4C9CA

Crystal structure of the strawberry pathogenesis-related 10 (pr-10) fra a 1e protein (form a)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
162
structure length
158
Chain Sequence
AMAGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR STRAWBERRY ALLERGEN FRA A 1-E
publication title The Strawberry Pathogenesis-Related 10 (Pr-10) Fra a Proteins Control Flavonoid Biosynthesis by Binding to Metabolic Intermediates.
pubmed doi rcsb
source organism Fragaria x ananassa
molecule tags Allergen
total genus 38
structure length 158
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 4c9cA00
4REJA 2LGHA 4M9WA 3OH8A 3KLXA 4XRWA 2Q3QA 3IJTA 3RT0C 2D4RA 2KCZA 2NS9A 3NMHA 4IGWA 5I8FA 2LF2A 3ZVUA 3KB0A 3GGNA 4WVOA 4Q0KA 4JDLA 4DS8A 3H3TA 2E3OA 3H3RA 3K90A 4A80A 4A87A 4IH0A 1X53A 2M47A 3CNWA 2E3MA 3C0VA 1Z94A 4B9RA 2IL5A 3KB3A 2A1LA 3KL1A 3NMTA 2E3PA 4JHHA 5E4MA 4N0GC 4A8VA 4A88A 3UQHA 4LGBA 2LE1A 3OTLA 3Q6AA 5JNNA 1UW5A 3JRQB 2WQLA 4IGYA 4A84A 2VQ5A 4XRTA 2LUZA 3NMNA 3PU2A 1LN2A 4LG5A 1T17A 3KAZA 3OQUA 4MA6A 4R7KA 2FLHA 5AMWA 4JDAA 1H2OA 4LA7A 1LLTA 4FPWA 4PSBA 2MOUA 2R55A 3NJOA 2E3RA 2M89A 4GY9A 5I9JA 3W9KA 2K7HA 3QN1A 1FM4A 1ZXFA 4OICA 2QIMA 4N3EA 4C9IA 4BKDA 3P51A 3NS2A 3H3QA 1XUVA 4M9BA 2LAKA 2K5GA 2FFSA 3ELIA 4Z3LA 2E3SA 3FO5A 2EJXA 3NI8A 4MNSA 4Y31A 3UJLA 2VNEA 1E09A 2E3QA 4JHIA 1FSKA 3P9VA 3NMPA 4BTZA 2KTEA 4QIPA 2E3NA 2QPVA 1XFSA 5BRLA 2RERA 2N4BA 3TFZA 2PSOA 3KDJA 5JO1A 3NEGA 4RYVA 3KDHA 3TVQA 1EM2A 4DSCA 4BK7A 3P0LA 4MAPA 3NJ0A 1TW0A 4A83A 4DSBA 2LPXA 4JHGA 3KDIA 1XDFA 3K3KA 1JSSA 2LDKA 2RESA 3RT2A 1LN1A 2GKDA 4C9CA 3TL1A 4A85A 4A8UA 3NEFA 4IHRA 1IFVA 4REIA 5C9YA 1TXCA 2PCSA 1LN3A 3PUTA 4C94A 3QSZA 4IGXA 3NJ1A 2LEQA 3TVRA 1B6FA 3WG8A 1XN6A 3E85A 3IE5A 1QMRA 2N4AA 3OJIA 3Q64A 4IH2A 5E4BA 4BK6A 2L65A 4REHA 2KEWA 2L8OA 1ICXA 1KCMA 1XN5A 2REZA 2Z9YA 1BTVA 2BK0A 2I9YA 3H3SA 3W9RA 5JO2A 3R6PA 3RD6A 2L9PA 4A8GA 3Q63A 4A86A 4IGVA 5E4DA 1VJHA 3JRSA 4LGAA 1BV1A 2NN5A 3NMVA 2KF2A 2LCGA 4BKCA 4A81A 3NR4A 2Z9ZA 2LIOA 3F08A 3UIDA 5E46A 3KAYA 1T27A
chains in the Genus database with same CATH superfamily
