4C9EA

Mouse znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 (seleno met) crystal form ii
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
KETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/signaling protein
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 37
structure length 153
sequence length 153
chains with identical sequence C, E, G
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4c9eA00
3I6SA 4NGNA 4C86A 3KASA 2EK8A 3D7DA 3I74A 2C6GA 4C8CA 4P44A 4C84A 3ICUA 4KNGE 2PVWA 3SJXA 3FF3A 4W9YA 5F09A 3D7HA 2JBKA 4NGQA 2C6CA 3BHXA 3BI1A 4MCPA 3FEEA 4C99A 4JZ0A 4C9RA 4JYWA 2C6PA 3BXMA 2CIJA 2OOTA 4TJXA 1Y9ZA 3EIFA 4NGTA 4X3RA 1Z8LA 2JBJA 2EK9A 4P4FA 4P45A 3S9MA 2XEJA 3IIBA 4MCQA 4NGSA 3S9NA 4LQGA 5D29A 3IWWA 4C9UA 4CDJA 5IB9A 1V6CA 4NGRA 1XF1A 4P4IA 4OC2A 4OC0A 3D7GA 3FECA 4C9EA 3D7FA 4C9AA 4C85A 4CDKA 2XEFA 4P4EA 3RBUA 4OC3A 4OMEA 2PVVA 4OC4A 3S9LA 1CX8A 4P4DA 3VTAA 4C9VA 4OC5A 3FEDA 4C8UA 2XEIA 4P4BA 4NGMA 4NGPA 4C8AA 4OC1A 4C8PA 4MCSA 4P4JA 4MCRA 2OR4A 4TWEA 4C8FA 2XEGA 1DE4C 3BI0A 4TJVA 3SJEA 1WVMA 4C8TA 3SJGA 3SJFA 4YN3A 5ELYA
chains in the Genus database with same CATH superfamily
2D0PA 2HWGA 3I6SA 4NGNA 4JVOA 2EZCA 1BXRB 3T05A 3TLBA 4C86A 3KASA 2EK8A 3TLAA 3D7DA 3I74A 2C6GA 4J0NA 1Q5XA 3C8OA 2PCNA 3KRVA 5F1YA 2B0AA 5IR2A 4C8CA 4P44A 4C84A 3ICUA 3GJZA 1KBLA 1NBWA 4MJXA 4KNGE 2PVWA 2AUMA 3SJXA 3FF3A 4W9YA 5F09A 3D7HA 2JBKA 2E28A 4NGQA 3TLYA 2C6CA 3BHXA 3BI1A 4MCPA 5F9MA 3FEEA 4C99A 4JZ0A 1C3OB 3EZBA 4C9RA 2EZAA 4JYWA 2C6PA 2EZBA 3BXMA 1J3LA 4IIYA 2YJTA 3G23A 2CIJA 2OOTA 2C5QA 2HI6A 1Y9ZA 4NGTA 3EIFA 4TJXA 4X3RA 1Z8LA 1A9XB 2AUNA 3U1BA 5FD8A 1ZYMA 2JBJA 4EYSA 4CZ1A 3T07A 1NXJA 3T0TA 2EK9A 4P4FA 3TLZA 4P45A 3S9MA 2XEJA 3IIBA 4MCQA 2YJVA 4NGSA 4E94A 1GGOA 3S9NA 1VI4A 4LQGA 1VBGA 5D29A 3IWWA 1CE8B 1M6VB 1JDBC 1R61A 4CO9A 4C9UA 4CDJA 5IB9A 1JDEA 1V6CA 4NGRA 3TLGA 4COBA 1XF1A 4P4IA 2GP4A 1KEEB 4OC2A 3EZEA 4OC0A 3D7GA 3FECA 1CS0B 4C9EA 1VBHA 1T36B 3D7FA 4C9AA 4C85A 4CDKA 2XEFA 4P4EA 1C30B 3RBUA 4OC3A 4OMEA 2PVVA 4OC4A 1EZBA 3S9LA 1CX8A 1ZRSA 4P4DA 5JYBA 3K4IA 3VTAA 4IIXA 4OC5A 3TYXA 4C9VA 1ZL0A 2MP0A 5JVLA 3FEDA 4H1HA 4C8UA 5K99A 3K9TA 2XEIA 4P4BA 4NGMA 3SR3A 4E5SA 4NGPA 2OLSA 2DIKA 4INJA 3T5MA 4C8AA 4OC1A 1EZAA 2D0OA 3TLEA 2HROA 4C8PA 4MCSA 1KC7A 4P4JA 2FM4A 4MCRA 2OR4A 4TWEA 4C8FA 2XEGA 4M8DA 1DIKA 1DE4C 3BI0A 4TJVA 3TLCA 3SJEA 2X0SA 2R82A 4COGA 5F5XA 1WVMA 3TLGB 3SJGA 4C8TA 3NOJA 4MI1A 3SJFA 4YN3A 3EZAA 5ELYA
