4C92G

Crystal structure of the yeast lsm1-7 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
75
Chain Sequence
AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSISKNARKLGLTVIRGTILVSLSSAEGSDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 11
structure length 75
sequence length 85
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92G00
2DZCA 2EJGA 4M75G 3RIRA 4X9CA 4C8QC 4JUVA 4NOYA 1LOJA 3V8JA 4J5YA 4XU3A 5GAOq 1HK9A 5GAOm 1X01A 4EMKC 4M7AE 5GAMg 5GMKe 5GAOl 3JB9I 3JB9J 3V7SA 4M78F 3JCMP 2ZGWA 3JCMc 1M8VA 2VXFA 3JCMQ 2DXUA 4C8QA 5GANf 4V2SA 1YCYA 1I5LA 3BFMA 3JB9F 3JCMd 5GAN6 3JB9G 4C8QE 4EMKB 3BDUA 5GAMf 2E1HA 5GAN7 4N0AC 3RKWA 4HT9A 3QO3A 1N9SA 4C92B 4M77C 4C92F 2HNIA 4EMKA 3V8KA 1LNXA 1MGQA 4EMGA 4NL3A 5DY9A 4PNOA 3V7CA 4M7AD 4OP0A 1D3BB 3RERA 1WPYA 2EJFA 5GMKh 4F7UA 5GAMd 2DJZA 4PJOF 5GANj 1KQ2A 4PJOB 4M75D 4M78A 2YHTA 4A53A 4M7AC 4M78D 2K57A 4M75A 4XU2A 4C92A 3L1AA 3V7RA 3SWNC 4J6YA 3RKYA 4DQ2A 2I2LA 4C8QG 5GMKm 4M7DC 5GMKl 2FB7A 5LJ5j 2E10A 4QVDA 1D3BA 5GAN4 1WNLA 4JRKA 2DKGA 4XQ3A 4F7UF 3INZA 4F7UB 5CAIA 4WF2A 5I21A 3FIFA 5GAOn 2DTOA 2VC8A 4PJOE 2DEQA 4HT8A 4PJOA 4RCCA 3JCMh 1BIBA 3PGGA 4M78B 4XU0A 4M7DD 4M75F 1WQWA 2RB6A 4M75B 4RCBA 4XTXA 1I81A 2RM4A 4C92D 1LJOA 3JCMJ 4A54A 3SB2A 4Y91A 5LJ5g 4M7AG 2RA2A 3JCMW 1BIAA 3JCMV 4M7AF 4J6XA 4M7DG 5GAMe 5LJ5e 1KQ1A 3V8LA 1JBMA 4PJOG 3JCMg 4M77E 2E65A 5GAOp 5LJ3d 3QUIA 3VU3C 2YLBA 5GANe 2DTHA 2E41A 2JN0A 2Y90A 5LJ3g 1N9RA 1U1TA 2EAYA 4M78G 4MMLA 4C8QF 5LJ5f 3HSBA 4C8QD 3GIBA 3FJPA 4XTZA 1WQ7A 2DXTA 1B34B 3SWNA 4X9DA 4PJOC 1M5Q1 3EFRA 3RESA 3FB9A 5GAN8 3RUXA 5LJ3f 5LJ3h 5LJ5d 1HXDA 3JCMe 3M4GA 3BY7A 3JB9H 2DTIA 2DVEA 4C92G 4C92E 5GANg 5GAN2 2YLCA 3HFOA 2FYKA 1U1SA 3L2ZA 3EFSA 4XU1A 1B34A 5GAMh 4M7AA 4QVCA 3SWNB 5GAMj 5LJ5h 4M77A 1I4K1 3HFNA 1I8FA 2CGHA 5GMKj 3AHUA 4M75E 3JCMX 3QHSA 2DZ9A 5GAOr 5GANh 4PJOD 3RKXA 4M7DA 4J6WA 3JB9D 4C92C 4M75C 1Y96B 4HA8A 2RD1A 4JLIA 4M7AB 4M77G 4M77D 4XTVA 4M77B 4MMKA 4EMHA 4M77F 4XTYA 4XTWA 2EWNA 5LJ3j 5GANd 5GAN3 4M78E 4N0AA 1TH7A 4JRIA 4M7DE 2EJ9A 3QSUA 3JCMf 2E64A 1H641 4XTUA 3BW1A 4F7UG 4F7UE 5LJ3e 5GAN5 4M7DB 4M7DF 1JRIA 4M78C 4NL2A 2QTXA 1Y96A 2VXEA 5GMKi 3JCMb 4C8QB
chains in the Genus database with same CATH superfamily
3EG0A 4E7JA 3CC4Q 1VQOQ 2ZGWA 1ABOA 3GF5A 4DBFA 4LDWA 3JB9G 2DK3A 3GNFB 3UF4A 1SHGA 2DD4A 3M53A 2A28A 1VQ9A 2FPFA 2KNBB 4C92B 4NL3A 1VQNQ 2KQWA 3RERA 4F7UA 4PJOF 1BI1A 1ZBJA 4RMOA 1K76A 4E7IA 2DEUA 3L1AA 1VQMA 2FZCB 4HVWA 1QCNA 2LT4A 1D3BA 2CZ0B 4OGCA 3I55T 1WQWA 1X6BA 4A54A 5LJ5g 2RA2A 1GL5A 2L3RA 4KGXB 2KE9A 3VS6A 1AD5A 1GFDA 1VUBA 2G3RA 1KC8U 1YITA 1VQ8Q 3SHWA 2K3XA 2QDLA 3UATA 1V1CA 2KI7A 1LVKA 2AZSA 2YRVA 3OY9A 5LJ3f 5C6SA 4ZN3A 2DVEA 3NPFA 1KHIA 3CCQQ 1M27C 2ECZA 3JAME 4QVCA 3C12A 1Z9QA 4RG8A 1M4ZA 3CCUA 2HBWA 4Z02A 4AFSC 4M75C 2RH2A 2A08A 4HVUA 4ZNXA 4XTVA 4XTYA 4PKCC 3I5RA 2KK4A 3M0PA 4M7DB 1AZEA 5KYXB 2D9TA 3JCMb 1MHNA 1SG5A 1VQKQ 3EHRA 1Q7YU 1M1KU 1VQ9Q 1ZUKA 1PCXA 4FL6A 2CT4A 2QA4T 3CPWA 1VQPA 3UWNA 1Y57A 1QVGP 5IN1A 2DIQA 1W70A 3SD4A 2D0NA 2DL3A 3CXCS 3OYMA 4N0AC 3P8DA 4PFZA 1SHFA 2JVVA 1XTDA 1YWOA 2OTJQ 1Z9ZA 1LNXA 1RABB 3G71A 1NYFA 4UC4A 2EJFA 2CUDA 1W2BP 1P92A 5GANj 3S3OA 1EFNA 3RKYA 1G83A 2DE0X 2EYYA 4QQ6A 4E7ZA 4FYYB 1K9MU 2VC8A 4PLIA 2RO0A 1K8AR 3PGGA 3UDCA 3GPLA 4OB3B 4ZGEB 1BIAA 1PKTA 1K9AA 2QQAA 3CC2A 2KXDA 3A98A 1VQKA 3CPWP 1M90R 2YLBA 1U5SA 4RG2A 4N4IA 3QIIA 3CCVA 8AT1B 3MHXA 1VQ7T 1U3OA 1GCQA 2O9VA 4X9DA 3CC2T 1VYVA 2AIRB 1D1BA 3BY7A 3OS2A 3TU4K 2OTJT 4CC4B 4ME7A 3CC2Q 3SWNB 2XIDA 2VWFA 2MCNA 2HL5C 4B9XA 3EG9B 2QTVA 4Z8AA 3LLRA 3UPUA 3RR6A 4NS5A 4KH1B 4FCYA 5GAN3 3OSVA 4M7DE 1N5ZA 1JJ2A 1YHQQ 2EYQA 3CD6A 5D6XA 4GY5A 1E6HA 5KE2A 3S3NA 2AHJB 2IVWA 2QEXQ 4XU3A 3WXMB 3CCEA 5GAMg 4FW2A 1VQ8T 3JCMP 1NEGA 2X51A 2RHZA 1UHCA 1VQ9T 4QT7A 4EMKB 4BY6C 3VUZA 2ENMA 3OYAA 1VQ5T 1MGQA 1WHGA 3X25B 2FPEA 4BE0A 1R77A 2ZPEB 2LQKA 2RJEA 1WHKA 2DETA 2L8DA 4FW1A 5I21A 4ORZA 1M2OA 1EZZB 4M75F 1PSEA 6AT1B 2XKOC 1AWWA 1VQNA 3A5ZB 3JCMW 4OMMA 1PNJA 2ZAEA 2MYSA 1AEYA 3V8LA 2NWMA 4PJOG 4R56A 3J7AF 3H9NA 4DOWA 3VU3C 3L2RA 2YUOA 2FG0A 2QQBA 2OX7A 5KYUB 1ZX6A 1FMWA 2XDDA 3C4SA 4J9BA 4AFUC 4PFPA 3LW5E 2EQIA 2O4XA 1LPLA 4PJOC 1M3AA 1JO8A 3MCAB 1K9MC 4J9GA 1VQ8A 2XD0A 2DJQA 3LYIA 3GBQA 2JTEA 4FIBA 3R6OA 3WVEB 3HFNA 2R58A 3OBWA 1OV3A 2HL3A 4BACA 5KYYB 4M77B 2LJ1A 3CBMA 1WXUA 1WJRA 1NLPC 3OW2S 3QBYA 4LD6A 3QSUA 1Y07A 2PVGB 5GAN5 1JU5C 1Y96A 4C0DB 1R0BG 2X35A 4ELZC 2EJGA 3T9NA 3QJYA 3NTIA 2J05A 2LDMA 2M1HA 4GBQA 2SEMA 1GBRA 3BFMA 3OQ5A 1M90C 2K5LA 1F1BB 2X3XD 2NUZA 2MF2A 1AWXA 4DEYA 1WJSA 1AHJB 1QKXA 5CIUA 3OMGA 2J06A 4VUBA 5DLOA 1BB9A 4C92A 4PJOE 4M7DC 2ED0A 3MEAA 3CCQA 1M3CA 4F7UB 1XJWB 1BIBA 2GQIA 4BI4A 1YJ9T 4M75B 3CMAT 2QEXT 4BUGA 5KCHA 3I56T 1OEBA 3VJPA 2DX1A 2P4RA 2E65A 1RAFB 2Y4XA 1AWJA 1D09B 2EQJA 3QJ6A 5FRMA 1GCPA 1KQSS 1JEGA 3F70A 4KUIA 1YJWA 3DLMA 4RTUA 2CREA 4LUDA 1VQLA 3O5ZA 1YIJA 3H0HA 2KXCA 4JZ3A 4F16A 2X3WD 3TSZA 1TU0B 2GFUA 2GFAA 3AHUA 3QWXX 4HKEA 2EYXA 5GANh 3J81E 3A8LB 2H3JA 4HA8A 2DXBA 4M7AB 2WSCE 2MIOA 4MDWA 4M77F 4RTWA 1TH7A 1KQSA 1G5VA 1WHMA 2HCKA 2ABLA 5GMKi 2YSQA 1W2BS 3I55Q 1KD1R 3HPWA 2XMFA 1TG0A 4NOYA 1LOJA 2L3QA 3E9GA 4EMKC 4C5GA 5GAOl 4BY6B 2E3IA 5KYXA 3FDRA 1NJIC 1SRLA 5GANf 3ME9A 4BE1A 1S72T 1OU8A 1AZGB 4RTXA 3OYYA 1VQ5A 4BB7A 2LJ0A 4PJJA 5GAMf 2E1HA 3I55A 1OOTA 2NUTB 2FPDA 2A37A 2LCCA 1X75C 2V26A 4OB1B 1RI9A 4KUDK 1RACB 3URGA 3HL8A 1OX8A 2AKLA 1PKSA 3MKDA 4E2FB 4QKUA 4OB0B 5FWBA 2K57A 3CEYA 3LGFA 4LDYA 4AFQC 1VQNT 2M9UA 2ZPIB 2E10A 5CAIA 1JXMA 2DTOA 2HMAA 2L3SA 3PFSA 4PJOA 2K4YA 4AFZC 4C92D 2RN8A 3OYDA 3EFOB 3SB2A 1OU9A 1QVPA 3QPHA 2FZGB 3JCMV 1X2KA 3JSCA 3THKA 2ZCFB 2CYZB 3QYGB 3BDLA 5D7UA 5LJ3d 5IXFA 5GANe 3G6ET 4OMLA 2Y90A 2PU9B 4PJMA 4DA4A 2DL4A 2MMPA 2RJFA 4E7HA 4IUTA 3PVLA 3JCMe 2CUBA 3G6EA 4IURA 2CKKA 1N27A 3GLXA 1M1GA 1N8RR 1K8AC 5A0DA 3X20B 4HCCA 3EGXA 3OB9A 2KY9A 1K73R 4IKFA 1MMNA 2RNAA 2L0AA 1WX6A 4ZGJB 5GANd 4JRQA 3DB3A 4DBHA 1VQ6A 4BI3A 1N8RC 4OMQA 3OYHA 2QQ9A 4DEXA 1JRIA 2DXCA 5CKBA 4CI0C 2DZCA 1GXIE 4X9CA 1H3HA 1VQLT 1UE9A 4XAXB 2GCXA 1I1JA 2RI5A 3CCET 1WGSA 3MP1A 3REAB 4L6V5 1O9SA 3MP8A 4RUGA 5KH6A 3M56A 1T0JA 4HCBA 3HHTB 3EG1A 2ROLA 3NTHA 5GAN7 2W0ZA 1UB4A 3M58A 2RJCA 4A4FA 4PL6A 2DO3A 5EC7A 3OYLA 4EMKA 1RADB 2ZPGB 1YJ9A 5IHKA 5FLXE 4M7AC 4XU2A 3V7RA 2KAFA 4J6YA 3I56A 1NJIU 3VKIA 3EGDB 5GAN4 4F7UF 5FU6C 2P84A 2E12A 2BE7D 3JCMh 2VYTA 4RCCA 4LDUA 4HCZA 4RCBA 5J3BA 2V8KA 3H0IA 1D0YA 4M7DG 4J6XA 1ZHIA 2JS2A 3LWHA 1YJWT 3G4SQ 1ZQ1A 4M77E 4K11A 5GAOp 1ZSGA 3P8BB 3G7ZA 3LX7A 2DYBA 4M78G 4MMLA 3L2QA 2C0IA 1Q86R 3EFRA 4N4GA 1FWZA 3QZ9B 2LZ6B 4KULA 2RQRA 4JPBW 5GAN2 4OMFB 2G6FX 4JJNK 