4C92G

Crystal structure of the yeast lsm1-7 complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
75
Chain Sequence
AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMSISKNARKLGLTVIRGTILVSLSSAEGSDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 11
structure length 75
sequence length 85
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92G00
1BIAA 4OP0A 2DZ9A 3JB9D 5GAOq 3SWNA 1LNXA 3JB9F 5LJ3d 4C92A 5CAIA 2E41A 2YLCA 2JN0A 4M7AC 4J6XA 4F7UE 3QUIA 4M7AD 4NL3A 1H641 4M7AF 3JCMP 4DQ2A 2I2LA 4PJOC 4JLIA 4RCBA 3SWNB 2DKGA 4PJOD 3JB9H 3RERA 3EFRA 4V2SA 1N9RA 5GAOr 2FB7A 3JB9I 3INZA 5GAN5 1X01A 3QSUA 4M75B 3JCMh 5GANf 4M7DD 1B34B 4M7DF 4XTXA 5GANj 3M4GA 4M77B 2EWNA 5GAN4 5GAOn 4XU0A 2E64A 5GMKl 3QO3A 3RKWA 2E1HA 1WPYA 1YCYA 1LOJA 4C8QC 4N0AA 3JCMd 5LJ5f 4XU3A 3JCMV 4XTYA 1WNLA 2QTXA 4NL2A 3RUXA 3V7SA 4C8QE 2DXTA 5LJ5j 4M78G 5GAOp 1I5LA 2DTOA 5LJ3g 1N9SA 2YHTA 5GANg 3PGGA 3JB9G 3VU3C 5I21A 1BIBA 2Y90A 4F7UF 4XTZA 4PNOA 3SWNC 5GANe 5GAMh 4C92C 4M75A 3BW1A 4C92D 4M7AG 1HXDA 3BY7A 1B34A 4JUVA 4PJOF 4C92E 4EMKA 5GMKj 4M77A 3V7CA 4PJOG 5LJ5g 5LJ3f 3JCMQ 5GAOl 4M78A 3JCMW 5LJ3j 5GAMd 3HFNA 4X9DA 4XTWA 5LJ5e 4EMKB 1KQ2A 1WQ7A 3FB9A 3FJPA 4M77E 1D3BB 1MGQA 4XU1A 4M7DG 2VXEA 4M78B 1M5Q1 2CGHA 3V8LA 4XTVA 3L1AA 3EFSA 3V8KA 3JCMc 4M7AA 4C8QD 4C8QF 3RKYA 4C8QG 2DVEA 4EMHA 1LJOA 5GAN6 5GMKe 4N0AC 4J6WA 4M7AB 4QVCA 2E65A 2DZCA 1I4K1 1HK9A 4HA8A 5LJ3e 3JB9J 1Y96A 4HT9A 4M7DA 4PJOB 4HT8A 3JCMf 2DTHA 2DTIA 2EJ9A 4X9CA 4F7UG 5GMKi 5GAN3 4MMLA 5GAN7 4XU2A 4A53A 4RCCA 4C92F 4A54A 2RB6A 3HSBA 1JBMA 4C92G 5GAN2 1Y96B 4M7DB 1D3BA 3BDUA 2RM4A 4M75C 3AHUA 3GIBA 2FYKA 4EMGA 4EMKC 3BFMA 4M75E 4M77C 5GMKm 4M77D 2VC8A 3V7RA 4J6YA 4Y91A 5GANh 1WQWA 3FIFA 4C8QB 2RA2A 4M78E 4F7UA 3JCMg 2YLBA 3JCMJ 1TH7A 3JCMe 5GAMf 4PJOA 3V8JA 2DEQA 5GAMj 1I81A 5GANd 2RD1A 4MMKA 5DY9A 4F7UB 5LJ5h 5GAN8 1U1SA 2HNIA 4M7AE 1I8FA 3HFOA 4NOYA 4C92B 3RKXA 4PJOE 4XQ3A 1JRIA 2K57A 4J5YA 2ZGWA 2DXUA 3RESA 4WF2A 2VXFA 4JRIA 5LJ5d 3JCMX 3JCMb 5GAOm 4M7DC 3QHSA 1KQ1A 2EJGA 4QVDA 5GMKh 4M7DE 3SB2A 4JRKA 4XTUA 1U1TA 4C8QA 4M75D 5GAMg 4M75F 4M75G 5LJ3h 5GAMe 1M8VA 3L2ZA 4M77F 2E10A 4M78C 3RIRA 2EJFA 2EAYA 4M78D 2DJZA 4M77G 4M78F
chains in the Genus database with same CATH superfamily
3M55A 3JB9D 5A0DA 1SRLA 1JB0E 1K1ZA 2I2LA 1SSFA 4OMFB 2RK1A 1WI7A 3NHNA 1VQ7T 2GF7A 1BI3A 3HRUA 2E1HA 3JCMd 4VUBA 1TWBA 2KY9A 3H8ZA 5M9OA 2LTOA 4FCYA 4PNOA 3OY9A 4OGEA 1PKSA 3V7CA 4JJDA 1VQ5Q 3HFNA 1EZZB 2KRMA 1TUGB 2DYBA 3V8KA 4OMNA 4A4GA 2XI9A 4IUPA 2LP5A 2FPDA 3CCVT 2EQJA 4FL6A 1RAFB 4J6WA 4M7AB 1YJNQ 2OTJQ 2XD0A 2BUDA 4L59A 2EJ9A 4F7UG 2QQBA 1Y7XA 1QCOA 5GAN2 3J7AF 1UB4A 2ZPHB 3AHUA 3OBWA 4IIOA 5I22A 1R0BG 3H41A 4C5EA 1HYOA 4MZMA 1YBYA 1YIJA 3A98A 4OB0B 1B7TA 2CZ0B 3CC7Q 2BZ8A 2ROTA 2YSQA 3VKIA 4PJOA 2VYTA 1WHKA 5DY9A 2O01E 1H3ZA 3LH0A 3C94A 4EPCA 4XQ3A 2ZGWA 2NUTA 5CVIA 4M7DC 3X28B 1GL5A 1TUDA 2EYZA 1IHWA 1UJ0A 1K9MC 4M78F 4RG2A 4ELYC 3WVEB 1VQ8T 2ZPEB 1BIAA 4C0DC 3ME9A 4IUTA 2RN8A 4LDVA 3F70A 3SHWA 2YLCA 2PVOB 4N4IA 2DKGA 2HDAA 2PNIA 1NEBA 1N9RA 3JB9I 3INZA 2VV5A 1YI2T 1X01A 2DRKA 4BI3A 4CI0C 1RAIB 3S3MA 1ZSZA 1R8OB 3RKWA 3CBMA 1BBZA 1WPYA 2E6ZA 3CD6T 2DVJA 3JCMV 4NL2A 5CIUA 4OMPA 3SWNC 2RQVA 1FMVA 4QQGA 2RK2A 1M27C 1M1KR 2V8JA 2Z0WA 1AWJA 3EFSA 2NWMA 4M7AA 4E7KA 1KK7A 1HSQA 2MIOA 1VQLQ 1TUCA 3EGDB 2DIGA 4B9WA 4PJJA 4N0AC 3HKSA 1VQ4A 1OX9A 2FZKB 3G71Q 2DTHA 1C0MA 2GGRA 1YITQ 2YDLA 1VQMT 2XIDA 2EYYA 3X20B 1M90U 1VQKA 2K3BA 4J6YA 2ZPBB 3GLXA 1NYGA 2LQNA 1EFNA 1W2BA 2NUPA 2LC4A 1M1KU 5CQXA 3DB4A 4RTVA 2K7AA 3HFOA 2HL5C 3THKA 1SHGA 1WHGA 3X25B 1EIFA 4QVZA 2RNAA 4KGZB 1SSHA 2LJ3A 2IPOB 2RHZA 4F14A 1KJWA 2J06A 2E5QA 2PU9B 3I56A 2RHYA 1VQPQ 6AT1B 2AHJB 5GAOq 3TQ7P 3CCUA 2CSQA 1BK2A 2ABLA 4BY6C 2JTMA 3PFSA 3G7ZA 1H641 4LE9A 4DBQA 3L42A 2R57A 3MP6A 2FG0A 2EPDA 5A2QE 1T0HA 2RJFA 4V2SA 4J9CA 1BI0A 3FC3A 1UE9A 3ASKA 1U8RA 2EGCA 1K0SA 1F1BB 3M58A 2H3EB 3HL8A 3JAME 4C8QC 1RABB 4XU3A 3GF5A 1R77A 2DLPA 4KUIA 1VQ6A 4RMOA 3G4ST 7AT1B 1N8RR 2YUNA 4ANJA 1UTIA 5FU7B 2X35A 3X24B 5GANe 2C0TA 3LGFA 1AWOA 3OW2S 4PJOG 5KCHA 1FMWA 5I2SA 2KR3A 2CYZB 1ARKA 2P4TA 1G2BA 2VXEA 3V8LA 1RAHB 1K8AR 3TSZA 3CMEA 5FRMA 2DL3A 1OPKA 2CT3A 1QWFA 2K6DA 3UWNA 4E6RA 3GBQA 2D0NA 4HT8A 4E7SA 4X9CA 1I07A 1NBEB 4XU2A 2EFIA 2QAZA 2P0PA 1D1CA 1N8RU 3PE0A 3EG0A 3NGPA 2PZ1A 4LXCA 1ZQ1A 2XMFA 4L5GA 3WVDB 1FX7A 2K3XA 2XK0A 1YIJQ 2ECZA 1QW1A 2DIQA 5LJ5h 2NUZA 4LUDA 1WDXA 2FHDA 1X2QA 4D8KA 2O9SA 1WZOA 2SEMA 3EG2A 5GAMg 4M75D 2JT4A 3NTKA 5KH6A 1W1FA 4ME7A 5LJ3h 1PNJA 3CMAA 1SKUB 2EJFA 3A8HB 2RHUA 2OTJT 2CZ7B 3RMSA 3REBB 4KUDK 5KCOA 4K11A 1GCPA 1ZUKA 1LPLA 4RTUA 3CPWA 3JCMP 2PUKB 5GJWB 4DBRA 3EFRA 5L23A 3EG3A 2O4XB 2PVDB 4FSXA 4JRPA 1JU5C 1Q82C 3CCQA 1K76A 3UT1A 2D6FA 2CDTA 5GAN4 4E7IA 2DL8A 1MNDA 3HHTB 3HRTA 1YCYA 1RLQC 4JDSA 5LJ5f 3EFOB 1AZEA 1MV0B 3V7SA 4JZ3A 5LJ5j 2C06A 1I5LA 2HQEA 2NYSA 2P4RA 4FSSA 1YJWA 1M3AA 1PSFA 3S3OA 1QP2A 4ZGDB 3NFCA 4C92D 1VUBA 3OA6A 4MZPA 3QZ5B 4Z89A 3VS2A 5LJ3f 5GAOl 2JTEA 3TREA 4CC2A 1IXDA 5LJ3j 1YCSB 2D8JA 2KBTA 1OQKA 1Q7YC 2GTJA 2EYXA 4M7DG 3MKDA 3MP1A 3QDRB 2X4XA 4M4ZA 3RKYA 1RAAB 1M2VB 4QVCA 1MMDA 3CCJT 2QQSA 1X2KA 2XKOC 1VQ4Q 2DTIA 1Y0MA 4MMLA 2YT6A 1VQ5A 3FRNA 1QP3A 3GIBA 4EMGA 3A8OB 4M75E 3V7RA 1VQKQ 1BKBA 3CCRA 4KBMB 2DL7A 3OB9A 4OMMA 2V8IA 3ZFJA 1YJNA 4DOWA 1I81A 4DBFA 5KYWA 5CR2A 2MOXA 1PG5B 1D1AA 2ZCFB 1NZ9A 5GAOm 3Q1JA 4J9EA 3O8VA 3A8GB 2OTLT 1RAGB 4M78D 3OQ5A 1VA7A 3CC7A 1VQNQ 5J39A 2DX1A 2DZ9A 4Y92A 4GLKA 3QIIA 2DE0X 2COYA 3VYHB 2E3HA 1PWTA 1OV3A 4IUUA 2HD0A 2K9GA 2WACA 3E9FA 3I55T 3QJYA 3OYIA 2X51A 3EFOA 5IXBA 4RTZA 1ZBJA 3L2QA 2XHCA 3AT1B 4J7IA 3PMTA 1BI2A 3N5BB 2C0IA 3OMGA 2M16A 1RACB 4JS5A 3M59A 4AFQC 1VQ6Q 3VS1A 2EQKA 4Z88A 2ESWA 4F7UF 2FRYA 3MEAA 1KQSS 2YRVA 4AFUC 1K73R 3BY7A 1IREB 1D1BA 1X69A 1OI1A 1S1NA 2CGHA 1M2VA 2KVQG 1M4ZA 3UPUA 4RTYA 3CMEQ 1AWXA 4BE2A 2QASA 2GFAA 1I4K1 2KDSA 1RUWA 1XOVA 1MNEA 3WXMB 1AHJB 3LLRA 2QQAA 4RCCA 1RAEB 1PD0A 1SRMA 3UF4A 1R0CB 2FYKA 2A7YA 2W10A 5DM7R 1QVFA 1GBQA 2M0YA 1KQSP 2DFUA 4M78E 2MPXC 1KC8C 2DBMA 3G71A 2RD1A 2DYIA 3OYBA 2YWWA 4C92B 4E7JA 2K57A 1YITA 2DXUA 2EW3A 3RESA 1IO6A 2AKLA 4ZGJB 4ZN1A 1M3CA 2LRQA 3RNJA 3P8DA 4QKUA 2FPFA 1UGQB 3M56A 1SPKA 2M9UA 1PRMC 2KYBA 3OS1A 2QK0A 2P84A 4KULA 1VQ9A 4NL3A 2QDYB 1QLYA 2LDMA 4PJOC 4PFZA 4RTWA 2L0AA 3SDZA 3EG1A 2BTTA 4C0GA 3PNWC 3QSUA 2EVRA 1B34B 2EKOA 4BI8B 4FYWB 4FW2A 2A37A 4ELZC 5GMKl 2F5TX 4HVWA 3CCQQ 1VQPA 1YIJT 4HCKA 1QWEA 2EYQA 2B8AA 3JV3A 1N9SA 2YHTA 3RDVA 1YJWQ 1NG2A 3QWXX 3CC4A 4M75A 2GTOA 4KH1B 4M77A 4FW1A 2WSCE 4XTWA 4C0FA 4M78B 3P8HA 2JNGA 3L1AA 1ZSZC 2FRWA 3UATA 1LJOA 5GAN6 4A63B 3MO8A 1NLOC 2DZCA 2A28A 5CO7A 2QQRA 