4C9EA

Mouse znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 (seleno met) crystal form ii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/signaling protein
total genus 37
structure length 153
sequence length 153
chains with identical sequence C, E, G
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9eA00
1Y9ZA 1CX8A 4JZ0A 4P4FA 1V6CA 2OR4A 3IIBA 4P4BA 3D7DA 4P4DA 3BI1A 2C6GA 3BXMA 4OC2A 4X3RA 4C8TA 4TJVA 5F09A 4NGMA 3EIFA 4YN3A 3SJEA 4C8CA 4P4JA 3RBUA 4NGRA 4P44A 2JBKA 4NGSA 4OC5A 3D7FA 4C8PA 4OMEA 4NGPA 4JYWA 2XEFA 4TJXA 3FF3A 5IB9A 2PVVA 3D7GA 3FEDA 3SJXA 4OC4A 3S9NA 2PVWA 2C6CA 4NGTA 4C84A 4KNGE 2EK8A 3I74A 2OOTA 1Z8LA 2XEIA 2CIJA 4OC0A 4C9UA 5ELYA 4NGQA 4MCPA 4C8UA 1DE4C 2EK9A 1WVMA 4MCRA 4LQGA 4C8FA 3IWWA 2XEJA 3S9LA 5D29A 2C6PA 4OC3A 4CDJA 4TWEA 4C9EA 3VTAA 4CDKA 4C9RA 4NGNA 2JBJA 4C9VA 3D7HA 3BHXA 4C8AA 3KASA 3FECA 4W9YA 3SJFA 4P45A 4P4EA 4C9AA 4C86A 4MCSA 4OC1A 2XEGA 1XF1A 3ICUA 4MCQA 3S9MA 4C99A 4P4IA 3I6SA 3BI0A 3FEEA 4C85A 3SJGA
chains in the Genus database with same CATH superfamily
1Y9ZA 1CX8A 1J3LA 4JZ0A 4P4FA 1V6CA 2HWGA 4IIYA 2OR4A 3IIBA 4P4BA 3TLEA 3D7DA 1CE8B 4P4DA 3BI1A 4M8DA 4EYSA 2C6GA 3BXMA 4OC2A 4X3RA 1JDBC 3U1BA 3TLGA 4C8TA 4COBA 4TJVA 5F09A 4NGMA 3EIFA 4YN3A 1Q5XA 3SJEA 4C8CA 4P4JA 3RBUA 4NGRA 4P44A 2JBKA 4NGSA 2AUNA 5IR2A 2AUMA 1KBLA 3K4IA 5K99A 1EZBA 4OC5A 3G23A 3D7FA 1EZAA 3T5MA 5F5XA 3TYXA 4C8PA 2HROA 2D0OA 4OMEA 4NGPA 4JYWA 2XEFA 1T36B 2EZBA 4MI1A 4TJXA 3FF3A 3T07A 2PVVA 3D7GA 5IB9A 5JYBA 3FEDA 2YJVA 3SJXA 1C30B 2GP4A 3C8OA 4OC4A 3S9NA 3KRVA 2PVWA 3EZAA 2C6CA 4J0NA 4NGTA 4C84A 2PCNA 4KNGE 1NXJA 4MJXA 2C5QA 2EK8A 3I74A 2OOTA 1Z8LA 3T0TA 1M6VB 4CO9A 2XEIA 2CIJA 4E5SA 4OC0A 2D0PA 4INJA 4H1HA 2FM4A 4C9UA 5ELYA 4NGQA 3K9TA 3SR3A 1GGOA 1ZYMA 4MCPA 1KEEB 4C8UA 1DE4C 1KC7A 2EK9A 1WVMA 4MCRA 4LQGA 2E28A 3T05A 4C8FA 3IWWA 2XEJA 2DIKA 3TLZA 1ZL0A 1R61A 2YJTA 3TLCA 3S9LA 2OLSA 5D29A 1JDEA 2C6PA 3EZEA 3EZBA 1VBHA 3NOJA 5F1YA 4OC3A 4CDJA 4TWEA 3TLBA 4C9EA 1VBGA 5F9MA 3VTAA 4CDKA 1ZRSA 5JVLA 2HI6A 4C9RA 4NGNA 2JBJA 4C9VA 3D7HA 3BHXA 4C8AA 3KASA 1VI4A 3FECA 4E94A 4W9YA 3SJFA 2EZCA 4JVOA 3GJZA 4P45A 4P4EA 3TLYA 1NBWA 4C86A 4C9AA 4MCSA 4OC1A 5FD8A 2XEGA 1XF1A 3ICUA 1BXRB 4MCQA 1A9XB 4COGA 3S9MA 4C99A 2R82A 2EZAA 2MP0A 2X0SA 4P4IA 3I6SA 3BI0A 3TLAA 1C3OB 3FEEA 2B0AA 1DIKA 4IIXA 4C85A 1CS0B 4CZ1A 3SJGA 3TLGB
chains in the Genus database with same CATH topology
