4C9EA

Mouse znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 (seleno met) crystal form ii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/signaling protein
total genus 37
structure length 153
sequence length 153
chains with identical sequence C, E, G
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9eA00
4OC5A 1XF1A 3I74A 4C8FA 4OC3A 4NGRA 3BI0A 2C6GA 3SJEA 1Z8LA 4C86A 2XEGA 4P4EA 4TJVA 4C9VA 3BHXA 4OC2A 4C8PA 4MCRA 3FECA 4C9AA 4C8TA 3FF3A 4KNGE 4C99A 2OR4A 3VTAA 3I6SA 4C8AA 4MCSA 3IIBA 3RBUA 4P44A 3S9MA 3D7HA 2CIJA 3SJGA 4C9EA 4C8CA 3EIFA 3S9NA 4P4FA 3SJFA 4YN3A 4NGNA 2PVWA 4NGSA 4C9UA 4LQGA 3D7FA 4C84A 4P45A 4P4IA 4JZ0A 4P4BA 1WVMA 1Y9ZA 2XEFA 3FEEA 3SJXA 4OC4A 3KASA 4TWEA 4CDKA 5ELYA 2C6CA 5IB9A 3IWWA 5D29A 3D7DA 4JYWA 4OC0A 4OMEA 4CDJA 4P4DA 2EK8A 2XEIA 4C85A 4NGTA 3S9LA 3D7GA 4TJXA 2JBJA 3ICUA 4NGMA 4NGQA 4NGPA 4X3RA 4W9YA 4C8UA 4C9RA 5F09A 2XEJA 1CX8A 4MCQA 3BXMA 4OC1A 2PVVA 2OOTA 4P4JA 2C6PA 1DE4C 4MCPA 2EK9A 1V6CA 3FEDA 2JBKA 3BI1A
chains in the Genus database with same CATH superfamily
4OC5A 1XF1A 3I74A 4C8FA 4MI1A 3U1BA 1C30B 4OC3A 3C8OA 4NGRA 1M6VB 2EZAA 1ZL0A 2YJTA 3BI0A 2D0PA 4COGA 4IIYA 3TLEA 2C6GA 3SJEA 5JYBA 1Z8LA 1VBGA 4C86A 2XEGA 4P4EA 4TJVA 5F9MA 3BHXA 4C9VA 2OLSA 4JVOA 4OC2A 3K4IA 1T36B 4C8PA 1JDBC 3EZEA 4MCRA 1NXJA 2GP4A 1Q5XA 3FECA 2AUMA 4C9AA 4C8TA 3G23A 1EZBA 1R61A 3FF3A 4KNGE 2EZCA 2OR4A 4MJXA 4C99A 2B0AA 3VTAA 3TLBA 4M8DA 3I6SA 4C8AA 2D0OA 4COBA 4MCSA 3IIBA 3TLGA 2PCNA 4P44A 3RBUA 3S9MA 3D7HA 2CIJA 3SJGA 4C9EA 4H1HA 4C8CA 4INJA 3TLCA 3T5MA 3EIFA 1A9XB 3EZAA 4J0NA 3S9NA 2X0SA 4P4FA 1BXRB 3SJFA 4YN3A 4NGNA 2PVWA 4NGSA 4C9UA 4E94A 3TLZA 3K9TA 4LQGA 5JVLA 3EZBA 3D7FA 4C84A 4P45A 2C5QA 2E28A 1KBLA 4P4IA 5IR2A 4JZ0A 4P4BA 4EYSA 3TLYA 1GGOA 1WVMA 1Y9ZA 2XEFA 3FEEA 3SJXA 1J3LA 4IIXA 1DIKA 4OC4A 3KASA 4TWEA 3SR3A 4CDKA 5ELYA 2HWGA 2C6CA 5IB9A 2AUNA 3IWWA 5F1YA 3GJZA 5D29A 3D7DA 1NBWA 2EZBA 2MP0A 4JYWA 4OC0A 4OMEA 3TLGB 4CDJA 1EZAA 3TYXA 2HROA 4P4DA 1KC7A 2EK8A 2XEIA 4C85A 4NGTA 1ZYMA 3T0TA 3S9LA 3D7GA 4TJXA 2JBJA 3ICUA 1CS0B 4NGMA 4NGQA 1C3OB 1VBHA 1ZRSA 4NGPA 4X3RA 4W9YA 4C8UA 4CZ1A 4C9RA 5F09A 2XEJA 3T07A 1CE8B 1CX8A 2HI6A 3TLAA 4CO9A 4MCQA 2DIKA 3KRVA 3BXMA 1VI4A 3NOJA 4OC1A 5F5XA 2PVVA 4E5SA 2OOTA 5K99A 4P4JA 1DE4C 2C6PA 5FD8A 4MCPA 3T05A 2EK9A 1KEEB 2FM4A 1JDEA 2R82A 1V6CA 3FEDA 2JBKA 3BI1A 2YJVA
chains in the Genus database with same CATH topology
