4CBUA

Crystal structure of plasmodium falciparum actin i
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
365
structure length
357
Chain Sequence
EDVQALVVDNGSGNVKAGVAGDDAPRSVFPSIVGRPKNPKDAFVGDEAQTKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRAAPEEHPVLLTEAPLNPKGNRERMTQIMFESFNVPAMYVAIQAVLSLYSSGRTTGIVLDSGDGVSHTVPIYEGYALPHAIMRLDLAGRDLTEYLMKILHERGYGFSTSAEKEIVRDIKEKLCYIALNFDEEMKTSEQSSDIEKSYELPDGNIITVGNERFRCPEALFQPSFLGKEAAGIHTTTFNSIKKCDVDIRKDLYGNIVLSGGTTMYEGIGERLTRDITTLAPSTMKIKVVAPPERKYSVWIGGSILSSLSTFQQMWITKEEYDESGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN-1
publication title Structural Differences Explain Diverse Functions of Plasmodium Actins.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Motor protein
total genus 119
structure length 357
sequence length 365
ec nomenclature
pdb deposition date 2013-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4cbuA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4cbuA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4cbuA03
1J6ZA 4EAHD 4JN4A 4NO7A 1WUAA 3UKUB 3H45C 1WOQA 2OANA 2FSNA 1H1VA 2HOEA 3MCPA 3O08A 4K43A 3D2FA 4FWSA 1ZXOA 1KAXA 2P9UB 3VENA 4A62A 2CGLA 3L6QA 3TU5A 3M3ZA 3CHWA 2UYTA 5E84A 4H0VB 4BC2A 4FPBA 3R9PA 3ZEUB 3ZETA 5KQDA 5KQ8A 3GOIA 3A0IX 4H0OA 2GUPA 2VWBA 3DXKA 4EFHA 2Q0UA 5AQTA 3WQUA 3W0LA 2QWNA 3H1QA 4JD2B 1NGBA 4JHDB 3J8AA 3D7EO 5AQOA 4BG9A 2FF3B 3CJAA 1QZ5A 5AQLA 5F2RA 3VGKA 3D2EB 3HI0A 1NGJA 4BRIA 3UKRA 4K25A 2YJEA 4FO0A 1MA9B 5JLFA 4B9QA 2CH5A 5KPRA 5JICA 1ESVA 3FGUA 2YHXA 1YAGA 4BR2A 2P9KB 5AZJA 4XH4A 4AM6A 4I6MB 4BREA 2CGJA 1U6ZA 3UKUA 3CETA 2Q36A 4H0YB 3BUZB 5AQIA 1HKBA 3VEYA 4PKHA 1S22A 1OKJA 4FOIA 3RSEB 4FOEA 3B8AX 4CZHA 5AFUA 4AM7A 2P9UA 4CD3A 5AQRA 1CZAN 3BEXA 1QZ6A 3G25A 2V51B 3VOVA 4YDUC 4H5RA 5AQVA 4BRDA 1LOTB 3ZEUA 3HM8A 3UB5A 5BPLA 2FSKA 3P4IA 5BRFA 2QWMA 1G99A 2A5XA 3CQXA 3FZLA 1DKGD 4CZIA 3VGLA 5EY4A 1GLDG 4MLHA 3O80A 2HMPA 3IFRA 3A5MC 3A5OC 4JHDA 4F9OA 5BR9A 3MN5A 5LY3A 4BQLA 3JXUA 1IG8A 1K8KB 3IUCA 2E2PA 4XH1A 5LJVA 3D2EA 4O5FA 2E8AA 3ZX2A 4QS7A 3ID8A 2QWQA 2VYPA 3VERA 3VPZA 4DCHA 2A6AA 4Z94A 2P9KA 4C23A 3WXJA 4I6MA 1JCEA 3QFUA 3UKRB 1NGFA 2V52B 3QICA 3H3OB 1HKCA 5AQQA 3O4WA 4XEIA 2D0OA 3GL1A 1XC3A 2Q31A 3VF6A 5BRDA 3VF2A 1ZBSA 4BC4A 4BRNA 4PL8A 3WXLA 4PL7A 3CJ7A 1YXQA 4M7XA 3RSEA 4CZJA 2A42A 5AQKA 4H5WA 1QQMA 2V7ZA 4BG8A 4QS9A 4ISGA 2Q0RA 1NGIA 1ATRA 2D4WA 3CIPA 4GY2B 3CQYA 1R59O 2ASPA 2ZWHA 3IMXA 2BUPA 1NWKA 2GELA 5AFUH 1MWMA 2QWLA 5AQSA 2P9IB 3VF4A 2FF6A 1KXPA 3OHRA 2FLOA 3WEEB 4BR0A 2WUSA 5EX5A 3BP8A 3QFPA 3SJHA 5AQZA 2ZGYA 3DAWA 3O8MA 5E26A 1GLAG 2E2QA 4JNEA 3C0BA 2QWOA 1K8KA 1T6DA 1NGGA 3MN9A 4YDUA 5JMVA 1BUPA 3U9ZA 2D1KA 1RDWX 3FZHA 4KBOA 5F0XA 3ENHA 1X3MA 2P9LB 4B1VA 1E4FT 1BA0A 3LM9A 5B8HA 4B1ZA 5AQUA 4CZEA 4BROA 1HKGA 4IXCA 4WQ4C 2NRHA 1MDUB 3M6GA 4BR7A 4B1UB 2P9PB 4RCHA 3SMSA 3S41A 1TYQB 4BRPA 2H3GX 5AQGA 4H0XB 3GDQA 1JCFA 2NZTA 5LJWA 2E2OA 1NBWA 4O8KA 4BVOA 3DXMB 1RGIA 1BG3A 4BRMA 3ZX3A 1DGKN 2E20A 2IVNA 2ASOA 4IJAA 2GTDA 2Q97A 1HJOA 4BR9A 2A40A 3LDPA 4FPAA 4GNIA 4A61A 2P9IA 4A2BA 5JLHA 1SQKA 3VESA 4BVPA 3MN7A 3WEEA 2HF3A 4ISFA 4LC9B 3HZ6A 3U8XA 3MK6A 1DEJA 2HF4A 3QB0A 3R8EA 1U2VB 1V4TA 5ADXA 3CJBA 1XQSC 1NLVA 2AA4A 5AZIB 1ATNA 4IO8A 4WQ5C 3VEZA 4BQZA 4BR5A 3IDHA 4CBWA 3GE1A 1QQNA 4DQ8A 3VEWA 4BRLA 3WUHA 2P9LA 4BRCA 1NGEA 3C7NB 3LDQA 1ATSA 1E4GT 3EN9A 3FZKA 4PKGA 3H46O 3KHYA 1NM1A 2P9PA 1BWFO 3CJCA 3VEXA 1TYQA 3TPQA 2E1ZA 3KZBA 2YI1A 4MLEA 3BF3A 4MO5A 3FLCO 3ULEB 5EXWA 1XUPO 1QQOA 4E1JA 1HUXA 3QDKA 3WQTA 3DXMA 2P9SA 1C0GA 4Y0WA 4H0PA 2F9TA 2PAVA 3DJCA 5BN8A 2W41A 2IVOA 4BRGA 3GG4A 4H5NA 4DB3A 3LDOA 4BRHA 4WYBA 2CGKA 2PBDA 3ATVA 1NGCA 4CZMA 2W40A 3VETA 3A5NC 3I8BA 4BRKA 3EL2A 3UE5A 5FPMA 4BC5A 2I7NA 1GLBG 1U2VA 1YVNA 1Z6RA 3L0QA 1LCUA 3EZWA 5BN9A 3EKUA 5AZIA 3JS6A 4JAXA 1GLCG 3R6MA 4CZKA 3H6EA 1X3NA 1HPMA 2A41A 2GWKA 4QS8A 3AARA 1KAZA 5BRHA 3W3DA 3HTVA 4BRQA 3C7NA 3SLCA 1GLEG 1T44A 5ADXH 4B1XB 1Q18A 4CZLA 1GLJO 2Q1NA 1NGDA 4XH5A 4CBXA 3VGMA 1BDGA 2QWPA 4EIAA 5FPDA 4EHTA 1YUWA 3O5BA 1NGAA 4FWKA 3QMLA 4WQ5A 3WXIA 5TKYA 3HSCA 5ELZA 3I33A 2QM1A 1P8ZA 1QHAA 2BTFA 4FWQA 3ULEA 1NMDA 3VEVA 1SZ2A 3MMVA 4FL9A 2I7PA 2E2NA 5AQHA 3LDNA 5KPZA 2P9NB 2DPNA 2EWSA 3CERA 4IZ9A 4DHYA 4BGAA 1S3XA 3FR0A 1MWKA 3O6WA 1RFQA 3ATUA 3QBXA 3O1WA 4B1WB 2AP1A 5FPNA 4MO4A 4HTLA 4FSVA 4B1YB 4RWTA 2J4RA 2KHOA 1Z05A 2E1YA 3WXKA 3SK3A 2CH6A 4CI6A 2P9SB 4BRAA 5AQYA 1EQYA 3HBTA 4M7YA 4FWRA 2YCHA 3M1FA 1ZC6A 1HX1A 3VEOA 1IJJA 3FFKB 4BR4A 3BF1A 2FSJA 2ASMA 1KAYA 2GEMA 4K42A 5AQFA 3F9MA 2IIRA 3U4LA 2IVPA 5FPEA 1V4SA 4CBUA 2ZGZA 3A8YA 3O1BA 1HLUA 3H3NO 5CE3A 3EO3A 3WT0A 3QBWA 1TUUA 3AAQA 5AQPA 3EKSA 4IJNA 3LL3A 5F1XA 4RTFD 2NLXA 1TUYA 1JCGA 3AAPA 4J8FA 4FWMA 3ENOA 3FZMA 2ITMA 4CJ7A 2VCPA 1GLLO 3SMPA 5AQNA 4CZGA 1X9JA 2ZF5O 4FWLA 4FWOA 4A2AA 3FE1A 4CZFA 3L4IA 3D2FB 2V7YA 2FXUA 4ISEA 1GLFO 2P9NA 3AY9A 4H5VA 5AQWA 5BPNA 1SAZA 3LDLA 5BREA 5EVZA 4NB4A 2QXLA 4CD1A 5EOYA 4FWNA 3CI5A 1BU6O 2GWJA 4H5TA 4JD2A 2D0PA 3LM2A 3ZETB 1C0FA 3DWLA 1BA1A 3CJ9A 4FWPA 5AR0A 2F9WA 3DXKB 3CJ1A 3FZFA 3A5LC 4M63C 4L3QA 4EHUA 1BO5O 4HWIA 4IWVA 5AQXA 4BGBA 2E88A 5AQJA 3H1VX 4PKIA 5BPMA 2Q2RA 4WQ4A 2YJFA 4H03B 4BC3A 2QWRA 4H0TB 3U9DA 2QW9A 1NGHA 2YHWA 1Y64A 3KVGA 4BRFA 3ZX0A 3MN6A 5AQMA 1T6CA 1BOTO 5I9EB 4K41A 3MDQA 2YHYA 1D4XA 3GBTA 2A3ZA 5KPTA 5AZJB
chains in the Genus database with same CATH superfamily
1J6ZA 4DR2K 1WUAA 3UKUB 1D8YA 4LF4K 1WOQA 3O3GA 2F96A 3O08A 2QA4N 1SKWA 4ILHA 4JYAK 1KAXA 3VENA 4A62A 2CGLA 3OBYA 3AGKA 1WSGA 3M3ZA 3CHWA 4OJRA 2UYTA 2YNGA 4Q5VA 4FPBA 3R9PA 4JI0K 4OKKA 4FM1A 5KQDA 1XNQK 5HOOA 3SAHA 2Q0UA 4QAGA 1TGOA 4CF9A 4A5BA 4NCBA 1NGBA 4JHDB 4WF9L 4BG9A 3O3HA 4W5NA 1QZ5A 3P83D 3F9KA 4DR4K 1NKBA 3HI0A 4E1MA 4Z4CA 1HNZK 2QXFA 1S1XA 1MA9B 5JLFA 3IG1A 4CCHA 2CH5A 3AVJA 3WNFA 4Z4HA 5JICA 5KPRA 4LF6K 2P9KB 5AZJA 3K5NA 4DFJA 4I6MB 3VQQA 4BREA 5J1EA 1U6ZA 3T3FA 3CETA 2G8KA 2BE2A 5AQIA 5M1NA 1XNRK 3VEYA 1HQUA 3N4PA 1VQKN 1OKJA 4YHHK 1LW2A 3B8AX 1RDBA 5AFUA 4CD3A 3KLFA 1QZ6A 3G25A 3J7AP 2V51B 4H5RA 3SPZA 2G8VA 4FLUA 4JKHA 1RCHA 4BRDA 4FLTA 1D9FA 1BL3A 1LOTB 3ZEUA 3QESA 2HHSA 3HP9A 2HHXA 4Q0BA 2FSKA 1VRTA 3CC4N 3MCAB 4FZZA 3FZLA 1DKGD 1W7AA 1BIUA 4LFAK 1GLDG 3O80A 4F9OA 5JS1A 1TKTA 4DKWA 2B6AA 3AA2A 3IUCA 2E2PA 3QNOA 2KKZA 4XH1A 1BGXT 4NYFA 4B9NA 5J2NA 4GKKK 1GOAA 4R79A 5HRSA 3NH2A 4M3YA 3VERA 3V6DA 4DFPA 4ID1A 4Z94A 2P1JA 1VQ7N 4FJGA 1TKXA 3OS1A 3WXJA 3JSMA 3NVKA 1JCEA 1S6QA 2KW4A 3C6HA 3QICA 2UUBK 3CC7N 2F7TA 2OZMA 3OJSA 4XEIA 3D6RA 3VF6A 3B6OA 2NRVA 2VQFK 4DR7K 3WXLA 2VG5A 1LWEA 3RSEA 4CZJA 3TANA 5C0YA 4W5TA 3RRHA 2UXBK 4CEBA 1VQLN 2D4WA 3CIPA 4GY2B 3WNGA 2B4JA 3K5OA 4DG1A 3AO1A 2QWLA 3TSPA 1S1WA 5JS2A 2ZM6K 3M8RA 3HK2A 5EX5A 2PYLA 4JI7K 3E9PA 1KVAA 2ZGYA 3DAWA 5E26A 1GLAG 1YHQN 1NK5A 3OYFA 1K8KA 4CJLA 5JMVA 2F8TA 2D1KA 1RDWX 3E01A 1S9EA 4IEIA 3F2KA 1TK8A 4NXMK 1VQ5N 3P38A 4YOWA 3LM9A 3M5RA 4BROA 4WQ4C 2D0CA 5JENA 2QK9A 2X78A 4JRPA 4DQIA 1F21A 1MDUB 3M6GA 4BR7A 3CFPA 2P9PB 3HRGA 1RTDA 4RCHA 4PY5A 3ZSRA 3EZ5A 2H3GX 3ITHA 1NK4A 1HNWK 4M3WA 4DTJA 4NCGA 1JCFA 3KJVA 5H1SQ 4NXNK 1NBWA 2O8CB 3OVNA 4E1NA 4W5OA 2G8HA 4CHOA 3DXMB 1BG3A 5IWAK 1RBUA 3KK1A 1NK9A 3ZX3A 1DGKN 2ASOA 2Q97A 4N76A 5LMNK 3PX4A 1C1AA 1HJOA 3VN5A 4BR9A 2A40A 1Q86O 5JLHA 1JLGA 4JI5K 1J54A 4DUYK 2YKNA 3HZ6A 5CY4A 4FLYA 4WCEL 4N56A 1DEJA 2YHAA 3AO5A 3R8EA 1U2VB 2Z1GA 5ADXA 5M1KA 2O8BB 3VEZA 3KLIA 4CBWA 3DRRA 3SQ4A 5M1OA 1SL2A 3S3NA 2FC0A 1QQNA 2UUAK 3LPUA 4BRCA 4PQUA 3C7NB 2UXCK 3PO5A 1ATSA 1E4GT 4Y1DA 3ZSVA 3ISNC 1UA0A 4M3UA 3FZKA 3O9RA 3AVHA 2G8FA 3BZCA 1NM1A 1CZ9A 5DK5A 4HUEA 4BECA 3R3LA 4DU4A 4FVUA 4HCBA 3FLCO 2HHUA 3DLGA 3QDKA 1C0GA 4M3RA 4M42A 2F9TA 3DJCA 4KHNA 2W41A 2IVOA 3GG4A 1ASVA 2IAJA 2KFZA 4BRHA 1ZBHA 1FK9A 1J9AA 4AHCA 3ATVA 5HRNA 3ID6A 3M8PA 2R7YA 1NGCA 4CZMA 1YVUA 4N41A 5M1PA 