4REJA 2LGHA 4M9WA 3OH8A 3KLXA 3GKEA 4XRWA 4QDCA 2Q3QA 3IJTA 3RT0C 4KPYA 2D4RA 2KCZA 2NS9A 3NMHA 4IGWA 5I8FA 2LF2A 3ZVUA 3KB0A 3GGNA 4WVOA 4Q0KA 4JDLA 4DS8A 3H3TA 2E3OA 3H3RA 3K90A 4A80A 4A87A 4IH0A 1X53A 2M47A 3CNWA 2E3MA 3C0VA 1Z94A 4B9RA 2IL5A 3KB3A 2A1LA 3KL1A 3NMTA 2E3PA 4JHHA 5E4MA 4N0GC 4A8VA 4A88A 3UQHA 4LGBA 2LE1A 3OTLA 3Q6AA 4QDFA 5JNNA 4NCBA 1UW5A 3JRQB 2WQLA 4IGYA 4A84A 2VQ5A 3HO1A 4XRTA 2LUZA 3NMNA 3PU2A 1LN2A 2YH6A 2ZYLA 4LG5A 1T17A 3KAZA 3OQUA 4MA6A 4R7KA 2FLHA 5AMWA 4JDAA 1H2OA 4LA7A 1LLTA 4FPWA 4PSBA 2MOUA 2R55A 3NJOA 2E3RA 3HVRA 2M89A 4GY9A 5I9JA 3W9KA 2K7HA 2LAFA 3QN1A 1FM4A 1ZXFA 4OICA 2QIMA 4N3EA 4C9IA 3HJFA 4BKDA 3P51A 3NS2A 3H3QA 1XUVA 3GOBA 4M9BA 2LAKA 2K5GA 2FFSA 3ELIA 4Z3LA 2E3SA 4QDDA 4QCKA 3FO5A 3GB4A 2EJXA 3NI8A 4MNSA 4JHYA 4Y31A 3UJLA 2VNEA 1E09A 2E3QA 4JHIA 4N76A 1FSKA 3P9VA 3NMPA 4BTZA 2KTEA 4QIPA 2E3NA 2QPVA 1XFSA 5BRLA 5EKQC 3HXMA 2RERA 2N4BA 3TFZA 2PSOA 3KDJA 5JO1A 3NEGA 4RYVA 3KDHA 3TVQA 1EM2A 4DSCA 3DLBA 3HK2A 4BK7A 3P0LA 4MAPA 3NJ0A 1TW0A 4A83A 4DSBA 2LPXA 4JHGA 3KDIA 1XDFA 3K3KA 1JSSA 2LDKA 2RESA 3RT2A 1LN1A 2GKDA 4C9CA 3TL1A 4A85A 4A8UA 3NEFA 4IHRA 1IFVA 4REIA 5C9YA 1TXCA 2PCSA 1LN3A 3PUTA 4N47A 4C94A 3QSZA 4IGXA 3NJ1A 2LEQA 3TVRA 1B6FA 3GTSA 3WG8A 4N41A 1XN6A 3E85A 3IE5A 1QMRA 3DLHA 2N4AA 3OJIA 3Q64A 4IH2A 5E4BA 4BK6A 2L65A 4REHA 3TGOC 4NCAA 2KEWA 2L8OA 3F73A 4E6FA 1ICXA 1KCMA 1XN5A 2REZA 2Z9YA 1BTVA 2BK0A 2I9YA 3H3SA 3W9RA 5JO2A 3HM9A 3R6PA 3RD6A 2L9PA 3GL2A 3Q63A 4A86A 4IGVA 4A8GA 5E4DA 4QDFB 1VJHA 3JRSA 4LGAA 1BV1A 2NN5A 3NMVA 2KF2A 2LCGA 4BKCA 3GL0A 4A81A 3NR4A 2Z9ZA 2LIOA 3NQNA 3F08A 3UIDA 5E46A 3KAYA 1T27A 3GTEA
chains in the Genus database with same CATH topology
4REJA 2LGHA 4M9WA 3OH8A 3KLXA 3GKEA 4XRWA 4QDCA 2Q3QA 3IJTA 3RT0C 4KPYA 2D4RA 2KCZA 2NS9A 3NMHA 4IGWA 5I8FA 2LF2A 3ZVUA 3KB0A 3GGNA 4WVOA 4Q0KA 4JDLA 4DS8A 3H3TA 2E3OA 3H3RA 3K90A 4A80A 4A87A 4IH0A 1X53A 2M47A 3CNWA 2E3MA 3C0VA 1Z94A 4B9RA 2IL5A 3KB3A 2A1LA 3KL1A 3NMTA 2E3PA 4JHHA 5E4MA 4N0GC 4A8VA 4A88A 3UQHA 4LGBA 2LE1A 3OTLA 3Q6AA 4QDFA 5JNNA 4NCBA 1UW5A 3JRQB 2WQLA 4IGYA 4A84A 2VQ5A 3HO1A 4XRTA 2LUZA 3NMNA 3PU2A 