chains in the Genus database with same CATH topology
3I6SA 4NGNA 4C86A 3KASA 2EK8A 3D7DA 3I74A 2C6GA 5IR2A 4C8CA 4P44A 4C84A 3ICUA 4KNGE 2PVWA 3SJXA 3FF3A 4W9YA 5F09A 3D7HA 2JBKA 4NGQA 2C6CA 3BHXA 3BI1A 4MCPA 3FEEA 4C99A 4JZ0A 4C9RA 4JYWA 2C6PA 3BXMA 2CIJA 2OOTA 2C5QA 4TJXA 1Y9ZA 3EIFA 4NGTA 4X3RA 1Z8LA 2JBJA 2EK9A 4P4FA 4P45A 3S9MA 2XEJA 3IIBA 4MCQA 4NGSA 3S9NA 4LQGA 5D29A 3IWWA 4C9UA 4CDJA 5IB9A 1V6CA 4NGRA 1XF1A 4P4IA 2GP4A 4OC2A 4OC0A 3D7GA 3FECA 4C9EA 3D7FA 4C9AA 4C85A 4CDKA 2XEFA 4P4EA 3RBUA 4OC3A 4OMEA 2PVVA 4OC4A 3S9LA 1CX8A 4P4DA 3VTAA 4C9VA 4OC5A 3FEDA 4C8UA 3K9TA 2XEIA 4P4BA 4NGMA 4NGPA 4C8AA 4OC1A 4C8PA 4MCSA 4P4JA 4MCRA 2OR4A 4TWEA 4C8FA 2XEGA 1DE4C 3BI0A 4TJVA 3SJEA 1WVMA 4C8TA 3SJGA 3SJFA 4YN3A 5ELYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I6S A;  4NGN A;  4C86 A;  3KAS A;  2EK8 A;  3D7D A;  3I74 A;  2C6G A;  4C8C A;  4P44 A;  4C84 A;  3ICU A;  4KNG E;  2PVW A;  3SJX A;  3FF3 A;  4W9Y A;  5F09 A;  3D7H A;  2JBK A;  4NGQ A;  2C6C A;  3BHX A;  3BI1 A;  4MCP A;  3FEE A;  4C99 A;  4JZ0 A;  4C9R A;  4JYW A;  2C6P A;  3BXM A;  2CIJ A;  2OOT A;  4TJX A;  1Y9Z A;  3EIF A;  4NGT A;  4X3R A;  1Z8L A;  2JBJ A;  2EK9 A;  4P4F A;  4P45 A;  3S9M A;  2XEJ A;  3IIB A;  4MCQ A;  4NGS A;  3S9N A;  4LQG A;  5D29 A;  3IWW A;  4C9U A;  4CDJ A;  5IB9 A;  1V6C A;  4NGR A;  1XF1 A;  4P4I A;  4OC2 A;  4OC0 A;  3D7G A;  3FEC A;  4C9E A;  3D7F A;  4C9A A;  4C85 A;  4CDK A;  2XEF A;  4P4E A;  3RBU A;  4OC3 A;  4OME A;  2PVV A;  4OC4 A;  3S9L A;  1CX8 A;  4P4D A;  3VTA A;  4C9V A;  4OC5 A;  3FED A;  4C8U A;  2XEI A;  4P4B A;  4NGM A;  4NGP A;  4C8A A;  4OC1 A;  4C8P A;  4MCS A;  4P4J A;  4MCR A;  2OR4 A;  4TWE A;  4C8F A;  2XEG A;  1DE4 C;  3BI0 A;  4TJV A;  3SJE A;  1WVM A;  4C8T A;  3SJG A;  3SJF A;  4YN3 A;  5ELY A; 
#chains in the Genus database with same CATH topology
 2D0P A;  2HWG A;  3I6S A;  4NGN A;  4JVO A;  2EZC A;  1BXR B;  3T05 A;  3TLB A;  4C86 A;  3KAS A;  2EK8 A;  3TLA A;  3D7D A;  3I74 A;  2C6G A;  4J0N A;  1Q5X A;  3C8O A;  2PCN A;  3KRV A;  5F1Y A;  2B0A A;  5IR2 A;  4C8C A;  4P44 A;  4C84 A;  3ICU A;  3GJZ A;  1KBL A;  1NBW A;  4MJX A;  4KNG E;  2PVW A;  2AUM A;  3SJX A;  3FF3 A;  4W9Y A;  5F09 A;  3D7H A;  2JBK A;  2E28 A;  4NGQ A;  3TLY A;  2C6C A;  3BHX A;  3BI1 A;  4MCP A;  5F9M A;  3FEE A;  4C99 A;  4JZ0 A;  1C3O B;  3EZB A;  4C9R A;  2EZA A;  4JYW A;  2C6P A;  2EZB A;  3BXM A;  1J3L A;  4IIY A;  2YJT A;  3G23 A;  2CIJ A;  2OOT A;  2C5Q