3G1JA 4PLLA 1FYNA 2GTOA 4Q5WA 3HRUA 4QQDA 1J3TA 3M59A 1U06A 5I11A 3JB9D 1UGVA 4JLIA 4D6WA 4MMKA 5IT9E 3EGUA 4N0AA 1YJNA 1VA7A 3E19A 2I0NA 2R5AA 1TUCA 3X24B 2QGFB 4C8QB 4FSSA 1TUGB 2X4JA 1R8OB 1M30A 1OPKA 2MAMA 2ED1A 2BZYA 4LUEA 3G6EQ 2CP7A 3M9QA 3V7SA 1HJDA 3LH0A 3JCMc 1UECA 1VQ7Q 4FM4B 2RQWA 1K0SA 2AT1B 4ANJA 4MZPA 3CCEQ 3CPWS 3M5AA 5CR2A 4HT9A 5FU7C 1OZ3A 2NUPB 3O8VA 1TSFA 3M0QA 2FRWA 3ASKA 2KBTA 1OPLA 4JLGA 1RAEB 1XQHA 1V76A 3MEVA 3S6WA 2FEIA 2XHCA 4KGZB 4M75D 4M78A 2CP5A 2FZKB 5IHNA 1H3ZA 5IAYA 4F17A 3VS0A 1RAGB 4JRKA 1QCFA 3ZL7C 1N6AA 2KRSA 1X6OA 2MWPA 2OAWA 5CKDA 3TQ7P 2HQHA 4M7AF 4LE9A 1NEBA 4ZTFA 3ZEHA 3A8OB 2ESWA 2QAZA 2GNCA 1SSFA 4IUQA 1OYXA 5HK0A 1AWOA 2HSPA 3CXCP 2K6DA 2P4TA 1TTHB 4IIOA 4XTZA 2H8HA 3DB4A 2RHYA 3HRSA 4F14A 1PRMC 5GAN8 4CRIA 3NFCA 1HYOA 4M4ZA 5GANg 3VS1A 2CP0A 1YIJT 5GAMh 2LX7A 4ESRA 2CT3A 2LMJA 2DLPA 5A0LA 3L2WA 1VQOA 4YTLA 1UEBA 4EMHA 2P0QA 4XTWA 4A4KA 2COWA 3NGPA 3X26B 4M78C 3TCJA 1D1AA 4HVVA 2X4WA 1M3BA 1U8RA 4C8QC 3CCMA 5GAOq 2JOYA 2HQXA 1M2VB 2VGNA 5GJWB 2E5QA 2JXBA 2XICA 4V2SA 1T3SA 1GBQA 2ATCB 1ACMB 1TXQA 4ELYC 2J6OA 1G3YA 1QMCA 2KR3A 1DJ7B 1Q82C 3KBGA 2MPXC 3WVDB 2PQWA 1UUEA 2DM1A 1WPYA 1MNEA 1H92A 5GMKm 2I2LA 1UJYA 1WHHA 4ZN1A 3A1PA 2JW4A 5LJ5j 2D1XA 1Q81C 3CCLT 4E7KA 4WTOB 3FIFA 1BU1A 3OYNA 2CZ1B 2OTLA 4QW2A 5FWCA 3G71Q 2EVRA 3OSSC 2LNHB 5GAMe 1CSKA 1YJ9Q 2L2PA 1KC8R 3QUIA 2A0FB 2QGGA 1SRMA 4OVAA 3R6NA 3A8GB 4OMPA 4F04B 3CCMQ 4ATOA 3CCUQ 1RLQC 2KRNA 2FRYA 2MWOA 2CDTA 1MV0B 1QKWA 1NPPA 1KJWA 3NTKA 2K3BA 5LJ5d 2BZXA 3JB9H 1ABQA 4C92G 2LQNA 4L59A 1OULA 2LTOA 3U23A 2RQUA 1OI1A 4J9DA 4DBQA 3EHQA 1VQ7A 5AYFA 1MUZA 2FO0A 2PZ1A 2F2WA 2KYBA 4AMCA 1WHJA 2DZ9A 4FYXB 1TUDA 2RHIA 2X4XA 1VQ6T 3UT1A 4JRIA 2B8AA 3FLGA 2PNIA 3JCMf 3BW1A 4NL2A 5IHIA 3CMEA 1NPRA 1T3LA 1H8KA 3CC7A 2QG9B 1Q86U 1UGQB 1R0CB 3VYHB 3H6ZA 1HSQA 1NZ9A 2DBKA 1GRIA 4IUVA 3VYGA 1UGSB 4HXJA 1IHVA 1YITQ 4KH0B 2CP6A 4JRPA 1IREB 1PM3A 2FVUA 1OQKA 2JS0A 4M77C 2HNIA 4Z88A 3H0FA 2MOXA 2EGAA 2CP3A 3META 5GAMd 1KQ2A 4KGVB 1G3TA 2AK5A 1AVZC 2RK2A 3KFVA 2LRQA 3A8HB 1BI0A 2QASA 1PD1A 2V8JA 5GAOn 2PTKA 3QDRB 1SF9A 2CH4W 4L5GA 7AT1B 1I81A 4RTVA 1Q7YC 2DAQA 1M1KC 2D8JA 3EGDA 2KGTA 1CKAA 5J39A 4X1VA 1WHLA 3I56Q 1D0XA 1VOMA 1JQQA 2VB6A 1YFNA 1B34B 3J80E 1TWBA 2HQEA 3EH1A 3CC7T 1V29B 2C0OA 1Q7YR 3L2UA 1Q81U 3CCUT 5KYUA 4C0ZA 5KYWA 2D8HA 3TREA 1ZSZA 2EGCA 3L2ZA 1PG5B 3CCJA 2M02A 2O4XB 2K5FA 1BI2A 4QVZA 2CGHA 2JM8A 2XG8D 3P8HA 1WJQA 2MK5A 3NHNA 2KROA 1NE8A 2EFIA 4GLMA 2EWNA 2JNGA 2CZ7B 1VQKT 3OYBA 2QXFA 3E9FA 1X69A 1Y7XA 2VXEA 5KYYA 1UJ0A 4M75G 3SFMA 2EYZA 3S3MA 1B3QA 3AT1B 3KUFA 3L42A 4CC2A 1UGPB 5M9OA 3CCSA 1M8VA 3CCRA 2WSEE 2VASA 3H8ZA 4J8OA 4A63B 3CC4T 1KC8C 1VQLQ 1Q95G 3JB9F 2HAXA 3RNJA 1MMGA 1PWTA 1QQJA 4PJNA 1C6VX 3GOXA 1IB8A 2KSSA 4Y28E 3RKWA 3CCST 2OTLT 2QI2A 3JRZA 2HZYA 2OAUA 2E6NA 1IO6A 3CC4A 2JUFA 1K4US 5C0MA 4EMGA 5DY9A 5CCAA 5EG2A 1NYGA 1BI3A 1WZOA 5IXBA 3QWYA 3PIPA 2NUPA 2BE9B 1B07A 2YHTA 2RI3A 1ZBXA 3OYIA 1IGUA 2M0YA 3DLLA 2KEAA 2GBQA 2KVQG 3PNWC 4FU6A 1YP5A 1QVGS 4AT1B 4HT8A 2EBPA 4M78B 4C5EA 1ZUUA 2XK0A 2EKOA 4Y91A 2VVKA 5CVIA 2A7YA 3EAEA 1KQ1A 4PFOA 1JBMA 2FHDA 3CCJQ 5LL6S 4GLKA 4JJDA 2V8IA 1VIFA 2JN0A 1U1TA 1FMKA 2Z0WA 2VV5A 5A0GA 2HEQA 3RUXA 1M1FA 3PIOA 2J6KA 4BDZA 4OB2B 1YBYA 1WIEA 5DLQE 3CCVT 2DBMA 2RHXA 2RQTA 2ZPFB 2JT4A 3ER0A 3ZBDA 1VQ5Q 4C5IA 2LT1A 5GAOr 4JDSA 4HCKA 3M4YA 2KMTA 4J9EA 1SSHA 2QQRA 2DERA 3CCRQ 2GQVA 2ZZDA 4E47A 3PT9A 2YUPA 2KT1A 2E4HA 4F7UE 4MDXA 4IIMA 3HP9A 1BCOA 2J6FA 1RL2A 3EG2A 4MZMA 3JB9J 3JB9I 1WXTA 4J83A 2VXFA 4RTTA 3VS2A 2QK0A 4CC3A 2QEXA 3E1SA 3PVQA 4C8QE 1VQ4A 2YT6A 1M2VA 4BE2A 3BDUA 1TOVA 2QYZA 2X4YA 1A0NB 1BK2A 2EGEA 1N9SA 3TSWA 4C0DC 3OS5A 3QXEB 1SEMA 4O6JA 1FXXA 4OP0A 1D3BB 1VYUA 1XNIA 3VV0A 2K2MA 5IH2A 2JTMA 2BTTA 2KT8A 1SPKA 4A53A 1IZ6A 4EPCA 2P0KA 4ZTJA 4J9CA 4J9FA 1KFZA 3TEEA 1AOJA 2RB6A 3MO8A 1NM7A 2XDPA 2LQWA 2E3HA 1XOVA 2DNUA 3JCMg 1C1AA 5L8RE 3CPFA 1I0CA 1BYMA 2E41A 2VKNA 4WCIA 1VQOT 1M90U 1YHQA 4C8QD 2BKDN 3TVTA 5D6WA 3CCJT 2F2XA 4IUPA 1WXBA 1KK7A 3FJ5A 1M5Q1 1KD1U 2COZA 2EIFA 3GNGA 2RF0A 2DRMA 2YLCA 2LCLA 1U1SA 1K9MR 1NJIR 1K0XA 5GAMj 1UHFA 1I8FA 5GMKj 1QVFA 4M75E 3JCMX 1YJNQ 1B7TA 2K9GA 3RKXA 4M7DA 4C92C 2E70A 2IPOB 4KRTA 1BBZA 1UG1A 3M57A 5J26A 1AT1B 3EG3A 3EGXB 3OYJA 2E64A 1W4SA 2XU8A 1YJWQ 4B6MA 1KSWA 3RIRA 3CMET 1UGRB 4M7AE 1HK9A 2AZVA 2XI9A 2V1RA 2DILA 3OYFA 3VS7A 2DA9A 2IG0A 3VS4A 2D6FA 3JCMd 5GAN6 4J7FA 3MEUA 1KG1A 2HSEB 4FYWB 3LWIA 1IRXA 1M9SA 2F5TX 3L2VA 2K7AA 4FT2A 4PNOA 2O9SA 4RTYA 2O88A 2LJ3A 3LH5A 4DQ2A 4JS4A 4C8QG 4LDXA 2H3EB 3JV3A 4A4GA 4RTZA 1WNLA 4XQ3A 3CQTA 1W6XA 4WF2A 5GJVB 2DEQA 1T0HA 1I07A 1WA7A 5D6YA 4XTXA 5CO7A 1KQSP 2C06A 2DVJA 9ATCB 4OMNA 2RMOA 2JMCA 5CQYA 4C0FA 1G2BA 1ARKA 2JZ2A 1M8MA 1YNZA 1YN8A 1EX4A 5KYNA 3OW2P 1ZUYA 1N9RA 4C8QF 3HSBA 1OZ2A 1X6GA 2LP5A 2O2OA 1ZA2B 4A4EA 2GF7A 5CK9A 1HXDA 4X34A 1VQMQ 2DD5A 2ZPBB 3CCSQ 3OS1A 3EG9A 4XU1A 3VRZA 1B34A 3KXTA 2Y4YA 2LQ8A 2DRKA 5KE3A 3MP6A 4DBRA 2K5IA 4M78E 5LJ3e 4F7UG 4XTUA 1KD1C 5CKHA 3QG1A 3G4SA 1Q82R 3V8JA 1QCOA 3FRNA 3CMEQ 5CQXA 1MV3A 1RAAB 4C8QA 2L89A 2HKNA 5I2SA 1I5LA 1FMVA 2RQVA 4II1A 4FSXA 2F5KA 2CP2A 1X2QA 3QO3A 1UDLA 2LCSA 4MZTA 1K8AU 4LDVA 2LVMA 3V7CA 2F69A 2DJZA 4AG2C 5L23A 2DPPB 1VYTA 2BUDA 1EIFA 2WSFE 2E6ZA 2L3PA 2AKKA 4QVDA 2QDYB 1K1ZA 2YRCA 2DL8A 1N8RU 2O01E 1G3WA 2E5KA 2M51A 3JCMJ 2KYMA 1YHQT 4P5NA 4LN2A 1QP3A 3C0CA 5A2QE 1QP2A 1K73C 2M16A 2EW3A 1YCSB 1GCQC 3CMAQ 3OYEA 3CC7Q 1JJ2P 5LJ3g 4FYVB 2DL7A 3ZFJA 1WQ7A 1WYXA 4CC7A 1WI7A 1FX7A 2ROTA 2RPNA 5LJ3h 4O5VA 2YRDA 2D0QB 3X28B 3PE0A 1NG2A 1VQPQ 1I4K1 1E6GA 3VRYA 4Z89A 2QA4A 1VQPT 1Y96B 2PVOB 2CS7A 4M77G 2KDSA 4EDUA 3RMSA 2EPDA 3A8MB 3CD6T 4AG1C 2CH4A 4XK8E 4D8KA 4OMOA 4JJCA 3EH2A 1BCMA 3HRTA 3QYHB 2DFUA 1MMDA 1QW1A 1PC0A 3JCMQ 2OTLQ 1YCYA 1NBEB 2W10A 3C94A 2FL7A 3QDFA 2NYSA 3C95A 2L5QA 1PD0A 1Y0MA 2VGMA 5HCKA 5KCOA 4M7AD 2V1QA 2F2VA 5GMKh 3VUBA 3MJXA 3CBOA 3H41A 4M78D 4M75A 4PJLA 4R0KA 3SWNC 3PTAA 2K2VA 1VQ6Q 5GMKl 3CD6Q 3INZA 2R5MA 3E2UA 4XU0A 3OYKA 4M7DD 2OTJA 1W2BA 3OA6A 3OMCA 1LCKA 2BZ8A 3GP8A 4LNPA 2F1LA 2DMOA 2RHUA 2HDAA 2EYWA 2J7IA 1VIEA 2EQMA 2EAYA 1YITT 3GIBA 2DXTA 5I2MA 1PHTA 1YWPA 2A3LA 2DTIA 4A4HA 2CZ6B 5FROA 4M7AA 3DKMA 4R55A 1K73U 4RKUE 3M55A 3CCVQ 2B86A 5FW9A 4C0GA 5AT1B 3FEOA 1QWFA 3RDVA 1IXDA 2PUOB 3OBYA 3I35A 4Y92A 2NLUA 1X27A 4BD3A 4E7SA 1NLOC 8ATCB 2GTJA 4EIKA 3QKJA 1RAIB 2QTXA 2SRCA 1Y71A 4BDYA 1S72A 4C5HA 1JJ2S 1RUWA 4J5YA 5GAOm 1X01A 5GMKe 3FC3A 2JMAA 3OYGA 2K3YA 3MEWA 1QVFS 2OJ2A 3CXCA 2NUTA 1WFWA 2XDBA 2WACA 1TS9A 3PMTA 2QA4Q 1WLPB 3M0UA 2IIMA 1KHCA 3I9QA 4C92F 4D8DA 4QQGA 3V8KA 1MMAA 2JJ9A 1X43A 3N5BB 2BIVA 3RBBB 4PJOB 3IQLA 4N4HA 