1LN2A 2YH6A 2ZYLA 4LG5A 1T17A 3KAZA 3OQUA 4MA6A 4R7KA 2FLHA 5AMWA 4JDAA 1H2OA 4LA7A 1LLTA 4FPWA 4PSBA 2MOUA 2R55A 3NJOA 2E3RA 3HVRA 2M89A 4GY9A 5I9JA 3W9KA 2K7HA 2LAFA 3QN1A 1FM4A 1ZXFA 4OICA 2QIMA 4N3EA 4C9IA 3HJFA 4BKDA 3P51A 3NS2A 3H3QA 1XUVA 3GOBA 4M9BA 2LAKA 2K5GA 2FFSA 3ELIA 4Z3LA 2E3SA 4QDDA 4QCKA 3FO5A 3GB4A 2EJXA 3NI8A 4MNSA 4JHYA 4Y31A 3UJLA 2VNEA 1E09A 2E3QA 4JHIA 4N76A 1FSKA 3P9VA 3NMPA 4BTZA 2KTEA 4QIPA 2E3NA 2QPVA 1XFSA 5BRLA 5EKQC 3HXMA 2RERA 2N4BA 3TFZA 2PSOA 3KDJA 5JO1A 3NEGA 4RYVA 3KDHA 3TVQA 1EM2A 4DSCA 3DLBA 3HK2A 4BK7A 3P0LA 4MAPA 3NJ0A 1TW0A 4A83A 4DSBA 2LPXA 4JHGA 3KDIA 1XDFA 3K3KA 1JSSA 2LDKA 2RESA 3RT2A 1LN1A 2GKDA 4C9CA 3TL1A 4A85A 4A8UA 3NEFA 4IHRA 1IFVA 4REIA 5C9YA 1TXCA 2PCSA 1LN3A 3PUTA 4N47A 4C94A 3QSZA 4IGXA 3NJ1A 2LEQA 3TVRA 1B6FA 3GTSA 3WG8A 4N41A 1XN6A 3E85A 3IE5A 1QMRA 3DLHA 2N4AA 3OJIA 3Q64A 4IH2A 5E4BA 4BK6A 2L65A 4REHA 3TGOC 4NCAA 2KEWA 2L8OA 3F73A 4E6FA 1ICXA 1KCMA 1XN5A 2REZA 2Z9YA 1BTVA 2BK0A 2I9YA 3H3SA 3W9RA 5JO2A 3HM9A 3R6PA 3RD6A 2L9PA 3GL2A 3Q63A 4A86A 4IGVA 4A8GA 5E4DA 4QDFB 1VJHA 3JRSA 4LGAA 1BV1A 2NN5A 3NMVA 2KF2A 2LCGA 4BKCA 3GL0A 4A81A 3NR4A 2Z9ZA 2LIOA 3NQNA 3F08A 3UIDA 5E46A 3KAYA 1T27A 3GTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4REJ A;  2LGH A;  4M9W A;  3OH8 A;  3KLX A;  4XRW A;  2Q3Q A;  3IJT A;  3RT0 C;  2D4R A;  2KCZ A;  2NS9 A;  3NMH A;  4IGW A;  5I8F A;  2LF2 A;  3ZVU A;  3KB0 A;  3GGN A;  4WVO A;  4Q0K A;  4JDL A;  4DS8 A;  3H3T A;  2E3O A;  3H3R A;  3K90 A;  4A80 A;  4A87 A;  4IH0 A;  1X53 A;  2M47 A;  3CNW A;  2E3M A;  3C0V A;  1Z94 A;  4B9R A;  2IL5 A;  3KB3 A;  2A1L A;  3KL1 A;  3NMT A;  2E3P A;  4JHH A;  5E4M A;  4N0G C;  4A8V A;  4A88 A;  3UQH A;  4LGB A;  2LE1 A;  3OTL A;  3Q6A A;  5JNN A;  1UW5 A;  3JRQ B;  2WQL A;  4IGY A;  4A84 A;  2VQ5 A;  4XRT A;  2LUZ A;  3NMN A;  3PU2 A;  1LN2 A;  4LG5 A;  1T17 A;  3KAZ A;  3OQU A;  4MA6 A;  4R7K A;  2FLH A;  5AMW A;  4JDA A;  1H2O A;  4LA7 A;  1LLT A;  4FPW A;  4PSB A;  2MOU A;  2R55 A;  3NJO A;  2E3R A;  2M89 A;  4GY9 A;  5I9J A;  3W9K A;  2K7H A;  3QN1 A;  1FM4 A;  1ZXF A;  4OIC A;  2QIM