3A5NC 5T7BA 4CHYA 3ZSQA 1IO2A 3AVNA 1GLBG 3L0QA 1QSLA 3PIOL 5AZIA 5SZTA 4GW6A 4QCLA 3R6MA 3THWA 2XY5A 3V1QA 1FKOA 4BRQA 3H08A 3KIOA 3CCRN 1T44A 4JEPA 2YHBA 3J81O 4EIAA 5FPDA 4AQYK 3CCSN 3O5BA 4FZXC 5JVHL 4FWKA 3QMLA 5GAGP 3V1RA 4OKJA 2BTFA 4FWQA 1BQMA 4JI2K 1S5JA 4KHUA 3VEVA 3OBWA 2I7PA 2E2NA 3OTOK 4B3TK 2EWSA 3CERA 3BDPA 1MWKA 3EEQA 2VWKA 3ATUA 3O1WA 3NCIA 4CGHA 3BZKA 1HRHA 4HTLA 2AJQA 5C2FA 1Z05A 2E1YA 1TAUA 3SV4A 5J2QA 4CHZA 4KI4A 4KB1A 4FM2A 5CZ1A 3T19A 3T7ZA 4CJKA 1EQYA 3HBTA 4M7YA 4A57A 2RN2A 3M1FA 1HX1A 3VA0A 3FFKB 4BR4A 2NRWA 1KRPA 3HPGA 1UWBA 1Q81O 2ASMA 1KAYA 2YX6A 1A5VA 4OLBA 2JLEA 4OGCA 4K42A 4GMJB 3NAEA 2OPSA 1Z26A 3F9MA 4FVMA 2IIRA 1VQ8N 1RT6A 4C1NI 5CE3A 4DTSA 4YOTA 4U7BA 1YF5L 3E66A 3AAQA 5AQPA 4DV2K 3HVTA 4RW6A 5F1XA 4F2SA 4CJ7A 3SMPA 4CF0A 3CD6N 3OYCA 2ZF5O 4FWLA 4FWOA 2D5RA 4W5QA 1BCOA 3AVLA 3OYBA 2Y1IA 1VAZA 1HNVA 4ISEA 1OVYA 3D45A 3HM9A 4CJ4A 3AY9A 5AQWA 3SI6A 1JL2A 2X6SA 5BREA 3C6TA 5EVZA 1BQNA 4BDZA 3PX0A 1VSHA 1RT1A 3DLKA 1T05A 3LM2A 1C0FA 3DWLA 3CJ9A 4B9TA 5AR0A 3DI6A 3DXKB 1RTIA 3FZFA 3SBGA 4JRQA 1VSJA 4KTWA 1O1WA 3WXMB 1M90O 4PKIA 3L3VA 5M1FA 2QWRA 4H0TB 3S3OA 1WB9A 2YHWA 4NLBA 3J7YP 4JKBA 2NUBA 3MECA 2KZZA 3KVGA 3NBPA 3MN6A 2ZQBA 1EX4A 1T6CA 1QVFM 3DLEA 4DTUA 4DS5A 3C65A 2IDOA 3F73A 4CFCA 4CEDA 3H45C 1RTJA 3MCPA 5IT9O 4AHUA 2O4IA 5FLXO 4LFBK 1OH8A 4FWSA 3TTDA 1ZXOA 4CJ3A 4Z4FA 3DLRA 2FBTA 3ZT3A 1QHTA 4A5AA 3TU5A 5CZ2A 3QETA 3ZETA 5KQ8A 3HSTB 1N32K 4CGJA 2VWBA 3C6AA 3W0LA 2QWNA 4DQRA 1N34K 1L3UA 3VQEA 3KLHA 3CG7A 1KC8O 4FLWA 4J2DA 2E6LA 1Q9YA 4LFCK 3J8AA 2FF3B 4RW9A 5AQLA 2OYQA 5F2RA 3D2EB 3I8DA 3CM5A 5A2QO 2YJEA 4FO0A 2GX9A 1BIZA 3K9KA 3V1OA 3TARA 2RE2A 3NMUA 3I56N 1C6VA 3FGUA 2KQ2A 2O8DB 1NJIO 2YKMA 4XH4A 4AM6A 2ZJRL 4F2RA 4PHTX 2CGJA 4XJXA 1JLBA 3RR7A 4FK4A 3BUZB 4R5PA 1HKBA 2UUCK 1WAJA 1Z25A 3NGZA 3MXJA 4K8ZA 1WSJA 1RT7A 2FBVA 2NNWA 1L3SA 2P9UA 3G6EN 5AQRA 1T8EA 2OZSA 2NRZA 3BEXA 4O5BA 3AVAA 4YDUC 3PX6A 5FROA 4LF9K 1K8AO 3QO9A 3V81A 5BPLA 4LF7K 4FJ9A 3P4IA 5BRFA 2QWMA 4QOZB 1G99A 2HNZA 3SAFA 3ZT2A 1X9MA 5HRRA 5EY4A 4MLHA 3J80O 4IKFA 4BE2A 3S5TA 3A5OC 5BR9A 4BQLA 4OX9K 3JXUA 1RT3A 2P5GA 4KFBA 4C8NA 2OPPA 3ZT0A 5LJVA 3ID8A 2HHIA 4DCHA 5HRPA 4LH5A 5FRMA 4Z4EA 1S9GA 3U3GA 1UA1A 4YOUA 5GINA 3SZ2A 3UKRB 2V52B 4DU1A 5C2DA 5AQQA 4LF8K 2D0OA 1TVRA 2Q31A 3HO1A 3MEEA 1TL1A 4BRNA 3AVMA 3KWGA 4JKDA 4M7XA 3CCEN 1LWCA 4CK2A 5AQKA 4X62K 2O4GA 1QQMA 1JL1A 4E3SA 2Q0RA 3HT3A 5EU7A 4CGFA 4J2EA 3CQYA 4IG3A 5GIPA 2ZWHA 1L5UA 3IMXA 2GELA 1NWKA 1MWMA 3VF4A 3CCVN 2FF6A 3OYHA 4O44A 5KRTA 3QFPA 2HSTA 5AQZA 4CFAA 4CJWA 1NK0A 1ILYA 3O8MA 4K0KK 3TABA 5KRSA 1NGGA 4E19A 1BUPA 3V9UA 3U9ZA 5DM6L 1R0AA 1KVCA 4IFVA 3L2UA 4KO0A 4FZYA 4CESA 4JI6K 5F0XA 3OYEA 2P5OA 4DUZK 2P9LB 3AA5X 1E4FT 1RDDA 1TKZA 3LWLA 3S9HA 1REVA 4B9UA 2VQEK 4CZEA 1HKGA 2NRHA 1J5OA 4DSFA 3I55N 4B1UB 4AHSA 3TTFA 4FYDA 4YOYA 4FJJA 1WN7A 1JLQA 1KVBA 3DRSA 4CF2A 4FLXA 4BVOA 1RGIA 2E20A 2IVNA 1X9WA 1NK8A 4JLHA 4DSJA 2NRTA 3S3MA 4FCYA 2HHQA 1FW6A 2P9IA 3K9JA 1SQKA 3VESA 3VQ7A 3QIPA 3WEEA 4JI1K 1VSLA 1QSYA 3O9UA 3EY1A 1QSSA 1VSIA 4CE9A 1YTAA 3PV8A 3WNEA 4IO8A 3PIPL 4G1QA 4PWDA 3THXB 3VEWA 1N8RO 1NGEA 1XHXA 1FJGK 3ASMA 3HXMA 3OW2M 4PKGA 2GV9A 3BY5A 1BWFO 3CJCA 1TYQA 3TPQA 3RMAA 2E1ZA 2DFHA 3KZBA 1VQ4N 2YI1A 3VQ4A 4DR6K 3BF3A 2W6LA 4KHSA 5EXWA 5KTQA 4DTXA 1QQOA 2I5JA 1KFSA 4H0PA 3PUFA 4CJ5A 5BN8A 4BRGA 4H5NA 5FDLA 1WSHA 4DV1K 3AVBA 3PSFA 4K8XA 1JJ2M 4CECA 5TKWA 1HYSA 4KHYA 3I8BA 5FPMA 1SKRA 1YVNA 1Z6RA 4GVEA 3B6PA 3EZWA 3NF9A 3EKUA 1NK6A 1UAXA 4CZKA 4EP4A 4BDPA 4FJKA 1KAZA 3N4QA 5BRHA 4IOCL 3KTQA 3T69A 3W3DA 2Z1HA 3SLCA 1K9MO 1GLEG 4C8KA 1Q18A 2PYJA 2Q1NA 1C0TA 1NGDA 2XY7A 4F3OA 4LY7A 1BDGA 2A1RA 2HNYA 2QWPA 4HTUA 1NU0A 1NGAA 3WXIA 3HSCA 3KK7A 5ELZA 3BGRA 3I33A 3RMDA 3THYB 3ZSOA 1QHAA 2NRRA 4BEBA 1T03A 3ULEA 4M41A 3VTHA 3KD1E 1SZ2A 3MMVA 4FL9A 3ALYA 3VQDA 1HPZA 4IZ9A 4E7LA 3OYAA 3O6WA 1B92A 1NJXA 4BE0A 4AHTA 4KTZA 3CCUN 4FSVA 4B1YB 3VA3A 4RWTA 3SYZA 2J4RA 2O8EA 3WXKA 3SK3A 3VQPA 4BRAA 4DTMA 2A1SA 3OYDA 3NGYA 2YCHA 3K0SA 1ZC6A 3VEOA 2QI2A 1IJJA 2VGNA 3OYKA 2VG7A 4FJXA 4H4OA 1VRUA 3O3FA 3U4LA 3QLHA 1BI4A 4CBUA 3KKRA 3VQBA 3O1BA 1HLUA 4KTQA 1HQEA 2JGUA 1W97L 3QBWA 3DOKA 4JI3K 4CK1A 1Q7YO 1TUYA 1JCGA 3DLLL 3QINA 3ZSWA 3ENOA 1JXEA 3FZMA 3HL8A 3L4QA 3F5TA 4JKAA 3E9OA 4A2AA 2QTDA 4KV8A 2WONA 3TTCA 4F3TA 2FXUA 4OVLA 2P9NA 2RHKA 2KTQA 1S1TA 3LP3A 4H5VA 1SAZA 3LDLA 3NF7A 5DMRA 2QXLA 5EOYA 3IAYA 3CI5A 4B9LA 2D0PA 5AJ3K 1BA1A 4KHQA 1I39A 5JVGL 2YNIA 2F9WA 3CJ1A 4N47A 4M63C 4EHUA 4BGBA 4HWIA 4OGEA 2Q2RA 3AV9A 1X9SA 2O8FA 3AVCA 3U9DA 1W2BM 1S1UA 2ATQA 4KH5A 4DV6K 1CLQA 2HVHA 3K58A 1BOTO 5C10A 5I9EB 5HROA 1RT5A 5I42A 1D4XA 5BR8K 2ZJQL 1OH6A 2A3ZA 4CEZA 5KPTA 4YOVA 5AZJB 4JN4A 4CF1A 1N33K 4IEEA 4NO7A 3OS0A 3OS2A 4DMNA 4JKGA 1HYVA 2OANA 2G8IA 1H1VA 2KFNA 1G15A 3WNHA 1IBLK 2OPRA 4DLGA 5LL6Z 4BWMA 5GAHP 3D2FA 1RTHA 1K6YA 1HYZA 3OYLA 5C12A 3DOLA 4OPAA 3CCJN 4V19S 1U47A 1VSMA 1EO1A 3L6QA 1XI1A 1YJWN 1YITN 5E84A 2DFFA 4I9LA 3NDKA 1DT9A 3ZEUB 4AH9A 4NYNA 3GOIA 2PY5A 2GUPA 4EFHA 4JKCA 4B3MK 1Y97A 4ZTJA 4FK2A 1OVQA 4KAZA 3TAQA 1QS4A 1A5XA 3C6UA 3AVKA 3VGKA 1NGJA 4BRIA 3MX2A 3UKRA 3ULDA 1BHLA 4B9QA 4CGIA 1ZBUA 1ESVA 1RBSA 2IOCA 4BR2A 3CC2N 4B08A 3UKUA 2Q36A 3KK2A 2GUIA 1B9DA 2EHGA 1S22A 1VQMN 3CXCM 4IDKA 2Z1IA 2OPQA 4FOIA 4H4MA 3RSEB 3IS9A 2IC3A 3L3UA 4AM7A 3VQAA 4CFDA 1VK0A 4Z0UA 4CZHA 1CZAN 2RKIA 3E1YA 4O8UA 3G71N 4ID5A 1GOBA 4CGDA 1XMOK 2IGIA 4YY3K 1WSEA 3HM8A 1VHXA 4GV9A 2HBKA 1DTQA 3KWIA 3LZIA 4C1NK 4DR3K 3I0SA 1RNHA 2A5XA 2VG6A 3CQXA 4ILJA 2D0BA 3CFRA 4FJIA 4CZIA 3NVMA 4DTNA 1QTMA 2ZD1A 4WFAL 3IFRA 5LY3A 4JHDA 3NH1A 2G8WA 5HLFA 2QKKA 3VQ5A 4CJTA 4FW1A 4JS4A 4HUFA 1LAWA 1K8KB 4EZ9A 3MXIA 1WSIA 4CEFA 4FJMA 1TAQA 4FJ7A 4QS7A 2QWQA 1KTQA 1EXQA 2P9KA 3TSQA 4I6MA 4C8OA 4UQGA 1ZBFA 4E0DA 1N5YA 1NGFA 2ITGA 1HKCA 1C0MA 3O4WA 3GL1A 2X6NA 5BRDA 3K5LA 3VF2A 4BC4A 4PL8A 4MQ3A 2XRIA 4JKFA 4RW4A 4PL7A 2DY4A 1YXQA 2QKBA 2A42A 3R1XA 3PY8A 1YJ9N 2V7ZA 4BG8A 4QS9A 2HNDA 3CFOA 1RT4A 4B8AB 4DQQA 1NGIA 1ATRA 4KHWA 3HOSA 4X64K 1R59O 2ASPA 2ETJA 3UIQA 1L3TA 5E41A 4WE1A 1W9HA 3AGRA 1DTTA 3IRXA 2FLOA 3OHRA 5CR4A 4BR0A 4CK3A 1XWLA 2Q3SA 4JK9A 1KCFA 4RW7A 4JNEA 3C0BA 3OJUA 1KQSM 4YDUA 4DTOA 4O0JA 4HHTA 3FZHA 5C42A 4KBOA 5K14A 3ENHA 1X3MA 1XHZA 4ICLA 3SJJA 2OA8A 3CM6A 1OH5A 4DV5K 4CEAA 2B5JA 4LD0A 4FJ5A 4CEEA 4M45A 5AQUA 4DLEA 4DU3A 4IXCA 3ZSYA 5KGXA 3TAFA 3RR8A 4J2AA 5SWMA 4IO9L 4KRFA 4IOXA 1NNEA 4FK0A 1VSDA 4CVNE 3S41A 4BRPA 1T7PA 4CHPA 4LSLA 1Q82O 4FJNA 1IKWA 2NZTA 3IKMA 2GBZA 4IG0A 5LJWA 2E2OA 3O9SA 5HL7L 4BY9C 3NF6A 4OPHA 3J7ZO 2BH1A 4YOXA 4IJAA 1RT2A 3TI0A 3P31A 2VWJA 3AO3A 3LDPA 4C8LA 3HPHA 4E7KA 4GNIA 4A61A 2HHTA 4W5RA 4BVPA 2HF3A 3TWHA 4IFYA 3U8XA 3DYAA 1U49A 3MK6A 4CFBA 2HF4A 1TK5A 1V4TA 1NLVA 3K2PA 4KREA 5AZIB 1ATNA 4WQ5C 4BQZA 1VSEA 4BR5A 4O4GA 1M1KO 3THWB 3PLAA 3AO4A 4DQ8A 3EE9A 4FJHA 1YT3A 3U3YA 4BRLA 3WUHA 4MFBA 4ELUA 4DV7K 3QEXA 3EN9A 3TSUA 1Q8IA 4B3SK 3KLGA 1L3VA 2P9PA 3OYJA 2W42A 4CJSA 2FBXA 1C1BA 1IKYA 4E7HA 4MLEA 4DS4A 1ASUA 2O8CA 1XUPO 4FLZA 4Z4IA 3WQTA 3DXMA 2BDPA 1A5WA 4FW2A 2PAVA 2X74A 3SUQA 3Q7CA 3Q7BA 1KLNA 1SS6A 4B8CA 2CGKA 3EE8A 2W40A 4IOAL 2F4VK 3LALA 2D0AA 2C1IA 4BRKA 1GOCA 2WTUA 4IDHA 4DWIA 1CXQA 2KLAA 1U2VA 1S6PA 1LCUA 1DLOA 5BN9A 2O8BA 4M3XA 1IBMK 4JAXA 5C25A 1X3NA 3SCXA 1HPMA 2A41A 2GWKA 2OTLN 3P1GA 1IG9A 5C15A 3HTVA 3C7NA 3P39A 4DQPA 1JLEA 3CMAN 4B1XB 1NJZA 1ZBIA 4CZLA 1SV5A 3U6FA 4CBXA 3OA9A 1WBBA 4E72A 1CXUA 1YUWA 3DMJA 4ZTFA 3SUPA 3RMCA 2HB5A 2ZE2A 1RDCA 4GV6A 1NOYA 3PSIA 5AQHA 1WNSA 3ZCMA 4DHYA 3KLEA 4BGAA 5C24A 5HP1A 4B3OA 3L2VA 3RWUA 2AP1A 2ZJPL 3SQ0A 4CF8A 2CH6A 4CI6A 2C1GA 2P9SB 1J53A 3NF8A 5AQYA 4OKEA 3T1HK 4I2QA 2F8SA 3OYNA 5D3GA 3V9ZA 3BF1A 4BWJA 1TK0A 2GEMA 3MEGA 5AQFA 4CJRA 2IVPA 3QEWA 3I0RA 1I94K 2ZGZA 3A8YA 3H3NO 3WT0A 4CEQA 4B9MA 1TUUA 3CYMA 3KD5E 1KLMA 3EKSA 3AVFA 