4C9CA

Crystal structure of the strawberry pathogenesis-related 10 (pr-10) fra a 1e protein (form a)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
162
structure length
158
Chain Sequence
b'AMAGVYTYENEFTSDIPAPKLFKAFVLDADNLIPKIAPQAVKCAEILEGDGGPGTIKKITFGYGYVKHKIHSIDKVNHTYSYSLIEGDALSENIEKIDYETKLVSAPHGGTIIKTTSKYHTKGDVEIKEEHVKAGKEKAAHLFKLIEGYLKDHPSEYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR STRAWBERRY ALLERGEN FRA A 1-E
publication title The Strawberry Pathogenesis-Related 10 (Pr-10) Fra a Proteins Control Flavonoid Biosynthesis by Binding to Metabolic Intermediates.
pubmed doi rcsb
source organism Fragaria x ananassa
molecule tags Allergen
total genus 38
structure length 158
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 4c9cA00
2N4BA 3H3SA 3KB0A 1JSSA 3H3TA 3TL1A 1T17A 3NMVA 4C9CA 4IHRA 2E3MA 3P51A 4IH0A 2M47A 4DSBA 3RT0C 1TW0A 4A87A 2IL5A 3KAYA 4N0GC 2L65A 3KAZA 2PCSA 4WVOA 1BTVA 2R55A 1XDFA 2E3SA 4B9RA 4JHHA 4Z3LA 2KCZA 3H3RA 1KCMA 3Q6AA 1XFSA 3F08A 4N3EA 3RT2A 3KDHA 3W9KA 1XUVA 4BK6A 4C94A 3K90A 2VQ5A 4C9IA 1XN6A 4LGBA 4IGWA 2LCGA 2REZA 3NMHA 2QIMA 3NJ0A 3OH8A 3JRQB 3KDIA 3QSZA 1LLTA 4LG5A 4IGYA 3C0VA 3UIDA 2I9YA 4BTZA 2KEWA 2WQLA 1T27A 5C9YA 5JO2A 1ZXFA 3K3KA 4BKDA 3P0LA 1VJHA 2RERA 3KDJA 3KB3A 4A85A 2QPVA 2K7HA 2LIOA 3IJTA 3NS2A 2FLHA 4MA6A 4A83A 2E3NA 2BK0A 3UJLA 4BK7A 4M9WA 1LN2A 2MOUA 4A84A 4A8VA 2LE1A 2GKDA 4REIA 2LGHA 1TXCA 1XN5A 1LN1A 2LUZA 3KLXA 2L9PA 4M9BA 1IFVA 2LEQA 1E09A 1FM4A 5JNNA 3TVRA 4A81A 2LAKA 3GGNA 3ELIA 4JHGA 4LA7A 3H3QA 4IGVA 2E3OA 5I9JA 3NEGA 3NJOA 2LDKA 3NMTA 4LGAA 3RD6A 2D4RA 2NS9A 1UW5A 1Z94A 4QIPA 5E4BA 4GY9A 4MNSA 2E3RA 4A88A 3UQHA 2N4AA 4FPWA 4JHIA 2M89A 4DSCA 3Q63A 4DS8A 4A8UA 3TFZA 3NEFA 3NR4A 3E85A 1BV1A 3JRSA 3TVQA 4XRWA 4BKCA 4IGXA 3OQUA 3OTLA 3PUTA 4PSBA 1H2OA 2PSOA 3Q64A 3NMNA 3CNWA 3NI8A 4OICA 2LPXA 5E4MA 2LF2A 5E46A 3W9RA 2EJXA 3R6PA 2VNEA 3QN1A 2K5GA 3IE5A 3NMPA 2A1LA 5I8FA 2Z9YA 3ZVUA 4REHA 1X53A 4A8GA 4R7KA 3WG8A 2FFSA 4Y31A 3PU2A 2E3PA 4REJA 4JDAA 1ICXA 2Z9ZA 2E3QA 4Q0KA 3NJ1A 4JDLA 5BRLA 5JO1A 2KTEA 2NN5A 3P9VA 4RYVA 3KL1A 4A86A 1LN3A 3FO5A 2RESA 4IH2A 5AMWA 2KF2A 2L8OA 1B6FA 5E4DA 3OJIA 1FSKA 4A80A 4MAPA 1QMRA 2Q3QA 4XRTA 1EM2A