3SEMA 2O31A 4J7IA 3EFOA 1ZSZC 1QWEA 4LD9K 2FB7A 3CBPA 1D0ZA 1D1CA 5HY6A 4TVRA 2LX9A 2DKGA 1PSFA 3CMAA 3PMIA 3OS0A 2COYA 1RI0A 4B9WA 2M0OA 3M0RA 1QVGA 5FU6B 2DTHA 2PUKB 1GFCA 5DM7R 5LJ5f 1VQMT 4J9HA 2JM9A 3NMZC 2VUBA 2LC4A 3SWNA 3HKSA 3FB9A 5FU7B 5CKFA 3M4GA 2PVDB 1Q82U 4KT0E 3HFOA 2P0PA 3EFSA 3CCLA 5LJ5h 1PRLC 1YI2Q 1ZA1B 4J9IA 4OF1A 3ULRB 1S1NA 3QHSA 2CSIA 3D7SB 5KYWB 1YIJQ 2HBPA 3BE3A 4J6WA 1ZSZB 5HKCA 2RD1A 2JTFA 4DOVA 3UA6A 5LJ3j 2EJ9A 2GGRA 1QVFP 1H641 2LNVA 2YWWA 4M7DF 1IHWA 2RK1A 3G4ST 2YXYA 2CSQA 2EKHA 4JUVA 1UFFA 4KBMB 4OGEA 2KRMA 3REBB 1VQ4Q 1OX9A 4M78F 3OYCA 3VS3A 4E7LA 2DXUA 2QQSA 1VQ4T 2ZPHB 3M0SA 2DYIA 1G8XA 1CKBA 1O75A 1M1KR 3M0TA 3M54A 1E7OA 1W1FA 1RAHB 1C0MA 3VS5A 3Q1JA 3HTRA 1YI2T 3RMQA 1YJNT 2HKQB 2RJDA 1IGQA 3MPUB 3UA7A 2YDLA 2YUNA 3CCRT 2MI6A 1ZLMA 1I5OB 1BKBA 3G71T 2R57A 1QLYA 2A36A 3I5SA 1WDXA 4JS5A 2HD0A 1JXOA 3OW2A 1Q81R 1JB0E 1UTIA 2K79A 1LJOA 2RM4A 1Q86C 4M7AG 5LJ5e 2DL5A 5ECAA 4E6RA 1G3SA 3FJPA 2EQUA 4LXCA 1S72Q 3CCQT 5CKEA 4BI8B 3CCMT 3RESA 4FT4A 4C92E 3SDZA 5FRNA 1KIKA 2FYKA 4ZGDB 2DF6A 2C0TA 2DIGA 4M77A 5HK3A 4PJOD 1HD3A 3CCLQ 2YUQA 4M77D 3LGLA 4JJBA 5I22A 4JZ4A 1YI2A 4IUUA 1RLPC 1SKUB 2EQKA 3QZ5B 4PK4A 2RI2A 2X9HA 2OI3A 1MNDA
chains in the Genus database with same CATH topology
3CC7A 3HPWA 1Q86U 4HT8A 4NOYA 1LOJA 3V8JA 4E7JA 1UGQB 3E9GA 4EMKC 3VYHB 4C5GA 5GAOl 3H6ZA 4BY6B 1NZ9A 2ZGWA 3FRNA 3FDRA 5CQXA 1NJIC 4IUVA 3VYGA 5GANf 3ME9A 1UGSB 2L89A 3GF5A 4C8QA 4BE1A 5I2SA 1S72T 1I5LA 4LDWA 4II1A 4FSXA 3OYYA 2F5KA 3JB9G 1VQ5A 2DK3A 4BB7A 5GAMf 2E1HA 3GNFB 4JRPA 3I55A 2DD4A 3QO3A 3M53A 1IREB 4MZTA 2LCCA 1X75C 4OB1B 2FVUA 1VQ9A 4C92B 4M77C 1K8AU 4LDVA 2HNIA 2LVMA 4KUDK 4NL3A 3URGA 3V7CA 3HL8A 2KQWA 3RERA 4F7UA 2F69A 3META 5GAMd 2DJZA 4PJOF 1KQ2A 1BI1A 1G3TA 4OB0B 4RMOA 2RK2A 2K57A 2DPPB 3CEYA 3LGFA 2LRQA 3L1AA 3A8HB 4LDYA 4E7IA 1VQMA 1VQNT 1BI0A 2BUDA 1EIFA 2M9UA 2WSFE 2E6ZA 2ZPIB 2LT4A 2E10A 4QVDA 1D3BA 2CZ0B 2V8JA 5CAIA 2QDYB 5GAOn 1N8RU 3QDRB 2DTOA 3PFSA 2O01E 4M7AC 4PJOA 2K4YA 1G3WA 4OGCA 3I55T 1WQWA 4L5GA 4C92D 1I81A 3OYDA 3JCMJ 4A54A 3SB2A 5LJ5g 2DAQA 1QVPA 2RA2A 1Q7YC 1YHQT 1M1KC 3QPHA 4P5NA 3JCMV 1QP3A 5A2QE 3JSCA 1QP2A 1K73C 2L3RA 2ZCFB 2M16A 2CYZB 3QYGB 5J39A 3BDLA 5LJ3d 3OYEA 1VUBA 5GANe 2G3RA 3G6ET 1YITA 1KC8U 5LJ3g 2Y90A 2K3XA 2PU9B 3ZFJA 4DA4A 1WQ7A 1B34B 3J80E 2HQEA 3CC7T 1V29B 2MMPA 2RJFA 4E7HA 1FX7A 2YRVA 3L2UA 4IUTA 3OY9A 1Q81U 5LJ3f 5LJ3h 3JCMe 5C6SA 4O5VA 3X28B 2D0QB 3CCUT 4ZN3A 2DVEA 3G6EA 4IURA 4C0ZA 2CKKA 3TREA 1N27A 1KHIA 3GLXA 3L2ZA 1M1GA 3JAME 4QVCA 3CCJA 2O4XB 1K8AC 1I4K1 1BI2A 2K5FA 3C12A 2CGHA 2XG8D 4QVZA 3X20B 5A0DA 4HCCA 3P8HA 3OB9A 1WJQA 1M4ZA 4RG8A 3CCUA 2KY9A 4Z02A 2QA4A 1NE8A 2EFIA 1VQPT 4M75C 1Y96B 2RH2A 4IKFA 2PVOB 2CS7A 4M77G 4XTVA 2KDSA 4EDUA 4XTYA 4ZGJB 2EWNA 2JNGA 4PKCC 2CZ7B 1VQKT 5GANd 4JRQA 2KK4A 3RMSA 3A8MB 3OYBA 3DB3A 2QXFA 1VQ6A 4BI3A 3CD6T 1N8RC 3OYHA 2QQ9A 4M7DB 3E9FA 1JRIA 4XK8E 2DXCA 5CKBA 1Y7XA 2VXEA 2D9TA 4CI0C 3JCMb 1MHNA 2DZCA 4M75G 1GXIE 4X9CA 3SFMA 1Q7YU 1M1KU 3HRTA 1VQLT 3QYHB 3S3MA 3KUFA 3L42A 4FL6A 4XAXB 2GCXA 1UGPB 2RI5A 3CCET 1QW1A 1WGSA 3MP1A 5M9OA 3CCSA 2QA4T 4L6V5 1M8VA 1O9SA 3JCMQ 3CPWA 3MP8A 3CCRA 1VQPA 2WSEE 3H8ZA 4J8OA 3CC4T 1YCYA 3UWNA 1KC8C 5KH6A 3JB9F 2HAXA 3M56A 3C94A 5IN1A 2DIQA 4HCBA 3SD4A 3GOXA 3HHTB 3NTHA 5GAN7 3CXCS 3OYMA 2KSSA 3P8DA 4N0AC 4Y28E 2FL7A 3RKWA 1UB4A 3M58A 2QI2A 3CCST 2OTLT 2RJCA 3JRZA 4A4FA 4M7DD 2OAUA 2E6NA 2JVVA 2L5QA 3C95A 2JUFA 1XTDA 2DO3A 4PL6A 3CC4A 2VGMA 3OYLA 4EMKA 1LNXA 5C0MA 4EMGA 3G71A 5DY9A 5CCAA 5EG2A 4UC4A 5KCOA 4M7AD 2EJFA 5GMKh 1BI3A 3VUBA 1P92A 5GANj 3PIPA 3CBOA 2ZPGB 1YJ9A 2YHTA 5FLXE 3S3OA 2RI3A 4M78D 4M75A 1ZBXA 4XU2A 3OYIA 3V7RA 3SWNC 2KAFA 4J6YA 3RKYA 3I56A 3PTAA 1NJIU 2K2VA 3VKIA 5GMKl 3DLLA 5GAN4 4QQ6A 2KVQG 3PNWC 4F7UF 4FU6A 3INZA 1K9MU 5FU6C 2VC8A 4PLIA 2E12A 2R5MA 2RO0A 1QVGS 2VYTA 4RCCA 3JCMh 3PGGA 4M78B 4LDUA 4XU0A 4HCZA 3UDCA 4RCBA 5J3BA 2XK0A 2V8KA 3OYKA 3OA6A 1W2BA 3OMCA 2EKOA 4Y91A 3GPLA 4OB3B 4ZGEB 1BIAA 5CVIA 4M7DG 2A7YA 4J6XA 1ZHIA 3LWHA 3EAEA 3GP8A 1YJWT 1KQ1A 2RHUA 1JBMA 1ZQ1A 2FHDA 4M77E 2QQAA 5GAOp 3CC2A 3P8BB 5LL6S 3G7ZA 1VQKA 2YLBA 4GLKA 3LX7A 1VIEA 2V8IA 4RG2A 4N4IA 1VIFA 2EQMA 2JN0A 4M78G 1U1TA 2EAYA 4MMLA 3L2QA 3QIIA 1YITT 3CCVA 3GIBA 2DXTA 2VV5A 5A0GA 3MHXA 5I2MA 1VQ7T 4X9DA 3CC2T 3EFRA 4N4GA 1FWZA 3QZ9B 3RUXA 3BY7A 3OS2A 2A3LA 3TU4K 2DTIA 2OTJT 1M1FA 3PIOA 4A4HA 4KULA 4BDZA 4OB2B 4OMFB 1YBYA 5DLQE 5GAN2 3CCVT 4JJNK 4ME7A 4PLLA 2CZ6B 2RHXA 5FROA 4M7AA 3SWNB 2ZPFB 3DKMA 4Q5WA 4R55A 1K73U 3ER0A 3HRUA 3ZBDA 4QQDA 4RKUE 4C5IA 2LT1A 2XIDA 3M55A 3M59A 5GAOr 4JDSA 4C0GA 4B9XA 3JB9D 3M4YA 2KMTA 3FEOA 3LLRA 3UPUA 4JLIA 4D6WA 2QQRA 4NS5A 4MMKA 5IT9E 2GQVA 2PUOB 3OBYA 5GAN3 2ZZDA 4BD3A 2NLUA 3OSVA 4N0AA 4M7DE 1YJNA 4E47A 3PT9A 4F7UE 1JJ2A 3QKJA 3E19A 4MDXA 2R5AA 2EYQA 3HP9A 2QTXA 3CD6A 5D6XA 1Y71A 4GY5A 3X24B 4BDYA 5KE2A 4C5HA 4C8QB 1S72A 3S3NA 1JJ2S 2X4JA 1R8OB 2AHJB 2IVWA 4J5YA 2MAMA 4XU3A 1RL2A 3WXMB 1X01A 5GAOm 3CCEA 4MZMA 5GAMg 5GMKe 3JB9J 3JB9I 3FC3A 1VQ8T 3M9QA 3V7SA 3OYGA 3JCMP 3LH0A 2K3YA 3MEWA 4J83A 3JCMc 1QVFS 2VXFA 3CXCA 2RHZA 4FM4B 1VQ9T 2QEXA 2XDBA 2WACA 3E1SA 4C8QE 4EMKB 1VQ4A 4MZPA 3PMTA 4BY6C 4BE2A 3BDUA 3CPWS 2X4YA 3M5AA 5CR2A 4HT9A 3VUZA 5FU7C 1OZ3A 1KHCA 1N9SA 3O8VA 3OYAA 3ASKA 4C92F 4C0DC 3OS5A 3QXEB 4QQGA 3V8KA 1VQ5T 1MGQA 4O6JA 1FXXA 4OP0A 1D3BB 1XQHA 3N5BB 4JLGA 1XNIA 3VV0A 3X25B 2BIVA 3MEVA 3S6WA 2JTMA 4BE0A 4PJOB 2XHCA 4M75D 4M78A 4N4HA 4A53A 2ZPEB 1IZ6A 2LQKA 2RJEA 4EPCA 5IAYA 1H3ZA 4J7IA 2P0KA 2L8DA 4ZTJA 4LD9K 2FB7A 3CBPA 5HY6A 4TVRA 4JRKA 2LX9A 2DKGA 1PSFA 5I21A 3TEEA 3CMAA 3PMIA 1N6AA 1PSEA 4M75F 1X6OA 2RB6A 3MO8A 2MWPA 2XKOC 3OS0A 2XDPA 5CKDA 1VQNA 1RI0A 3A5ZB 4B9WA 2M0OA 3JCMW 4M7AF 1XOVA 4ZTFA 1QVGA 3ZEHA 3A8OB 3V8LA 4R56A 4PJOG 3JCMg 3J7AF 1SSFA 4IUQA 4DOWA 1OYXA 5HK0A 3VU3C 3L2RA 4C5EA 5L8RE 3CPFA 5FU6B 2P4TA 2QQBA 2DTHA 1BYMA 2E41A 2PUKB 5DM7R 1VQOT 5LJ5f 1VQMT 1YHQA 4C8QD 1M90U 2XDDA 3C4SA 4XTZA 2BKDN 2VUBA 3LW5E 5D6WA 3CCJT 2LC4A 3SWNA 2O4XA 4IUPA 3DB4A 2RHYA 3HRSA 1M5Q1 1KD1U 4PJOC 3HKSA 3FB9A 5GAN8 5FU7B 3NFCA 3MCAB 5CKFA 3M4GA 2EIFA 2PVDB 3GNGA 4CRIA 1K9MC 1VQ8A 1Q82U 2XD0A 3LYIA 4KT0E 5GANg 2YLCA 3HFOA 2LCLA 2P0PA 1U1SA 3EFSA 1YIJT 4FIBA 3CCLA 5GAMh 5GAMj 5LJ5h 3R6OA 3WVEB 3HFNA 1I8FA 5GMKj 1QVFA 2R58A 3OBWA 4OF1A 4M75E 3JCMX 3QHSA 5A0LA 3L2WA 3RKXA 2HBPA 4M7DA 4J6WA 4C92C 2E70A 4BACA 1VQOA 5HKCA 4YTLA 1UEBA 2RD1A 2JTFA 3M57A 5J26A 4EMHA 4M77B 4DOVA 3CBMA 2P0QA 4XTWA 4A4KA 5LJ3j 1WJRA 3OW2S 3QBYA 2EJ9A 4LD6A 3OYJA 3QSUA 1Y07A 2E64A 1H641 2LNVA 2PVGB 5GAN5 3X26B 4M78C 3TCJA 1W4SA 4M7DF 1Y96A 2XU8A 2RK1A 4C0DB 2X35A 4ELZC 2EJGA 2X4WA 3T9NA 