4JS4A 1X43A 1LCKA 1AEYA 3EG9A 2IIMA 4C92F 3OSSC 2JS2A 2XU8A 4LDYA 3SD4A 3QDFA 3OBYA 3UA6A 1M90C 5GMKm 1MMGA 4Y91A 2JM8A 1OYXA 2DNUA 1WQWA 2NLUA 3LH5A 3JCMg 2WSEE 1UFFA 2DRMA 3CCRQ 2F1LA 1WXUA 3G6EA 5GANd 4J8OA 1FWZA 4ZTFA 4NOYA 5IXFA 2LNVA 1S72A 1NLPC 1YHQQ 2X4WA 3JCMb 2KYMA 3QG1A 4QVDA 4ZNXA 5AYFA 4JJBA 2BIVA 1FXXA 2RQWA 4J9BA 2DO3A 3QXEB 3EHQA 2W0ZA 1VQ4T 1BCMA 2E6NA 1KIKA 1KD1C 5FW9A 1TSFA 8AT1B 1QKXA 3FLGA 3RERA 3OYEA 2KQWA 3EGXB 2P0KA 3H0HA 2EWNA 1IHVA 4BDZA 1AOJA 1M3BA 1WXBA 2DTOA 1A0NB 3VU3C 5I21A 3MHXA 1X6BA 5GAMh 1CKBA 1SHFA 2LT4A 4B6MA 1G83A 4M78A 2A3LA 1YNZA 4X9DA 4BE1A 5LJ5e 3RMQA 3I56T 4C0DB 2QA4A 3CCUT 2XICA 1NM7A 1T3LA 1IRXA 2QQ9A 4GLMA 2ZAEA 5CKHA 5LJ3e 2GCXA 1GBRA 1TXQA 1W70A 1WYXA 3VYGA 2DAQA 5KYXB 3OSVA 5KYYB 2OAWA 1IGQA 2DPPB 4BE0A 2COWA 5HKCA 2JUFA 4L6V5 2PQWA 4N4HA 2YRCA 2MI6A 2VUBA 1VQ6T 2DETA 2EQUA 5GAMf 5GAMj 1Z9QA 2LCLA 1U1SA 2K5FA 4AFZC 1W2BS 3RKXA 2FZGB 1JRIA 3CPFA 2VGNA 4JRIA 3JCMX 3OYKA 3VS6A 5GMKh 3OYLA 2XDBA 4WCIA 1ZUUA 2HKQB 4M75G 1M8VA 2GQVA 3RIRA 3CMET 4M77G 4FYXB 1M2OA 2JW4A 5CAIA 4LD6A 2EGEA 2E41A 3BDLA 2JN0A 5CKEA 4J6XA 1NPPA 4PKCC 3KUFA 4JLIA 4RCBA 2IVWA 3EGXA 1VQ9Q 2D9TA 2F5KA 2I0NA 4M7DF 3CCSQ 3U23A 1W2BP 1VQNA 3NMZC 2K5LA 4A4FA 2E12A 2KMTA 3EAEA 2AIRB 2CKKA 2CS7A 4LD9K 3M0TA 2QEXQ 5I11A 4AT1B 1K9MR 2KAFA 2CUDA 3VRYA 5GMKj 1VQOA 3CC4Q 1Q81C 3M57A 1HJDA 3OYAA 4EMKB 1TS9A 3CMAT 2LNHB 4LDXA 2X3XD 1NE8A 1JQQA 4GBQA 4OMQA 1ZSGA 3MCAB 2KK4A 4ZGEB 4BY6B 1KFZA 2M0OA 3HTRA 2CSIA 3EH1A 4HT9A 4BACA 2HQXA 1VYTA 1BI1A 5KYYA 1GCQC 5IHNA 4A53A 5KYNA 2VB6A 3LW5E 1Q86C 1M9SA 4EDUA 3CCQT 1XTDA 3M0SA 4RTXA 3VS7A 2EKHA 2LX7A 2VC8A 3S6WA 4FM4B 4C8QB 3EGDA 2RA2A 2K79A 4OB3B 1AT1B 1IB8A 2D1XA 1GXIE 1PSEA 1G3TA 1YJWT 3C4SA 3M0UA 5A0GA 2MYSA 4HCBA 5HK3A 3G6EQ 2BE9B 1ZA1B 2CZ1B 2DA9A 2J05A 2HZYA 2VXFA 4OGCA 3OS0A 2GFUA 4JPBW 1S72Q 2JJ9A 1NJIC 1U1TA 4BB7A 4J9FA 4LNPA 1P92A 1DJ7B 2CH4W 1JO8A 2E3IA 4FT2A 3OW2P 1LNXA 4J9GA 1LVKA 2AK5A 4F7UE 4PJNA 4Y28E 2DD4A 3I35A 2RQUA 1RLPC 2MAMA 3QBYA 1K8AU 1VQ5T 2D8HA 5GAOr 2FB7A 4PFOA 2HKNA 2RHXA 2YXYA 3CPWS 3KBGA 2COZA 3L2UA 3CCRT 4B9XA 4PFPA 1WNLA 4E7ZA 2PUOB 2RQTA 1YJNT 2L3SA 1IGUA 4RTTA 3OS5A 3E19A 1H3HA 2LJ1A 2KI7A 4J9DA 2QGGA 4M7AG 1HXDA 3OYNA 4EMKA 2RMOA 4PLIA 2MCNA 4CC7A 3LWIA 4EIKA 2DL4A 4LN2A 3UDCA 1BB9A 1M5Q1 3CC7T 3M0RA 3OS2A 2DBKA 4CC4B 1PHTA 4C8QF 2DM1A 4A4HA 3I5RA 1FMKA 2QA4Q 3CPWP 1OU8A 1Y57A 3PVQA 5GJVB 1HD3A 2VKNA 4N4GA 2EIFA 2JM9A 1UHFA 1WHHA 2RM4A 2E5KA 3BFMA 1WJSA 3PT9A 3IQLA 1UECA 2V1RA 4J7FA 1X6GA 4F7UB 2MK5A 2CREA 2HNIA 3OYMA 3CCVQ 1TG0A 5CKBA 4Q5WA 4J5YA 2LT1A 4WF2A 2A08A 2F69A 2CUBA 3CCLA 2AZVA 2DF6A 3L2ZA 3J81E 2DL5A 2O9VA 3FJ5A 5IHIA 2E70A 2H8HA 1JXMA 2FO0A 2KROA 4HKEA 4PJOD 5DLQE 1YHQA 1WHLA 2LQWA 5J26A 4ORZA 3JCMh 1YJ9A 1X75C 3QO3A 3MEWA 2QTVA 4DA4A 1E7OA 1Q95G 1VQLT 4HCZA 2EYWA 1OX8A 2MF2A 3I5SA 2JXBA 2XDDA 2JVVA 3G71T 1VQ8Q 3ER0A 3JB9G 4TVRA 2QI2A 4YTLA 3X26B 2BKDN 5FU6B 1YITT 2O4XA 2KSSA 2YRDA 4C92E 1D0ZA 4IKFA 2MMPA 3GNGA 3L2VA 2L5QA 1VQOQ 3LWHA 2BE7D 2KXCA 1D3BB 2L8DA 3C0CA 2RHIA 1UEBA 2EQIA 3R6OA 1BU1A 1V76A 4FT4A 3CD6Q 3NTHA 3CCEA 3VJPA 1VQ9T 1Q82R 1JEGA 1WHMA 4C0ZA 3LX7A 3JCMf 1UDLA 4M75C 2IG0A 4M77C 2KEAA 2QDLA 1IZ6A 1VQPT 1JJ2A 1TOVA 4F7UA 1ZA2B 3PVLA 1QCNA 1TH7A 4NS5A 4Z02A 1NEGA 3V8JA 1QVFS 8ATCB 1Q7YR 3CC4T 2FPEA 4JRQA 4PJOE 5EG2A 3CCMA 2JTFA 5LJ5d 2X4JA 3QHSA 1Q82U 2ZPFB 2CP5A 1VQMQ 1YFNA 2J6KA 5GAMe 2SRCA 3META 1OEBA 1K73U 3MEUA 1KQSA 4PL6A 3T9NA 2KRNA 2MWOA 5LJ3d 2HEQA 2J6FA 1WJQA 2R58A 5IAYA 2X9HA 2A0FB 4DQ2A 5KE3A 1K0XA 5GAN5 1QVGA 2JMCA 4M7DD 1QVFP 1WHJA 3M4GA 1GFDA 2KXDA 2CH4A 1KHCA 2OTLA 1LOJA 1NYFA 4XTYA 1MHNA 3DLMA 5LJ3g 3G6ET 1YN8A 2FVUA 2HBWA 2QXFA 3FDRA 4PJLA 2C0OA 2RI2A 5A0LA 1BIBA 2Y90A 4XTZA 1M1FA 4E2FB 4WTOB 3CXCA 1U5SA 3BE3A 4JUVA 3JCMQ 3CCSA 3I55A 2DEUA 2O31A 2J7IA 2KT8A 5CQYA 4R56A 4HVUA 4DEXA 4XU1A 3OYJA 1AD5A 1QQJA 4IIMA 2RJEA 2EQMA 3GPLA 2CZ6B 3TEEA 5CK9A 2L2PA 5GMKe 4X1VA 2QEXA 2E65A 1HK9A 1I1JA 1B3QA 3G4SQ 4PJOB 3I9QA 2K3YA 2L3RA 2HAXA 2OX7A 4A54A 1UGPB 4LDWA 4QT7A 3QYHB 4MDWA 2NUTB 2DK3A 4IUQA 4LUEA 3JRZA 4RUGA 3C12A 3JCMJ 3H0IA 1J3TA 1M30A 3A8LB 4BDYA 3TU4K 1PKTA 3HRSA 4JLGA 3D7SB 2LCCA 4M7DE 3CCLQ 1W6XA 1XJWB 2E10A 1ZSZB 2QA4T 4AG2C 4MZTA 3OYCA 3CC2A 1XNIA 4P5NA 1SEMA 1W4SA 5KE2A 4C92A 4Z8AA 1Y71A 1M1KC 4M7AC 2PVGB 1Y07A 3VS0A 2M51A 1KC8R 3OYFA 2KNBB 4J9HA 2HCKA 2DD5A 2OJ2A 2AZSA 2RI3A 4C5HA 3PTAA 1T3SA 5CKFA 1BCOA 3OYYA 2E64A 3QZ9B 1YJ9Q 5KYUB 4FU6A 2DXTA 4OB2B 5GANg 3OYGA 2V26A 4F17A 1AWWA 1I5OB 5D6XA 3BW1A 2GBQA 2ENMA 2YUQA 1B34A 4PJOF 1WGSA 1EX4A 4PJMA 3H6ZA 3JCMW 2P0QA 2CP3A 3ZL7C 2V8KA 3O5ZA 4C5IA 1VQKT 3MPUB 1KQ2A 1OULA 3PMIA 1MMAA 1KC8U 5HK0A 3JCMc 3GP8A 4C8QD 2ED1A 4OVAA 3CBOA 4EMHA 2NUPB 3SFMA 2EBPA 3CCEQ 3E1SA 2JOYA 2ZPGB 4DEYA 1YWOA 5GAN7 5C0MA 4M7DB 3QKJA 3VUBA 4UC4A 1VQ7A 4R0KA 1WA7A 1VQNT 4J83A 5IT9E 1M8MA 1D09B 3VV0A 1K9AA 1X6OA 1JXOA 2LVMA 4A4EA 1C6VX 4MMKA 5I2MA 1VIFA 1PCXA 2ED0A 1VQOT 3CCJQ 1QCFA 3URGA 1KQ1A 2AKKA 3CCMQ 3SB2A 1U3OA 4JRKA 4XTUA 3NPFA 3OYHA 4E47A 1N8RC 2M1HA 4HVVA 1WXTA 2VWFA 5HY6A 4FYVB 2JZ2A 1BYMA 2MWPA 2DMOA 1KG1A 3CEYA 3G1JA 3C95A 5IN1A 2G6FX 2QGFB 1OU9A 4J9IA 1M90R 3CCVA 4M7AF 4JJCA 1MMNA 3SWNB 1K8AC 2JMAA 2RH2A 5KYUA 3RR6A 4XTXA 1WFWA 1T0JA 3R6NA 1WX6A 2LQKA 2DXCA 4C8QE 2OTLQ 3OMCA 2XDPA 2CP0A 4LDUA 1C1AA 1PD1A 1ZHIA 3J80E 1E6HA 3KFVA 4ZTJA 5IH2A 5FRNA 5D6WA 3L2WA 1KD1R 9ATCB 3I55Q 3FB9A 1OZ2A 1UJYA 2QYZA 1G3YA 2K4YA 1VQ8A 2ZPIB 4HA8A 4M7DA 2FL7A 1WIEA 3GNFB 3M4YA 1VOMA 2RB6A 1JBMA 4C92G 1YI2A 3H0FA 3TVTA 4EMKC 2RJCA 1G3WA 1O9SA 4OMLA 2KT1A 2LQ8A 5D7UA 4JZ4A 4IUVA 1GRIA 3CD6A 2YLBA 2DILA 3JCMe 3S3NA 4QQ6A 2L89A 1KD1U 1KSWA 3ULRB 4OMOA 5FU7C 2KE9A 5KYXA 3A5ZB 4RG8A 2CT4A 1Z9ZA 4F04B 2V1QA 1D0XA 2KRSA 4RKUE 1K9MU 5C6SA 3CBPA 1V29B 1K4US 3SWNA 4E7HA 3JB9F 4OB1B 3CC2Q 3QJ6A 2FZCB 1N6AA 3QUIA 1U06A 1RADB 4FYYB 3JB9H 4DBHA 1UGVA 3LYIA 1ABQA 1VQMA 3UA7A 1VIEA 1RI0A 4X34A 4PK4A 3TSWA 4CRIA 4N0AA 4XK8E 3P8BB 2QTXA 3PIPA 4M78G 4O5VA 3OW2A 2RPNA 3QWYA 1UUEA 2O88A 2LZ6B 1UGRB 4KGVB 3CCLT 1H92A 5GAMd 3NTIA 1KHIA 2ATCB 1ZBXA 3L2RA 4C5GA 5ECAA 2DJQA 5LL6S 2HSEB 2BZYA 1ZX6A 2F2WA 1YHQT 5KYWB 3H9NA 1ACMB 4HCCA 3SEMA 3HSBA 3KXTA 1Y96B 1YJ9T 2RI5A 1YP5A 1NPRA 2Y4YA 2K5IA 2VASA 3EH2A 4M77D 4XAXB 1VQ7Q 2A36A 3FIFA 3VUZA 2FEIA 1OZ3A 1V1CA 2E4HA 1GFCA 3A1PA 1Q81R 3E9GA 3JSCA 1UHCA 1SG5A 4QQDA 3G4SA 5FWCA 1PRLC 4AFSC 2KGTA 2LJ0A 4FIBA 4C8QA 4O6JA 5CCAA 2B86A 1K73C 2EAYA 2LX9A 2DJZA 1YWPA 4ATOA 1MUZA 2CP6A 4OP0A 1Q86R 3CCET 3DB3A 1M1GA 3M0PA 5DLOA 1GCQA 2BZXA 3DKMA 3FEOA 2R5MA 3M0QA 1I0CA 1Q81U 1UG1A 5IHKA 5AT1B 1N5ZA 4OF1A 4XU0A 3HP9A 4ZN3A 4AG1C 1WJRA 3RUXA 2F2XA 2RO0A 3QPHA 1VYVA 1NJIR 4BUGA 