 3NPFA 3OSSC 2DYBA 5DM7R 1VQKQ 2FRWA 1H8KA 4A4EA 1ZUKA 2L89A 1HXDA 1VQ5T 2XG8D 2QEXT 4BE0A 1NPRA 3ZBDA 3GNFB 2E6ZA 3RIRA 4AFZC 2QDYB 3MKDA 5HK3A 3CCEA 4KUDK 4PJOD 3CC4T 2DJQA 4ATOA 1YI2A 4E7IA 2LQWA 1AHJB 2MYSA 3V8JA 3EGXA 3CC7A 1K73C 3HRTA 1TXQA 4IIOA 3CEYA 3GPLA 2ABLA 2MMPA 4XTXA 1NJIU 4M7DA 1UGQB 1UGVA 2QQSA 3JV3A 4DBHA 2X51A 1WZOA 3MEWA 2M02A 2YUPA 1AWWA 1KD1U 5KYUB 2VWFA 5KCOA 3EH1A 2VB6A 1Y07A 1VQPQ 1ZSZC 4QKUA 3V8KA 3FIFA 2BE7D 1NG2A 3S6WA 3CCRT 3OY9A 1YJWA 1M1KC 3CCSA 2KAFA 5CKBA 3H8ZA 3OYMA 1VQOA 2K4YA 1NLOC 3CCQQ 1BIBA 3JCMP 2L5QA 2LCLA 4DOVA 4M78G 5FROA 4C5HA 1T3SA 3J81E 3OYHA 1GCQA 1MNDA 3I5RA 2E12A 5L23A 2E4HA 1Q7YU 4RTXA 3CCJT 3CCMT 2JS0A 4CI0C 3QZ5B 1S72T 2L3QA 1Q81C 3SDZA 3CMAQ 1W2BP 3QYHB 1OQKA 1EIFA 1PKTA 3G71Q 1KQSS 1QVPA 4C8QD 1WGSA 1WJQA 3EG0A 4D8KA 2BUDA 4IURA 4C92C 3CPWP 1WHHA 3CMET 3OS0A 2ZZDA 1FMWA 3RERA 2CP5A 1QVGA 2P84A 4M77F 1H3ZA 1HJDA 1IZ6A 2COZA 4RG2A 4Z02A 2FPFA 2CSIA 3OYNA 3QUIA 3OYIA 1NEGA 3VRZA 2QQ9A 4BUGA 4IIMA 2BTTA 1HD3A 2M9UA 3P8BB 3DLMA 2PUOB 2QXFA 4QT7A 2W10A 4F7UB 2IVWA 1Z9ZA 2BZXA 5GMKj 1P92A 3E9GA 4P5NA 2NUPA 4HXJA 2I2LA 1M1GA 5CQYA 3GBQA 1FWZA 4HT9A 3EG3A 4KT0E 3MCAB 2X9HA 1PHTA 1IO6A 2PVGB 1AZEA 5IHKA 1WIEA 2KI7A 2AK5A 5L8RE 4X1VA 5EG2A 2K2VA 3FJPA 4XTUA 2J7IA 3CCLQ 2KDSA 1DJ7B 1SSFA 3TU4K 4OMNA 4M77A 1YHQA 1N27A 1VQ8A 2DRMA 3WVEB 2E10A 1VQ9A 4HKEA 3CCET 1YI2T 1K9MU 1EZZB 4R0KA 3VS0A 3SWNA 4M78D 4PFZA 1UHCA 3A1PA 1AD5A 3CC7T 2EJGA 4BE2A 3ZEHA 1PG5B 2M1HA 1TS9A 4FT2A 4C92F 2ESWA 1I07A 3TSWA 2MF2A 4XTZA 5D6XA 4HCCA 4KGVB 2DPPB 2MI6A 4CC3A 4ME7A 1WHGA 3DKMA 2CYZB 2OTJA 4C0FA 1OPKA 3JCMf 5I2SA 2EYQA 4CC2A 4ELZC 3HTRA 1RLPC 1TG0A 2M0OA 3META 5AT1B 4F04B 1YJWT 5GAMf 3CCST 3L2UA 2GQVA 3A8HB 1VQOT 3PIPA 2K5IA 2JJ9A 2FEIA 1U1TA 1KHIA 4KBMB 4ZGJB 2KSSA 3QZ9B 5EC7A 5GAOl 4XQ3A 1TSFA 1IGQA 2NWMA 1X01A 5LJ5f 4OMOA 3PNWC 1BI2A 3GLXA 2FRYA 5A0GA 1WX6A 4MMLA 1VQLQ 3M9QA 1RI9A 2DD5A 1I81A 1TUGB 2F2VA 2XU8A 5GAN7 5IH2A 2HEQA 2ZGWA 3ME9A 4YTLA 1UJYA 3QJ6A 3OYYA 5IT9E 4L6V5 4QQ6A 4FYVB 7AT1B 3MJXA 2HD0A 1QCFA 3JB9F 3EGDB 2K7AA 2PU9B 4DBFA 2HSEB 2LQKA 2BE9B 2K3XA 4EMGA 1GXIE 4PKCC 2H8HA 1MV0B 4XTYA 2A28A 4J9GA 2LJ0A 2MCNA 1JJ2P 1OYXA 2E5QA 4JJDA 1YJNA 4FYYB 4LDUA 1KFZA 3M59A 1AOJA 3OS5A 1T3LA 2V8JA 3LYIA 4N0AA 5A0LA 4E7ZA 2L2PA 1RUWA 2CT4A 1RLQC 2RMOA 4OMLA 4DQ2A 1YHQT 2L8DA 2CUBA 1EX4A 5GAOp 5KH6A 1VQ8T 1QVFP 2HKNA 3ZL7C 1M8VA 1WXUA 5CKFA 1VQ9T 3JCMQ 2JTEA 1UUEA 2VXEA 1YJ9Q 3CC2T 1WQWA 3VS2A 2H3EB 5FW9A 3TCJA 2YRVA 1BK2A 1OV3A 1SF9A 1WXTA 9ATCB 2KQWA 1ZSZB 3CBPA 1UB4A 2O9VA 1HK9A 1ZA1B 3PMIA 3HSBA 2HNIA 2RA2A 5A0DA 1O75A 5GAMj 4HVUA 1KC8C 3TVTA 3EG9B 4M75E 1PWTA 2OTJT 5FU7C 2VGNA 2Y4YA 4GY5A 2E70A 1Q81U 4OVAA 5GANd 2OTLA 4M75C 4JZ3A 2HQHA 4PJMA 5GAN5 1KQSA 2DEQA 2HDAA 4C5IA 2CZ0B 2DX1A 1LNXA 1IB8A 1WYXA 5CVIA 2RF0A 4QQGA 5LJ5j 4KH0B 1ABQA 2LT4A 2DBMA 2EQUA 4BE1A 3JCMJ 1ABOA 2JT4A 3I55A 4C92B 4GLMA 1GBRA 3PE0A 2DETA 2XICA 4F14A 3JCMX 2EYWA 2MAMA 5IXFA 2D6FA 5LJ3e 5A2QE 5LJ3g 1QQJA 3RMQA 3UA7A 4M7AG 8ATCB 3OYKA 3RDVA 3Q1JA 5CIUA 3OSVA 3X26B 3A5ZB 1VQ7Q 2O2OA 1I8FA 1Y71A 2YHTA 3OYLA 1PRMC 3ASKA 4KULA 3OYGA 1NZ9A 2F2WA 1M90R 1XQHA 4EMKC 1OZ2A 3DB3A 1IHWA 3NHNA 1ZX6A 4PJOF 3OS1A 3C12A 2DXBA 1K0SA 1R0CB 2Y4XA 1EFNA 1UEBA 3FB9A 1D3BA 1V1CA 2DL3A 3H0HA 3O5ZA 4JDSA 2VKNA 3C0CA 2CKKA 4AG1C 1TOVA 4M7DE 5GAOn 1M8MA 2C06A 4E6RA 1M3BA 2D8JA 2YLBA 4MZTA 4B6MA 1MMGA 3L2RA 4M7DC 1YITQ 1OPLA 1WFWA 3QYGB 3CXCA 1Y96B 1JB0E 4XU2A 1YJNT 1WHMA 1X6OA 2LCSA 4ANJA 4CC4B 2DERA 1CSKA 3INZA 2HQEA 2KROA 3LH0A 2FPEA 3JB9H 1U1SA 2CS7A 1W1FA 3E19A 1YIJQ 4E7JA 1Q86U 1VQ6Q 2M51A 2LNHB 4RTZA 1YBYA 4PJOA 1XNIA 4MMKA 2JMAA 2KRNA 4LD9K 4NS5A 1GCQC 1MMAA 1JQQA 3NTKA 1LVKA 1X6GA 4C8QF 5GANh 1OX8A 2JOYA 2KVQG 3EAEA 5CKHA 2VC8A 2ZPIB 2RJCA 3M0SA 4M7AD 1N5ZA 4DBRA 4AFQC 1QVGP 1BI0A 5KYWA 1OI1A 1ZSGA 2RI3A 3BY7A 5CR2A 2OTLT 3JCMh 3L2ZA 2QEXQ 1I5OB 2E1HA 2YXYA 3OB9A 3NMZC 1NJIR 2P4RA 4KRTA 2EQMA 2O4XA 1VQ4Q 2QGFB 3CC4Q 3V8LA 2BIVA 2LVMA 1NBEB 2LC4A 1G3WA 5GAMe 3I55T 3CCVA 4HVWA 5IAYA 1PM3A 1PKSA 1X2QA 2QTVA 4ZTJA 1AWJA 1D0XA 1BKBA 3CCQA 1W2BS 5I21A 4LUEA 4C8QA 4OB2B 3CCUQ 4D8DA 1KK7A 4C5EA 1RAGB 4Y91A 2RHIA 3UWNA 4M77E 1Q7YR 3I56A 4PLIA 3KUFA 4F7UG 5LJ5e 2EGCA 2Z0WA 3CMAA 1N8RR 4DEXA 2JM8A 1ZUUA 1RAFB 3F70A 3L2VA 1UTIA 4GBQA 4IUQA 2X4JA 2RNAA 4M77C 3G71A 1IHVA 1B3QA 4M78F 3G6EA 4BI8B 2DLPA 2L0AA 2CP7A 3EFSA 3A98A 4PJLA 2J6KA 1WDXA 3OW2P 3CCJQ 3CCMQ 2J06A 4X34A 3SWNC 3M0UA 2LT1A 3HFOA 1KHCA 4K11A 2KRSA 3JCMb 4O5VA 2EW3A 2WSEE 3M55A 1QWFA 1VYUA 1M2VA 4WCIA 4Y28E 4NOYA 4JZ4A 3CMEQ 1KIKA 2A7YA 3VYGA 3PGGA 1D0ZA 3JCMV 4LDXA 3AT1B 4JJBA 2K2MA 4PJNA 3QIIA 1SHFA 2NLUA 3M0RA 1UE9A 5IHNA 1ACMB 4RTUA 2V26A 1I4K1 2DYIA 3PTAA 4J6YA 2X4YA 4ZN3A 2P0PA 4M78A 3VS3A 3OYDA 5FU7B 2DTIA 4PFPA 3VRYA 4M75B 2OJ2A 2WACA 2Y90A 3LH5A 4C92E 1VOMA 2GTOA 2EJ9A 4JS4A 3M4YA 2JZ2A 3VS5A 2XIDA 4NL3A 1MUZA 5HCKA 4L5GA 2L3SA 4C0GA 5GAN4 2DNUA 4OMQA 3VUBA 4PLLA 2DMOA 2DM1A 2SEMA 4N4GA 3FDRA 3HKSA 4IUPA 1HYOA 2F2XA 1RAEB 2CP0A 3ER0A 1F1BB 1LJOA 3PVQA 3ULRB 4QVZA 1OOTA 3CC7Q 1M30A 5GAN6 1BIAA 3CCVT 1K1ZA 3JCMc 2AKKA 2DF6A 3EGUA 1D1CA 5C0MA 2M16A 4HCZA 4J8OA 4EMKB 3UPUA 2ECZA 2YUQA 3CCQT 1G2BA 3BDUA 2J6FA 3LW5E 2YDLA 2DIQA 2CH4A 2QG9B 5GJWB 3I56T 1W4SA 2KYBA 4N0AC 4IUTA 3M5AA 3VS6A 3EGXB 2IIMA 2E3IA 3CMAT 1CKBA 4MDXA 3M54A 2NUTA 3G4SA 3G71T 2E5KA 2RB6A 4M7DB 3R6OA 3MP8A 1LPLA 3G6ET 5D6WA 3CC2A 1W6XA 1FX7A 1K8AU 3H0FA 4L59A 2ZPBB 1NPPA 5GANf 3H41A 4FSSA 4UC4A 2RHZA 2DJZA 2G6FX 1NLPC 1NE8A 1JO8A 1UGRB 1X27A 1JJ2S 3IQLA 2X4WA 2DBKA 4OMPA 1SEMA 1U3OA 3RMSA 2MOXA 1VQNA 3VKIA 2LZ6B 3REBB 1NYFA 4Z89A 2KK4A 1C6VX 1TWBA 4E7KA 3TEEA 1KQSP 2AT1B 1JXOA 1QKXA 2PZ1A 2KYMA 2NYSA 4M4ZA 1Y0MA 