1Y9ZA 1CX8A 4JZ0A 4P4FA 1V6CA 2OR4A 3IIBA 4P4BA 3D7DA 4P4DA 3BI1A 2C6GA 3BXMA 4OC2A 4X3RA 4C8TA 4TJVA 5F09A 4NGMA 3EIFA 4YN3A 3SJEA 4C8CA 4P4JA 3RBUA 4NGRA 4P44A 2JBKA 4NGSA 5IR2A 4OC5A 3D7FA 4C8PA 4OMEA 4NGPA 4JYWA 2XEFA 4TJXA 3FF3A 5IB9A 2PVVA 3D7GA 3FEDA 3SJXA 2GP4A 4OC4A 3S9NA 2PVWA 2C6CA 4NGTA 4C84A 4KNGE 2C5QA 2EK8A 3I74A 2OOTA 1Z8LA 2XEIA 2CIJA 4OC0A 4C9UA 5ELYA 4NGQA 3K9TA 4MCPA 4C8UA 1DE4C 2EK9A 1WVMA 4MCRA 4LQGA 4C8FA 3IWWA 2XEJA 3S9LA 5D29A 2C6PA 4OC3A 4CDJA 4TWEA 4C9EA 3VTAA 4CDKA 4C9RA 4NGNA 2JBJA 4C9VA 3D7HA 3BHXA 4C8AA 3KASA 3FECA 4W9YA 3SJFA 4P45A 4P4EA 4C9AA 4C86A 4MCSA 4OC1A 2XEGA 1XF1A 3ICUA 4MCQA 3S9MA 4C99A 4P4IA 3I6SA 3BI0A 3FEEA 4C85A 3SJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y9Z A;  1CX8 A;  4JZ0 A;  4P4F A;  1V6C A;  2OR4 A;  3IIB A;  4P4B A;  3D7D A;  4P4D A;  3BI1 A;  2C6G A;  3BXM A;  4OC2 A;  4X3R A;  4C8T A;  4TJV A;  5F09 A;  4NGM A;  3EIF A;  4YN3 A;  3SJE A;  4C8C A;  4P4J A;  3RBU A;  4NGR A;  4P44 A;  2JBK A;  4NGS A;  4OC5 A;  3D7F A;  4C8P A;  4OME A;  4NGP A;  4JYW A;  2XEF A;  4TJX A;  3FF3 A;  5IB9 A;  2PVV A;  3D7G A;  3FED A;  3SJX A;  4OC4 A;  3S9N A;  2PVW A;  2C6C A;  4NGT A;  4C84 A;  4KNG E;  2EK8 A;  3I74 A;  2OOT A;  1Z8L A;  2XEI A;  2CIJ A;  4OC0 A;  4C9U A;  5ELY A;  4NGQ A;  4MCP A;  4C8U A;  1DE4 C;  2EK9 A;  1WVM A;  4MCR A;  4LQG A;  4C8F A;  3IWW A;  2XEJ A;  3S9L A;  5D29 A;  2C6P A;  4OC3 A;  4CDJ A;  4TWE A;  4C9E A;  3VTA A;  4CDK A;  4C9R A;  4NGN A;  2JBJ A;  4C9V A;  3D7H A;  3BHX A;  4C8A A;  3KAS A;  3FEC A;  4W9Y A;  3SJF A;  4P45 A;  4P4E A;  4C9A A;  4C86 A;  4MCS A;  4OC1 A;  2XEG A;  1XF1 A;  3ICU A;  4MCQ A;  3S9M A;  4C99 A;  4P4I A;  3I6S A;  3BI0 A;  3FEE A;  4C85 A;  3SJG A; 
#chains in the Genus database with same CATH topology
 1Y9Z A;  1CX8 A;  1J3L A;  4JZ0 A;  4P4F A;  1V6C A;  2HWG A;  4IIY A;  2OR4 A;  3IIB A;  4P4B A;  3TLE A;  3D7D A;  1CE8 B;  4P4D A;  3BI1 A;  4M8D A;  4EYS A;  2C6G A;  3BXM A;  4OC2 A;  4X3R A;  1JDB C;  3U1B A;  3TLG A;  4C8T A;  4COB A;  4TJV A;  5F09 A;  4NGM A;  3EIF A;  4YN3 A;  1Q5X A;  3SJE A;  4C8C A;  4P4J A;  3RBU A;  4NGR A;  4P44 A;  2JBK A;  4NGS A;  2AUN A;  5IR2 A;  2AUM A;  1KBL A;  3K4I A;  5K99 A;  1EZB A;  4OC5 A;  3G23 A;  3D7F A;  1EZA A;  3T5M A;  5F5X A;  3TYX A;  4C8P A;  2HRO A;  2D0O A;  4OME A;  4NGP A;  4JYW A;  2XEF A;  1T36 B;  2EZB A;  4MI1 A;  4TJX A;  3FF3 A;  3T07 A;  2PVV A;  3D7G A;  