4CBCA

Open-form navms sodium channel pore (with c-terminal domain) after thallium soak
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
93
structure length
93
Chain Sequence
GVGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ION TRANSPORT PROTEIN
publication title Prokaryotic Navms Channel as a Structural and Functional Model for Eukaryotic Sodium Channel Antagonism.
pubmed doi rcsb
source organism Magnetococcus marinus mc-1
molecule tags Transport protein
total genus 33
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4cbcA00
4RO2A 3UM7A 4GX0A 3ASOC 5B1BC 3E86A 3K03A 4PA6A 1G4YB 3K08A 2EILC 4RUEA 2WLNA 4PDVA 4R50A 3VOUA 4JTDB 3TETA 2P7TC 4X89A 3LDEA 4P2ZA 2HJFC 4XDKA 4CBCA 3JYCA 1R3IC 4G27B 1XL4A 2Q69A 3KG2A 3SYQA 1K4DC 2A0LA 1P7BA 2KB1A 2WLLB 5EBWC 2EIKC 3IGAC 4H33A 2WLHA 2R9RB 1R3LC 3ASNC 2Q6AA 2WLIA 2WLKA 3SYCA 4MVMA 4LBEC 3STZC 4GX1A 4MSWC 4HZ3A 4WFHA 1ORQC 3OR7C 3UKMA 4PA4A 1OCCC 3EFFK 3RW0A 3E83A 4J9YB 4H37A 2IH1C 3RVYA 1JVMA 4PDMA 1K4CC 3SYAA 5J9PC 2HVKC 3X2QC 3IFXA 4RUFA 3T4ZA 3K0DA 3ZRSA 2HVJC 2Y69C 3LDCA 4I9WA 4J9ZB 2DYSC 4DXWA 4RAIA 3SPIA 3GB7C 2QTOA 3OR6C 2ITCC 4JTCB 4P9OA 4WFGA 4MW3A 4KFMA 3STLC 1M57C 2X6CA 3E89A 5EC1C 1OCRC 2NLJC 4MTGA 3ZJZA 2Q67A 4MVUA 2OCCC 4MVRA 3SYPA 3OGCC 1J95A 3E8HA 3PJSK 3E8FA 5EBMC 3F7YC 3SJQC 4BW5A 5CBHA 5E1AC 3F7VC 4UUJC 4ZBMA 2Q68A 1M56C 4X88A 2A9HA 4OXSA 4PDLA 2H8PC 3R65A 2YEVA 3AG2C 3AG3C 3K06A 4HYOA 2HFEC 4LP8A 4MTOA 4XDJA 2DWEC 4LCUC 4F4LA 3FB6C 4MTFA 4MS2A 4EKWA 2JK5C 5CBFA 3LDDA 2DYRC 2WLMA 2A79B 3RVZA 3LNMB 4G28B 2EIJC 2HG5C 3F5WC 3SPJA 4QNHB 3LUTB 4PA9A 1R3JC 1QLEC 4MVQA 3FB7C 2QKSA 1KKDA 4PA7A 3TCUA 4MVZA 4P30A 5BZBA 2WLJA 3HPLC 1XL6A 2AHZA 5KUKA 5EBLC 1ZWIC 2WLLA 1R3KC 3ABMC 4WFFA 4GX5A 4WFEA 4R8CA 5B3SC 2IH3C 3T1CA 3FB5C 3FB8C 2X6BA 3SYOA 2EIMC 1OCOC 2X6AA 3K0GA 3WG7C 1V54C 5CBGA 4XDLA 4GX2A 2AHYA 2EINC 4TWKA 1S5HC 3SPHA 2BOCC 4QE7A 2WLIB 3RBZA 1V55C 2DWDC 4MVSA 3SPCA 3T4DA 2BOBC 4MW8A 1OCZC 4MVOA 3BEHA 5IY5C 4R7CA 3K04A 4JTAB 2ZD9A 3OUFA 5KUMA 3AG4C 4PDRA 4X8AA 3ABLC 1LNQA 3E8BA 4QE9A 5EC2C 3T2MA 3AG1C 5EK0A 2ATKC 2ZXWC 5B1AC 1BL8A 2W0FC 3SPGA 3E8GA 2K1EA 4R6ZA 4PA3A 2ITDC 4P9PA 3ABKC 3OUSA
chains in the Genus database with same CATH superfamily
3ASOC 2ILMA 5K1XA 3K08A 5IYZB 2AGAA 4ZKIA 3OTOO 4LFAB 4X89A 3LDEA 4DR4B 2BCCH 2Q69A 1K4DC 2A0LA 2AZ2A 2R9RB 3F5TA 2QWOB 1FPOA 5JQGB 1VQ6V 1LUWA 2CGNA 3DGEA 4DR2O 4B3TB 4O2BB 1ROPA 3OR7C 3HKBA 2OT5A 1I0HA 1TVKB 1VQ8V 1N36B 3OMIB 4ZI7B 1QCEA 3B4SA 5J9PC 2HVKC 4CC5A 4FFBA 1OCRB 2Y69C 1W59A 4NXNO 4RAIA 1FJGO 4DW1A 3OR6C 4EFEA 1NTKH 1Y74A 4KFMA 2D2CB 1HNWO 1YXBA 2ZM6B 1M56B 3OGCC 1DK1A 4BW5A 1I5YA 5DECA 2IU3A 2UXBB 2A9HA 4MTOA 2IM9A 4D6TH 4CZZA 1F51A 1KP3A 5CBFA 2JK5C 1IURA 1PL0A 5TISZ 1XNQB 4QNHB 5B1BB 2PUSA 4CH3A 3CCUV 2UUBO 1KKDA 1PM9A 1IXMA 5LP6C 1N0JA 2RNBA 2F4VB 3RT3C 1M93A 2EINB 1YJNV 2CK3G 3FB8C 4QPKA 4DV6O 1AR5A 3WG7C 2YXLA 5LHIA 4BAYA 4F6RA 2KKWA 3JAKB 4YHHO 3D36C 1N4CA 2DWDC 3W7XA 4LF4O 2Y0IA 4MW8A 3VQYA 1AJQA 4PDRA 2FTKA 3ZBHA 2PF4E 2M7WA 3RGBA 1EN4A 3U0ZA 4I5SA 4BIOA 1FXKB 1GN6A 4YY3O 4DR7B 5IWAB 1GK9A 2X7RB 4PELA 1KMIZ 1EZVH 5LXTB 2HJFC 3CX5F 2QM7A 4CS3A 1P7BA 1WB7A 5LYJB 3JASB 5C8YB 3RYIA 5KLVH 3SYCA 2ZIOA 3STZC 4X20A 1Q43A 1QHTA 2GTSA 2RQ6A 5ITZB 2VQEB 3ZMUA 1ZX3A 2PTMA 4NTXA 3X2QC 3G6BA 1NR7A 3HKDB 4DV1B 2QWQB 3LSSA 1OCRC 4MTGA 1SQPH 2L6LA 4E2LA 3F7VC 2XUMA 4LFBO 4ZBMA 4JI2B 1M56C 3QVNA 2CTQA 4I7ZB 2Q8VA 2YEVA 1VQPV 2MK3A 4ZHQB 2VWKA 3QO7A 4YJ3A 1BQZA 3MHSC 3ZN0A 2KG7B 4OGQB 4JYBA 4B3SO 2HG5C 4JAVA 2HR3A 1NS1A 4MVQA 3QNEA 4TV9B 2O57A 1RPRA 2ADQB 2WLJA 4B3MO 1R6KA 1WP8A 3BA8A 5JCOA 3CXCU 1E1RG 2JEXA 3TXQA 4IHJA 4BIUA 5LL6Y 4PJ0Z 4UCSA 4I55A 3CCSV 2EINC 1S77D 1ZSPA 2LQTA 3DSQA 1Z5VA 1KQSU 4JYAB 2CTRA 1EZJA 4LF5O 5FNVA 4LF7B 1PPJH 4DR3O 1XNRO 3CRAA 4GCZA 4FZ1A 2UU9O 2K1EA 4J42A 4X64O 2JGDA 2ITDC 5D5QA 4ZOLA 4JI0B 2UXDB 2JS3A 3OMAB 4RUEA 3N2KB 1BT8A 1K92A 1K33A 4CBCA 2AZ0A 1VQOV 3A0BZ 2ZDIC 4K3AA 4WBNA 4JYYA 3N27A 1GTOA 3P32A 4DUYO 1K5SA 4MT8A 2ARHA 3K0DA 4DV4B 1ENVA 2OTLV 2RMKB 3I55V 3ZJZA 5EBMC 5E1AC 1JOYA 1L0NH 3GVMA 1XMQB 2EIJB 1DTOA 4HYOA 2Q0AA 2WSSG 3ZRWB 4MTFA 2ZXWB 4KHPO 1KBHA 5L3DA 3CC7V 4AILC 3FX7A 1JPXA 1XHXA 1R3JC 5KX5A 3OTOB 2JJ2G 4O4JA 1WPXA 4FZ0A 2KQXA 2EZOA 1GKFA 1Q86W 1SQGA 3E35A 3W7WA 1ZAUA 3JALA 1RFYA 3W7SA 2X6BA 3JSLA 1VQKV 1WJZA 2BOCC 4QE7A 5GTIZ 4D7SA 3SPCA 4ASUG 3D8CA 3RFRA 3OTFA 5KUMA 5LP6A 5J2TB 1FKAO 3C90A 1GH6A 1FJGB 1ZLZA 1YJ9V 2ZNJA 5HFLA 2WAMA 5J2UA 4AQYO 4UVAA 4JI4O 2IJKA 3D36A 4G2KA 3TGUH 2A7WA 3CRMA 4HNAB 4C7UA 5IJ9B 3SYQA 3OE7G 1YI2V 2E5LO 1AROP 2WLHA 1R3LC 1TGOA 1OJHA 1CP9A 3P3PA 2LGQA 2V1DA 5EZYA 1B06A 2RCVA 1BZKA 2Z0AA 5LOVB 2GBOA 4Z2WA 1VQ7V 1M57B 3ETEA 3L70H 4DV5O 3N2GA 3GB7C 4D7TA 4J7KA 2Y0PA 3K9SA 1K3EA 3TJTA 1CPYA 3CPWU 4YHHB 2HLDG 4LF4B 3AG3B 5IDJA 4UVBA 1FAFA 2CUGA 4ZIBA 5JQGA 3M7MX 4DV2O 3CMAV 4NR1A 2RDCA 4LF8O 2EULA 3RYCB 4BR6A 1TVKA 1H8HG 3RVZA 5EIBC 2EIJC 1F23A 3F5WC 2W0XA 1NQTA 3TCUA 3OM3B 1XL6A 3E22B 1ZWIC 1GN3A 4NXMO 4NTYA 1B04A 2Z5UA 1H2MA 2ZIMA 2GV9A 3FAVA 3RBZA 4DR6O 1PP9H 4JZ2A 2BE3A 2DQ0A 3JD4A 4H0LB 2PI4A 4DUZO 2EILB 3AK2A 3H1HH 3UM7A 4GX0A 1S5JA 3E86A 1G4YB 3BA9A 4DO2A 4A5UB 3OMNB 4R50A 3VOUA 4LFBB 1EFRG 4JI3B 3CYOA 3BVOA 2R72A 1PKXA 4TUYB 4TOIA 3JATA 5LMNO 1AR4A 1GM7A 4B3SB 3BFRA 1NH2D 3AG7A 3K9AA 3UKMA 1IX9A 4B7EA 1IBLO 5IT9N 1K97A 3G4SV 1NJIW 1J5EO 5LMUO 5K1PA 4J9ZB 1YITV 3Q4HA 2QJ1A 5H5NA 1M57C 5EC1C 1UFIA 2ZDIA 3HKEB 3SYPA 5LXTA 3M8AA 2XT9A 5CBHA 2P4VA 5LYJA 2IJHA 2Z3YA 4LF5B 1GM9A 3JASA 5C8YA 2DYRB 4FMTA 3DC6A 2DQ3A 4DR3B 3JD1A 2UU9B 2H8PC 1XNRB 3AG3C 3K06A 4K35A 4X64B 2DWEC 2PYLA 3EHBB 1RSOB 1EN6A 4NVPA 5ITZA 4JV5O 4Q6GA 1QQCA 5FL7G 3CCVV 4O4IB 