4CA3A

Solution structure of streptomyces virginiae vira acp5b
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
88
structure length
88
Chain Sequence
b'GPGSAVAVDPAPVARALREELARTLYCEPGDIDDEASFNTLGLDSILGVEFVAFVNQTYGLDEKAGILYDHPSLAALSRHVAGRAAPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HYBRID POLYKETIDE SYNTHASE-NON RIBOSOMAL PEPTIDE SYNTHETASE
publication title Insights Into the Function of Trans-Acyl Transferase Polyketide Synthases from the Saxs Structure of a Complete Module.
doi rcsb
source organism Streptomyces virginiae
molecule tags Ribosomal protein
total genus 23
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4ca3A01
3RG2A 2N98A 2N5HA 2X2BA 2JU1A 2KOOA 2KOQA 1AF8A 2L0QA 1VKUA 3NY7B 2KGCA 2M5RA 3EJBA 3EJDA 2L22A 2N6YA 2EHTA 2KOPA 4MRTC 4PXHB 4BPHA 2JGPA 5HV8A 1OR5A 2KG9A 4DG9A 4BPGA 2FADA 2CQ8A 2LL8A 2AVAA 2LMLA 2PNGA 2LKIA 4H2WC 2GDWA 2LOLA 2JQ4A 1NQ4A 2FVAA 2FVEA 5HVCA 2DNWA 1X3OA 2K92A 2K0XA 2MR7A 2K2QA 2LIWA 1HQBA 1F80D 2GDXA 2KGEA 2L9FA 2MF4A 2MVUA 2KORA 2N5IA 1HY8A 5KP6B 2MVVA 2LTEA 2FHSC 2K93A 1T8KA 5KP7B 2KW2A 3CE7A 2KG6A 4NEOA 2MY5A 2XZ0D 1KLPA 1DV5A 3LMOA 2LIUA 2FQ0A 3GZLA 1ACPA 2L4BA 4IZ6A 2CGQA 2K0YA 2XZ1C 2KOSA 1DNYA 2K94A 2FVFA 2KG8A 2AFDA 2AF8A 4CA3A 2KWLA 2FACA 5CZDB 2QNWA 2KGDA 4H2XC 2MD9A 2N50A 2N6ZA 4HKGA 2CNRA 2KGAA 1L0HA 3EJEA 2EHSA 3GZMA 2GDYA 5EJDA 4R0MA 2FAEA 4PWVB 2LPKA 4BPFA 2KR5A 2CG5B 1L0IA 2MR8A 2FQ2A 5KP8B 2ROQA 2VSQA 2FQ1A 2AFEA 2JU2A 4H2YC
chains in the Genus database with same CATH superfamily
3RG2A 1YIJP 2JO0A 3G1IA 3LRYA 1E0HA 3CD6P 2L22A 3B5IA 1Q81Q 2JBGA 3CMAP 2FADA 2LL8A 2VLNA 1W2BO 2OARA 1ZMBA 4U0BA 1NQ4A 4XFZA 2EFJA 2FVAA 4U0DA 5HVCA 2K0DX 5DCKA 3MGEA 2EG5A 1Q86Q 1KD1Q 3CC2P 5HGNA 2OTJP 2VLQA 2K2QA 1EOQA 1F80D 2MF4A 2MVUA 2E1MA 5KP6B 3M1MA 3CPWO 1KC8Q 1VQMP 1DV5A 3I55P 2JYGA 2Z46A 1BAJA 1EIAA 5HGOA 2K0YA 2XZ1C 2KOSA 4GR2A 2FVFA 2LF4A 2AFDA 3GJNA 2KWLA 3CCVP 5CZDB 2N50A 3DS1A 5F2NA 2KGAA 2GZJA 1M1KQ 5EJDA 1FR2A 1N8RQ 2KODA 5JPAA 1YHQP 1VQPP 3HYBA 2JYLA 3G26A 2KR5A 1A43A 4XFXA 4U0FA 2PY8A 5F2KA 2AFEA 3DS4A 2KOOA 2KOQA 2ONTA 