A;  4N3E A;  4C9I A;  4BKD A;  3P51 A;  3NS2 A;  3H3Q A;  1XUV A;  4M9B A;  2LAK A;  2K5G A;  2FFS A;  3ELI A;  4Z3L A;  2E3S A;  3FO5 A;  2EJX A;  3NI8 A;  4MNS A;  4Y31 A;  3UJL A;  2VNE A;  1E09 A;  2E3Q A;  4JHI A;  1FSK A;  3P9V A;  3NMP A;  4BTZ A;  2KTE A;  4QIP A;  2E3N A;  2QPV A;  1XFS A;  5BRL A;  2RER A;  2N4B A;  3TFZ A;  2PSO A;  3KDJ A;  5JO1 A;  3NEG A;  4RYV A;  3KDH A;  3TVQ A;  1EM2 A;  4DSC A;  4BK7 A;  3P0L A;  4MAP A;  3NJ0 A;  1TW0 A;  4A83 A;  4DSB A;  2LPX A;  4JHG A;  3KDI A;  1XDF A;  3K3K A;  1JSS A;  2LDK A;  2RES A;  3RT2 A;  1LN1 A;  2GKD A;  4C9C A;  3TL1 A;  4A85 A;  4A8U A;  3NEF A;  4IHR A;  1IFV A;  4REI A;  5C9Y A;  1TXC A;  2PCS A;  1LN3 A;  3PUT A;  4C94 A;  3QSZ A;  4IGX A;  3NJ1 A;  2LEQ A;  3TVR A;  1B6F A;  3WG8 A;  1XN6 A;  3E85 A;  3IE5 A;  1QMR A;  2N4A A;  3OJI A;  3Q64 A;  4IH2 A;  5E4B A;  4BK6 A;  2L65 A;  4REH A;  2KEW A;  2L8O A;  1ICX A;  1KCM A;  1XN5 A;  2REZ A;  2Z9Y A;  1BTV A;  2BK0 A;  2I9Y A;  3H3S A;  3W9R A;  5JO2 A;  3R6P A;  3RD6 A;  2L9P A;  4A8G A;  3Q63 A;  4A86 A;  4IGV A;  5E4D A;  1VJH A;  3JRS A;  4LGA A;  1BV1 A;  2NN5 A;  3NMV A;  2KF2 A;  2LCG A;  4BKC A;  4A81 A;  3NR4 A;  2Z9Z A;  2LIO A;  3F08 A;  3UID A;  5E46 A;  3KAY A;  1T27 A; 
#chains in the Genus database with same CATH topology
 4REJ A;  2LGH A;  4M9W A;  3OH8 A;  3KLX A;  3GKE A;  4XRW A;  4QDC A;  2Q3Q A;  3IJT A;  3RT0 C;  4KPY A;  2D4R A;  2KCZ A;  2NS9 A;  3NMH A;  4IGW A;  5I8F A;  2LF2 A;  3ZVU A;  3KB0 A;  3GGN A;  4WVO A;  4Q0K A;  4JDL A;  4DS8 A;  3H3T A;  2E3O A;  3H3R A;  3K90 A;  4A80 A;  4A87 A;  4IH0 A;  1X53 A;  2M47 A;  3CNW A;  2E3M A;  3C0V A;  1Z94 A;  4B9R A;  2IL5 A;  3KB3 A;  2A1L A;  3KL1 A;  3NMT A;  2E3P A;  4JHH A;  5E4M A;  4N0G C;  4A8V A;  4A88 A;  3UQH A;  4LGB A;  2LE1 A;  3OTL A;  3Q6A A;  4QDF A;  5JNN A;  4NCB A;  1UW5 A;  3JRQ B;  2WQL A;  4IGY A;  4A84 A;  2VQ5 A;  3HO1 A;  4XRT A;  2LUZ A;  3NMN A;  3PU2 A;  1LN2 A;  2YH6 A;  2ZYL A;  4LG5 A;  1T17 A;  3KAZ A;  3OQU A;  4MA6 A;  4R7K A;  2FLH A;  5AMW A;  4JDA A;  1H2O A;  4LA7 A;  1LLT A;  