4ZNXA 1TUCA 5FWCA 2LX9A 2KRMA 2JUFA 1QVFS 2DRKA 3UF4A 2QK0A 3M0TA 3UT1A 2QAZA 2EKOA 2QYZA 2KY9A 2CUDA 1U5SA 1VQMQ 3MPUB 1C1AA 1M90C 4J83A 4DEYA 1I1JA 2XK0A 2FZKB 4J9BA 5IN1A 2DK3A 2K5LA 4KGZB 4RTWA 1ZQ1A 1G3SA 1YJ9A 1E7OA 4D6WA 3A8MB 4JJCA 2W0ZA 4R55A 2RHYA 1TU0B 1B7TA 2X3WD 4XU1A 2EYXA 4RG8A 1W2BA 1KQ1A 4C92G 5LJ3d 4OP0A 2DL5A 2WSCE 3M57A 4A54A 3JRZA 1VQ9Q 2PNIA 4LUDA 4LDVA 3A8LB 4R56A 4Z8AA 1KJWA 1MMNA 1YN8A 1ZA2B 2X3XD 1YCYA 4IKFA 4BI4A 3R6NA 2EPDA 3TSZA 2DXCA 4OF1A 3CXCP 4JLGA 2DXTA 4RCBA 5KYYA 4M77B 2OTJQ 1K73U 1GL5A 1BB9A 3QG1A 3I35A 1B34A 2MPXC 2R57A 5KYNA 2A3LA 3SWNB 2EGEA 5GMKe 2F5KA 2CGHA 4PJOE 5GAN2 4E7LA 5GANj 2RQRA 3G4ST 1H641 3EFOB 1QLYA 2RPNA 2LJ1A 2QASA 1WJRA 2FVUA 4PL6A 4PJOC 2IG0A 1M1KU 1M27C 2CSQA 4JRPA 3EG1A 1E6HA 3VS1A 3GF5A 1NJIC 3EFRA 2EKHA 3PT9A 4HA8A 4M7AF 2FYKA 4FYXB 5KYXA 2ZPGB 3CD6Q 5CO7A 2CP2A 1UGPB 2YUOA 3GNGA 2JS2A 1D1BA 1R8OB 1VQNT 4MDWA 2RHXA 4EMHA 2A0FB 2RN8A 1OEBA 2O31A 4FSXA 4XTWA 5I2MA 2XDPA 5KE3A 1X43A 2OI3A 2YSQA 5HK0A 2OAWA 1YITA 2GCXA 1I0CA 4HVVA 4ZGEB 4C92D 3BE3A 3UDCA
chains in the Genus database with same CATH topology
1Q81C 3SDZA 2RI3A 4JLIA 4ZTFA 3CBOA 1Q82C 3QYHB 1UGSB 4M7AE 4ELYC 3BY7A 5CR2A 2OTLT 3JCMh 3L2ZA 2E1HA 4FT4A 1EIFA 4CRIA 2PUKB 2RK2A 4JS5A 1VIFA 1KQSS 1QVPA 3OB9A 4C8QD 1WGSA 1WJQA 3TREA 1Q7YC 2EQMA 2BUDA 2O4XA 4M7AC 4IURA 1TH7A 4C92C 4J6WA 3CMET 1N8RC 3OS0A 3V8LA 2ZZDA 3RERA 4C8QE 4MZPA 3URGA 4BY6C 1QVGA 3BFMA 2HQXA 3HPWA 4M77F 1H3ZA 1IZ6A 2BIVA 4C0DB 4ZN1A 3OYBA 3ZFJA 2LVMA 2JNGA 4RG2A 5LJ3h 3RKWA 4Z02A 3MHXA 2LC4A 3OMGA 3S3OA 1G3WA 3OYNA 5GAMe 3I55T 3QUIA 3OYIA 3CCVA 2DKGA 4M7AA 4C8QC 1YJ9T 4FL6A 4C92A 1RL2A 5IAYA 5LL6S 3CD6A 2QQ9A 4BUGA 2M9UA 2FHDA 3P8BB 5CAIA 3S3MA 4ZTJA 2CZ1B 3DLMA 4LDYA 3CPWA 1PSFA 4N4HA 3MEVA 2RM4A 2PUOB 1BKBA 3CCQA 2QXFA 1W2BS 4F7UB 3S3NA 2O01E 2IVWA 5I21A 1N6AA 4C8QA 3GP8A 5GMKj 4OB2B 1P92A 3MEUA 3E9GA 2GF7A 4M77D 4P5NA 5FU6B 3X24B 5CK9A 1KG1A 2I2LA 4C5EA 1M1GA 1O9SA 4Y91A 2RHIA 5CQYA 1FWZA 3P8HA 4HT9A 3C94A 4KT0E 3UWNA 3FLGA 1G3YA 4M77E 5GMKi 1X75C 4FU6A 4PLIA 3I56A 2EFIA 3KUFA 2EQKA 3C95A 3MCAB 4F7UG 2E41A 3MP1A 3JB9I 3WXMB 5LJ5e 3CMAA 2PVGB 3F70A 3L2VA 4IUQA 2X4JA 1VQMT 4M77C 5L8RE 3G71A 5FRMA 2F69A 1OZ3A 2K2VA 1WQ7A 2QQRA 2DVEA 3FJPA 2LTOA 4M78F 3BW1A 4OGCA 4XTUA 5LJ5d 3G6EA 4BI8B 2KDSA 1DJ7B 1SSFA 2DAQA 3EFSA 4KUIA 3TU4K 2JN0A 4X34A 2QA4A 2X4XA 2RJFA 4M77A 3SWNC 1YHQA 3VJPA 1N27A 1M9SA 2LT1A 1VQ8A 3HFOA 5GMKl 1KHCA 2ZCFB 3LWIA 5HY6A 3WVEB 2R5AA 2K3YA 2E10A 5GMKh 3JB9D 1VQ9A 1WPYA 2XD0A 4HKEA 3JCMb 3CCET 1QP2A 1VQLT 2EAYA 3SD4A 1YI2T 4O5VA 1K9MU 1VQ7A 4J7FA 3E1SA 3HRUA 2WSEE 3M55A 3SWNA 4M78D 2HBPA 4Q5WA 1Y96A 4Y28E 4NOYA 2R5MA 5J39A 3CC7T 4IUUA 1M4ZA 2EJGA 3HRSA 2BKDN 4BE2A 5M9OA 2A7YA 3ZEHA 3VYGA 4M78E 3CCUA 2M1HA 3PGGA 4OB3B 4A53A 4BD3A 4FT2A 4C92F 3HL8A 3JCMV 2MF2A 4LDXA 4XTZA 3LGFA 5D6XA 1XOVA 4HCCA 1Y7XA 3OW2S 2DPPB 3OQ5A 3QIIA 3VV0A 1VQKA 2XDBA 4M78C 5D6YA 4FIBA 2MI6A 1KD1C 1KQ2A 3CPFA 4XK8E 3JB9G 2NLUA 4ME7A 2RO0A 3DKMA 5J26A 2CYZB 2OTJA 4C0FA 3FRNA 1JBMA 4XU0A 3JCMf 1I4K1 2GFUA 2RI5A 5I2SA 1QVFA 2EYQA 3VYHB 4ELZC 3PTAA 2XHCA 4J6YA 2ZPFB 2X4YA 2QI2A 4ZN3A 2P0PA 4M78A 3L2WA 2M0OA 3A8OB 3META 3QPHA 1YJWT 5GAMf 3CBMA 3CCST 3L2UA 3OYDA 5FU7B 3GOXA 4OB0B 3JCMW 3L2QA 2DTIA 2GQVA 4V2SA 3A8HB 1VQOT 2PQWA 3PIPA 3DB4A 2K5IA 2CZ6B 3NTIA 4M75B 2WACA 4F7UF 2Y90A 3LX7A 1U1TA 2QQAA 3RESA 4C92E 2LRQA 1ZHIA 3MEAA 2MWOA 2AHJB 2EJ9A 3RKXA 3M4YA 3OYEA 4JRQA 2JZ2A 4JS4A 1YITT 1KHIA 3QHSA 5AYFA 3DLLA 3L1AA 4KBMB 2LNVA 3NTHA 4ZGJB 2XIDA 3M56A 2RD1A 1YIJA 1WJSA 2KSSA 4O6JA 4NL3A 2VGMA 3QZ9B 1MHNA 4BI3A 5GAOl 4RMOA 4M75G 4XQ3A 3JCMe 3LLRA 1VQ6A 2DD4A 1N9RA 4J6XA 4L5GA 1VQPA 3JCMg 4C0GA 1QP3A 1X01A 5LJ5f 5GAN4 1FXXA 3VUBA 4LDWA 4PLLA 2DO3A 1BI2A 3PNWC 4C0DC 3GLXA 1M5Q1 2ZPHB 3QKJA 5C6SA 3JCMd 4N4GA 5GAMg 3HFNA 3FDRA 3HKSA 3JSCA 5A0GA 4IUPA 4MMLA 2JTFA 1QVGS 4OB1B 3N5BB 2P0KA 3M9QA 2DD5A 4F7UE 1I81A 5GAMd 2E65A 2K57A 3ER0A 3OYFA 4ZGDB 2XU8A 1VUBA 1LJOA 4J5YA 3H6ZA 4QVZA 5GAN7 2YLCA 2ZGWA 5GAN6 1BIAA 3OBWA 3ME9A 2RHUA 3CCVT 3C4SA 4YTLA 3JCMc 3QJ6A 3OYYA 4HCBA 3CD6T 2VYTA 3M4GA 2VV5A 5C0MA 2EWNA 3CPWS 2M16A 4HCZA 2OAUA 5FU6C 5IT9E 4J8OA 3QSUA 2KMTA 4L6V5 2EJFA 4QQ6A 3QJYA 5J3BA 4EMKB 3UPUA 3QBYA 3CCQT 5HKCA 2HD0A 3T9NA 3JB9F 3BDUA 4F7UA 5LJ5g 1VQ5A 2QEXA 3RKYA 2PU9B 3OS2A 2LQKA 3LW5E 4BB7A 4XU3A 3FC3A 2DIQA 2K3XA 4EMGA 1GXIE 4PKCC 4C5GA 4A4KA 2DZ9A 1B34B 1VQ4A 3PMTA 4NL2A 4RKUE 3CC4A 3I56T 1W4SA 2FL7A 4N0AC 4XTYA 2WSFE 4IUTA 5GAOq 3M5AA 1OYXA 2E5QA 3VUZA 1YJNA 3CMAT 2RJDA 4LD6A 4MDXA 2L3RA 4LDUA 3M59A 3M54A 3KXTA 2LQ8A 4QVDA 3OS5A 3G4SA 3G71T 4M7DB 2RB6A 4PNOA 4DA4A 3R6OA 3MP8A 2D0QB 2V8JA 2R58A 3LYIA 4N0AA 5A0LA 5GMKm 5D6WA 3OYAA 4EPCA 3G6ET 1VQ4T 1BI3A 4EDUA 4JRKA 3CC2A 4A4GA 5KCHA 4DQ2A 5DLOA 1QW1A 1FX7A 1K8AU 5KE2A 2QA4T 3LWHA 1JJ2A 4L59A 1YHQT 2L8DA 2ZPBB 1NPPA 5GANf 5CKDA 1VIEA 4M75F 5KH6A 5GAOp 2K5FA 4QQDA 1VQ8T 4UC4A 4N4IA 2RHZA 2DJZA 4M7DG 1NE8A 1M8VA 1BI1A 2XDDA 4PJOB 1VQ9T 2JTMA 4MZMA 5CKFA 2LCCA 3JCMQ 3HP9A 4JRIA 4X9CA 3OBYA 2P4TA 1K9MC 1VQ7T 1UGRB 1PSEA 2VXEA 3CCRA 1WNLA 3CC2T 1WQWA 3FEOA 1JJ2S 3TCJA 2YRVA 1K8AC 1KC8U 2X4WA 3V7RA 1M1FA 2RI2A 2KQWA 3QO3A 3RMSA 3CBPA 4XTVA 3BDLA 3O8VA 2JVVA 1VQNA 1UB4A 3VKIA 2E6NA 3NFCA 4PJOG 3CCUT 2QQBA 3JB9J 1HK9A 2EQJA 2FB7A 3M58A 5CKEA 2KK4A 4M75D 3X25B 1G5VA 3CCLA 3PMIA 3HSBA 2HNIA 4E7KA 2RA2A 2QTXA 1O75A 3TEEA 4B9XA 5A0DA 5GAMj 1VQKT 1KC8C 5DY9A 4QVCA 3CCJA 2G3RA 3CCMA 4M75E 5GANe 1M90U 3GIBA 2VUBA 3A8GB 2LX9A 2OTJT 5FU7C 3HHTB 2JUFA 5GANg 2VGNA 2Y4YA 4GY5A 1S72A 1QVFS 1LOJA 4IUVA 2F5TX 5LJ3f 3UT1A 2E70A 1Q81U 2P0QA 4OVAA 2DIGA 2EKOA 1Q82U 2ZPEB 5GANd 2OTLA 4M75C 5FRNA 2KY9A 2PVOB 2V8KA 3V7SA 5DLQE 2DTHA 