4CBUA

Crystal structure of plasmodium falciparum actin i
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
365
structure length
357
Chain Sequence
EDVQALVVDNGSGNVKAGVAGDDAPRSVFPSIVGRPKNPKDAFVGDEAQTKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRAAPEEHPVLLTEAPLNPKGNRERMTQIMFESFNVPAMYVAIQAVLSLYSSGRTTGIVLDSGDGVSHTVPIYEGYALPHAIMRLDLAGRDLTEYLMKILHERGYGFSTSAEKEIVRDIKEKLCYIALNFDEEMKTSEQSSDIEKSYELPDGNIITVGNERFRCPEALFQPSFLGKEAAGIHTTTFNSIKKCDVDIRKDLYGNIVLSGGTTMYEGIGERLTRDITTLAPSTMKIKVVAPPERKYSVWIGGSILSSLSTFQQMWITKEEYDESGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Differences Explain Diverse Functions of Plasmodium Actins.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Motor protein
molecule keywords ACTIN-1
total genus 119
structure length 357
sequence length 365
ec nomenclature
pdb deposition date 2013-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00022 Actin Actin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4cbuA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4cbuA02
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 4cbuA03
3LDQA 3D2EA 3VEYA 4BR9A 3MN5A 2ZF5O 1R59O 3FLCO 4H0PA 3A5OC 5I9EB 1QZ5A 1HLUA 3VF2A 2D1KA 1NGHA 3A5NC 1WUAA 4I6MA 4FWSA 2Q0RA 5AQWA 2QWLA 3C7NB 1MDUB 4MLHA 5AQIA 3CJ1A 1S22A 3ATUA 1BO5O 4H03B 3CI5A 3LDOA 3WXJA 2P9PB 3R6MA 2QWMA 3GDQA 4CD1A 1V4SA 3UKRA 2YHYA 2QWOA 4BRAA 2VCPA 4NB4A 3O1BA 4BRQA 3H1QA 5AQKA 1U2VA 5KPZA 3H3NO 3QB0A 1C0GA 5FPNA 4CZLA 5AQQA 5BREA 3WQTA 4RWTA 2GTDA 1BWFO 4M7YA 3CJCA 3QBWA 3O5BA 4BVPA 4H0VB 2F9WA 2YI1A 3FR0A 1RDWX 1SQKA 1KAZA 2CH5A 4WQ5C 3W3DA 4EFHA 2I7PA 5CE3A 3QDKA 1BUPA 1T6CA 4IWVA 3HBTA 3AY9A 4M63C 4BC2A 4JAXA 3D2FB 4H5VA 5BPLA 1S3XA 3HI0A 3VENA 3LL3A 4ISFA 3VPZA 5B8HA 5AR0A 2GELA 3D2FA 3CIPA 5F2RA 1HUXA 3FZKA 5AQMA 2E1ZA 2YJFA 4HTLA 