4CA3A

Solution structure of streptomyces virginiae vira acp5b
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
88
structure length
88
Chain Sequence
GPGSAVAVDPAPVARALREELARTLYCEPGDIDDEASFNTLGLDSILGVEFVAFVNQTYGLDEKAGILYDHPSLAALSRHVAGRAAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYBRID POLYKETIDE SYNTHASE-NON RIBOSOMAL PEPTIDE SYNTHETASE
publication title Insights Into the Function of Trans-Acyl Transferase Polyketide Synthases from the Saxs Structure of a Complete Module.
doi rcsb
source organism Streptomyces virginiae
molecule tags Ribosomal protein
total genus 23
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4ca3A01
2JQ4A 2FQ0A 1KLPA 2JU1A 2AFEA 1T8KA 2X2BA 2FADA 2MF4A 2K0YA 5CZDB 3EJDA 2K0XA 2K94A 4R0MA 1L0HA 2L4BA 2MY5A 2EHSA 2FVEA 2N50A 4IZ6A 2N5IA 2KOSA 2LOLA 2JGPA 2PNGA 4H2YC 2KOPA 1ACPA 2K93A 3EJEA 2LL8A 2N6YA 3GZLA 5HV8A 2LIWA 4CA3A 2AFDA 2KG6A 2VSQA 1VKUA 2N6ZA 2XZ1C 2MD9A 2FACA 4MRTC 3LMOA 2KOOA 2KG8A 3GZMA 5EJDA 4BPHA 2MR7A 2N5HA 4NEOA 3CE7A 2KOQA 1X3OA 2KORA 4H2XC 2N98A 1AF8A 2CG5B 2AF8A 2GDWA 5KP7B 4H2WC 1L0IA 2FVAA 1DNYA 2FAEA 3NY7B 2GDYA 2LIUA 2KGCA 1NQ4A 2KW2A 4DG9A 3RG2A 2FQ1A 5KP6B 2LKIA 5KP8B 2ROQA 2XZ0D 2KGAA 2KR5A 2AVAA 2L22A 2EHTA 3EJBA 2FHSC 2JU2A 4BPFA 2CGQA 2K2QA 1F80D 2MVUA 1HY8A 2FQ2A 1DV5A 2KWLA 1HQBA 2GDXA 2K92A 2MR8A 5HVCA 2LMLA 2L0QA 2M5RA 2LTEA 2FVFA 2CNRA 2QNWA 2LPKA 4BPGA 2KGEA 4HKGA 1OR5A 2KGDA 4PXHB 2DNWA 4PWVB 2KG9A 2MVVA 2L9FA 2CQ8A
chains in the Genus database with same CATH superfamily
2JU1A 1MZ8A 2X2BA 5CZDB 2DGYA 2VLQA 7CEIA 2GZJA 3CD6P 2M8LA 3VRLC 2PY8A 3G26A 4XROA 4U0DA 5HGOA 1M90Q 2Z44A 2BUOA 2LOLA 4F37A 1GPJA 5HV8A 5F2NA 2BHVA 5BS1A 4GR2A 2FACA 4MRTC 1M1KQ 2KOOA 3CCUP 4QNBA 1QVGO 2K0DX 3CMAP 1X3OA 2KORA 4H2XC 2CG5B 5F2KA 1DNYA 4DG9A 2CWOA 1D1DA 2KGAA 2M8PA 2L22A 1VQ9P 2JO0A 3CXCO 2EHTA 4XRQA 1S72P 2JU2A 2ERHA 4UHPB 5EW5E 1VQ7P 1HY8A 2FQ2A 1DV5A 3DS2A 2KWLA 3G6EP 2VLNA 1HQBA 1IMPA 2OTJP 1KC8Q 2M5RA 4PH0A 2CNRA 2LPKA 2EIAA 1Q82Q 4HKGA 1OR5A 2KGDA 3G21A 3CCRP 2JBGA 2MVVA 2L9FA 2JQ4A 1T8KA 1M6NA 2MF4A 1IMQA 5HGLA 3HYBA 