1DF4A 2QKSA 1YEWA 4NKGB 2EIMB 1KC8W 1AI7A 4KXRA 4WFFA 5CB4B 4U7NA 2IH3C 1SQXH 4IIJB 4LF6O 1HNZO 3JARA 4GX2A 2ZT9B 4DUYB 1XEQA 1A32A 3OUFA 2AXTZ 4X8AA 4QE9A 1P4RA 1BL8A 2KG7A 2YIBD 1K5QA 1VIBA 2YIDA 5CA1A 1FFXB 3CHXA 1WA8B 1GO3F 1N34O 2EILC 1DGSA 2P7TC 5KAIZ 1AB3A 4XDKA 2BTQB 1K9MW 4FM2A 3AK3A 1VEWA 4KHPB 2XAFA 4EB6B 5L3FA 3CSXA 3MHHC 4J9YB 1MMMA 1XMOO 2UXCO 3ETQA 1I94O 5IYCO 4QPJA 3G71V 1L0LH 4I50B 5JJNB 1EBOA 4Z1VA 1HNXO 1BGYH 2Y4TA 3VQVA 3ABMB 1H2GA 3N2KA 4LF9O 2JRIA 5BMVA 2R9AA 3K59A 1KUQA 3PJSK 3MD0A 3F7YC 2F95B 4JI7B 1SQFA 1TUBA 1MZFA 1O9HA 4DV3B 4JASA 2ZKOA 5KA5A 1MG1A 1BSMA 2DYRC 1WLEA 5JH7B 4AQYB 3OFNG 3B2EE 4YJ2A 4WCEV 1WNSA 2CH7B 2E5LB 1YTFB 2QWNB 1IXBA 3OW2U 2EIMC 2WA3A 4XDLA 4W4KA 1TAEA 3H01A 3CC2V 2V4DA 1XHZA 1F7YA 3J81N 3ZRWA 2BSKB 1U96A 5EC2C 4DV5B 5L3EA 1WN7A 2HP8A 4RWUA 1Q5OA 2FL4A 4J41A 4JTDB 3H1IH 2B5UA 4UVCA 1VP7A 3KG2A 4DV2B 4X1KA 4LF8B 4BIZA 2Y48A 4UCVA 3QO8A 4FLVA 3T1YB 4MVMA 1FXVA 1Q81W 4DRXA 1NZ6A 4WFHA 1THZA 3BRCA 2XASA 2LP7A 3RW0A 5J2TA 2ADPA 3SYAA 4RQEA 4I9QA 2GSMB 1AJNA 4NXMB 2OCCB 1I5XA 3RYFB 3EXAA 4P9OA 4WFGA 4JTCB 4K0KO 4F6EA 2N74A 3AEIA 5IJ9A 3K5OA 1U97A 2IBZH 4YXWG 4DR6B 2ZCEA 4UUJC 2HJDA 4GUNA 1TUEB 5EIBD 3KCYA 1US6A 1PNLA 1UPGA 4PDLA 3SJCC 4DUZB 3VQWA 1NI8A 4MS2A 2QKAA 5LOVA 4I4TB 3FB7C 1BE3H 3UT5B 2QSAA 1D5NA 1M4UA 3VBBA 4B3RO 1KP2A 2HKOA 2XNDG 3CB2A 4O4HB 1P7GA 5LMNB 3KZIZ 3CMEV 4ICGA 3JAMN 3AG1B 1QR8A 2WLIB 5KMGB 1MSWD 1IBLB 4MVOA 3OD4A 5BR8O 2GTAA 1X4TA 3HKCB 3A8TA 2PI5A 1LNQA 1J5EB 1Q7YW 1Y76B 1KU9A 5LMUB 2JJ1G 1SRYA 3E8GA 3FKSG 4CH5A 5LGUA 1NR1A 5B1BC 3K5LA 2XTAA 1VQNV 1S3JA 5A2QN 4LNUB 3ICXA 2ZE6A 2Q7GA 4B08A 4N21A 3NXSA 4FVMA 4P2ZA 4G27B 1XL4A 5EBWC 1QR9A 5L3GA 4JPRA 2DN9A 3AG2B 4K8XA 4K8ZA 3BY6A 1XBLA 2ZR2A 2LGWA 3S3XA 2V7QG 4IT5A 5IE9A 4FLXA 2EJRA 4DR1O 1JCHA 4JAAA 2XAQA 2ETNA 1FXKC 4UCTA 1R6TA 3SPIA 1FYJA 4L8JA 3CWBH 4LF6B 1HNZB 1Q8IA 2X6CA 5IJ0B 2OCCC 1IBMO 3CCLV 1SKVA 1W0KG 2QEXV 2P90A 4X88A 4PHZA 3KCXA 1ZL8B 4XDJA 3CCQV 1MABG 3FB6C 2A79B 2CE4A 4JF3A 2WWWA 3BHPA 1XREA 1N34B 3LUTB 1DLBA 4WFAV 4PA9A 3APOA 4RQFA 2OWOA 1QU7A 2PYJA 1BHBA 3ZRXA 2YIAA 5BZBA 1QBZA 2WLLA 4KP4A 2H3OA 3HKEA 1SERA 1IDSA 5CA3A 3RN4A 4ABMA 2GDSA 2JGUA 4TWKA 4UV9A 4UB8Z 3ZRVA 5B1AB 4MVSA 3G6EV 3C3SA 4X62O 1XMOB 1N33O 2UXCB 3BEHA 1I94B 1QVGU 3AG1C 2GUZB 4GZRB 1Y66A 1HNXB 3QTCA 4X66O 3K03A 1GN4A 4I0XB 4DR2B 5GONA 3DTUB 2UUCO 5H9CA 3IC9A 5KA6A 2KB1A 1OCCB 3K5NA 1RPOA 2ZR3A 3DC5A 4NXNB 4F6RB 4HZ3A 5CA0A 1HNWB 3JAWB 2F93B 4FIPC 2EX3A 1HWYA 1AP6A 4B3TO 1WA8A 1SQBH 3ZHQA 3E89A 1SA0A 4J80A 1H2NA 3OT7A 3S3WA 3RYHB 2YI8A 3UCSC 3SJAC 2KSDA 2UUBB 4EB6A 3FYIB 3KKYA 4W4LA 3LSQA 3RYIB 2ZINA 3GWOA 3UO2A 2WLMA 1B3QA 3L71H 4WF9V 2UUAO 4FLYA 2HEPA 4DV6B 5IYZA 2ZE5A 3CRCA 1GM8A 4JI8O 2UXNA 3H1LH 3HPLC 1YJWV 5LHGA 5KUKA 1R3KC 2M6YA 1LR1A 1JR9A 3L9DA 1V55B 3ABTA 1PNKA 3J7AU 2X6AA 1HR0O 3AG4B 4O2BA 3L75H 1G6UA 4LWSB 4HAMA 4ZI7A 4YY3B 1SZXA 4O2AB 4LH6A 2NNUA 4XBFA 1Z5WA 3M99B 5DN6G 2ATKC 2ZXWC 5B1AC 4DW0A 2YEVB 1JMKC 4K0KB 3BABA 4YJ3B 5BY1A 5DEDA 1DF5A 2ZQMA 4JZGA 2QR4A 2YSUB 3ZHVA 2YC0A 4HBNA 3ZCCA 4H33A 3I5DA 3WB1A 2Q6AA 1NVPB 1P49A 4FLZA 2VQFO 4IL6Z 2BSKA 1GN2A 4PA4A 1OCCC 2DYSB 1MOFA 1QLEB 2JS5A 2IJIA 4RUFA 2F43G 1MA1A 5IYBO 2K9PA 4DXWA 1URFA 1D2DA 2VQEO 4Q20A 3SR2C 3JAKA 4MVUA 2OTJV 1CXZB 1VARA 3SJQC 4OPHA 2Q0OC 5BR8B 3ZMSA 1BS3A 4OX9O 1TA8A 3R65A 2HFEC 4B3MB 2Q73A 4LCUC 1NT2B 3P30A 2P5OA 3CCRV 1S5LZ 1FXKA 3LDDA 5LA6B 1F4NA 1FFTB 4FPPA 4EFBA 3J80N 3SPJA 1VQ5V 4JI5O 1NKDA 3APQA 3JD2A 2W6IG 4P30A 2E74B 2ZE8A 1S0VA 4GKJO 2QDOA 4NTWA 3D3QA 4WFEA 1FXHA 2PY5A 3W7UA 4U3FH 3QF7A 4LC1A 2DW4A 3JCUZ 1MSDA 3ZMTA 1M5IA 2CTPA 1XDCA 2Q7EA 3ABLB 5KHJA 5KHHA 3LSUA 3SPHA 4E4EA 4FM1A 1V55C 1L8DA 2PGGA 1X59A 1M90W 4DR1B 4R7CA 2VWJA 4BWAA 3AG4C 4UXNA 1H2LA 1YF2A 2W0FC 2CTWA 3HKDA 3D3IA 2JEUA 4I4TA 4JYAO 4UB6Z 2L35A 3UT5A 2EIKB 4PI0A 4LF7O 1IBMB 4O4JB 5AG2A 2LJ2A 3IGAC 4ZHQA 4UCRA 4Z1MG 3QO5A 2WLIA 3ZS8C 2XAGA 3QG5A 4IYIA 3UQ8A 4IGGA 3THOA 4TV9A 5B1OA 4PDMA 4LFCO 4GKKO 3IFXA 1Q6UA 2P67A 5LP6B 4FLUA 3R66A 3ZX6A 1AILA 2DYSC 5B1NA 4LNUA 2QTOA 2OIGA 2QWPB 3STLC 4LR3A 1KECA 2NLJC 2Q67A 3HR0A 5J2UB 1BQ0A 1H8EG 1YHQV 3K79A 4X62B 3CXHF 5L3CA 2QKCA 5L3BA 4U3JB 1BCCH 1NTZH 2QA4V 2JVDA 1JJ2U 5DM6V 4O4LB 2GHYA 3HB3B 3OGIB 4X66B 3DXRB 3B77A 3WFVA 4KL1A 2JIZG 4MVZA 2FMLA 2AHZA 5LHHA 5EYPB 5IJ0A 3T1CA 3N2GB 2E3CA 3CD6V 2P4KA 1PD3A 1S72V 1LUVA 2ZE7A 2IJJA 4AI8A 4JYCA 3RWRD 1XOUA 4JI6O 2E76B 2BTOA 1ZL8A 4FFKA 3ABKB 2LFRA 4JI4B 3ABLC 1M1KW 3X2QB 3L73H 1NH2B 2QWRB 1NU1H 4PDVA 3IC7A 4X1IB 5F2VO 3ASNB 1IBKO 1K73W 2E75B 1HP8A 1R3IC 2EIKC 1I08A 2UXXA 5H6RA 4J11A 1W2BU 1O9GA 3H1KH 2UUAB 3NR7A 2NR5A 1NTMH 1D5AA 3G80A 4YIPA 5KHKA 2DJVA 3FAVB 2GUZA 4TV8B 4JI8B 1AP5A 1JVMA 4UV8A 1COWG 4OPAA 3T4ZA 4QIWF 3TK1A 4I9WA 4PD4F 1OV9A 2A3QA 5B66Z 1R6NA 4I0XA 1HR0B 3ZEDA 4X1YB 3E2EA 4MVRA 2DMXA 1P84F 2EBOA 4L87A 5KAFZ 1N32O 1YSCA 3JATB 2WPDG 3JAWA 4GLXA 2N04A 1ZUQA 4AHCA 1Q82W 2IU0A 4GYCB 2YUAA 3CJHB 4HNAA 1MNGA 1OCOB 3ABMC 4GX5A 1Q6IA 2XOKG 3Q4HB 3RYHA 1OCZB 3K0GA 5IY5B 3CP1A 1UJWB 2VQFB 5CN0A 1S5HC 5JVDB 1W0JG 1Y67A 1AI6A 2CGOA 3T1HO 4JTAB 3LNNA 3E8BA 3L74H 3BCCH 5JJEB 5EK0A 1JJOA 1HW7A 3UO3A 3TXSA 4DR5O 4X9QA 4PI2A 3JD0A 3ABKC 3OUSA 3MAQA 1JFFB 1PV0A 1R73A 1VQ9V 1XQ8A 4X65O 4DV0O 1BMFG 3I56V 3JYCA 4OX9B 2YXYA 1QVFU 1GMGA 3B8MA 3ASNC 4LWSA 3RYCA 4LBEC 5FPRA 1WPBA 4J10A 3ZHRA 3JARB 3VQXA 4JI3O 5CMUA 2DE0X 4O2AA 4JI5B 3EFFK 3E83A 5JJJB 3RVYA 1Y4MA 4GKJB 3E22A 2QM4A 4NB5A 4DK0A 1BHAA 5CA1B 2MW2B 3AK1A 4H13B 2EJ7A 3E8HA 5KHIA 4JV5B 3ZHTA 1I7FA 4DV7O 2OIEA 2XHBA 4FK5C 3CEIA 3ZHUA 4CS2A 3U10A 2H94A 4LH7A 4F4LA 2FKXA 2XAHA 3LNMB 5LGTA 1OZ0A 4TSFG 2P06A 1SQQH 1ZTEA 4PV1B 1V54B 4TUYA 3ETGA 