3WEEA 2CH6A 2EWSA 5ADXA 2AA4A 2OANA 3EZWA 4A2BA 5E84A 2FLOA 4F9OA 1QZ6A 2E2NA 3MN7A 3IUCA 2AP1A 1QQNA 4IO8A 3DXMA 4CBUA 1HX1A 4BRLA 4K25A 2ZWHA 1D4XA 3MK6A 4L3QA 3CQXA 4CZFA 1XC3A 3MN6A 4JNEA 3J8AA 3VEVA 3WQUA 5JLFA 3S41A 3H3OB 3CJAA 3CHWA 3WXKA 4B1WB 5KPTA 4DB3A 4BC4A 1IJJA 1NGCA 4BREA 1GLCG 4CZIA 1CZAN 3SMSA 3UKUA 4BRKA 1GLEG 3BF1A 1JCEA 1HKGA 4BGAA 3TU5A 4H0OA 5BN8A 2QWQA 3MDQA 4GNIA 4YDUC 4WYBA 3O4WA 3L0QA 5FPEA 2ZGYA 1DGKN 3FGUA 4H5WA 3VESA 2E20A 2HF3A 4BROA 1J6ZA 3ZX2A 3ZX0A 1MWKA 2YCHA 1T6DA 4I6MB 1P8ZA 3VGKA 2Q31A 2E88A 4JD2A 3BF3A 2ASMA 4EAHD 1GLAG 1BG3A 4CI6A 4MLEA 2FSKA 3FFKB 4CBWA 3ZETA 3TPQA 4CZGA 4BRCA 4PL7A 2E2QA 2V7ZA 4A2AA 2KHOA 2Q1NA 1Z6RA 3ZETB 1U2VB 5AQPA 3EL2A 3ZX3A 1XQSC 5F0XA 4BRHA 5AFUA 1TUUA 3JS6A 2FF6A 3EN9A 5AQOA 4M7XA 2Q0UA 4RTFD 3IMXA 4HWIA 1LCUA 1YVNA 3MN9A 3CJ9A 2F9TA 5AQGA 5JLHA 3H45C 2BTFA 1X3NA 4XH4A 4K43A 4MO4A 4GY2B 2P9NB 4NO7A 3SMPA 2P9IA 4FWRA 4DQ8A 3FZMA 3HZ6A 3ID8A 5EY4A 4B1YB 3H6EA 2P9IB 3QFUA 4FWNA 4Y0WA 4BC3A 3A5MC 4BG9A 4LC9B 4BQZA 1ZXOA 5JMVA 4CZEA 2VYPA 5BRFA 3GOIA 4FPBA 3D2EB 3CJ7A 3L4IA 4FL9A 3JXUA 2P9KA 1X3MA 4PKGA 3HM8A 2A6AA 5AQTA 3M1FA 3VOVA 3F9MA 3UKUB 1YXQA 3HTVA 3VF6A 5BRDA 3GE1A 2GEMA 5EOYA 3ENOA 2IIRA 3SK3A 1YAGA 4H0XB 3RSEB 1E4GT 2YJEA 3MCPA 4EHTA 2IVNA 4CZJA 3AARA 4BRPA 1NGGA 3KHYA 1NGDA 3WXIA 5JICA 3CERA 3O1WA 1ATSA 1K8KB 4RCHA 1U6ZA 3ULEB 2FSNA 1T44A 1GLFO 3HSCA 3GL1A 4O8KA 2P9LB 2E2PA 3MMVA 5ELZA 1TUYA 4WQ5A 3VEOA 4QS9A 4K41A 1NM1A 3LDNA 2I7NA 2QM1A 4JHDA 3QMLA 4FWOA 4H5NA 4JD2B 3VERA 1E4FT 1SAZA 4PKHA 1LOTB 3O80A 3VEXA 3H46O 5EVZA 4JHDB 1OKJA 2D0OA 2J4RA 4BRMA 4H0TB 4CZMA 2P9SB 3ATVA 2Q97A 1NLVA 3ENHA 3UB5A 2CGLA 3I8BA 4FWPA 5KQDA 4IZ9A 1XUPO 3W0LA 1GLDG 2IVOA 4JN4A 1NGJA 2A41A 2CGJA 1NGFA 3U8XA 2Q36A 3O6WA 5BPNA 3G25A 2PAVA 4A62A 1SZ2A 4C23A 2V51B 3GG4A 5TKYA 3DAWA 