3A2FA 4RTFD 3G10A 3ZT1A 4J8FA 3AAPA 4KH6A 1GLLO 1X9JA 2LSNA 3LAKA 1EWQA 4AHRA 3FE1A 3MAQA 3L4IA 3C94A 3QEPA 1GLFO 2JWLA 3RMBA 3M8SA 4NB4A 1RBVA 4CD1A 4FWNA 1VSKA 2UU9K 3KKSA 3ZETB 3HYFA 3OY9A 4FWPA 1EETA 4DTPA 3K59A 2HBMA 1HR0K 1I3AA 3A5LC 3PO4A 3AO2A 3QEIA 4L3QA 1BO5O 4IWVA 4E7IA 2QEXN 4DQSA 1VQPN 2E88A 3K5MA 5GAEP 3H1VX 2YV0X 4WQ4A 4CEOA 3DLBA 1P90A 3L2RA 4DR1K 2QW9A 1NGHA 4DV0K 4BRFA 5AQMA 4CJQA 5M1QA 1MU2A 3ZLJA 1U04A 2BANA 3SUNA 3LDSA 3MDQA 1SUQA 3DRPA 3AVIA 5GADP 4EAHD 4NLCA 2FSNA 2HOEA 4AILC 4K43A 4FJLA 4MDAA 2UXDK 2P9UB 3VQ8A 4BACA 4IFEA 3SBTA 1IKVA 4EZ6A 4H0VB 4BC2A 2G8UA 4Y1CA 2KZMA 3A0IX 4H0OA 1NJWA 3LP1A 3DXKA 4JI4K 3RVCA 1JLFA 5AQTA 3WQUA 4DFKA 1HNXK 3O9TA 2HW3A 1TL3A 3H1QA 4AF1A 3L8BA 5J2MA 4JD2B 3D7EO 5AQOA 2HMIA 3CJAA 3DLHA 3TAPA 4DSEA 2WBNA 4K25A 1S72N 3V9WA 2HVIA 3AA4A 5DM7L 2YHXA 1YAGA 4XIUA 4KH4A 3CPEA 2WC9A 3VQ6A 4YFUA 3TR8A 4H0YB 2DFEA 3T1YK 3SNNA 5CHIA 4PKHA 1U48A 1VSFA 3HOTA 1U4BA 4FOEA 1RDAA 3KK3A 3VOVA 5AQVA 4DSIA 4TSXA 2DTUA 2HHWA 3FFIA 1C1CA 3O4QA 1VQON 3K57A 2Y1JA 3UB5A 4JK8A 3VTIA 4N5SA 1YTUA 4RW8A 5I3UA 3AA3A 3VGLA 4BDYA 2XY6A 1IKXA 2HMPA 5GIOA 3A5MC 1HNIA 3MN5A 4DR5K 2Z1JA 1IG8A 1WBDA 2RF2A 4UY8O 3O4NA 1NKCA 3D2EA 4O5FA 1T3VA 4FLVA 4DSLA 2E8AA 1NOZA 3ZX2A 3TAGA 4DV4K 4AHVA 3QIOA 4ILGB 2VYPA 3VPZA 2A6AA 2O8DA 3CMEN 4C23A 3QFUA 4Z4GA 4ELTA 4FM0A 3H3OB 1YJNN 1XC3A 1ZBSA 1IH7A 4B9VA 1WLJA 4WFBL 3CJ7A 4DF4A 3LANA 3NHGA 3E9LA 1O13A 3HPOA 3M8QA 4H5WA 4ISGA 4E89A 1KD1O 3JYTA 3CCMN 2BUPA 5AFUH 3VMFB 5AQSA 2P9IB 3QEVA 1KXPA 3WEEB 4GKJK 2WUSA 3V9XA 4G9ZA 4CIEA 3BP8A 1LAVA 3SJHA 3G4SN 3L2WA 2E2QA 1UOCA 2HHVA 2QWOA 3TAMA 1T6DA 3MN9A 4IBNA 4J2BA 1JLCA 1HJRA 2VGMA 1N36K 1EWRA 2WFBA 2HBJA 4B1VA 1BA0A 1SL0A 5B8HA 4B1ZA 4YNQA 4LF5K 4CGGA 5FRNA 2HHHK 3MWTA 4L8RB 3SUOA 3SMSA 1TYQB 4CHNA 4KHPK 3ENBA 5AQGA 4H0XB 3CF5L 3GDQA 3OYMA 2XY8A 4KKOA 2WOMA 4O8KA 4CJEA 1XMQK 1D5AA 4BRMA 2GTDA 2IS3A 2E5LK 1ASWA 1JXBA 3HVRA 4FPAA 4LSNA 3OYIA 3NFAA 3ZYYX 4A2BA 2JWKA 4I9QA 3MN7A 4ISFA 3EYZA 4LC9B 2FBYA 5J2PA 1NKEA 3QB0A 3NE6A 3CJBA 1XQSC 4KB0A 2AA4A 3IDHA 4H8KA 3GE1A 3AVGA 4JS5A 4CJUA 5KGWA 3JAMO 2P9LA 3C95A 1RBRA 3ZT4A 4M3TA 3LDQA 4I7FA 4DV3K 3OYGA 1QE1A 2W6KA 3ZSZA 1S1VA 3LPTA 1SL1A 3VQCA 4CERA 1QVGM 3H46O 3KHYA 3VEXA 4DF8A 4GVMA 4PUOA 2XO7A 3QERA 3SQ1A 4MO5A 3ULEB 2EX3A 3QNNA 4E1JA 1VQNN 1HUXA 4OPJA 3HP6A 1TV6A 2P9SA 4Y0WA 2YNHA 3RRGA 4KPYA 3ZSXA 4DB3A 3LP2A 3LDOA 5CYQA 4FXDA 4WYBA 2O8EB 3SQ2A 2PBDA 4HVJA 1LW0A 4B3RK 4O55A 3MXMA 1BISA 4BE7B 1XC9A 2HBLA 1LWFA 3MWPA 3VETA 4HUGA 3EL2A 3UE5A 4BC5A 2I7NA 4B9SA 3TAEA 1BCMA 5HBMA 3JS6A 4CW7B 1GLCG 3H6EA 4WFNL 1B9FA 3AARA 4QS8A 3THXA 2W00A 1BI4B 1X1PA 4LH4A 4RG8A 4CJVA 3DM2A 5ADXH 3G0ZA 1FXXA 1C0UA 4ELVA 4JV5K 1GLJO 4ZHRA 4XH5A 1RBTA 3VGMA 1N6QA 4EHTA 1E3MA 1NG9A 3SPYA 1W0HA 4WQ5A 5TKYA 4HCCA 4CIFA 1VQ9N 2E4LA 2QM1A 1U45A 1P8ZA 1NMNA 4DSKA 1NMDA 4X65K 3LDNA 1YIJN 4X66K 4MDBA 5KPZA 2P9NB 2DPNA 3D0PA 1KFDA 1S3XA 3FR0A 1NJYA 1RFQA 2PZSA 3QBXA 1OH7A 4B1WB 2E6MA 5FPNA 4MO4A 5LMUK 3CPWM 4U67L 2KHOA 3LZJA 1JKHA 4CHQA 4E7JA 4EP5A 5CYMA 3CCQN 4FWRA 1KSPA 4PA1A 4GV3A 1ZYQA 1J5EK 4BE1A 2O8FB 3V9SA 3HJFA 3NGIA 2RPIA 1JLAA 2FSJA 1VQ6N 4M3ZA 2XHBA 1LV5A 4F4KA 1HMVA 1D9DA 4I2PA 3MX5A 4JI8K 5FPEA 1V4SA 4F8RA 1YI2N 3P5JA 2YNFA 3EO3A 3LP0A 4NCAA 1EKEA 4KI6A 4OO1J 4IJNA 3LL3A 3LAMA 3SAGA 2NRXA 4JKEA 4DFMA 2NLXA 5KI6A 4JKGB 4FWMA 2ITMA 2VCPA 5AQNA 4CZGA 4JK7A 3SV3A 4OLAA 4DTRA 1CZBA 4CJPA 1NK7A 4CZFA 3THYA 3O9QA 3D2FB 2OTJN 2V7YA 4CIGA 1ZBLA 5BPNA 4FJ8A 4YORA 1IV0A 2OCEA 1BU6O 4CJFA 3THVA 3V4IA 2P51A 3NH0A 3CCLN 2GWJA 4H5TA 2PFUA 5MLCQ 4JD2A 3LWMA 1K73O 1WSFA 3MEDA 1RDUA 4O0IA 1IBKK 5AQXA 1FKPA 2BGGA 3CYGA 5AQJA 5BPMA 1WAFA 2YJFA 4H03B 4BC3A 3CQ8A 3L2QA 1Y64A 3RTVA 3ZX0A 1QQCA 4OPKA 1SKSA 1TKDA 1EP4A 1Q9XA 1ITGA 4K41A 4C8MA 3VQ9A 2YHYA 4A59A 1RILA 3GBTA 3T1AA
chains in the Genus database with same CATH topology
1J6ZA 4EAHD 4JN4A 4IEEA 4NO7A 1WUAA 3UKUB 4JKGA 4NLCA 3H45C 1WOQA 2OANA 2FSNA 1H1VA 2HOEA 3MCPA 3O08A 2QA4N 4K43A 5GAHP 3D2FA 4FWSA 4ILHA 3TTDA 1ZXOA 4MDAA 5C12A 4OPAA 3CCJN 1KAXA 2P9UB 3VENA 4A62A 2CGLA 3OBYA 1EO1A 3L6QA 3AGKA 4A5AA 3TU5A 4IFEA 3M3ZA 3SBTA 1YJWN 3CHWA 1YITN 2UYTA 5E84A 4H0VB 4BC2A 4FPBA 3R9PA 1DT9A 3ZEUB 3ZETA 5KQDA 5KQ8A 3GOIA 3A0IX 5HOOA 4H0OA 3SAHA 2GUPA 2VWBA 3C6AA 3DXKA 4JKCA 2Q0UA 4EFHA 3RVCA 5AQTA 3WQUA 3W0LA 2QWNA 3O9TA 3H1QA 4AF1A 1KC8O 4A5BA 4JD2B 1NGBA 4JHDB 4WF9L 3J8AA 3D7EO 5AQOA 4BG9A 2FF3B 3CJAA 1QZ5A 5AQLA 5F2RA 3VGKA 3D2EB 3HI0A 1NGJA 4BRIA 2WBNA 3MX2A 3UKRA 4K25A 1S72N 2YJEA 4FO0A 1MA9B 5JLFA 4B9QA 2GX9A 2CH5A 3K9KA 5KPRA 5JICA 2RE2A 3NMUA 5DM7L 3I56N 1ESVA 3FGUA 2YHXA 1YAGA 4BR2A 3CC2N 1NJIO 2P9KB 4KH4A 4XH4A 4AM6A 5AZJA 2ZJRL 3CPEA 2WC9A 4I6MB 4BREA 4PHTX 2CGJA 4XJXA 1U6ZA 3UKUA 3CETA 2Q36A 4H0YB 3BUZB 5AQIA 5M1NA 1HKBA 3VEYA 3N4PA 5CHIA 4PKHA 1S22A 1VQMN 1VQKN 1OKJA 3CXCM 3HOTA 4YOVA 4FOIA 3RSEB 4FOEA 3B8AX 4CZHA 5AFUA 2NNWA 4AM7A 2P9UA 4CD3A 3G6EN 5AQRA 1CZAN 2NRZA 3BEXA 1QZ6A 3E1YA 3G25A 4O8UA 2V51B 3VOVA 4YDUC 4H5RA 5AQVA 3G71N 4JKHA 4BRDA 1K8AO 1LOTB 3ZEUA 3HM8A 4GV9A 1VQON 3UB5A 4JK8A 5BPLA 2FSKA 2HBKA 3P4IA 3KWIA 5BRFA 2QWMA 4C1NK 3CC4N 1G99A 2A5XA 3CQXA 3MCAB 4ILJA 3VTIA 3SAFA 3FZLA 1DKGD 4CZIA 3NVMA 3VGLA 5EY4A 1GLDG 4MLHA 4WFAL 3O80A 2HMPA 3IFRA 5GIOA 3A5MC 3A5OC 4JHDA 4F9OA 5BR9A 3MN5A 5LY3A 4BQLA 3JXUA 4DKWA 1IG8A 1K8KB 3IUCA 2E2PA 2KKZA 4XH1A 4UY8O 5LJVA 3D2EA 4O5FA 1T3VA 2E8AA 3ZX2A 4R79A 4QS7A 3ID8A 4ILGB 2QWQA 2VYPA 3VERA 3VPZA 4DCHA 2A6AA 4Z94A 3CMEN 2P9KA 4C23A 1VQ7N 3WXJA 3TSQA 4I6MA 3NVKA 1JCEA 4YOUA 5GINA 3QFUA 3UKRB 1NGFA 2V52B 3C6HA 3QICA 5C2DA 3H3OB 3CC7N 2F7TA 1HKCA 5AQQA 1YJNN 3O4WA 4XEIA 2D0OA 3GL1A 1XC3A 3D6RA 2Q31A 3VF6A 5BRDA 3VF2A 1ZBSA 4BC4A 2NRVA 4PL8A 4BRNA 3WXLA 4JKFA 3KWGA 3CJ7A 4PL7A 4JKDA 4WFBL 1YXQA 4M7XA 3RSEA 3CCEN 4CZJA 3E9LA 2A42A 1O13A 3R1XA 5AQKA 4H5WA 1QQMA 1YJ9N 2V7ZA 4BG8A 5C0YA 4QS9A 4ISGA 2Q0RA 1KD1O 1VQLN 1NGIA 1ATRA 2D4WA 3CIPA 4GY2B 3HOSA 3CCMN 3CQYA 5GIPA 1R59O 2ASPA 2ZWHA 3IMXA 2BUPA 1NWKA 2GELA 5AFUH 1MWMA 3VMFB 3TSPA 2QWLA 5AQSA 2P9IB 3VF4A 3CCVN 2FF6A 1KXPA 3AGRA 3OHRA 5CR4A 2FLOA 3WEEB 4BR0A 2WUSA 5EX5A 4G9ZA 3BP8A 3QFPA 2HSTA 5AQZA 3SJHA 3E9PA 3G4SN 2ZGYA 1ILYA 3DAWA 3O8MA 4JK9A 5E26A 1GLAG 2E2QA 1YHQN 4JNEA 3C0BA 2QWOA 1KQSM 1K8KA 1T6DA 1NGGA 3MN9A 4YDUA 5JMVA 1BUPA 3U9ZA 2D1KA 5DM6L 1RDWX 3FZHA 4KBOA 5F0XA 4IEIA 2VGMA 3ENHA 3F2KA 1X3MA 2P9LB 2WFBA 2HBJA 4B1VA 1E4FT 1BA0A 1VQ5N 3P38A 4YOWA 3LM9A 5B8HA 4B1ZA 5AQUA 3M5RA 4BROA 1HKGA 4CZEA 4IXCA 4WQ4C 2NRHA 1MDUB 3M6GA 4BR7A 3I55N 4B1UB 4IO9L 3MWTA 2P9PB 3HRGA 3TTFA 4RCHA 4IOXA 3SMSA 3S41A 1TYQB 4BRPA 4YOYA 2H3GX 3ENBA 5AQGA 4H0XB 3CF5L 1Q82O 3GDQA 1JCFA 2NZTA 3IKMA 5LJWA 2E2OA 3O9SA 1NBWA 5HL7L 5H1SQ 4BY9C 4O8KA 4BVOA 3DXMB 1RGIA 1BG3A 4BRMA 4OPHA 3J7ZO 3ZX3A 1DGKN 2E20A 2BH1A 2IVNA 2ASOA 4YOXA 4IJAA 2GTDA 2Q97A 3P31A 2NRTA 1HJOA 4BR9A 2A40A 1Q86O 3LDPA 4FPAA 4GNIA 3ZYYX 4A61A 2P9IA 4A2BA 2JWKA 3K9JA 1SQKA 3VESA 5JLHA 4BVPA 3MN7A 3WEEA 2HF3A 4ISFA 4LC9B 3HZ6A 3U8XA 4WCEL 3MK6A 3O9UA 1DEJA 2HF4A 3QB0A 3R8EA 1U2VB 1V4TA 5ADXA 3CJBA 1XQSC 5M1KA 1NLVA 2AA4A 5AZIB 1ATNA 4IO8A 4WQ5C 3VEZA 4BQZA 4BR5A 3IDHA 4CBWA 3PIPL 1M1KO 3GE1A 5M1OA 3PLAA 1QQNA 3EE9A 4DQ8A 3VEWA 4BRLA 3WUHA 2P9LA 1N8RO 4BRCA 1NGEA 3C7NB 3LDQA 1ATSA 1E4GT 3OW2M 3EN9A 3FZKA 1QVGM 4PKGA 3O9RA 3TSUA 3H46O 3KHYA 1NM1A 2P9PA 1BWFO 3CJCA 4BECA 3VEXA 3R3LA 1TYQA 3TPQA 2E1ZA 3KZBA 1VQ4N 4FVUA 2YI1A 4MLEA 3BF3A 4MO5A 3FLCO 3ULEB 5EXWA 1XUPO 1QQOA 4E1JA 1HUXA 3QDKA 3WQTA 3DXMA 1VQNN 2P9SA 1C0GA 4Y0WA 4H0PA 2F9TA 2PAVA 3DJCA 5BN8A 2W41A 2IVOA 4BRGA 3GG4A 4H5NA 3Q7CA 4DB3A 3LDOA 3Q7BA 4BRHA 4WYBA 1SS6A 2CGKA 2PBDA 3ATVA 3ID6A 3EE8A 1JJ2M 1NGCA 5TKWA 2W40A 4CZMA 4IOAL 4BE7B 2HBLA 3MWPA 5M1PA 3VETA 3A5NC 3I8BA 2C1IA 4BRKA 3EL2A 4IDHA 3UE5A 5FPMA 4BC5A 2I7NA 2KLAA 1GLBG 1U2VA 1YVNA 1Z6RA 3L0QA 4GVEA 