4OC5A 1XF1A 3I74A 4C8FA 4OC3A 4NGRA 3BI0A 2C6GA 3SJEA 1Z8LA 4C86A 2XEGA 4P4EA 4TJVA 4C9VA 3BHXA 4OC2A 4C8PA 4MCRA 2GP4A 3FECA 4C9AA 4C8TA 3FF3A 4KNGE 4C99A 2OR4A 3VTAA 3I6SA 4C8AA 4MCSA 3IIBA 3RBUA 4P44A 3S9MA 3D7HA 2CIJA 3SJGA 4C9EA 4C8CA 3EIFA 3S9NA 4P4FA 3SJFA 4YN3A 4NGNA 2PVWA 4NGSA 4C9UA 3K9TA 4LQGA 3D7FA 4C84A 4P45A 2C5QA 4P4IA 5IR2A 4JZ0A 4P4BA 1WVMA 1Y9ZA 2XEFA 3FEEA 3SJXA 4OC4A 3KASA 4TWEA 4CDKA 5ELYA 2C6CA 5IB9A 3IWWA 5D29A 3D7DA 4JYWA 4OC0A 4OMEA 4CDJA 4P4DA 2EK8A 2XEIA 4C85A 4NGTA 3S9LA 3D7GA 4TJXA 2JBJA 3ICUA 4NGMA 4NGQA 4NGPA 4X3RA 4W9YA 4C8UA 4C9RA 5F09A 2XEJA 1CX8A 4MCQA 3BXMA 4OC1A 2PVVA 2OOTA 4P4JA 2C6PA 1DE4C 4MCPA 2EK9A 1V6CA 3FEDA 2JBKA 3BI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OC5 A;  1XF1 A;  3I74 A;  4C8F A;  4OC3 A;  4NGR A;  3BI0 A;  2C6G A;  3SJE A;  1Z8L A;  4C86 A;  2XEG A;  4P4E A;  4TJV A;  4C9V A;  3BHX A;  4OC2 A;  4C8P A;  4MCR A;  3FEC A;  4C9A A;  4C8T A;  3FF3 A;  4KNG E;  4C99 A;  2OR4 A;  3VTA A;  3I6S A;  4C8A A;  4MCS A;  3IIB A;  3RBU A;  4P44 A;  3S9M A;  3D7H A;  2CIJ A;  3SJG A;  4C9E A;  4C8C A;  3EIF A;  3S9N A;  4P4F A;  3SJF A;  4YN3 A;  4NGN A;  2PVW A;  4NGS A;  4C9U A;  4LQG A;  3D7F A;  4C84 A;  4P45 A;  4P4I A;  4JZ0 A;  4P4B A;  1WVM A;  1Y9Z A;  2XEF A;  3FEE A;  3SJX A;  4OC4 A;  3KAS A;  4TWE A;  4CDK A;  5ELY A;  2C6C A;  5IB9 A;  3IWW A;  5D29 A;  3D7D A;  4JYW A;  4OC0 A;  4OME A;  4CDJ A;  4P4D A;  2EK8 A;  2XEI A;  4C85 A;  4NGT A;  3S9L A;  3D7G A;  4TJX A;  2JBJ A;  3ICU A;  4NGM A;  4NGQ A;  4NGP A;  4X3R A;  4W9Y A;  4C8U A;  4C9R A;  5F09 A;  2XEJ A;  1CX8 A;  4MCQ A;  3BXM A;  4OC1 A;  2PVV A;  2OOT A;  4P4J A;  2C6P A;  1DE4 C;  4MCP A;  2EK9 A;  1V6C A;  3FED A;  2JBK A;  3BI1 A; 
#chains in the Genus database with same CATH topology
 4OC5 A;  1XF1 A;  3I74 A;  4C8F A;  4MI1 A;  3U1B A;  1C30 B;  4OC3 A;  3C8O A;  4NGR A;  1M6V B;  2EZA A;  1ZL0 A;  2YJT A;  3BI0 A;  2D0P A;  4COG A;  4IIY A;  3TLE A;  2C6G A;  3SJE A;  5JYB A;  1Z8L A;  1VBG A;  4C86 A;  2XEG A;  4P4E A;  4TJV A;  5F9M A;  3BHX A;  4C9V A;  2OLS A;  4JVO A;  4OC2 A;  3K4I A;  1T36 B;  4C8P A;  1JDB C;  3EZE A;  4MCR A;  1NXJ A;  2GP4 A;  1Q5X A;  3FEC A;  2AUM A;  4C9A A;  4C8T A;  3G23 A;  1EZB A;  1R61 A;  3FF3 A;  4KNG E;  2EZC A;  2OR4 A;  4MJX A;  4C99 A;  2B0A A;  3VTA A;  3TLB A;  4M8D A;  3I6S A;  4C8A A;  2D0O A;  4COB A;  4MCS A;  3IIB A;  3TLG A;  2PCN A;  4P44 A;  3RBU A;  