1OOTA 3PGGA 3CCMT 2K2VA 4GY5A 3EGUA 3ZBDA 1Q86U 2YUOA 4PLLA 1N27A 2R5AA 2GQIA 4M77E 1ZUYA 4XTVA 1MV3A 1QMCA 1ZLMA 2M02A 1TTHB 2OTJA 2DVEA 4BD3A 3LGLA 2DXBA 4A4KA 2J6OA 1Y96A 3CQTA 5FU6C 2F2VA 3EHRA 5GMKi 5GAN3 3A8MB 1VYUA 1RI9A 1CSKA 2HMAA 3BDUA 1NJIU 4KGXB 2QG9B 4KRTA 1YI2Q 5GANh 2OI3A 4CC3A 1O75A 3I56Q 1UGSB 1JJ2S 2DEQA 2HL3A 3MEVA 2DERA 3CCUQ 5FROA 1I8FA 1E6GA 1PM3A 1WLPB 1B07A 1G5VA 2ROLA 2L3QA 1G8XA 2RQRA 3CCST 4HXJA 2X4YA 2LMJA 1AZGB 3HPWA 5EC7A 3VS5A 3DLLA 1TU0B 3M9QA 2QEXT 2RJDA 2HQHA 4M7AD 2Y4XA 5FWBA 3CCJA 5HCKA 2D0QB 4AMCA 3QYGB 1RL2A 4M75B 5GANf 3REAB 1JJ2P 5GANj 2PTKA 4M77B 4KT0E 3OYDA 5GAOn 5J3BA 1QVGS 4F16A 2VVKA 1ABOA 4D8DA 5GAOp 4QW2A 1AVZC 1XQHA 3MJXA 3VRZA 4BI4A 4MDXA 2CP2A 4C92C 4JJNK 1SF9A 3RBBB 2XG8D 5LJ5g 3PIOA 3EG9B 3TCJA 1Q7YU 3CXCS 1WQ7A 4II1A 3FJPA 4KH0B 1MGQA 1D0YA 2O2OA 2X3WD 3VS3A 1X27A 3VS4A 3CC2T 1VQLA 2WSFE 4IURA 1G3SA 4C8QG 4D6WA 2H3JA 2JS0A 3M54A 2HBPA 1CKAA 2VGMA 3JB9J 2EGAA 2OAUA 2AT1B 1QVPA 2ZZDA 1FYNA 5CKDA 3GOXA 1S72T 1QVGP 2YUPA 1D3BA 5D6YA 4E7LA 2RF0A 1H8KA 3M5AA 3CMAQ 4R55A 4ESRA 3ZEHA 3MP8A 5L8RE 4DOVA 1OPLA 2LCSA 2CP7A 5GAN8 4M7AE 3CXCP 3M53A 2EJGA 2GNCA 2K2MA 1PC0A 3E2UA 4M75F 5FLXE 1QKWA 2L3PA 4M77F 4M78C 2HSPA 2G3RA
chains in the Genus database with same CATH topology
3CEYA 2DZ9A 3M55A 3C95A 5IN1A 3JB9D 4GLKA 4FT2A 5A0DA 1LNXA 3QIIA 3VYHB 4F7UE 3CCVA 4M7AF 1JB0E 2I2LA 4Y28E 1SSFA 2DD4A 3SWNB 2MAMA 1K8AU 3QBYA 1K8AC 4IUUA 4OMFB 1VQ5T 2HD0A 5GAOr 2FB7A 2WACA 2RHXA 3E9FA 2RH2A 2RK1A 3I55T 3QJYA 1VQ7T 3CPWS 2GF7A 3OYIA 4XTXA 1BI3A 3KBGA 3L2QA 3L2UA 2XHCA 2E1HA 3HRUA 3CCRT 3JCMd 2LQKA 4VUBA 2DXCA 4B9XA 1WNLA 2PUOB 3PMTA 4J7IA 1BI2A 3N5BB 3OMCA 4C8QE 1YJNT 2KY9A 3OMGA 2XDPA 2M16A 4JS5A 3M59A 4LDUA 3H8ZA 2EQKA 5M9OA 3OS5A 4F7UF 2LTOA 3E19A 4PNOA 3MEAA 1KQSS 2YRVA 4M7AG 1HXDA 3OY9A 1ZHIA 3BY7A 4EMKA 4OGEA 3J80E 3OYNA 1IREB 4PLIA 3V7CA 3LWIA 4ZTJA 3HFNA 1OI1A 5FRNA 5D6WA 3L2WA 3FB9A 1OZ2A 3UDCA 1M5Q1 2CGHA 3CC7T 3OS2A 3V8KA 2KVQG 4A4GA 1M4ZA 1G3YA 3UPUA 2K4YA 2XI9A 4IUPA 4C8QF 1VQ8A 4A4HA 4BE2A 3CCVT 2EQJA 4FL6A 2GFAA 4J6WA 4M7AB 1I4K1 2XD0A 2KDSA 2ZPIB 4HA8A 4M7DA 2BUDA 4L59A 2EJ9A 2FL7A 2QQBA 4F7UG 1XOVA 3WXMB 1AHJB 3GNFB 1Y7XA 3LLRA 3M4YA 2QQAA 4N4GA 4RCCA 2EIFA 2RB6A 1JBMA 4C92G 5GAN2 3J7AF 1UB4A 2ZPHB 2RM4A 3OBWA 3AHUA 1YI2A 2FYKA 4EMKC 2A7YA 2RJCA 3BFMA 1G3WA 4C5EA 1WJSA 5DM7R 1O9SA 3PT9A 1QVFA 2LQ8A 4MZMA 4IUVA 1YBYA 4M78E 3CD6A 2YLBA 1YIJA 1KC8C 4J7FA 4OB0B 2CZ0B 3JCMe 3VKIA 4PJOA 3S3NA 4QQ6A 2VYTA 2L89A 3G71A 2RD1A 4F7UB 5DY9A 1KD1U 2HNIA 2O01E 1H3ZA 3OYBA 3LH0A 3OYMA 5FU7C 4C92B 5CKBA 3C94A 4Q5WA 4EPCA 4XQ3A 3A5ZB 2K57A 4J5YA 4E7JA 1YITA 2ZGWA 2DXUA 2LT1A 4WF2A 3RESA 4RG8A 4ZGJB 4ZN1A 5CVIA 4M7DC 2F69A 3X28B 2LRQA 3CCLA 3P8DA 1UGQB 4RKUE 3L2ZA 3M56A 1K9MU 5C6SA 1K9MC 3J81E 3CBPA 4M78F 4RG2A 4ELYC 2M9UA 3WVEB 3OS1A 1VQ8T 2ZPEB 1BIAA 1V29B 4C0DC 3ME9A 2E70A 4IUTA 3SWNA 4E7HA 3JB9F 4LDVA 4OB1B 3F70A 2YLCA 3QJ6A 1N6AA 4KULA 2PVOB 1VQ9A 3QUIA 4NL3A 2QDYB 4N4IA 2LDMA 4HKEA 4PJOC 2DKGA 5DLQE 1YHQA 4PJOD 3SDZA 3JB9H 4C0GA 1N9RA 3JB9I 3INZA 3LYIA 3PNWC 5J26A 2VV5A 1YI2T 1X01A 3QSUA 3JCMh 1VQMA 4BI3A 1B34B 4CI0C 1YJ9A 2EKOA 4BI8B 3S3MA 1R8OB 1VIEA 1X75C 5GMKl 1RI0A 3QO3A 3MEWA 4X34A 3RKWA 2F5TX 4ELZC 4DA4A 4CRIA 3CBMA 1VQPA 1WPYA 2E6ZA 3CD6T 1YIJT 1VQLT 4N0AA 4HCZA 4XK8E 3JCMV 3P8BB 2QTXA 4NL2A 3PIPA 2MF2A 2EYQA 4M78G 4O5VA 2XDDA 2JVVA 2B8AA 5CIUA 1N9SA 3G71T 2YHTA 3ER0A 3OW2A 3JB9G 4TVRA 2QI2A 4YTLA 3X26B 2BKDN 5FU6B 3SWNC 2O4XA 2KSSA 4M75A 1YITT 3CC4A 1UGRB 4C92E 4M77A 3CCLT 4IKFA 2MMPA 3GNGA 4QQGA 2RK2A 2L5QA 3L2VA 5GAMd 2WSCE 4XTWA 3LWHA 3NTIA 2V8JA 1KHIA 1D3BB 4C0FA 2L8DA 4M78B 3P8HA 2JNGA 3L1AA 1ZBXA 2RHIA 1UEBA 3EFSA 3R6OA 4E7KA 4M7AA 3L2RA 4C5GA 4FT4A 3NTHA 1LJOA 2DIGA 5LL6S 4B9WA 4N0AC 3HKSA 3VJPA 5GAN6 3CCEA 3MO8A 1VQ4A 1VQ9T 2DZCA 5CO7A 4C0ZA 2QQRA 4JS4A 1YHQT 3LX7A 3JCMf 2DTHA 4HCCA 4C92F 3OSSC 2XU8A 4LDYA 3SD4A 3HSBA 3KXTA 1VQMT 1Y96B 2XIDA 4M75C 1YJ9T 2RI5A 1NPRA 2IG0A 3OBYA 2Y4YA 3X20B 1M90U 1M90C 4M77C 2K5IA 1VQKA 5GMKm 4M77D 1IZ6A 1VQPT 4J6YA 2ZPBB 4Y91A 1OYXA 4XAXB 1JJ2A 3GLXA 1WQWA 2NLUA 3FIFA 3VUZA 4F7UA 3JCMg 2WSEE 1W2BA 1OZ3A 3E9GA 1TH7A 4NS5A 4Z02A 3V8JA 2LC4A 3JSCA 1M1KU 1QVFS 3G6EA 5CQXA 4J8OA 5GANd 4QQDA 1FWZA 3DB4A 4ZTFA 3G4SA 3CC4T 3HFOA 4NOYA 4JRQA 4PJOE 2LNVA 5EG2A 1S72A 3CCMA 2JTFA 3X25B 5LJ5d 2X4WA 3JCMb 2X4JA 3QHSA 1EIFA 3QG1A 4QVDA 1Q82U 2ZPFB 5AYFA 4QVZA 4FIBA 4C8QA 4O6JA 5CCAA 2BIVA 1FXXA 2RHZA 5GAMe 3META 2E5QA 1K73U 2PU9B 2EAYA 2LX9A 2DJZA 3I56A 3MEUA 1K73C 1KQSA 2RHYA 4PL6A 2DO3A 3QXEB 3T9NA 4ATOA 4OP0A 2AHJB 3CCET 2MWOA 1M1GA 3DB3A 5DLOA 5GAOq 3CCUA 1VQ4T 5LJ3d 4BY6C 2JTMA 1WJQA 2E6NA 3DKMA 3PFSA 1KD1C 3G7ZA 1H641 2R58A 3FEOA 3L42A 4DQ2A 5IAYA 2R5MA 2R57A 3MP6A 5KE3A 3FLGA 5A2QE 3RERA 2RJFA 1Q81U 4V2SA 1BI0A 5GAN5 3OYEA 3FC3A 1QVGA 2KQWA 4M7DD 3ASKA 2P0KA 1U8RA 3M4GA 4OF1A 2EWNA 3M58A 4XU0A 3HP9A 4ZN3A 1KHCA 1WJRA 3HL8A 2OTLA 3JAME 1LOJA 4C8QC 4BDZA 4XU3A 4XTYA 3RUXA 1MHNA 2RO0A 3GF5A 3QPHA 4KUIA 1VQ6A 3DLMA 2DTOA 5LJ3g 2FVUA 3G6ET 2QXFA 4BUGA 3FDRA 4RMOA 3G4ST 2RI2A 3PGGA 5A0LA 3VU3C 5I21A 1BIBA 2Y90A 3MHXA 5FU7B 4XTZA 2X35A 3X24B 5GANe 5GAMh 1M1FA 3CCMT 3CXCA 2K2VA 4GY5A 3LGFA 4JUVA 2LT4A 3ZBDA 3OW2S 1Q86U 4PJOG 5KCHA 3JCMQ 4PLLA 1N27A 2R5AA 4M78A 2A3LA 3CCSA 3I55A 5I2SA 4X9DA 4BE1A 2CYZB 5LJ5e 5CQYA 4R56A 2P4TA 3RMQA 4M77E 4XU1A 3OYJA 2VXEA 3I56T 3V8LA 4XTVA 3CMEA 2RJEA 4C0DB 2EQMA 3GPLA 5FRMA 2CZ6B 2QA4A 3CCUT 2XICA 3TEEA 5CK9A 2OTJA 5GMKe 2DVEA 2QQ9A 2QEXA 3UWNA 4BD3A 2E65A 3LGLA 2DXBA 1HK9A 5CKHA 4A4KA 5LJ3e 1Y96A 5FU6C 4PJOB 4HT8A 2GCXA 2K3YA 4X9CA 5GMKi 2L3RA 5GAN3 3A8MB 2HAXA 4XU2A 4A54A 1UGPB 2EFIA 4LDWA 2DAQA 3VYGA 3BDUA 1NJIU 2P0PA 3QYHB 3OSVA 4MDWA 1N8RU 2DPPB 4BE0A 2DK3A 5HKCA 4IUQA 2JUFA 4L6V5 2PQWA 4N4HA 3JRZA 5GANh 2MI6A 2VUBA 1ZQ1A 1O75A 1VQ6T 3C12A 3JCMJ 4L5GA 3WVDB 1FX7A 1UGSB 2EQUA 5GAMf 3A8LB 4BDYA 2K3XA 2DEQA 2XK0A 3MEVA 3TU4K 5GAMj 1JJ2S 1QW1A 2DIQA 5LJ5h 2LCLA 1U1SA 5FROA 1I8FA 2K5FA 1W2BS 3HRSA 3RKXA 4JLGA 1JRIA 3CPFA 2FHDA 2VGNA 1G5VA 4JRIA 3JCMX 3CCST 3OYKA 2X4YA 2LCCA 5GMKh 4M7DE 3OYLA 5GAMg 2XDBA 4M75D 3NTKA 3HPWA 5KH6A 4M75G 4ME7A 5LJ3h 1M8VA 2E10A 3CMAA 2GQVA 3RIRA 2EJFA 3CMET 4M77G 3DLLA 2QA4T 3A8HB 2RHUA 4MZTA 3OYCA 3CC2A 2OTJT 1XNIA 3M9QA 2CZ7B 4P5NA 1W4SA 3RMSA 5KE2A 2QEXT 5CAIA 4LD6A 4C92A 5KCOA 4KUDK 2E41A 3BDLA 1Y71A 2RJDA 1M1KC 2JN0A 4M7AC 5CKEA 2PVGB 4J6XA 4M7AD 1NPPA 2Y4XA 1Y07A 3JCMP 3CPWA 4PKCC 3CCJA 3KUFA 4JLIA 4RCBA 2IVWA 2PUKB 3OYFA 2D0QB 3EFRA 2DD5A 3QYGB 2O4XB 1RL2A 2D9TA 2F5KA 2PVDB 4FSXA 4M75B 5GANf 2RI3A 3PTAA 4C5HA 4JRPA 5CKFA 1Q82C 3CCQA 5GANj 4M7DF 4M77B 3UT1A 2D6FA 4KT0E 3OYYA 5GAN4 3OYDA 5GAOn 