1LCUA 3EZWA 5BN9A 3PIOL 3EKUA 5AZIA 3JS6A 4JAXA 1GLCG 3R6MA 4CZKA 3H6EA 1X3NA 4WFNL 1HPMA 2A41A 2GWKA 4QS8A 3AARA 2OTLN 2W00A 5C15A 1KAZA 3N4QA 5BRHA 4IOCL 3T69A 3W3DA 3HTVA 4BRQA 3C7NA 3P39A 3SLCA 3CCRN 1K9MO 1GLEG 1T44A 5ADXH 4JEPA 3CMAN 4B1XB 1Q18A 4CZLA 1GLJO 2Q1NA 1NGDA 4XH5A 4CBXA 3OA9A 3VGMA 1BDGA 2QWPA 4EIAA 5FPDA 4EHTA 1YUWA 3CCSN 3O5BA 1NGAA 4FWKA 3QMLA 5JVHL 4WQ5A 3WXIA 5TKYA 5GAGP 3HSCA 3KK7A 5ELZA 3I33A 1VQ9N 2QM1A 1P8ZA 1QHAA 2BTFA 2NRRA 4FWQA 3ULEA 4GV6A 3VTHA 4BEBA 1NMDA 3VEVA 1SZ2A 3MMVA 4FL9A 3OBWA 2I7PA 2E2NA 5AQHA 3LDNA 1YIJN 4MDBA 5KPZA 2P9NB 2DPNA 2EWSA 3CERA 4IZ9A 4DHYA 4BGAA 1S3XA 3FR0A 1MWKA 3O6WA 1RFQA 3ATUA 3QBXA 3O1WA 4B1WB 2AP1A 5FPNA 4MO4A 3CCUN 4HTLA 4FSVA 4B1YB 3CPWM 4RWTA 2ZJPL 2J4RA 4U67L 5C2FA 2KHOA 1Z05A 2E1YA 3WXKA 3SK3A 2CH6A 4CI6A 2C1GA 2P9SB 4BRAA 5AQYA 3T7ZA 1EQYA 3CCQN 3HBTA 4M7YA 4FWRA 4A57A 2YCHA 3M1FA 1ZC6A 1HX1A 3VEOA 2QI2A 1IJJA 2VGNA 4GV3A 3FFKB 4BR4A 2NRWA 3BF1A 2FSJA 1Q81O 2ASMA 1VQ6N 1KAYA 2YX6A 2GEMA 4K42A 5AQFA 3F9MA 2IIRA 3U4LA 3MX5A 2IVPA 1VQ8N 5FPEA 1V4SA 4CBUA 1YI2N 4C1NI 2ZGZA 3A8YA 3O1BA 1HLUA 3H3NO 5CE3A 3EO3A 3WT0A 1W97L 3QBWA 1TUUA 4YOTA 4U7BA 1YF5L 4OO1J 3E66A 3AAQA 5AQPA 3EKSA 4IJNA 1Q7YO 3LL3A 3SAGA 5F1XA 2NRXA 4JKEA 4RTFD 2NLXA 1TUYA 1JCGA 3AAPA 4J8FA 4JKGB 3DLLL 4FWMA 3ENOA 3FZMA 4KH6A 2ITMA 2VCPA 4CJ7A 1GLLO 3L4QA 3SMPA 5AQNA 4CZGA 4JK7A 1X9JA 3CD6N 2ZF5O 4FWLA 4FWOA 3F5TA 4JKAA 3E9OA 4A2AA 3FE1A 4CZFA 1VAZA 3O9QA 2QTDA 3L4IA 3D2FB 2OTJN 2V7YA 3TTCA 2FXUA 4ISEA 1OVYA 1GLFO 2P9NA 3AY9A 2RHKA 4H5VA 5AQWA 5BPNA 2JWLA 1SAZA 3LDLA 4YORA 5BREA 5EVZA 4NB4A 2QXLA 4CD1A 5EOYA 4FWNA 3CI5A 1BU6O 3CCLN 2GWJA 4H5TA 2PFUA 5MLCQ 4JD2A 2D0PA 3LM2A 3ZETB 1C0FA 3DWLA 1BA1A 3CJ9A 4FWPA 1K73O 5AR0A 5JVGL 2F9WA 2HBMA 3CJ1A 3DXKB 3FZFA 1RDUA 3A5LC 3SBGA 4M63C 4L3QA 4EHUA 1BO5O 4HWIA 4IWVA 5AQXA 4BGBA 1VQPN 2QEXN 2E88A 3WXMB 5AQJA 3H1VX 4PKIA 5GAEP 5BPMA 2Q2RA 4WQ4A 2YJFA 1M90O 1P90A 4H03B 4BC3A 5M1FA 2QWRA 4H0TB 3U9DA 2QW9A 1W2BM 1NGHA 2YHWA 4NLBA 1Y64A 4JKBA 3KVGA 4BRFA 3ZX0A 4KH5A 3MN6A 5AQMA 5M1QA 1T6CA 1QVFM 1BOTO 5C10A 5I9EB 4K41A 3MDQA 2YHYA 1D4XA 4A59A 3GBTA 2ZJQL 2A3ZA 3C65A 5KPTA 5GADP 5AZJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6Z A;  4EAH D;  4JN4 A;  4NO7 A;  1WUA A;  3UKU B;  3H45 C;  1WOQ A;  2OAN A;  2FSN A;  1H1V A;  2HOE A;  3MCP A;  3O08 A;  4K43 A;  3D2F A;  4FWS A;  1ZXO A;  1KAX A;  2P9U B;  3VEN A;  4A62 A;  2CGL A;  3L6Q A;  3TU5 A;  3M3Z A;  3CHW A;  2UYT A;  5E84 A;  4H0V B;  4BC2 A;  4FPB A;  3R9P A;  3ZEU B;  3ZET A;  5KQD A;  5KQ8 A;  3GOI A;  3A0I X;  4H0O A;  2GUP A;  2VWB A;  3DXK A;  4EFH A;  2Q0U A;  5AQT A;  3WQU A;  3W0L A;  2QWN A;  3H1Q A;  4JD2 B;  1NGB A;  4JHD B;  3J8A A;  3D7E O;  5AQO A;  4BG9 A;  2FF3 B;  3CJA A;  1QZ5 A;  5AQL A;  5F2R A;  3VGK A;  3D2E B;  3HI0 A;  1NGJ A;  4BRI A;  3UKR A;  4K25 A;  2YJE A;  4FO0 A;  1MA9 B;  5JLF A;  4B9Q A;  2CH5 A;  5KPR A;  5JIC A;  1ESV A;  3FGU A;  2YHX A;  1YAG A;  4BR2 A;  2P9K B;  5AZJ A;  4XH4 A;  4AM6 A;  4I6M B;  4BRE A;  2CGJ A;  1U6Z A;  3UKU A;  3CET A;  2Q36 A;  4H0Y B;  3BUZ B;  5AQI A;  1HKB A;  3VEY A;  4PKH A;  1S22 A;  1OKJ A;  4FOI A;  3RSE B;  4FOE A;  3B8A X;  4CZH A;  5AFU A;  4AM7 A;  2P9U A;  4CD3 A;  5AQR A;  1CZA N;  3BEX A;  1QZ6 A;  3G25 A;  2V51 B;  3VOV A;  4YDU C;  4H5R A;  5AQV A;  4BRD A;  1LOT B;  3ZEU A;  3HM8 A;  3UB5 A;  5BPL A;  2FSK A;  3P4I A;  5BRF A;  2QWM A;  1G99 A;  2A5X A;  3CQX A;  3FZL A;  1DKG D;  4CZI A;  3VGL A;  5EY4 A;  1GLD G;  4MLH A;  3O80 A;  2HMP A;  3IFR A;  3A5M C;  3A5O C;  4JHD A;  4F9O A;  5BR9 A;  3MN5 A;  5LY3 A;  4BQL A;  3JXU A;  1IG8 A;  1K8K B;  3IUC A;  2E2P A;  4XH1 A;  5LJV A;  3D2E A;  4O5F A;  2E8A A;  3ZX2 A;  4QS7 A;  3ID8 A;  2QWQ A;  2VYP A;  3VER A;  3VPZ A;  4DCH A;  2A6A A;  4Z94 A;  2P9K A;  4C23 A;  3WXJ A;  4I6M A;  1JCE A;  3QFU A;  3UKR B;  1NGF A;  2V52 B;  3QIC A;  3H3O B;  1HKC A;  5AQQ A;  3O4W A;  4XEI A;  2D0O A;  3GL1 A;  1XC3 A;  2Q31 A;  3VF6 A;  5BRD A;  3VF2 A;  1ZBS A;  4BC4 A;  4BRN A;  4PL8 A;  3WXL A;  4PL7 A;  3CJ7 A;  1YXQ A;  4M7X A;  3RSE A;  4CZJ A;  2A42 A;  5AQK A;  4H5W A;  1QQM A;  2V7Z A;  4BG8 A;  4QS9 A;  4ISG A;  2Q0R A;  1NGI A;  1ATR A;  2D4W A;  3CIP A;  4GY2 B;  3CQY A;  1R59 O;  2ASP A;  2ZWH A;  3IMX A;  2BUP A;  1NWK A;  2GEL A;  5AFU H;  1MWM A;  2QWL A;  5AQS A;  2P9I B;  3VF4 A;  2FF6 A;  1KXP A;  3OHR A;  2FLO A;  3WEE B;  4BR0 A;  2WUS A;  5EX5 A;  3BP8 A;  3QFP A;  3SJH A;  5AQZ A;  2ZGY A;  3DAW A;  3O8M A;  5E26 A;  1GLA G;  2E2Q A;  4JNE A;  3C0B A;  2QWO A;  1K8K A;  1T6D A;  1NGG A;  3MN9 A;  4YDU A;  5JMV A;  1BUP A;  3U9Z A;  2D1K A;  1RDW X;  3FZH A;  4KBO A;  5F0X A;  3ENH A;  1X3M A;  2P9L B;  4B1V A;  1E4F T;  1BA0 A;  3LM9 A;  5B8H A;  4B1Z A;  5AQU A;  4CZE A;  4BRO A;  1HKG A;  4IXC A;  4WQ4 C;  2NRH A;  1MDU B;  3M6G A;  4BR7 A;  4B1U B;  2P9P B;  4RCH A;  3SMS A;  3S41 A;  1TYQ B;  4BRP A;  2H3G X;  5AQG A;  4H0X B;  3GDQ A;  1JCF A;  2NZT A;  5LJW A;  2E2O A;  1NBW A;  4O8K A;  4BVO A;  3DXM B;  1RGI A;  1BG3 A;  4BRM A;  3ZX3 A;  1DGK N;  2E20 A;  2IVN A;  2ASO A;  4IJA A;  2GTD A;  2Q97 A;  1HJO A;  4BR9 A;  2A40 A;  3LDP A;  4FPA A;  4GNI A;  4A61 A;  2P9I A;  4A2B A;  5JLH A;  1SQK A;  3VES A;  4BVP A;  3MN7 A;  3WEE A;  2HF3 A;  4ISF A;  4LC9 B;  3HZ6 A;  3U8X A;  3MK6 A;  1DEJ A;  2HF4 A;  3QB0 A;  3R8E A;  1U2V B;  1V4T A;  5ADX A;  3CJB A;  1XQS C;  1NLV A;  2AA4 A;  5AZI B;  1ATN A;  4IO8 A;  4WQ5 C;  3VEZ A;  4BQZ A;  4BR5 A;  3IDH A;  4CBW A;  3GE1 A;  1QQN A;  4DQ8 A;  3VEW A;  4BRL A;  3WUH A;  2P9L A;  4BRC A;  1NGE A;  3C7N B;  3LDQ A;  1ATS A;  1E4G T;  3EN9 A;  3FZK A;  4PKG A;  3H46 O;  3KHY A;  1NM1 A;  2P9P A;  1BWF O;  3CJC A;  3VEX A;  1TYQ A;  3TPQ A;  2E1Z A;  3KZB A;  2YI1 A;  4MLE A;  3BF3 A;  4MO5 A;  3FLC O;  3ULE B;  5EXW A;  1XUP O;  1QQO A;  4E1J A;  1HUX A;  3QDK A;  3WQT A;  3DXM A;  2P9S A;  1C0G A;  4Y0W A;  4H0P A;  2F9T A;  2PAV A;  3DJC A;  5BN8 A;  2W41 A;  2IVO A;  4BRG A;  3GG4 A;  4H5N A;  4DB3 A;  3LDO A;  4BRH A;  4WYB A;  2CGK A;  2PBD A;  3ATV A;  1NGC A;  4CZM A;  2W40 A;  3VET A;  3A5N C;  3I8B A;  4BRK A;  3EL2 A;  3UE5 A;  5FPM A;  4BC5 A;  2I7N A;  1GLB G;  1U2V A;  1YVN A;  1Z6R A;  3L0Q A;  1LCU A;  3EZW A;  5BN9 A;  3EKU A;  5AZI A;  3JS6 A;  4JAX A;  1GLC G;  3R6M A;  4CZK A;  3H6E A;  1X3N A;  1HPM A;  2A41 A;  2GWK A;  4QS8 A;  3AAR A;  1KAZ A;  5BRH A;  3W3D A;  3HTV A;  4BRQ A;  3C7N A;  3SLC A;  1GLE G;  1T44 A;  5ADX H;  4B1X B;  1Q18 A;  4CZL A;  1GLJ O;  2Q1N A;  1NGD A;  4XH5 A;  4CBX A;  3VGM A;  1BDG A;  2QWP A;  4EIA A;  5FPD A;  4EHT A;  1YUW A;  3O5B A;  1NGA A;  4FWK A;  3QML A;  4WQ5 A;  3WXI A;  5TKY A;  3HSC A;  5ELZ A;  3I33 A;  2QM1 A;  1P8Z A;  1QHA A;  2BTF A;  4FWQ A;  3ULE A;  1NMD A;  3VEV A;  1SZ2 A;  3MMV A;  4FL9 A;  2I7P A;  2E2N A;  5AQH A;  3LDN A;  5KPZ A;  2P9N B;  2DPN A;  2EWS A;  3CER A;  4IZ9 A;  4DHY A;  4BGA A;  1S3X A;  3FR0 A;  1MWK A;  3O6W A;  1RFQ A;  3ATU A;  3QBX A;  3O1W A;  4B1W B;  2AP1 A;  5FPN A;  4MO4 A;  4HTL A;  4FSV A;  4B1Y B;  4RWT A;  2J4R A;  2KHO A;  1Z05 A;  2E1Y A;  3WXK A;  3SK3 A;  2CH6 A;  4CI6 A;  2P9S B;  4BRA A;  5AQY A;  1EQY A;  3HBT A;  4M7Y A;  4FWR A;  2YCH A;  3M1F A;  1ZC6 A;  1HX1 A;  3VEO A;  1IJJ A;  3FFK B;  4BR4 A;  3BF1 A;  2FSJ A;  2ASM A;  1KAY A;  2GEM A;  4K42 A;  5AQF A;  3F9M A;  2IIR A;  3U4L A;  2IVP A;  5FPE A;  1V4S A;  4CBU A;  2ZGZ A;  3A8Y A;  3O1B A;  1HLU A;  3H3N O;  5CE3 A;  3EO3 A;  3WT0 A;  3QBW A;  1TUU A;  3AAQ A;  5AQP A;  3EKS A;  4IJN A;  3LL3 A;  5F1X A;  4RTF D;  2NLX A;  1TUY A;  1JCG A;  3AAP A;  4J8F A;  4FWM A;  3ENO A;  3FZM A;  2ITM A;  4CJ7 A;  2VCP A;  1GLL O;  3SMP A;  5AQN A;  4CZG A;  1X9J A;  2ZF5 O;  4FWL A;  4FWO A;  4A2A A;  3FE1 A;  4CZF A;  3L4I A;  3D2F B;  2V7Y A;  2FXU A;  4ISE A;  1GLF O;  2P9N A;  3AY9 A;  4H5V A;  5AQW A;  5BPN A;  1SAZ A;  3LDL A;  5BRE A;  5EVZ A;  4NB4 A;  2QXL A;  4CD1 A;  5EOY A;  4FWN A;  3CI5 A;  1BU6 O;  2GWJ A;  4H5T A;  4JD2 A;  2D0P A;  3LM2 A;  3ZET B;  1C0F A;  3DWL A;  1BA1 A;  3CJ9 A;  4FWP A;  5AR0 A;  2F9W A;  3DXK B;  3CJ1 A;  3FZF A;  3A5L C;  4M63 C;  4L3Q A;  4EHU A;  1BO5 O;  4HWI A;  4IWV A;  5AQX A;  4BGB A;  2E88 A;  5AQJ A;  3H1V X;  4PKI A;  5BPM A;  2Q2R A;  4WQ4 A;  2YJF A;  4H03 B;  4BC3 A;  2QWR A;  4H0T B;  3U9D A;  2QW9 A;  1NGH A;  2YHW A;  1Y64 A;  3KVG A;  4BRF A;  3ZX0 A;  3MN6 A;  5AQM A;  1T6C A;  1BOT O;  5I9E B;  4K41 A;  3MDQ A;  2YHY A;  1D4X A;  3GBT A;  2A3Z A;  5KPT A;  5AZJ B; 