3J80E 4BACA 5GAN5 1N9SA 2O4XB 4DOWA 5CCAA 1M90C 4J83A 1KQSA 2DEQA 3JAME 4C5IA 2RH2A 3CMEA 2XK0A 1N8RU 2CZ0B 5IN1A 4E47A 3E9FA 1LNXA 3PFSA 2DK3A 2K5LA 4M75A 5CVIA 4II1A 5GAOm 4HT8A 4QQGA 1IREB 1ZQ1A 5LJ5j 4X9DA 2HAXA 1U8RA 2LT4A 2EQUA 4BE1A 1G3SA 3AHUA 4M7AB 3JCMJ 3I55A 3PIOA 3G7ZA 4C92B 1YJ9A 2CZ7B 2D9TA 2EIFA 3A8MB 4B9WA 5CQXA 2XICA 4D6WA 4R55A 4BY6B 1I5LA 1YIJT 3JCMX 5GAMh 2MAMA 2RHYA 5GAN8 3J7AF 4TVRA 2D6FA 5LJ3e 1VQ6T 3OYCA 3MP6A 3QXEB 2VXFA 5LJ3g 5A2QE 1VQPT 1BYMA 4XU1A 4C8QB 3RMQA 4RG8A 4JUVA 4JJNK 1W2BA 1KQ1A 4J7IA 4M7AG 4FM4B 4C92G 3MO8A 4XAXB 5LJ3d 4OP0A 3OYKA 4M7DF 2WSCE 3M57A 1RI0A 3JRZA 3Q1JA 4A54A 5CIUA 4A4FA 1V29B 3OSVA 3X26B 1D3BB 3A5ZB 4LDVA 2RJEA 2B8AA 2XI9A 3OA6A 1I8FA 4E7HA 3A8LB 1Y71A 2YHTA 3OYLA 3OMCA 3ASKA 4KULA 3OYGA 1NZ9A 1XQHA 4C8QG 4EMKC 1OZ2A 4R56A 3DB3A 2XKOC 4PJOF 3OS1A 3C12A 5LJ5h 2DXBA 4GLKA 2LDMA 1YCYA 3X28B 1VQMA 4IKFA 2Y4XA 4BI4A 2E64A 1UEBA 3L42A 2DTOA 2H3JA 3LGLA 3FB9A 2DXCA 4WF2A 3OYHA 1D3BA 4M7DD 4OF1A 4EMKA 3X20B 2GFAA 3OSSC 5DM7R 4JLGA 3KBGA 4JDSA 4A4EA 2DXTA 2CKKA 4RCBA 2L89A 1HXDA 4M77B 1VQ5T 4M7DE 2XG8D 2QEXT 4BE0A 1K73U 5GAOn 1NPRA 2PVDB 3ZBDA 3WVDB 3GNFB 2E6ZA 3QG1A 2C06A 3RIRA 2QDYB 5FLXE 2YLBA 4MZTA 5HK3A 3CCEA 3L2RA 1VQLA 4KUDK 4PJOD 3CC4T 1B34A 4M7DC 4ATOA 2R57A 1YI2A 2A3LA 1ZBXA 3SWNB 4E7IA 2MWPA 3QYGB 1Y96B 1JB0E 1AHJB 4XU2A 4M77G 3V8JA 3CXCA 4BDYA 1YJNT 5GMKe 2F5KA 1X6OA 2CGHA 4PJOE 3VU3C 5GAN2 3CC7A 4E7LA 3HRTA 5GANj 3RUXA 1K73C 3CEYA 3G4ST 3GPLA 1H641 3INZA 2MMPA 2HQEA 4XTXA 1NJIU 4M7DA 1UGQB 3LH0A 1WJRA 2FVUA 4VUBA 2QQSA 1MGQA 3SB2A 3OYJA 4PL6A 3JB9H 4PJOC 2IG0A 1U1SA 2RK1A 3MEWA 3CXCS 1M1KU 4QW2A 2CS7A 1JRIA 3E19A 3V7CA 4JRPA 5GAOr 3SFMA 4E7JA 3OW2A 1KD1U 1Q86U 5KCOA 3GF5A 1Y07A 1NJIC 3J81E 3V8KA 3EFRA 1YBYA 3FIFA 4PJOA 1XNIA 3M53A 3P8DA 4MMKA 2DXUA 3PT9A 4HA8A 4M7AF 4M78B 2FYKA 3S6WA 3CCRT 2X35A 3OY9A 1YJWA 1M1KC 4NS5A 4LD9K 2ZPGB 4OGEA 2KAFA 3CCSA 5CO7A 1UGPB 3GNGA 5CKBA 4BDZA 3H8ZA 3OYMA 1R8OB 1VQOA 2K4YA 1Q86C 3NTKA 1VQNT 4MDWA 1BIBA 2RHXA 4A4HA 4EMHA 5LJ3j 3JCMP 4C8QF 5GANh 2L5QA 1XTDA 2LCLA 3QDRB 4RCCA 2JOYA 4DOVA 3CCLT 4M78G 4FSXA 1G3TA 2KVQG 3EAEA 4XTWA 5EG2A 5CKHA 5I2MA 5FROA 2XDPA 4C5HA 2E12A 5KE3A 5GAN3 5HK0A 2DZCA 2VC8A 1YITA 2V8IA 1Q7YU 2GCXA 4OMFB 3CCJT 3CCMT 2ZPIB 2RJCA 4ZGEB 4M7AD 3UDCA 4C92D 1BI0A 4C0ZA 4CI0C 3QZ5B 1S72T 1OI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTZ A;  4JLI A;  1D3B B;  4M7A E;  3BY7 A;  4QVD A;  4M78 C;  3JCM h;  3L2Z A;  2E1H A;  2RB6 A;  1KQ2 A;  3JB9 G;  1I8F A;  4PNO A;  4M7D B;  2YHT A;  5GMK m;  4N0A A;  4C8Q D;  4C8Q G;  4EMK C;  1JBM A;  4XU0 A;  4JRK A;  3JCM f;  4M7A C;  1I4K 1;  1TH7 A;  4J6W A;  4C92 C;  4DQ2 A;  4PJO F;  3V8L A;  5LJ5 h;  3RER A;  1YCY A;  4C8Q E;  4J6Y A;  2E64 A;  3BFM A;  4M78 A;  4M77 F;  5GAN f;  4M75 F;  5GAO p;  2DTO A;  5GAM f;  4WF2 A;  3JCM W;  3FB9 A;  4M7D D;  1D3B A;  4M7D G;  2DJZ A;  2DTI A;  5LJ3 h;  4EMK A;  3RKW A;  4PJO B;  4V2S A;  1M8V A;  5GAM e;  3JCM Q;  3QUI A;  2DXT A;  4JRI A;  2DKG A;  4RCB A;  4X9C A;  4C8Q C;  4M7A A;  1HXD A;  4M77 B;  4C92 A;  4M75 B;  4M7D E;  4F7U F;  2VXE A;  1WNL A;  2Y90 A;  5GAO n;  1U1T A;  1WQW A;  3RES A;  4C92 E;  5CAI A;  3RIR A;  3V7R A;  2YLB A;  2RM4 A;  2EJ9 A;  3RKX A;  3QO3 A;  4XTV A;  3QHS A;  4F7U B;  3L1A A;  4PJO D;  4M7D C;  1B34 A;  5I21 A;  3JB9 J;  4PJO G;  4C8Q A;  1HK9 A;  5GMK j;  2FB7 A;  2RD1 A;  3SWN B;  4NL3 A;  4M77 D;  1Y96 B;  4XU2 A;  4M75 D;  4M77 G;  3V8J A;  5GAO l;  4M75 G;  4XQ3 A;  3JCM e;  5GMK e;  3HSB A;  2I2L A;  2CGH A;  2HNI A;  1N9R A;  4PJO E;  4J6X A;  3VU3 C;  4Y91 A;  5GAN 2;  2RA2 A;  2QTX A;  3RUX A;  3JCM g;  5GAM j;  5GAN j;  4HT9 A;  1X01 A;  5DY9 A;  4QVC A;  5LJ5 f;  5GAN 4;  1H64 1;  3INZ A;  4M77 E;  5GMK i;  4M75 E;  5GAN e;  3GIB A;  4XTX A;  4M7D A;  1M5Q 1;  4F7U G;  2E41 A;  3JCM d;  5GAN g;  1MGQ A;  5LJ5 e;  3HFN A;  3SB2 A;  5GAM g;  3JB9 I;  3JB9 H;  1LOJ A;  4PJO C;  1U1S A;  4MML A;  5LJ3 f;  1JRI A;  3V7C A;  4M77 C;  4F7U E;  5GAN d;  1I81 A;  4M75 C;  2E65 A;  5GAM d;  2K57 A;  5GAO r;  4X9D A;  1WQ7 A;  3FJP A;  2DVE A;  4XTU A;  4M78 F;  3V7S A;  3BW1 A;  5LJ5 d;  2DTH A;  1LJO A;  5GAN 5;  1N9S A;  4J5Y A;  5GAN 7;  3EFS A;  2YLC A;  2ZGW A;  5GAN 6;  3V8K A;  1BIA A;  3EFR A;  2DEQ A;  3FIF A;  4PJO A;  2JN0 A;  4MMK A;  2DXU A;  3JCM c;  4HA8 A;  4M7A F;  1LNX A;  4M78 B;  2FYK A;  3M4G A;  4M77 A;  4M75 A;  3SWN C;  2EWN A;  5GAO m;  3HFO A;  5GMK l;  4HT8 A;  3QSU A;  5LJ5 j;  4EMK B;  2EJF A;  2E10 A;  5GMK h;  3JB9 D;  1WPY A;  3AHU A;  4M7A B;  3JCM J;  3JCM b;  4C92 B;  3JB9 F;  2EAY A;  3BDU A;  1BIB A;  4F7U A;  5LJ5 g;  4EMH A;  5LJ3 j;  3JCM P;  1I5L A;  4C8Q F;  3JCM X;  3RKY A;  5GAN h;  5GAM h;  5GAN 8;  4RCC A;  4M78 D;  3SWN A;  4XU3 A;  4M78 G;  1Y96 A;  5LJ3 e;  4NOY A;  4XTW A;  4EMG A;  5GAN 3;  2VXF A;  5LJ3 g;  2EJG A;  2DZC A;  2VC8 A;  2DZ9 A;  1B34 B;  4NL2 A;  4XU1 A;  4C8Q B;  4M78 E;  4N0A C;  4JUV A;  4XTY A;  4M7A D;  4C92 D;  1KQ1 A;  5GAO q;  4M7A G;  4C92 G;  3PGG A;  5LJ3 d;  4A53 A;  4OP0 A;  4M7D F;  4A54 A;  4C92 F;  3JCM V; 
#chains in the Genus database with same CATH topology