3G4ST 3RIRA 3CMET 3QJYA 4C8QC 1U8RA 4JUVA 3NTIA 4KBMB 1UGRB 3CCMA 4OGEA 2LDMA 1HK9A 2M1HA 5GAOq 4M7AE 2JOYA 2HQXA 2VGNA 2XI9A 2E5QA 4M78F 3OYCA 4E7LA 3OYFA 2XICA 2DXUA 2QQSA 4V2SA 2IG0A 1VQ4T 3BFMA 3OQ5A 2D6FA 3JCMd 2ZPHB 5GAN6 4J7FA 1M90C 3MEUA 1KG1A 1O75A 4ELYC 2K5LA 1G3YA 3M54A 2MF2A 3LWIA 1DJ7B 1M9SA 3Q1JA 1Q82C 3KBGA 1YI2T 2F5TX 3RMQA 3L2VA 3WVDB 2PQWA 4FT2A 4PNOA 1YJNT 2RJDA 1WJSA 1WPYA 1AHJB 5CIUA 3OMGA 4VUBA 4DQ2A 4C92A 5DLOA 2MI6A 3CCRT 4JS4A 4M7DC 5GMKm 4PJOE 2I2LA 4C8QG 4LDXA 1BKBA 3MEAA 4ZN1A 3G71T 2R57A 4A4GA 5LJ5j 3CCQA 1Q81C 1WNLA 4XQ3A 3CCLT 4E7KA 4F7UB 4WF2A 4JS5A 3FIFA 2HD0A 2DEQA 3OYNA 1BIBA 4BI4A 3OW2A 2CZ1B 5D6YA 2OTLA 4XTXA 1YJ9T 4M75B 4QW2A 5CO7A 1JB0E 2RM4A 2QEXT 1LJOA 3CMAT 1Q86C 3OSSC 4BUGA 5KCHA 3I56T 2C06A 4M7AG 5GAMe 5CQYA 4C0FA 5LJ5e 3VJPA 2JZ2A 2E65A 3QUIA 2Y4XA 4OVAA 2EQJA 1G3SA 3A8GB 3QJ6A 5FRMA 1N9RA 1KQSS 4ATOA 4C8QF 3HSBA 3F70A 1OZ2A 2MWOA 3FJPA 2EQUA 4KUIA 1YJWA 3DLMA 3CCQT 5CKEA 1NPPA 4BI8B 3NTKA 3CCMT 3RESA 4A4EA 2GF7A 1VQLA 5LJ5d 5CK9A 3JB9H 1HXDA 4FT4A 4X34A 2OTJA 4C92E 4C92G 3SDZA 1YIJA 5FRNA 2ZPBB 2DD5A 4L59A 2LTOA 2FYKA 4ZGDB 3OS1A 1OI1A 4XU1A 1B34A 3KXTA 2DIGA 1VQ7A 2Y4YA 2LQ8A 4M77A 5AYFA 2GFUA 2GFAA 3AHUA 5KE3A 5HK3A 4HKEA 2DZ9A 3MP6A 5GANh 4PJOD 3J81E 2RHIA 3A8LB 2H3JA 4HA8A 2DXBA 2X4XA 4M7AB 4M77D 2WSCE 3LGLA 4MDWA 4M77F 1YI2A 4IUUA 2K5IA 4M78E 1VQ6T 3UT1A 1TH7A 2EQKA 2B8AA 3FLGA 4JRIA 1KQSA 3JCMf 4F7UG 4XTUA 5LJ3e 3BW1A 3QZ5B 1KD1C 5CKHA 1G5VA 2RI2A 3QG1A 3G4SA 4NL2A 5GMKi 3CMEA 1NPRA 1W2BS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZC A;  2EJG A;  4M75 G;  3RIR A;  4X9C A;  4C8Q C;  4JUV A;  4NOY A;  1LOJ A;  3V8J A;  4J5Y A;  4XU3 A;  5GAO q;  1HK9 A;  5GAO m;  1X01 A;  4EMK C;  4M7A E;  5GAM g;  5GMK e;  5GAO l;  3JB9 I;  3JB9 J;  3V7S A;  4M78 F;  3JCM P;  2ZGW A;  3JCM c;  1M8V A;  2VXF A;  3JCM Q;  2DXU A;  4C8Q A;  5GAN f;  4V2S A;  1YCY A;  1I5L A;  3BFM A;  3JB9 F;  3JCM d;  5GAN 6;  3JB9 G;  4C8Q E;  4EMK B;  3BDU A;  5GAM f;  2E1H A;  5GAN 7;  4N0A C;  3RKW A;  4HT9 A;  3QO3 A;  1N9S A;  4C92 B;  4M77 C;  4C92 F;  2HNI A;  4EMK A;  3V8K A;  1LNX A;  1MGQ A;  4EMG A;  4NL3 A;  5DY9 A;  4PNO A;  3V7C A;  4M7A D;  4OP0 A;  1D3B B;  3RER A;  1WPY A;  2EJF A;  5GMK h;  4F7U A;  5GAM d;  2DJZ A;  4PJO F;  5GAN j;  1KQ2 A;  4PJO B;  4M75 D;  4M78 A;  2YHT A;  4A53 A;  4M7A C;  4M78 D;  2K57 A;  4M75 A;  4XU2 A;  4C92 A;  3L1A A;  3V7R A;  3SWN C;  4J6Y A;  3RKY A;  4DQ2 A;  2I2L A;  4C8Q G;  5GMK m;  4M7D C;  5GMK l;  2FB7 A;  5LJ5 j;  2E10 A;  4QVD A;  1D3B A;  5GAN 4;  1WNL A;  4JRK A;  2DKG A;  4XQ3 A;  4F7U F;  3INZ A;  4F7U B;  5CAI A;  4WF2 A;  5I21 A;  3FIF A;  5GAO n;  2DTO A;  2VC8 A;  4PJO E;  2DEQ A;  4HT8 A;  4PJO A;  4RCC A;  3JCM h;  1BIB A;  3PGG A;  4M78 B;  4XU0 A;  4M7D D;  4M75 F;  1WQW A;  2RB6 A;  4M75 B;  4RCB A;  4XTX A;  1I81 A;  2RM4 A;  4C92 D;  1LJO A;  3JCM J;  4A54 A;  3SB2 A;  4Y91 A;  5LJ5 g;  4M7A G;  2RA2 A;  3JCM W;  1BIA A;  3JCM V;  4M7A F;  4J6X A;  4M7D G;  5GAM e;  5LJ5 e;  1KQ1 A;  3V8L A;  1JBM A;  4PJO G;  3JCM g;  4M77 E;  2E65 A;  5GAO p;  5LJ3 d;  3QUI A;  3VU3 C;  2YLB A;  5GAN e;  2DTH A;  2E41 A;  2JN0 A;  2Y90 A;  5LJ3 g;  1N9R A;  1U1T A;  2EAY A;  4M78 G;  4MML A;  4C8Q F;  5LJ5 f;  3HSB A;  4C8Q D;  3GIB A;  3FJP A;  4XTZ A;  1WQ7 A;  2DXT A;  1B34 B;  3SWN A;  4X9D A;  4PJO C;  1M5Q 1;  3EFR A;  3RES A;  3FB9 A;  5GAN 8;  3RUX A;  5LJ3 f;  5LJ3 h;  5LJ5 d;  1HXD A;  3JCM e;  3M4G A;  3BY7 A;  3JB9 H;  2DTI A;  2DVE A;  4C92 G;  4C92 E;  5GAN g;  5GAN 2;  2YLC A;  3HFO A;  2FYK A;  1U1S A;  3L2Z A;  3EFS A;  4XU1 A;  1B34 A;  5GAM h;  4M7A A;  4QVC A;  3SWN B;  5GAM j;  5LJ5 h;  4M77 A;  1I4K 1;  3HFN A;  1I8F A;  2CGH A;  5GMK j;  3AHU A;  4M75 E;  3JCM X;  3QHS A;  2DZ9 A;  5GAO r;  5GAN h;  4PJO D;  3RKX A;  4M7D A;  4J6W A;  3JB9 D;  4C92 C;  4M75 C;  1Y96 B;  4HA8 A;  2RD1 A;  4JLI A;  4M7A B;  4M77 G;  4M77 D;  4XTV A;  4M77 B;  4MMK A;  4EMH A;  4M77 F;  4XTY A;  4XTW A;  2EWN A;  5LJ3 j;  5GAN d;  5GAN 3;  4M78 E;  4N0A A;  1TH7 A;  4JRI A;  4M7D E;  2EJ9 A;  3QSU A;  3JCM f;  2E64 A;  1H64 1;  4XTU A;  3BW1 A;  4F7U G;  4F7U E;  5LJ3 e;  5GAN 5;  4M7D B;  4M7D F;  1JRI A;  4M78 C;  4NL2 A;  2QTX A;  1Y96 A;  2VXE A;  5GMK i;  3JCM b;  4C8Q B; 
#chains in the Genus database with same CATH topology
 3EG0 A;  4E7J A;  3CC4 Q;  1VQO Q;  2ZGW A;  1ABO A;  3GF5 A;  4DBF A;  4LDW A;  3JB9 G;  2DK3 A;  3GNF B;  3UF4 A;  1SHG A;  2DD4 A;  3M53 A;  2A28 A;  1VQ9 A;  2FPF A;  2KNB B;  4C92 B;  4NL3 A;  1VQN Q;  2KQW A;  3RER A;  4F7U A;  4PJO F;  1BI1 A;  1ZBJ A;  4RMO A;  1K76 A;  4E7I A;  2DEU A;  3L1A A;  1VQM A;  2FZC B;  4HVW A;  1QCN A;  2LT4 A;  1D3B A;  2CZ0 B;  4OGC A;  3I55 T;  1WQW A;  1X6B A;  4A54 A;  5LJ5 g;  2RA2 A;  1GL5 A;  2L3R A;  4KGX B;  2KE9 A;  3VS6 A;  1AD5 A;  1GFD A;  1VUB A;  2G3R A;  1KC8 U;  1YIT A;  1VQ8 Q;  3SHW A;  2K3X A;  2QDL A;  3UAT A;  1V1C A;  2KI7 A;  1LVK A;  2AZS A;  2YRV A;  3OY9 A;  5LJ3 f;  5C6S A;  4ZN3 A;  2DVE A;  3NPF A;  1KHI A;  3CCQ Q;  1M27 C;  2ECZ A;  3JAM E;  4QVC A;  3C12 A;  1Z9Q A;  4RG8 A;  1M4Z A;  3CCU A;  2HBW A;  4Z02 A;  4AFS C;  4M75 C;  2RH2 A;  2A08 A;  4HVU A;  4ZNX A;  4XTV A;  4XTY A;  4PKC C;  3I5R A;  2KK4 A;  3M0P A;  4M7D B;  1AZE A;  5KYX B;  2D9T A;  3JCM b;  1MHN A;  1SG5 A;  1VQK Q;  3EHR A;  1Q7Y U;  1M1K U;  1VQ9 Q;  1ZUK A;  1PCX A;  4FL6 A;  2CT4 A;  2QA4 T;  3CPW A;  1VQP A;  3UWN A;  1Y57 A;  1QVG P;  5IN1 A;  2DIQ A;  1W70 A;  3SD4 A;  2D0N A;  2DL3 A;  3CXC S;  3OYM A;  4N0A C;  3P8D A;  4PFZ A;  1SHF A;  2JVV A;  1XTD A;  1YWO A;  2OTJ Q;  1Z9Z A;  1LNX A;  1RAB B;  3G71 A;  1NYF A;  4UC4 A;  2EJF A;  2CUD A;  1W2B P;  1P92 A;  5GAN j;  3S3O A;  1EFN A;  3RKY A;  1G83 A;  2DE0 X;  2EYY A;  4QQ6 A;  4E7Z A;  4FYY B;  1K9M U;  2VC8 A;  4PLI A;  2RO0 A;  1K8A R;  3PGG A;  3UDC A;  3GPL A;  4OB3 B;  4ZGE B;  1BIA A;  1PKT A;  1K9A A;  2QQA A;  3CC2 A;  2KXD A;  3A98 A;  1VQK A;  3CPW P;  1M90 R;  2YLB A;  1U5S A;  4RG2 A;  4N4I A;  3QII A;  3CCV A;  8AT1 B;  3MHX A;  1VQ7 T;  1U3O A;  1GCQ A;  2O9V A;  4X9D A;  3CC2 T;  1VYV A;  2AIR B;  1D1B A;  3BY7 A;  3OS2 A;  3TU4 K;  2OTJ T;  4CC4 B;  4ME7 A;  3CC2 Q;  3SWN B;  2XID A;  2VWF A;  2MCN A;  2HL5 C;  4B9X A;  3EG9 B;  2QTV A;  4Z8A A;  3LLR A;  3UPU A;  3RR6 A;  4NS5 A;  4KH1 B;  4FCY A;  5GAN 3;  3OSV A;  4M7D E;  1N5Z A;  1JJ2 A;  1YHQ Q;  2EYQ A;  3CD6 A;  5D6X A;  4GY5 A;  1E6H A;  5KE2 A;  3S3N A;  2AHJ B;  2IVW A;  2QEX Q;  4XU3 A;  3WXM B;  3CCE A;  5GAM g;  4FW2 A;  1VQ8 T;  