#chains in the Genus database with same CATH topology
 1J6Z A;  4DR2 K;  1WUA A;  3UKU B;  1D8Y A;  4LF4 K;  1WOQ A;  3O3G A;  2F96 A;  3O08 A;  2QA4 N;  1SKW A;  4ILH A;  4JYA K;  1KAX A;  3VEN A;  4A62 A;  2CGL A;  3OBY A;  3AGK A;  1WSG A;  3M3Z A;  3CHW A;  4OJR A;  2UYT A;  2YNG A;  4Q5V A;  4FPB A;  3R9P A;  4JI0 K;  4OKK A;  4FM1 A;  5KQD A;  1XNQ K;  5HOO A;  3SAH A;  2Q0U A;  4QAG A;  1TGO A;  4CF9 A;  4A5B A;  4NCB A;  1NGB A;  4JHD B;  4WF9 L;  4BG9 A;  3O3H A;  4W5N A;  1QZ5 A;  3P83 D;  3F9K A;  4DR4 K;  1NKB A;  3HI0 A;  4E1M A;  4Z4C A;  1HNZ K;  2QXF A;  1S1X A;  1MA9 B;  5JLF A;  3IG1 A;  4CCH A;  2CH5 A;  3AVJ A;  3WNF A;  4Z4H A;  5JIC A;  5KPR A;  4LF6 K;  2P9K B;  5AZJ A;  3K5N A;  4DFJ A;  4I6M B;  3VQQ A;  4BRE A;  5J1E A;  1U6Z A;  3T3F A;  3CET A;  2G8K A;  2BE2 A;  5AQI A;  5M1N A;  1XNR K;  3VEY A;  1HQU A;  3N4P A;  1VQK N;  1OKJ A;  4YHH K;  1LW2 A;  3B8A X;  1RDB A;  5AFU A;  4CD3 A;  3KLF A;  1QZ6 A;  3G25 A;  3J7A P;  2V51 B;  4H5R A;  3SPZ A;  2G8V A;  4FLU A;  4JKH A;  1RCH A;  4BRD A;  4FLT A;  1D9F A;  1BL3 A;  1LOT B;  3ZEU A;  3QES A;  2HHS A;  3HP9 A;  2HHX A;  4Q0B A;  2FSK A;  1VRT A;  3CC4 N;  3MCA B;  4FZZ A;  3FZL A;  1DKG D;  1W7A A;  1BIU A;  4LFA K;  1GLD G;  3O80 A;  4F9O A;  5JS1 A;  1TKT A;  4DKW A;  2B6A A;  3AA2 A;  3IUC A;  2E2P A;  3QNO A;  2KKZ A;  4XH1 A;  1BGX T;  4NYF A;  4B9N A;  5J2N A;  4GKK K;  1GOA A;  4R79 A;  5HRS A;  3NH2 A;  4M3Y A;  3VER A;  3V6D A;  4DFP A;  4ID1 A;  4Z94 A;  2P1J A;  1VQ7 N;  4FJG A;  1TKX A;  3OS1 A;  3WXJ A;  3JSM A;  3NVK A;  1JCE A;  1S6Q A;  2KW4 A;  3C6H A;  3QIC A;  2UUB K;  3CC7 N;  2F7T A;  2OZM A;  3OJS A;  4XEI A;  3D6R A;  3VF6 A;  3B6O A;  2NRV A;  2VQF K;  4DR7 K;  3WXL A;  2VG5 A;  1LWE A;  3RSE A;  4CZJ A;  3TAN A;  5C0Y A;  4W5T A;  3RRH A;  2UXB K;  4CEB A;  1VQL N;  2D4W A;  3CIP A;  4GY2 B;  3WNG A;  2B4J A;  3K5O A;  4DG1 A;  3AO1 A;  2QWL A;  3TSP A;  1S1W A;  5JS2 A;  2ZM6 K;  3M8R A;  3HK2 A;  5EX5 A;  2PYL A;  4JI7 K;  3E9P A;  1KVA A;  2ZGY A;  3DAW A;  5E26 A;  1GLA G;  1YHQ N;  1NK5 A;  3OYF A;  1K8K A;  4CJL A;  5JMV A;  2F8T A;  2D1K A;  1RDW X;  3E01 A;  1S9E A;  4IEI A;  3F2K A;  1TK8 A;  4NXM K;  1VQ5 N;  3P38 A;  4YOW A;  3LM9 A;  3M5R A;  4BRO A;  4WQ4 C;  2D0C A;  5JEN A;  2QK9 A;  2X78 A;  4JRP A;  4DQI A;  1F21 A;  1MDU B;  3M6G A;  4BR7 A;  3CFP A;  2P9P B;  3HRG A;  1RTD A;  4RCH A;  4PY5 A;  3ZSR A;  3EZ5 A;  2H3G X;  3ITH A;  1NK4 A;  1HNW K;  4M3W A;  4DTJ A;  4NCG A;  1JCF A;  3KJV A;  5H1S Q;  4NXN K;  1NBW A;  2O8C B;  3OVN A;  4E1N A;  4W5O A;  2G8H A;  4CHO A;  3DXM B;  1BG3 A;  5IWA K;  1RBU A;  3KK1 A;  1NK9 A;  3ZX3 A;  1DGK N;  2ASO A;  2Q97 A;  4N76 A;  5LMN K;  3PX4 A;  1C1A A;  1HJO A;  3VN5 A;  4BR9 A;  2A40 A;  1Q86 O;  5JLH A;  1JLG A;  4JI5 K;  1J54 A;  4DUY K;  2YKN A;  3HZ6 A;  5CY4 A;  4FLY A;  4WCE L;  4N56 A;  1DEJ A;  2YHA A;  3AO5 A;  3R8E A;  1U2V B;  2Z1G A;  5ADX A;  5M1K A;  2O8B B;  3VEZ A;  3KLI A;  4CBW A;  3DRR A;  3SQ4 A;  5M1O A;  1SL2 A;  3S3N A;  2FC0 A;  1QQN A;  2UUA K;  3LPU A;  4BRC A;  4PQU A;  3C7N B;  2UXC K;  3PO5 A;  1ATS A;  1E4G T;  4Y1D A;  3ZSV A;  3ISN C;  1UA0 A;  4M3U A;  3FZK A;  3O9R A;  3AVH A;  2G8F A;  3BZC A;  1NM1 A;  1CZ9 A;  5DK5 A;  4HUE A;  4BEC A;  3R3L A;  4DU4 A;  4FVU A;  4HCB A;  3FLC O;  2HHU A;  3DLG A;  3QDK A;  1C0G A;  4M3R A;  4M42 A;  2F9T A;  3DJC A;  4KHN A;  2W41 A;  2IVO A;  3GG4 A;  1ASV A;  2IAJ A;  2KFZ A;  4BRH A;  1ZBH A;  1FK9 A;  1J9A A;  4AHC A;  3ATV A;  5HRN A;  3ID6 A;  3M8P A;  2R7Y A;  1NGC A;  4CZM A;  1YVU A;  4N41 A;  5M1P A;  3A5N C;  5T7B A;  4CHY A;  3ZSQ A;  1IO2 A;  3AVN A;  1GLB G;  3L0Q A;  1QSL A;  3PIO L;  5AZI A;  5SZT A;  4GW6 A;  4QCL A;  3R6M A;  3THW A;  2XY5 A;  3V1Q A;  1FKO A;  4BRQ A;  3H08 A;  3KIO A;  3CCR N;  1T44 A;  4JEP A;  2YHB A;  3J81 O;  4EIA A;  5FPD A;  4AQY K;  3CCS N;  3O5B A;  4FZX C;  5JVH L;  4FWK A;  3QML A;  5GAG P;  3V1R A;  4OKJ A;  2BTF A;  4FWQ A;  1BQM A;  4JI2 K;  1S5J A;  4KHU A;  3VEV A;  3OBW A;  2I7P A;  2E2N A;  3OTO K;  4B3T K;  2EWS A;  3CER A;  3BDP A;  1MWK A;  3EEQ A;  2VWK A;  3ATU A;  3O1W A;  3NCI A;  4CGH A;  3BZK A;  1HRH A;  4HTL A;  2AJQ A;  5C2F A;  1Z05 A;  2E1Y A;  1TAU A;  3SV4 A;  5J2Q A;  4CHZ A;  4KI4 A;  4KB1 A;  4FM2 A;  5CZ1 A;  3T19 A;  3T7Z A;  4CJK A;  1EQY A;  3HBT A;  4M7Y A;  4A57 A;  2RN2 A;  3M1F A;  1HX1 A;  3VA0 A;  3FFK B;  4BR4 A;  2NRW A;  1KRP A;  3HPG A;  1UWB A;  1Q81 O;  2ASM A;  1KAY A;  2YX6 A;  1A5V A;  4OLB A;  2JLE A;  4OGC A;  4K42 A;  4GMJ B;  3NAE A;  2OPS A;  1Z26 A;  3F9M A;  4FVM A;  2IIR A;  1VQ8 N;  1RT6 A;  4C1N I;  5CE3 A;  4DTS A;  4YOT A;  4U7B A;  1YF5 L;  3E66 A;  3AAQ A;  5AQP A;  4DV2 K;  3HVT A;  4RW6 A;  5F1X A;  4F2S A;  4CJ7 A;  3SMP A;  4CF0 A;  3CD6 N;  3OYC A;  2ZF5 O;  4FWL A;  4FWO A;  2D5R A;  4W5Q A;  1BCO A;  3AVL A;  3OYB A;  2Y1I A;  1VAZ A;  1HNV A;  4ISE A;  1OVY A;  3D45 A;  3HM9 A;  4CJ4 A;  3AY9 A;  5AQW A;  3SI6 A;  1JL2 A;  2X6S A;  5BRE A;  3C6T A;  5EVZ A;  1BQN A;  4BDZ A;  3PX0 A;  1VSH A;  1RT1 A;  3DLK A;  1T05 A;  3LM2 A;  1C0F A;  3DWL A;  3CJ9 A;  4B9T A;  5AR0 A;  3DI6 A;  3DXK B;  1RTI A;  3FZF A;  3SBG A;  4JRQ A;  1VSJ A;  4KTW A;  1O1W A;  3WXM B;  1M90 O;  4PKI A;  3L3V A;  5M1F A;  2QWR A;  4H0T B;  3S3O A;  1WB9 A;  2YHW A;  4NLB A;  3J7Y P;  4JKB A;  2NUB A;  3MEC A;  2KZZ A;  3KVG A;  3NBP A;  3MN6 A;  2ZQB A;  1EX4 A;  1T6C A;  1QVF M;  3DLE A;  4DTU A;  4DS5 A;  3C65 A;  2IDO A;  3F73 A;  4CFC A;  4CED A;  3H45 C;  1RTJ A;  3MCP A;  5IT9 O;  4AHU A;  2O4I A;  5FLX O;  4LFB K;  1OH8 A;  4FWS A;  3TTD A;  1ZXO A;  4CJ3 A;  4Z4F A;  3DLR A;  2FBT A;  3ZT3 A;  1QHT A;  4A5A A;  3TU5 A;  5CZ2 A;  3QET A;  3ZET A;  5KQ8 A;  3HST B;  1N32 K;  4CGJ A;  2VWB A;  3C6A A;  3W0L A;  2QWN A;  4DQR A;  1N34 K;  1L3U A;  3VQE A;  3KLH A;  3CG7 A;  1KC8 O;  4FLW A;  4J2D A;  2E6L A;  1Q9Y A;  4LFC K;  3J8A A;  2FF3 B;  4RW9 A;  5AQL A;  2OYQ A;  5F2R A;  3D2E B;  3I8D A;  3CM5 A;  5A2Q O;  2YJE A;  4FO0 A;  2GX9 A;  1BIZ A;  3K9K A;  3V1O A;  3TAR A;  2RE2 A;  3NMU A;  3I56 N;  1C6V A;  3FGU A;  2KQ2 A;  2O8D B;  1NJI O;  2YKM A;  4XH4 A;  4AM6 A;  2ZJR L;  4F2R A;  4PHT X;  2CGJ A;  4XJX A;  1JLB A;  3RR7 A;  4FK4 A;  3BUZ B;  4R5P A;  1HKB A;  2UUC K;  1WAJ A;  1Z25 A;  3NGZ A;  3MXJ A;  4K8Z A;  1WSJ A;  1RT7 A;  2FBV A;  2NNW A;  1L3S A;  2P9U A;  3G6E N;  5AQR A;  1T8E A;  2OZS A;  2NRZ A;  3BEX A;  4O5B A;  3AVA A;  4YDU C;  3PX6 A;  5FRO A;  4LF9 K;  1K8A O;  3QO9 A;  3V81 A;  5BPL A;  4LF7 K;  4FJ9 A;  3P4I A;  5BRF A;  2QWM A;  4QOZ B;  1G99 A;  2HNZ A;  3SAF A;  3ZT2 A;  1X9M A;  5HRR A;  5EY4 A;  4MLH A;  3J80 O;  4IKF A;  4BE2 A;  3S5T A;  3A5O C;  5BR9 A;  4BQL A;  4OX9 K;  3JXU A;  1RT3 A;  2P5G A;  4KFB A;  4C8N A;  2OPP A;  3ZT0 A;  5LJV A;  3ID8 A;  2HHI A;  4DCH A;  5HRP