 4JLI A;  2HKQ B;  2A37 A;  2KBT A;  2AZS A;  4ELY C;  2RK2 A;  1YWO A;  2EYZ A;  4CC7 A;  1VIF A;  3FJ5 A;  1Q7Y C;  1UDL A;  4LE9 A;  1YFN A;  1TH7 A;  1N8R C;  1FMK A;  2DL4 A;  4C8Q E;  4MZP A;  5ECA A;  4KGX B;  3H0I A;  2QA4 Q;  4ZN1 A;  1Q86 R;  3ZFJ A;  2JNG A;  1YNZ A;  5LJ3 h;  2QGG A;  3RKW A;  3S3O A;  3MHX A;  3OMG A;  2LJ3 A;  4M7A A;  4C8Q C;  1YJ9 T;  4FL6 A;  5LL6 S;  1IGU A;  2I0N A;  2FHD A;  3S3M A;  5CAI A;  2CZ1 B;  1PSF A;  3MEV A;  2RM4 A;  2QDL A;  2O01 E;  4AFU C;  1K4U S;  2KE9 A;  2COW A;  4WTO B;  5IXB A;  2CT3 A;  2NUZ A;  5CK9 A;  1Q82 R;  1O9S A;  4RTY A;  1D09 B;  3E2U A;  4FW2 A;  1SSH A;  1G3Y A;  1X75 C;  2LQN A;  4FU6 A;  2EFI A;  2EQK A;  2DFU A;  2E41 A;  3JB9 I;  3WXM B;  2KXD A;  2XMF A;  2KR3 A;  5FRM A;  2QQR A;  2KXC A;  5LJ5 d;  4OGC A;  2DAQ A;  4KUI A;  1X69 A;  1LCK A;  2RJF A;  3VJP A;  1RAC B;  1X2K A;  2ZCF B;  3LWI A;  2K3Y A;  3JB9 D;  2C0O A;  2CDT A;  3EHQ A;  1SG5 A;  2D1X A;  2CP6 A;  1BU1 A;  3REA B;  1U06 A;  1UHF A;  1D0Y A;  2R5M A;  1TUD A;  5J39 A;  4E2F B;  3HRS A;  2BKD N;  5GJV B;  5M9O A;  1SHG A;  4M78 E;  3CCU A;  4OB3 B;  4A53 A;  4BD3 A;  1UG1 A;  3I55 Q;  3LGF A;  3OW2 S;  2ATC B;  3OQ5 A;  1VQK A;  3VV0 A;  2RQV A;  1G8X A;  4M78 C;  1KQ2 A;  1GFC A;  4XK8 E;  2RO0 A;  5J26 A;  2FO0 A;  5KYU A;  1JBM A;  3M0P A;  2RI5 A;  1QVF A;  2XHC A;  2ZPF B;  1JEG A;  3L2W A;  3A8O B;  4OB0 B;  3L2Q A;  2FPD A;  4V2S A;  2PQW A;  3DB4 A;  3NTI A;  4F7U F;  3LX7 A;  3SHW A;  1VQ5 Q;  2LRQ A;  1ZHI A;  3MEA A;  2O88 A;  1MNE A;  2AHJ B;  3RKX A;  3OYE A;  1YIT T;  3QHS A;  5AYF A;  1NYG A;  3NTH A;  3M56 A;  1WJS A;  1FMV A;  2VGM A;  1MHN A;  4RMO A;  1VA7 A;  4M75 G;  3JCM e;  1GRI A;  1VQP A;  3JCM g;  1KD1 R;  1QP3 A;  2HMA A;  2DA9 A;  4LDW A;  2DO3 A;  4C0D C;  1M5Q 1;  3QKJ A;  5GAM g;  3JSC A;  2DE0 X;  2K3B A;  2JTF A;  4OB1 B;  3N5B B;  2P0K A;  4AFS C;  3OYF A;  1AEY A;  4J5Y A;  3H6Z A;  2YLC A;  1J3T A;  3OBW A;  2RHU A;  1M3A A;  1UFF A;  3C4S A;  4HCB A;  3M4G A;  2VV5 A;  3CPW S;  2OAU A;  5FU6 C;  3CCR Q;  3QSU A;  2KMT A;  2EJF A;  4J9H A;  3T9N A;  1QCN A;  2OX7 A;  4F7U A;  2C0T A;  3U23 A;  5LJ5 g;  1AVZ C;  1JXM A;  3RKY A;  3OS2 A;  4BB7 A;  4XU3 A;  2FG0 A;  2K9G A;  4C5G A;  4A4K A;  2DZ9 A;  1SRM A;  2FL7 A;  3G1J A;  5GAO q;  1AT1 B;  3VUZ A;  3RBB B;  2RJD A;  1S72 Q;  2LQ8 A;  1WI7 A;  2HL5 C;  2D0Q B;  5GMK m;  2R58 A;  1PD1 A;  1YP5 A;  4EPC A;  1VQ4 T;  1BI3 A;  4EDU A;  4A4G A;  5KCH A;  2VVK A;  5DLO A;  1QW1 A;  1MMD A;  5CKD A;  1VIE A;  2K5F A;  4QQD A;  4M7D G;  4J9E A;  1BI1 A;  4PJO B;  2JTM A;  3HP9 A;  4JRI A;  2RQU A;  2P4T A;  2L3P A;  1WNL A;  1KC8 U;  2RI2 A;  2HZY A;  2KEA A;  3O8V A;  2JVV A;  1WXB A;  2E6N A;  3CCU T;  3M58 A;  4M75 D;  1G5V A;  2DVJ A;  3CCL A;  3CCV Q;  1AZG B;  1VQK T;  5DY9 A;  3GIB A;  1QWE A;  5KYW B;  3HHT B;  4IUV A;  2AIR B;  2F5T X;  5LJ3 f;  1D1A A;  2P0Q A;  1XJW B;  2PVO B;  2V8K A;  5DLQ E;  4BAC A;  2O4X B;  5CCA A;  1K9M R;  2KNB B;  1N8R U;  3I56 Q;  1RAH B;  4E47 A;  3E9F A;  1K8A R;  2EYY A;  2V1Q A;  4HT8 A;  1IRE B;  1U8R A;  1Y57 A;  2D9T A;  3CCE Q;  5CQX A;  2PTK A;  3G6E Q;  2C0I A;  2LP5 A;  4KH1 B;  1YI2 Q;  3VS7 A;  3J7A F;  4TVR A;  1IXD A;  3OYC A;  3MP6 A;  3QXE B;  1AWX A;  1VQP T;  2GQI A;  1BYM A;  4C8Q B;  2J6O A;  4JJN K;  4J7I A;  3VS4 A;  1B07 A;  1HSQ A;  1V29 B;  2ED1 A;  2D0N A;  4E7H A;  3OMC A;  2FZC B;  3QWY A;  4E7S A;  2XKO C;  2F1L A;  2M0Y A;  1VYV A;  1VQM A;  4GLK A;  3X28 B;  1QCO A;  2DTO A;  2H3J A;  1WHL A;  3LGL A;  4WF2 A;  4M7D D;  3H9N A;  1YJW Q;  3RNJ A;  3CCS Q;  2GFA A;  3KBG A;  1VQO Q;  3EGD A;  2PVD B;  3WVD B;  5FLX E;  1VQL A;  1ZBX A;  2ZAE A;  1M2V B;  2MWP A;  4BDY A;  4M77 G;  1H92 A;  3VU3 C;  5I22 A;  3RUX A;  2JM9 A;  1OX9 A;  1RAB B;  2GTJ A;  2EQI A;  4VUB A;  4DBQ A;  1MGQ A;  3SB2 A;  5FWB A;  3OYJ A;  6AT1 B;  3CXC S;  2RK1 A;  2RQT A;  4QW2 A;  1JRI A;  4FW1 A;  3V7C A;  5GAO r;  3SFM A;  3OW2 A;  4RTV A;  2ROT A;  4HCK A;  4AT1 B;  3EFO A;  3M53 A;  3P8D A;  2MIO A;  2DL8 A;  2DXU A;  1PNJ A;  4M78 B;  2X35 A;  4OGE A;  1G83 A;  1OU9 A;  4BDZ A;  1Q86 C;  1ZSZ A;  4A4H A;  2DEU A;  2K6D A;  5LJ3 j;  2LX7 A;  1R77 A;  1XTD A;  3QDR B;  4RCC A;  1K73 R;  3CCL T;  1G3T A;  4DA4 A;  5GAN 3;  2DZC A;  2V8I A;  4OMF B;  5I11 A;  3EG9 A;  4C0Z A;  4ZTF A;  3CBO A;  1Q82 C;  4M7A E;  1UGS B;  1WA7 A;  2GBQ A;  3SEM A;  2EBP A;  4CRI A;  4FT4 A;  2PUK B;  4JS5 A;  1FYN A;  1R0B G;  8AT1 B;  3TRE A;  2RQW A;  4M7A C;  2DL7 A;  2GGR A;  4J6W A;  1M1K R;  1VYT A;  3URG A;  2B86 A;  4RUG A;  4BY6 C;  3BFM A;  2HQX A;  3HPW A;  1NEB A;  2E3H A;  4C0D B;  1GBQ A;  3OYB A;  1YHQ Q;  1VQ8 Q;  2NUP B;  1WLP B;  3G4S Q;  2DKG A;  4C92 A;  1RL2 A;  1SPK A;  3CD6 A;  2CH4 W;  3CC2 Q;  4LDY A;  1MV3 A;  4N4H A;  3CPW A;  1ARK A;  3S3N A;  2YRD A;  1WHJ A;  1N6A A;  3GP8 A;  1Q81 R;  3MEU A;  4M77 D;  2GF7 A;  5FU6 B;  3X24 B;  1KG1 A;  4AG2 C;  5D7U A;  3D7S B;  3M0Q A;  2MK5 A;  3P8H A;  3C94 A;  4JPB W;  3FLG A;  5GMK i;  1PD0 A;  3C95 A;  3MP1 A;  2FZG B;  2NUT B;  2K79 A;  1VQN Q;  1SKU B;  1VQM T;  4J9C A;  2F69 A;  1OZ3 A;  4X9D A;  1WQ7 A;  1YWP A;  2DVE A;  2LTO A;  3BW1 A;  3TQ7 P;  1SRL A;  1JU5 C;  4Z88 A;  1ZLM A;  1T0H A;  3KFV A;  2JN0 A;  1S1N A;  3PVL A;  2QA4 A;  2X4X A;  1OUL A;  2EVR A;  4A63 B;  1M9S A;  1PRL C;  5GMK l;  5HY6 A;  2R5A A;  3QWX X;  5GMK h;  1WHK A;  1WPY A;  2XD0 A;  2DIL A;  1QP2 A;  1VQL T;  2EAY A;  3SD4 A;  1VQ7 A;  4J7F A;  3E1S A;  3HRU A;  4J9D A;  2HBP A;  4Q5W A;  1Y96 A;  4IUU A;  1M4Z A;  1M3C A;  2HL3 A;  3HL8 A;  1XOV A;  1Y7X A;  3THK A;  2XDB A;  5D6Y A;  4FIB A;  1KD1 C;  3CPF A;  3JB9 G;  1UEC A;  1K9A A;  3FRN A;  4XU0 A;  1RAD B;  3UA6 A;  2GFU A;  3I9Q A;  3VYH B;  2KGT A;  2HSP A;  2QI2 A;  3QPH A;  1RAI B;  3CBM A;  3JCM W;  3GOX A;  1Q95 G;  2AKL A;  2CZ6 B;  2QQA A;  3RES A;  4J9I A;  1ZBJ A;  2MWO A;  1UJ0 A;  4JRQ A;  3DLL A;  3L1A A;  2LNV A;  1PCX A;  2RD1 A;  1YIJ A;  4O6J A;  3EHR A;  2VAS A;  4BI3 A;  1BBZ A;  