2E64A 4E7IA 3QZ9B 3HHTB 3HRTA 1YCYA 5J3BA 1QVGS 1VQNA 4JDSA 5LJ5f 4A4FA 2K5LA 2E12A 4FU6A 2KMTA 3V7SA 2C06A 2DXTA 5LJ5j 5GAOp 1I5LA 2HQEA 4QW2A 4OB2B 3EAEA 1YJWA 1XQHA 2CKKA 5GANg 3OYGA 1BYMA 2CS7A 4LD9K 1PSFA 3S3OA 5D6XA 4BI4A 1QP2A 4MDXA 4ZGDB 4C92C 2KAFA 3NFCA 4JJNK 3BW1A 4C92D 1VUBA 3OA6A 1B34A 5GMKj 4PJOF 1WGSA 2XG8D 4MZPA 1VQOA 3QZ5B 1Q81C 5LJ5g 3M57A 5LJ3f 3H6ZA 5GAOl 3PIOA 3JCMW 2P0QA 3TREA 5LJ3j 4C5IA 2V8KA 3OYAA 3TCJA 1Q7YU 1Q7YC 4EMKB 1VQKT 1KQ2A 3CXCS 1WQ7A 4II1A 3FJPA 3CMAT 1MGQA 3PMIA 4M7DG 3MP1A 3QDRB 1KC8U 5HK0A 3CC2T 2X4XA 3JCMc 1NE8A 3GP8A 1VQLA 4LDXA 4C8QD 2WSFE 4IURA 4OVAA 1G3SA 3RKYA 3CBOA 3MCAB 2KK4A 4C8QG 4EMHA 4D6WA 2H3JA 4ZGEB 3M54A 4BY6B 2HBPA 2M0OA 4QVCA 2VGMA 3SFMA 3CCJT 2QQSA 3JB9J 2OAUA 3E1SA 2XKOC 4BACA 2HQXA 4HT9A 1QVPA 2ZZDA 2JOYA 2ZPGB 1BI1A 2DTIA 5CKDA 3GOXA 1S72T 4MMLA 5GAN7 4A53A 5C0MA 3LW5E 1VQ5A 1Q86C 4M7DB 1M9SA 1D3BA 3FRNA 3QKJA 1QP3A 5D6YA 3VUBA 1XTDA 4EDUA 3CCQT 4UC4A 3GIBA 4EMGA 3A8OB 4M75E 4E7LA 1VQ7A 2VC8A 3S6WA 3V7RA 1VQNT 4FM4B 4J83A 5IT9E 4C8QB 1BKBA 2RA2A 3M5AA 4OB3B 3VV0A 3CCRA 4KBMB 1X6OA 3OB9A 4R55A 1GXIE 1PSEA 2LVMA 3ZEHA 1G3TA 4A4EA 3C4SA 3MP8A 2V8IA 5L8RE 3ZFJA 4DOVA 1YJNA 4DOWA 1YJWT 1I81A 4MMKA 5A0GA 5GAN8 5I2MA 1VIFA 4M7AE 4HCBA 5CR2A 5HK3A 1VQOT 2ZCFB 2CZ1B 2VXFA 1NZ9A 4OGCA 3URGA 3OS0A 2GFUA 5GAOm 3M53A 1KQ1A 2EJGA 3SB2A 4JRKA 4XTUA 1U1TA 4BB7A 1NJIC 3OYHA 4M75F 1P92A 3Q1JA 5FLXE 4E47A 1N8RC 2M1HA 3O8VA 3A8GB 1DJ7B 2OTLT 4M77F 4M78C 4M78D 3OQ5A 5HY6A 2JZ2A 3CC7A 2MWPA 2G3RA 1KG1A 5J39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIA A;  4OP0 A;  2DZ9 A;  3JB9 D;  5GAO q;  3SWN A;  1LNX A;  3JB9 F;  5LJ3 d;  4C92 A;  5CAI A;  2E41 A;  2YLC A;  2JN0 A;  4M7A C;  4J6X A;  4F7U E;  3QUI A;  4M7A D;  4NL3 A;  1H64 1;  4M7A F;  3JCM P;  4DQ2 A;  2I2L A;  4PJO C;  4JLI A;  4RCB A;  3SWN B;  2DKG A;  4PJO D;  3JB9 H;  3RER A;  3EFR A;  4V2S A;  1N9R A;  5GAO r;  2FB7 A;  3JB9 I;  3INZ A;  5GAN 5;  1X01 A;  3QSU A;  4M75 B;  3JCM h;  5GAN f;  4M7D D;  1B34 B;  4M7D F;  4XTX A;  5GAN j;  3M4G A;  4M77 B;  2EWN A;  5GAN 4;  5GAO n;  4XU0 A;  2E64 A;  5GMK l;  3QO3 A;  3RKW A;  2E1H A;  1WPY A;  1YCY A;  1LOJ A;  4C8Q C;  4N0A A;  3JCM d;  5LJ5 f;  4XU3 A;  3JCM V;  4XTY A;  1WNL A;  2QTX A;  4NL2 A;  3RUX A;  3V7S A;  4C8Q E;  2DXT A;  5LJ5 j;  4M78 G;  5GAO p;  1I5L A;  2DTO A;  5LJ3 g;  1N9S A;  2YHT A;  5GAN g;  3PGG A;  3JB9 G;  3VU3 C;  5I21 A;  1BIB A;  2Y90 A;  4F7U F;  4XTZ A;  4PNO A;  3SWN C;  5GAN e;  5GAM h;  4C92 C;  4M75 A;  3BW1 A;  4C92 D;  4M7A G;  1HXD A;  3BY7 A;  1B34 A;  4JUV A;  4PJO F;  4C92 E;  4EMK A;  5GMK j;  4M77 A;  3V7C A;  4PJO G;  5LJ5 g;  5LJ3 f;  3JCM Q;  5GAO l;  4M78 A;  3JCM W;  5LJ3 j;  5GAM d;  3HFN A;  4X9D A;  4XTW A;  5LJ5 e;  4EMK B;  1KQ2 A;  1WQ7 A;  3FB9 A;  3FJP A;  4M77 E;  1D3B B;  1MGQ A;  4XU1 A;  4M7D G;  2VXE A;  4M78 B;  1M5Q 1;  2CGH A;  3V8L A;  4XTV A;  3L1A A;  3EFS A;  3V8K A;  3JCM c;  4M7A A;  4C8Q D;  4C8Q F;  3RKY A;  4C8Q G;  2DVE A;  4EMH A;  1LJO A;  5GAN 6;  5GMK e;  4N0A C;  4J6W A;  4M7A B;  4QVC A;  2E65 A;  2DZC A;  1I4K 1;  1HK9 A;  4HA8 A;  5LJ3 e;  3JB9 J;  1Y96 A;  4HT9 A;  4M7D A;  4PJO B;  4HT8 A;  3JCM f;  2DTH A;  2DTI A;  2EJ9 A;  4X9C A;  4F7U G;  5GMK i;  5GAN 3;  4MML A;  5GAN 7;  4XU2 A;  4A53 A;  4RCC A;  4C92 F;  4A54 A;  2RB6 A;  3HSB A;  1JBM A;  4C92 G;  5GAN 2;  1Y96 B;  4M7D B;  1D3B A;  3BDU A;  2RM4 A;  4M75 C;  3AHU A;  3GIB A;  2FYK A;  4EMG A;  4EMK C;  3BFM A;  4M75 E;  4M77 C;  5GMK m;  4M77 D;  2VC8 A;  3V7R A;  4J6Y A;  4Y91 A;  5GAN h;  1WQW A;  3FIF A;  4C8Q B;  2RA2 A;  4M78 E;  4F7U A;  3JCM g;  2YLB A;  3JCM J;  1TH7 A;  3JCM e;  5GAM f;  4PJO A;  3V8J A;  2DEQ A;  5GAM j;  1I81 A;  5GAN d;  2RD1 A;  4MMK A;  5DY9 A;  4F7U B;  5LJ5 h;  5GAN 8;  1U1S A;  2HNI A;  4M7A E;  1I8F A;  3HFO A;  4NOY A;  4C92 B;  3RKX A;  4PJO E;  4XQ3 A;  1JRI A;  2K57 A;  4J5Y A;  2ZGW A;  2DXU A;  3RES A;  4WF2 A;  2VXF A;  4JRI A;  5LJ5 d;  3JCM X;  3JCM b;  5GAO m;  4M7D C;  3QHS A;  1KQ1 A;  2EJG A;  4QVD A;  5GMK h;  4M7D E;  3SB2 A;  4JRK A;  4XTU A;  1U1T A;  4C8Q A;  4M75 D;  5GAM g;  4M75 F;  4M75 G;  5LJ3 h;  5GAM e;  1M8V A;  3L2Z A;  4M77 F;  2E10 A;  4M78 C;  3RIR A;  2EJF A;  2EAY A;  4M78 D;  2DJZ A;  4M77 G;  4M78 F; 
#chains in the Genus database with same CATH topology
 3M55 A;  3JB9 D;  5A0D A;  1SRL A;  1JB0 E;  1K1Z A;  2I2L A;  1SSF A;  4OMF B;  2RK1 A;  1WI7 A;  3NHN A;  1VQ7 T;  2GF7 A;  1BI3 A;  3HRU A;  2E1H A;  3JCM d;  4VUB A;  1TWB A;  2KY9 A;  3H8Z A;  5M9O A;  2LTO A;  4FCY A;  4PNO A;  3OY9 A;  4OGE A;  1PKS A;  3V7C A;  4JJD A;  1VQ5 Q;  3HFN A;  1EZZ B;  2KRM A;  1TUG B;  2DYB A;  3V8K A;  4OMN A;  4A4G A;  2XI9 A;  4IUP A;  2LP5 A;  2FPD A;  3CCV T;  2EQJ A;  4FL6 A;  1RAF B;  4J6W A;  4M7A B;  1YJN Q;  2OTJ Q;  2XD0 A;  2BUD A;  4L59 A;  2EJ9 A;  4F7U G;  2QQB A;  1Y7X A;  1QCO A;  5GAN 2;  3J7A F;  1UB4 A;  2ZPH B;  3AHU A;  3OBW A;  4IIO A;  5I22 A;  1R0B G;  3H41 A;  4C5E A;  1HYO A;  4MZM A;  1YBY A;  1YIJ A;  3A98 A;  4OB0 B;  1B7T A;  2CZ0 B;  3CC7 Q;  2BZ8 A;  2ROT A;  2YSQ A;  3VKI A;  4PJO A;  2VYT A;  1WHK A;  5DY9 A;  2O01 E;  1H3Z A;  3LH0 A;  3C94 A;  4EPC A;  4XQ3 A;  2ZGW A;  2NUT A;  5CVI A;  4M7D C;  3X28 B;  1GL5 A;  1TUD A;  2EYZ A;  1IHW A;  1UJ0 A;  1K9M C;  4M78 F;  4RG2 A;  4ELY C;  3WVE B;  1VQ8 T;  2ZPE B;  1BIA A;  4C0D C;  3ME9 A;  4IUT A;  2RN8 A;  4LDV A;  3F70 A;  3SHW A;  2YLC A;  2PVO B;  4N4I A;  2DKG A;  2HDA A;  2PNI A;  1NEB A;  1N9R A;  3JB9 I;  3INZ A;  2VV5 A;  1YI2 T;  1X01 A;  2DRK A;  4BI3 A;  4CI0 C;  1RAI B;  3S3M A;  1ZSZ A;  1R8O B;  3RKW A;  3CBM A;  1BBZ A;  1WPY A;  2E6Z A;  3CD6 T;  2DVJ A;  3JCM V;  4NL2 A;  5CIU A;  4OMP A;  3SWN C;  2RQV A;  1FMV A;  4QQG A;  2RK2 A;  1M27 C;  1M1K R;  2V8J A;  2Z0W A;  1AWJ A;  3EFS A;  2NWM A;  4M7A A;  4E7K A;  1KK7 A;  1HSQ A;  2MIO A;  1VQL Q;  1TUC A;  3EGD B;  2DIG A;  4B9W A;  4PJJ A;  4N0A C;  3HKS A;  1VQ4 A;  1OX9 A;  2FZK B;  3G71 Q;  2DTH A;  1C0M A;  2GGR A;  1YIT Q;  2YDL A;  1VQM T;  2XID A;  2EYY A;  3X20 B;  1M90 U;  1VQK A;  2K3B A;  4J6Y A;  2ZPB B;  3GLX A;  1NYG A;  2LQN A;  1EFN A;  1W2B A;  2NUP A;  2LC4 A;  1M1K U;  5CQX A;  3DB4 A;  4RTV A;  2K7A A;  3HFO A;  2HL5 C;  3THK A;  1SHG A;  1WHG A;  3X25 B;  1EIF A;  4QVZ A;  2RNA A;  4KGZ B;  1SSH A;  2LJ3 A;  2IPO B;  2RHZ A;  4F14 A;  1KJW A;  2J06 A;  2E5Q A;  2PU9 B;  3I56 A;  2RHY A;  1VQP Q;  6AT1 B;  2AHJ B;  5GAO q;  3TQ7 P;  3CCU A;  2CSQ A;  1BK2 A;  2ABL A;  4BY6 C;  2JTM A;  3PFS A;  3G7Z A;  