4C9EA

Mouse znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 (seleno met) crystal form ii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/signaling protein
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 37
structure length 153
sequence length 153
chains with identical sequence C, E, G
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9eA00
3RBUA 4C99A 4NGRA 3I74A 4OMEA 3IWWA 4C9VA 3FEDA 3BHXA 1DE4C 4C84A 3D7FA 2EK9A 2OR4A 3D7DA 3SJXA 4C9UA 3FF3A 4MCRA 4P45A 2EK8A 4OC1A 5IB9A 4C9AA 4JYWA 4C8FA 4P4DA 4MCSA 3SJFA 2CIJA 4OC3A 4C8AA 3D7GA 4W9YA 4YN3A 4P4JA 4CDJA 3EIFA 4C86A 4P4FA 4P4IA 4CDKA 4NGPA 3BI1A 4X3RA 5F09A 4P44A 1WVMA 3S9LA 4C85A 4NGSA 3VTAA 3BI0A 2XEFA 4MCQA 3S9MA 4P4BA 3BXMA 4NGNA 2OOTA 5D29A 2XEGA 4KNGE 2JBKA 4C9EA 5ELYA 3SJGA 4C8UA 3ICUA 2C6CA 3D7HA 4TJXA 2PVVA 4NGTA 3KASA 4C8TA 4LQGA 1XF1A 4MCPA 4JZ0A 4TJVA 2XEJA 3SJEA 4OC5A 4P4EA 1V6CA 4OC4A 2XEIA 4NGMA 4C8CA 2C6GA 1Z8LA 3FEEA 1CX8A 2PVWA 4TWEA 4OC0A 3FECA 3I6SA 2JBJA 4C8PA 4NGQA 2C6PA 4OC2A 4C9RA 1Y9ZA 3IIBA 3S9NA
chains in the Genus database with same CATH superfamily
4COGA 2EZAA 3RBUA 3TLZA 4C99A 4NGRA 3I74A 4OMEA 3IWWA 3EZEA 4C9VA 3TLGA 5K99A 5F1YA 3FEDA 3BHXA 1DE4C 4C84A 3KRVA 3D7FA 2EK9A 2OR4A 3K9TA 3D7DA 3SJXA 1KEEB 2E28A 4EYSA 4CO9A 3TYXA 4C9UA 2X0SA 3FF3A 4MCRA 4P45A 2EK8A 3T5MA 1GGOA 3TLAA 1KC7A 1R61A 4OC1A 3T0TA 5JVLA 2YJTA 5IB9A 4C9AA 2DIKA 4JYWA 4C8FA 3G23A 3T05A 4P4DA 4MCSA 3SJFA 1CS0B 2CIJA 4OC3A 4C8AA 3D7GA 4W9YA 5F9MA 4YN3A 5IR2A 4P4JA 2YJVA 3K4IA 1ZL0A 1C30B 4CDJA 2GP4A 5F5XA 1JDEA 3EIFA 4C86A 4P4FA 1M6VB 4P4IA 2HWGA 4CDKA 1Q5XA 3EZAA 4NGPA 1J3LA 3BI1A 4X3RA 5F09A 2AUMA 2EZCA 1ZRSA 4P44A 4MJXA 1WVMA 1EZAA 3S9LA 1VI4A 4C85A 3TLYA 4NGSA 3VTAA 3BI0A 2XEFA 4MCQA 3TLBA 1JDBC 3S9MA 4P4BA 4J0NA 2EZBA 3BXMA 3TLGB 4COBA 3TLCA 4NGNA 2OOTA 5D29A 1VBHA 2XEGA 4KNGE 2JBKA 4C9EA 2FM4A 5ELYA 2AUNA 3SJGA 4C8UA 1BXRB 3ICUA 2C6CA 3D7HA 4TJXA 2PVVA 2OLSA 3TLEA 4NGTA 3NOJA 1T36B 1A9XB 3KASA 2C5QA 1EZBA 1CE8B 4C8TA 1VBGA 2D0OA 4LQGA 4IIXA 5JYBA 1XF1A 2MP0A 4MCPA 1ZYMA 4E94A 4JZ0A 4TJVA 2XEJA 3SJEA 4OC5A 4P4EA 3C8OA 1V6CA 4OC4A 2XEIA 4JVOA 5FD8A 3GJZA 4NGMA 2D0PA 4C8CA 1NBWA 2C6GA 1Z8LA 3FEEA 4IIYA 4H1HA 1KBLA 1CX8A 2PVWA 4TWEA 1NXJA 1C3OB 4OC0A 3FECA 2HI6A 3SR3A 3I6SA 4E5SA 4M8DA 2JBJA 2R82A 4C8PA 3EZBA 4NGQA 2C6PA 2B0AA 4MI1A 3T07A 1DIKA 2PCNA 4OC2A 4C9RA 4INJA 2HROA 4CZ1A 3U1BA 1Y9ZA 3IIBA 3S9NA
chains in the Genus database with same CATH topology