1VQ6 A;  3LLR A;  1GFD A;  2DD4 A;  1QKW A;  1N9R A;  1ZUY A;  4J6X A;  1YJN Q;  1NM7 A;  4LXC A;  1FXX A;  2A36 A;  2COY A;  2ZPH B;  5C6S A;  3JCM d;  2YWW A;  3HFN A;  4ORZ A;  4LNP A;  1QVG S;  4F7U E;  4OMM A;  5GAM d;  2E65 A;  2K57 A;  4RTT A;  2JMC A;  4ZGD B;  2ED0 A;  1VUB A;  1YCS B;  1V76 A;  4PJJ A;  3CD6 T;  2KT1 A;  2VYT A;  2EWN A;  3QJY A;  5J3B A;  3QBY A;  2KT8 A;  5KYY B;  5HKC A;  1T0J A;  1VQ5 A;  2QEX A;  2J05 A;  2LMJ A;  3FC3 A;  1E6G A;  2JW4 A;  1B34 B;  2O9S A;  1VQ4 A;  3PMT A;  4NL2 A;  4RKU E;  3CC4 A;  2HBW A;  4PK4 A;  2WSF E;  4LD6 A;  2L3R A;  1H3H A;  3KXT A;  3EG2 A;  4QVD A;  1BCO A;  4PNO A;  2OTL Q;  3OYA A;  2CP3 A;  4JRK A;  4Y92 A;  1IRX A;  4FCY A;  5KE2 A;  2QA4 T;  3LWH A;  1JJ2 A;  1Z9Q A;  3QDF A;  4M75 F;  4N4I A;  2XDD A;  1KSW A;  4MZM A;  1RAA B;  2LCC A;  4X9C A;  3OBY A;  1K9M C;  1K0X A;  1VQ7 T;  1PSE A;  5KYX B;  3CCR A;  3FEO A;  1K8A C;  1C0M A;  3V7R A;  1M1F A;  3QO3 A;  1CKA A;  4XTV A;  3BDL A;  3JB9 J;  3NFC A;  4PJO G;  1M2O A;  2QQB A;  2EQJ A;  2FB7 A;  5CKE A;  3X25 B;  3CQT A;  1TTH B;  2SRC A;  1X6B A;  2QTX A;  4B9X A;  1GCP A;  4QVC A;  3CCJ A;  1OU8 A;  2G3R A;  3CCM A;  5GAN e;  1M90 U;  2VUB A;  3A8G B;  4F17 A;  1BCM A;  5GAN g;  1S72 A;  1LOJ A;  3NGP A;  2HCK A;  2DIG A;  2ROL A;  1Q82 U;  2ZPE B;  5FRN A;  2IPO B;  2ENM A;  3UAT A;  3V7S A;  2DTH A;  3J80 E;  2GNC A;  1N9S A;  4DOW A;  4LN2 A;  3JAM E;  1K76 A;  3CME A;  2RH2 A;  3I5S A;  3PFS A;  4M75 A;  4II1 A;  5GAO m;  2A08 A;  2YRC A;  2HAX A;  2JXB A;  3AHU A;  4M7A B;  3PIO A;  3G7Z A;  2D8H A;  2BZY A;  2CZ7 B;  2EIF A;  4B9W A;  4BY6 B;  1I5L A;  4AMC A;  1YIJ T;  4F16 A;  4ESR A;  5GAM h;  5GAN 8;  3RR6 A;  1VQ6 T;  1KC8 R;  2VXF A;  1QMC A;  4JUV A;  4FM4 B;  4M7D F;  3MO8 A;  4XAX B;  1RI0 A;  3EH2 A;  4A4F A;  1D3B B;  2EGA A;  2RJE A;  2B8A A;  2XI9 A;  3OA6 A;  1W70 A;  1PC0 A;  4FYW B;  5IHI A;  4C8Q G;  2V1R A;  2YUN A;  4EIK A;  5LJ5 h;  2LDM A;  2CRE A;  2BZ8 A;  2E64 A;  3L42 A;  2AZV A;  4J9F A;  1A0N B;  4PFO A;  2YT6 A;  1AWO A;  4EMK A;  3X20 B;  3NPF A;  3OSS C;  2DYB A;  5DM7 R;  1VQK Q;  2FRW A;  1H8K A;  4A4E A;  1ZUK A;  2L89 A;  1HXD A;  1VQ5 T;  2XG8 D;  2QEX T;  4BE0 A;  1NPR A;  3ZBD A;  3GNF B;  2E6Z A;  3RIR A;  4AFZ C;  2QDY B;  3MKD A;  5HK3 A;  3CCE A;  4KUD K;  4PJO D;  3CC4 T;  2DJQ A;  4ATO A;  1YI2 A;  4E7I A;  2LQW A;  1AHJ B;  2MYS A;  3V8J A;  3EGX A;  3CC7 A;  1K73 C;  3HRT A;  1TXQ A;  4IIO A;  3CEY A;  3GPL A;  2ABL A;  2MMP A;  4XTX A;  1NJI U;  4M7D A;  1UGQ B;  1UGV A;  2QQS A;  3JV3 A;  4DBH A;  2X51 A;  1WZO A;  3MEW A;  2M02 A;  2YUP A;  1AWW A;  1KD1 U;  5KYU B;  2VWF A;  5KCO A;  3EH1 A;  2VB6 A;  1Y07 A;  1VQP Q;  1ZSZ C;  4QKU A;  3V8K A;  3FIF A;  2BE7 D;  1NG2 A;  3S6W A;  3CCR T;  3OY9 A;  1YJW A;  1M1K C;  3CCS A;  2KAF A;  5CKB A;  3H8Z A;  3OYM A;  1VQO A;  2K4Y A;  1NLO C;  3CCQ Q;  1BIB A;  3JCM P;  2L5Q A;  2LCL A;  4DOV A;  4M78 G;  5FRO A;  4C5H A;  1T3S A;  3J81 E;  3OYH A;  1GCQ A;  1MND A;  3I5R A;  2E12 A;  5L23 A;  2E4H A;  1Q7Y U;  4RTX A;  3CCJ T;  3CCM T;  2JS0 A;  4CI0 C;  3QZ5 B;  1S72 T;  2L3Q A;  1Q81 C;  3SDZ A;  3CMA Q;  1W2B P;  3QYH B;  1OQK A;  1EIF A;  1PKT A;  3G71 Q;  1KQS S;  1QVP A;  4C8Q D;  1WGS A;  1WJQ A;  3EG0 A;  4D8K A;  2BUD A;  4IUR A;  4C92 C;  3CPW P;  1WHH A;  3CME T;  3OS0 A;  2ZZD A;  1FMW A;  3RER A;  2CP5 A;  1QVG A;  2P84 A;  4M77 F;  1H3Z A;  1HJD A;  1IZ6 A;  2COZ A;  4RG2 A;  4Z02 A;  2FPF A;  2CSI A;  3OYN A;  3QUI A;  3OYI A;  1NEG A;  3VRZ A;  2QQ9 A;  4BUG A;  4IIM A;  2BTT A;  1HD3 A;  2M9U A;  3P8B B;  3DLM A;  2PUO B;  2QXF A;  4QT7 A;  2W10 A;  4F7U B;  2IVW A;  1Z9Z A;  2BZX A;  5GMK j;  1P92 A;  3E9G A;  4P5N A;  2NUP A;  4HXJ A;  2I2L A;  1M1G A;  5CQY A;  3GBQ A;  1FWZ A;  4HT9 A;  3EG3 A;  4KT0 E;  3MCA B;  2X9H A;  1PHT A;  1IO6 A;  2PVG B;  1AZE A;  5IHK A;  1WIE A;  2KI7 A;  2AK5 A;  5L8R E;  4X1V A;  5EG2 A;  2K2V A;  3FJP A;  4XTU A;  2J7I A;  3CCL Q;  2KDS A;  1DJ7 B;  1SSF A;  3TU4 K;  4OMN A;  4M77 A;  1YHQ A;  1N27 A;  1VQ8 A;  2DRM A;  3WVE B;  2E10 A;  1VQ9 A;  4HKE A;  3CCE T;  1YI2 T;  1K9M U;  1EZZ B;  4R0K A;  3VS0 A;  3SWN A;  4M78 D;  4PFZ A;  1UHC A;  3A1P A;  1AD5 A;  3CC7 T;  2EJG A;  4BE2 A;  3ZEH A;  1PG5 B;  2M1H A;  1TS9 A;  4FT2 A;  4C92 F;  2ESW A;  1I07 A;  3TSW A;  2MF2 A;  4XTZ A;  5D6X A;  4HCC A;  4KGV B;  2DPP B;  2MI6 A;  4CC3 A;  4ME7 A;  1WHG A;  3DKM A;  2CYZ B;  2OTJ A;  4C0F A;  1OPK A;  3JCM f;  5I2S A;  2EYQ A;  4CC2 A;  4ELZ C;  3HTR A;  1RLP C;  1TG0 A;  2M0O A;  3MET A;  5AT1 B;  4F04 B;  1YJW T;  5GAM f;  3CCS T;  3L2U A;  2GQV A;  3A8H B;  1VQO T;  3PIP A;  2K5I A;  2JJ9 A;  2FEI A;  1U1T A;  1KHI A;  4KBM B;  4ZGJ B;  2KSS A;  3QZ9 B;  5EC7 A;  5GAO l;  4XQ3 A;  1TSF A;  1IGQ A;  2NWM A;  1X01 A;  5LJ5 f;  4OMO A;  3PNW C;  1BI2 A;  3GLX A;  2FRY A;  5A0G A;  1WX6 A;  4MML A;  1VQL Q;  3M9Q A;  1RI9 A;  2DD5 A;  1I81 A;  1TUG B;  2F2V A;  2XU8 A;  5GAN 7;  5IH2 A;  2HEQ A;  2ZGW A;  3ME9 A;  4YTL A;  1UJY A;  3QJ6 A;  3OYY A;  5IT9 E;  4L6V 5;  4QQ6 A;  4FYV B;  7AT1 B;  3MJX A;  2HD0 A;  1QCF A;  3JB9 F;  3EGD B;  2K7A A;  2PU9 B;  4DBF A;  2HSE B;  2LQK A;  2BE9 B;  2K3X A;  4EMG A;  1GXI E;  4PKC C;  2H8H A;  1MV0 B;  4XTY A;  2A28 A;  4J9G A;  2LJ0 A;  2MCN A;  1JJ2 P;  1OYX A;  2E5Q A;  4JJD A;  1YJN A;  4FYY B;  4LDU A;  1KFZ A;  3M59 A;  1AOJ A;  3OS5 A;  1T3L A;  2V8J A;  3LYI A;  4N0A A;  5A0L A;  4E7Z A;  2L2P A;  1RUW A;  2CT4 A;  1RLQ C;  2RMO A;  4OML A;  4DQ2 A;  1YHQ T;  2L8D A;  2CUB A;  1EX4 A;  5GAO p;  