5IB9 A;  5JYB A;  3FED A;  2YJV A;  3SJX A;  1C30 B;  2GP4 A;  3C8O A;  4OC4 A;  3S9N A;  3KRV A;  2PVW A;  3EZA A;  2C6C A;  4J0N A;  4NGT A;  4C84 A;  2PCN A;  4KNG E;  1NXJ A;  4MJX A;  2C5Q A;  2EK8 A;  3I74 A;  2OOT A;  1Z8L A;  3T0T A;  1M6V B;  4CO9 A;  2XEI A;  2CIJ A;  4E5S A;  4OC0 A;  2D0P A;  4INJ A;  4H1H A;  2FM4 A;  4C9U A;  5ELY A;  4NGQ A;  3K9T A;  3SR3 A;  1GGO A;  1ZYM A;  4MCP A;  1KEE B;  4C8U A;  1DE4 C;  1KC7 A;  2EK9 A;  1WVM A;  4MCR A;  4LQG A;  2E28 A;  3T05 A;  4C8F A;  3IWW A;  2XEJ A;  2DIK A;  3TLZ A;  1ZL0 A;  1R61 A;  2YJT A;  3TLC A;  3S9L A;  2OLS A;  5D29 A;  1JDE A;  2C6P A;  3EZE A;  3EZB A;  1VBH A;  3NOJ A;  5F1Y A;  4OC3 A;  4CDJ A;  4TWE A;  3TLB A;  4C9E A;  1VBG A;  5F9M A;  3VTA A;  4CDK A;  1ZRS A;  5JVL A;  2HI6 A;  4C9R A;  4NGN A;  2JBJ A;  4C9V A;  3D7H A;  3BHX A;  4C8A A;  3KAS A;  1VI4 A;  3FEC A;  4E94 A;  4W9Y A;  3SJF A;  2EZC A;  4JVO A;  3GJZ A;  4P45 A;  4P4E A;  3TLY A;  1NBW A;  4C86 A;  4C9A A;  4MCS A;  4OC1 A;  5FD8 A;  2XEG A;  1XF1 A;  3ICU A;  1BXR B;  4MCQ A;  1A9X B;  4COG A;  3S9M A;  4C99 A;  2R82 A;  2EZA A;  2MP0 A;  2X0S A;  4P4I A;  3I6S A;  3BI0 A;  3TLA A;  1C3O B;  3FEE A;  2B0A A;  1DIK A;  4IIX A;  4C85 A;  1CS0 B;  4CZ1 A;  3SJG A;  3TLG B; 
#chains in the Genus database with same CATH homology
 1Y9Z A;  1CX8 A;  4JZ0 A;  4P4F A;  1V6C A;  2OR4 A;  3IIB A;  4P4B A;  3D7D A;  4P4D A;  3BI1 A;  2C6G A;  3BXM A;  4OC2 A;  4X3R A;  4C8T A;  4TJV A;  5F09 A;  4NGM A;  3EIF A;  4YN3 A;  3SJE A;  4C8C A;  4P4J A;  3RBU A;  4NGR A;  4P44 A;  2JBK A;  4NGS A;  5IR2 A;  4OC5 A;  3D7F A;  4C8P A;  4OME A;  4NGP A;  4JYW A;  2XEF A;  4TJX A;  3FF3 A;  5IB9 A;  2PVV A;  3D7G A;  3FED A;  3SJX A;  2GP4 A;  4OC4 A;  3S9N A;  2PVW A;  2C6C A;  4NGT A;  4C84 A;  4KNG E;  2C5Q A;  2EK8 A;  3I74 A;  2OOT A;  1Z8L A;  2XEI A;  2CIJ A;  4OC0 A;  4C9U A;  5ELY A;  4NGQ A;  3K9T A;  4MCP A;  4C8U A;  1DE4 C;  2EK9 A;  1WVM A;  4MCR A;  4LQG A;  4C8F A;  3IWW A;  2XEJ A;  3S9L A;  5D29 A;  2C6P A;  4OC3 A;  4CDJ A;  4TWE A;  4C9E A;  3VTA A;  4CDK A;  4C9R A;  4NGN A;  2JBJ A;  4C9V A;  3D7H A;  3BHX A;  4C8A A;  3KAS A;  3FEC A;  4W9Y A;  3SJF A;  4P45 A;  4P4E A;  4C9A A;  4C86 A;  4MCS A;  4OC1 A;  2XEG A;  1XF1 A;  3ICU A;  4MCQ A;  3S9M A;  4C99 A;  4P4I A;  3I6S A;  3BI0 A;  3FEE A;  4C85 A;  3SJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...