2D0PA 1NGEA 4B1ZA 3VGMA 2ZGZA 4DHYA 1KAXA 2P9UB 2ITMA 5AQXA 2IVPA 1Z05A 4KBOA 2P9PA 5LY3A 2HMPA 3U9ZA 4CBXA 3GBTA 1ATRA 5AQFA 2NLXA 4H0YB 2P9UA 3SLCA 4FWQA 1NWKA 1YUWA 2NZTA 1DEJA 3D7EO 1NGAA 4CZHA 4XH1A 4YDUA 2YHWA 3A5LC 5FPMA 5AZIB 3FZFA 4B1XB 5AZJB 4E1JA 1ZBSA 5AQZA 1BOTO 1H1VA 1GLBG 4XH5A 5EXWA 5FPDA 3AAPA 1BU6O 2P9KB 2QWRA 2A40A 1NBWA 2QXLA 3A8YA 1V4TA 5ADXH 4K42A 4B1VA 1MA9B 1HPMA 4BG8A 4PKIA 3KVGA 2D4WA 1QQMA 4FSVA 4FWLA 3R9PA 4ISEA 4CJ7A 5LJVA 3CQYA 3VF4A 2P9LA 4BRDA 5F1XA 3RSEA 1Y64A 2FF3B 3EKSA 3R8EA 3UE5A 3ZEUA 1EQYA 4WQ4A 3C0BA 2GWKA 5BR9A 3WUHA 4BRIA 2H3GX 2V52B 1NGIA 3DXMB 3U9DA 2E1YA 5AFUH 3SJHA 1GLLO 4WQ4C 3BEXA 3VEWA 3DJCA 2HF4A 1GLJO 3WXLA 2FSJA 2QW9A 5KQ8A 1BA1A 4H5RA 4BRGA 1ATNA 1QQOA 2DPNA 5AQLA 1BDGA 2NRHA 5AQVA 3DXKA 1NGBA 2W41A 1ESVA 5AQSA 4QS7A 3CETA 3VETA 4BRNA 3LDLA 2P9SA 2Q2RA 2A42A 1KXPA 3WT0A 4BR7A 3DXKB 1QHAA 4B9QA 4FOIA 5LJWA 3P4IA 4BR5A 3A0IX 3UKRB 4A61A 4EHUA 1DKGD 4BGBA 1BA0A 3C7NA 1C0FA 3M3ZA 5AQJA 2ASPA 4BR4A 2A5XA 3IDHA 3LM9A 3AAQA 2FXUA 2E2OA 3VEZA 2PBDA 3B8AX 1HJOA 3BUZB 3L6QA 5KPRA 4PL8A 2GUPA 1G99A 5AZJA 3FZLA 2UYTA 5E26A 5AQHA 1X9JA 4BR2A 2V7YA 2HOEA 2QWPA 3FE1A 4IXCA 3QICA 2YHXA 1ZC6A 3OHRA 4BQLA 3H1VX 3U4LA 4BVOA 4AM6A 4FWMA 3BP8A 4J8FA 1WOQA 4FOEA 5AZIA 4Z94A 1RGIA 3EKUA 3IFRA 4IJNA 5AQRA 3QBXA 4BC5A 2A3ZA 1NMDA 2E8AA 4O5FA 3KZBA 4AM7A 4BRFA 3WEEB 4H5TA 3I33A 4XEIA 4BR0A 4B1UB 2BUPA 1RFQA 2VWBA 4FWKA 5BPMA 1K8KA 3O08A 5BN9A 5EX5A 3ULEA 3EO3A 3ZEUB 3CJBA 1HKBA 4CD3A 1TYQA 4CZKA 1JCGA 3O8MA 3FZHA 4FPAA 4MO5A 5AQNA 1JCFA 1HKCA 3LDPA 4IJAA 5AQUA 3LM2A 5AQYA 2ASOA 2P9NA 1MWMA 5BRHA 3QFPA 1TYQB 2QWNA 4EIAA 3M6GA 4FO0A 4QS8A 1Q18A 2W40A 3DWLA 4ISGA 1KAYA 2WUSA 1IG8A 2CGKA 4DCHA 3VGLA 2GWJA
chains in the Genus database with same CATH superfamily