3JCM P;  1NEG A;  2X51 A;  2RHZ A;  1UHC A;  1VQ9 T;  4QT7 A;  4EMK B;  4BY6 C;  3VUZ A;  2ENM A;  3OYA A;  1VQ5 T;  1MGQ A;  1WHG A;  3X25 B;  2FPE A;  4BE0 A;  1R77 A;  2ZPE B;  2LQK A;  2RJE A;  1WHK A;  2DET A;  2L8D A;  4FW1 A;  5I21 A;  4ORZ A;  1M2O A;  1EZZ B;  4M75 F;  1PSE A;  6AT1 B;  2XKO C;  1AWW A;  1VQN A;  3A5Z B;  3JCM W;  4OMM A;  1PNJ A;  2ZAE A;  2MYS A;  1AEY A;  3V8L A;  2NWM A;  4PJO G;  4R56 A;  3J7A F;  3H9N A;  4DOW A;  3VU3 C;  3L2R A;  2YUO A;  2FG0 A;  2QQB A;  2OX7 A;  5KYU B;  1ZX6 A;  1FMW A;  2XDD A;  3C4S A;  4J9B A;  4AFU C;  4PFP A;  3LW5 E;  2EQI A;  2O4X A;  1LPL A;  4PJO C;  1M3A A;  1JO8 A;  3MCA B;  1K9M C;  4J9G A;  1VQ8 A;  2XD0 A;  2DJQ A;  3LYI A;  3GBQ A;  2JTE A;  4FIB A;  3R6O A;  3WVE B;  3HFN A;  2R58 A;  3OBW A;  1OV3 A;  2HL3 A;  4BAC A;  5KYY B;  4M77 B;  2LJ1 A;  3CBM A;  1WXU A;  1WJR A;  1NLP C;  3OW2 S;  3QBY A;  4LD6 A;  3QSU A;  1Y07 A;  2PVG B;  5GAN 5;  1JU5 C;  1Y96 A;  4C0D B;  1R0B G;  2X35 A;  4ELZ C;  2EJG A;  3T9N A;  3QJY A;  3NTI A;  2J05 A;  2LDM A;  2M1H A;  4GBQ A;  2SEM A;  1GBR A;  3BFM A;  3OQ5 A;  1M90 C;  2K5L A;  1F1B B;  2X3X D;  2NUZ A;  2MF2 A;  1AWX A;  4DEY A;  1WJS A;  1AHJ B;  1QKX A;  5CIU A;  3OMG A;  2J06 A;  4VUB A;  5DLO A;  1BB9 A;  4C92 A;  4PJO E;  4M7D C;  2ED0 A;  3MEA A;  3CCQ A;  1M3C A;  4F7U B;  1XJW B;  1BIB A;  2GQI A;  4BI4 A;  1YJ9 T;  4M75 B;  3CMA T;  2QEX T;  4BUG A;  5KCH A;  3I56 T;  1OEB A;  3VJP A;  2DX1 A;  2P4R A;  2E65 A;  1RAF B;  2Y4X A;  1AWJ A;  1D09 B;  2EQJ A;  3QJ6 A;  5FRM A;  1GCP A;  1KQS S;  1JEG A;  3F70 A;  4KUI A;  1YJW A;  3DLM A;  4RTU A;  2CRE A;  4LUD A;  1VQL A;  3O5Z A;  1YIJ A;  3H0H A;  2KXC A;  4JZ3 A;  4F16 A;  2X3W D;  3TSZ A;  1TU0 B;  2GFU A;  2GFA A;  3AHU A;  3QWX X;  4HKE A;  2EYX A;  5GAN h;  3J81 E;  3A8L B;  2H3J A;  4HA8 A;  2DXB A;  4M7A B;  2WSC E;  2MIO A;  4MDW A;  4M77 F;  4RTW A;  1TH7 A;  1KQS A;  1G5V A;  1WHM A;  2HCK A;  2ABL A;  5GMK i;  2YSQ A;  1W2B S;  3I55 Q;  1KD1 R;  3HPW A;  2XMF A;  1TG0 A;  4NOY A;  1LOJ A;  2L3Q A;  3E9G A;  4EMK C;  4C5G A;  5GAO l;  4BY6 B;  2E3I A;  5KYX A;  3FDR A;  1NJI C;  1SRL A;  5GAN f;  3ME9 A;  4BE1 A;  1S72 T;  1OU8 A;  1AZG B;  4RTX A;  3OYY A;  1VQ5 A;  4BB7 A;  2LJ0 A;  4PJJ A;  5GAM f;  2E1H A;  3I55 A;  1OOT A;  2NUT B;  2FPD A;  2A37 A;  2LCC A;  1X75 C;  2V26 A;  4OB1 B;  1RI9 A;  4KUD K;  1RAC B;  3URG A;  3HL8 A;  1OX8 A;  2AKL A;  1PKS A;  3MKD A;  4E2F B;  4QKU A;  4OB0 B;  5FWB A;  2K57 A;  3CEY A;  3LGF A;  4LDY A;  4AFQ C;  1VQN T;  2M9U A;  2ZPI B;  2E10 A;  5CAI A;  1JXM A;  2DTO A;  2HMA A;  2L3S A;  3PFS A;  4PJO A;  2K4Y A;  4AFZ C;  4C92 D;  2RN8 A;  3OYD A;  3EFO B;  3SB2 A;  1OU9 A;  1QVP A;  3QPH A;  2FZG B;  3JCM V;  1X2K A;  3JSC A;  3THK A;  2ZCF B;  2CYZ B;  3QYG B;  3BDL A;  5D7U A;  5LJ3 d;  5IXF A;  5GAN e;  3G6E T;  4OML A;  2Y90 A;  2PU9 B;  4PJM A;  4DA4 A;  2DL4 A;  2MMP A;  2RJF A;  4E7H A;  4IUT A;  3PVL A;  3JCM e;  2CUB A;  3G6E A;  4IUR A;  2CKK A;  1N27 A;  3GLX A;  1M1G A;  1N8R R;  1K8A C;  5A0D A;  3X20 B;  4HCC A;  3EGX A;  3OB9 A;  2KY9 A;  1K73 R;  4IKF A;  1MMN A;  2RNA A;  2L0A A;  1WX6 A;  4ZGJ B;  5GAN d;  4JRQ A;  3DB3 A;  4DBH A;  1VQ6 A;  4BI3 A;  1N8R C;  4OMQ A;  3OYH A;  2QQ9 A;  4DEX A;  1JRI A;  2DXC A;  5CKB A;  4CI0 C;  2DZC A;  1GXI E;  4X9C A;  1H3H A;  1VQL T;  1UE9 A;  4XAX B;  2GCX A;  1I1J A;  2RI5 A;  3CCE T;  1WGS A;  3MP1 A;  3REA B;  4L6V 5;  1O9S A;  3MP8 A;  4RUG A;  5KH6 A;  3M56 A;  1T0J A;  4HCB A;  3HHT B;  3EG1 A;  2ROL A;  3NTH A;  5GAN 7;  2W0Z A;  1UB4 A;  3M58 A;  2RJC A;  4A4F A;  4PL6 A;  2DO3 A;  5EC7 A;  3OYL A;  4EMK A;  1RAD B;  2ZPG B;  1YJ9 A;  5IHK A;  5FLX E;  4M7A C;  4XU2 A;  3V7R A;  2KAF A;  4J6Y A;  3I56 A;  1NJI U;  3VKI A;  3EGD B;  5GAN 4;  4F7U F;  5FU6 C;  2P84 A;  2E12 A;  2BE7 D;  3JCM h;  2VYT A;  4RCC A;  4LDU A;  4HCZ A;  4RCB A;  5J3B A;  2V8K A;  3H0I A;  1D0Y A;  4M7D G;  4J6X A;  1ZHI A;  2JS2 A;  3LWH A;  1YJW T;  3G4S Q;  1ZQ1 A;  4M77 E;  4K11 A;  5GAO p;  1ZSG A;  3P8B B;  3G7Z A;  3LX7 A;  2DYB A;  4M78 G;  4MML A;  3L2Q A;  2C0I A;  1Q86 R;  3EFR A;  4N4G A;  1FWZ A;  3QZ9 B;  2LZ6 B;  4KUL A;  2RQR A;  4JPB W;  5GAN 2;  4OMF B;  2G6F X;  4JJN K;  3G1J A;  4PLL A;  1FYN A;  2GTO A;  4Q5W A;  3HRU A;  4QQD A;  1J3T A;  3M59 A;  1U06 A;  5I11 A;  3JB9 D;  1UGV A;  4JLI A;  4D6W A;  4MMK A;  5IT9 E;  3EGU A;  4N0A A;  1YJN A;  1VA7 A;  3E19 A;  2I0N A;  2R5A A;  1TUC A;  3X24 B;  2QGF B;  4C8Q B;  4FSS A;  1TUG B;  2X4J A;  1R8O B;  1M30 A;  1OPK A;  2MAM A;  2ED1 A;  2BZY A;  4LUE A;  3G6E Q;  2CP7 A;  3M9Q A;  3V7S A;  1HJD A;  3LH0 A;  3JCM c;  1UEC A;  1VQ7 Q;  4FM4 B;  2RQW A;  1K0S A;  2AT1 B;  4ANJ A;  4MZP A;  3CCE Q;  3CPW S;  3M5A A;  5CR2 A;  4HT9 A;  5FU7 C;  1OZ3 A;  2NUP B;  3O8V A;  1TSF A;  3M0Q A;  2FRW A;  3ASK A;  2KBT A;  1OPL A;  4JLG A;  1RAE B;  1XQH A;  1V76 A;  3MEV A;  3S6W A;  2FEI A;  2XHC A;  4KGZ B;  4M75 D;  4M78 A;  2CP5 A;  2FZK B;  5IHN A;  1H3Z A;  5IAY A;  4F17 A;  3VS0 A;  1RAG B;  4JRK A;  1QCF A;  3ZL7 C;  1N6A A;  2KRS A;  1X6O A;  2MWP A;  2OAW A;  5CKD A;  3TQ7 P;  2HQH A;  4M7A F;  4LE9 A;  1NEB A;  4ZTF A;  3ZEH A;  3A8O B;  2ESW A;  2QAZ A;  2GNC A;  1SSF A;  4IUQ A;  1OYX A;  5HK0 A;  1AWO A;  2HSP A;  3CXC P;  2K6D A;  2P4T A;  1TTH B;  4IIO A;  4XTZ A;  2H8H A;  3DB4 A;  2RHY A;  3HRS A;  4F14 A;  1PRM C;  5GAN 8;  4CRI A;  3NFC A;  1HYO A;  4M4Z A;  5GAN g;  3VS1 A;  2CP0 A;  1YIJ T;  5GAM h;  2LX7 A;  4ESR A;  2CT3 A;  2LMJ A;  2DLP A;  5A0L A;  3L2W A;  1VQO A;  4YTL A;  1UEB A;  4EMH A;  2P0Q A;  4XTW A;  4A4K A;  2COW A;  3NGP A;  3X26 B;  4M78 C;  3TCJ A;  1D1A A;  4HVV A;  2X4W A;  1M3B A;  1U8R A;  4C8Q C;  3CCM A;  5GAO q;  2JOY A;  2HQX A;  1M2V B;  2VGN A;  5GJW B;  2E5Q A;  2JXB A;  2XIC A;  4V2S A;  1T3S A;  1GBQ A;  2ATC B;  1ACM B;  1TXQ A;  4ELY C;  2J6O A;  1G3Y A;  1QMC A;  2KR3 A;  1DJ7 B;  1Q82 C;  3KBG A;  2MPX C;  3WVD B;  2PQW A;  1UUE A;  2DM1 A;  1WPY A;  1MNE A;  1H92 A;  5GMK m;  2I2L A;  1UJY A;  1WHH A;  4ZN1 A;  3A1P A;  2JW4 A;  5LJ5 j;  2D1X A;  1Q81 C;  3CCL T;  4E7K A;  4WTO B;  3FIF A;  1BU1 A;  3OYN A;  2CZ1 B;  2OTL A;  4QW2 A;  5FWC A;  3G71 Q;  2EVR A;  3OSS C;  2LNH B;  5GAM e;  1CSK A;  1YJ9 Q;  2L2P A;  1KC8 R;  3QUI A;  2A0F B;  2QGG A;  1SRM A;  4OVA A;  3R6N A;  3A8G B;  4OMP A;  4F04 B;  3CCM Q;  4ATO A;  3CCU Q;  1RLQ C;  2KRN A;  2FRY A;  2MWO A;  2CDT A;  1MV0 B;  1QKW A;  1NPP A;  1KJW A;  3NTK A;  2K3B A;  5LJ5 d;  2BZX A;  3JB9 