3S9M A;  3D7H A;  2CIJ A;  3SJG A;  4C9E A;  4H1H A;  4C8C A;  4INJ A;  3TLC A;  3T5M A;  3EIF A;  1A9X B;  3EZA A;  4J0N A;  3S9N A;  2X0S A;  4P4F A;  1BXR B;  3SJF A;  4YN3 A;  4NGN A;  2PVW A;  4NGS A;  4C9U A;  4E94 A;  3TLZ A;  3K9T A;  4LQG A;  5JVL A;  3EZB A;  3D7F A;  4C84 A;  4P45 A;  2C5Q A;  2E28 A;  1KBL A;  4P4I A;  5IR2 A;  4JZ0 A;  4P4B A;  4EYS A;  3TLY A;  1GGO A;  1WVM A;  1Y9Z A;  2XEF A;  3FEE A;  3SJX A;  1J3L A;  4IIX A;  1DIK A;  4OC4 A;  3KAS A;  4TWE A;  3SR3 A;  4CDK A;  5ELY A;  2HWG A;  2C6C A;  5IB9 A;  2AUN A;  3IWW A;  5F1Y A;  3GJZ A;  5D29 A;  3D7D A;  1NBW A;  2EZB A;  2MP0 A;  4JYW A;  4OC0 A;  4OME A;  3TLG B;  4CDJ A;  1EZA A;  3TYX A;  2HRO A;  4P4D A;  1KC7 A;  2EK8 A;  2XEI A;  4C85 A;  4NGT A;  1ZYM A;  3T0T A;  3S9L A;  3D7G A;  4TJX A;  2JBJ A;  3ICU A;  1CS0 B;  4NGM A;  4NGQ A;  1C3O B;  1VBH A;  1ZRS A;  4NGP A;  4X3R A;  4W9Y A;  4C8U A;  4CZ1 A;  4C9R A;  5F09 A;  2XEJ A;  3T07 A;  1CE8 B;  1CX8 A;  2HI6 A;  3TLA A;  4CO9 A;  4MCQ A;  2DIK A;  3KRV A;  3BXM A;  1VI4 A;  3NOJ A;  4OC1 A;  5F5X A;  2PVV A;  4E5S A;  2OOT A;  5K99 A;  4P4J A;  1DE4 C;  2C6P A;  5FD8 A;  4MCP A;  3T05 A;  2EK9 A;  1KEE B;  2FM4 A;  1JDE A;  2R82 A;  1V6C A;  3FED A;  2JBK A;  3BI1 A;  2YJV A; 
#chains in the Genus database with same CATH homology
 4OC5 A;  1XF1 A;  3I74 A;  4C8F A;  4OC3 A;  4NGR A;  3BI0 A;  2C6G A;  3SJE A;  1Z8L A;  4C86 A;  2XEG A;  4P4E A;  4TJV A;  4C9V A;  3BHX A;  4OC2 A;  4C8P A;  4MCR A;  2GP4 A;  3FEC A;  4C9A A;  4C8T A;  3FF3 A;  4KNG E;  4C99 A;  2OR4 A;  3VTA A;  3I6S A;  4C8A A;  4MCS A;  3IIB A;  3RBU A;  4P44 A;  3S9M A;  3D7H A;  2CIJ A;  3SJG A;  4C9E A;  4C8C A;  3EIF A;  3S9N A;  4P4F A;  3SJF A;  4YN3 A;  4NGN A;  2PVW A;  4NGS A;  4C9U A;  3K9T A;  4LQG A;  3D7F A;  4C84 A;  4P45 A;  2C5Q A;  4P4I A;  5IR2 A;  4JZ0 A;  4P4B A;  1WVM A;  1Y9Z A;  2XEF A;  3FEE A;  3SJX A;  4OC4 A;  3KAS A;  4TWE A;  4CDK A;  5ELY A;  2C6C A;  5IB9 A;  3IWW A;  5D29 A;  3D7D A;  4JYW A;  4OC0 A;  4OME A;  4CDJ A;  4P4D A;  2EK8 A;  2XEI A;  4C85 A;  4NGT A;  3S9L A;  3D7G A;  4TJX A;  2JBJ A;  3ICU A;  4NGM A;  4NGQ A;  4NGP A;  4X3R A;  4W9Y A;  4C8U A;  4C9R A;  5F09 A;  2XEJ A;  1CX8 A;  4MCQ A;  3BXM A;  4OC1 A;  2PVV A;  2OOT A;  4P4J A;  2C6P A;  1DE4 C;  4MCP A;  2EK9 A;  1V6C A;  3FED A;  2JBK A;  3BI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...