2K94A 4R0MA 4WYMA 2JB0A 2GZGA 2PEJA 4XFXA 2MY5A 1RNIA 2EHSA 2N50A 1EOQA 1M6EX 2NO8A 2N5IA 2KOSA 3CCMP 3DS4A 2JGPA 2XT1A 2N6YA 1VQPP 2EFJA 5HGNA 3CPWO 2KG6A 3DS3A 1K73Q 1UJZA 3LMOA 1E6JP 3CCEP 2KG8A 3GZMA 4BPHA 3G28A 2GZIA 2N5HA 4NEOA 2KOQA 2EG5A 2N98A 1RO2A 5KP7B 1YHQP 4H2WC 2FVAA 2XXMA 2GDYA 1YJ9P 1NQ4A 2LF4A 2E1MA 2KW2A 4GR6A 2LKIA 1AUMA 3OW2O 4U0BA 3CCVP 5JPAA 2GZEA 1YITP 1VQKP 3H47A 2FHSC 2CGQA 1EIAA 2K2QA 1F80D 2K5XA 2MVUA 3GJNA 3MGEA 1Z6MA 1K8AQ 2VLOA 3NTEA 1AYIA 2GDXA 3G4SP 1Q81Q 3CC2P 2P9XA 5HVCA 1M74A 1KQSO 4XFZA 4BPGA 3CCQP 4PWVB 2K93A 3Q20A 1VHNA 2AFEA 2FADA 2OARA 3EJDA 3M1MA 2K0XA 2M8NA 3G29A 2PENA 2KODA 3G1GA 1ZNVA 4IZ6A 2PEMA 1W2BO 3CC7P 4H2YC 1ACPA 3EJEA 2LL8A 4CA3A 2LIWA 2PEIA 2VSQA 3DS0A 1Q7YQ 2N6ZA 2XZ1C 1CEIA 5EJDA 2JAZA 3DTJA 1A43A 1E0HA 3B5IA 1EMVA 4U0CA 1VQ8P 3DPHA 3E2DA 2GZFA 1YJWP 1ZMBA 3G71P 3CCLP 2FQ1A 5KP6B 5KP8B 3I56P 1RO0A 2JYGA 2XZ0D 2AVAA 5HGMA 4QKOA 1BAJA 3EJBA 5F2OA 3CC4P 3CMEP 2L6EA 1NJIQ 4XFYA 1VQ5P 3B4QA 3DS5A 2K92A 4U0FA 2LMLA 2L0QA 2FVFA 1VQOP 2KGEA 4PXHB 2Z46A 2KG9A 3RG6C 2JYLA 2FQ0A 1KLPA 2ONTA 2PEKA 2K0YA 1A8OA 2PEQA 3U43A 4PH1A 1VQLP 4IPYA 1L0HA 2L4BA 2FVEA 5DCKA 1BXIA 1IUQA 2PNGA 3G0VA 2KOPA 1QVFO 3GZLA 2AFDA 1VKUA 2WPTA 3I55P 2MD9A 1K30A 3CCSP 3LRYA 4COPA 1VQ4P 5I4TG 1GXGA 3DS1A 4COCA 1JJ2O 2MR7A 1QRJA 3CE7A 1AF8A 2AF8A 2GDWA 2VLPA 3WBHA 1L0IA 3GKLC 5BS2A 2FAEA 3NY7B 2LIUA 3H0DA 4U0AA 2KGCA 3HZQA 3RG2A 1KD1Q 2PEOA 2ROQA 1YJNP 2GYKA 1FR2A 3H4EA 2KR5A 1N8RQ 2OTLP 3P05A 1GXHA 1YI2P 4BPFA 1Q86Q 1VQ6P 3G1IA 1VQMP 3CCJP 1K9MQ 2Z45A 2MR8A 2XV6A 2LTEA 1UNKA 2QNWA 4U0EA 1VQNP 2QEXP 1YIJP 2DNWA 4M0IA 2QA4P 2CQ8A
chains in the Genus database with same CATH topology
2JQ4A 2FQ0A 1KLPA 2JU1A 2AFEA 1T8KA 2X2BA 2FADA 2MF4A 2K0YA 5CZDB 3EJDA 2K0XA 2K94A 4R0MA 1L0HA 2L4BA 2MY5A 2EHSA 2FVEA 2N50A 4IZ6A 2N5IA 2KOSA 2LOLA 2JGPA 2PNGA 4H2YC 2KOPA 1ACPA 2K93A 3EJEA 2LL8A 2N6YA 3GZLA 5HV8A 2LIWA 4CA3A 2AFDA 2KG6A 2VSQA 1VKUA 2N6ZA 2XZ1C 2MD9A 2FACA 4MRTC 3LMOA 2KOOA 2KG8A 3GZMA 5EJDA 4BPHA 2MR7A 2N5HA 4NEOA 3CE7A 2KOQA 1X3OA 2KORA 4H2XC 2N98A 1AF8A 2CG5B 2AF8A 2GDWA 