1H64 1;  4LE9 A;  4DBQ A;  3L42 A;  2R57 A;  3MP6 A;  2FG0 A;  2EPD A;  5A2Q E;  1T0H A;  2RJF A;  4V2S A;  4J9C A;  1BI0 A;  3FC3 A;  1UE9 A;  3ASK A;  1U8R A;  2EGC A;  1K0S A;  1F1B B;  3M58 A;  2H3E B;  3HL8 A;  3JAM E;  4C8Q C;  1RAB B;  4XU3 A;  3GF5 A;  1R77 A;  2DLP A;  4KUI A;  1VQ6 A;  4RMO A;  3G4S T;  7AT1 B;  1N8R R;  2YUN A;  4ANJ A;  1UTI A;  5FU7 B;  2X35 A;  3X24 B;  5GAN e;  2C0T A;  3LGF A;  1AWO A;  3OW2 S;  4PJO G;  5KCH A;  1FMW A;  5I2S A;  2KR3 A;  2CYZ B;  1ARK A;  2P4T A;  1G2B A;  2VXE A;  3V8L A;  1RAH B;  1K8A R;  3TSZ A;  3CME A;  5FRM A;  2DL3 A;  1OPK A;  2CT3 A;  1QWF A;  2K6D A;  3UWN A;  4E6R A;  3GBQ A;  2D0N A;  4HT8 A;  4E7S A;  4X9C A;  1I07 A;  1NBE B;  4XU2 A;  2EFI A;  2QAZ A;  2P0P A;  1D1C A;  1N8R U;  3PE0 A;  3EG0 A;  3NGP A;  2PZ1 A;  4LXC A;  1ZQ1 A;  2XMF A;  4L5G A;  3WVD B;  1FX7 A;  2K3X A;  2XK0 A;  1YIJ Q;  2ECZ A;  1QW1 A;  2DIQ A;  5LJ5 h;  2NUZ A;  4LUD A;  1WDX A;  2FHD A;  1X2Q A;  4D8K A;  2O9S A;  1WZO A;  2SEM A;  3EG2 A;  5GAM g;  4M75 D;  2JT4 A;  3NTK A;  5KH6 A;  1W1F A;  4ME7 A;  5LJ3 h;  1PNJ A;  3CMA A;  1SKU B;  2EJF A;  3A8H B;  2RHU A;  2OTJ T;  2CZ7 B;  3RMS A;  3REB B;  4KUD K;  5KCO A;  4K11 A;  1GCP A;  1ZUK A;  1LPL A;  4RTU A;  3CPW A;  3JCM P;  2PUK B;  5GJW B;  4DBR A;  3EFR A;  5L23 A;  3EG3 A;  2O4X B;  2PVD B;  4FSX A;  4JRP A;  1JU5 C;  1Q82 C;  3CCQ A;  1K76 A;  3UT1 A;  2D6F A;  2CDT A;  5GAN 4;  4E7I A;  2DL8 A;  1MND A;  3HHT B;  3HRT A;  1YCY A;  1RLQ C;  4JDS A;  5LJ5 f;  3EFO B;  1AZE A;  1MV0 B;  3V7S A;  4JZ3 A;  5LJ5 j;  2C06 A;  1I5L A;  2HQE A;  2NYS A;  2P4R A;  4FSS A;  1YJW A;  1M3A A;  1PSF A;  3S3O A;  1QP2 A;  4ZGD B;  3NFC A;  4C92 D;  1VUB A;  3OA6 A;  4MZP A;  3QZ5 B;  4Z89 A;  3VS2 A;  5LJ3 f;  5GAO l;  2JTE A;  3TRE A;  4CC2 A;  1IXD A;  5LJ3 j;  1YCS B;  2D8J A;  2KBT A;  1OQK A;  1Q7Y C;  2GTJ A;  2EYX A;  4M7D G;  3MKD A;  3MP1 A;  3QDR B;  2X4X A;  4M4Z A;  3RKY A;  1RAA B;  1M2V B;  4QVC A;  1MMD A;  3CCJ T;  2QQS A;  1X2K A;  2XKO C;  1VQ4 Q;  2DTI A;  1Y0M A;  4MML A;  2YT6 A;  1VQ5 A;  3FRN A;  1QP3 A;  3GIB A;  4EMG A;  3A8O B;  4M75 E;  3V7R A;  1VQK Q;  1BKB A;  3CCR A;  4KBM B;  2DL7 A;  3OB9 A;  4OMM A;  2V8I A;  3ZFJ A;  1YJN A;  4DOW A;  1I81 A;  4DBF A;  5KYW A;  5CR2 A;  2MOX A;  1PG5 B;  1D1A A;  2ZCF B;  1NZ9 A;  5GAO m;  3Q1J A;  4J9E A;  3O8V A;  3A8G B;  2OTL T;  1RAG B;  4M78 D;  3OQ5 A;  1VA7 A;  3CC7 A;  1VQN Q;  5J39 A;  2DX1 A;  2DZ9 A;  4Y92 A;  4GLK A;  3QII A;  2DE0 X;  2COY A;  3VYH B;  2E3H A;  1PWT A;  1OV3 A;  4IUU A;  2HD0 A;  2K9G A;  2WAC A;  3E9F A;  3I55 T;  3QJY A;  3OYI A;  2X51 A;  3EFO A;  5IXB A;  4RTZ A;  1ZBJ A;  3L2Q A;  2XHC A;  3AT1 B;  4J7I A;  3PMT A;  1BI2 A;  3N5B B;  2C0I A;  3OMG A;  2M16 A;  1RAC B;  4JS5 A;  3M59 A;  4AFQ C;  1VQ6 Q;  3VS1 A;  2EQK A;  4Z88 A;  2ESW A;  4F7U F;  2FRY A;  3MEA A;  1KQS S;  2YRV A;  4AFU C;  1K73 R;  3BY7 A;  1IRE B;  1D1B A;  1X69 A;  1OI1 A;  1S1N A;  2CGH A;  1M2V A;  2KVQ G;  1M4Z A;  3UPU A;  4RTY A;  3CME Q;  1AWX A;  4BE2 A;  2QAS A;  2GFA A;  1I4K 1;  2KDS A;  1RUW A;  1XOV A;  1MNE A;  3WXM B;  1AHJ B;  3LLR A;  2QQA A;  4RCC A;  1RAE B;  1PD0 A;  1SRM A;  3UF4 A;  1R0C B;  2FYK A;  2A7Y A;  2W10 A;  5DM7 R;  1QVF A;  1GBQ A;  2M0Y A;  1KQS P;  2DFU A;  4M78 E;  2MPX C;  1KC8 C;  2DBM A;  3G71 A;  2RD1 A;  2DYI A;  3OYB A;  2YWW A;  4C92 B;  4E7J A;  2K57 A;  1YIT A;  2DXU A;  2EW3 A;  3RES A;  1IO6 A;  2AKL A;  4ZGJ B;  4ZN1 A;  1M3C A;  2LRQ A;  3RNJ A;  3P8D A;  4QKU A;  2FPF A;  1UGQ B;  3M56 A;  1SPK A;  2M9U A;  1PRM C;  2KYB A;  3OS1 A;  2QK0 A;  2P84 A;  4KUL A;  1VQ9 A;  4NL3 A;  2QDY B;  1QLY A;  2LDM A;  4PJO C;  4PFZ A;  4RTW A;  2L0A A;  3SDZ A;  3EG1 A;  2BTT A;  4C0G A;  3PNW C;  3QSU A;  2EVR A;  1B34 B;  2EKO A;  4BI8 B;  4FYW B;  4FW2 A;  2A37 A;  4ELZ C;  5GMK l;  2F5T X;  4HVW A;  3CCQ Q;  1VQP A;  1YIJ T;  4HCK A;  1QWE A;  2EYQ A;  2B8A A;  3JV3 A;  1N9S A;  2YHT A;  3RDV A;  1YJW Q;  1NG2 A;  3QWX X;  3CC4 A;  4M75 A;  2GTO A;  4KH1 B;  4M77 A;  4FW1 A;  2WSC E;  4XTW A;  4C0F A;  4M78 B;  3P8H A;  2JNG A;  3L1A A;  1ZSZ C;  2FRW A;  3UAT A;  1LJO A;  5GAN 6;  4A63 B;  3MO8 A;  1NLO C;  2DZC A;  2A28 A;  5CO7 A;  2QQR A;  4JS4 A;  1X43 A;  1LCK A;  1AEY A;  3EG9 A;  2IIM A;  4C92 F;  3OSS C;  2JS2 A;  2XU8 A;  4LDY A;  3SD4 A;  3QDF A;  3OBY A;  3UA6 A;  1M90 C;  5GMK m;  1MMG A;  4Y91 A;  2JM8 A;  1OYX A;  2DNU A;  1WQW A;  2NLU A;  3LH5 A;  3JCM g;  2WSE E;  1UFF A;  2DRM A;  3CCR Q;  2F1L A;  1WXU A;  3G6E A;  5GAN d;  4J8O A;  1FWZ A;  4ZTF A;  4NOY A;  5IXF A;  2LNV A;  1S72 A;  1NLP C;  1YHQ Q;  2X4W A;  3JCM b;  2KYM A;  3QG1 A;  4QVD A;  4ZNX A;  5AYF A;  4JJB A;  2BIV A;  1FXX A;  2RQW A;  4J9B A;  2DO3 A;  3QXE B;  3EHQ A;  2W0Z A;  1VQ4 T;  1BCM A;  2E6N A;  1KIK A;  1KD1 C;  5FW9 A;  1TSF A;  8AT1 B;  1QKX A;  3FLG A;  3RER A;  3OYE A;  2KQW A;  3EGX B;  2P0K A;  3H0H A;  2EWN A;  1IHV A;  4BDZ A;  1AOJ A;  1M3B A;  1WXB A;  2DTO A;  1A0N B;  3VU3 C;  5I21 A;  3MHX A;  1X6B A;  5GAM h;  1CKB A;  1SHF A;  2LT4 A;  4B6M A;  1G83 A;  4M78 A;  2A3L A;  1YNZ A;  4X9D A;  4BE1 A;  5LJ5 e;  3RMQ A;  3I56 T;  4C0D B;  2QA4 A;  3CCU T;  2XIC A;  1NM7 A;  1T3L A;  1IRX A;  2QQ9 A;  4GLM A;  2ZAE A;  5CKH A;  5LJ3 e;  2GCX A;  1GBR A;  1TXQ A;  1W70 A;  1WYX A;  3VYG A;  2DAQ A;  5KYX B;  3OSV A;  5KYY B;  2OAW A;  1IGQ A;  2DPP B;  4BE0 A;  2COW A;  5HKC A;  2JUF A;  4L6V 5;  2PQW A;  4N4H A;  2YRC A;  2MI6 A;  2VUB A;  1VQ6 T;  2DET A;  2EQU A;  5GAM f;  5GAM j;  1Z9Q A;  2LCL A;  1U1S A;  2K5F A;  4AFZ C;  1W2B S;  3RKX A;  2FZG B;  1JRI A;  3CPF A;  2VGN A;  4JRI A;  3JCM X;  3OYK A;  3VS6 A;  5GMK h;  3OYL A;  2XDB A;  4WCI A;  1ZUU A;  2HKQ B;  4M75 G;  1M8V A;  2GQV A;  3RIR A;  3CME T;  4M77 G;  4FYX B;  1M2O A;  2JW4 A;  5CAI A;  4LD6 A;  2EGE A;  2E41 A;  3BDL A;  2JN0 A;  5CKE A;  4J6X A;  1NPP A;  4PKC C;  3KUF A;  4JLI A;  4RCB A;  2IVW A;  3EGX A;  1VQ9 Q;  2D9T A;  2F5K A;  2I0N A;  4M7D F;  3CCS Q;  3U23 A;  1W2B P;  1VQN A;  3NMZ C;  2K5L A;  4A4F A;  2E12 A;  2KMT A;  3EAE A;  2AIR B;  2CKK A;  2CS7 A;  4LD9 K;  3M0T A;  2QEX Q;  5I11 A;  4AT1 B;  1K9M R;  2KAF A;  2CUD A;  3VRY A;  5GMK j;  1VQO A;  3CC4 Q;  1Q81 C;  3M57 A;  1HJD A;  3OYA A;  4EMK B;  1TS9 A;  3CMA T;  2LNH B;  4LDX A;  2X3X D;  1NE8 A;  1JQQ A;  4GBQ A;  4OMQ A;  1ZSG A;  3MCA B;  2KK4 A;  4ZGE B;  4BY6 B;  1KFZ A;  2M0O A;  3HTR A;  2CSI A;  3EH1 A;  4HT9 A;  4BAC A;  2HQX A;  1VYT A;  1BI1 A;  5KYY A;  1GCQ C;  5IHN