H;  1ABQ A;  4C92 G;  2LQN A;  4L59 A;  1OUL A;  2LTO A;  3U23 A;  2RQU A;  1OI1 A;  4J9D A;  4DBQ A;  3EHQ A;  1VQ7 A;  5AYF A;  1MUZ A;  2FO0 A;  2PZ1 A;  2F2W A;  2KYB A;  4AMC A;  1WHJ A;  2DZ9 A;  4FYX B;  1TUD A;  2RHI A;  2X4X A;  1VQ6 T;  3UT1 A;  4JRI A;  2B8A A;  3FLG A;  2PNI A;  3JCM f;  3BW1 A;  4NL2 A;  5IHI A;  3CME A;  1NPR A;  1T3L A;  1H8K A;  3CC7 A;  2QG9 B;  1Q86 U;  1UGQ B;  1R0C B;  3VYH B;  3H6Z A;  1HSQ A;  1NZ9 A;  2DBK A;  1GRI A;  4IUV A;  3VYG A;  1UGS B;  4HXJ A;  1IHV A;  1YIT Q;  4KH0 B;  2CP6 A;  4JRP A;  1IRE B;  1PM3 A;  2FVU A;  1OQK A;  2JS0 A;  4M77 C;  2HNI A;  4Z88 A;  3H0F A;  2MOX A;  2EGA A;  2CP3 A;  3MET A;  5GAM d;  1KQ2 A;  4KGV B;  1G3T A;  2AK5 A;  1AVZ C;  2RK2 A;  3KFV A;  2LRQ A;  3A8H B;  1BI0 A;  2QAS A;  1PD1 A;  2V8J A;  5GAO n;  2PTK A;  3QDR B;  1SF9 A;  2CH4 W;  4L5G A;  7AT1 B;  1I81 A;  4RTV A;  1Q7Y C;  2DAQ A;  1M1K C;  2D8J A;  3EGD A;  2KGT A;  1CKA A;  5J39 A;  4X1V A;  1WHL A;  3I56 Q;  1D0X A;  1VOM A;  1JQQ A;  2VB6 A;  1YFN A;  1B34 B;  3J80 E;  1TWB A;  2HQE A;  3EH1 A;  3CC7 T;  1V29 B;  2C0O A;  1Q7Y R;  3L2U A;  1Q81 U;  3CCU T;  5KYU A;  4C0Z A;  5KYW A;  2D8H A;  3TRE A;  1ZSZ A;  2EGC A;  3L2Z A;  1PG5 B;  3CCJ A;  2M02 A;  2O4X B;  2K5F A;  1BI2 A;  4QVZ A;  2CGH A;  2JM8 A;  2XG8 D;  3P8H A;  1WJQ A;  2MK5 A;  3NHN A;  2KRO A;  1NE8 A;  2EFI A;  4GLM A;  2EWN A;  2JNG A;  2CZ7 B;  1VQK T;  3OYB A;  2QXF A;  3E9F A;  1X69 A;  1Y7X A;  2VXE A;  5KYY A;  1UJ0 A;  4M75 G;  3SFM A;  2EYZ A;  3S3M A;  1B3Q A;  3AT1 B;  3KUF A;  3L42 A;  4CC2 A;  1UGP B;  5M9O A;  3CCS A;  1M8V A;  3CCR A;  2WSE E;  2VAS A;  3H8Z A;  4J8O A;  4A63 B;  3CC4 T;  1KC8 C;  1VQL Q;  1Q95 G;  3JB9 F;  2HAX A;  3RNJ A;  1MMG A;  1PWT A;  1QQJ A;  4PJN A;  1C6V X;  3GOX A;  1IB8 A;  2KSS A;  4Y28 E;  3RKW A;  3CCS T;  2OTL T;  2QI2 A;  3JRZ A;  2HZY A;  2OAU A;  2E6N A;  1IO6 A;  3CC4 A;  2JUF A;  1K4U S;  5C0M A;  4EMG A;  5DY9 A;  5CCA A;  5EG2 A;  1NYG A;  1BI3 A;  1WZO A;  5IXB A;  3QWY A;  3PIP A;  2NUP A;  2BE9 B;  1B07 A;  2YHT A;  2RI3 A;  1ZBX A;  3OYI A;  1IGU A;  2M0Y A;  3DLL A;  2KEA A;  2GBQ A;  2KVQ G;  3PNW C;  4FU6 A;  1YP5 A;  1QVG S;  4AT1 B;  4HT8 A;  2EBP A;  4M78 B;  4C5E A;  1ZUU A;  2XK0 A;  2EKO A;  4Y91 A;  2VVK A;  5CVI A;  2A7Y A;  3EAE A;  1KQ1 A;  4PFO A;  1JBM A;  2FHD A;  3CCJ Q;  5LL6 S;  4GLK A;  4JJD A;  2V8I A;  1VIF A;  2JN0 A;  1U1T A;  1FMK A;  2Z0W A;  2VV5 A;  5A0G A;  2HEQ A;  3RUX A;  1M1F A;  3PIO A;  2J6K A;  4BDZ A;  4OB2 B;  1YBY A;  1WIE A;  5DLQ E;  3CCV T;  2DBM A;  2RHX A;  2RQT A;  2ZPF B;  2JT4 A;  3ER0 A;  3ZBD A;  1VQ5 Q;  4C5I A;  2LT1 A;  5GAO r;  4JDS A;  4HCK A;  3M4Y A;  2KMT A;  4J9E A;  1SSH A;  2QQR A;  2DER A;  3CCR Q;  2GQV A;  2ZZD A;  4E47 A;  3PT9 A;  2YUP A;  2KT1 A;  2E4H A;  4F7U E;  4MDX A;  4IIM A;  3HP9 A;  1BCO A;  2J6F A;  1RL2 A;  3EG2 A;  4MZM A;  3JB9 J;  3JB9 I;  1WXT A;  4J83 A;  2VXF A;  4RTT A;  3VS2 A;  2QK0 A;  4CC3 A;  2QEX A;  3E1S A;  3PVQ A;  4C8Q E;  1VQ4 A;  2YT6 A;  1M2V A;  4BE2 A;  3BDU A;  1TOV A;  2QYZ A;  2X4Y A;  1A0N B;  1BK2 A;  2EGE A;  1N9S A;  3TSW A;  4C0D C;  3OS5 A;  3QXE B;  1SEM A;  4O6J A;  1FXX A;  4OP0 A;  1D3B B;  1VYU A;  1XNI A;  3VV0 A;  2K2M A;  5IH2 A;  2JTM A;  2BTT A;  2KT8 A;  1SPK A;  4A53 A;  1IZ6 A;  4EPC A;  2P0K A;  4ZTJ A;  4J9C A;  4J9F A;  1KFZ A;  3TEE A;  1AOJ A;  2RB6 A;  3MO8 A;  1NM7 A;  2XDP A;  2LQW A;  2E3H A;  1XOV A;  2DNU A;  3JCM g;  1C1A A;  5L8R E;  3CPF A;  1I0C A;  1BYM A;  2E41 A;  2VKN A;  4WCI A;  1VQO T;  1M90 U;  1YHQ A;  4C8Q D;  2BKD N;  3TVT A;  5D6W A;  3CCJ T;  2F2X A;  4IUP A;  1WXB A;  1KK7 A;  3FJ5 A;  1M5Q 1;  1KD1 U;  2COZ A;  2EIF A;  3GNG A;  2RF0 A;  2DRM A;  2YLC A;  2LCL A;  1U1S A;  1K9M R;  1NJI R;  1K0X A;  5GAM j;  1UHF A;  1I8F A;  5GMK j;  1QVF A;  4M75 E;  3JCM X;  1YJN Q;  1B7T A;  2K9G A;  3RKX A;  4M7D A;  4C92 C;  2E70 A;  2IPO B;  4KRT A;  1BBZ A;  1UG1 A;  3M57 A;  5J26 A;  1AT1 B;  3EG3 A;  3EGX B;  3OYJ A;  2E64 A;  1W4S A;  2XU8 A;  1YJW Q;  4B6M A;  1KSW A;  3RIR A;  3CME T;  1UGR B;  4M7A E;  1HK9 A;  2AZV A;  2XI9 A;  2V1R A;  2DIL A;  3OYF A;  3VS7 A;  2DA9 A;  2IG0 A;  3VS4 A;  2D6F A;  3JCM d;  5GAN 6;  4J7F A;  3MEU A;  1KG1 A;  2HSE B;  4FYW B;  3LWI A;  1IRX A;  1M9S A;  2F5T X;  3L2V A;  2K7A A;  4FT2 A;  4PNO A;  2O9S A;  4RTY A;  2O88 A;  2LJ3 A;  3LH5 A;  4DQ2 A;  4JS4 A;  4C8Q G;  4LDX A;  2H3E B;  3JV3 A;  4A4G A;  4RTZ A;  1WNL A;  4XQ3 A;  3CQT A;  1W6X A;  4WF2 A;  5GJV B;  2DEQ A;  1T0H A;  1I07 A;  1WA7 A;  5D6Y A;  4XTX A;  5CO7 A;  1KQS P;  2C06 A;  2DVJ A;  9ATC B;  4OMN A;  2RMO A;  2JMC A;  5CQY A;  4C0F A;  1G2B A;  1ARK A;  2JZ2 A;  1M8M A;  1YNZ A;  1YN8 A;  1EX4 A;  5KYN A;  3OW2 P;  1ZUY A;  1N9R A;  4C8Q F;  3HSB A;  1OZ2 A;  1X6G A;  2LP5 A;  2O2O A;  1ZA2 B;  4A4E A;  2GF7 A;  5CK9 A;  1HXD A;  4X34 A;  1VQM Q;  2DD5 A;  2ZPB B;  3CCS Q;  3OS1 A;  3EG9 A;  4XU1 A;  3VRZ A;  1B34 A;  3KXT A;  2Y4Y A;  2LQ8 A;  2DRK A;  5KE3 A;  3MP6 A;  4DBR A;  2K5I A;  4M78 E;  5LJ3 e;  4F7U G;  4XTU A;  1KD1 C;  5CKH A;  3QG1 A;  3G4S A;  1Q82 R;  3V8J A;  1QCO A;  3FRN A;  3CME Q;  5CQX A;  1MV3 A;  1RAA B;  4C8Q A;  2L89 A;  2HKN A;  5I2S A;  1I5L A;  1FMV A;  2RQV A;  4II1 A;  4FSX A;  2F5K A;  2CP2 A;  1X2Q A;  3QO3 A;  1UDL A;  2LCS A;  4MZT A;  1K8A U;  4LDV A;  2LVM A;  3V7C A;  2F69 A;  2DJZ A;  4AG2 C;  5L23 A;  2DPP B;  1VYT A;  2BUD A;  1EIF A;  2WSF E;  2E6Z A;  2L3P A;  2AKK A;  4QVD A;  2QDY B;  1K1Z A;  2YRC A;  2DL8 A;  1N8R U;  2O01 E;  1G3W A;  2E5K A;  2M51 A;  3JCM J;  2KYM A;  1YHQ T;  4P5N A;  4LN2 A;  1QP3 A;  3C0C A;  5A2Q E;  1QP2 A;  1K73 C;  2M16 A;  2EW3 A;  1YCS B;  1GCQ C;  3CMA Q;  3OYE A;  3CC7 Q;  1JJ2 P;  5LJ3 g;  4FYV B;  2DL7 A;  3ZFJ A;  1WQ7 A;  1WYX A;  4CC7 A;  1WI7 A;  1FX7 A;  2ROT A;  2RPN A;  5LJ3 h;  4O5V A;  2YRD A;  2D0Q B;  3X28 B;  3PE0 A;  1NG2 A;  1VQP Q;  1I4K 1;  1E6G A;  3VRY A;  4Z89 A;  2QA4 A;  1VQP T;  1Y96 B;  2PVO B;  2CS7 A;  4M77 G;  2KDS A;  4EDU A;  3RMS A;  2EPD A;  3A8M B;  3CD6 T;  4AG1 C;  2CH4 A;  4XK8 E;  4D8K A;  4OMO A;  4JJC A;  3EH2 A;  1BCM A;  3HRT A;  3QYH B;  2DFU A;  1MMD A;  1QW1 A;  1PC0 A;  3JCM Q;  2OTL Q;  1YCY A;  1NBE B;  2W10 A;  3C94 A;  2FL7 A;  3QDF A;  2NYS A;  3C95 A;  2L5Q A;  1PD0 A;  1Y0M A;  2VGM A;  5HCK A;  5KCO A;  4M7A D;  2V1Q A;  2F2V A;  5GMK h;  3VUB A;  3MJX A;  3CBO A;  3H41 A;  4M78 D;  4M75 A;  4PJL A;  4R0K A;  3SWN C;  3PTA A;  2K2V A;  1VQ6 Q;  5GMK l;  3CD6 Q;  3INZ A;  2R5M A;  