5KH6 A;  1VQ8 T;  1QVF P;  2HKN A;  3ZL7 C;  1M8V A;  1WXU A;  5CKF A;  1VQ9 T;  3JCM Q;  2JTE A;  1UUE A;  2VXE A;  1YJ9 Q;  3CC2 T;  1WQW A;  3VS2 A;  2H3E B;  5FW9 A;  3TCJ A;  2YRV A;  1BK2 A;  1OV3 A;  1SF9 A;  1WXT A;  9ATC B;  2KQW A;  1ZSZ B;  3CBP A;  1UB4 A;  2O9V A;  1HK9 A;  1ZA1 B;  3PMI A;  3HSB A;  2HNI A;  2RA2 A;  5A0D A;  1O75 A;  5GAM j;  4HVU A;  1KC8 C;  3TVT A;  3EG9 B;  4M75 E;  1PWT A;  2OTJ T;  5FU7 C;  2VGN A;  2Y4Y A;  4GY5 A;  2E70 A;  1Q81 U;  4OVA A;  5GAN d;  2OTL A;  4M75 C;  4JZ3 A;  2HQH A;  4PJM A;  5GAN 5;  1KQS A;  2DEQ A;  2HDA A;  4C5I A;  2CZ0 B;  2DX1 A;  1LNX A;  1IB8 A;  1WYX A;  5CVI A;  2RF0 A;  4QQG A;  5LJ5 j;  4KH0 B;  1ABQ A;  2LT4 A;  2DBM A;  2EQU A;  4BE1 A;  3JCM J;  1ABO A;  2JT4 A;  3I55 A;  4C92 B;  4GLM A;  1GBR A;  3PE0 A;  2DET A;  2XIC A;  4F14 A;  3JCM X;  2EYW A;  2MAM A;  5IXF A;  2D6F A;  5LJ3 e;  5A2Q E;  5LJ3 g;  1QQJ A;  3RMQ A;  3UA7 A;  4M7A G;  8ATC B;  3OYK A;  3RDV A;  3Q1J A;  5CIU A;  3OSV A;  3X26 B;  3A5Z B;  1VQ7 Q;  2O2O A;  1I8F A;  1Y71 A;  2YHT A;  3OYL A;  1PRM C;  3ASK A;  4KUL A;  3OYG A;  1NZ9 A;  2F2W A;  1M90 R;  1XQH A;  4EMK C;  1OZ2 A;  3DB3 A;  1IHW A;  3NHN A;  1ZX6 A;  4PJO F;  3OS1 A;  3C12 A;  2DXB A;  1K0S A;  1R0C B;  2Y4X A;  1EFN A;  1UEB A;  3FB9 A;  1D3B A;  1V1C A;  2DL3 A;  3H0H A;  3O5Z A;  4JDS A;  2VKN A;  3C0C A;  2CKK A;  4AG1 C;  1TOV A;  4M7D E;  5GAO n;  1M8M A;  2C06 A;  4E6R A;  1M3B A;  2D8J A;  2YLB A;  4MZT A;  4B6M A;  1MMG A;  3L2R A;  4M7D C;  1YIT Q;  1OPL A;  1WFW A;  3QYG B;  3CXC A;  1Y96 B;  1JB0 E;  4XU2 A;  1YJN T;  1WHM A;  1X6O A;  2LCS A;  4ANJ A;  4CC4 B;  2DER A;  1CSK A;  3INZ A;  2HQE A;  2KRO A;  3LH0 A;  2FPE A;  3JB9 H;  1U1S A;  2CS7 A;  1W1F A;  3E19 A;  1YIJ Q;  4E7J A;  1Q86 U;  1VQ6 Q;  2M51 A;  2LNH B;  4RTZ A;  1YBY A;  4PJO A;  1XNI A;  4MMK A;  2JMA A;  2KRN A;  4LD9 K;  4NS5 A;  1GCQ C;  1MMA A;  1JQQ A;  3NTK A;  1LVK A;  1X6G A;  4C8Q F;  5GAN h;  1OX8 A;  2JOY A;  2KVQ G;  3EAE A;  5CKH A;  2VC8 A;  2ZPI B;  2RJC A;  3M0S A;  4M7A D;  1N5Z A;  4DBR A;  4AFQ C;  1QVG P;  1BI0 A;  5KYW A;  1OI1 A;  1ZSG A;  2RI3 A;  3BY7 A;  5CR2 A;  2OTL T;  3JCM h;  3L2Z A;  2QEX Q;  1I5O B;  2E1H A;  2YXY A;  3OB9 A;  3NMZ C;  1NJI R;  2P4R A;  4KRT A;  2EQM A;  2O4X A;  1VQ4 Q;  2QGF B;  3CC4 Q;  3V8L A;  2BIV A;  2LVM A;  1NBE B;  2LC4 A;  1G3W A;  5GAM e;  3I55 T;  3CCV A;  4HVW A;  5IAY A;  1PM3 A;  1PKS A;  1X2Q A;  2QTV A;  4ZTJ A;  1AWJ A;  1D0X A;  1BKB A;  3CCQ A;  1W2B S;  5I21 A;  4LUE A;  4C8Q A;  4OB2 B;  3CCU Q;  4D8D A;  1KK7 A;  4C5E A;  1RAG B;  4Y91 A;  2RHI A;  3UWN A;  4M77 E;  1Q7Y R;  3I56 A;  4PLI A;  3KUF A;  4F7U G;  5LJ5 e;  2EGC A;  2Z0W A;  3CMA A;  1N8R R;  4DEX A;  2JM8 A;  1ZUU A;  1RAF B;  3F70 A;  3L2V A;  1UTI A;  4GBQ A;  4IUQ A;  2X4J A;  2RNA A;  4M77 C;  3G71 A;  1IHV A;  1B3Q A;  4M78 F;  3G6E A;  4BI8 B;  2DLP A;  2L0A A;  2CP7 A;  3EFS A;  3A98 A;  4PJL A;  2J6K A;  1WDX A;  3OW2 P;  3CCJ Q;  3CCM Q;  2J06 A;  4X34 A;  3SWN C;  3M0U A;  2LT1 A;  3HFO A;  1KHC A;  4K11 A;  2KRS A;  3JCM b;  4O5V A;  2EW3 A;  2WSE E;  3M55 A;  1QWF A;  1VYU A;  1M2V A;  4WCI A;  4Y28 E;  4NOY A;  4JZ4 A;  3CME Q;  1KIK A;  2A7Y A;  3VYG A;  3PGG A;  1D0Z A;  3JCM V;  4LDX A;  3AT1 B;  4JJB A;  2K2M A;  4PJN A;  3QII A;  1SHF A;  2NLU A;  3M0R A;  1UE9 A;  5IHN A;  1ACM B;  4RTU A;  2V26 A;  1I4K 1;  2DYI A;  3PTA A;  4J6Y A;  2X4Y A;  4ZN3 A;  2P0P A;  4M78 A;  3VS3 A;  3OYD A;  5FU7 B;  2DTI A;  4PFP A;  3VRY A;  4M75 B;  2OJ2 A;  2WAC A;  2Y90 A;  3LH5 A;  4C92 E;  1VOM A;  2GTO A;  2EJ9 A;  4JS4 A;  3M4Y A;  2JZ2 A;  3VS5 A;  2XID A;  4NL3 A;  1MUZ A;  5HCK A;  4L5G A;  2L3S A;  4C0G A;  5GAN 4;  2DNU A;  4OMQ A;  3VUB A;  4PLL A;  2DMO A;  2DM1 A;  2SEM A;  4N4G A;  3FDR A;  3HKS A;  4IUP A;  1HYO A;  2F2X A;  1RAE B;  2CP0 A;  3ER0 A;  1F1B B;  1LJO A;  3PVQ A;  3ULR B;  4QVZ A;  1OOT A;  3CC7 Q;  1M30 A;  5GAN 6;  1BIA A;  3CCV T;  1K1Z A;  3JCM c;  2AKK A;  2DF6 A;  3EGU A;  1D1C A;  5C0M A;  2M16 A;  4HCZ A;  4J8O A;  4EMK B;  3UPU A;  2ECZ A;  2YUQ A;  3CCQ T;  1G2B A;  3BDU A;  2J6F A;  3LW5 E;  2YDL A;  2DIQ A;  2CH4 A;  2QG9 B;  5GJW B;  3I56 T;  1W4S A;  2KYB A;  4N0A C;  4IUT A;  3M5A A;  3VS6 A;  3EGX B;  2IIM A;  2E3I A;  3CMA T;  1CKB A;  4MDX A;  3M54 A;  2NUT A;  3G4S A;  3G71 T;  2E5K A;  2RB6 A;  4M7D B;  3R6O A;  3MP8 A;  1LPL A;  3G6E T;  5D6W A;  3CC2 A;  1W6X A;  1FX7 A;  1K8A U;  3H0F A;  4L59 A;  2ZPB B;  1NPP A;  5GAN f;  3H41 A;  4FSS A;  4UC4 A;  2RHZ A;  2DJZ A;  2G6F X;  1NLP C;  1NE8 A;  1JO8 A;  1UGR B;  1X27 A;  1JJ2 S;  3IQL A;  2X4W A;  2DBK A;  4OMP A;  1SEM A;  1U3O A;  3RMS A;  2MOX A;  1VQN A;  3VKI A;  2LZ6 B;  3REB B;  1NYF A;  4Z89 A;  2KK4 A;  1C6V X;  1TWB A;  4E7K A;  3TEE A;  1KQS P;  2AT1 B;  1JXO A;  1QKX A;  2PZ1 A;  2KYM A;  2NYS A;  4M4Z A;  1Y0M A;  4ZNX A;  1TUC A;  5FWC A;  2LX9 A;  2KRM A;  2JUF A;  1QVF S;  2DRK A;  3UF4 A;  2QK0 A;  3M0T A;  3UT1 A;  2QAZ A;  2EKO A;  2QYZ A;  2KY9 A;  2CUD A;  1U5S A;  1VQM Q;  3MPU B;  1C1A A;  1M90 C;  4J83 A;  4DEY A;  1I1J A;  2XK0 A;  2FZK B;  4J9B A;  5IN1 A;  2DK3 A;  2K5L A;  4KGZ B;  4RTW A;  1ZQ1 A;  1G3S A;  1YJ9 A;  1E7O A;  4D6W A;  3A8M B;  4JJC A;  2W0Z A;  4R55 A;  2RHY A;  1TU0 B;  1B7T A;  2X3W D;  4XU1 A;  2EYX A;  4RG8 A;  1W2B A;  1KQ1 A;  4C92 G;  5LJ3 d;  4OP0 A;  2DL5 A;  2WSC E;  3M57 A;  4A54 A;  3JRZ A;  1VQ9 Q;  2PNI A;  4LUD A;  4LDV A;  3A8L B;  4R56 A;  4Z8A A;  1KJW A;  1MMN A;  1YN8 A;  1ZA2 B;  2X3X D;  1YCY A;  4IKF A;  4BI4 A;  3R6N A;  2EPD