4FPW A;  4PSB A;  2MOU A;  2R55 A;  3NJO A;  2E3R A;  3HVR A;  2M89 A;  4GY9 A;  5I9J A;  3W9K A;  2K7H A;  2LAF A;  3QN1 A;  1FM4 A;  1ZXF A;  4OIC A;  2QIM A;  4N3E A;  4C9I A;  3HJF A;  4BKD A;  3P51 A;  3NS2 A;  3H3Q A;  1XUV A;  3GOB A;  4M9B A;  2LAK A;  2K5G A;  2FFS A;  3ELI A;  4Z3L A;  2E3S A;  4QDD A;  4QCK A;  3FO5 A;  3GB4 A;  2EJX A;  3NI8 A;  4MNS A;  4JHY A;  4Y31 A;  3UJL A;  2VNE A;  1E09 A;  2E3Q A;  4JHI A;  4N76 A;  1FSK A;  3P9V A;  3NMP A;  4BTZ A;  2KTE A;  4QIP A;  2E3N A;  2QPV A;  1XFS A;  5BRL A;  5EKQ C;  3HXM A;  2RER A;  2N4B A;  3TFZ A;  2PSO A;  3KDJ A;  5JO1 A;  3NEG A;  4RYV A;  3KDH A;  3TVQ A;  1EM2 A;  4DSC A;  3DLB A;  3HK2 A;  4BK7 A;  3P0L A;  4MAP A;  3NJ0 A;  1TW0 A;  4A83 A;  4DSB A;  2LPX A;  4JHG A;  3KDI A;  1XDF A;  3K3K A;  1JSS A;  2LDK A;  2RES A;  3RT2 A;  1LN1 A;  2GKD A;  4C9C A;  3TL1 A;  4A85 A;  4A8U A;  3NEF A;  4IHR A;  1IFV A;  4REI A;  5C9Y A;  1TXC A;  2PCS A;  1LN3 A;  3PUT A;  4N47 A;  4C94 A;  3QSZ A;  4IGX A;  3NJ1 A;  2LEQ A;  3TVR A;  1B6F A;  3GTS A;  3WG8 A;  4N41 A;  1XN6 A;  3E85 A;  3IE5 A;  1QMR A;  3DLH A;  2N4A A;  3OJI A;  3Q64 A;  4IH2 A;  5E4B A;  4BK6 A;  2L65 A;  4REH A;  3TGO C;  4NCA A;  2KEW A;  2L8O A;  3F73 A;  4E6F A;  1ICX A;  1KCM A;  1XN5 A;  2REZ A;  2Z9Y A;  1BTV A;  2BK0 A;  2I9Y A;  3H3S A;  3W9R A;  5JO2 A;  3HM9 A;  3R6P A;  3RD6 A;  2L9P A;  3GL2 A;  3Q63 A;  4A86 A;  4IGV A;  4A8G A;  5E4D A;  4QDF B;  1VJH A;  3JRS A;  4LGA A;  1BV1 A;  2NN5 A;  3NMV A;  2KF2 A;  2LCG A;  4BKC A;  3GL0 A;  4A81 A;  3NR4 A;  2Z9Z A;  2LIO A;  3NQN A;  3F08 A;  3UID A;  5E46 A;  3KAY A;  1T27 A;  3GTE A; 
#chains in the Genus database with same CATH homology
 4REJ A;  2LGH A;  4M9W A;  3OH8 A;  3KLX A;  3GKE A;  4XRW A;  4QDC A;  2Q3Q A;  3IJT A;  3RT0 C;  4KPY A;  2D4R A;  2KCZ A;  2NS9 A;  3NMH A;  4IGW A;  5I8F A;  2LF2 A;  3ZVU A;  3KB0 A;  3GGN A;  4WVO A;  4Q0K A;  4JDL A;  4DS8 A;  3H3T A;  2E3O A;  3H3R A;  3K90 A;  4A80 A;  4A87 A;  4IH0 A;  1X53 A;  2M47 A;  3CNW A;  2E3M A;  3C0V A;  1Z94 A;  4B9R A;  2IL5 A;  3KB3 A;  