4U0AA 4U0EA 1CEIA 1Q7YQ 3G6EP 3EJBA 3EJDA 1AYIA 2EHTA 4MRTC 3CCMP 3CXCO 3E2DA 3CCSP 2JGPA 5HV8A 3I56P 4DG9A 2AVAA 1VQNP 5HGLA 1MZ8A 3DS2A 1M74A 2M8NA 3NTEA 1M90Q 1M6EX 2PEOA 1A8OA 2LIWA 2GDXA 4PH0A 1UJZA 3CCQP 3H47A 5KP7B 2DGYA 3CCUP 4COCA 2FQ0A 1ACPA 1BXIA 2L4BA 4GR6A 1RO2A 1DNYA 5I4TG 4QNBA 2GZEA 2AF8A 4H2XC 2MD9A 3P05A 4HKGA 2CNRA 1JJ2O 3EJEA 4UHPB 2EHSA 2OTLP 1QRJA 4R0MA 4COPA 1VQOP 4PWVB 1VQ9P 2VLPA 2CG5B 3CCLP 3GKLC 3CCJP 1VQLP 2MR8A 1K30A 2ROQA 1D1DA 3CCEP 3DPHA 2GZGA 4M0IA 2JU1A 2M8PA 1VQKP 2L0QA 3NY7B 1K9MQ 1VQ4P 2M5RA 2KOPA 4PXHB 3CMEP 1K73Q 1OR5A 2KG9A 4BPGA 2CQ8A 1GXGA 1AUMA 2GDWA 3WBHA 3CC7P 2Z45A 3CC4P 3G71P 3G0VA 2DNWA 1S72P 1IMQA 3G29A 3H4EA 1RNIA 2XT1A 1QVGO 2CWOA 7CEIA 1HY8A 2LTEA 2L6EA 2K93A 1T8KA 1YJNP 2KW2A 3CE7A 2KG6A 2MY5A 2XZ0D 1KLPA 4U0CA 1ZNVA 2GZFA 2GZIA 2LIUA 3GZLA 4IZ6A 2PEJA 1GPJA 2K94A 2PEMA 1VQ5P 1UNKA 4CA3A 2FACA 2QNWA 1E6JP 2JB0A 1L0HA 2ERHA 2PENA 1Q82Q 1YJWP 2FAEA 5BS2A 5HGMA 3B4QA 4F37A 4IPYA 1L0IA 1VQ8P 2FQ2A 3DTJA 5KP8B 2JAZA 2NO8A 3G4SP 4PH1A 2FQ1A 2N98A 3VRLC 2N5HA 2X2BA 3HZQA 1AF8A 1VKUA 2Z44A 2PEKA 2KGCA 3RG6C 2N6YA 1IUQA 4BPHA 5BS1A 2LMLA 2PNGA 2LKIA 4H2WC 1M6NA 2LOLA 2JQ4A 2M8LA 1VQ6P 2FVEA 3DS5A 2BUOA 1X3OA 2BHVA 4XROA 2K92A 2K0XA 2WPTA 2MR7A 2PEQA 1IMPA 1HQBA 2KGEA 2L9FA 1NJIQ 2KORA 4XRQA 2N5IA 2MVVA 2FHSC 2QA4P 2K5XA 1VHNA 3G28A 3DS0A 4NEOA 1KQSO 2GYKA 3LMOA 2XV6A 1EMVA 5EW5E 3DS3A 3Q20A 2CGQA 1RO0A 3OW2O 1YI2P 3H0DA 1GXHA 2KG8A 2P9XA 3CCRP 3G21A 1YJ9P 1VQ7P 1QVFO 2KGDA 4QKOA 1Z6MA 2PEIA 2N6ZA 1YITP 3GZMA 2EIAA 2GDYA 3G1GA 3U43A 4WYMA 1K8AQ 2LPKA 4BPFA 2VLOA 2JU2A 2VSQA 2QEXP 4XFYA 2XXMA 5F2OA 4H2YC
chains in the Genus database with same CATH topology
3RG2A 2N98A 2N5HA 2X2BA 2JU1A 2KOOA 2KOQA 1AF8A 2L0QA 1VKUA 3NY7B 2KGCA 2M5RA 3EJBA 3EJDA 2L22A 2N6YA 2EHTA 2KOPA 4MRTC 4PXHB 4BPHA 2JGPA 5HV8A 1OR5A 2KG9A 4DG9A 4BPGA 2FADA 2CQ8A 2LL8A 2AVAA 2LMLA 2PNGA 2LKIA 4H2WC 2GDWA 2LOLA 2JQ4A 1NQ4A 2FVAA 2FVEA 5HVCA 2DNWA 1X3OA 2K92A 2K0XA 2MR7A 2K2QA 2LIWA 1HQBA 1F80D 2GDXA 2KGEA 2L9FA 2MF4A 2MVUA 2KORA 2N5IA 1HY8A 5KP6B 2MVVA 2LTEA 2FHSC 2K93A 1T8KA 