A;  4LH5 A;  5FRM A;  4Z4E A;  1S9G A;  3U3G A;  1UA1 A;  4YOU A;  5GIN A;  3SZ2 A;  3UKR B;  2V52 B;  4DU1 A;  5C2D A;  5AQQ A;  4LF8 K;  2D0O A;  1TVR A;  2Q31 A;  3HO1 A;  3MEE A;  1TL1 A;  4BRN A;  3AVM A;  3KWG A;  4JKD A;  4M7X A;  3CCE N;  1LWC A;  4CK2 A;  5AQK A;  4X62 K;  2O4G A;  1QQM A;  1JL1 A;  4E3S A;  2Q0R A;  3HT3 A;  5EU7 A;  4CGF A;  4J2E A;  3CQY A;  4IG3 A;  5GIP A;  2ZWH A;  1L5U A;  3IMX A;  2GEL A;  1NWK A;  1MWM A;  3VF4 A;  3CCV N;  2FF6 A;  3OYH A;  4O44 A;  5KRT A;  3QFP A;  2HST A;  5AQZ A;  4CFA A;  4CJW A;  1NK0 A;  1ILY A;  3O8M A;  4K0K K;  3TAB A;  5KRS A;  1NGG A;  4E19 A;  1BUP A;  3V9U A;  3U9Z A;  5DM6 L;  1R0A A;  1KVC A;  4IFV A;  3L2U A;  4KO0 A;  4FZY A;  4CES A;  4JI6 K;  5F0X A;  3OYE A;  2P5O A;  4DUZ K;  2P9L B;  3AA5 X;  1E4F T;  1RDD A;  1TKZ A;  3LWL A;  3S9H A;  1REV A;  4B9U A;  2VQE K;  4CZE A;  1HKG A;  2NRH A;  1J5O A;  4DSF A;  3I55 N;  4B1U B;  4AHS A;  3TTF A;  4FYD A;  4YOY A;  4FJJ A;  1WN7 A;  1JLQ A;  1KVB A;  3DRS A;  4CF2 A;  4FLX A;  4BVO A;  1RGI A;  2E20 A;  2IVN A;  1X9W A;  1NK8 A;  4JLH A;  4DSJ A;  2NRT A;  3S3M A;  4FCY A;  2HHQ A;  1FW6 A;  2P9I A;  3K9J A;  1SQK A;  3VES A;  3VQ7 A;  3QIP A;  3WEE A;  4JI1 K;  1VSL A;  1QSY A;  3O9U A;  3EY1 A;  1QSS A;  1VSI A;  4CE9 A;  1YTA A;  3PV8 A;  3WNE A;  4IO8 A;  3PIP L;  4G1Q A;  4PWD A;  3THX B;  3VEW A;  1N8R O;  1NGE A;  1XHX A;  1FJG K;  3ASM A;  3HXM A;  3OW2 M;  4PKG A;  2GV9 A;  3BY5 A;  1BWF O;  3CJC A;  1TYQ A;  3TPQ A;  3RMA A;  2E1Z A;  2DFH A;  3KZB A;  1VQ4 N;  2YI1 A;  3VQ4 A;  4DR6 K;  3BF3 A;  2W6L A;  4KHS A;  5EXW A;  5KTQ A;  4DTX A;  1QQO A;  2I5J A;  1KFS A;  4H0P A;  3PUF A;  4CJ5 A;  5BN8 A;  4BRG A;  4H5N A;  5FDL A;  1WSH A;  4DV1 K;  3AVB A;  3PSF A;  4K8X A;  1JJ2 M;  4CEC A;  5TKW A;  1HYS A;  4KHY A;  3I8B A;  5FPM A;  1SKR A;  1YVN A;  1Z6R A;  4GVE A;  3B6P A;  3EZW A;  3NF9 A;  3EKU A;  1NK6 A;  1UAX A;  4CZK A;  4EP4 A;  4BDP A;  4FJK A;  1KAZ A;  3N4Q A;  5BRH A;  4IOC L;  3KTQ A;  3T69 A;  3W3D A;  2Z1H A;  3SLC A;  1K9M O;  1GLE G;  4C8K A;  1Q18 A;  2PYJ A;  2Q1N A;  1C0T A;  1NGD A;  2XY7 A;  4F3O A;  4LY7 A;  1BDG A;  2A1R A;  2HNY A;  2QWP A;  4HTU A;  1NU0 A;  1NGA A;  3WXI A;  3HSC A;  3KK7 A;  5ELZ A;  3BGR A;  3I33 A;  3RMD A;  3THY B;  3ZSO A;  1QHA A;  2NRR A;  4BEB A;  1T03 A;  3ULE A;  4M41 A;  3VTH A;  3KD1 E;  1SZ2 A;  3MMV A;  4FL9 A;  3ALY A;  3VQD A;  1HPZ A;  4IZ9 A;  4E7L A;  3OYA A;  3O6W A;  1B92 A;  1NJX A;  4BE0 A;  4AHT A;  4KTZ A;  3CCU N;  4FSV A;  4B1Y B;  3VA3 A;  4RWT A;  3SYZ A;  2J4R A;  2O8E A;  3WXK A;  3SK3 A;  3VQP A;  4BRA A;  4DTM A;  2A1S A;  3OYD A;  3NGY A;  2YCH A;  3K0S A;  1ZC6 A;  3VEO A;  2QI2 A;  1IJJ A;  2VGN A;  3OYK A;  2VG7 A;  4FJX A;  4H4O A;  1VRU A;  3O3F A;  3U4L A;  3QLH A;  1BI4 A;  4CBU A;  3KKR A;  3VQB A;  3O1B A;  1HLU A;  4KTQ A;  1HQE A;  2JGU A;  1W97 L;  3QBW A;  3DOK A;  4JI3 K;  4CK1 A;  1Q7Y O;  1TUY A;  1JCG A;  3DLL L;  3QIN A;  3ZSW A;  3ENO A;  1JXE A;  3FZM A;  3HL8 A;  3L4Q A;  3F5T A;  4JKA A;  3E9O A;  4A2A A;  2QTD A;  4KV8 A;  2WON A;  3TTC A;  4F3T A;  2FXU A;  4OVL A;  2P9N A;  2RHK A;  2KTQ A;  1S1T A;  3LP3 A;  4H5V A;  1SAZ A;  3LDL A;  3NF7 A;  5DMR A;  2QXL A;  5EOY A;  3IAY A;  3CI5 A;  4B9L A;  2D0P A;  5AJ3 K;  1BA1 A;  4KHQ A;  1I39 A;  5JVG L;  2YNI A;  2F9W A;  3CJ1 A;  4N47 A;  4M63 C;  4EHU A;  4BGB A;  4HWI A;  4OGE A;  2Q2R A;  3AV9 A;  1X9S A;  2O8F A;  3AVC A;  3U9D A;  1W2B M;  1S1U A;  2ATQ A;  4KH5 A;  4DV6 K;  1CLQ A;  2HVH A;  3K58 A;  1BOT O;  5C10 A;  5I9E B;  5HRO A;  1RT5 A;  5I42 A;  1D4X A;  5BR8 K;  2ZJQ L;  1OH6 A;  2A3Z A;  4CEZ A;  5KPT A;  4YOV A;  5AZJ B;  4JN4 A;  4CF1 A;  1N33 K;  4IEE A;  4NO7 A;  3OS0 A;  3OS2 A;  4DMN A;  4JKG A;  1HYV A;  2OAN A;  2G8I A;  1H1V A;  2KFN A;  1G15 A;  3WNH A;  1IBL K;  2OPR A;  4DLG A;  5LL6 Z;  4BWM A;  5GAH P;  3D2F A;  1RTH A;  1K6Y A;  1HYZ A;  3OYL A;  5C12 A;  3DOL A;  4OPA A;  3CCJ N;  4V19 S;  1U47 A;  1VSM A;  1EO1 A;  3L6Q A;  1XI1 A;  1YJW N;  1YIT N;  5E84 A;  2DFF A;  4I9L A;  3NDK A;  1DT9 A;  3ZEU B;  4AH9 A;  4NYN A;  3GOI A;  2PY5 A;  2GUP A;  4EFH A;  4JKC A;  4B3M K;  1Y97 A;  4ZTJ A;  4FK2 A;  1OVQ A;  4KAZ A;  3TAQ A;  1QS4 A;  1A5X A;  3C6U A;  3AVK A;  3VGK A;  1NGJ A;  4BRI A;  3MX2 A;  3UKR A;  3ULD A;  1BHL A;  4B9Q A;  4CGI A;  1ZBU A;  1ESV A;  1RBS A;  2IOC A;  4BR2 A;  3CC2 N;  4B08 A;  3UKU A;  2Q36 A;  3KK2 A;  2GUI A;  1B9D A;  2EHG A;  1S22 A;  1VQM N;  3CXC M;  4IDK A;  2Z1I A;  2OPQ A;  4FOI A;  4H4M A;  3RSE B;  3IS9 A;  2IC3 A;  3L3U A;  4AM7 A;  3VQA A;  4CFD A;  1VK0 A;  4Z0U A;  4CZH A;  1CZA N;  2RKI A;  3E1Y A;  4O8U A;  3G71 N;  4ID5 A;  1GOB A;  4CGD A;  1XMO K;  2IGI A;  4YY3 K;  1WSE A;  3HM8 A;  1VHX A;  4GV9 A;  2HBK A;  1DTQ A;  3KWI A;  3LZI A;  4C1N K;  4DR3 K;  3I0S A;  1RNH A;  2A5X A;  2VG6 A;  3CQX A;  4ILJ A;  2D0B A;  3CFR A;  4FJI A;  4CZI A;  3NVM A;  4DTN A;  1QTM A;  2ZD1 A;  4WFA L;  3IFR A;  5LY3 A;  4JHD A;  3NH1 A;  2G8W A;  5HLF A;  2QKK A;  3VQ5 A;  4CJT A;  4FW1 A;  4JS4 A;  4HUF A;  1LAW A;  1K8K B;  4EZ9 A;  3MXI A;  1WSI A;  4CEF A;  4FJM A;  1TAQ A;  4FJ7 A;  4QS7 A;  2QWQ A;  1KTQ A;  1EXQ A;  2P9K A;  3TSQ A;  4I6M A;  4C8O A;  4UQG A;  1ZBF A;  4E0D A;  1N5Y A;  1NGF A;  2ITG A;  1HKC A;  1C0M A;  3O4W A;  3GL1 A;  2X6N A;  5BRD A;  3K5L A;  3VF2 A;  4BC4 A;  4PL8 A;  4MQ3 A;  2XRI A;  4JKF A;  4RW4 A;  4PL7 A;  2DY4 A;  1YXQ A;  2QKB A;  2A42 A;  3R1X A;  3PY8 A;  1YJ9 N;  2V7Z A;  4BG8 A;  4QS9 A;  2HND A;  3CFO A;  1RT4 A;  4B8A B;  4DQQ A;  1NGI A;  1ATR A;  4KHW A;  3HOS A;  4X64 K;  1R59 O;  2ASP A;  2ETJ A;  3UIQ A;  1L3T A;  5E41 A;  4WE1 A;  1W9H A;  3AGR A;  1DTT A;  3IRX A;  2FLO A;  3OHR A;  5CR4 A;  4BR0 A;  4CK3 A;  1XWL A;  2Q3S A;  4JK9 A;  1KCF A;  4RW7 A;  4JNE A;  3C0B A;  3OJU A;  1KQS M;  4YDU A;  4DTO A;  4O0J A;  4HHT A;  3FZH A;  5C42 A;  4KBO A;  5K14 A;  3ENH A;  1X3M A;  1XHZ A;  4ICL A;  3SJJ A;  2OA8 A;  3CM6 A;  1OH5 A;  4DV5 K;  4CEA A;  2B5J A;  4LD0 A;  4FJ5 A;  4CEE A;  4M45 A;  5AQU A;  4DLE A;  4DU3 A;  4IXC A;  3ZSY A;  5KGX A;  3TAF A;  3RR8 A;  4J2A A;  5SWM A;  4IO9 L;  4KRF A;  4IOX A;  1NNE A;  4FK0 A;  1VSD A;  4CVN E;  3S41 A;  4BRP A;  1T7P A;  4CHP A;  4LSL A;  1Q82 O;  4FJN A;  1IKW A;  2NZT A;  3IKM A;  2GBZ A;  4IG0 A;  5LJW A;  2E2O A;  3O9S A;  5HL7 L;  4BY9 C;  3NF6 A;  4OPH A;  3J7Z O;  2BH1 A;  4YOX A;  4IJA A;  1RT2 A;  3TI0 A;  3P31 A;  2VWJ A;  3AO3 A;  3LDP A;  4C8L A;  3HPH A;  4E7K A;  4GNI A;  4A61 A;  2HHT A;  4W5R A;  4BVP A;  2HF3 A;  3TWH A;  4IFY A;  3U8X A;  3DYA A;  1U49 A;  3MK6 A;  4CFB A;  2HF4 A;  1TK5 A;  1V4T A;  1NLV A;  3K2P A;  4KRE A;  5AZI B;  1ATN A;  4WQ5 C;  4BQZ A;  1VSE A;  4BR5 A;  4O4G A;  1M1K O;  3THW B;  3PLA A;  3AO4 A;  4DQ8 A;  3EE9 A;  4FJH A;  1YT3 A;  3U3Y A;  4BRL A;  3WUH A;  4MFB A;  4ELU A;  4DV7 K;  3QEX A;  3EN9 A;  3TSU A;  1Q8I A;  4B3S K;  3KLG A;  1L3V A;  2P9P A;  3OYJ A;  2W42 A;  4CJS A;  2FBX A;  1C1B A;  1IKY A;  4E7H A;  4MLE A;  4DS4 A;  1ASU A;  2O8C A;  1XUP O;  4FLZ A;  4Z4I A;  3WQT A;  3DXM A;  2BDP A;  1A5W A;  4FW2 A;  2PAV A;  2X74 A;  3SUQ A;  3Q7C A;  3Q7B A;  1KLN A;  1SS6 A;  4B8C A;  2CGK A;  3EE8 A;  2W40 A;  4IOA L;  2F4V K;  3LAL A;  2D0A A;  2C1I A;  4BRK A;  1GOC A;  2WTU A;  4IDH A;  4DWI A;  1CXQ A;  2KLA A;  1U2V A;  1S6P A;  1LCU A;  1DLO A;  5BN9 A;  2O8B A;  4M3X A;  1IBM K;  4JAX A;  5C25 A;  1X3N A;  3SCX A;  1HPM A;  2A41 A;  2GWK A;  2OTL N;  3P1G A;  1IG9 A;  5C15 A;  3HTV A;  3C7N A;  3P39 A;  4DQP A;  1JLE A;  3CMA N;  4B1X B;  1NJZ A;  1ZBI A;  4CZL A;  1SV5 A;  3U6F A;  4CBX A;  3OA9 A;  1WBB A;  4E72 