A;  4A53 A;  5KYN A;  2VB6 A;  3LW5 E;  1Q86 C;  1M9S A;  4EDU A;  3CCQ T;  1XTD A;  3M0S A;  4RTX A;  3VS7 A;  2EKH A;  2LX7 A;  2VC8 A;  3S6W A;  4FM4 B;  4C8Q B;  3EGD A;  2RA2 A;  2K79 A;  4OB3 B;  1AT1 B;  1IB8 A;  2D1X A;  1GXI E;  1PSE A;  1G3T A;  1YJW T;  3C4S A;  3M0U A;  5A0G A;  2MYS A;  4HCB A;  5HK3 A;  3G6E Q;  2BE9 B;  1ZA1 B;  2CZ1 B;  2DA9 A;  2J05 A;  2HZY A;  2VXF A;  4OGC A;  3OS0 A;  2GFU A;  4JPB W;  1S72 Q;  2JJ9 A;  1NJI C;  1U1T A;  4BB7 A;  4J9F A;  4LNP A;  1P92 A;  1DJ7 B;  2CH4 W;  1JO8 A;  2E3I A;  4FT2 A;  3OW2 P;  1LNX A;  4J9G A;  1LVK A;  2AK5 A;  4F7U E;  4PJN A;  4Y28 E;  2DD4 A;  3I35 A;  2RQU A;  1RLP C;  2MAM A;  3QBY A;  1K8A U;  1VQ5 T;  2D8H A;  5GAO r;  2FB7 A;  4PFO A;  2HKN A;  2RHX A;  2YXY A;  3CPW S;  3KBG A;  2COZ A;  3L2U A;  3CCR T;  4B9X A;  4PFP A;  1WNL A;  4E7Z A;  2PUO B;  2RQT A;  1YJN T;  2L3S A;  1IGU A;  4RTT A;  3OS5 A;  3E19 A;  1H3H A;  2LJ1 A;  2KI7 A;  4J9D A;  2QGG A;  4M7A G;  1HXD A;  3OYN A;  4EMK A;  2RMO A;  4PLI A;  2MCN A;  4CC7 A;  3LWI A;  4EIK A;  2DL4 A;  4LN2 A;  3UDC A;  1BB9 A;  1M5Q 1;  3CC7 T;  3M0R A;  3OS2 A;  2DBK A;  4CC4 B;  1PHT A;  4C8Q F;  2DM1 A;  4A4H A;  3I5R A;  1FMK A;  2QA4 Q;  3CPW P;  1OU8 A;  1Y57 A;  3PVQ A;  5GJV B;  1HD3 A;  2VKN A;  4N4G A;  2EIF A;  2JM9 A;  1UHF A;  1WHH A;  2RM4 A;  2E5K A;  3BFM A;  1WJS A;  3PT9 A;  3IQL A;  1UEC A;  2V1R A;  4J7F A;  1X6G A;  4F7U B;  2MK5 A;  2CRE A;  2HNI A;  3OYM A;  3CCV Q;  1TG0 A;  5CKB A;  4Q5W A;  4J5Y A;  2LT1 A;  4WF2 A;  2A08 A;  2F69 A;  2CUB A;  3CCL A;  2AZV A;  2DF6 A;  3L2Z A;  3J81 E;  2DL5 A;  2O9V A;  3FJ5 A;  5IHI A;  2E70 A;  2H8H A;  1JXM A;  2FO0 A;  2KRO A;  4HKE A;  4PJO D;  5DLQ E;  1YHQ A;  1WHL A;  2LQW A;  5J26 A;  4ORZ A;  3JCM h;  1YJ9 A;  1X75 C;  3QO3 A;  3MEW A;  2QTV A;  4DA4 A;  1E7O A;  1Q95 G;  1VQL T;  4HCZ A;  2EYW A;  1OX8 A;  2MF2 A;  3I5S A;  2JXB A;  2XDD A;  2JVV A;  3G71 T;  1VQ8 Q;  3ER0 A;  3JB9 G;  4TVR A;  2QI2 A;  4YTL A;  3X26 B;  2BKD N;  5FU6 B;  1YIT T;  2O4X A;  2KSS A;  2YRD A;  4C92 E;  1D0Z A;  4IKF A;  2MMP A;  3GNG A;  3L2V A;  2L5Q A;  1VQO Q;  3LWH A;  2BE7 D;  2KXC A;  1D3B B;  2L8D A;  3C0C A;  2RHI A;  1UEB A;  2EQI A;  3R6O A;  1BU1 A;  1V76 A;  4FT4 A;  3CD6 Q;  3NTH A;  3CCE A;  3VJP A;  1VQ9 T;  1Q82 R;  1JEG A;  1WHM A;  4C0Z A;  3LX7 A;  3JCM f;  1UDL A;  4M75 C;  2IG0 A;  4M77 C;  2KEA A;  2QDL A;  1IZ6 A;  1VQP T;  1JJ2 A;  1TOV A;  4F7U A;  1ZA2 B;  3PVL A;  1QCN A;  1TH7 A;  4NS5 A;  4Z02 A;  1NEG A;  3V8J A;  1QVF S;  8ATC B;  1Q7Y R;  3CC4 T;  2FPE A;  4JRQ A;  4PJO E;  5EG2 A;  3CCM A;  2JTF A;  5LJ5 d;  2X4J A;  3QHS A;  1Q82 U;  2ZPF B;  2CP5 A;  1VQM Q;  1YFN A;  2J6K A;  5GAM e;  2SRC A;  3MET A;  1OEB A;  1K73 U;  3MEU A;  1KQS A;  4PL6 A;  3T9N A;  2KRN A;  2MWO A;  5LJ3 d;  2HEQ A;  2J6F A;  1WJQ A;  2R58 A;  5IAY A;  2X9H A;  2A0F B;  4DQ2 A;  5KE3 A;  1K0X A;  5GAN 5;  1QVG A;  2JMC A;  4M7D D;  1QVF P;  1WHJ A;  3M4G A;  1GFD A;  2KXD A;  2CH4 A;  1KHC A;  2OTL A;  1LOJ A;  1NYF A;  4XTY A;  1MHN A;  3DLM A;  5LJ3 g;  3G6E T;  1YN8 A;  2FVU A;  2HBW A;  2QXF A;  3FDR A;  4PJL A;  2C0O A;  2RI2 A;  5A0L A;  1BIB A;  2Y90 A;  4XTZ A;  1M1F A;  4E2F B;  4WTO B;  3CXC A;  1U5S A;  3BE3 A;  4JUV A;  3JCM Q;  3CCS A;  3I55 A;  2DEU A;  2O31 A;  2J7I A;  2KT8 A;  5CQY A;  4R56 A;  4HVU A;  4DEX A;  4XU1 A;  3OYJ A;  1AD5 A;  1QQJ A;  4IIM A;  2RJE A;  2EQM A;  3GPL A;  2CZ6 B;  3TEE A;  5CK9 A;  2L2P A;  5GMK e;  4X1V A;  2QEX A;  2E65 A;  1HK9 A;  1I1J A;  1B3Q A;  3G4S Q;  4PJO B;  3I9Q A;  2K3Y A;  2L3R A;  2HAX A;  2OX7 A;  4A54 A;  1UGP B;  4LDW A;  4QT7 A;  3QYH B;  4MDW A;  2NUT B;  2DK3 A;  4IUQ A;  4LUE A;  3JRZ A;  4RUG A;  3C12 A;  3JCM J;  3H0I A;  1J3T A;  1M30 A;  3A8L B;  4BDY A;  3TU4 K;  1PKT A;  3HRS A;  4JLG A;  3D7S B;  2LCC A;  4M7D E;  3CCL Q;  1W6X A;  1XJW B;  2E10 A;  1ZSZ B;  2QA4 T;  4AG2 C;  4MZT A;  3OYC A;  3CC2 A;  1XNI A;  4P5N A;  1SEM A;  1W4S A;  5KE2 A;  4C92 A;  4Z8A A;  1Y71 A;  1M1K C;  4M7A C;  2PVG B;  1Y07 A;  3VS0 A;  2M51 A;  1KC8 R;  3OYF A;  2KNB B;  4J9H A;  2HCK A;  2DD5 A;  2OJ2 A;  2AZS A;  2RI3 A;  4C5H A;  3PTA A;  1T3S A;  5CKF A;  1BCO A;  3OYY A;  2E64 A;  3QZ9 B;  1YJ9 Q;  5KYU B;  4FU6 A;  2DXT A;  4OB2 B;  5GAN g;  3OYG A;  2V26 A;  4F17 A;  1AWW A;  1I5O B;  5D6X A;  3BW1 A;  2GBQ A;  2ENM A;  2YUQ A;  1B34 A;  4PJO F;  1WGS A;  1EX4 A;  4PJM A;  3H6Z A;  3JCM W;  2P0Q A;  2CP3 A;  3ZL7 C;  2V8K A;  3O5Z A;  4C5I A;  1VQK T;  3MPU B;  1KQ2 A;  1OUL A;  3PMI A;  1MMA A;  1KC8 U;  5HK0 A;  3JCM c;  3GP8 A;  4C8Q D;  2ED1 A;  4OVA A;  3CBO A;  4EMH A;  2NUP B;  3SFM A;  2EBP A;  3CCE Q;  3E1S A;  2JOY A;  2ZPG B;  4DEY A;  1YWO A;  5GAN 7;  5C0M A;  4M7D B;  3QKJ A;  3VUB A;  4UC4 A;  1VQ7 A;  4R0K A;  1WA7 A;  1VQN T;  4J83 A;  5IT9 E;  1M8M A;  1D09 B;  3VV0 A;  1K9A A;  1X6O A;  1JXO A;  2LVM A;  4A4E A;  1C6V X;  4MMK A;  5I2M A;  1VIF A;  1PCX A;  2ED0 A;  1VQO T;  3CCJ Q;  1QCF A;  3URG A;  1KQ1 A;  2AKK A;  3CCM Q;  3SB2 A;  1U3O A;  4JRK A;  4XTU A;  3NPF A;  3OYH A;  4E47 A;  1N8R C;  2M1H A;  4HVV A;  1WXT A;  2VWF A;  5HY6 A;  4FYV B;  2JZ2 A;  1BYM A;  2MWP A;  2DMO A;  1KG1 A;  3CEY A;  3G1J A;  3C95 A;  5IN1 A;  2G6F X;  2QGF B;  1OU9 A;  4J9I A;  1M90 R;  3CCV A;  4M7A F;  4JJC A;  1MMN A;  3SWN B;  1K8A C;  2JMA A;  2RH2 A;  5KYU A;  3RR6 A;  4XTX A;  1WFW A;  1T0J A;  3R6N A;  1WX6 A;  2LQK A;  2DXC A;  4C8Q E;  2OTL Q;  3OMC A;  2XDP A;  2CP0 A;  4LDU A;  1C1A A;  1PD1 A;  1ZHI A;  3J80 E;  1E6H A;  3KFV A;  4ZTJ A;  5IH2 A;  5FRN A;  5D6W A;  3L2W A;  1KD1 R;  9ATC B;  3I55 Q;  3FB9 A;  1OZ2 A;  1UJY A;  2QYZ A;  1G3Y A;  2K4Y A;  1VQ8 A;  2ZPI B;  4HA8 A;  4M7D A;  2FL7 A;  1WIE A;  3GNF B;  3M4Y A;  1VOM A;  2RB6 A;  1JBM A;  4C92 G;  1YI2 A;  3H0F A;  3TVT A;  4EMK C;  2RJC A;  1G3W A;  1O9S A;  4OML A;  2KT1 A;  2LQ8 A;  5D7U A;  4JZ4 A;  4IUV A;  1GRI A;  3CD6 A;  2YLB A;  2DIL A;  3JCM e;  3S3N A;  4QQ6 A;  2L89 A;  1KD1 U;  1KSW A;  3ULR B;  4OMO A;  5FU7 C;  2KE9 A;  5KYX A;  3A5Z B;  4RG8 A;  2CT4 A;  1Z9Z A;  4F04 B;  2V1Q A;  1D0X A;  2KRS A;  4RKU E;  1K9M U;  5C6S A;  3CBP A;  1V29 B;  1K4U S;  3SWN A;  4E7H A;  3JB9 F;  4OB1 B;  3CC2 Q;  3QJ6 A;  2FZC B;  1N6A A;  3QUI A;  1U06 A;  1RAD B;  4FYY B;  3JB9 H;  4DBH A;  1UGV A;  3LYI A;  1ABQ A;  1VQM A;  3UA7 A;  1VIE A;  1RI0 A;  4X34 A;  4PK4 A;  3TSW A;  4CRI A;  4N0A A;  4XK8 E;  3P8B B;  2QTX A;  3PIP A;  4M78 G;  4O5V A;  3OW2 A;  2RPN A;  3QWY A;  1UUE A;  2O88 A;  