3RBUA 4C99A 4NGRA 3I74A 4OMEA 3IWWA 4C9VA 3FEDA 3BHXA 1DE4C 4C84A 3D7FA 2EK9A 2OR4A 3K9TA 3D7DA 3SJXA 4C9UA 3FF3A 4MCRA 4P45A 2EK8A 4OC1A 5IB9A 4C9AA 4JYWA 4C8FA 4P4DA 4MCSA 3SJFA 2CIJA 4OC3A 4C8AA 3D7GA 4W9YA 4YN3A 5IR2A 4P4JA 4CDJA 2GP4A 3EIFA 4C86A 4P4FA 4P4IA 4CDKA 4NGPA 3BI1A 4X3RA 5F09A 4P44A 1WVMA 3S9LA 4C85A 4NGSA 3VTAA 3BI0A 2XEFA 4MCQA 3S9MA 4P4BA 3BXMA 4NGNA 2OOTA 5D29A 2XEGA 4KNGE 2JBKA 4C9EA 5ELYA 3SJGA 4C8UA 3ICUA 2C6CA 3D7HA 4TJXA 2PVVA 4NGTA 3KASA 2C5QA 4C8TA 4LQGA 1XF1A 4MCPA 4JZ0A 4TJVA 2XEJA 3SJEA 4OC5A 4P4EA 1V6CA 4OC4A 2XEIA 4NGMA 4C8CA 2C6GA 1Z8LA 3FEEA 1CX8A 2PVWA 4TWEA 4OC0A 3FECA 3I6SA 2JBJA 4C8PA 4NGQA 2C6PA 4OC2A 4C9RA 1Y9ZA 3IIBA 3S9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RBU A;  4C99 A;  4NGR A;  3I74 A;  4OME A;  3IWW A;  4C9V A;  3FED A;  3BHX A;  1DE4 C;  4C84 A;  3D7F A;  2EK9 A;  2OR4 A;  3D7D A;  3SJX A;  4C9U A;  3FF3 A;  4MCR A;  4P45 A;  2EK8 A;  4OC1 A;  5IB9 A;  4C9A A;  4JYW A;  4C8F A;  4P4D A;  4MCS A;  3SJF A;  2CIJ A;  4OC3 A;  4C8A A;  3D7G A;  4W9Y A;  4YN3 A;  4P4J A;  4CDJ A;  3EIF A;  4C86 A;  4P4F A;  4P4I A;  4CDK A;  4NGP A;  3BI1 A;  4X3R A;  5F09 A;  4P44 A;  1WVM A;  3S9L A;  4C85 A;  4NGS A;  3VTA A;  3BI0 A;  2XEF A;  4MCQ A;  3S9M A;  4P4B A;  3BXM A;  4NGN A;  2OOT A;  5D29 A;  2XEG A;  4KNG E;  2JBK A;  4C9E A;  5ELY A;  3SJG A;  4C8U A;  3ICU A;  2C6C A;  3D7H A;  4TJX A;  2PVV A;  4NGT A;  3KAS A;  4C8T A;  4LQG A;  1XF1 A;  4MCP A;  4JZ0 A;  4TJV A;  2XEJ A;  3SJE A;  4OC5 A;  4P4E A;  1V6C A;  4OC4 A;  2XEI A;  4NGM A;  4C8C A;  2C6G A;  1Z8L A;  3FEE A;  1CX8 A;  2PVW A;  4TWE A;  4OC0 A;  3FEC A;  3I6S A;  2JBJ A;  4C8P A;  4NGQ A;  2C6P A;  4OC2 A;  4C9R A;  1Y9Z A;  3IIB A;  3S9N A; 
#chains in the Genus database with same CATH topology
 4COG A;  2EZA A;  3RBU A;  3TLZ A;  4C99 A;  4NGR A;  3I74 A;  4OME A;  3IWW A;  3EZE A;  4C9V A;  3TLG A;  5K99 A;  5F1Y A;  3FED A;  3BHX A;  1DE4 C;  4C84 A;  3KRV A;  3D7F A;  2EK9 A;  2OR4 A;  3K9T A;  3D7D A;  3SJX A;  1KEE B;  2E28 A;  4EYS A;  4CO9 A;  3TYX A;  4C9U A;  2X0S A;  3FF3 A;  4MCR A;  4P45 A;  2EK8 A;  3T5M A;  1GGO A;  3TLA A;  1KC7 A;  1R61 A;  4OC1 A;  3T0T A;  5JVL A;  2YJT A;  5IB9 A;  4C9A A;  2DIK A;  4JYW A;  4C8F A;  3G23 A;  3T05 A;  4P4D A;  4MCS A;  3SJF A;  1CS0 B;  2CIJ A;  4OC3 A;  4C8A A;  3D7G A;  4W9Y A;  5F9M A;  4YN3 A;  5IR2 A;  4P4J A;  2YJV A;  3K4I A;  1ZL0 A;  1C30 