3E2U A;  4XU0 A;  3OYK A;  4M7D D;  2OTJ A;  1W2B A;  3OA6 A;  3OMC A;  1LCK A;  2BZ8 A;  3GP8 A;  4LNP A;  2F1L A;  2DMO A;  2RHU A;  2HDA A;  2EYW A;  2J7I A;  1VIE A;  2EQM A;  2EAY A;  1YIT T;  3GIB A;  2DXT A;  5I2M A;  1PHT A;  1YWP A;  2A3L A;  2DTI A;  4A4H A;  2CZ6 B;  5FRO A;  4M7A A;  3DKM A;  4R55 A;  1K73 U;  4RKU E;  3M55 A;  3CCV Q;  2B86 A;  5FW9 A;  4C0G A;  5AT1 B;  3FEO A;  1QWF A;  3RDV A;  1IXD A;  2PUO B;  3OBY A;  3I35 A;  4Y92 A;  2NLU A;  1X27 A;  4BD3 A;  4E7S A;  1NLO C;  8ATC B;  2GTJ A;  4EIK A;  3QKJ A;  1RAI B;  2QTX A;  2SRC A;  1Y71 A;  4BDY A;  1S72 A;  4C5H A;  1JJ2 S;  1RUW A;  4J5Y A;  5GAO m;  1X01 A;  5GMK e;  3FC3 A;  2JMA A;  3OYG A;  2K3Y A;  3MEW A;  1QVF S;  2OJ2 A;  3CXC A;  2NUT A;  1WFW A;  2XDB A;  2WAC A;  1TS9 A;  3PMT A;  2QA4 Q;  1WLP B;  3M0U A;  2IIM A;  1KHC A;  3I9Q A;  4C92 F;  4D8D A;  4QQG A;  3V8K A;  1MMA A;  2JJ9 A;  1X43 A;  3N5B B;  2BIV A;  3RBB B;  4PJO B;  3IQL A;  4N4H A;  3SEM A;  2O31 A;  4J7I A;  3EFO A;  1ZSZ C;  1QWE A;  4LD9 K;  2FB7 A;  3CBP A;  1D0Z A;  1D1C A;  5HY6 A;  4TVR A;  2LX9 A;  2DKG A;  1PSF A;  3CMA A;  3PMI A;  3OS0 A;  2COY A;  1RI0 A;  4B9W A;  2M0O A;  3M0R A;  1QVG A;  5FU6 B;  2DTH A;  2PUK B;  1GFC A;  5DM7 R;  5LJ5 f;  1VQM T;  4J9H A;  2JM9 A;  3NMZ C;  2VUB A;  2LC4 A;  3SWN A;  3HKS A;  3FB9 A;  5FU7 B;  5CKF A;  3M4G A;  2PVD B;  1Q82 U;  4KT0 E;  3HFO A;  2P0P A;  3EFS A;  3CCL A;  5LJ5 h;  1PRL C;  1YI2 Q;  1ZA1 B;  4J9I A;  4OF1 A;  3ULR B;  1S1N A;  3QHS A;  2CSI A;  3D7S B;  5KYW B;  1YIJ Q;  2HBP A;  3BE3 A;  4J6W A;  1ZSZ B;  5HKC A;  2RD1 A;  2JTF A;  4DOV A;  3UA6 A;  5LJ3 j;  2EJ9 A;  2GGR A;  1QVF P;  1H64 1;  2LNV A;  2YWW A;  4M7D F;  1IHW A;  2RK1 A;  3G4S T;  2YXY A;  2CSQ A;  2EKH A;  4JUV A;  1UFF A;  4KBM B;  4OGE A;  2KRM A;  3REB B;  1VQ4 Q;  1OX9 A;  4M78 F;  3OYC A;  3VS3 A;  4E7L A;  2DXU A;  2QQS A;  1VQ4 T;  2ZPH B;  3M0S A;  2DYI A;  1G8X A;  1CKB A;  1O75 A;  1M1K R;  3M0T A;  3M54 A;  1E7O A;  1W1F A;  1RAH B;  1C0M A;  3VS5 A;  3Q1J A;  3HTR A;  1YI2 T;  3RMQ A;  1YJN T;  2HKQ B;  2RJD A;  1IGQ A;  3MPU B;  3UA7 A;  2YDL A;  2YUN A;  3CCR T;  2MI6 A;  1ZLM A;  1I5O B;  1BKB A;  3G71 T;  2R57 A;  1QLY A;  2A36 A;  3I5S A;  1WDX A;  4JS5 A;  2HD0 A;  1JXO A;  3OW2 A;  1Q81 R;  1JB0 E;  1UTI A;  2K79 A;  1LJO A;  2RM4 A;  1Q86 C;  4M7A G;  5LJ5 e;  2DL5 A;  5ECA A;  4E6R A;  1G3S A;  3FJP A;  2EQU A;  4LXC A;  1S72 Q;  3CCQ T;  5CKE A;  4BI8 B;  3CCM T;  3RES A;  4FT4 A;  4C92 E;  3SDZ A;  5FRN A;  1KIK A;  2FYK A;  4ZGD B;  2DF6 A;  2C0T A;  2DIG A;  4M77 A;  5HK3 A;  4PJO D;  1HD3 A;  3CCL Q;  2YUQ A;  4M77 D;  3LGL A;  4JJB A;  5I22 A;  4JZ4 A;  1YI2 A;  4IUU A;  1RLP C;  1SKU B;  2EQK A;  3QZ5 B;  4PK4 A;  2RI2 A;  2X9H A;  2OI3 A;  1MND A; 
#chains in the Genus database with same CATH homology
 3CC7 A;  3HPW A;  1Q86 U;  4HT8 A;  4NOY A;  1LOJ A;  3V8J A;  4E7J A;  1UGQ B;  3E9G A;  4EMK C;  3VYH B;  4C5G A;  5GAO l;  3H6Z A;  4BY6 B;  1NZ9 A;  2ZGW A;  3FRN A;  3FDR A;  5CQX A;  1NJI C;  4IUV A;  3VYG A;  5GAN f;  3ME9 A;  1UGS B;  2L89 A;  3GF5 A;  4C8Q A;  4BE1 A;  5I2S A;  1S72 T;  1I5L A;  4LDW A;  4II1 A;  4FSX A;  3OYY A;  2F5K A;  3JB9 G;  1VQ5 A;  2DK3 A;  4BB7 A;  5GAM f;  2E1H A;  3GNF B;  4JRP A;  3I55 A;  2DD4 A;  3QO3 A;  3M53 A;  1IRE B;  4MZT A;  2LCC A;  1X75 C;  4OB1 B;  2FVU A;  1VQ9 A;  4C92 B;  4M77 C;  1K8A U;  4LDV A;  2HNI A;  2LVM A;  4KUD K;  4NL3 A;  3URG A;  3V7C A;  3HL8 A;  2KQW A;  3RER A;  4F7U A;  2F69 A;  3MET A;  5GAM d;  2DJZ A;  4PJO F;  1KQ2 A;  1BI1 A;  1G3T A;  4OB0 B;  4RMO A;  2RK2 A;  2K57 A;  2DPP B;  3CEY A;  3LGF A;  2LRQ A;  3L1A A;  3A8H B;  4LDY A;  4E7I A;  1VQM A;  1VQN T;  1BI0 A;  2BUD A;  1EIF A;  2M9U A;  2WSF E;  2E6Z A;  2ZPI B;  2LT4 A;  2E10 A;  4QVD A;  1D3B A;  2CZ0 B;  2V8J A;  5CAI A;  2QDY B;  5GAO n;  1N8R U;  3QDR B;  2DTO A;  3PFS A;  2O01 E;  4M7A C;  4PJO A;  2K4Y A;  1G3W A;  4OGC A;  3I55 T;  1WQW A;  4L5G A;  4C92 D;  1I81 A;  3OYD A;  3JCM J;  4A54 A;  3SB2 A;  5LJ5 g;  2DAQ A;  1QVP A;  2RA2 A;  1Q7Y C;  1YHQ T;  1M1K C;  3QPH A;  4P5N A;  3JCM V;  1QP3 A;  5A2Q E;  3JSC A;  1QP2 A;  1K73 C;  2L3R A;  2ZCF B;  2M16 A;  2CYZ B;  3QYG B;  5J39 A;  3BDL A;  5LJ3 d;  3OYE A;  1VUB A;  5GAN e;  2G3R A;  3G6E T;  1YIT A;  1KC8 U;  5LJ3 g;  2Y90 A;  2K3X A;  2PU9 B;  3ZFJ A;  4DA4 A;  1WQ7 A;  1B34 B;  3J80 E;  2HQE A;  3CC7 T;  1V29 B;  2MMP A;  2RJF A;  4E7H A;  1FX7 A;  2YRV A;  3L2U A;  4IUT A;  3OY9 A;  1Q81 U;  5LJ3 f;  5LJ3 h;  3JCM e;  5C6S A;  4O5V A;  3X28 B;  2D0Q B;  3CCU T;  4ZN3 A;  2DVE A;  3G6E A;  4IUR A;  4C0Z A;  2CKK A;  3TRE A;  1N27 A;  1KHI A;  3GLX A;  3L2Z A;  1M1G A;  3JAM E;  4QVC A;  3CCJ A;  2O4X B;  1K8A C;  1I4K 1;  1BI2 A;  2K5F A;  3C12 A;  2CGH A;  2XG8 D;  4QVZ A;  3X20 B;  5A0D A;  4HCC A;  3P8H A;  3OB9 A;  1WJQ A;  1M4Z A;  4RG8 A;  3CCU A;  2KY9 A;  4Z02 A;  2QA4 A;  1NE8 A;  2EFI A;  1VQP T;  4M75 C;  1Y96 B;  2RH2 A;  4IKF A;  2PVO B;  2CS7 A;  4M77 G;  4XTV A;  2KDS A;  4EDU A;  4XTY A;  4ZGJ B;  2EWN A;  2JNG A;  4PKC C;  2CZ7 B;  1VQK T;  5GAN d;  4JRQ A;  2KK4 A;  3RMS A;  3A8M B;  3OYB A;  3DB3 A;  2QXF A;  1VQ6 A;  4BI3 A;  3CD6 T;  1N8R C;  3OYH A;  2QQ9 A;  4M7D B;  3E9F A;  1JRI A;  4XK8 E;  2DXC A;  5CKB A;  1Y7X A;  2VXE A;  2D9T A;  4CI0 C;  3JCM b;  1MHN A;  2DZC A;  4M75 G;  1GXI E;  4X9C A;  3SFM A;  1Q7Y U;  1M1K U;  3HRT A;  1VQL T;  3QYH B;  3S3M A;  3KUF A;  3L42 A;  4FL6 A;  4XAX B;  2GCX A;  1UGP B;  2RI5 A;  3CCE T;  1QW1 A;  1WGS A;  3MP1 A;  5M9O A;  3CCS A;  2QA4 T;  4L6V 5;  1M8V A;  1O9S A;  3JCM Q;  3CPW A;  3MP8 A;  3CCR A;  1VQP A;  2WSE E;  3H8Z A;  4J8O A;  3CC4 T;  1YCY A;  3UWN A;  1KC8 C;  5KH6 A;  3JB9 F;  2HAX A;  3M56 A;  3C94 A;  5IN1 A;  2DIQ A;  4HCB A;  3SD4 A;  3GOX A;  3HHT B;  3NTH A;  5GAN 7;  3CXC S;  3OYM A;  2KSS A;  3P8D A;  4N0A C;  4Y28 E;  2FL7 A;  3RKW A;  1UB4 A;  3M58 A;  2QI2 A;  3CCS T;  2OTL T;  2RJC A;  3JRZ A;  4A4F A;  4M7D D;  2OAU A;  2E6N A;  2JVV A;  2L5Q A;  3C95 A;  2JUF A;  1XTD A;  2DO3 A;  4PL6 A;  3CC4 A;  2VGM A;  3OYL A;  4EMK A;  1LNX A;  5C0M A;  4EMG A;  3G71 A;  5DY9 A;  5CCA A;  5EG2 A;  4UC4 A;  5KCO A;  4M7A D;  2EJF A;  5GMK h;  1BI3 A;  3VUB A;  1P92 A;  5GAN j;  3PIP A;  3CBO A;  2ZPG B;  1YJ9 A;  2YHT A;  5FLX E;  3S3O A;  2RI3 A;  4M78 D;  4M75 A;  1ZBX A;  4XU2 A;  3OYI A;  3V7R A;  3SWN C;  2KAF A;  4J6Y A;  3RKY A;  3I56 A;  3PTA A;  1NJI U;  2K2V A;  3VKI A;  5GMK l;  3DLL A;  5GAN 4;  4QQ6 A;  2KVQ G;  3PNW