A;  3TSZ A;  2DXC A;  4OF1 A;  3CXC P;  4JLG A;  2DXT A;  4RCB A;  5KYY A;  4M77 B;  2OTJ Q;  1K73 U;  1GL5 A;  1BB9 A;  3QG1 A;  3I35 A;  1B34 A;  2MPX C;  2R57 A;  5KYN A;  2A3L A;  3SWN B;  2EGE A;  5GMK e;  2F5K A;  2CGH A;  4PJO E;  5GAN 2;  4E7L A;  5GAN j;  2RQR A;  3G4S T;  1H64 1;  3EFO B;  1QLY A;  2RPN A;  2LJ1 A;  2QAS A;  1WJR A;  2FVU A;  4PL6 A;  4PJO C;  2IG0 A;  1M1K U;  1M27 C;  2CSQ A;  4JRP A;  3EG1 A;  1E6H A;  3VS1 A;  3GF5 A;  1NJI C;  3EFR A;  2EKH A;  3PT9 A;  4HA8 A;  4M7A F;  2FYK A;  4FYX B;  5KYX A;  2ZPG B;  3CD6 Q;  5CO7 A;  2CP2 A;  1UGP B;  2YUO A;  3GNG A;  2JS2 A;  1D1B A;  1R8O B;  1VQN T;  4MDW A;  2RHX A;  4EMH A;  2A0F B;  2RN8 A;  1OEB A;  2O31 A;  4FSX A;  4XTW A;  5I2M A;  2XDP A;  5KE3 A;  1X43 A;  2OI3 A;  2YSQ A;  5HK0 A;  2OAW A;  1YIT A;  2GCX A;  1I0C A;  4HVV A;  4ZGE B;  4C92 D;  3BE3 A;  3UDC A; 
#chains in the Genus database with same CATH homology
 1Q81 C;  3SDZ A;  2RI3 A;  4JLI A;  4ZTF A;  3CBO A;  1Q82 C;  3QYH B;  1UGS B;  4M7A E;  4ELY C;  3BY7 A;  5CR2 A;  2OTL T;  3JCM h;  3L2Z A;  2E1H A;  4FT4 A;  1EIF A;  4CRI A;  2PUK B;  2RK2 A;  4JS5 A;  1VIF A;  1KQS S;  1QVP A;  3OB9 A;  4C8Q D;  1WGS A;  1WJQ A;  3TRE A;  1Q7Y C;  2EQM A;  2BUD A;  2O4X A;  4M7A C;  4IUR A;  1TH7 A;  4C92 C;  4J6W A;  3CME T;  1N8R C;  3OS0 A;  3V8L A;  2ZZD A;  3RER A;  4C8Q E;  4MZP A;  3URG A;  4BY6 C;  1QVG A;  3BFM A;  2HQX A;  3HPW A;  4M77 F;  1H3Z A;  1IZ6 A;  2BIV A;  4C0D B;  4ZN1 A;  3OYB A;  3ZFJ A;  2LVM A;  2JNG A;  4RG2 A;  5LJ3 h;  3RKW A;  4Z02 A;  3MHX A;  2LC4 A;  3OMG A;  3S3O A;  1G3W A;  3OYN A;  5GAM e;  3I55 T;  3QUI A;  3OYI A;  3CCV A;  2DKG A;  4M7A A;  4C8Q C;  1YJ9 T;  4FL6 A;  4C92 A;  1RL2 A;  5IAY A;  5LL6 S;  3CD6 A;  2QQ9 A;  4BUG A;  2M9U A;  2FHD A;  3P8B B;  5CAI A;  3S3M A;  4ZTJ A;  2CZ1 B;  3DLM A;  4LDY A;  3CPW A;  1PSF A;  4N4H A;  3MEV A;  2RM4 A;  2PUO B;  1BKB A;  3CCQ A;  2QXF A;  1W2B S;  4F7U B;  3S3N A;  2O01 E;  2IVW A;  5I21 A;  1N6A A;  4C8Q A;  3GP8 A;  5GMK j;  4OB2 B;  1P92 A;  3MEU A;  3E9G A;  2GF7 A;  4M77 D;  4P5N A;  5FU6 B;  3X24 B;  5CK9 A;  1KG1 A;  2I2L A;  4C5E A;  1M1G A;  1O9S A;  4Y91 A;  2RHI A;  5CQY A;  1FWZ A;  3P8H A;  4HT9 A;  3C94 A;  4KT0 E;  3UWN A;  3FLG A;  1G3Y A;  4M77 E;  5GMK i;  1X75 C;  4FU6 A;  4PLI A;  3I56 A;  2EFI A;  3KUF A;  2EQK A;  3C95 A;  3MCA B;  4F7U G;  2E41 A;  3MP1 A;  3JB9 I;  3WXM B;  5LJ5 e;  3CMA A;  2PVG B;  3F70 A;  3L2V A;  4IUQ A;  2X4J A;  1VQM T;  4M77 C;  5L8R E;  3G71 A;  5FRM A;  2F69 A;  1OZ3 A;  2K2V A;  1WQ7 A;  2QQR A;  2DVE A;  3FJP A;  2LTO A;  4M78 F;  3BW1 A;  4OGC A;  4XTU A;  5LJ5 d;  3G6E A;  4BI8 B;  2KDS A;  1DJ7 B;  1SSF A;  2DAQ A;  3EFS A;  4KUI A;  3TU4 K;  2JN0 A;  4X34 A;  2QA4 A;  2X4X A;  2RJF A;  4M77 A;  3SWN C;  1YHQ A;  3VJP A;  1N27 A;  1M9S A;  2LT1 A;  1VQ8 A;  3HFO A;  5GMK l;  1KHC A;  2ZCF B;  3LWI A;  5HY6 A;  3WVE B;  2R5A A;  2K3Y A;  2E10 A;  5GMK h;  3JB9 D;  1VQ9 A;  1WPY A;  2XD0 A;  4HKE A;  3JCM b;  3CCE T;  1QP2 A;  1VQL T;  2EAY A;  3SD4 A;  1YI2 T;  4O5V A;  1K9M U;  1VQ7 A;  4J7F A;  3E1S A;  3HRU A;  2WSE E;  3M55 A;  3SWN A;  4M78 D;  2HBP A;  4Q5W A;  1Y96 A;  4Y28 E;  4NOY A;  2R5M A;  5J39 A;  3CC7 T;  4IUU A;  1M4Z A;  2EJG A;  3HRS A;  2BKD N;  4BE2 A;  5M9O A;  2A7Y A;  3ZEH A;  3VYG A;  4M78 E;  3CCU A;  2M1H A;  3PGG A;  4OB3 B;  4A53 A;  4BD3 A;  4FT2 A;  4C92 F;  3HL8 A;  3JCM V;  2MF2 A;  4LDX A;  4XTZ A;  3LGF A;  5D6X A;  1XOV A;  4HCC A;  1Y7X A;  3OW2 S;  2DPP B;  3OQ5 A;  3QII A;  3VV0 A;  1VQK A;  2XDB A;  4M78 C;  5D6Y A;  4FIB A;  2MI6 A;  1KD1 C;  1KQ2 A;  3CPF A;  4XK8 E;  3JB9 G;  2NLU A;  4ME7 A;  2RO0 A;  3DKM A;  5J26 A;  2CYZ B;  2OTJ A;  4C0F A;  3FRN A;  1JBM A;  4XU0 A;  3JCM f;  1I4K 1;  2GFU A;  2RI5 A;  5I2S A;  1QVF A;  2EYQ A;  3VYH B;  4ELZ C;  3PTA A;  2XHC A;  4J6Y A;  2ZPF B;  2X4Y A;  2QI2 A;  4ZN3 A;  2P0P A;  4M78 A;  3L2W A;  2M0O A;  3A8O B;  3MET A;  3QPH A;  1YJW T;  5GAM f;  3CBM A;  3CCS T;  3L2U A;  3OYD A;  5FU7 B;  3GOX A;  4OB0 B;  3JCM W;  3L2Q A;  2DTI A;  2GQV A;  4V2S A;  3A8H B;  1VQO T;  2PQW A;  3PIP A;  3DB4 A;  2K5I A;  2CZ6 B;  3NTI A;  4M75 B;  2WAC A;  4F7U F;  2Y90 A;  3LX7 A;  1U1T A;  2QQA A;  3RES A;  4C92 E;  2LRQ A;  1ZHI A;  3MEA A;  2MWO A;  2AHJ B;  2EJ9 A;  3RKX A;  3M4Y A;  3OYE A;  4JRQ A;  2JZ2 A;  4JS4 A;  1YIT T;  1KHI A;  3QHS A;  5AYF A;  3DLL A;  3L1A A;  4KBM B;  2LNV A;  3NTH A;  4ZGJ B;  2XID A;  3M56 A;  2RD1 A;  1YIJ A;  1WJS A;  2KSS A;  4O6J A;  4NL3 A;  2VGM A;  3QZ9 B;  1MHN A;  4BI3 A;  5GAO l;  4RMO A;  4M75 G;  4XQ3 A;  3JCM e;  3LLR A;  1VQ6 A;  2DD4 A;  1N9R A;  4J6X A;  4L5G A;  1VQP A;  3JCM g;  4C0G A;  1QP3 A;  1X01 A;  5LJ5 f;  5GAN 4;  1FXX A;  3VUB A;  4LDW A;  4PLL A;  2DO3 A;  1BI2 A;  3PNW C;  4C0D C;  3GLX A;  1M5Q 1;  2ZPH B;  3QKJ A;  5C6S A;  3JCM d;  4N4G A;  5GAM g;  3HFN A;  3FDR A;  3HKS A;  3JSC A;  5A0G A;  4IUP A;  4MML A;  2JTF A;  1QVG S;  4OB1 B;  3N5B B;  2P0K A;  3M9Q A;  2DD5 A;  4F7U E;  1I81 A;  5GAM d;  2E65 A;  2K57 A;  3ER0 A;  3OYF A;  4ZGD B;  2XU8 A;  1VUB A;  1LJO A;  4J5Y A;  3H6Z A;  4QVZ A;  5GAN 7;  2YLC A;  2ZGW A;  5GAN 6;  1BIA A;  3OBW A;  3ME9 A;  2RHU A;  3CCV T;  3C4S A;  4YTL A;  3JCM c;  3QJ6 A;  3OYY A;  4HCB A;  3CD6 T;  2VYT A;  3M4G A;  2VV5 A;  5C0M A;  2EWN A;  3CPW S;  2M16 A;  4HCZ A;  2OAU A;  5FU6 C;  5IT9 E;  4J8O A;  3QSU A;  2KMT A;  4L6V 5;  2EJF A;  4QQ6 A;  3QJY A;  5J3B A;  4EMK B;  3UPU A;  3QBY A;  3CCQ T;  5HKC A;  2HD0 A;  3T9N A;  3JB9 F;  3BDU A;  4F7U A;  5LJ5 