chains in the Genus database with same CATH superfamily
2N4BA 3DLBA 3H3SA 3KB0A 1JSSA 3H3TA 5EKQC 3F73A 3TL1A 1T17A 3NMVA 4C9CA 4IHRA 2E3MA 3GOBA 3P51A 4IH0A 2M47A 4DSBA 3RT0C 1TW0A 4A87A 2IL5A 4KPYA 3KAYA 3GTSA 2L65A 3KAZA 4N0GC 3TGOC 2PCSA 4WVOA 1BTVA 2R55A 1XDFA 2E3SA 4B9RA 4JHHA 4Z3LA 2KCZA 3H3RA 1KCMA 3Q6AA 1XFSA 3F08A 4N3EA 3RT2A 3KDHA 3W9KA 1XUVA 4BK6A 4C94A 3K90A 2VQ5A 4C9IA 1XN6A 4LGBA 4IGWA 2LCGA 2REZA 3NMHA 2QIMA 3NJ0A 3OH8A 3JRQB 3KDIA 3QSZA 4NCBA 1LLTA 4LG5A 4IGYA 3C0VA 3UIDA 2I9YA 4BTZA 4QDFA 2KEWA 2WQLA 1T27A 5C9YA 5JO2A 1ZXFA 3K3KA 4JHYA 4BKDA 3P0LA 3GTEA 1VJHA 2RERA 3KDJA 3KB3A 4A85A 2QPVA 2K7HA 2LIOA 3IJTA 3NS2A 2FLHA 4MA6A 4QCKA 4A83A 2E3NA 2BK0A 3UJLA 4BK7A 4M9WA 1LN2A 2MOUA 4A84A 4A8VA 2LE1A 2GKDA 4REIA 4NCAA 4QDCA 2LAFA 2LGHA 1TXCA 1XN5A 1LN1A 2LUZA 3KLXA 2L9PA 4M9BA 1IFVA 2LEQA 3HVRA 1E09A 1FM4A 5JNNA 3TVRA 4A81A 2LAKA 3HJFA 3GGNA 3ELIA 4JHGA 4LA7A 3H3QA 4IGVA 2E3OA 4E6FA 5I9JA 3NEGA 3NJOA 2LDKA 3NMTA 4LGAA 3RD6A 2D4RA 2NS9A 4N41A 1UW5A 1Z94A 4QIPA 5E4BA 4GY9A 4N76A 4MNSA 2E3RA 4A88A 3UQHA 2N4AA 4FPWA 4JHIA 3HXMA 2M89A 4DSCA 3Q63A 4QDFB 4A8UA 4DS8A 3TFZA 3NEFA 3NR4A 3E85A 1BV1A 3JRSA 4N47A 3GL2A 4XRWA 3TVQA 4IGXA 2YH6A 4BKCA 3OQUA 3OTLA 3PUTA 3HK2A 4PSBA 1H2OA 2PSOA 3Q64A 3NMNA 3CNWA 3NI8A 4OICA 2LPXA 5E4MA 2LF2A 5E46A 3W9RA 2EJXA 3R6PA 2VNEA 3QN1A 3GB4A 2K5GA 3IE5A 3NMPA 2A1LA 5I8FA 2ZYLA 2Z9YA 3ZVUA 4REHA 1X53A 4A8GA 4R7KA 3WG8A 2FFSA 3GKEA 4Y31A 3PU2A 2E3PA 4REJA 3NQNA 4JDAA 1ICXA 2Z9ZA 2E3QA 4Q0KA 3NJ1A 4JDLA 5BRLA 5JO1A 2KTEA 3HO1A 2NN5A 3P9VA 4RYVA 3KL1A 4A86A 1LN3A 3FO5A 2RESA 4IH2A 5AMWA 2KF2A 2L8OA 1B6FA 5E4DA 3OJIA 3HM9A 1FSKA 3DLHA 4A80A 4MAPA 1QMRA 3GL0A 2Q3QA 4QDDA 4XRTA 1EM2A
chains in the Genus database with same CATH topology
2N4BA 3DLBA 3H3SA 3KB0A 1JSSA 3H3TA 5EKQC 3F73A 3TL1A 1T17A 3NMVA 4C9CA 4IHRA 2E3MA 3GOBA 3P51A 4IH0A 2M47A 4DSBA 3RT0C 1TW0A 4A87A 2IL5A 4KPYA 3KAYA 3GTSA 2L65A 3KAZA 4N0GC 3TGOC 2PCSA 4WVOA 1BTVA 2R55A 1XDFA 2E3SA 4B9RA 4JHHA 4Z3LA 2KCZA 3H3RA 1KCMA 3Q6AA 1XFSA 3F08A 4N3EA 3RT2A 3KDHA 3W9KA 1XUVA 4BK6A 4C94A 3K90A 