3B09A 1RM1B 1JX9A 4H44B 3ETDA 1OCOC 1WB8A 5BMVB 1IVSA 1EM1A 1AI4A 2F23A 3CRQA 1YVWA 3CCJV 1AVMA 4LFCB 1OCZC 2LW1A 2D3OW 1PNMA 5IY5C 4GKKB 2ZD9A 2R9IA 3HKBB 1TUBB 4J7ZA 4YIOA 3K58A 2PZSA 5LA6A 2OYQA 3SPGA 3FYEB 4P9PA 2RN9A 4DYLA 4FFBB 2HHHO 3H1JH 4CH6A 1SF9A 2WA4A 1Y74B 3BAAA 1GAXA 4YJ2B 3K57A 1B6QA 1N0NA 3K3WA 1NVPD 1RSOA 2YI9A 3B8NA 4JI1O 3CC4V 4QJFB 4O4IA 2VS0A 2YDEA 2YS8A 1VMGA 3CRRA 4LF9B 3U11A 2IH1C 1K4CC 2IW5A 3ZRSA 2HVJC 1KD1W 5CB4A 3W7TA 2CAZC 4N23A 2ITCC 1E1QG 4IIJA 1F4MA 1VF6C 3C3TA 3CE2A 4JI6B 1FS0G 1IZ3A 4CS4A 4LFAO 2R70A 5A9GA 4DR4O 4B7KA 3AG2C 4X1KB 4LP8A 1VQLV 1WAZA 1FFXA 4FJCC 5JWPA 1WP7A 1YZBA 4UCOA 1XI1A 4DRXB 4JI7O 2Q9LA 1PL4A 1T5EA 4DV3O 1IBKB 1N36O 1GRJA 2BTQA 3ZHSA 3WB0A 3IJ4A 3WU2Z 4R8CA 2Q7HA 3CS5A 2C2AA 1YCIA 1V54C 2ZM6O 5BXZA 1M9NA 1MZEA 5KHGA 1RM1C 5HFMA 3T4DA 2XAJA 3OEEG 4U3JA 4X20B 1Z2GA 2Q5ZA 1SETA 2UXBO 4O4LA 1H2SB 2G38A 1L1FA 3DXRA 4I50A 2QTSA 1G1XB 4R6ZA 2VRZA 1H2KA 3L72H 4JGSA 5D5PA 3CCEV 5LBQA 3A2FA 1XNQO 3G67A 3ML0A 2WLNA 5EYPA 2W6JG 3WB2A 4MTXA 3TETA 3EVKA 2F4VO 1N32B 1KB9F 3MDSA 2N05A 2WLKA 2B1IA 4TT3G 4GX1A 3SGIA 2ODMA 3O65A 5JH7A 2FB5A 1QLNA 2CH7A 2RJZA 3ABUA 3T1YO 5FPOA 2Q4PA 1NBMG 2CDYA 4BW9A 2ZNIA 3OEHG 4MW3A 1YIJV 2EZPA 4X1IA 4IHJB 3IAYA 4UCUA 1Q3EA 1AI5A 1EN5A 4DR7O 3E8FA 5IWAO 2F66C 4U7OA 4I55B 3T1HB 5LGNA 3K5MA 1S76D 1VQ4V 3SJBC 4DR5B 2QGNA 4B3RB 5FNVB 2QE7G 3ZN1A 4EKWA 4TV8A 1OHHG 3FFQA 2LW7A 5IYDO 2JGDB 1SS3A 2QM8A 4ZOLB 5B3SB 2YICA 4PA7A 4X65B 4DV0B 4JAUA 2P6JA 4J7JA 2FYUH 5EBLC 1G8MA 4X1YA 3ZMVA 3PN1A 4DV1O 2AW9A 4QGPA 2AHYA 4KUMA 1JQ0A 4FLWA 2F1MA 4WBNB 2BOBC 5FLXN 3K04A 5B5EZ 5H6QA 1SC5B 3ASOB 2OCHA 3T2MA 4JI2O 2NN4A 5C93A 1CEZA 1K7DA 3RYFA 4WFBV 4PA3A 3JD3A 4RO2A 1YTFD 4PA6A 4DK1A 3CJHA 1SESA 3BPZA 2YIBA 3FD9A 4DV7B 3B40A 1K8AW 1N8RW 4TQDA 2B1GA 3A0RA 1VF5B 1AR1B 2WLLB 1E79G 1H38A 3OAAG 5JVDA 1KYOF 4MSWC 1Y6XA 1ORQC 2X0LA 3H9VA 2Y69B 4IYHA 1Q6HA 1VF7A 4H37A 4FLTA 2A06H 1KKCA 1XILA 5KX5B 1SQVH 4O4HA 3LDCA 1JFFA 2LFSA 3A0HZ 3JCZA 2JDIG 4JI0O 2UXDO 3JALB 3O9OA 3ZIAG 4CC6A 1J95A 2DOSA 5KMGA 1Q90D 3ZMZA 1JA8A 5GONB 5JCOC 2B9ZA 1QNMA 3HKCA 1R1BA 4EEQA 2Q68A 1AJPA 1Y76A 4OXSA 4UFZA 1XUQA 1K34A 4CH4A 2HHHB 1HDJA 1RP3B 4G28B 5CA0B 1QLEC 1FD9A 1VF6A 1VQMV 4FM0A 1V9PA 3WG7B 3GWKC 1N33B 2LO1A 4DV4O 4NYKA 5B3SC 3CCMV 1SZTA 3FB5C 5GTHZ 4TQFA 4GT1A 4JI1B 3SYOA 2P22C 3P3NA 5CBGA 1SA0B 5H2FZ 1YDXA 2Y4UA 5E79Z 3JSNA 2YXHA 5GW7A 5EZYB 3SDLA 1XMQO 2UUCB
chains in the Genus database with same CATH topology
3UM7A 4GX0A 3ASOC 3E86A 3K03A 1G4YB 1R73A 1VQ9V 3K08A 4DO2A 3OMNB 4ZKIA 4R50A 3VOUA 3DTUB 1EFRG 4X89A 3LDEA 5H9CA 3CYOA 1BMFG 3I56V 3JYCA 2Q69A 1K4DC 2A0LA 2KB1A 5KA6A 1PKXA 1QVFU 1GMGA 3B8MA 1OCCB 2R9RB 1RPOA 3ASNC 2ZR3A 1VQ6V 1GM7A 4LBEC 3DGEA 1NH2D 4HZ3A 1ROPA 5CMUA 3K9AA 3OR7C 3UKMA 2OT5A 3EFFK 1VQ8V 3E83A 3RVYA 3OMIB 1Y4MA 1QCEA 5J9PC 2HVKC 4FIPC 1K97A 3G4SV 1NJIW 1OCRB 1HWYA 2Y69C 4J9ZB 1YITV 4RAIA 1BHAA 3OR6C 4KFMA 1M57C 3E89A 5EC1C 2ZDIA 1M56B 3SYPA 3OGCC 3E8HA 5CBHA 4BW5A 1I5YA 4FK5C 2IJHA 2IU3A 2Z3YA 1GM9A 2DYRB 4FMTA 2A9HA 2DQ3A 3JD1A 2H8PC 2H94A 3FYIB 3AG3C 3K06A 4MTOA 3LSQA 2DWEC 4F4LA 4CZZA 3EHBB 1F51A 1KP3A 5CBFA 2JK5C 3GWOA 2XAHA 2WLMA 1PL0A 5FL7G 4WF9V 3LNMB 3CCVV 5LGTA 1OZ0A 4TSFG 4QNHB 1DF4A 5B1BB 1GM8A 3CCUV 2QKSA 1KKDA 1IXMA 2UXNA 3HPLC 2EIMB 1YJWV 1KC8W 1AI7A 5LHGA 1V54B 5KUKA 1R3KC 2EINB 1YJNV 4WFFA 3ETGA 2CK3G 4U7NA 2IH3C 1RM1B 1JX9A 1V55B 3FB8C 3ETDA 4QPKA 3ABTA 1PNKA 3WG7C 1OCOC 2X6AA 5LHIA 3AG4B 4BAYA 4GX2A 1AI4A 4HAMA 3CCJV 2DWDC 3W7XA 4MW8A 1OCZC 2D3OW 1PNMA 5IY5C 1AJQA 2ZD9A 3OUFA 2R9IA 4PDRA 4X8AA 2FTKA 2NNUA 4QE9A 4XBFA 1P4RA 3M99B 2ATKC 2ZXWC 5B1AC 5DN6G 1BL8A 2YEVB 2M7WA 1K5QA 3SPGA 4I5SA 3FYEB 4P9PA 1FXKB 1DF5A 1GO3F 2EILC 1GK9A 2ZQMA 2YSUB 2X7RB 4PELA 2P7TC 3ZCCA 2HJFC 4XDKA 1B6QA 1K9MW 2QM7A 1P7BA 4H33A 3K3WA 1NVPD 2Q6AA 1NVPB 3B8NA 3SYCA 2XAFA 3CC4V 4QJFB 3STZC 5L3FA 4PA4A 3MHHC 1OCCC 3ZMUA 2DYSB 4J9YB 2IH1C 1K4CC 1MOFA 1QLEB 2IW5A 3X2QC 5IYCO 2IJIA 4RUFA 3ZRSA 4QPJA 3G71V 2HVJC 1KD1W 1EBOA 2F43G 5IYBO 4DXWA 1NR7A 3W7TA 4N23A 2ITCC 1H2GA 3ABMB 1E1QG 1F4MA 3LSSA 4Q20A 1OCRC 4MTGA 4MVUA 2OTJV 4E2LA 1FS0G 3PJSK 3MD0A 3F7YC 3SJQC 3F7VC 3ZMSA 4ZBMA 1M56C 3R65A 2YEVA 3AG2C 4LP8A 1VQPV 2HFEC 4JASA 1VQLV 2MK3A 5KA5A 4LCUC 1MG1A 3P30A 3QO7A 3CCRV 1FXKA 3LDDA 2DYRC 4FJCC 3MHSC 3ZN0A 1F4NA 1FFTB 1WLEA 4FPPA 4JYBA 2HG5C 4JAVA 3SPJA 2HR3A 3OFNG 1VQ5V 4MVQA 1NKDA 3JD2A 3QNEA 2W6IG 4P30A 4WCEV 1RPRA 2WLJA 1S0VA 1R6KA 3CXCU 1E1RG 2JEXA 4WFEA 1FXHA 1YTFB 4R8CA 4BIUA 3W7UA 4LC1A 2DW4A 3OW2U 2EIMC 2C2AA 3ZMTA 1V54C 4XDLA 3CCSV 3ABLB 2EINC 1S77D 3H01A 1M9NA 3SPHA 1RM1C 5HFMA 1V55C 3T4DA 2XAJA 1KQSU 3CC2V 3OEEG 1M90W 1EZJA 4R7CA 1SETA 3ZRWA 3AG4C 4UXNA 1L1FA 5EC2C 4GCZA 2W0FC 2K1EA 4R6ZA 2ITDC 3D3IA 4JGSA 2JEUA 3CCEV 5L3EA 5LBQA 3OMAB 3ML0A 4RUEA 2EIKB 2WLNA 2W6JG 4JTDB 4MTXA 3TETA 1K92A 2B5UA 4UVCA 1K33A 4CBCA 3KG2A 1VQOV 3IGAC 4BIZA 2Y48A 4Z1MG 2ZDIC 3QO5A 3QO8A 2WLIA 2WLKA 4MVMA 1FXVA 2B1IA 2XAGA 4TT3G 4GX1A 1Q81W 4WFHA 1GTOA 1THZA 2XASA 2LP7A 3P32A 3RW0A 5B1OA 4PDMA 1QLNA 3SYAA 4RQEA 1K5SA 4MT8A 3ABUA 3IFXA 2GSMB 1AJNA 2P67A 3K0DA 1ENVA 2OCCB 1I5XA 1NBMG 5B1NA 2DYSC 2QTOA 4P9OA 4WFGA 4JTCB 3OEHG 4MW3A 1YIJV 2EZPA 3I55V 2OTLV 3STLC 3AEIA 3ZJZA 1KECA 2NLJC 2Q67A 1AI5A 5EBMC 1H8EG 1YHQV 3K79A 3E8FA 4YXWG 5E1AC 4U7OA 4UUJC 1JOYA 5LGNA 1S76D 5L3CA 5L3BA 1TUEB 1VQ4V 1PNLA 4PDLA 2EIJB 1DTOA 4HYOA 2QA4V 3ZRWB 2WSSG 1JJ2U 5DM6V 2GHYA 2QE7G 2ZXWB 3HB3B 4MS2A 4MTFA 3ZN1A 4EKWA 1OHHG 3B77A 5L3DA 3CC7V 3WFVA 1JPXA 5IYDO 1R3JC 2QM8A 2JIZG 3FB7C 5B3SB 4PA7A 2JJ2G 4MVZA 1WPXA 3VBBA 4JAUA 1KP2A 2P6JA 2EZOA 2AHZA 2HKOA 5LHHA 5EBLC 1GKFA 2XNDG 1Q86W 1G8MA 3E35A 3W7WA 3ZMVA 3T1CA 3W7SA 