5KP7B 4H2WC 1L0IA 2FVAA 1DNYA 2FAEA 3NY7B 2GDYA 2LIUA 2KGCA 1NQ4A 2KW2A 4DG9A 3RG2A 2FQ1A 5KP6B 2LKIA 5KP8B 2ROQA 2XZ0D 2KGAA 2KR5A 2AVAA 2L22A 2EHTA 3EJBA 2FHSC 2JU2A 4BPFA 2CGQA 2K2QA 1F80D 2MVUA 1HY8A 2FQ2A 1DV5A 2KWLA 1HQBA 2GDXA 2K92A 2MR8A 5HVCA 2LMLA 2L0QA 2M5RA 2LTEA 2FVFA 2CNRA 2QNWA 2LPKA 4BPGA 2KGEA 4HKGA 1OR5A 2KGDA 4PXHB 2DNWA 4PWVB 2KG9A 2MVVA 2L9FA 2CQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQ4 A;  2FQ0 A;  1KLP A;  2JU1 A;  2AFE A;  1T8K A;  2X2B A;  2FAD A;  2MF4 A;  2K0Y A;  5CZD B;  3EJD A;  2K0X A;  2K94 A;  4R0M A;  1L0H A;  2L4B A;  2MY5 A;  2EHS A;  2FVE A;  2N50 A;  4IZ6 A;  2N5I A;  2KOS A;  2LOL A;  2JGP A;  2PNG A;  4H2Y C;  2KOP A;  1ACP A;  2K93 A;  3EJE A;  2LL8 A;  2N6Y A;  3GZL A;  5HV8 A;  2LIW A;  4CA3 A;  2AFD A;  2KG6 A;  2VSQ A;  1VKU A;  2N6Z A;  2XZ1 C;  2MD9 A;  2FAC A;  4MRT C;  3LMO A;  2KOO A;  2KG8 A;  3GZM A;  5EJD A;  4BPH A;  2MR7 A;  2N5H A;  4NEO A;  3CE7 A;  2KOQ A;  1X3O A;  2KOR A;  4H2X C;  2N98 A;  1AF8 A;  2CG5 B;  2AF8 A;  2GDW A;  5KP7 B;  4H2W C;  1L0I A;  2FVA A;  1DNY A;  2FAE A;  3NY7 B;  2GDY A;  2LIU A;  2KGC A;  1NQ4 A;  2KW2 A;  4DG9 A;  3RG2 A;  2FQ1 A;  5KP6 B;  2LKI A;  5KP8 B;  2ROQ A;  2XZ0 D;  2KGA A;  2KR5 A;  2AVA A;  2L22 A;  2EHT A;  3EJB A;  2FHS C;  2JU2 A;  4BPF A;  2CGQ A;  2K2Q A;  1F80 D;  2MVU A;  1HY8 A;  2FQ2 A;  1DV5 A;  2KWL A;  1HQB A;  2GDX A;  2K92 A;  2MR8 A;  5HVC A;  2LML A;  2L0Q A;  2M5R A;  2LTE A;  2FVF A;  2CNR A;  2QNW A;  2LPK A;  4BPG A;  2KGE A;  4HKG A;  1OR5 A;  2KGD A;  4PXH B;  2DNW A;  4PWV B;  2KG9 A;  2MVV A;  2L9F A;  2CQ8 A; 
#chains in the Genus database with same CATH topology
 2JU1 A;  1MZ8 A;  2X2B A;  5CZD B;  2DGY A;  2VLQ A;  7CEI A;  2GZJ A;  3CD6 P;  2M8L A;  3VRL C;  2PY8 A;  3G26 A;  4XRO A;  4U0D A;  5HGO A;  1M90 Q;  2Z44 A;  2BUO A;  2LOL A;  4F37 A;  1GPJ A;  5HV8 A;  5F2N A;  2BHV A;  5BS1 A;  4GR2 A;  2FAC A;  4MRT C;  1M1K Q;  2KOO A;  3CCU P;  4QNB A;  1QVG O;  2K0D X;  3CMA P;  1X3O A;  2KOR A;  4H2X C;  2CG5 B;  5F2K A;  1DNY A;  4DG9 A;  2CWO A;  