4DSEA 3MN5A 2ZF5O 2XHBA 1XNQK 5KGXA 4LSLA 1TAQA 1A5WA 5JENA 3A5NC 3OYEA 1WUAA 1W97L 3ZSVA 5CZ2A 4E7HA 3ATUA 1BO5O 5JS2A 1VSFA 3KWIA 4DU1A 4OPJA 1FJGK 2EHGA 1YJWN 5C24A 1QQCA 2QWOA 2VCPA 2B6AA 4NB4A 3H1QA 3OA9A 5AQKA 5KPZA 1FK9A 1LWCA 5AQQA 5BREA 3WQTA 3SQ1A 4B9SA 3THYA 3BGRA 3FR0A 3W3DA 4EFHA 5CE3A 1UAXA 3QDKA 1T6CA 1XMQK 1RILA 2YKNA 1S3XA 3AVHA 3O9TA 5CYQA 4B08A 5J2NA 2Z1HA 5B8HA 2E6LA 1NK6A 5AR0A 1IBLK 4N76A 3NF8A 4B8CA 1HUXA 3FZKA 3ZSZA 2OTLN 3L2UA 3PX0A 1RTDA 3VTIA 4HUEA 3HOTA 1ILYA 4A2BA 2EX3A 5E84A 1HR0K 4NLCA 2FLOA 4MDAA 4F9OA 2E2NA 3IUCA 1QQNA 3DXMA 3JYTA 4DV0K 2QKBA 2UUCK 4BRLA 4K25A 1NK5A 3BY5A 4QCLA 4F3OA 1TV6A 4YOTA 4CIEA 2X74A 3J8AA 3AVBA 3VEVA 3S41A 1JL1A 2Z1JA 2RPIA 4DB3A 4BC4A 2VG7A 5IT9O 4JYAK 1C1BA 2JGUA 3HP9A 3TU5A 5BN8A 2QWQA 5GIPA 1BIZA 3TTCA 3CFPA 4I9QA 5FPEA 3DLLL 3FGUA 3AVJA 4H5WA 4DSFA 4JV5K 4PWDA 3ZX2A 3KK7A 2Q31A 4A5AA 2ZE2A 3BF3A 2Z1IA 1TKDA 4NCAA 5CHIA 4CI6A 4JEPA 3V9SA 3I8DA 3TPQA 1TL1A 5M1QA 2E2QA 4AHCA 4JKEA 3ZLJA 4Z4IA 1NJIO 1WN7A 2Q1NA 1K9MO 1NKEA 3OYCA 3EL2A 5JS1A 5TKWA 3WNHA 5GADP 1XHZA 3VQ7A 4BRHA 4YOUA 1NNEA 1FW6A 1N33K 1TUUA 3JS6A 2OCEA 3AA4A 2Q0UA 1NOZA 3SYZA 4CGHA 3C6HA 4OVLA 3DLHA 2F9TA 4M3ZA 5AQGA 3OYJA 4OPHA 1RDDA 3K5NA 5M1FA 1X3NA 4FJKA 2X78A 2HHVA 1EO1A 3TAMA 3ID8A 5EY4A 2DTUA 1N8RO 4B1YB 2YX6A 4DV1K 3A5MC 1VRUA 4LC9B 5JMVA 3M8PA 4CZEA 5C15A 1N34K 3JXUA 4JKFA 5AQTA 4BE1A 3ISNC 2O8DA 3F9MA 3SAHA 3GE1A 3G6EN 4X66K 1A5VA 2C1IA 1WNSA 3V9UA 3AO3A 3RSEB 4KI6A 2IVNA 1NGGA 3KHYA 4CFDA 2PZSA 3WXIA 4YY3K 3O1WA 1NJXA 1JXEA 4CHPA 3VMFB 4J2AA 3LANA 1RT6A 4FJ8A 4O8KA 2P9LB 5KTQA 2PYLA 3MMVA 5ELZA 4KHWA 4DU3A 1T3VA 4W5QA 2QM1A 2YHBA 3A2FA 4H5NA 4CHOA 3IS9A 1LOTB 3VEXA 2KLAA 1RBTA 1S9GA 4IDKA 2P9SB 1NLVA 2Y1IA 1TKZA 2CGLA 4FWPA 4IZ9A 3S5TA 2HHXA 1GLDG 2YKMA 1S1WA 1JL2A 1JJ2M 1ZBHA 3S3NA 3G25A 1QE1A 3ZT3A 4A62A 2RKIA 3NE6A 5TKYA 3SQ2A 1A5XA 