2VQ5A 4C9IA 1XN6A 4LGBA 4IGWA 2LCGA 2REZA 3NMHA 2QIMA 3NJ0A 3OH8A 3JRQB 3KDIA 3QSZA 4NCBA 1LLTA 4LG5A 4IGYA 3C0VA 3UIDA 2I9YA 4BTZA 4QDFA 2KEWA 2WQLA 1T27A 5C9YA 5JO2A 1ZXFA 3K3KA 4JHYA 4BKDA 3P0LA 3GTEA 1VJHA 2RERA 3KDJA 3KB3A 4A85A 2QPVA 2K7HA 2LIOA 3IJTA 3NS2A 2FLHA 4MA6A 4QCKA 4A83A 2E3NA 2BK0A 3UJLA 4BK7A 4M9WA 1LN2A 2MOUA 4A84A 4A8VA 2LE1A 2GKDA 4REIA 4NCAA 4QDCA 2LAFA 2LGHA 1TXCA 1XN5A 1LN1A 2LUZA 3KLXA 2L9PA 4M9BA 1IFVA 2LEQA 3HVRA 1E09A 1FM4A 5JNNA 3TVRA 4A81A 2LAKA 3HJFA 3GGNA 3ELIA 4JHGA 4LA7A 3H3QA 4IGVA 2E3OA 4E6FA 5I9JA 3NEGA 3NJOA 2LDKA 3NMTA 4LGAA 3RD6A 2D4RA 2NS9A 4N41A 1UW5A 1Z94A 4QIPA 5E4BA 4GY9A 4N76A 4MNSA 2E3RA 4A88A 3UQHA 2N4AA 4FPWA 4JHIA 3HXMA 2M89A 4DSCA 3Q63A 4QDFB 4A8UA 4DS8A 3TFZA 3NEFA 3NR4A 3E85A 1BV1A 3JRSA 4N47A 3GL2A 4XRWA 3TVQA 4IGXA 2YH6A 4BKCA 3OQUA 3OTLA 3PUTA 3HK2A 4PSBA 1H2OA 2PSOA 3Q64A 3NMNA 3CNWA 3NI8A 4OICA 2LPXA 5E4MA 2LF2A 5E46A 3W9RA 2EJXA 3R6PA 2VNEA 3QN1A 3GB4A 2K5GA 3IE5A 3NMPA 2A1LA 5I8FA 2ZYLA 2Z9YA 3ZVUA 4REHA 1X53A 4A8GA 4R7KA 3WG8A 2FFSA 3GKEA 4Y31A 3PU2A 2E3PA 4REJA 3NQNA 4JDAA 1ICXA 2Z9ZA 2E3QA 4Q0KA 3NJ1A 4JDLA 5BRLA 5JO1A 2KTEA 3HO1A 2NN5A 3P9VA 4RYVA 3KL1A 4A86A 1LN3A 3FO5A 2RESA 4IH2A 5AMWA 2KF2A 2L8OA 1B6FA 5E4DA 3OJIA 3HM9A 1FSKA 3DLHA 4A80A 4MAPA 1QMRA 3GL0A 2Q3QA 4QDDA 4XRTA 1EM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N4B A;  3H3S A;  3KB0 A;  1JSS A;  3H3T A;  3TL1 A;  1T17 A;  3NMV A;  4C9C A;  4IHR A;  2E3M A;  3P51 A;  4IH0 A;  2M47 A;  4DSB A;  3RT0 C;  1TW0 A;  4A87 A;  2IL5 A;  3KAY A;  4N0G C;  2L65 A;  3KAZ A;  2PCS A;  4WVO A;  1BTV A;  2R55 A;  1XDF A;  2E3S A;  4B9R A;  4JHH A;  4Z3L A;  2KCZ A;  3H3R A;  1KCM A;  3Q6A A;  1XFS A;  3F08 A;  4N3E A;  3RT2 A;  3KDH A;  3W9K A;  1XUV A;  4BK6 A;  4C94 A;  3K90 A;  2VQ5 A;  4C9I A;  1XN6 A;  4LGB A;  4IGW A;  2LCG A;  2REZ A;  3NMH A;  2QIM A;  3NJ0 A;  3OH8 A;  3JRQ B;  3KDI A;  3QSZ A;  1LLT A;  4LG5 A;  4IGY A;  3C0V A;  3UID A;  2I9Y A;  4BTZ A;  2KEW A;  2WQL A;  1T27 A;  5C9Y A;  5JO2 A;  1ZXF A;  3K3K A;  4BKD A;  3P0L A;  1VJH A;  2RER A;  3KDJ A;  3KB3 A;  4A85 A;  2QPV A;  2K7H A;  2LIO A;  