1D1D A;  2KGA A;  2M8P A;  2L22 A;  1VQ9 P;  2JO0 A;  3CXC O;  2EHT A;  4XRQ A;  1S72 P;  2JU2 A;  2ERH A;  4UHP B;  5EW5 E;  1VQ7 P;  1HY8 A;  2FQ2 A;  1DV5 A;  3DS2 A;  2KWL A;  3G6E P;  2VLN A;  1HQB A;  1IMP A;  2OTJ P;  1KC8 Q;  2M5R A;  4PH0 A;  2CNR A;  2LPK A;  2EIA A;  1Q82 Q;  4HKG A;  1OR5 A;  2KGD A;  3G21 A;  3CCR P;  2JBG A;  2MVV A;  2L9F A;  2JQ4 A;  1T8K A;  1M6N A;  2MF4 A;  1IMQ A;  5HGL A;  3HYB A;  2K94 A;  4R0M A;  4WYM A;  2JB0 A;  2GZG A;  2PEJ A;  4XFX A;  2MY5 A;  1RNI A;  2EHS A;  2N50 A;  1EOQ A;  1M6E X;  2NO8 A;  2N5I A;  2KOS A;  3CCM P;  3DS4 A;  2JGP A;  2XT1 A;  2N6Y A;  1VQP P;  2EFJ A;  5HGN A;  3CPW O;  2KG6 A;  3DS3 A;  1K73 Q;  1UJZ A;  3LMO A;  1E6J P;  3CCE P;  2KG8 A;  3GZM A;  4BPH A;  3G28 A;  2GZI A;  2N5H A;  4NEO A;  2KOQ A;  2EG5 A;  2N98 A;  1RO2 A;  5KP7 B;  1YHQ P;  4H2W C;  2FVA A;  2XXM A;  2GDY A;  1YJ9 P;  1NQ4 A;  2LF4 A;  2E1M A;  2KW2 A;  4GR6 A;  2LKI A;  1AUM A;  3OW2 O;  4U0B A;  3CCV P;  5JPA A;  2GZE A;  1YIT P;  1VQK P;  3H47 A;  2FHS C;  2CGQ A;  1EIA A;  2K2Q A;  1F80 D;  2K5X A;  2MVU A;  3GJN A;  3MGE A;  1Z6M A;  1K8A Q;  2VLO A;  3NTE A;  1AYI A;  2GDX A;  3G4S P;  1Q81 Q;  3CC2 P;  2P9X A;  5HVC A;  1M74 A;  1KQS O;  4XFZ A;  4BPG A;  3CCQ P;  4PWV B;  2K93 A;  3Q20 A;  1VHN A;  2AFE A;  2FAD A;  2OAR A;  3EJD A;  3M1M A;  2K0X A;  2M8N A;  3G29 A;  2PEN A;  2KOD A;  3G1G A;  1ZNV A;  4IZ6 A;  2PEM A;  1W2B O;  3CC7 P;  4H2Y C;  1ACP A;  3EJE A;  2LL8 A;  4CA3 A;  2LIW A;  2PEI A;  2VSQ A;  3DS0 A;  1Q7Y Q;  2N6Z A;  2XZ1 C;  1CEI A;  5EJD A;  2JAZ A;  3DTJ A;  1A43 A;  1E0H A;  3B5I A;  1EMV A;  4U0C A;  1VQ8 P;  3DPH A;  3E2D A;  2GZF A;  1YJW P;  1ZMB A;  3G71 P;  3CCL P;  2FQ1 A;  5KP6 B;  5KP8 B;  3I56 P;  1RO0 A;  2JYG A;  2XZ0 D;  2AVA A;  5HGM A;  4QKO A;  1BAJ A;  3EJB A;  5F2O A;  3CC4 P;  3CME P;  2L6E A;  1NJI Q;  4XFY A;  1VQ5 P;  3B4Q A;  3DS5 A;  2K92 A;  4U0F A;  2LML A;  2L0Q A;  2FVF A;  1VQO P;  2KGE A;  4PXH B;  2Z46 A;  2KG9 A;  3RG6 C;  2JYL A;  2FQ0 A;  1KLP A;  2ONT A;  2PEK A;  2K0Y A;  