5FRNA 4HHTA 4H8KA 2P9UB 2ITMA 4LFBK 2IVPA 4FCYA 2P5OA 2P9PA 4W5OA 3U9ZA 2HHTA 4CBXA 1IKWA 3GBTA 3OYBA 1VSJA 1TKXA 4B9VA 4FJJA 2UXDK 2WFBA 5HBMA 4CZHA 2E5LK 3HPHA 2YHWA 3DOKA 5FPMA 3HM9A 1W0HA 2DFHA 5FROA 4DSKA 3CCQN 1BOTO 5H1SQ 1TK8A 1SKRA 4BWJA 3SUQA 1BU6O 2QWRA 3LDSA 2QXLA 1JLAA 5ADXH 2G8KA 2GX9A 2HHIA 4BG8A 4FYDA 3KVGA 2D4WA 3HYFA 1VQNN 4FSVA 5LJVA 1HYVA 4DF4A 1UA1A 3B6OA 4DQSA 3M8SA 2FF3B 4G9ZA 3PUFA 4GMJB 4CGGA 1CZBA 1BI4A 2YHAA 1GOAA 2F8SA 3CCSN 3OS1A 2OA8A 2V52B 3MEEA 3K9JA 4TSXA 1WAFA 4CJUA 1VQ9N 1TKTA 2E1YA 3BEXA 4XIUA 4FLVA 4KV8A 3O3GA 3ZCMA 4F3TA 5KQ8A 1BA1A 4BRGA 3NHGA 1ATNA 4BE7B 5DM7L 4RG8A 3HL8A 1YI2N 2NRHA 4BWMA 3TI0A 3EZ5A 1KD1O 5AQSA 3VTHA 3VETA 1ASUA 5HRRA 2A42A 5J2MA 3WT0A 1IG9A 3DXKB 3K5LA 5T7BA 3S3MA 3NAEA 3VQ9A 2QA4N 1F21A 3AA3A 1RNHA 4QOZB 5C10A 3C7NA 1C0FA 4JKGB 5AQJA 5GAEP 3IDHA 2IC3A 2W00A 4J2DA 3MEDA 1S1XA 1SL1A 4YORA 1RDAA 4JKCA 4JI3K 2GUPA 1N5YA 4DTNA 4GVEA 2V7YA 1VQMN 2QWPA 4WFAL 5GAGP 4BQLA 1ZC6A 4CHZA 4RW9A 1RT5A 4FWMA 3CC4N 4FOEA 1C0MA 1OH6A 1HJRA 4K0KK 3P31A 4BC5A 4KREA 2B4JA 4ILHA 4FZXC 3L2VA 3OYNA 3NH2A 1WBBA 2BDPA 1OVYA 1RFQA 2HBJA 2VWBA 1K8KA 1WSHA 3CJBA 3VQQA 3IG1A 1DTQA 4CJTA 1TYQA 4CZKA 1JCGA 4N5SA 4DSIA 1ASVA 1HKCA 2OZSA 5AQUA 5FRMA 2D0BA 3MWTA 5BRHA 1TYQB 3CM5A 2OPSA 3KKRA 3M6GA 4QS8A 3AA2A 3RWUA 4LD0A 1QSYA 3CCEN 1HYSA 3I55N 2W40A 4KPYA 1XI1A 1BI4B 4DLEA 1KAYA 3TSUA 2GWJA 2FSJA 3LDQA 1S1TA 1JLGA 1I3AA 3VEYA 4FK4A 1JLBA 4LF8K 4FM0A 4H0PA 4FJMA 3A5OC 1QZ5A 2RE2A 5KRTA 2OPPA 4DTPA 4ELVA 4HVJA 3SBGA 3P83D 1WAJA 2QWLA 2G8FA 4CJSA 5AQIA 3OVNA 2F4VK 3PIOL 1S22A 3LAKA 4LFCK 3WXJA 2QWMA 3ZSQA 4CD1A 1EKEA 3KK3A 3THWB 2HW3A 1NKBA 3VQAA 1WBDA 4CFBA 3J7YP 1JXBA 3H3NO 3MEGA 1C0GA 2HHSA 4CZLA 4KO0A 4OLBA 3AO1A 3RVCA 3NF7A 4BVPA 4OX9K 4H0VB 2GV9A 3LP1A 3OYIA 2CH5A 1KAZA 2XY6A 4KHSA 4DFKA 3HBTA 4ELUA 