3IJT A;  3NS2 A;  2FLH A;  4MA6 A;  4A83 A;  2E3N A;  2BK0 A;  3UJL A;  4BK7 A;  4M9W A;  1LN2 A;  2MOU A;  4A84 A;  4A8V A;  2LE1 A;  2GKD A;  4REI A;  2LGH A;  1TXC A;  1XN5 A;  1LN1 A;  2LUZ A;  3KLX A;  2L9P A;  4M9B A;  1IFV A;  2LEQ A;  1E09 A;  1FM4 A;  5JNN A;  3TVR A;  4A81 A;  2LAK A;  3GGN A;  3ELI A;  4JHG A;  4LA7 A;  3H3Q A;  4IGV A;  2E3O A;  5I9J A;  3NEG A;  3NJO A;  2LDK A;  3NMT A;  4LGA A;  3RD6 A;  2D4R A;  2NS9 A;  1UW5 A;  1Z94 A;  4QIP A;  5E4B A;  4GY9 A;  4MNS A;  2E3R A;  4A88 A;  3UQH A;  2N4A A;  4FPW A;  4JHI A;  2M89 A;  4DSC A;  3Q63 A;  4DS8 A;  4A8U A;  3TFZ A;  3NEF A;  3NR4 A;  3E85 A;  1BV1 A;  3JRS A;  3TVQ A;  4XRW A;  4BKC A;  4IGX A;  3OQU A;  3OTL A;  3PUT A;  4PSB A;  1H2O A;  2PSO A;  3Q64 A;  3NMN A;  3CNW A;  3NI8 A;  4OIC A;  2LPX A;  5E4M A;  2LF2 A;  5E46 A;  3W9R A;  2EJX A;  3R6P A;  2VNE A;  3QN1 A;  2K5G A;  3IE5 A;  3NMP A;  2A1L A;  5I8F A;  2Z9Y A;  3ZVU A;  4REH A;  1X53 A;  4A8G A;  4R7K A;  3WG8 A;  2FFS A;  4Y31 A;  3PU2 A;  2E3P A;  4REJ A;  4JDA A;  1ICX A;  2Z9Z A;  2E3Q A;  4Q0K A;  3NJ1 A;  4JDL A;  5BRL A;  5JO1 A;  2KTE A;  2NN5 A;  3P9V A;  4RYV A;  3KL1 A;  4A86 A;  1LN3 A;  3FO5 A;  2RES A;  4IH2 A;  5AMW A;  2KF2 A;  2L8O A;  1B6F A;  5E4D A;  3OJI A;  1FSK A;  4A80 A;  4MAP A;  1QMR A;  2Q3Q A;  4XRT A;  1EM2 A; 
#chains in the Genus database with same CATH topology
 2N4B A;  3DLB A;  3H3S A;  3KB0 A;  1JSS A;  3H3T A;  5EKQ C;  3F73 A;  3TL1 A;  1T17 A;  3NMV A;  4C9C A;  4IHR A;  2E3M A;  3GOB A;  3P51 A;  4IH0 A;  2M47 A;  4DSB A;  3RT0 C;  1TW0 A;  4A87 A;  2IL5 A;  4KPY A;  3KAY A;  3GTS A;  2L65 A;  3KAZ A;  4N0G C;  3TGO C;  2PCS A;  4WVO A;  1BTV A;  2R55 A;  1XDF A;  2E3S A;  4B9R A;  4JHH A;  4Z3L A;  2KCZ A;  3H3R A;  1KCM A;  3Q6A A;  1XFS A;  3F08 A;  4N3E A;  3RT2 A;  3KDH A;  3W9K A;  1XUV A;  4BK6 A;  4C94 A;  3K90 A;  2VQ5 A;  4C9I A;  1XN6 A;  4LGB A;  4IGW A;  2LCG A;  2REZ A;  3NMH A;  2QIM A;  3NJ0 A;  3OH8 A;  3JRQ B;  3KDI A;  3QSZ A;  4NCB A;  1LLT A;  4LG5 A;  4IGY A;  3C0V A;  3UID A;  2I9Y A;  4BTZ A;  4QDF A;  2KEW A;  2WQL A;  1T27 A;  