3CD6V 2X6BA 1PD3A 1VQKV 3CMEV 2AHYA 4KUMA 1JQ0A 1S72V 3AG1B 2IJJA 2BOCC 4JYCA 4QE7A 1QR8A 2WLIB 3SPCA 4ASUG 2BOBC 1MSWD 4MVOA 3ABKB 3K04A 5H6QA 5KUMA 2LFRA 3ASOB 3ABLC 1LNQA 3T2MA 2PI5A 1Q7YW 1M1KW 2JJ1G 1SRYA 5C93A 1CEZA 3X2QB 3E8GA 1K7DA 4WFBV 4PA3A 3FKSG 1NH2B 3JD3A 4RO2A 5LGUA 1NR1A 1YJ9V 1YTFD 5B1BC 5HFLA 4PA6A 1VQNV 1S3JA 1SESA 2WAMA 4UVAA 4PDVA 3IC7A 2IJKA 4N21A 3D36A 3NXSA 4G2KA 3ASNB 1K8AW 4P2ZA 1N8RW 1K73W 3SYQA 1R3IC 2B1GA 1XL4A 3A0RA 3OE7G 4G27B 1YI2V 1AR1B 5EBWC 2WLLB 1AROP 1QR9A 1E79G 2EIKC 5L3GA 1H38A 2UXXA 4JPRA 2WLHA 5H6RA 3OAAG 1R3LC 1W2BU 3AG2B 1CP9A 4MSWC 3BY6A 1ORQC 2X0LA 2Y69B 2ZR2A 2V1DA 2V7QG 4H37A 1JVMA 4UV8A 2EJRA 1COWG 3T4ZA 1JCHA 4QIWF 3TK1A 1M57B 3ETEA 1VQ7V 2XAQA 2LFSA 3LDCA 4I9WA 1FXKC 3JCZA 2JDIG 3SPIA 3GB7C 1R6NA 3CPWU 1K3EA 2X6CA 1CPYA 3E2EA 2HLDG 2OCCC 4MVRA 3ZIAG 1J95A 3AG3B 3ZMZA 5IDJA 4UVBA 3CCLV 2EBOA 1W0KG 2QEXV 2P90A 2Q68A 1AJPA 4L87A 4X88A 4OXSA 3CMAV 1YSCA 4XDJA 3CCQV 1MABG 3FB6C 1K34A 2WPDG 1H8HG 3RVZA 2A79B 4JF3A 4G28B 2EIJC 1F23A 2WWWA 3F5WC 3LUTB 1DLBA 4WFAV 4PA9A 1Q82W 2IU0A 1NQTA 1QLEC 4RQFA 3TCUA 1VQMV 3OM3B 1BHBA 3ZRXA 5BZBA 3WG7B 1XL6A 1OCOB 1QBZA 1ZWIC 2WLLA 3ABMC 4KP4A 4GX5A 2XOKG 5B3SC 3CCMV 1SZTA 1SERA 3FB5C 2Z5UA 1OCZB 4GT1A 3SYOA 3K0GA 5CA3A 5IY5B 3CP1A 1UJWB 5CN0A 5CBGA 4TWKA 4UV9A 1S5HC 3ZRVA 5B1AB 3RBZA 1W0JG 4MVSA 3G6EV 1AI6A 3BEHA 1QVGU 4JTAB 3E8BA 2DQ0A 3JD4A 3AG1C 5EK0A 5GW7A 2PI4A 1Y66A 2EILB 3JD0A 3ABKC 3OUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RO2 A;  3UM7 A;  4GX0 A;  3ASO C;  5B1B C;  3E86 A;  3K03 A;  4PA6 A;  1G4Y B;  3K08 A;  2EIL C;  4RUE A;  2WLN A;  4PDV A;  4R50 A;  3VOU A;  4JTD B;  3TET A;  2P7T C;  4X89 A;  3LDE A;  4P2Z A;  2HJF C;  4XDK A;  4CBC A;  3JYC A;  1R3I C;  4G27 B;  1XL4 A;  2Q69 A;  3KG2 A;  3SYQ A;  1K4D C;  2A0L A;  1P7B A;  2KB1 A;  2WLL B;  5EBW C;  2EIK C;  3IGA C;  4H33 A;  2WLH A;  2R9R B;  1R3L C;  3ASN C;  2Q6A A;  2WLI A;  2WLK A;  3SYC A;  4MVM A;  4LBE C;  3STZ C;  4GX1 A;  4MSW C;  4HZ3 A;  4WFH A;  1ORQ C;  3OR7 C;  3UKM A;  4PA4 A;  1OCC C;  3EFF K;  3RW0 A;  3E83 A;  4J9Y B;  4H37 A;  2IH1 C;  3RVY A;  1JVM A;  4PDM A;  1K4C C;  3SYA A;  5J9P C;  2HVK C;  3X2Q C;  3IFX A;  4RUF A;  3T4Z A;  3K0D A;  3ZRS A;  2HVJ C;  2Y69 C;  3LDC A;  4I9W A;  4J9Z B;  2DYS C;  4DXW A;  4RAI A;  3SPI A;  3GB7 C;  2QTO A;  3OR6 C;  2ITC C;  4JTC B;  4P9O A;  4WFG A;  4MW3 A;  4KFM A;  3STL C;  1M57 C;  2X6C A;  3E89 A;  5EC1 C;  1OCR C;  2NLJ C;  4MTG A;  3ZJZ A;  2Q67 A;  4MVU A;  2OCC C;  4MVR A;  3SYP A;  3OGC C;  1J95 A;  3E8H A;  3PJS K;  3E8F A;  5EBM C;  3F7Y C;  3SJQ C;  4BW5 A;  5CBH A;  5E1A C;  3F7V C;  4UUJ C;  4ZBM A;  2Q68 A;  1M56 C;  4X88 A;  2A9H A;  4OXS A;  4PDL A;  2H8P C;  3R65 A;  2YEV A;  3AG2 C;  3AG3 C;  3K06 A;  4HYO A;  2HFE C;  4LP8 A;  4MTO A;  4XDJ A;  2DWE C;  4LCU C;  4F4L A;  3FB6 C;  4MTF A;  4MS2 A;  4EKW A;  2JK5 C;  5CBF A;  3LDD A;  2DYR C;  2WLM A;  2A79 B;  3RVZ A;  3LNM B;  4G28 B;  2EIJ C;  2HG5 C;  3F5W C;  3SPJ A;  4QNH B;  3LUT B;  4PA9 A;  1R3J C;  1QLE C;  4MVQ A;  3FB7 C;  2QKS A;  1KKD A;  4PA7 A;  3TCU A;  4MVZ A;  4P30 A;  5BZB A;  2WLJ A;  3HPL C;  1XL6 A;  2AHZ A;  5KUK A;  5EBL C;  1ZWI C;  2WLL A;  1R3K C;  3ABM C;  4WFF A;  4GX5 A;  4WFE A;  4R8C A;  5B3S C;  2IH3 C;  3T1C A;  3FB5 C;  3FB8 C;  2X6B A;  3SYO A;  2EIM C;  1OCO C;  2X6A A;  3K0G A;  3WG7 C;  1V54 C;  5CBG A;  4XDL A;  4GX2 A;  2AHY A;  2EIN C;  4TWK A;  1S5H C;  3SPH A;  2BOC C;  4QE7 A;  2WLI B;  3RBZ A;  1V55 C;  2DWD C;  4MVS A;  3SPC A;  3T4D A;  2BOB C;  4MW8 A;  1OCZ C;  4MVO A;  3BEH A;  5IY5 C;  4R7C A;  3K04 A;  4JTA B;  2ZD9 A;  3OUF A;  5KUM A;  3AG4 C;  4PDR A;  4X8A A;  3ABL C;  1LNQ A;  3E8B A;  4QE9 A;  5EC2 C;  3T2M A;  3AG1 C;  5EK0 A;  2ATK C;  2ZXW C;  5B1A C;  1BL8 A;  2W0F C;  3SPG A;  3E8G A;  2K1E A;  4R6Z A;  4PA3 A;  2ITD C;  4P9P A;  3ABK C;  3OUS A; 
#chains in the Genus database with same CATH topology
 3ASO C;  2ILM A;  5K1X A;  3K08 A;  5IYZ B;  2AGA A;  4ZKI A;  3OTO O;  4LFA B;  4X89 A;  3LDE A;  4DR4 B;  2BCC H;  2Q69 A;  1K4D C;  2A0L A;  2AZ2 A;  2R9R B;  3F5T A;  2QWO B;  1FPO A;  5JQG B;  1VQ6 V;  1LUW A;  2CGN A;  3DGE A;  4DR2 O;  4B3T B;  4O2B B;  1ROP A;  3OR7 C;  3HKB A;  2OT5 A;  1I0H A;  1TVK B;  1VQ8 V;  1N36 B;  3OMI B;  4ZI7 B;  1QCE A;  3B4S A;  5J9P C;  2HVK C;  4CC5 A;  4FFB A;  1OCR B;  2Y69 C;  1W59 A;  4NXN O;  4RAI A;  1FJG O;  4DW1 A;  3OR6 C;  4EFE A;  1NTK H;  1Y74 A;  4KFM A;  2D2C B;  1HNW O;  1YXB A;  2ZM6 B;  1M56 B;  3OGC C;  1DK1 A;  4BW5 A;  1I5Y A;  5DEC A;  2IU3 A;  2UXB B;  2A9H A;  4MTO A;  2IM9 A;  4D6T H;  4CZZ A;  1F51 A;  1KP3 A;  5CBF A;  2JK5 C;  1IUR A;  1PL0 A;  5TIS Z;  1XNQ B;  4QNH B;  5B1B B;  2PUS A;  4CH3 A;  3CCU V;  2UUB O;  1KKD A;  1PM9 A;  1IXM A;  5LP6 C;  1N0J A;  2RNB A;  2F4V B;  3RT3 C;  1M93 A;  2EIN B;  1YJN V;  2CK3 G;  3FB8 C;  4QPK A;  4DV6 O;  1AR5 A;  3WG7 C;  2YXL A;  5LHI A;  4BAY A;  4F6R A;  2KKW A;  3JAK B;  4YHH O;  3D36 C;  1N4C A;  2DWD C;  3W7X A;  4LF4 O;  2Y0I A;  4MW8 A;  3VQY A;  1AJQ A;  4PDR A;  2FTK A;  3ZBH A;  2PF4 E;  2M7W A;  3RGB A;  1EN4 A;  3U0Z A;  4I5S A;  4BIO A;  1FXK B;  1GN6 A;  4YY3 O;  4DR7 B;  5IWA B;  1GK9 A;  2X7R B;  4PEL A;  1KMI Z;  1EZV H;  5LXT B;  2HJF C;  3CX5 F;  2QM7 A;  4CS3 A;  1P7B A;  1WB7 A;  5LYJ B;  3JAS B;  5C8Y B;  3RYI A;  5KLV H;  3SYC A;  2ZIO A;  3STZ C;  4X20 A;  1Q43 A;  1QHT A;  2GTS A;  2RQ6 A;  5ITZ B;  2VQE B;  3ZMU A;  1ZX3 A;  2PTM A;  4NTX A;  3X2Q C;  3G6B A;  1NR7 A;  3HKD B;  4DV1 B;  2QWQ B;  3LSS A;  1OCR C;  4MTG A;  1SQP H;  2L6L A;  