A;  1CXU A;  1YUW A;  3DMJ A;  4ZTF A;  3SUP A;  3RMC A;  2HB5 A;  2ZE2 A;  1RDC A;  4GV6 A;  1NOY A;  3PSI A;  5AQH A;  1WNS A;  3ZCM A;  4DHY A;  3KLE A;  4BGA A;  5C24 A;  5HP1 A;  4B3O A;  3L2V A;  3RWU A;  2AP1 A;  2ZJP L;  3SQ0 A;  4CF8 A;  2CH6 A;  4CI6 A;  2C1G A;  2P9S B;  1J53 A;  3NF8 A;  5AQY A;  4OKE A;  3T1H K;  4I2Q A;  2F8S A;  3OYN A;  5D3G A;  3V9Z A;  3BF1 A;  4BWJ A;  1TK0 A;  2GEM A;  3MEG A;  5AQF A;  4CJR A;  2IVP A;  3QEW A;  3I0R A;  1I94 K;  2ZGZ A;  3A8Y A;  3H3N O;  3WT0 A;  4CEQ A;  4B9M A;  1TUU A;  3CYM A;  3KD5 E;  1KLM A;  3EKS A;  3AVF A;  3A2F A;  4RTF D;  3G10 A;  3ZT1 A;  4J8F A;  3AAP A;  4KH6 A;  1GLL O;  1X9J A;  2LSN A;  3LAK A;  1EWQ A;  4AHR A;  3FE1 A;  3MAQ A;  3L4I A;  3C94 A;  3QEP A;  1GLF O;  2JWL A;  3RMB A;  3M8S A;  4NB4 A;  1RBV A;  4CD1 A;  4FWN A;  1VSK A;  2UU9 K;  3KKS A;  3ZET B;  3HYF A;  3OY9 A;  4FWP A;  1EET A;  4DTP A;  3K59 A;  2HBM A;  1HR0 K;  1I3A A;  3A5L C;  3PO4 A;  3AO2 A;  3QEI A;  4L3Q A;  1BO5 O;  4IWV A;  4E7I A;  2QEX N;  4DQS A;  1VQP N;  2E88 A;  3K5M A;  5GAE P;  3H1V X;  2YV0 X;  4WQ4 A;  4CEO A;  3DLB A;  1P90 A;  3L2R A;  4DR1 K;  2QW9 A;  1NGH A;  4DV0 K;  4BRF A;  5AQM A;  4CJQ A;  5M1Q A;  1MU2 A;  3ZLJ A;  1U04 A;  2BAN A;  3SUN A;  3LDS A;  3MDQ A;  1SUQ A;  3DRP A;  3AVI A;  5GAD P;  4EAH D;  4NLC A;  2FSN A;  2HOE A;  4AIL C;  4K43 A;  4FJL A;  4MDA A;  2UXD K;  2P9U B;  3VQ8 A;  4BAC A;  4IFE A;  3SBT A;  1IKV A;  4EZ6 A;  4H0V B;  4BC2 A;  2G8U A;  4Y1C A;  2KZM A;  3A0I X;  4H0O A;  1NJW A;  3LP1 A;  3DXK A;  4JI4 K;  3RVC A;  1JLF A;  5AQT A;  3WQU A;  4DFK A;  1HNX K;  3O9T A;  2HW3 A;  1TL3 A;  3H1Q A;  4AF1 A;  3L8B A;  5J2M A;  4JD2 B;  3D7E O;  5AQO A;  2HMI A;  3CJA A;  3DLH A;  3TAP A;  4DSE A;  2WBN A;  4K25 A;  1S72 N;  3V9W A;  2HVI A;  3AA4 A;  5DM7 L;  2YHX A;  1YAG A;  4XIU A;  4KH4 A;  3CPE A;  2WC9 A;  3VQ6 A;  4YFU A;  3TR8 A;  4H0Y B;  2DFE A;  3T1Y K;  3SNN A;  5CHI A;  4PKH A;  1U48 A;  1VSF A;  3HOT A;  1U4B A;  4FOE A;  1RDA A;  3KK3 A;  3VOV A;  5AQV A;  4DSI A;  4TSX A;  2DTU A;  2HHW A;  3FFI A;  1C1C A;  3O4Q A;  1VQO N;  3K57 A;  2Y1J A;  3UB5 A;  4JK8 A;  3VTI A;  4N5S A;  1YTU A;  4RW8 A;  5I3U A;  3AA3 A;  3VGL A;  4BDY A;  2XY6 A;  1IKX A;  2HMP A;  5GIO A;  3A5M C;  1HNI A;  3MN5 A;  4DR5 K;  2Z1J A;  1IG8 A;  1WBD A;  2RF2 A;  4UY8 O;  3O4N A;  1NKC A;  3D2E A;  4O5F A;  1T3V A;  4FLV A;  4DSL A;  2E8A A;  1NOZ A;  3ZX2 A;  3TAG A;  4DV4 K;  4AHV A;  3QIO A;  4ILG B;  2VYP A;  3VPZ A;  2A6A A;  2O8D A;  3CME N;  4C23 A;  3QFU A;  4Z4G A;  4ELT A;  4FM0 A;  3H3O B;  1YJN N;  1XC3 A;  1ZBS A;  1IH7 A;  4B9V A;  1WLJ A;  4WFB L;  3CJ7 A;  4DF4 A;  3LAN A;  3NHG A;  3E9L A;  1O13 A;  3HPO A;  3M8Q A;  4H5W A;  4ISG A;  4E89 A;  1KD1 O;  3JYT A;  3CCM N;  2BUP A;  5AFU H;  3VMF B;  5AQS A;  2P9I B;  3QEV A;  1KXP A;  3WEE B;  4GKJ K;  2WUS A;  3V9X A;  4G9Z A;  4CIE A;  3BP8 A;  1LAV A;  3SJH A;  3G4S N;  3L2W A;  2E2Q A;  1UOC A;  2HHV A;  2QWO A;  3TAM A;  1T6D A;  3MN9 A;  4IBN A;  4J2B A;  1JLC A;  1HJR A;  2VGM A;  1N36 K;  1EWR A;  2WFB A;  2HBJ A;  4B1V A;  1BA0 A;  1SL0 A;  5B8H A;  4B1Z A;  4YNQ A;  4LF5 K;  4CGG A;  5FRN A;  2HHH K;  3MWT A;  4L8R B;  3SUO A;  3SMS A;  1TYQ B;  4CHN A;  4KHP K;  3ENB A;  5AQG A;  4H0X B;  3CF5 L;  3GDQ A;  3OYM A;  2XY8 A;  4KKO A;  2WOM A;  4O8K A;  4CJE A;  1XMQ K;  1D5A A;  4BRM A;  2GTD A;  2IS3 A;  2E5L K;  1ASW A;  1JXB A;  3HVR A;  4FPA A;  4LSN A;  3OYI A;  3NFA A;  3ZYY X;  4A2B A;  2JWK A;  4I9Q A;  3MN7 A;  4ISF A;  3EYZ A;  4LC9 B;  2FBY A;  5J2P A;  1NKE A;  3QB0 A;  3NE6 A;  3CJB A;  1XQS C;  4KB0 A;  2AA4 A;  3IDH A;  4H8K A;  3GE1 A;  3AVG A;  4JS5 A;  4CJU A;  5KGW A;  3JAM O;  2P9L A;  3C95 A;  1RBR A;  3ZT4 A;  4M3T A;  3LDQ A;  4I7F A;  4DV3 K;  3OYG A;  1QE1 A;  2W6K A;  3ZSZ A;  1S1V A;  3LPT A;  1SL1 A;  3VQC A;  4CER A;  1QVG M;  3H46 O;  3KHY A;  3VEX A;  4DF8 A;  4GVM A;  4PUO A;  2XO7 A;  3QER A;  3SQ1 A;  4MO5 A;  3ULE B;  2EX3 A;  3QNN A;  4E1J A;  1VQN N;  1HUX A;  4OPJ A;  3HP6 A;  1TV6 A;  2P9S A;  4Y0W A;  2YNH A;  3RRG A;  4KPY A;  3ZSX A;  4DB3 A;  3LP2 A;  3LDO A;  5CYQ A;  4FXD A;  4WYB A;  2O8E B;  3SQ2 A;  2PBD A;  4HVJ A;  1LW0 A;  4B3R K;  4O55 A;  3MXM A;  1BIS A;  4BE7 B;  1XC9 A;  2HBL A;  1LWF A;  3MWP A;  3VET A;  4HUG A;  3EL2 A;  3UE5 A;  4BC5 A;  2I7N A;  4B9S A;  3TAE A;  1BCM A;  5HBM A;  3JS6 A;  4CW7 B;  1GLC G;  3H6E A;  4WFN L;  1B9F A;  3AAR A;  4QS8 A;  3THX A;  2W00 A;  1BI4 B;  1X1P A;  4LH4 A;  4RG8 A;  4CJV A;  3DM2 A;  5ADX H;  3G0Z A;  1FXX A;  1C0U A;  4ELV A;  4JV5 K;  1GLJ O;  4ZHR A;  4XH5 A;  1RBT A;  3VGM A;  1N6Q A;  4EHT A;  1E3M A;  1NG9 A;  3SPY A;  1W0H A;  4WQ5 A;  5TKY A;  4HCC A;  4CIF A;  1VQ9 N;  2E4L A;  2QM1 A;  1U45 A;  1P8Z A;  1NMN A;  4DSK A;  1NMD A;  4X65 K;  3LDN A;  1YIJ N;  4X66 K;  4MDB A;  5KPZ A;  2P9N B;  2DPN A;  3D0P A;  1KFD A;  1S3X A;  3FR0 A;  1NJY A;  1RFQ A;  2PZS A;  3QBX A;  1OH7 A;  4B1W B;  2E6M A;  5FPN A;  4MO4 A;  5LMU K;  3CPW M;  4U67 L;  2KHO A;  3LZJ A;  1JKH A;  4CHQ A;  4E7J A;  4EP5 A;  5CYM A;  3CCQ N;  4FWR A;  1KSP A;  4PA1 A;  4GV3 A;  1ZYQ A;  1J5E K;  4BE1 A;  2O8F B;  3V9S A;  3HJF A;  3NGI A;  2RPI A;  1JLA A;  2FSJ A;  1VQ6 N;  4M3Z A;  2XHB A;  1LV5 A;  4F4K A;  1HMV A;  1D9D A;  4I2P A;  3MX5 A;  4JI8 K;  5FPE A;  1V4S A;  4F8R A;  1YI2 N;  3P5J A;  2YNF A;  3EO3 A;  3LP0 A;  4NCA A;  1EKE A;  4KI6 A;  4OO1 J;  4IJN A;  3LL3 A;  3LAM A;  3SAG A;  2NRX A;  4JKE A;  4DFM A;  2NLX A;  5KI6 A;  4JKG B;  4FWM A;  2ITM A;  2VCP A;  5AQN A;  4CZG A;  4JK7 A;  3SV3 A;  4OLA A;  4DTR A;  1CZB A;  4CJP A;  1NK7 A;  4CZF A;  3THY A;  3O9Q A;  3D2F B;  2OTJ N;  2V7Y A;  4CIG A;  1ZBL A;  5BPN A;  4FJ8 A;  4YOR A;  1IV0 A;  2OCE A;  1BU6 O;  4CJF A;  3THV A;  3V4I A;  2P51 A;  3NH0 A;  3CCL N;  2GWJ A;  4H5T A;  2PFU A;  5MLC Q;  4JD2 A;  3LWM A;  1K73 O;  1WSF A;  3MED A;  1RDU A;  4O0I A;  1IBK K;  5AQX A;  1FKP A;  2BGG A;  3CYG A;  5AQJ A;  5BPM A;  1WAF A;  2YJF A;  4H03 B;  4BC3 A;  3CQ8 A;  3L2Q A;  1Y64 A;  3RTV A;  3ZX0 A;  1QQC A;  4OPK A;  1SKS A;  1TKD A;  1EP4 A;  1Q9X A;  1ITG A;  4K41 A;  4C8M A;  3VQ9 A;  2YHY A;  4A59 A;  1RIL A;  3GBT A;  3T1A A; 
#chains in the Genus database with same CATH homology
 1J6Z A;  4EAH D;  4JN4 A;  4IEE A;  4NO7 A;  1WUA A;  3UKU B;  4JKG A;  4NLC A;  3H45 C;  1WOQ A;  2OAN A;  2FSN A;  1H1V A;  2HOE A;  3MCP A;  3O08 A;  2QA4 N;  4K43 A;  5GAH P;  3D2F A;  4FWS A;  4ILH A;  3TTD A;  1ZXO A;  4MDA A;  5C12 A;  4OPA A;  3CCJ N;  1KAX A;  2P9U B;  3VEN A;  4A62 A;  2CGL A;  3OBY A;  1EO1 A;  3L6Q A;  3AGK A;  4A5A A;  3TU5 A;  4IFE A;  3M3Z A;  3SBT A;  1YJW N;  3CHW A;  1YIT N;  2UYT A;  5E84 A;  4H0V B;  4BC2 A;  4FPB A;  3R9P A;  1DT9 A;  3ZEU B;  3ZET A;  5KQD A;  5KQ8 A;  3GOI A;  3A0I X;  5HOO A;  4H0O A;  3SAH A;  2GUP A;  2VWB A;  3C6A A;  3DXK A;  4JKC A;  2Q0U A;  4EFH A;  3RVC A;  5AQT A;  3WQU A;  3W0L A;  2QWN A;  3O9T A;  3H1Q A;  4AF1 A;  1KC8 O;  4A5B A;  4JD2 B;  1NGB A;  4JHD B;  4WF9 L;  3J8A A;  3D7E O;  5AQO A;  4BG9 A;  2FF3 B;  3CJA A;  1QZ5 A;  5AQL A;  5F2R A;  3VGK A;  3D2E B;  3HI0 A;  1NGJ A;  4BRI A;  2WBN A;  3MX2 A;  3UKR A;  4K25 A;  1S72 N;  2YJE A;  4FO0 A;  1MA9 B;  5JLF A;  4B9Q A;  2GX9 A;  2CH5 A;  3K9K A;  5KPR A;  5JIC A;  2RE2 A;  3NMU A;  5DM7 L;  3I56 N;  1ESV A;  3FGU A;  2YHX A;  1YAG A;  4BR2 A;  3CC2 N;  1NJI O;  2P9K B;  4KH4 A;  4XH4 A;  4AM6 A;  5AZJ A;  2ZJR L;  3CPE A;  2WC9 A;  4I6M B;  4BRE A;  4PHT X;  2CGJ A;  4XJX A;  1U6Z A;  3UKU A;  3CET A;  2Q36 A;  4H0Y B;  3BUZ B;  5AQI A;  5M1N A;  1HKB A;  3VEY A;  3N4P A;  5CHI A;  4PKH A;  1S22 A;  1VQM N;  1VQK N;  1OKJ A;  3CXC M;  3HOT A;  4YOV A;  4FOI A;  3RSE B;  4FOE A;  3B8A X;  4CZH A;  5AFU A;  2NNW A;  4AM7 A;  2P9U A;  4CD3 A;  3G6E N;  5AQR A;  1CZA N;  2NRZ A;  3BEX A;  1QZ6 A;  3E1Y A;  3G25 A;  4O8U A;  2V51 B;  3VOV A;  4YDU C;  4H5R A;  5AQV A;  3G71 N;  4JKH A;  4BRD A;  1K8A O;  1LOT B;  3ZEU A;  3HM8 A;  4GV9 A;  1VQO N;  3UB5 A;  4JK8 A;  5BPL A;  2FSK A;  2HBK A;  3P4I A;  3KWI A;  5BRF A;  2QWM A;  4C1N K;  3CC4 N;  1G99 A;  2A5X A;  3CQX A;  3MCA B;  4ILJ A;  3VTI A;  3SAF A;  3FZL A;  1DKG D;  4CZI A;  3NVM A;  3VGL A;  5EY4 A;  1GLD G;  4MLH A;  4WFA L;  3O80 A;  2HMP A;  3IFR A;  5GIO A;  3A5M C;  3A5O C;  4JHD A;  4F9O A;  5BR9 A;  3MN5 A;  5LY3 A;  4BQL A;  3JXU A;  4DKW A;  1IG8 A;  1K8K B;  3IUC A;  2E2P A;  2KKZ A;  4XH1 A;  4UY8 O;  5LJV A;  3D2E A;  4O5F A;  1T3V A;  2E8A A;  3ZX2 A;  4R79 A;  4QS7 A;  3ID8 A;  4ILG B;  2QWQ A;  2VYP A;  3VER A;  3VPZ A;  4DCH A;  2A6A A;  4Z94 A;  3CME N;  2P9K A;  4C23 A;  1VQ7 N;  3WXJ A;  3TSQ A;  4I6M A;  3NVK A;  1JCE A;  4YOU A;  5GIN A;  3QFU A;  3UKR B;  1NGF A;  2V52 B;  3C6H A;  3QIC A;  5C2D A;  3H3O B;  3CC7 N;  2F7T A;  1HKC A;  5AQQ A;  1YJN N;  3O4W A;  4XEI A;  2D0O A;  3GL1 A;  1XC3 A;  3D6R A;  2Q31 A;  3VF6 A;  5BRD A;  3VF2 A;  1ZBS A;  4BC4 A;  2NRV A;  4PL8 A;  4BRN A;  3WXL A;  4JKF A;  3KWG A;  3CJ7 A;  4PL7 A;  4JKD A;  4WFB L;  1YXQ A;  4M7X A;  3RSE A;  3CCE N;  4CZJ A;  3E9L A;  2A42 A;  1O13 A;  3R1X A;  5AQK A;  4H5W A;  1QQM A;  1YJ9 N;  2V7Z A;  4BG8 A;  5C0Y A;  4QS9 A;  4ISG A;  2Q0R A;  1KD1 O;  1VQL N;  1NGI A;  1ATR A;  2D4W A;  3CIP A;  4GY2 B;  3HOS A;  3CCM N;  3CQY A;  5GIP A;  1R59 O;  2ASP A;  2ZWH A;  3IMX A;  2BUP A;  1NWK A;  2GEL A;  5AFU H;  1MWM A;  3VMF B;  3TSP A;  2QWL A;  5AQS A;  2P9I B;  3VF4 A;  3CCV N;  2FF6 A;  1KXP A;  3AGR A;  3OHR A;  5CR4 A;  2FLO A;  3WEE B;  4BR0 A;  2WUS A;  5EX5 A;  4G9Z A;  3BP8 A;  3QFP A;  2HST A;  5AQZ A;  3SJH A;  3E9P A;  3G4S N;  2ZGY A;  1ILY A;  3DAW A;  3O8M A;  4JK9 A;  5E26 A;  1GLA G;  2E2Q A;  1YHQ N;  4JNE A;  3C0B A;  2QWO A;  1KQS M;  1K8K A;  1T6D A;  1NGG A;  3MN9 A;  4YDU A;  5JMV A;  1BUP A;  3U9Z A;  2D1K A;  5DM6 L;  1RDW X;  3FZH A;  4KBO A;  5F0X A;  4IEI A;  2VGM A;  3ENH A;  3F2K A;  1X3M A;  2P9L B;  2WFB A;  2HBJ A;  4B1V A;  1E4F T;  1BA0 A;  1VQ5 N;  3P38 A;  4YOW A;  3LM9 A;  5B8H A;  4B1Z A;  5AQU A;  3M5R A;  4BRO A;  1HKG A;  4CZE A;  4IXC A;  4WQ4 C;  2NRH A;  1MDU B;  3M6G A;  4BR7 A;  3I55 N;  4B1U B;  4IO9 L;  3MWT A;  2P9P B;  3HRG A;  3TTF A;  4RCH A;  4IOX A;  3SMS A;  3S41 A;  1TYQ B;  4BRP A;  4YOY A;  2H3G X;  3ENB A;  5AQG A;  4H0X B;  3CF5 L;  1Q82 O;  3GDQ A;  1JCF A;  2NZT A;  3IKM A;  5LJW A;  2E2O A;  3O9S A;  1NBW A;  5HL7 L;  5H1S Q;  4BY9 C;  4O8K A;  4BVO A;  3DXM B;  1RGI A;  1BG3 A;  4BRM A;  4OPH A;  3J7Z O;  3ZX3 A;  1DGK N;  2E20 A;  2BH1 A;  2IVN A;  2ASO A;  4YOX A;  4IJA A;  2GTD A;  2Q97 A;  3P31 A;  2NRT A;  1HJO A;  4BR9 A;  2A40 A;  1Q86 O;  3LDP A;  4FPA A;  4GNI A;  3ZYY X;  4A61 A;  2P9I A;  4A2B A;  2JWK A;  3K9J A;  1SQK A;  3VES A;  5JLH A;  4BVP A;  3MN7 A;  3WEE A;  2HF3 A;  4ISF A;  4LC9 B;  3HZ6 A;  3U8X A;  4WCE L;  3MK6 A;  3O9U A;  1DEJ A;  2HF4 A;  3QB0 A;  3R8E A;  1U2V B;  1V4T A;  5ADX A;  3CJB A;  1XQS C;  5M1K A;  1NLV A;  2AA4 A;  5AZI B;  1ATN A;  4IO8 A;  4WQ5 C;  3VEZ A;  4BQZ A;  4BR5 A;  3IDH A;  4CBW A;  3PIP L;  1M1K O;  3GE1 A;  5M1O A;  3PLA A;  1QQN A;  3EE9 A;  4DQ8 A;  3VEW A;  4BRL A;  3WUH A;  2P9L A;  1N8R O;  4BRC A;  1NGE A;  3C7N B;  3LDQ A;  1ATS A;  1E4G T;  3OW2 M;  3EN9 A;  3FZK A;  1QVG M;  4PKG A;  3O9R A;  3TSU A;  3H46 O;  3KHY A;  1NM1 A;  2P9P A;  1BWF O;  3CJC A;  4BEC A;  3VEX A;  3R3L A;  1TYQ A;  3TPQ A;  2E1Z A;  3KZB A;  1VQ4 N;  4FVU A;  2YI1 A;  4MLE A;  3BF3 A;  4MO5 A;  3FLC O;  3ULE B;  5EXW A;  1XUP O;  1QQO A;  4E1J A;  1HUX A;  3QDK A;  3WQT A;  3DXM A;  1VQN N;  2P9S A;  1C0G A;  4Y0W A;  4H0P A;  2F9T A;  2PAV A;  3DJC A;  5BN8 A;  2W41 A;  2IVO A;  4BRG A;  3GG4 A;  4H5N A;  3Q7C A;  4DB3 A;  3LDO A;  3Q7B A;  4BRH A;  4WYB A;  1SS6 A;  2CGK A;  2PBD A;  3ATV A;  3ID6 A;  3EE8 A;  1JJ2 M;  1NGC A;  5TKW A;  2W40 A;  4CZM A;  4IOA L;  4BE7 B;  2HBL A;  3MWP A;  5M1P A;  3VET A;  3A5N C;  3I8B A;  2C1I A;  4BRK A;  3EL2 A;  4IDH A;  3UE5 A;  5FPM A;  4BC5 A;  2I7N A;  2KLA A;  1GLB G;  1U2V A;  1YVN A;  1Z6R A;  3L0Q A;  4GVE A;  1LCU A;  3EZW A;  5BN9 A;  3PIO L;  3EKU A;  5AZI A;  3JS6 A;  4JAX A;  1GLC G;  3R6M A;  4CZK A;  3H6E A;  1X3N A;  4WFN L;  1HPM A;  2A41 A;  2GWK A;  4QS8 A;  3AAR A;  2OTL N;  2W00 A;  5C15 A;  1KAZ A;  3N4Q A;  5BRH A;  4IOC L;  3T69 A;  3W3D A;  3HTV A;  4BRQ A;  3C7N A;  3P39 A;  3SLC A;  3CCR N;  1K9M O;  1GLE G;  1T44 A;  5ADX H;  4JEP A;  3CMA N;  4B1X B;  1Q18 A;  4CZL A;  1GLJ O;  2Q1N A;  1NGD A;  4XH5 A;  4CBX A;  3OA9 A;  3VGM A;  1BDG A;  2QWP A;  4EIA A;  5FPD A;  4EHT A;  1YUW A;  3CCS N;  3O5B A;  1NGA A;  4FWK A;  3QML A;  5JVH L;  4WQ5 A;  3WXI A;  5TKY A;  5GAG P;  3HSC A;  3KK7 A;  5ELZ A;  3I33 A;  1VQ9 N;  2QM1 A;  1P8Z A;  1QHA A;  2BTF A;  2NRR A;  4FWQ A;  3ULE A;  4GV6 A;  3VTH A;  4BEB A;  1NMD A;  3VEV A;  1SZ2 A;  3MMV A;  4FL9 A;  3OBW A;  2I7P A;  2E2N A;  5AQH A;  3LDN A;  1YIJ N;  4MDB A;  5KPZ A;  2P9N B;  2DPN A;  2EWS A;  3CER A;  4IZ9 A;  4DHY A;  4BGA A;  1S3X A;  3FR0 A;  1MWK A;  3O6W A;  1RFQ A;  3ATU A;  3QBX A;  3O1W A;  4B1W B;  2AP1 A;  5FPN A;  4MO4 A;  3CCU N;  4HTL A;  4FSV A;  4B1Y B;  3CPW M;  4RWT A;  2ZJP L;  2J4R A;  4U67 L;  5C2F A;  2KHO A;  1Z05 A;  2E1Y A;  3WXK A;  3SK3 A;  2CH6 A;  4CI6 A;  2C1G A;  2P9S B;  4BRA A;  5AQY A;  3T7Z A;  1EQY A;  3CCQ N;  3HBT A;  4M7Y A;  4FWR A;  4A57 A;  2YCH A;  3M1F A;  1ZC6 A;  1HX1 A;  3VEO A;  2QI2 A;  1IJJ A;  2VGN A;  4GV3 A;  3FFK B;  4BR4 A;  2NRW A;  3BF1 A;  2FSJ A;  1Q81 O;  2ASM A;  1VQ6 N;  1KAY A;  2YX6 A;  2GEM A;  4K42 A;  5AQF A;  3F9M A;  2IIR A;  3U4L A;  3MX5 A;  2IVP A;  1VQ8 N;  5FPE A;  1V4S A;  4CBU A;  1YI2 N;  4C1N I;  2ZGZ A;  3A8Y A;  3O1B A;  1HLU A;  3H3N O;  5CE3 A;  3EO3 A;  3WT0 A;  1W97 L;  3QBW A;  1TUU A;  4YOT A;  4U7B A;  1YF5 L;  4OO1 J;  3E66 A;  3AAQ A;  5AQP A;  3EKS A;  4IJN A;  1Q7Y O;  3LL3 A;  3SAG A;  5F1X A;  2NRX A;  4JKE A;  4RTF D;  2NLX A;  1TUY A;  1JCG A;  3AAP A;  4J8F A;  4JKG B;  3DLL L;  4FWM A;  3ENO A;  3FZM A;  4KH6 A;  2ITM A;  2VCP A;  4CJ7 A;  1GLL O;  3L4Q A;  3SMP A;  5AQN A;  4CZG A;  4JK7 A;  1X9J A;  3CD6 N;  2ZF5 O;  4FWL A;  4FWO A;  3F5T A;  4JKA A;  3E9O A;  4A2A A;  3FE1 A;  4CZF A;  1VAZ A;  3O9Q A;  2QTD A;  3L4I A;  3D2F B;  2OTJ N;  2V7Y A;  3TTC A;  2FXU A;  4ISE A;  1OVY A;  1GLF O;  2P9N A;  3AY9 A;  2RHK A;  4H5V A;  5AQW A;  5BPN A;  2JWL A;  1SAZ A;  3LDL A;  4YOR A;  5BRE A;  5EVZ A;  4NB4 A;  2QXL A;  4CD1 A;  5EOY A;  4FWN A;  3CI5 A;  1BU6 O;  3CCL N;  2GWJ A;  4H5T A;  2PFU A;  5MLC Q;  4JD2 A;  2D0P A;  3LM2 A;  3ZET B;  1C0F A;  3DWL A;  1BA1 A;  3CJ9 A;  4FWP A;  1K73 O;  5AR0 A;  5JVG L;  2F9W A;  2HBM A;  3CJ1 A;  3DXK B;  3FZF A;  1RDU A;  3A5L C;  3SBG A;  4M63 C;  4L3Q A;  4EHU A;  1BO5 O;  4HWI A;  4IWV A;  5AQX A;  4BGB A;  1VQP N;  2QEX N;  2E88 A;  3WXM B;  5AQJ A;  3H1V X;  4PKI A;  5GAE P;  5BPM A;  2Q2R A;  4WQ4 A;  2YJF A;  1M90 O;  1P90 A;  4H03 B;  4BC3 A;  5M1F A;  2QWR A;  4H0T B;  3U9D A;  2QW9 A;  1W2B M;  1NGH A;  2YHW A;  4NLB A;  1Y64 A;  4JKB A;  3KVG A;  4BRF A;  3ZX0 A;  4KH5 A;  3MN6 A;  5AQM A;  5M1Q A;  1T6C A;  1QVF M;  1BOT O;  5C10 A;  5I9E B;  4K41 A;  3MDQ A;  2YHY A;  1D4X A;  4A59 A;  3GBT A;  2ZJQ L;  2A3Z A;  3C65 A;  5KPT A;  5GAD P;  5AZJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...