5C9Y A;  5JO2 A;  1ZXF A;  3K3K A;  4JHY A;  4BKD A;  3P0L A;  3GTE A;  1VJH A;  2RER A;  3KDJ A;  3KB3 A;  4A85 A;  2QPV A;  2K7H A;  2LIO A;  3IJT A;  3NS2 A;  2FLH A;  4MA6 A;  4QCK A;  4A83 A;  2E3N A;  2BK0 A;  3UJL A;  4BK7 A;  4M9W A;  1LN2 A;  2MOU A;  4A84 A;  4A8V A;  2LE1 A;  2GKD A;  4REI A;  4NCA A;  4QDC A;  2LAF A;  2LGH A;  1TXC A;  1XN5 A;  1LN1 A;  2LUZ A;  3KLX A;  2L9P A;  4M9B A;  1IFV A;  2LEQ A;  3HVR A;  1E09 A;  1FM4 A;  5JNN A;  3TVR A;  4A81 A;  2LAK A;  3HJF A;  3GGN A;  3ELI A;  4JHG A;  4LA7 A;  3H3Q A;  4IGV A;  2E3O A;  4E6F A;  5I9J A;  3NEG A;  3NJO A;  2LDK A;  3NMT A;  4LGA A;  3RD6 A;  2D4R A;  2NS9 A;  4N41 A;  1UW5 A;  1Z94 A;  4QIP A;  5E4B A;  4GY9 A;  4N76 A;  4MNS A;  2E3R A;  4A88 A;  3UQH A;  2N4A A;  4FPW A;  4JHI A;  3HXM A;  2M89 A;  4DSC A;  3Q63 A;  4QDF B;  4A8U A;  4DS8 A;  3TFZ A;  3NEF A;  3NR4 A;  3E85 A;  1BV1 A;  3JRS A;  4N47 A;  3GL2 A;  4XRW A;  3TVQ A;  4IGX A;  2YH6 A;  4BKC A;  3OQU A;  3OTL A;  3PUT A;  3HK2 A;  4PSB A;  1H2O A;  2PSO A;  3Q64 A;  3NMN A;  3CNW A;  3NI8 A;  4OIC A;  2LPX A;  5E4M A;  2LF2 A;  5E46 A;  3W9R A;  2EJX A;  3R6P A;  2VNE A;  3QN1 A;  3GB4 A;  2K5G A;  3IE5 A;  3NMP A;  2A1L A;  5I8F A;  2ZYL A;  2Z9Y A;  3ZVU A;  4REH A;  1X53 A;  4A8G A;  4R7K A;  3WG8 A;  2FFS A;  3GKE A;  4Y31 A;  3PU2 A;  2E3P A;  4REJ A;  3NQN A;  4JDA A;  1ICX A;  2Z9Z A;  2E3Q A;  4Q0K A;  3NJ1 A;  4JDL A;  5BRL A;  5JO1 A;  2KTE A;  3HO1 A;  2NN5 A;  3P9V A;  4RYV A;  3KL1 A;  4A86 A;  1LN3 A;  3FO5 A;  2RES A;  4IH2 A;  5AMW A;  2KF2 A;  2L8O A;  1B6F A;  5E4D A;  3OJI A;  3HM9 A;  1FSK A;  3DLH A;  4A80 A;  4MAP A;  1QMR A;  3GL0 A;  2Q3Q A;  4QDD A;  4XRT A;  1EM2 A; 
#chains in the Genus database with same CATH homology
 2N4B A;  3DLB A;  3H3S A;  3KB0 A;  1JSS A;  3H3T A;  5EKQ C;  3F73 A;  3TL1 A;  1T17 A;  3NMV A;  4C9C A;  4IHR A;  2E3M A;  3GOB A;  3P51 A;  4IH0 A;  2M47 A;  4DSB A;  3RT0 C;  1TW0 A;  4A87 A;  2IL5 A;  4KPY A;  3KAY A;  3GTS A;  2L65 A;  3KAZ A;  4N0G C;  3TGO C;  2PCS A;  4WVO A;  1BTV A;  2R55 A;  1XDF A;  2E3S A;  4B9R A;  4JHH A;  4Z3L A;  2KCZ A;  3H3R A;  1KCM A;  3Q6A A;  1XFS A;  3F08 A;  4N3E A;  3RT2 A;  3KDH A;  3W9K A;  1XUV A;  4BK6 A;  4C94 A;  3K90 A;  2VQ5 A;  4C9I A;  1XN6 A;  4LGB A;  4IGW A;  2LCG A;  2REZ A;  3NMH A;  2QIM A;  3NJ0 A;  3OH8 A;  3JRQ B;  3KDI A;  3QSZ A;  4NCB A;  1LLT A;  4LG5 A;  4IGY A;  3C0V A;  3UID A;  2I9Y A;  4BTZ A;  4QDF A;  2KEW A;  2WQL A;  1T27 A;  5C9Y A;  5JO2 A;  1ZXF A;  3K3K A;  4JHY A;  4BKD A;  3P0L A;  3GTE A;  1VJH A;  2RER A;  3KDJ A;  3KB3 A;  4A85 A;  2QPV A;  2K7H A;  2LIO A;  3IJT A;  3NS2 A;  2FLH A;  4MA6 A;  4QCK A;  4A83 A;  2E3N A;  2BK0 A;  3UJL A;  4BK7 A;  4M9W A;  1LN2 A;  2MOU A;  4A84 A;  4A8V A;  2LE1 A;  2GKD A;  4REI A;  4NCA A;  4QDC A;  2LAF A;  2LGH A;  1TXC A;  1XN5 A;  1LN1 A;  2LUZ A;  3KLX A;  2L9P A;  4M9B A;  1IFV A;  2LEQ A;  3HVR A;  1E09 A;  1FM4 A;  5JNN A;  3TVR A;  4A81 A;  2LAK A;  3HJF A;  3GGN A;  3ELI A;  4JHG A;  4LA7 A;  3H3Q A;  4IGV A;  2E3O A;  4E6F A;  5I9J A;  3NEG A;  3NJO A;  2LDK A;  3NMT A;  4LGA A;  3RD6 A;  2D4R A;  2NS9 A;  4N41 A;  1UW5 A;  1Z94 A;  4QIP A;  5E4B A;  4GY9 A;  4N76 A;  4MNS A;  2E3R A;  4A88 A;  3UQH A;  2N4A A;  4FPW A;  4JHI A;  3HXM A;  2M89 A;  4DSC A;  3Q63 A;  4QDF B;  4A8U A;  4DS8 A;  3TFZ A;  3NEF A;  3NR4 A;  3E85 A;  1BV1 A;  3JRS A;  4N47 A;  3GL2 A;  4XRW A;  3TVQ A;  4IGX A;  2YH6 A;  4BKC A;  3OQU A;  3OTL A;  3PUT A;  3HK2 A;  4PSB A;  1H2O A;  2PSO A;  3Q64 A;  3NMN A;  3CNW A;  3NI8 A;  4OIC A;  2LPX A;  5E4M A;  2LF2 A;  5E46 A;  3W9R A;  2EJX A;  3R6P A;  2VNE A;  3QN1 A;  3GB4 A;  2K5G A;  3IE5 A;  3NMP A;  2A1L A;  5I8F A;  2ZYL A;  2Z9Y A;  3ZVU A;  4REH A;  1X53 A;  4A8G A;  4R7K A;  3WG8 A;  2FFS A;  3GKE A;  4Y31 A;  3PU2 A;  2E3P A;  4REJ A;  3NQN A;  4JDA A;  1ICX A;  2Z9Z A;  2E3Q A;  4Q0K A;  3NJ1 A;  4JDL A;  5BRL A;  5JO1 A;  2KTE A;  3HO1 A;  2NN5 A;  3P9V A;  4RYV A;  3KL1 A;  4A86 A;  1LN3 A;  3FO5 A;  2RES A;  4IH2 A;  5AMW A;  2KF2 A;  2L8O A;  1B6F A;  5E4D A;  3OJI A;  3HM9 A;  1FSK A;  3DLH A;  4A80 A;  4MAP A;  1QMR A;  3GL0 A;  2Q3Q A;  4QDD A;  4XRT A;  1EM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...