5KP7B 2KW2A 3CE7A 2KG6A 4NEOA 2MY5A 2XZ0D 1KLPA 1DV5A 3LMOA 2LIUA 2FQ0A 3GZLA 1ACPA 2L4BA 4IZ6A 2CGQA 2K0YA 2XZ1C 2KOSA 1DNYA 2K94A 2FVFA 2KG8A 2AFDA 2AF8A 4CA3A 2KWLA 2FACA 5CZDB 2QNWA 2KGDA 4H2XC 2MD9A 2N50A 2N6ZA 4HKGA 2CNRA 2KGAA 1L0HA 3EJEA 2EHSA 3GZMA 2GDYA 5EJDA 4R0MA 2FAEA 4PWVB 2LPKA 4BPFA 2KR5A 2CG5B 1L0IA 2MR8A 2FQ2A 5KP8B 2ROQA 2VSQA 2FQ1A 2AFEA 2JU2A 4H2YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RG2 A;  2N98 A;  2N5H A;  2X2B A;  2JU1 A;  2KOO A;  2KOQ A;  1AF8 A;  2L0Q A;  1VKU A;  3NY7 B;  2KGC A;  2M5R A;  3EJB A;  3EJD A;  2L22 A;  2N6Y A;  2EHT A;  2KOP A;  4MRT C;  4PXH B;  4BPH A;  2JGP A;  5HV8 A;  1OR5 A;  2KG9 A;  4DG9 A;  4BPG A;  2FAD A;  2CQ8 A;  2LL8 A;  2AVA A;  2LML A;  2PNG A;  2LKI A;  4H2W C;  2GDW A;  2LOL A;  2JQ4 A;  1NQ4 A;  2FVA A;  2FVE A;  5HVC A;  2DNW A;  1X3O A;  2K92 A;  2K0X A;  2MR7 A;  2K2Q A;  2LIW A;  1HQB A;  1F80 D;  2GDX A;  2KGE A;  2L9F A;  2MF4 A;  2MVU A;  2KOR A;  2N5I A;  1HY8 A;  5KP6 B;  2MVV A;  2LTE A;  2FHS C;  2K93 A;  1T8K A;  5KP7 B;  2KW2 A;  3CE7 A;  2KG6 A;  4NEO A;  2MY5 A;  2XZ0 D;  1KLP A;  1DV5 A;  3LMO A;  2LIU A;  2FQ0 A;  3GZL A;  1ACP A;  2L4B A;  4IZ6 A;  2CGQ A;  2K0Y A;  2XZ1 C;  2KOS A;  1DNY A;  2K94 A;  2FVF A;  2KG8 A;  2AFD A;  2AF8 A;  4CA3 A;  2KWL A;  2FAC A;  5CZD B;  2QNW A;  2KGD A;  4H2X C;  2MD9 A;  2N50 A;  2N6Z A;  4HKG A;  2CNR A;  2KGA A;  1L0H A;  3EJE A;  2EHS A;  3GZM A;  2GDY A;  5EJD A;  4R0M A;  2FAE A;  4PWV B;  2LPK A;  4BPF A;  2KR5 A;  2CG5 B;  1L0I A;  2MR8 A;  2FQ2 A;  5KP8 B;  2ROQ A;  2VSQ A;  2FQ1 A;  2AFE A;  2JU2 A;  4H2Y C; 
#chains in the Genus database with same CATH topology
 3RG2 A;  1YIJ P;  2JO0 A;  3G1I A;  3LRY A;  1E0H A;  3CD6 P;  2L22 A;  3B5I A;  1Q81 Q;  2JBG A;  3CMA P;  2FAD A;  2LL8 A;  2VLN A;  1W2B O;  2OAR A;  1ZMB A;  4U0B A;  1NQ4 A;  4XFZ A;  2EFJ A;  2FVA A;  4U0D A;  5HVC A;  2K0D X;  5DCK A;  3MGE A;  2EG5 A;  1Q86 Q;  1KD1 Q;  3CC2 P;  5HGN A;  2OTJ P;  2VLQ A;  2K2Q A;  1EOQ A;  1F80 D;  2MF4 A;  2MVU A;  2E1M A;  5KP6 B;  3M1M A;  3CPW