2LZ6 B;  1UGR B;  4KGV B;  3CCL T;  1H92 A;  5GAM d;  3NTI A;  1KHI A;  2ATC B;  1ZBX A;  3L2R A;  4C5G A;  5ECA A;  2DJQ A;  5LL6 S;  2HSE B;  2BZY A;  1ZX6 A;  2F2W A;  1YHQ T;  5KYW B;  3H9N A;  1ACM B;  4HCC A;  3SEM A;  3HSB A;  3KXT A;  1Y96 B;  1YJ9 T;  2RI5 A;  1YP5 A;  1NPR A;  2Y4Y A;  2K5I A;  2VAS A;  3EH2 A;  4M77 D;  4XAX B;  1VQ7 Q;  2A36 A;  3FIF A;  3VUZ A;  2FEI A;  1OZ3 A;  1V1C A;  2E4H A;  1GFC A;  3A1P A;  1Q81 R;  3E9G A;  3JSC A;  1UHC A;  1SG5 A;  4QQD A;  3G4S A;  5FWC A;  1PRL C;  4AFS C;  2KGT A;  2LJ0 A;  4FIB A;  4C8Q A;  4O6J A;  5CCA A;  2B86 A;  1K73 C;  2EAY A;  2LX9 A;  2DJZ A;  1YWP A;  4ATO A;  1MUZ A;  2CP6 A;  4OP0 A;  1Q86 R;  3CCE T;  3DB3 A;  1M1G A;  3M0P A;  5DLO A;  1GCQ A;  2BZX A;  3DKM A;  3FEO A;  2R5M A;  3M0Q A;  1I0C A;  1Q81 U;  1UG1 A;  5IHK A;  5AT1 B;  1N5Z A;  4OF1 A;  4XU0 A;  3HP9 A;  4ZN3 A;  4AG1 C;  1WJR A;  3RUX A;  2F2X A;  2RO0 A;  3QPH A;  1VYV A;  1NJI R;  4BUG A;  1OOT A;  3PGG A;  3CCM T;  2K2V A;  4GY5 A;  3EGU A;  3ZBD A;  1Q86 U;  2YUO A;  4PLL A;  1N27 A;  2R5A A;  2GQI A;  4M77 E;  1ZUY A;  4XTV A;  1MV3 A;  1QMC A;  1ZLM A;  2M02 A;  1TTH B;  2OTJ A;  2DVE A;  4BD3 A;  3LGL A;  2DXB A;  4A4K A;  2J6O A;  1Y96 A;  3CQT A;  5FU6 C;  2F2V A;  3EHR A;  5GMK i;  5GAN 3;  3A8M B;  1VYU A;  1RI9 A;  1CSK A;  2HMA A;  3BDU A;  1NJI U;  4KGX B;  2QG9 B;  4KRT A;  1YI2 Q;  5GAN h;  2OI3 A;  4CC3 A;  1O75 A;  3I56 Q;  1UGS B;  1JJ2 S;  2DEQ A;  2HL3 A;  3MEV A;  2DER A;  3CCU Q;  5FRO A;  1I8F A;  1E6G A;  1PM3 A;  1WLP B;  1B07 A;  1G5V A;  2ROL A;  2L3Q A;  1G8X A;  2RQR A;  3CCS T;  4HXJ A;  2X4Y A;  2LMJ A;  1AZG B;  3HPW A;  5EC7 A;  3VS5 A;  3DLL A;  1TU0 B;  3M9Q A;  2QEX T;  2RJD A;  2HQH A;  4M7A D;  2Y4X A;  5FWB A;  3CCJ A;  5HCK A;  2D0Q B;  4AMC A;  3QYG B;  1RL2 A;  4M75 B;  5GAN f;  3REA B;  1JJ2 P;  5GAN j;  2PTK A;  4M77 B;  4KT0 E;  3OYD A;  5GAO n;  5J3B A;  1QVG S;  4F16 A;  2VVK A;  1ABO A;  4D8D A;  5GAO p;  4QW2 A;  1AVZ C;  1XQH A;  3MJX A;  3VRZ A;  4BI4 A;  4MDX A;  2CP2 A;  4C92 C;  4JJN K;  1SF9 A;  3RBB B;  2XG8 D;  5LJ5 g;  3PIO A;  3EG9 B;  3TCJ A;  1Q7Y U;  3CXC S;  1WQ7 A;  4II1 A;  3FJP A;  4KH0 B;  1MGQ A;  1D0Y A;  2O2O A;  2X3W D;  3VS3 A;  1X27 A;  3VS4 A;  3CC2 T;  1VQL A;  2WSF E;  4IUR A;  1G3S A;  4C8Q G;  4D6W A;  2H3J A;  2JS0 A;  3M54 A;  2HBP A;  1CKA A;  2VGM A;  3JB9 J;  2EGA A;  2OAU A;  2AT1 B;  1QVP A;  2ZZD A;  1FYN A;  5CKD A;  3GOX A;  1S72 T;  1QVG P;  2YUP A;  1D3B A;  5D6Y A;  4E7L A;  2RF0 A;  1H8K A;  3M5A A;  3CMA Q;  4R55 A;  4ESR A;  3ZEH A;  3MP8 A;  5L8R E;  4DOV A;  1OPL A;  2LCS A;  2CP7 A;  5GAN 8;  4M7A E;  3CXC P;  3M53 A;  2EJG A;  2GNC A;  2K2M A;  1PC0 A;  3E2U A;  4M75 F;  5FLX E;  1QKW A;  2L3P A;  4M77 F;  4M78 C;  2HSP A;  2G3R A; 
#chains in the Genus database with same CATH homology
 3CEY A;  2DZ9 A;  3M55 A;  3C95 A;  5IN1 A;  3JB9 D;  4GLK A;  4FT2 A;  5A0D A;  1LNX A;  3QII A;  3VYH B;  4F7U E;  3CCV A;  4M7A F;  1JB0 E;  2I2L A;  4Y28 E;  1SSF A;  2DD4 A;  3SWN B;  2MAM A;  1K8A U;  3QBY A;  1K8A C;  4IUU A;  4OMF B;  1VQ5 T;  2HD0 A;  5GAO r;  2FB7 A;  2WAC A;  2RHX A;  3E9F A;  2RH2 A;  2RK1 A;  3I55 T;  3QJY A;  1VQ7 T;  3CPW S;  2GF7 A;  3OYI A;  4XTX A;  1BI3 A;  3KBG A;  3L2Q A;  3L2U A;  2XHC A;  2E1H A;  3HRU A;  3CCR T;  3JCM d;  2LQK A;  4VUB A;  2DXC A;  4B9X A;  1WNL A;  2PUO B;  3PMT A;  4J7I A;  1BI2 A;  3N5B B;  3OMC A;  4C8Q E;  1YJN T;  2KY9 A;  3OMG A;  2XDP A;  2M16 A;  4JS5 A;  3M59 A;  4LDU A;  3H8Z A;  2EQK A;  5M9O A;  3OS5 A;  4F7U F;  2LTO A;  3E19 A;  4PNO A;  3MEA A;  1KQS S;  2YRV A;  4M7A G;  1HXD A;  3OY9 A;  1ZHI A;  3BY7 A;  4EMK A;  4OGE A;  3J80 E;  3OYN A;  1IRE B;  4PLI A;  3V7C A;  3LWI A;  4ZTJ A;  3HFN A;  1OI1 A;  5FRN A;  5D6W A;  3L2W A;  3FB9 A;  1OZ2 A;  3UDC A;  1M5Q 1;  2CGH A;  3CC7 T;  3OS2 A;  3V8K A;  2KVQ G;  4A4G A;  1M4Z A;  1G3Y A;  3UPU A;  2K4Y A;  2XI9 A;  4IUP A;  4C8Q F;  1VQ8 A;  4A4H A;  4BE2 A;  3CCV T;  2EQJ A;  4FL6 A;  2GFA A;  4J6W A;  4M7A B;  1I4K 1;  2XD0 A;  2KDS A;  2ZPI B;  4HA8 A;  4M7D A;  2BUD A;  4L59 A;  2EJ9 A;  2FL7 A;  2QQB A;  4F7U G;  1XOV A;  3WXM B;  1AHJ B;  3GNF B;  1Y7X A;  3LLR A;  3M4Y A;  2QQA A;  4N4G A;  4RCC A;  2EIF A;  2RB6 A;  1JBM A;  4C92 G;  5GAN 2;  3J7A F;  1UB4 A;  2ZPH B;  2RM4 A;  3OBW A;  3AHU A;  1YI2 A;  2FYK A;  4EMK C;  2A7Y A;  2RJC A;  3BFM A;  1G3W A;  4C5E A;  1WJS A;  5DM7 R;  1O9S A;  3PT9 A;  1QVF A;  2LQ8 A;  4MZM A;  4IUV A;  1YBY A;  4M78 E;  3CD6 A;  2YLB A;  1YIJ A;  1KC8 C;  4J7F A;  4OB0 B;  2CZ0 B;  3JCM e;  3VKI A;  4PJO A;  3S3N A;  4QQ6 A;  2VYT A;  2L89 A;  3G71 A;  2RD1 A;  4F7U B;  5DY9 A;  1KD1 U;  2HNI A;  2O01 E;  1H3Z A;  3OYB A;  3LH0 A;  3OYM A;  5FU7 C;  4C92 B;  5CKB A;  3C94 A;  4Q5W A;  4EPC A;  4XQ3 A;  3A5Z B;  2K57 A;  4J5Y A;  4E7J A;  1YIT A;  2ZGW A;  2DXU A;  2LT1 A;  4WF2 A;  3RES A;  4RG8 A;  4ZGJ B;  4ZN1 A;  5CVI A;  4M7D C;  2F69 A;  3X28 B;  2LRQ A;  3CCL A;  3P8D A;  1UGQ B;  4RKU E;  3L2Z A;  3M56 A;  1K9M U;  5C6S A;  1K9M C;  3J81 E;  3CBP A;  4M78 F;  4RG2 A;  4ELY C;  2M9U A;  3WVE B;  3OS1 A;  1VQ8 T;  2ZPE B;  1BIA A;  1V29 B;  4C0D C;  3ME9 A;  2E70 A;  4IUT A;  3SWN A;  4E7H A;  3JB9 F;  4LDV A;  4OB1 B;  3F70 A;  2YLC A;  3QJ6 A;  1N6A A;  4KUL A;  2PVO B;  1VQ9 A;  3QUI A;  4NL3 A;  2QDY B;  4N4I A;  2LDM A;  4HKE A;  4PJO C;  2DKG A;  5DLQ E;  1YHQ A;  4PJO D;  3SDZ A;  3JB9 H;  4C0G A;  1N9R A;  3JB9 I;  3INZ A;  3LYI A;  3PNW C;  5J26 A;  2VV5 A;  1YI2 T;  1X01 A;  3QSU A;  3JCM h;  1VQM A;  4BI3 A;  1B34 B;  4CI0 C;  1YJ9 A;  2EKO A;  4BI8 B;  3S3M A;  1R8O B;  1VIE A;  1X75 C;  5GMK l;  1RI0 A;  3QO3 A;  3MEW A;  4X34 A;  3RKW A;  2F5T X;  4ELZ C;  4DA4 A;  4CRI A;  3CBM A;  1VQP A;  1WPY A;  2E6Z A;  3CD6 T;  1YIJ T;  1VQL T;  4N0A A;  4HCZ A;  4XK8 E;  3JCM V;  3P8B B;  2QTX A;  4NL2 A;  3PIP A;  2MF2 A;  2EYQ A;  4M78 G;  4O5V A;  2XDD A;  2JVV A;  2B8A A;  5CIU A;  1N9S A;  3G71 T;  2YHT A;  3ER0 A;  3OW2 A;  3JB9 G;  4TVR A;  2QI2 A;  4YTL A;  3X26 B;  2BKD N;  5FU6 B;  3SWN C;  2O4X A;  2KSS A;  4M75 A;  1YIT T;  3CC4 A;  1UGR B;  4C92 E;  4M77 A;  3CCL T;  4IKF A;  2MMP A;  3GNG A;  4QQG A;  2RK2 A;  2L5Q A;  3L2V A;  5GAM d;  2WSC E;  4XTW A;  3LWH A;  3NTI A;  2V8J A;  1KHI A;  1D3B B;  4C0F A;  2L8D A;  4M78 B;  3P8H A;  2JNG A;  3L1A A;  1ZBX A;  2RHI A;  1UEB A;  3EFS A;  3R6O A;  4E7K A;  4M7A A;  3L2R A;  4C5G A;  4FT4 A;  3NTH A;  1LJO A;  2DIG A;  5LL6 S;  4B9W A;  4N0A C;  3HKS A;  3VJP A;  5GAN 6;  