4E2L A;  3F7V C;  2XUM A;  4LFB O;  4ZBM A;  4JI2 B;  1M56 C;  3QVN A;  2CTQ A;  4I7Z B;  2Q8V A;  2YEV A;  1VQP V;  2MK3 A;  4ZHQ B;  2VWK A;  3QO7 A;  4YJ3 A;  1BQZ A;  3MHS C;  3ZN0 A;  2KG7 B;  4OGQ B;  4JYB A;  4B3S O;  2HG5 C;  4JAV A;  2HR3 A;  1NS1 A;  4MVQ A;  3QNE A;  4TV9 B;  2O57 A;  1RPR A;  2ADQ B;  2WLJ A;  4B3M O;  1R6K A;  1WP8 A;  3BA8 A;  5JCO A;  3CXC U;  1E1R G;  2JEX A;  3TXQ A;  4IHJ A;  4BIU A;  5LL6 Y;  4PJ0 Z;  4UCS A;  4I55 A;  3CCS V;  2EIN C;  1S77 D;  1ZSP A;  2LQT A;  3DSQ A;  1Z5V A;  1KQS U;  4JYA B;  2CTR A;  1EZJ A;  4LF5 O;  5FNV A;  4LF7 B;  1PPJ H;  4DR3 O;  1XNR O;  3CRA A;  4GCZ A;  4FZ1 A;  2UU9 O;  2K1E A;  4J42 A;  4X64 O;  2JGD A;  2ITD C;  5D5Q A;  4ZOL A;  4JI0 B;  2UXD B;  2JS3 A;  3OMA B;  4RUE A;  3N2K B;  1BT8 A;  1K92 A;  1K33 A;  4CBC A;  2AZ0 A;  1VQO V;  3A0B Z;  2ZDI C;  4K3A A;  4WBN A;  4JYY A;  3N27 A;  1GTO A;  3P32 A;  4DUY O;  1K5S A;  4MT8 A;  2ARH A;  3K0D A;  4DV4 B;  1ENV A;  2OTL V;  2RMK B;  3I55 V;  3ZJZ A;  5EBM C;  5E1A C;  1JOY A;  1L0N H;  3GVM A;  1XMQ B;  2EIJ B;  1DTO A;  4HYO A;  2Q0A A;  2WSS G;  3ZRW B;  4MTF A;  2ZXW B;  4KHP O;  1KBH A;  5L3D A;  3CC7 V;  4AIL C;  3FX7 A;  1JPX A;  1XHX A;  1R3J C;  5KX5 A;  3OTO B;  2JJ2 G;  4O4J A;  1WPX A;  4FZ0 A;  2KQX A;  2EZO A;  1GKF A;  1Q86 W;  1SQG A;  3E35 A;  3W7W A;  1ZAU A;  3JAL A;  1RFY A;  3W7S A;  2X6B A;  3JSL A;  1VQK V;  1WJZ A;  2BOC C;  4QE7 A;  5GTI Z;  4D7S A;  3SPC A;  4ASU G;  3D8C A;  3RFR A;  3OTF A;  5KUM A;  5LP6 A;  5J2T B;  1FKA O;  3C90 A;  1GH6 A;  1FJG B;  1ZLZ A;  1YJ9 V;  2ZNJ A;  5HFL A;  2WAM A;  5J2U A;  4AQY O;  4UVA A;  4JI4 O;  2IJK A;  3D36 A;  4G2K A;  3TGU H;  2A7W A;  3CRM A;  4HNA B;  4C7U A;  5IJ9 B;  3SYQ A;  3OE7 G;  1YI2 V;  2E5L O;  1ARO P;  2WLH A;  1R3L C;  1TGO A;  1OJH A;  1CP9 A;  3P3P A;  2LGQ A;  2V1D A;  5EZY A;  1B06 A;  2RCV A;  1BZK A;  2Z0A A;  5LOV B;  2GBO A;  4Z2W A;  1VQ7 V;  1M57 B;  3ETE A;  3L70 H;  4DV5 O;  3N2G A;  3GB7 C;  4D7T A;  4J7K A;  2Y0P A;  3K9S A;  1K3E A;  3TJT A;  1CPY A;  3CPW U;  4YHH B;  2HLD G;  4LF4 B;  3AG3 B;  5IDJ A;  4UVB A;  1FAF A;  2CUG A;  4ZIB A;  5JQG A;  3M7M X;  4DV2 O;  3CMA V;  4NR1 A;  2RDC A;  4LF8 O;  2EUL A;  3RYC B;  4BR6 A;  1TVK A;  1H8H G;  3RVZ A;  5EIB C;  2EIJ C;  1F23 A;  3F5W C;  2W0X A;  1NQT A;  3TCU A;  3OM3 B;  1XL6 A;  3E22 B;  1ZWI C;  1GN3 A;  4NXM O;  4NTY A;  1B04 A;  2Z5U A;  1H2M A;  2ZIM A;  2GV9 A;  3FAV A;  3RBZ A;  4DR6 O;  1PP9 H;  4JZ2 A;  2BE3 A;  2DQ0 A;  3JD4 A;  4H0L B;  2PI4 A;  4DUZ O;  2EIL B;  3AK2 A;  3H1H H;  3UM7 A;  4GX0 A;  1S5J A;  3E86 A;  1G4Y B;  3BA9 A;  4DO2 A;  4A5U B;  3OMN B;  4R50 A;  3VOU A;  4LFB B;  1EFR G;  4JI3 B;  3CYO A;  3BVO A;  2R72 A;  1PKX A;  4TUY B;  4TOI A;  3JAT A;  5LMN O;  1AR4 A;  1GM7 A;  4B3S B;  3BFR A;  1NH2 D;  3AG7 A;  3K9A A;  3UKM A;  1IX9 A;  4B7E A;  1IBL O;  5IT9 N;  1K97 A;  3G4S V;  1NJI W;  1J5E O;  5LMU O;  5K1P A;  4J9Z B;  1YIT V;  3Q4H A;  2QJ1 A;  5H5N A;  1M57 C;  5EC1 C;  1UFI A;  2ZDI A;  3HKE B;  3SYP A;  5LXT A;  3M8A A;  2XT9 A;  5CBH A;  2P4V A;  5LYJ A;  2IJH A;  2Z3Y A;  4LF5 B;  1GM9 A;  3JAS A;  5C8Y A;  2DYR B;  4FMT A;  3DC6 A;  2DQ3 A;  4DR3 B;  3JD1 A;  2UU9 B;  2H8P C;  1XNR B;  3AG3 C;  3K06 A;  4K35 A;  4X64 B;  2DWE C;  2PYL A;  3EHB B;  1RSO B;  1EN6 A;  4NVP A;  5ITZ A;  4JV5 O;  4Q6G A;  1QQC A;  5FL7 G;  3CCV V;  4O4I B;  1DF4 A;  2QKS A;  1YEW A;  4NKG B;  2EIM B;  1KC8 W;  1AI7 A;  4KXR A;  4WFF A;  5CB4 B;  4U7N A;  2IH3 C;  1SQX H;  4IIJ B;  4LF6 O;  1HNZ O;  3JAR A;  4GX2 A;  2ZT9 B;  4DUY B;  1XEQ A;  1A32 A;  3OUF A;  2AXT Z;  4X8A A;  4QE9 A;  1P4R A;  1BL8 A;  2KG7 A;  2YIB D;  1K5Q A;  1VIB A;  2YID A;  5CA1 A;  1FFX B;  3CHX A;  1WA8 B;  1GO3 F;  1N34 O;  2EIL C;  1DGS A;  2P7T C;  5KAI Z;  1AB3 A;  4XDK A;  2BTQ B;  1K9M W;  4FM2 A;  3AK3 A;  1VEW A;  4KHP B;  2XAF A;  4EB6 B;  5L3F A;  3CSX A;  3MHH C;  4J9Y B;  1MMM A;  1XMO O;  2UXC O;  3ETQ A;  1I94 O;  5IYC O;  4QPJ A;  3G71 V;  1L0L H;  4I50 B;  5JJN B;  1EBO A;  4Z1V A;  1HNX O;  1BGY H;  2Y4T A;  3VQV A;  3ABM B;  1H2G A;  3N2K A;  4LF9 O;  2JRI A;  5BMV A;  2R9A A;  3K59 A;  1KUQ A;  3PJS K;  3MD0 A;  3F7Y C;  2F95 B;  4JI7 B;  1SQF A;  1TUB A;  1MZF A;  1O9H A;  4DV3 B;  4JAS A;  2ZKO A;  5KA5 A;  1MG1 A;  1BSM A;  2DYR C;  1WLE A;  5JH7 B;  4AQY B;  3OFN G;  3B2E E;  4YJ2 A;  4WCE V;  1WNS A;  2CH7 B;  2E5L B;  1YTF B;  2QWN B;  1IXB A;  3OW2 U;  2EIM C;  2WA3 A;  4XDL A;  4W4K A;  1TAE A;  3H01 A;  3CC2 V;  2V4D A;  1XHZ A;  1F7Y A;  3J81 N;  3ZRW A;  2BSK B;  1U96 A;  5EC2 C;  4DV5 B;  5L3E A;  1WN7 A;  2HP8 A;  4RWU A;  1Q5O A;  2FL4 A;  4J41 A;  4JTD B;  3H1I H;  2B5U A;  4UVC A;  1VP7 A;  3KG2 A;  4DV2 B;  4X1K A;  4LF8 B;  4BIZ A;  2Y48 A;  4UCV A;  3QO8 A;  4FLV A;  3T1Y B;  4MVM A;  1FXV A;  1Q81 W;  4DRX A;  1NZ6 A;  4WFH A;  1THZ A;  3BRC A;  2XAS A;  2LP7 A;  3RW0 A;  5J2T A;  2ADP A;  3SYA A;  4RQE A;  4I9Q A;  2GSM B;  1AJN A;  4NXM B;  2OCC B;  1I5X A;  3RYF B;  3EXA A;  4P9O A;  4WFG A;  4JTC B;  4K0K O;  4F6E A;  2N74 A;  3AEI A;  5IJ9 A;  3K5O A;  1U97 A;  2IBZ H;  4YXW G;  4DR6 B;  2ZCE A;  4UUJ C;  2HJD A;  4GUN A;  1TUE B;  5EIB D;  3KCY A;  1US6 A;  1PNL A;  1UPG A;  4PDL A;  3SJC C;  4DUZ B;  3VQW A;  1NI8 A;  4MS2 A;  2QKA A;  5LOV A;  4I4T B;  3FB7 C;  1BE3 H;  3UT5 B;  2QSA A;  1D5N A;  1M4U A;  3VBB A;  4B3R O;  1KP2 A;  2HKO A;  2XND G;  3CB2 A;  4O4H B;  1P7G A;  5LMN B;  3KZI Z;  3CME V;  4ICG A;  3JAM N;  3AG1 B;  1QR8 A;  2WLI B;  5KMG B;  1MSW D;  1IBL B;  4MVO A;  3OD4 A;  5BR8 O;  2GTA A;  