2A1L A;  3KL1 A;  3NMT A;  2E3P A;  4JHH A;  5E4M A;  4N0G C;  4A8V A;  4A88 A;  3UQH A;  4LGB A;  2LE1 A;  3OTL A;  3Q6A A;  4QDF A;  5JNN A;  4NCB A;  1UW5 A;  3JRQ B;  2WQL A;  4IGY A;  4A84 A;  2VQ5 A;  3HO1 A;  4XRT A;  2LUZ A;  3NMN A;  3PU2 A;  1LN2 A;  2YH6 A;  2ZYL A;  4LG5 A;  1T17 A;  3KAZ A;  3OQU A;  4MA6 A;  4R7K A;  2FLH A;  5AMW A;  4JDA A;  1H2O A;  4LA7 A;  1LLT A;  4FPW A;  4PSB A;  2MOU A;  2R55 A;  3NJO A;  2E3R A;  3HVR A;  2M89 A;  4GY9 A;  5I9J A;  3W9K A;  2K7H A;  2LAF A;  3QN1 A;  1FM4 A;  1ZXF A;  4OIC A;  2QIM A;  4N3E A;  4C9I A;  3HJF A;  4BKD A;  3P51 A;  3NS2 A;  3H3Q A;  1XUV A;  3GOB A;  4M9B A;  2LAK A;  2K5G A;  2FFS A;  3ELI A;  4Z3L A;  2E3S A;  4QDD A;  4QCK A;  3FO5 A;  3GB4 A;  2EJX A;  3NI8 A;  4MNS A;  4JHY A;  4Y31 A;  3UJL A;  2VNE A;  1E09 A;  2E3Q A;  4JHI A;  4N76 A;  1FSK A;  3P9V A;  3NMP A;  4BTZ A;  2KTE A;  4QIP A;  2E3N A;  2QPV A;  1XFS A;  5BRL A;  5EKQ C;  3HXM A;  2RER A;  2N4B A;  3TFZ A;  2PSO A;  3KDJ A;  5JO1 A;  3NEG A;  4RYV A;  3KDH A;  3TVQ A;  1EM2 A;  4DSC A;  3DLB A;  3HK2 A;  4BK7 A;  3P0L A;  4MAP A;  3NJ0 A;  1TW0 A;  4A83 A;  4DSB A;  2LPX A;  4JHG A;  3KDI A;  1XDF A;  3K3K A;  1JSS A;  2LDK A;  2RES A;  3RT2 A;  1LN1 A;  2GKD A;  4C9C A;  3TL1 A;  4A85 A;  4A8U A;  3NEF A;  4IHR A;  1IFV A;  4REI A;  5C9Y A;  1TXC A;  2PCS A;  1LN3 A;  3PUT A;  4N47 A;  4C94 A;  3QSZ A;  4IGX A;  3NJ1 A;  2LEQ A;  3TVR A;  1B6F A;  3GTS A;  3WG8 A;  4N41 A;  1XN6 A;  3E85 A;  3IE5 A;  1QMR A;  3DLH A;  2N4A A;  3OJI A;  3Q64 A;  4IH2 A;  5E4B A;  4BK6 A;  2L65 A;  4REH A;  3TGO C;  4NCA A;  2KEW A;  2L8O A;  3F73 A;  4E6F A;  1ICX A;  1KCM A;  1XN5 A;  2REZ A;  2Z9Y A;  1BTV A;  2BK0 A;  2I9Y A;  3H3S A;  3W9R A;  5JO2 A;  3HM9 A;  3R6P A;  3RD6 A;  2L9P A;  3GL2 A;  3Q63 A;  4A86 A;  4IGV A;  4A8G A;  5E4D A;  4QDF B;  1VJH A;  3JRS A;  4LGA A;  1BV1 A;  2NN5 A;  3NMV A;  2KF2 A;  2LCG A;  4BKC A;  3GL0 A;  4A81 A;  3NR4 A;  2Z9Z A;  2LIO A;  3NQN A;  3F08 A;  3UID A;  5E46 A;  3KAY A;  1T27 A;  3GTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...