A;  2HI6 A;  1Y9Z A;  4NGT A;  3EIF A;  4TJX A;  4X3R A;  1Z8L A;  1A9X B;  2AUN A;  3U1B A;  5FD8 A;  1ZYM A;  2JBJ A;  4EYS A;  4CZ1 A;  3T07 A;  1NXJ A;  3T0T A;  2EK9 A;  4P4F A;  3TLZ A;  4P45 A;  3S9M A;  2XEJ A;  3IIB A;  4MCQ A;  2YJV A;  4NGS A;  4E94 A;  1GGO A;  3S9N A;  1VI4 A;  4LQG A;  1VBG A;  5D29 A;  3IWW A;  1CE8 B;  1M6V B;  1JDB C;  1R61 A;  4CO9 A;  4C9U A;  4CDJ A;  5IB9 A;  1JDE A;  1V6C A;  4NGR A;  3TLG A;  4COB A;  1XF1 A;  4P4I A;  2GP4 A;  1KEE B;  4OC2 A;  3EZE A;  4OC0 A;  3D7G A;  3FEC A;  1CS0 B;  4C9E A;  1VBH A;  1T36 B;  3D7F A;  4C9A A;  4C85 A;  4CDK A;  2XEF A;  4P4E A;  1C30 B;  3RBU A;  4OC3 A;  4OME A;  2PVV A;  4OC4 A;  1EZB A;  3S9L A;  1CX8 A;  1ZRS A;  4P4D A;  5JYB A;  3K4I A;  3VTA A;  4IIX A;  4OC5 A;  3TYX A;  4C9V A;  1ZL0 A;  2MP0 A;  5JVL A;  3FED A;  4H1H A;  4C8U A;  5K99 A;  3K9T A;  2XEI A;  4P4B A;  4NGM A;  3SR3 A;  4E5S A;  4NGP A;  2OLS A;  2DIK A;  4INJ A;  3T5M A;  4C8A A;  4OC1 A;  1EZA A;  2D0O A;  3TLE A;  2HRO A;  4C8P A;  4MCS A;  1KC7 A;  4P4J A;  2FM4 A;  4MCR A;  2OR4 A;  4TWE A;  4C8F A;  2XEG A;  4M8D A;  1DIK A;  1DE4 C;  3BI0 A;  4TJV A;  3TLC A;  3SJE A;  2X0S A;  2R82 A;  4COG A;  5F5X A;  1WVM A;  3TLG B;  3SJG A;  4C8T A;  3NOJ A;  4MI1 A;  3SJF A;  4YN3 A;  3EZA A;  5ELY A; 
#chains in the Genus database with same CATH homology
 3I6S A;  4NGN A;  4C86 A;  3KAS A;  2EK8 A;  3D7D A;  3I74 A;  2C6G A;  5IR2 A;  4C8C A;  4P44 A;  4C84 A;  3ICU A;  4KNG E;  2PVW A;  3SJX A;  3FF3 A;  4W9Y A;  5F09 A;  3D7H A;  2JBK A;  4NGQ A;  2C6C A;  3BHX A;  3BI1 A;  4MCP A;  3FEE A;  4C99 A;  4JZ0 A;  4C9R A;  4JYW A;  2C6P A;  3BXM A;  2CIJ A;  2OOT A;  2C5Q A;  4TJX A;  1Y9Z A;  3EIF A;  4NGT A;  4X3R A;  1Z8L A;  2JBJ A;  2EK9 A;  4P4F A;  4P45 A;  3S9M A;  2XEJ A;  3IIB A;  4MCQ A;  4NGS A;  3S9N A;  4LQG A;  5D29 A;  3IWW A;  4C9U A;  4CDJ A;  5IB9 A;  1V6C A;  4NGR A;  1XF1 A;  4P4I A;  2GP4 A;  4OC2 A;  4OC0 A;  3D7G A;  3FEC A;  4C9E A;  3D7F A;  4C9A A;  4C85 A;  4CDK A;  2XEF A;  4P4E A;  3RBU A;  4OC3 A;  4OME A;  2PVV A;  4OC4 A;  3S9L A;  1CX8 A;  4P4D A;  3VTA A;  4C9V A;  4OC5 A;  3FED A;  4C8U A;  3K9T A;  2XEI A;  4P4B A;  4NGM A;  4NGP A;  4C8A A;  4OC1 A;  4C8P A;  4MCS A;  4P4J A;  4MCR A;  2OR4 A;  4TWE A;  4C8F A;  2XEG A;  1DE4 C;  3BI0 A;  4TJV A;  3SJE A;  1WVM A;  4C8T A;  3SJG A;  3SJF A;  4YN3 A;  5ELY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...