1X4T A;  3HKC B;  3A8T A;  2PI5 A;  1LNQ A;  1J5E B;  1Q7Y W;  1Y76 B;  1KU9 A;  5LMU B;  2JJ1 G;  1SRY A;  3E8G A;  3FKS G;  4CH5 A;  5LGU A;  1NR1 A;  5B1B C;  3K5L A;  2XTA A;  1VQN V;  1S3J A;  5A2Q N;  4LNU B;  3ICX A;  2ZE6 A;  2Q7G A;  4B08 A;  4N21 A;  3NXS A;  4FVM A;  4P2Z A;  4G27 B;  1XL4 A;  5EBW C;  1QR9 A;  5L3G A;  4JPR A;  2DN9 A;  3AG2 B;  4K8X A;  4K8Z A;  3BY6 A;  1XBL A;  2ZR2 A;  2LGW A;  3S3X A;  2V7Q G;  4IT5 A;  5IE9 A;  4FLX A;  2EJR A;  4DR1 O;  1JCH A;  4JAA A;  2XAQ A;  2ETN A;  1FXK C;  4UCT A;  1R6T A;  3SPI A;  1FYJ A;  4L8J A;  3CWB H;  4LF6 B;  1HNZ B;  1Q8I A;  2X6C A;  5IJ0 B;  2OCC C;  1IBM O;  3CCL V;  1SKV A;  1W0K G;  2QEX V;  2P90 A;  4X88 A;  4PHZ A;  3KCX A;  1ZL8 B;  4XDJ A;  3CCQ V;  1MAB G;  3FB6 C;  2A79 B;  2CE4 A;  4JF3 A;  2WWW A;  3BHP A;  1XRE A;  1N34 B;  3LUT B;  1DLB A;  4WFA V;  4PA9 A;  3APO A;  4RQF A;  2OWO A;  1QU7 A;  2PYJ A;  1BHB A;  3ZRX A;  2YIA A;  5BZB A;  1QBZ A;  2WLL A;  4KP4 A;  2H3O A;  3HKE A;  1SER A;  1IDS A;  5CA3 A;  3RN4 A;  4ABM A;  2GDS A;  2JGU A;  4TWK A;  4UV9 A;  4UB8 Z;  3ZRV A;  5B1A B;  4MVS A;  3G6E V;  3C3S A;  4X62 O;  1XMO B;  1N33 O;  2UXC B;  3BEH A;  1I94 B;  1QVG U;  3AG1 C;  2GUZ B;  4GZR B;  1Y66 A;  1HNX B;  3QTC A;  4X66 O;  3K03 A;  1GN4 A;  4I0X B;  4DR2 B;  5GON A;  3DTU B;  2UUC O;  5H9C A;  3IC9 A;  5KA6 A;  2KB1 A;  1OCC B;  3K5N A;  1RPO A;  2ZR3 A;  3DC5 A;  4NXN B;  4F6R B;  4HZ3 A;  5CA0 A;  1HNW B;  3JAW B;  2F93 B;  4FIP C;  2EX3 A;  1HWY A;  1AP6 A;  4B3T O;  1WA8 A;  1SQB H;  3ZHQ A;  3E89 A;  1SA0 A;  4J80 A;  1H2N A;  3OT7 A;  3S3W A;  3RYH B;  2YI8 A;  3UCS C;  3SJA C;  2KSD A;  2UUB B;  4EB6 A;  3FYI B;  3KKY A;  4W4L A;  3LSQ A;  3RYI B;  2ZIN A;  3GWO A;  3UO2 A;  2WLM A;  1B3Q A;  3L71 H;  4WF9 V;  2UUA O;  4FLY A;  2HEP A;  4DV6 B;  5IYZ A;  2ZE5 A;  3CRC A;  1GM8 A;  4JI8 O;  2UXN A;  3H1L H;  3HPL C;  1YJW V;  5LHG A;  5KUK A;  1R3K C;  2M6Y A;  1LR1 A;  1JR9 A;  3L9D A;  1V55 B;  3ABT A;  1PNK A;  3J7A U;  2X6A A;  1HR0 O;  3AG4 B;  4O2B A;  3L75 H;  1G6U A;  4LWS B;  4HAM A;  4ZI7 A;  4YY3 B;  1SZX A;  4O2A B;  4LH6 A;  2NNU A;  4XBF A;  1Z5W A;  3M99 B;  5DN6 G;  2ATK C;  2ZXW C;  5B1A C;  4DW0 A;  2YEV B;  1JMK C;  4K0K B;  3BAB A;  4YJ3 B;  5BY1 A;  5DED A;  1DF5 A;  2ZQM A;  4JZG A;  2QR4 A;  2YSU B;  3ZHV A;  2YC0 A;  4HBN A;  3ZCC A;  4H33 A;  3I5D A;  3WB1 A;  2Q6A A;  1NVP B;  1P49 A;  4FLZ A;  2VQF O;  4IL6 Z;  2BSK A;  1GN2 A;  4PA4 A;  1OCC C;  2DYS B;  1MOF A;  1QLE B;  2JS5 A;  2IJI A;  4RUF A;  2F43 G;  1MA1 A;  5IYB O;  2K9P A;  4DXW A;  1URF A;  1D2D A;  2VQE O;  4Q20 A;  3SR2 C;  3JAK A;  4MVU A;  2OTJ V;  1CXZ B;  1VAR A;  3SJQ C;  4OPH A;  2Q0O C;  5BR8 B;  3ZMS A;  1BS3 A;  4OX9 O;  1TA8 A;  3R65 A;  2HFE C;  4B3M B;  2Q73 A;  4LCU C;  1NT2 B;  3P30 A;  2P5O A;  3CCR V;  1S5L Z;  1FXK A;  3LDD A;  5LA6 B;  1F4N A;  1FFT B;  4FPP A;  4EFB A;  3J80 N;  3SPJ A;  1VQ5 V;  4JI5 O;  1NKD A;  3APQ A;  3JD2 A;  2W6I G;  4P30 A;  2E74 B;  2ZE8 A;  1S0V A;  4GKJ O;  2QDO A;  4NTW A;  3D3Q A;  4WFE A;  1FXH A;  2PY5 A;  3W7U A;  4U3F H;  3QF7 A;  4LC1 A;  2DW4 A;  3JCU Z;  1MSD A;  3ZMT A;  1M5I A;  2CTP A;  1XDC A;  2Q7E A;  3ABL B;  5KHJ A;  5KHH A;  3LSU A;  3SPH A;  4E4E A;  4FM1 A;  1V55 C;  1L8D A;  2PGG A;  1X59 A;  1M90 W;  4DR1 B;  4R7C A;  2VWJ A;  4BWA A;  3AG4 C;  4UXN A;  1H2L A;  1YF2 A;  2W0F C;  2CTW A;  3HKD A;  3D3I A;  2JEU A;  4I4T A;  4JYA O;  4UB6 Z;  2L35 A;  3UT5 A;  2EIK B;  4PI0 A;  4LF7 O;  1IBM B;  4O4J B;  5AG2 A;  2LJ2 A;  3IGA C;  4ZHQ A;  4UCR A;  4Z1M G;  3QO5 A;  2WLI A;  3ZS8 C;  2XAG A;  3QG5 A;  4IYI A;  3UQ8 A;  4IGG A;  3THO A;  4TV9 A;  5B1O A;  4PDM A;  4LFC O;  4GKK O;  3IFX A;  1Q6U A;  2P67 A;  5LP6 B;  4FLU A;  3R66 A;  3ZX6 A;  1AIL A;  2DYS C;  5B1N A;  4LNU A;  2QTO A;  2OIG A;  2QWP B;  3STL C;  4LR3 A;  1KEC A;  2NLJ C;  2Q67 A;  3HR0 A;  5J2U B;  1BQ0 A;  1H8E G;  1YHQ V;  3K79 A;  4X62 B;  3CXH F;  5L3C A;  2QKC A;  5L3B A;  4U3J B;  1BCC H;  1NTZ H;  2QA4 V;  2JVD A;  1JJ2 U;  5DM6 V;  4O4L B;  2GHY A;  3HB3 B;  3OGI B;  4X66 B;  3DXR B;  3B77 A;  3WFV A;  4KL1 A;  2JIZ G;  4MVZ A;  2FML A;  2AHZ A;  5LHH A;  5EYP B;  5IJ0 A;  3T1C A;  3N2G B;  2E3C A;  3CD6 V;  2P4K A;  1PD3 A;  1S72 V;  1LUV A;  2ZE7 A;  2IJJ A;  4AI8 A;  4JYC A;  3RWR D;  1XOU A;  4JI6 O;  2E76 B;  2BTO A;  1ZL8 A;  4FFK A;  3ABK B;  2LFR A;  4JI4 B;  3ABL C;  1M1K W;  3X2Q B;  3L73 H;  1NH2 B;  2QWR B;  1NU1 H;  4PDV A;  3IC7 A;  4X1I B;  5F2V O;  3ASN B;  1IBK O;  1K73 W;  2E75 B;  1HP8 A;  1R3I C;  2EIK C;  1I08 A;  2UXX A;  5H6R A;  4J11 A;  1W2B U;  1O9G A;  3H1K H;  2UUA B;  3NR7 A;  2NR5 A;  1NTM H;  1D5A A;  3G80 A;  4YIP A;  5KHK A;  2DJV A;  3FAV B;  2GUZ A;  4TV8 B;  4JI8 B;  1AP5 A;  1JVM A;  4UV8 A;  1COW G;  4OPA A;  3T4Z A;  4QIW F;  3TK1 A;  4I9W A;  4PD4 F;  1OV9 A;  2A3Q A;  5B66 Z;  1R6N A;  4I0X A;  1HR0 B;  3ZED A;  4X1Y B;  3E2E A;  4MVR A;  2DMX A;  1P84 F;  2EBO A;  4L87 A;  5KAF Z;  1N32 O;  1YSC A;  3JAT B;  2WPD G;  3JAW A;  4GLX A;  2N04 A;  1ZUQ A;  4AHC A;  1Q82 W;  2IU0 A;  4GYC B;  2YUA A;  3CJH B;  4HNA A;  1MNG A;  1OCO B;  3ABM C;  4GX5 A;  1Q6I A;  2XOK G;  3Q4H B;  3RYH A;  1OCZ B;  3K0G A;  5IY5 B;  3CP1 A;  1UJW B;  2VQF B;  5CN0 A;  1S5H C;  5JVD B;  1W0J G;  1Y67 A;  1AI6 A;  2CGO A;  3T1H O;  4JTA B;  3LNN A;  3E8B A;  3L74 H;  3BCC H;  5JJE B;  5EK0 A;  1JJO A;  1HW7 A;  3UO3 A;  3TXS A;  4DR5 O;  4X9Q A;  4PI2 A;  3JD0 A;  3ABK C;  3OUS A;  3MAQ A;  1JFF B;  1PV0 A;  1R73 A;  1VQ9 V;  1XQ8 A;  4X65 O;  4DV0 O;  1BMF G;  3I56 V;  