O;  1KC8 Q;  1VQM P;  1DV5 A;  3I55 P;  2JYG A;  2Z46 A;  1BAJ A;  1EIA A;  5HGO A;  2K0Y A;  2XZ1 C;  2KOS A;  4GR2 A;  2FVF A;  2LF4 A;  2AFD A;  3GJN A;  2KWL A;  3CCV P;  5CZD B;  2N50 A;  3DS1 A;  5F2N A;  2KGA A;  2GZJ A;  1M1K Q;  5EJD A;  1FR2 A;  1N8R Q;  2KOD A;  5JPA A;  1YHQ P;  1VQP P;  3HYB A;  2JYL A;  3G26 A;  2KR5 A;  1A43 A;  4XFX A;  4U0F A;  2PY8 A;  5F2K A;  2AFE A;  3DS4 A;  2KOO A;  2KOQ A;  2ONT A;  4U0A A;  4U0E A;  1CEI A;  1Q7Y Q;  3G6E P;  3EJB A;  3EJD A;  1AYI A;  2EHT A;  4MRT C;  3CCM P;  3CXC O;  3E2D A;  3CCS P;  2JGP A;  5HV8 A;  3I56 P;  4DG9 A;  2AVA A;  1VQN P;  5HGL A;  1MZ8 A;  3DS2 A;  1M74 A;  2M8N A;  3NTE A;  1M90 Q;  1M6E X;  2PEO A;  1A8O A;  2LIW A;  2GDX A;  4PH0 A;  1UJZ A;  3CCQ P;  3H47 A;  5KP7 B;  2DGY A;  3CCU P;  4COC A;  2FQ0 A;  1ACP A;  1BXI A;  2L4B A;  4GR6 A;  1RO2 A;  1DNY A;  5I4T G;  4QNB A;  2GZE A;  2AF8 A;  4H2X C;  2MD9 A;  3P05 A;  4HKG A;  2CNR A;  1JJ2 O;  3EJE A;  4UHP B;  2EHS A;  2OTL P;  1QRJ A;  4R0M A;  4COP A;  1VQO P;  4PWV B;  1VQ9 P;  2VLP A;  2CG5 B;  3CCL P;  3GKL C;  3CCJ P;  1VQL P;  2MR8 A;  1K30 A;  2ROQ A;  1D1D A;  3CCE P;  3DPH A;  2GZG A;  4M0I A;  2JU1 A;  2M8P A;  1VQK P;  2L0Q A;  3NY7 B;  1K9M Q;  1VQ4 P;  2M5R A;  2KOP A;  4PXH B;  3CME P;  1K73 Q;  1OR5 A;  2KG9 A;  4BPG A;  2CQ8 A;  1GXG A;  1AUM A;  2GDW A;  3WBH A;  3CC7 P;  2Z45 A;  3CC4 P;  3G71 P;  3G0V A;  2DNW A;  1S72 P;  1IMQ A;  3G29 A;  3H4E A;  1RNI A;  2XT1 A;  1QVG O;  2CWO A;  7CEI A;  1HY8 A;  2LTE A;  2L6E A;  2K93 A;  1T8K A;  1YJN P;  2KW2 A;  3CE7 A;  2KG6 A;  2MY5 A;  2XZ0 D;  1KLP A;  4U0C A;  1ZNV A;  2GZF A;  2GZI A;  2LIU A;  3GZL A;  4IZ6 A;  2PEJ A;  1GPJ A;  2K94 A;  2PEM A;  1VQ5 P;  1UNK A;  4CA3 A;  2FAC A;  2QNW A;  1E6J P;  2JB0 A;  1L0H A;  2ERH A;  2PEN A;  1Q82 Q;  1YJW P;  2FAE A;  5BS2 A;  5HGM A;  3B4Q A;  4F37 A;  4IPY A;  1L0I A;  1VQ8 P;  2FQ2 A;  3DTJ A;  5KP8 B;  2JAZ A;  2NO8 A;  3G4S P;  4PH1 A;  2FQ1 A;  2N98 A;  3VRL C;  2N5H A;  2X2B A;  3HZQ A;  1AF8 A;  1VKU A;  2Z44 A;  2PEK A;  2KGC A;  