B;  4CDJ A;  2GP4 A;  5F5X A;  1JDE A;  3EIF A;  4C86 A;  4P4F A;  1M6V B;  4P4I A;  2HWG A;  4CDK A;  1Q5X A;  3EZA A;  4NGP A;  1J3L A;  3BI1 A;  4X3R A;  5F09 A;  2AUM A;  2EZC A;  1ZRS A;  4P44 A;  4MJX A;  1WVM A;  1EZA A;  3S9L A;  1VI4 A;  4C85 A;  3TLY A;  4NGS A;  3VTA A;  3BI0 A;  2XEF A;  4MCQ A;  3TLB A;  1JDB C;  3S9M A;  4P4B A;  4J0N A;  2EZB A;  3BXM A;  3TLG B;  4COB A;  3TLC A;  4NGN A;  2OOT A;  5D29 A;  1VBH A;  2XEG A;  4KNG E;  2JBK A;  4C9E A;  2FM4 A;  5ELY A;  2AUN A;  3SJG A;  4C8U A;  1BXR B;  3ICU A;  2C6C A;  3D7H A;  4TJX A;  2PVV A;  2OLS A;  3TLE A;  4NGT A;  3NOJ A;  1T36 B;  1A9X B;  3KAS A;  2C5Q A;  1EZB A;  1CE8 B;  4C8T A;  1VBG A;  2D0O A;  4LQG A;  4IIX A;  5JYB A;  1XF1 A;  2MP0 A;  4MCP A;  1ZYM A;  4E94 A;  4JZ0 A;  4TJV A;  2XEJ A;  3SJE A;  4OC5 A;  4P4E A;  3C8O A;  1V6C A;  4OC4 A;  2XEI A;  4JVO A;  5FD8 A;  3GJZ A;  4NGM A;  2D0P A;  4C8C A;  1NBW A;  2C6G A;  1Z8L A;  3FEE A;  4IIY A;  4H1H A;  1KBL A;  1CX8 A;  2PVW A;  4TWE A;  1NXJ A;  1C3O B;  4OC0 A;  3FEC A;  2HI6 A;  3SR3 A;  3I6S A;  4E5S A;  4M8D A;  2JBJ A;  2R82 A;  4C8P A;  3EZB A;  4NGQ A;  2C6P A;  2B0A A;  4MI1 A;  3T07 A;  1DIK A;  2PCN A;  4OC2 A;  4C9R A;  4INJ A;  2HRO A;  4CZ1 A;  3U1B A;  1Y9Z A;  3IIB A;  3S9N A; 
#chains in the Genus database with same CATH homology
 3RBU A;  4C99 A;  4NGR A;  3I74 A;  4OME A;  3IWW A;  4C9V A;  3FED A;  3BHX A;  1DE4 C;  4C84 A;  3D7F A;  2EK9 A;  2OR4 A;  3K9T A;  3D7D A;  3SJX A;  4C9U A;  3FF3 A;  4MCR A;  4P45 A;  2EK8 A;  4OC1 A;  5IB9 A;  4C9A A;  4JYW A;  4C8F A;  4P4D A;  4MCS A;  3SJF A;  2CIJ A;  4OC3 A;  4C8A A;  3D7G A;  4W9Y A;  4YN3 A;  5IR2 A;  4P4J A;  4CDJ A;  2GP4 A;  3EIF A;  4C86 A;  4P4F A;  4P4I A;  4CDK A;  4NGP A;  3BI1 A;  4X3R A;  5F09 A;  4P44 A;  1WVM A;  3S9L A;  4C85 A;  4NGS A;  3VTA A;  3BI0 A;  2XEF A;  4MCQ A;  3S9M A;  4P4B A;  3BXM A;  4NGN A;  2OOT A;  5D29 A;  2XEG A;  4KNG E;  2JBK A;  4C9E A;  5ELY A;  3SJG A;  4C8U A;  3ICU A;  2C6C A;  3D7H A;  4TJX A;  2PVV A;  4NGT A;  3KAS A;  2C5Q A;  4C8T A;  4LQG A;  1XF1 A;  4MCP A;  4JZ0 A;  4TJV A;  2XEJ A;  3SJE A;  4OC5 A;  4P4E A;  1V6C A;  4OC4 A;  2XEI A;  4NGM A;  4C8C A;  2C6G A;  1Z8L A;  3FEE A;  1CX8 A;  2PVW A;  4TWE A;  4OC0 A;  3FEC A;  3I6S A;  2JBJ A;  4C8P A;  4NGQ A;  2C6P A;  4OC2 A;  4C9R A;  1Y9Z A;  3IIB A;  3S9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...