3JYC A;  4OX9 B;  2YXY A;  1QVF U;  1GMG A;  3B8M A;  3ASN C;  4LWS A;  3RYC A;  4LBE C;  5FPR A;  1WPB A;  4J10 A;  3ZHR A;  3JAR B;  3VQX A;  4JI3 O;  5CMU A;  2DE0 X;  4O2A A;  4JI5 B;  3EFF K;  3E83 A;  5JJJ B;  3RVY A;  1Y4M A;  4GKJ B;  3E22 A;  2QM4 A;  4NB5 A;  4DK0 A;  1BHA A;  5CA1 B;  2MW2 B;  3AK1 A;  4H13 B;  2EJ7 A;  3E8H A;  5KHI A;  4JV5 B;  3ZHT A;  1I7F A;  4DV7 O;  2OIE A;  2XHB A;  4FK5 C;  3CEI A;  3ZHU A;  4CS2 A;  3U10 A;  2H94 A;  4LH7 A;  4F4L A;  2FKX A;  2XAH A;  3LNM B;  5LGT A;  1OZ0 A;  4TSF G;  2P06 A;  1SQQ H;  1ZTE A;  4PV1 B;  1V54 B;  4TUY A;  3ETG A;  3B09 A;  1RM1 B;  1JX9 A;  4H44 B;  3ETD A;  1OCO C;  1WB8 A;  5BMV B;  1IVS A;  1EM1 A;  1AI4 A;  2F23 A;  3CRQ A;  1YVW A;  3CCJ V;  1AVM A;  4LFC B;  1OCZ C;  2LW1 A;  2D3O W;  1PNM A;  5IY5 C;  4GKK B;  2ZD9 A;  2R9I A;  3HKB B;  1TUB B;  4J7Z A;  4YIO A;  3K58 A;  2PZS A;  5LA6 A;  2OYQ A;  3SPG A;  3FYE B;  4P9P A;  2RN9 A;  4DYL A;  4FFB B;  2HHH O;  3H1J H;  4CH6 A;  1SF9 A;  2WA4 A;  1Y74 B;  3BAA A;  1GAX A;  4YJ2 B;  3K57 A;  1B6Q A;  1N0N A;  3K3W A;  1NVP D;  1RSO A;  2YI9 A;  3B8N A;  4JI1 O;  3CC4 V;  4QJF B;  4O4I A;  2VS0 A;  2YDE A;  2YS8 A;  1VMG A;  3CRR A;  4LF9 B;  3U11 A;  2IH1 C;  1K4C C;  2IW5 A;  3ZRS A;  2HVJ C;  1KD1 W;  5CB4 A;  3W7T A;  2CAZ C;  4N23 A;  2ITC C;  1E1Q G;  4IIJ A;  1F4M A;  1VF6 C;  3C3T A;  3CE2 A;  4JI6 B;  1FS0 G;  1IZ3 A;  4CS4 A;  4LFA O;  2R70 A;  5A9G A;  4DR4 O;  4B7K A;  3AG2 C;  4X1K B;  4LP8 A;  1VQL V;  1WAZ A;  1FFX A;  4FJC C;  5JWP A;  1WP7 A;  1YZB A;  4UCO A;  1XI1 A;  4DRX B;  4JI7 O;  2Q9L A;  1PL4 A;  1T5E A;  4DV3 O;  1IBK B;  1N36 O;  1GRJ A;  2BTQ A;  3ZHS A;  3WB0 A;  3IJ4 A;  3WU2 Z;  4R8C A;  2Q7H A;  3CS5 A;  2C2A A;  1YCI A;  1V54 C;  2ZM6 O;  5BXZ A;  1M9N A;  1MZE A;  5KHG A;  1RM1 C;  5HFM A;  3T4D A;  2XAJ A;  3OEE G;  4U3J A;  4X20 B;  1Z2G A;  2Q5Z A;  1SET A;  2UXB O;  4O4L A;  1H2S B;  2G38 A;  1L1F A;  3DXR A;  4I50 A;  2QTS A;  1G1X B;  4R6Z A;  2VRZ A;  1H2K A;  3L72 H;  4JGS A;  5D5P A;  3CCE V;  5LBQ A;  3A2F A;  1XNQ O;  3G67 A;  3ML0 A;  2WLN A;  5EYP A;  2W6J G;  3WB2 A;  4MTX A;  3TET A;  3EVK A;  2F4V O;  1N32 B;  1KB9 F;  3MDS A;  2N05 A;  2WLK A;  2B1I A;  4TT3 G;  4GX1 A;  3SGI A;  2ODM A;  3O65 A;  5JH7 A;  2FB5 A;  1QLN A;  2CH7 A;  2RJZ A;  3ABU A;  3T1Y O;  5FPO A;  2Q4P A;  1NBM G;  2CDY A;  4BW9 A;  2ZNI A;  3OEH G;  4MW3 A;  1YIJ V;  2EZP A;  4X1I A;  4IHJ B;  3IAY A;  4UCU A;  1Q3E A;  1AI5 A;  1EN5 A;  4DR7 O;  3E8F A;  5IWA O;  2F66 C;  4U7O A;  4I55 B;  3T1H B;  5LGN A;  3K5M A;  1S76 D;  1VQ4 V;  3SJB C;  4DR5 B;  2QGN A;  4B3R B;  5FNV B;  2QE7 G;  3ZN1 A;  4EKW A;  4TV8 A;  1OHH G;  3FFQ A;  2LW7 A;  5IYD O;  2JGD B;  1SS3 A;  2QM8 A;  4ZOL B;  5B3S B;  2YIC A;  4PA7 A;  4X65 B;  4DV0 B;  4JAU A;  2P6J A;  4J7J A;  2FYU H;  5EBL C;  1G8M A;  4X1Y A;  3ZMV A;  3PN1 A;  4DV1 O;  2AW9 A;  4QGP A;  2AHY A;  4KUM A;  1JQ0 A;  4FLW A;  2F1M A;  4WBN B;  2BOB C;  5FLX N;  3K04 A;  5B5E Z;  5H6Q A;  1SC5 B;  3ASO B;  2OCH A;  3T2M A;  4JI2 O;  2NN4 A;  5C93 A;  1CEZ A;  1K7D A;  3RYF A;  4WFB V;  4PA3 A;  3JD3 A;  4RO2 A;  1YTF D;  4PA6 A;  4DK1 A;  3CJH A;  1SES A;  3BPZ A;  2YIB A;  3FD9 A;  4DV7 B;  3B40 A;  1K8A W;  1N8R W;  4TQD A;  2B1G A;  3A0R A;  1VF5 B;  1AR1 B;  2WLL B;  1E79 G;  1H38 A;  3OAA G;  5JVD A;  1KYO F;  4MSW C;  1Y6X A;  1ORQ C;  2X0L A;  3H9V A;  2Y69 B;  4IYH A;  1Q6H A;  1VF7 A;  4H37 A;  4FLT A;  2A06 H;  1KKC A;  1XIL A;  5KX5 B;  1SQV H;  4O4H A;  3LDC A;  1JFF A;  2LFS A;  3A0H Z;  3JCZ A;  2JDI G;  4JI0 O;  2UXD O;  3JAL B;  3O9O A;  3ZIA G;  4CC6 A;  1J95 A;  2DOS A;  5KMG A;  1Q90 D;  3ZMZ A;  1JA8 A;  5GON B;  5JCO C;  2B9Z A;  1QNM A;  3HKC A;  1R1B A;  4EEQ A;  2Q68 A;  1AJP A;  1Y76 A;  4OXS A;  4UFZ A;  1XUQ A;  1K34 A;  4CH4 A;  2HHH B;  1HDJ A;  1RP3 B;  4G28 B;  5CA0 B;  1QLE C;  1FD9 A;  1VF6 A;  1VQM V;  4FM0 A;  1V9P A;  3WG7 B;  3GWK C;  1N33 B;  2LO1 A;  4DV4 O;  4NYK A;  5B3S C;  3CCM V;  1SZT A;  3FB5 C;  5GTH Z;  4TQF A;  4GT1 A;  4JI1 B;  3SYO A;  2P22 C;  3P3N A;  5CBG A;  1SA0 B;  5H2F Z;  1YDX A;  2Y4U A;  5E79 Z;  3JSN A;  2YXH A;  5GW7 A;  5EZY B;  3SDL A;  1XMQ O;  2UUC B; 
#chains in the Genus database with same CATH homology
 3UM7 A;  4GX0 A;  3ASO C;  3E86 A;  3K03 A;  1G4Y B;  1R73 A;  1VQ9 V;  3K08 A;  4DO2 A;  3OMN B;  4ZKI A;  4R50 A;  3VOU A;  3DTU B;  1EFR G;  4X89 A;  3LDE A;  5H9C A;  3CYO A;  1BMF G;  3I56 V;  3JYC A;  2Q69 A;  1K4D C;  2A0L A;  2KB1 A;  5KA6 A;  1PKX A;  1QVF U;  1GMG A;  3B8M A;  1OCC B;  2R9R B;  1RPO A;  3ASN C;  2ZR3 A;  1VQ6 V;  1GM7 A;  4LBE C;  3DGE A;  1NH2 D;  4HZ3 A;  1ROP A;  5CMU A;  3K9A A;  3OR7 C;  3UKM A;  2OT5 A;  3EFF K;  1VQ8 V;  3E83 A;  3RVY A;  3OMI B;  1Y4M A;  1QCE A;  5J9P C;  2HVK C;  4FIP C;  1K97 A;  3G4S V;  1NJI W;  1OCR B;  1HWY A;  2Y69 C;  4J9Z B;  1YIT V;  4RAI A;  1BHA A;  3OR6 C;  4KFM A;  1M57 C;  3E89 A;  5EC1 C;  2ZDI A;  1M56 B;  3SYP A;  3OGC C;  3E8H A;  5CBH A;  4BW5 A;  1I5Y A;  4FK5 C;  2IJH A;  2IU3 A;  2Z3Y A;  1GM9 A;  2DYR B;  4FMT A;  2A9H A;  2DQ3 A;  3JD1 A;  2H8P C;  2H94 A;  3FYI B;  3AG3 C;  3K06 A;  4MTO A;  3LSQ A;  2DWE C;  4F4L A;  4CZZ A;  3EHB B;  1F51 A;  1KP3 A;  5CBF A;  2JK5 C;  3GWO A;  2XAH A;  2WLM A;  1PL0 A;  5FL7 G;  4WF9 V;  3LNM B;  3CCV V;  5LGT A;  1OZ0 A;  4TSF G;  4QNH B;  1DF4 A;  5B1B B;  1GM8 A;  3CCU V;  2QKS A;  1KKD A;  1IXM A;  2UXN A;  3HPL C;  2EIM B;  1YJW V;  1KC8 W;  1AI7 A;  5LHG A;  1V54 B;  5KUK A;  1R3K C;  2EIN B;  1YJN V;  4WFF A;  3ETG A;  2CK3 G;  4U7N A;  2IH3 