3RG6 C;  2N6Y A;  1IUQ A;  4BPH A;  5BS1 A;  2LML A;  2PNG A;  2LKI A;  4H2W C;  1M6N A;  2LOL A;  2JQ4 A;  2M8L A;  1VQ6 P;  2FVE A;  3DS5 A;  2BUO A;  1X3O A;  2BHV A;  4XRO A;  2K92 A;  2K0X A;  2WPT A;  2MR7 A;  2PEQ A;  1IMP A;  1HQB A;  2KGE A;  2L9F A;  1NJI Q;  2KOR A;  4XRQ A;  2N5I A;  2MVV A;  2FHS C;  2QA4 P;  2K5X A;  1VHN A;  3G28 A;  3DS0 A;  4NEO A;  1KQS O;  2GYK A;  3LMO A;  2XV6 A;  1EMV A;  5EW5 E;  3DS3 A;  3Q20 A;  2CGQ A;  1RO0 A;  3OW2 O;  1YI2 P;  3H0D A;  1GXH A;  2KG8 A;  2P9X A;  3CCR P;  3G21 A;  1YJ9 P;  1VQ7 P;  1QVF O;  2KGD A;  4QKO A;  1Z6M A;  2PEI A;  2N6Z A;  1YIT P;  3GZM A;  2EIA A;  2GDY A;  3G1G A;  3U43 A;  4WYM A;  1K8A Q;  2LPK A;  4BPF A;  2VLO A;  2JU2 A;  2VSQ A;  2QEX P;  4XFY A;  2XXM A;  5F2O A;  4H2Y C; 
#chains in the Genus database with same CATH homology
 3RG2 A;  2N98 A;  2N5H A;  2X2B A;  2JU1 A;  2KOO A;  2KOQ A;  1AF8 A;  2L0Q A;  1VKU A;  3NY7 B;  2KGC A;  2M5R A;  3EJB A;  3EJD A;  2L22 A;  2N6Y A;  2EHT A;  2KOP A;  4MRT C;  4PXH B;  4BPH A;  2JGP A;  5HV8 A;  1OR5 A;  2KG9 A;  4DG9 A;  4BPG A;  2FAD A;  2CQ8 A;  2LL8 A;  2AVA A;  2LML A;  2PNG A;  2LKI A;  4H2W C;  2GDW A;  2LOL A;  2JQ4 A;  1NQ4 A;  2FVA A;  2FVE A;  5HVC A;  2DNW A;  1X3O A;  2K92 A;  2K0X A;  2MR7 A;  2K2Q A;  2LIW A;  1HQB A;  1F80 D;  2GDX A;  2KGE A;  2L9F A;  2MF4 A;  2MVU A;  2KOR A;  2N5I A;  1HY8 A;  5KP6 B;  2MVV A;  2LTE A;  2FHS C;  2K93 A;  1T8K A;  5KP7 B;  2KW2 A;  3CE7 A;  2KG6 A;  4NEO A;  2MY5 A;  2XZ0 D;  1KLP A;  1DV5 A;  3LMO A;  2LIU A;  2FQ0 A;  3GZL A;  1ACP A;  2L4B A;  4IZ6 A;  2CGQ A;  2K0Y A;  2XZ1 C;  2KOS A;  1DNY A;  2K94 A;  2FVF A;  2KG8 A;  2AFD A;  2AF8 A;  4CA3 A;  2KWL A;  2FAC A;  5CZD B;  2QNW A;  2KGD A;  4H2X C;  2MD9 A;  2N50 A;  2N6Z A;  4HKG A;  2CNR A;  2KGA A;  1L0H A;  3EJE A;  2EHS A;  3GZM A;  2GDY A;  5EJD A;  4R0M A;  2FAE A;  4PWV B;  2LPK A;  4BPF A;  2KR5 A;  2CG5 B;  1L0I A;  2MR8 A;  2FQ2 A;  5KP8 B;  2ROQ A;  2VSQ A;  2FQ1 A;  2AFE A;  2JU2 A;  4H2Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...