1A8O A;  2PEQ A;  3U43 A;  4PH1 A;  1VQL P;  4IPY A;  1L0H A;  2L4B A;  2FVE A;  5DCK A;  1BXI A;  1IUQ A;  2PNG A;  3G0V A;  2KOP A;  1QVF O;  3GZL A;  2AFD A;  1VKU A;  2WPT A;  3I55 P;  2MD9 A;  1K30 A;  3CCS P;  3LRY A;  4COP A;  1VQ4 P;  5I4T G;  1GXG A;  3DS1 A;  4COC A;  1JJ2 O;  2MR7 A;  1QRJ A;  3CE7 A;  1AF8 A;  2AF8 A;  2GDW A;  2VLP A;  3WBH A;  1L0I A;  3GKL C;  5BS2 A;  2FAE A;  3NY7 B;  2LIU A;  3H0D A;  4U0A A;  2KGC A;  3HZQ A;  3RG2 A;  1KD1 Q;  2PEO A;  2ROQ A;  1YJN P;  2GYK A;  1FR2 A;  3H4E A;  2KR5 A;  1N8R Q;  2OTL P;  3P05 A;  1GXH A;  1YI2 P;  4BPF A;  1Q86 Q;  1VQ6 P;  3G1I A;  1VQM P;  3CCJ P;  1K9M Q;  2Z45 A;  2MR8 A;  2XV6 A;  2LTE A;  1UNK A;  2QNW A;  4U0E A;  1VQN P;  2QEX P;  1YIJ P;  2DNW A;  4M0I A;  2QA4 P;  2CQ8 A; 
#chains in the Genus database with same CATH homology
 2JQ4 A;  2FQ0 A;  1KLP A;  2JU1 A;  2AFE A;  1T8K A;  2X2B A;  2FAD A;  2MF4 A;  2K0Y A;  5CZD B;  3EJD A;  2K0X A;  2K94 A;  4R0M A;  1L0H A;  2L4B A;  2MY5 A;  2EHS A;  2FVE A;  2N50 A;  4IZ6 A;  2N5I A;  2KOS A;  2LOL A;  2JGP A;  2PNG A;  4H2Y C;  2KOP A;  1ACP A;  2K93 A;  3EJE A;  2LL8 A;  2N6Y A;  3GZL A;  5HV8 A;  2LIW A;  4CA3 A;  2AFD A;  2KG6 A;  2VSQ A;  1VKU A;  2N6Z A;  2XZ1 C;  2MD9 A;  2FAC A;  4MRT C;  3LMO A;  2KOO A;  2KG8 A;  3GZM A;  5EJD A;  4BPH A;  2MR7 A;  2N5H A;  4NEO A;  3CE7 A;  2KOQ A;  1X3O A;  2KOR A;  4H2X C;  2N98 A;  1AF8 A;  2CG5 B;  2AF8 A;  2GDW A;  5KP7 B;  4H2W C;  1L0I A;  2FVA A;  1DNY A;  2FAE A;  3NY7 B;  2GDY A;  2LIU A;  2KGC A;  1NQ4 A;  2KW2 A;  4DG9 A;  3RG2 A;  2FQ1 A;  5KP6 B;  2LKI A;  5KP8 B;  2ROQ A;  2XZ0 D;  2KGA A;  2KR5 A;  2AVA A;  2L22 A;  2EHT A;  3EJB A;  2FHS C;  2JU2 A;  4BPF A;  2CGQ A;  2K2Q A;  1F80 D;  2MVU A;  1HY8 A;  2FQ2 A;  1DV5 A;  2KWL A;  1HQB A;  2GDX A;  2K92 A;  2MR8 A;  5HVC A;  2LML A;  2L0Q A;  2M5R A;  2LTE A;  2FVF A;  2CNR A;  2QNW A;  2LPK A;  4BPG A;  2KGE A;  4HKG A;  1OR5 A;  2KGD A;  4PXH B;  2DNW A;  4PWV B;  2KG9 A;  2MVV A;  2L9F A;  2CQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...