C;  1RM1 B;  1JX9 A;  1V55 B;  3FB8 C;  3ETD A;  4QPK A;  3ABT A;  1PNK A;  3WG7 C;  1OCO C;  2X6A A;  5LHI A;  3AG4 B;  4BAY A;  4GX2 A;  1AI4 A;  4HAM A;  3CCJ V;  2DWD C;  3W7X A;  4MW8 A;  1OCZ C;  2D3O W;  1PNM A;  5IY5 C;  1AJQ A;  2ZD9 A;  3OUF A;  2R9I A;  4PDR A;  4X8A A;  2FTK A;  2NNU A;  4QE9 A;  4XBF A;  1P4R A;  3M99 B;  2ATK C;  2ZXW C;  5B1A C;  5DN6 G;  1BL8 A;  2YEV B;  2M7W A;  1K5Q A;  3SPG A;  4I5S A;  3FYE B;  4P9P A;  1FXK B;  1DF5 A;  1GO3 F;  2EIL C;  1GK9 A;  2ZQM A;  2YSU B;  2X7R B;  4PEL A;  2P7T C;  3ZCC A;  2HJF C;  4XDK A;  1B6Q A;  1K9M W;  2QM7 A;  1P7B A;  4H33 A;  3K3W A;  1NVP D;  2Q6A A;  1NVP B;  3B8N A;  3SYC A;  2XAF A;  3CC4 V;  4QJF B;  3STZ C;  5L3F A;  4PA4 A;  3MHH C;  1OCC C;  3ZMU A;  2DYS B;  4J9Y B;  2IH1 C;  1K4C C;  1MOF A;  1QLE B;  2IW5 A;  3X2Q C;  5IYC O;  2IJI A;  4RUF A;  3ZRS A;  4QPJ A;  3G71 V;  2HVJ C;  1KD1 W;  1EBO A;  2F43 G;  5IYB O;  4DXW A;  1NR7 A;  3W7T A;  4N23 A;  2ITC C;  1H2G A;  3ABM B;  1E1Q G;  1F4M A;  3LSS A;  4Q20 A;  1OCR C;  4MTG A;  4MVU A;  2OTJ V;  4E2L A;  1FS0 G;  3PJS K;  3MD0 A;  3F7Y C;  3SJQ C;  3F7V C;  3ZMS A;  4ZBM A;  1M56 C;  3R65 A;  2YEV A;  3AG2 C;  4LP8 A;  1VQP V;  2HFE C;  4JAS A;  1VQL V;  2MK3 A;  5KA5 A;  4LCU C;  1MG1 A;  3P30 A;  3QO7 A;  3CCR V;  1FXK A;  3LDD A;  2DYR C;  4FJC C;  3MHS C;  3ZN0 A;  1F4N A;  1FFT B;  1WLE A;  4FPP A;  4JYB A;  2HG5 C;  4JAV A;  3SPJ A;  2HR3 A;  3OFN G;  1VQ5 V;  4MVQ A;  1NKD A;  3JD2 A;  3QNE A;  2W6I G;  4P30 A;  4WCE V;  1RPR A;  2WLJ A;  1S0V A;  1R6K A;  3CXC U;  1E1R G;  2JEX A;  4WFE A;  1FXH A;  1YTF B;  4R8C A;  4BIU A;  3W7U A;  4LC1 A;  2DW4 A;  3OW2 U;  2EIM C;  2C2A A;  3ZMT A;  1V54 C;  4XDL A;  3CCS V;  3ABL B;  2EIN C;  1S77 D;  3H01 A;  1M9N A;  3SPH A;  1RM1 C;  5HFM A;  1V55 C;  3T4D A;  2XAJ A;  1KQS U;  3CC2 V;  3OEE G;  1M90 W;  1EZJ A;  4R7C A;  1SET A;  3ZRW A;  3AG4 C;  4UXN A;  1L1F A;  5EC2 C;  4GCZ A;  2W0F C;  2K1E A;  4R6Z A;  2ITD C;  3D3I A;  4JGS A;  2JEU A;  3CCE V;  5L3E A;  5LBQ A;  3OMA B;  3ML0 A;  4RUE A;  2EIK B;  2WLN A;  2W6J G;  4JTD B;  4MTX A;  3TET A;  1K92 A;  2B5U A;  4UVC A;  1K33 A;  4CBC A;  3KG2 A;  1VQO V;  3IGA C;  4BIZ A;  2Y48 A;  4Z1M G;  2ZDI C;  3QO5 A;  3QO8 A;  2WLI A;  2WLK A;  4MVM A;  1FXV A;  2B1I A;  2XAG A;  4TT3 G;  4GX1 A;  1Q81 W;  4WFH A;  1GTO A;  1THZ A;  2XAS A;  2LP7 A;  3P32 A;  3RW0 A;  5B1O A;  4PDM A;  1QLN A;  3SYA A;  4RQE A;  1K5S A;  4MT8 A;  3ABU A;  3IFX A;  2GSM B;  1AJN A;  2P67 A;  3K0D A;  1ENV A;  2OCC B;  1I5X A;  1NBM G;  5B1N A;  2DYS C;  2QTO A;  4P9O A;  4WFG A;  4JTC B;  3OEH G;  4MW3 A;  1YIJ V;  2EZP A;  3I55 V;  2OTL V;  3STL C;  3AEI A;  3ZJZ A;  1KEC A;  2NLJ C;  2Q67 A;  1AI5 A;  5EBM C;  1H8E G;  1YHQ V;  3K79 A;  3E8F A;  4YXW G;  5E1A C;  4U7O A;  4UUJ C;  1JOY A;  5LGN A;  1S76 D;  5L3C A;  5L3B A;  1TUE B;  1VQ4 V;  1PNL A;  4PDL A;  2EIJ B;  1DTO A;  4HYO A;  2QA4 V;  3ZRW B;  2WSS G;  1JJ2 U;  5DM6 V;  2GHY A;  2QE7 G;  2ZXW B;  3HB3 B;  4MS2 A;  4MTF A;  3ZN1 A;  4EKW A;  1OHH G;  3B77 A;  5L3D A;  3CC7 V;  3WFV A;  1JPX A;  5IYD O;  1R3J C;  2QM8 A;  2JIZ G;  3FB7 C;  5B3S B;  4PA7 A;  2JJ2 G;  4MVZ A;  1WPX A;  3VBB A;  4JAU A;  1KP2 A;  2P6J A;  2EZO A;  2AHZ A;  2HKO A;  5LHH A;  5EBL C;  1GKF A;  2XND G;  1Q86 W;  1G8M A;  3E35 A;  3W7W A;  3ZMV A;  3T1C A;  3W7S A;  3CD6 V;  2X6B A;  1PD3 A;  1VQK V;  3CME V;  2AHY A;  4KUM A;  1JQ0 A;  1S72 V;  3AG1 B;  2IJJ A;  2BOC C;  4JYC A;  4QE7 A;  1QR8 A;  2WLI B;  3SPC A;  4ASU G;  2BOB C;  1MSW D;  4MVO A;  3ABK B;  3K04 A;  5H6Q A;  5KUM A;  2LFR A;  3ASO B;  3ABL C;  1LNQ A;  3T2M A;  2PI5 A;  1Q7Y W;  1M1K W;  2JJ1 G;  1SRY A;  5C93 A;  1CEZ A;  3X2Q B;  3E8G A;  1K7D A;  4WFB V;  4PA3 A;  3FKS G;  1NH2 B;  3JD3 A;  4RO2 A;  5LGU A;  1NR1 A;  1YJ9 V;  1YTF D;  5B1B C;  5HFL A;  4PA6 A;  1VQN V;  1S3J A;  1SES A;  2WAM A;  4UVA A;  4PDV A;  3IC7 A;  2IJK A;  4N21 A;  3D36 A;  3NXS A;  4G2K A;  3ASN B;  1K8A W;  4P2Z A;  1N8R W;  1K73 W;  3SYQ A;  1R3I C;  2B1G A;  1XL4 A;  3A0R A;  3OE7 G;  4G27 B;  1YI2 V;  1AR1 B;  5EBW C;  2WLL B;  1ARO P;  1QR9 A;  1E79 G;  2EIK C;  5L3G A;  1H38 A;  2UXX A;  4JPR A;  2WLH A;  5H6R A;  3OAA G;  1R3L C;  1W2B U;  3AG2 B;  1CP9 A;  4MSW C;  3BY6 A;  1ORQ C;  2X0L A;  2Y69 B;  2ZR2 A;  2V1D A;  2V7Q G;  4H37 A;  1JVM A;  4UV8 A;  2EJR A;  1COW G;  3T4Z A;  1JCH A;  4QIW F;  3TK1 A;  1M57 B;  3ETE A;  1VQ7 V;  2XAQ A;  2LFS A;  3LDC A;  4I9W A;  1FXK C;  3JCZ A;  2JDI G;  3SPI A;  3GB7 C;  1R6N A;  3CPW U;  1K3E A;  2X6C A;  1CPY A;  3E2E A;  2HLD G;  2OCC C;  4MVR A;  3ZIA G;  1J95 A;  3AG3 B;  3ZMZ A;  5IDJ A;  4UVB A;  3CCL V;  2EBO A;  1W0K G;  2QEX V;  2P90 A;  2Q68 A;  1AJP A;  4L87 A;  4X88 A;  4OXS A;  3CMA V;  1YSC A;  4XDJ A;  3CCQ V;  1MAB G;  3FB6 C;  1K34 A;  2WPD G;  1H8H G;  3RVZ A;  2A79 B;  4JF3 A;  4G28 B;  2EIJ C;  1F23 A;  2WWW A;  3F5W C;  3LUT B;  1DLB A;  4WFA V;  4PA9 A;  1Q82 W;  2IU0 A;  1NQT A;  1QLE C;  4RQF A;  3TCU A;  1VQM V;  3OM3 B;  1BHB A;  3ZRX A;  5BZB A;  3WG7 B;  1XL6 A;  1OCO B;  1QBZ A;  1ZWI C;  2WLL A;  3ABM C;  4KP4 A;  4GX5 A;  2XOK G;  5B3S C;  3CCM V;  1SZT A;  1SER A;  3FB5 C;  2Z5U A;  1OCZ B;  4GT1 A;  3SYO A;  3K0G A;  5CA3 A;  5IY5 B;  3CP1 A;  1UJW B;  5CN0 A;  5CBG A;  4TWK A;  4UV9 A;  1S5H C;  3ZRV A;  5B1A B;  3RBZ A;  1W0J G;  4MVS A;  3G6E V;  1AI6 A;  3BEH A;  1QVG U;  4JTA B;  3E8B A;  2DQ0 A;  3JD4 A;  3AG1 C;  5EK0 A;  5GW7 A;  2PI4 A;  1Y66 A;  2EIL B;  3JD0 A;  3ABK C;  3OUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...