g;  1VQ5 A;  2QEX A;  3RKY A;  2PU9 B;  3OS2 A;  2LQK A;  3LW5 E;  4BB7 A;  4XU3 A;  3FC3 A;  2DIQ A;  2K3X A;  4EMG A;  1GXI E;  4PKC C;  4C5G A;  4A4K A;  2DZ9 A;  1B34 B;  1VQ4 A;  3PMT A;  4NL2 A;  4RKU E;  3CC4 A;  3I56 T;  1W4S A;  2FL7 A;  4N0A C;  4XTY A;  2WSF E;  4IUT A;  5GAO q;  3M5A A;  1OYX A;  2E5Q A;  3VUZ A;  1YJN A;  3CMA T;  2RJD A;  4LD6 A;  4MDX A;  2L3R A;  4LDU A;  3M59 A;  3M54 A;  3KXT A;  2LQ8 A;  4QVD A;  3OS5 A;  3G4S A;  3G71 T;  4M7D B;  2RB6 A;  4PNO A;  4DA4 A;  3R6O A;  3MP8 A;  2D0Q B;  2V8J A;  2R58 A;  3LYI A;  4N0A A;  5A0L A;  5GMK m;  5D6W A;  3OYA A;  4EPC A;  3G6E T;  1VQ4 T;  1BI3 A;  4EDU A;  4JRK A;  3CC2 A;  4A4G A;  5KCH A;  4DQ2 A;  5DLO A;  1QW1 A;  1FX7 A;  1K8A U;  5KE2 A;  2QA4 T;  3LWH A;  1JJ2 A;  4L59 A;  1YHQ T;  2L8D A;  2ZPB B;  1NPP A;  5GAN f;  5CKD A;  1VIE A;  4M75 F;  5KH6 A;  5GAO p;  2K5F A;  4QQD A;  1VQ8 T;  4UC4 A;  4N4I A;  2RHZ A;  2DJZ A;  4M7D G;  1NE8 A;  1M8V A;  1BI1 A;  2XDD A;  4PJO B;  1VQ9 T;  2JTM A;  4MZM A;  5CKF A;  2LCC A;  3JCM Q;  3HP9 A;  4JRI A;  4X9C A;  3OBY A;  2P4T A;  1K9M C;  1VQ7 T;  1UGR B;  1PSE A;  2VXE A;  3CCR A;  1WNL A;  3CC2 T;  1WQW A;  3FEO A;  1JJ2 S;  3TCJ A;  2YRV A;  1K8A C;  1KC8 U;  2X4W A;  3V7R A;  1M1F A;  2RI2 A;  2KQW A;  3QO3 A;  3RMS A;  3CBP A;  4XTV A;  3BDL A;  3O8V A;  2JVV A;  1VQN A;  1UB4 A;  3VKI A;  2E6N A;  3NFC A;  4PJO G;  3CCU T;  2QQB A;  3JB9 J;  1HK9 A;  2EQJ A;  2FB7 A;  3M58 A;  5CKE A;  2KK4 A;  4M75 D;  3X25 B;  1G5V A;  3CCL A;  3PMI A;  3HSB A;  2HNI A;  4E7K A;  2RA2 A;  2QTX A;  1O75 A;  3TEE A;  4B9X A;  5A0D A;  5GAM j;  1VQK T;  1KC8 C;  5DY9 A;  4QVC A;  3CCJ A;  2G3R A;  3CCM A;  4M75 E;  5GAN e;  1M90 U;  3GIB A;  2VUB A;  3A8G B;  2LX9 A;  2OTJ T;  5FU7 C;  3HHT B;  2JUF A;  5GAN g;  2VGN A;  2Y4Y A;  4GY5 A;  1S72 A;  1QVF S;  1LOJ A;  4IUV A;  2F5T X;  5LJ3 f;  3UT1 A;  2E70 A;  1Q81 U;  2P0Q A;  4OVA A;  2DIG A;  2EKO A;  1Q82 U;  2ZPE B;  5GAN d;  2OTL A;  4M75 C;  5FRN A;  2KY9 A;  2PVO B;  2V8K A;  3V7S A;  5DLQ E;  2DTH A;  3J80 E;  4BAC A;  5GAN 5;  1N9S A;  2O4X B;  4DOW A;  5CCA A;  1M90 C;  4J83 A;  1KQS A;  2DEQ A;  3JAM E;  4C5I A;  2RH2 A;  3CME A;  2XK0 A;  1N8R U;  2CZ0 B;  5IN1 A;  4E47 A;  3E9F A;  1LNX A;  3PFS A;  2DK3 A;  2K5L A;  4M75 A;  5CVI A;  4II1 A;  5GAO m;  4HT8 A;  4QQG A;  1IRE B;  1ZQ1 A;  5LJ5 j;  4X9D A;  2HAX A;  1U8R A;  2LT4 A;  2EQU A;  4BE1 A;  1G3S A;  3AHU A;  4M7A B;  3JCM J;  3I55 A;  3PIO A;  3G7Z A;  4C92 B;  1YJ9 A;  2CZ7 B;  2D9T A;  2EIF A;  3A8M B;  4B9W A;  5CQX A;  2XIC A;  4D6W A;  4R55 A;  4BY6 B;  1I5L A;  1YIJ T;  3JCM X;  5GAM h;  2MAM A;  2RHY A;  5GAN 8;  3J7A F;  4TVR A;  2D6F A;  5LJ3 e;  1VQ6 T;  3OYC A;  3MP6 A;  3QXE B;  2VXF A;  5LJ3 g;  5A2Q E;  1VQP T;  1BYM A;  4XU1 A;  4C8Q B;  3RMQ A;  4RG8 A;  4JUV A;  4JJN K;  1W2B A;  1KQ1 A;  4J7I A;  4M7A G;  4FM4 B;  4C92 G;  3MO8 A;  4XAX B;  5LJ3 d;  4OP0 A;  3OYK A;  4M7D F;  2WSC E;  3M57 A;  1RI0 A;  3JRZ A;  3Q1J A;  4A54 A;  5CIU A;  4A4F A;  1V29 B;  3OSV A;  3X26 B;  1D3B B;  3A5Z B;  4LDV A;  2RJE A;  2B8A A;  2XI9 A;  3OA6 A;  1I8F A;  4E7H A;  3A8L B;  1Y71 A;  2YHT A;  3OYL A;  3OMC A;  3ASK A;  4KUL A;  3OYG A;  1NZ9 A;  1XQH A;  4C8Q G;  4EMK C;  1OZ2 A;  4R56 A;  3DB3 A;  2XKO C;  4PJO F;  3OS1 A;  3C12 A;  5LJ5 h;  2DXB A;  4GLK A;  2LDM A;  1YCY A;  3X28 B;  1VQM A;  4IKF A;  2Y4X A;  4BI4 A;  2E64 A;  1UEB A;  3L42 A;  2DTO A;  2H3J A;  3LGL A;  3FB9 A;  2DXC A;  4WF2 A;  3OYH A;  1D3B A;  4M7D D;  4OF1 A;  4EMK A;  3X20 B;  2GFA A;  3OSS C;  5DM7 R;  4JLG A;  3KBG A;  4JDS A;  4A4E A;  2DXT A;  2CKK A;  4RCB A;  2L89 A;  1HXD A;  4M77 B;  1VQ5 T;  4M7D E;  2XG8 D;  2QEX T;  4BE0 A;  1K73 U;  5GAO n;  1NPR A;  2PVD B;  3ZBD A;  3WVD B;  3GNF B;  2E6Z A;  3QG1 A;  2C06 A;  3RIR A;  2QDY B;  5FLX E;  2YLB A;  4MZT A;  5HK3 A;  3CCE A;  3L2R A;  1VQL A;  4KUD K;  4PJO D;  3CC4 T;  1B34 A;  4M7D C;  4ATO A;  2R57 A;  1YI2 A;  2A3L A;  1ZBX A;  3SWN B;  4E7I A;  2MWP A;  3QYG B;  1Y96 B;  1JB0 E;  1AHJ B;  4XU2 A;  4M77 G;  3V8J A;  3CXC A;  4BDY A;  1YJN T;  5GMK e;  2F5K A;  1X6O A;  2CGH A;  4PJO E;  3VU3 C;  5GAN 2;  3CC7 A;  4E7L A;  3HRT A;  5GAN j;  3RUX A;  1K73 C;  3CEY A;  3G4S T;  3GPL A;  1H64 1;  3INZ A;  2MMP A;  2HQE A;  4XTX A;  1NJI U;  4M7D A;  1UGQ B;  3LH0 A;  1WJR A;  2FVU A;  4VUB A;  2QQS A;  1MGQ A;  3SB2 A;  3OYJ A;  4PL6 A;  3JB9 H;  4PJO C;  2IG0 A;  1U1S A;  2RK1 A;  3MEW A;  3CXC S;  1M1K U;  4QW2 A;  2CS7 A;  1JRI A;  3E19 A;  3V7C A;  4JRP A;  5GAO r;  3SFM A;  4E7J A;  3OW2 A;  1KD1 U;  1Q86 U;  5KCO A;  3GF5 A;  1Y07 A;  1NJI C;  3J81 E;  3V8K A;  3EFR A;  1YBY A;  3FIF A;  4PJO A;  1XNI A;  3M53 A;  3P8D A;  4MMK A;  2DXU A;  3PT9 A;  4HA8 A;  4M7A F;  4M78 B;  2FYK A;  3S6W A;  3CCR T;  2X35 A;  3OY9 A;  1YJW A;  1M1K C;  4NS5 A;  4LD9 K;  2ZPG B;  4OGE A;  2KAF A;  3CCS A;  5CO7 A;  1UGP B;  3GNG A;  5CKB A;  4BDZ A;  3H8Z A;  3OYM A;  1R8O B;  1VQO A;  2K4Y A;  1Q86 C;  3NTK A;  1VQN T;  4MDW A;  1BIB A;  2RHX A;  4A4H A;  4EMH A;  5LJ3 j;  3JCM P;  4C8Q F;  5GAN h;  2L5Q A;  1XTD A;  2LCL A;  3QDR B;  4RCC A;  2JOY A;  4DOV A;  3CCL T;  4M78 G;  4FSX A;  1G3T A;  2KVQ G;  3EAE A;  4XTW A;  5EG2 A;  5CKH A;  5I2M A;  5FRO A;  2XDP A;  4C5H A;  2E12 A;  5KE3 A;  5GAN 3;  5HK0 A;  2DZC A;  2VC8 A;  1YIT A;  2V8I A;  1Q7Y U;  2GCX A;  4OMF B;  3CCJ T;  3CCM T;  2ZPI B;  2RJC A;  4ZGE B;  4M7A D;  3UDC A;  4C92 D;  1BI0 A;  4C0Z A;  4CI0 C;  3QZ5 B;  1S72 T;  1OI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...