C;  4F7U F;  4FU6 A;  3INZ A;  1K9M U;  5FU6 C;  2VC8 A;  4PLI A;  2E12 A;  2R5M A;  2RO0 A;  1QVG S;  2VYT A;  4RCC A;  3JCM h;  3PGG A;  4M78 B;  4LDU A;  4XU0 A;  4HCZ A;  3UDC A;  4RCB A;  5J3B A;  2XK0 A;  2V8K A;  3OYK A;  3OA6 A;  1W2B A;  3OMC A;  2EKO A;  4Y91 A;  3GPL A;  4OB3 B;  4ZGE B;  1BIA A;  5CVI A;  4M7D G;  2A7Y A;  4J6X A;  1ZHI A;  3LWH A;  3EAE A;  3GP8 A;  1YJW T;  1KQ1 A;  2RHU A;  1JBM A;  1ZQ1 A;  2FHD A;  4M77 E;  2QQA A;  5GAO p;  3CC2 A;  3P8B B;  5LL6 S;  3G7Z A;  1VQK A;  2YLB A;  4GLK A;  3LX7 A;  1VIE A;  2V8I A;  4RG2 A;  4N4I A;  1VIF A;  2EQM A;  2JN0 A;  4M78 G;  1U1T A;  2EAY A;  4MML A;  3L2Q A;  3QII A;  1YIT T;  3CCV A;  3GIB A;  2DXT A;  2VV5 A;  5A0G A;  3MHX A;  5I2M A;  1VQ7 T;  4X9D A;  3CC2 T;  3EFR A;  4N4G A;  1FWZ A;  3QZ9 B;  3RUX A;  3BY7 A;  3OS2 A;  2A3L A;  3TU4 K;  2DTI A;  2OTJ T;  1M1F A;  3PIO A;  4A4H A;  4KUL A;  4BDZ A;  4OB2 B;  4OMF B;  1YBY A;  5DLQ E;  5GAN 2;  3CCV T;  4JJN K;  4ME7 A;  4PLL A;  2CZ6 B;  2RHX A;  5FRO A;  4M7A A;  3SWN B;  2ZPF B;  3DKM A;  4Q5W A;  4R55 A;  1K73 U;  3ER0 A;  3HRU A;  3ZBD A;  4QQD A;  4RKU E;  4C5I A;  2LT1 A;  2XID A;  3M55 A;  3M59 A;  5GAO r;  4JDS A;  4C0G A;  4B9X A;  3JB9 D;  3M4Y A;  2KMT A;  3FEO A;  3LLR A;  3UPU A;  4JLI A;  4D6W A;  2QQR A;  4NS5 A;  4MMK A;  5IT9 E;  2GQV A;  2PUO B;  3OBY A;  5GAN 3;  2ZZD A;  4BD3 A;  2NLU A;  3OSV A;  4N0A A;  4M7D E;  1YJN A;  4E47 A;  3PT9 A;  4F7U E;  1JJ2 A;  3QKJ A;  3E19 A;  4MDX A;  2R5A A;  2EYQ A;  3HP9 A;  2QTX A;  3CD6 A;  5D6X A;  1Y71 A;  4GY5 A;  3X24 B;  4BDY A;  5KE2 A;  4C5H A;  4C8Q B;  1S72 A;  3S3N A;  1JJ2 S;  2X4J A;  1R8O B;  2AHJ B;  2IVW A;  4J5Y A;  2MAM A;  4XU3 A;  1RL2 A;  3WXM B;  1X01 A;  5GAO m;  3CCE A;  4MZM A;  5GAM g;  5GMK e;  3JB9 J;  3JB9 I;  3FC3 A;  1VQ8 T;  3M9Q A;  3V7S A;  3OYG A;  3JCM P;  3LH0 A;  2K3Y A;  3MEW A;  4J83 A;  3JCM c;  1QVF S;  2VXF A;  3CXC A;  2RHZ A;  4FM4 B;  1VQ9 T;  2QEX A;  2XDB A;  2WAC A;  3E1S A;  4C8Q E;  4EMK B;  1VQ4 A;  4MZP A;  3PMT A;  4BY6 C;  4BE2 A;  3BDU A;  3CPW S;  2X4Y A;  3M5A A;  5CR2 A;  4HT9 A;  3VUZ A;  5FU7 C;  1OZ3 A;  1KHC A;  1N9S A;  3O8V A;  3OYA A;  3ASK A;  4C92 F;  4C0D C;  3OS5 A;  3QXE B;  4QQG A;  3V8K A;  1VQ5 T;  1MGQ A;  4O6J A;  1FXX A;  4OP0 A;  1D3B B;  1XQH A;  3N5B B;  4JLG A;  1XNI A;  3VV0 A;  3X25 B;  2BIV A;  3MEV A;  3S6W A;  2JTM A;  4BE0 A;  4PJO B;  2XHC A;  4M75 D;  4M78 A;  4N4H A;  4A53 A;  2ZPE B;  1IZ6 A;  2LQK A;  2RJE A;  4EPC A;  5IAY A;  1H3Z A;  4J7I A;  2P0K A;  2L8D A;  4ZTJ A;  4LD9 K;  2FB7 A;  3CBP A;  5HY6 A;  4TVR A;  4JRK A;  2LX9 A;  2DKG A;  1PSF A;  5I21 A;  3TEE A;  3CMA A;  3PMI A;  1N6A A;  1PSE A;  4M75 F;  1X6O A;  2RB6 A;  3MO8 A;  2MWP A;  2XKO C;  3OS0 A;  2XDP A;  5CKD A;  1VQN A;  1RI0 A;  3A5Z B;  4B9W A;  2M0O A;  3JCM W;  4M7A F;  1XOV A;  4ZTF A;  1QVG A;  3ZEH A;  3A8O B;  3V8L A;  4R56 A;  4PJO G;  3JCM g;  3J7A F;  1SSF A;  4IUQ A;  4DOW A;  1OYX A;  5HK0 A;  3VU3 C;  3L2R A;  4C5E A;  5L8R E;  3CPF A;  5FU6 B;  2P4T A;  2QQB A;  2DTH A;  1BYM A;  2E41 A;  2PUK B;  5DM7 R;  1VQO T;  5LJ5 f;  1VQM T;  1YHQ A;  4C8Q D;  1M90 U;  2XDD A;  3C4S A;  4XTZ A;  2BKD N;  2VUB A;  3LW5 E;  5D6W A;  3CCJ T;  2LC4 A;  3SWN A;  2O4X A;  4IUP A;  3DB4 A;  2RHY A;  3HRS A;  1M5Q 1;  1KD1 U;  4PJO C;  3HKS A;  3FB9 A;  5GAN 8;  5FU7 B;  3NFC A;  3MCA B;  5CKF A;  3M4G A;  2EIF A;  2PVD B;  3GNG A;  4CRI A;  1K9M C;  1VQ8 A;  1Q82 U;  2XD0 A;  3LYI A;  4KT0 E;  5GAN g;  2YLC A;  3HFO A;  2LCL A;  2P0P A;  1U1S A;  3EFS A;  1YIJ T;  4FIB A;  3CCL A;  5GAM h;  5GAM j;  5LJ5 h;  3R6O A;  3WVE B;  3HFN A;  1I8F A;  5GMK j;  1QVF A;  2R58 A;  3OBW A;  4OF1 A;  4M75 E;  3JCM X;  3QHS A;  5A0L A;  3L2W A;  3RKX A;  2HBP A;  4M7D A;  4J6W A;  4C92 C;  2E70 A;  4BAC A;  1VQO A;  5HKC A;  4YTL A;  1UEB A;  2RD1 A;  2JTF A;  3M57 A;  5J26 A;  4EMH A;  4M77 B;  4DOV A;  3CBM A;  2P0Q A;  4XTW A;  4A4K A;  5LJ3 j;  1WJR A;  3OW2 S;  3QBY A;  2EJ9 A;  4LD6 A;  3OYJ A;  3QSU A;  1Y07 A;  2E64 A;  1H64 1;  2LNV A;  2PVG B;  5GAN 5;  3X26 B;  4M78 C;  3TCJ A;  1W4S A;  4M7D F;  1Y96 A;  2XU8 A;  2RK1 A;  4C0D B;  2X35 A;  4ELZ C;  2EJG A;  2X4W A;  3T9N A;  3G4S T;  3RIR A;  3CME T;  3QJY A;  4C8Q C;  1U8R A;  4JUV A;  3NTI A;  4KBM B;  1UGR B;  3CCM A;  4OGE A;  2LDM A;  1HK9 A;  2M1H A;  5GAO q;  4M7A E;  2JOY A;  2HQX A;  2VGN A;  2XI9 A;  2E5Q A;  4M78 F;  3OYC A;  4E7L A;  3OYF A;  2XIC A;  2DXU A;  2QQS A;  4V2S A;  2IG0 A;  1VQ4 T;  3BFM A;  3OQ5 A;  2D6F A;  3JCM d;  2ZPH B;  5GAN 6;  4J7F A;  1M90 C;  3MEU A;  1KG1 A;  1O75 A;  4ELY C;  2K5L A;  1G3Y A;  3M54 A;  2MF2 A;  3LWI A;  1DJ7 B;  1M9S A;  3Q1J A;  1Q82 C;  3KBG A;  1YI2 T;  2F5T X;  3RMQ A;  3L2V A;  3WVD B;  2PQW A;  4FT2 A;  4PNO A;  1YJN T;  2RJD A;  1WJS A;  1WPY A;  1AHJ B;  5CIU A;  3OMG A;  4VUB A;  4DQ2 A;  4C92 A;  5DLO A;  2MI6 A;  3CCR T;  4JS4 A;  4M7D C;  5GMK m;  4PJO E;  2I2L A;  4C8Q G;  4LDX A;  1BKB A;  3MEA A;  4ZN1 A;  3G71 T;  2R57 A;  4A4G A;  5LJ5 j;  3CCQ A;  1Q81 C;  1WNL A;  4XQ3 A;  3CCL T;  4E7K A;  4F7U B;  4WF2 A;  4JS5 A;  3FIF A;  2HD0 A;  2DEQ A;  3OYN A;  1BIB A;  4BI4 A;  3OW2 A;  2CZ1 B;  5D6Y A;  2OTL A;  4XTX A;  1YJ9 T;  4M75 B;  4QW2 A;  5CO7 A;  1JB0 E;  2RM4 A;  2QEX T;  1LJO A;  3CMA T;  1Q86 C;  3OSS C;  4BUG A;  5KCH A;  3I56 T;  2C06 A;  4M7A G;  5GAM e;  5CQY A;  4C0F A;  5LJ5 e;  3VJP A;  2JZ2 A;  2E65 A;  3QUI A;  2Y4X A;  4OVA A;  2EQJ A;  1G3S A;  3A8G B;  3QJ6 A;  5FRM A;  1N9R A;  1KQS S;  4ATO A;  4C8Q F;  3HSB A;  3F70 A;  1OZ2 A;  2MWO A;  3FJP A;  2EQU A;  4KUI A;  1YJW A;  3DLM A;  3CCQ T;  5CKE A;  1NPP A;  4BI8 B;  3NTK A;  3CCM T;  3RES A;  4A4E A;  2GF7 A;  1VQL A;  5LJ5 d;  5CK9 A;  3JB9 H;  1HXD A;  4FT4 A;  4X34 A;  2OTJ A;  4C92 E;  4C92 G;  3SDZ A;  1YIJ A;  5FRN A;  2ZPB B;  2DD5 A;  4L59 A;  2LTO A;  2FYK A;  4ZGD B;  3OS1 A;  1OI1 A;  4XU1 A;  1B34 A;  3KXT A;  2DIG A;  1VQ7 A;  2Y4Y A;  2LQ8 A;  4M77 A;  5AYF A;  2GFU A;  2GFA A;  3AHU A;  5KE3 A;  5HK3 A;  4HKE A;  2DZ9 A;  3MP6 A;  5GAN h;  4PJO D;  3J81 E;  2RHI A;  3A8L B;  2H3J A;  4HA8 A;  2DXB A;  2X4X A;  4M7A B;  4M77 D;  2WSC E;  3LGL A;  4MDW A;  4M77 F;  1YI2 A;  4IUU A;  2K5I A;  4M78 E;  1VQ6 T;  3UT1 A;  1TH7 A;  2EQK A;  2B8A A;  3FLG A;  4JRI A;  1KQS A;  3JCM f;  4F7U G;  4XTU A;  5LJ3 e;  3BW1 A;  3QZ5 B;  1KD1 C;  5CKH A;  1G5V A;  2RI2 A;  3QG1 A;  3G4S A;  4NL2 A;  5GMK i;  3CME A;  1NPR A;  1W2B S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...