3CCE A;  3MO8 A;  1VQ4 A;  1VQ9 T;  2DZC A;  5CO7 A;  4C0Z A;  2QQR A;  4JS4 A;  1YHQ T;  3LX7 A;  3JCM f;  2DTH A;  4HCC A;  4C92 F;  3OSS C;  2XU8 A;  4LDY A;  3SD4 A;  3HSB A;  3KXT A;  1VQM T;  1Y96 B;  2XID A;  4M75 C;  1YJ9 T;  2RI5 A;  1NPR A;  2IG0 A;  3OBY A;  2Y4Y A;  3X20 B;  1M90 U;  1M90 C;  4M77 C;  2K5I A;  1VQK A;  5GMK m;  4M77 D;  1IZ6 A;  1VQP T;  4J6Y A;  2ZPB B;  4Y91 A;  1OYX A;  4XAX B;  1JJ2 A;  3GLX A;  1WQW A;  2NLU A;  3FIF A;  3VUZ A;  4F7U A;  3JCM g;  2WSE E;  1W2B A;  1OZ3 A;  3E9G A;  1TH7 A;  4NS5 A;  4Z02 A;  3V8J A;  2LC4 A;  3JSC A;  1M1K U;  1QVF S;  3G6E A;  5CQX A;  4J8O A;  5GAN d;  4QQD A;  1FWZ A;  3DB4 A;  4ZTF A;  3G4S A;  3CC4 T;  3HFO A;  4NOY A;  4JRQ A;  4PJO E;  2LNV A;  5EG2 A;  1S72 A;  3CCM A;  2JTF A;  3X25 B;  5LJ5 d;  2X4W A;  3JCM b;  2X4J A;  3QHS A;  1EIF A;  3QG1 A;  4QVD A;  1Q82 U;  2ZPF B;  5AYF A;  4QVZ A;  4FIB A;  4C8Q A;  4O6J A;  5CCA A;  2BIV A;  1FXX A;  2RHZ A;  5GAM e;  3MET A;  2E5Q A;  1K73 U;  2PU9 B;  2EAY A;  2LX9 A;  2DJZ A;  3I56 A;  3MEU A;  1K73 C;  1KQS A;  2RHY A;  4PL6 A;  2DO3 A;  3QXE B;  3T9N A;  4ATO A;  4OP0 A;  2AHJ B;  3CCE T;  2MWO A;  1M1G A;  3DB3 A;  5DLO A;  5GAO q;  3CCU A;  1VQ4 T;  5LJ3 d;  4BY6 C;  2JTM A;  1WJQ A;  2E6N A;  3DKM A;  3PFS A;  1KD1 C;  3G7Z A;  1H64 1;  2R58 A;  3FEO A;  3L42 A;  4DQ2 A;  5IAY A;  2R5M A;  2R57 A;  3MP6 A;  5KE3 A;  3FLG A;  5A2Q E;  3RER A;  2RJF A;  1Q81 U;  4V2S A;  1BI0 A;  5GAN 5;  3OYE A;  3FC3 A;  1QVG A;  2KQW A;  4M7D D;  3ASK A;  2P0K A;  1U8R A;  3M4G A;  4OF1 A;  2EWN A;  3M58 A;  4XU0 A;  3HP9 A;  4ZN3 A;  1KHC A;  1WJR A;  3HL8 A;  2OTL A;  3JAM E;  1LOJ A;  4C8Q C;  4BDZ A;  4XU3 A;  4XTY A;  3RUX A;  1MHN A;  2RO0 A;  3GF5 A;  3QPH A;  4KUI A;  1VQ6 A;  3DLM A;  2DTO A;  5LJ3 g;  2FVU A;  3G6E T;  2QXF A;  4BUG A;  3FDR A;  4RMO A;  3G4S T;  2RI2 A;  3PGG A;  5A0L A;  3VU3 C;  5I21 A;  1BIB A;  2Y90 A;  3MHX A;  5FU7 B;  4XTZ A;  2X35 A;  3X24 B;  5GAN e;  5GAM h;  1M1F A;  3CCM T;  3CXC A;  2K2V A;  4GY5 A;  3LGF A;  4JUV A;  2LT4 A;  3ZBD A;  3OW2 S;  1Q86 U;  4PJO G;  5KCH A;  3JCM Q;  4PLL A;  1N27 A;  2R5A A;  4M78 A;  2A3L A;  3CCS A;  3I55 A;  5I2S A;  4X9D A;  4BE1 A;  2CYZ B;  5LJ5 e;  5CQY A;  4R56 A;  2P4T A;  3RMQ A;  4M77 E;  4XU1 A;  3OYJ A;  2VXE A;  3I56 T;  3V8L A;  4XTV A;  3CME A;  2RJE A;  4C0D B;  2EQM A;  3GPL A;  5FRM A;  2CZ6 B;  2QA4 A;  3CCU T;  2XIC A;  3TEE A;  5CK9 A;  2OTJ A;  5GMK e;  2DVE A;  2QQ9 A;  2QEX A;  3UWN A;  4BD3 A;  2E65 A;  3LGL A;  2DXB A;  1HK9 A;  5CKH A;  4A4K A;  5LJ3 e;  1Y96 A;  5FU6 C;  4PJO B;  4HT8 A;  2GCX A;  2K3Y A;  4X9C A;  5GMK i;  2L3R A;  5GAN 3;  3A8M B;  2HAX A;  4XU2 A;  4A54 A;  1UGP B;  2EFI A;  4LDW A;  2DAQ A;  3VYG A;  3BDU A;  1NJI U;  2P0P A;  3QYH B;  3OSV A;  4MDW A;  1N8R U;  2DPP B;  4BE0 A;  2DK3 A;  5HKC A;  4IUQ A;  2JUF A;  4L6V 5;  2PQW A;  4N4H A;  3JRZ A;  5GAN h;  2MI6 A;  2VUB A;  1ZQ1 A;  1O75 A;  1VQ6 T;  3C12 A;  3JCM J;  4L5G A;  3WVD B;  1FX7 A;  1UGS B;  2EQU A;  5GAM f;  3A8L B;  4BDY A;  2K3X A;  2DEQ A;  2XK0 A;  3MEV A;  3TU4 K;  5GAM j;  1JJ2 S;  1QW1 A;  2DIQ A;  5LJ5 h;  2LCL A;  1U1S A;  5FRO A;  1I8F A;  2K5F A;  1W2B S;  3HRS A;  3RKX A;  4JLG A;  1JRI A;  3CPF A;  2FHD A;  2VGN A;  1G5V A;  4JRI A;  3JCM X;  3CCS T;  3OYK A;  2X4Y A;  2LCC A;  5GMK h;  4M7D E;  3OYL A;  5GAM g;  2XDB A;  4M75 D;  3NTK A;  3HPW A;  5KH6 A;  4M75 G;  4ME7 A;  5LJ3 h;  1M8V A;  2E10 A;  3CMA A;  2GQV A;  3RIR A;  2EJF A;  3CME T;  4M77 G;  3DLL A;  2QA4 T;  3A8H B;  2RHU A;  4MZT A;  3OYC A;  3CC2 A;  2OTJ T;  1XNI A;  3M9Q A;  2CZ7 B;  4P5N A;  1W4S A;  3RMS A;  5KE2 A;  2QEX T;  5CAI A;  4LD6 A;  4C92 A;  5KCO A;  4KUD K;  2E41 A;  3BDL A;  1Y71 A;  2RJD A;  1M1K C;  2JN0 A;  4M7A C;  5CKE A;  2PVG B;  4J6X A;  4M7A D;  1NPP A;  2Y4X A;  1Y07 A;  3JCM P;  3CPW A;  4PKC C;  3CCJ A;  3KUF A;  4JLI A;  4RCB A;  2IVW A;  2PUK B;  3OYF A;  2D0Q B;  3EFR A;  2DD5 A;  3QYG B;  2O4X B;  1RL2 A;  2D9T A;  2F5K A;  2PVD B;  4FSX A;  4M75 B;  5GAN f;  2RI3 A;  3PTA A;  4C5H A;  4JRP A;  5CKF A;  1Q82 C;  3CCQ A;  5GAN j;  4M7D F;  4M77 B;  3UT1 A;  2D6F A;  4KT0 E;  3OYY A;  5GAN 4;  3OYD A;  5GAO n;  2E64 A;  4E7I A;  3QZ9 B;  3HHT B;  3HRT A;  1YCY A;  5J3B A;  1QVG S;  1VQN A;  4JDS A;  5LJ5 f;  4A4F A;  2K5L A;  2E12 A;  4FU6 A;  2KMT A;  3V7S A;  2C06 A;  2DXT A;  5LJ5 j;  5GAO p;  1I5L A;  2HQE A;  4QW2 A;  4OB2 B;  3EAE A;  1YJW A;  1XQH A;  2CKK A;  5GAN g;  3OYG A;  1BYM A;  2CS7 A;  4LD9 K;  1PSF A;  3S3O A;  5D6X A;  4BI4 A;  1QP2 A;  4MDX A;  4ZGD B;  4C92 C;  2KAF A;  3NFC A;  4JJN K;  3BW1 A;  4C92 D;  1VUB A;  3OA6 A;  1B34 A;  5GMK j;  4PJO F;  1WGS A;  2XG8 D;  4MZP A;  1VQO A;  3QZ5 B;  1Q81 C;  5LJ5 g;  3M57 A;  5LJ3 f;  3H6Z A;  5GAO l;  3PIO A;  3JCM W;  2P0Q A;  3TRE A;  5LJ3 j;  4C5I A;  2V8K A;  3OYA A;  3TCJ A;  1Q7Y U;  1Q7Y C;  4EMK B;  1VQK T;  1KQ2 A;  3CXC S;  1WQ7 A;  4II1 A;  3FJP A;  3CMA T;  1MGQ A;  3PMI A;  4M7D G;  3MP1 A;  3QDR B;  1KC8 U;  5HK0 A;  3CC2 T;  2X4X A;  3JCM c;  1NE8 A;  3GP8 A;  1VQL A;  4LDX A;  4C8Q D;  2WSF E;  4IUR A;  4OVA A;  1G3S A;  3RKY A;  3CBO A;  3MCA B;  2KK4 A;  4C8Q G;  4EMH A;  4D6W A;  2H3J A;  4ZGE B;  3M54 A;  4BY6 B;  2HBP A;  2M0O A;  4QVC A;  2VGM A;  3SFM A;  3CCJ T;  2QQS A;  3JB9 J;  2OAU A;  3E1S A;  2XKO C;  4BAC A;  2HQX A;  4HT9 A;  1QVP A;  2ZZD A;  2JOY A;  2ZPG B;  1BI1 A;  2DTI A;  5CKD A;  3GOX A;  1S72 T;  4MML A;  5GAN 7;  4A53 A;  5C0M A;  3LW5 E;  1VQ5 A;  1Q86 C;  4M7D B;  1M9S A;  1D3B A;  3FRN A;  3QKJ A;  1QP3 A;  5D6Y A;  3VUB A;  1XTD A;  4EDU A;  3CCQ T;  4UC4 A;  3GIB A;  4EMG A;  3A8O B;  4M75 E;  4E7L A;  1VQ7 A;  2VC8 A;  3S6W A;  3V7R A;  1VQN T;  4FM4 B;  4J83 A;  5IT9 E;  4C8Q B;  1BKB A;  2RA2 A;  3M5A A;  4OB3 B;  3VV0 A;  3CCR A;  4KBM B;  1X6O A;  3OB9 A;  4R55 A;  1GXI E;  1PSE A;  2LVM A;  3ZEH A;  1G3T A;  4A4E A;  3C4S A;  3MP8 A;  2V8I A;  5L8R E;  3ZFJ A;  4DOV A;  1YJN A;  4DOW A;  1YJW T;  1I81 A;  4MMK A;  5A0G A;  5GAN 8;  5I2M A;  1VIF A;  4M7A E;  4HCB A;  5CR2 A;  5HK3 A;  1VQO T;  2ZCF B;  2CZ1 B;  2VXF A;  1NZ9 A;  4OGC A;  3URG A;  3OS0 A;  2GFU A;  5GAO m;  3M53 A;  1KQ1 A;  2EJG A;  3SB2 A;  4JRK A;  4XTU A;  1U1T A;  4BB7 A;  1NJI C;  3OYH A;  4M75 F;  1P92 A;  3Q1J A;  5FLX E;  4E47 A;  1N8R C;  2M1H A;  3O8V A;  3A8G B;  1DJ7 B;  2OTL T;  4M77 F;  4M78 C;  4M78 D;  3OQ5 A;  5HY6 A;  2JZ2 A;  3CC7 A;  2MWP A;  2G3R A;  1KG1 A;  5J39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...