3RRGA 4E19A 1M90O 3QEPA 4LF4K 3O4NA 2HNZA 4H5VA 3LL3A 4ISFA 1HPZA 4KH4A 3WNEA 2FC0A 3CYMA 4GVMA 1VHXA 4YFUA 4JI7K 2E1ZA 4X65K 2EWSA 4FLYA 2AA4A 3EZWA 3WNFA 4CK3A 4YHHK 1QZ6A 4YOVA 4IO8A 4CBUA 3PIPL 1D4XA 4L3QA 1VRTA 2WTUA 3C6TA 4DR2K 1T8EA 2O8CA 1XC3A 1TL3A 3MN6A 4JNEA 5JLFA 1LW0A 1SUQA 3HVTA 3CJAA 3OW2M 1RBSA 3WXKA 4JI0K 4B1WB 1RTHA 1IKVA 4CF0A 4BDYA 5AJ3K 4ZTJA 1IJJA 2VGMA 1NGCA 2KKZA 3AVGA 3NBPA 4OGEA 1KC8O 3FFIA 1CLQA 1GLEG 4XJXA 1BL3A 1HKGA 4HUGA 4H0OA 3MDQA 4YDUC 2QK9A 2G8IA 1M1KO 3L0QA 2ZGYA 3VESA 2HF3A 1RBVA 1SV5A 3P1GA 3VQBA 1OVQA 4F8RA 1MWKA 2YCHA 3N4QA 1QVFM 4JD2A 4DR3K 1GLAG 2FSKA 3SV3A 1KVAA 3FFKB 3AVMA 4CZGA 1L3TA 4W5TA 1RDCA 2V7ZA 5M1PA 4YOXA 3TANA 1W7AA 1RT3A 4A2AA 2KHOA 2DFEA 1I94K 4KI4A 3ZETB 2NNWA 4CJ4A 4LH5A 3ZX3A 3LP2A 4CJRA 1XQSC 3PO4A 4NLBA 1BCMA 4W5RA 2JLEA 4GV6A 3EEQA 3H08A 4F2RA 3HT3A 1ZBLA 4DR1K 3AVNA 1J5OA 4B9TA 5HROA 1VSMA 3R3LA 3K0SA 1IKXA 4O5BA 4OKJA 3CFRA 4HWIA 3CJ9A 3ALYA 5LL6Z 1NG9A 3CC2N 3EY1A 4AQYK 5C0YA 3H45C 2BTFA 4XH4A 4DUZK 4MO4A 1XWLA 2P9NB 1D8YA 2P9IA 1YTAA 4DQ8A 4DQQA 1NK4A 4DWIA 5GIOA 3THXB 1N36K 1WSFA 1BHLA 4DR5K 4FLUA 3QIOA 3QFUA 4Y0WA 2HVIA 4BG9A 1KFSA 1T03A 3DRRA 3LZJA 4I7FA 1MU2A 2B5JA 3D2EB 3CJ7A 2A6AA 3L2RA 4KHYA 3VF6A 5BRDA 4JK7A 2GEMA 1IH7A 4FW2A 5EOYA 1HQUA 3SK3A 4CEOA 1YAGA 2A1SA 2HVHA 2YJEA 1TK5A 3NH0A 3AARA 3ZSYA 3QO9A 3KLGA 2VWJA 2HHHK 5JICA 2OPRA 4O44A 2NRRA 4FM1A 1KTQA 3NVKA 1T44A 1GLFO 3GL1A 2E2PA 3OYFA 4FJGA 4B3OA 1NM1A 4I2PA 2I7NA 2ATQA 4JHDA 4C1NK 3QMLA 1B9FA 1BISA 1S9EA 3H46O 5EVZA 2FBXA 4CIFA 4JHDB 5SWMA 1QSLA 1FXXA 1Q8IA 3NGIA 1OKJA 3LP3A 2J4RA 4BRMA 3RRHA 4H0TB 4CZMA 3CMAN 1HMVA 3ATVA 2Q97A 3C65A 4BDPA 5C2DA 5DM6L 3UB5A 3I8BA 5KQDA 3V1QA 3OY9A 3W0LA 4DV5K 3G0ZA 4DV6K 2A41A 4X62K 2CGJA 4KTZA 1NGFA 4M3UA 2I5JA 1KSPA 3HVRA 1RT2A 4C23A 1W2BM 3RMAA 4CERA 2UUAK 4FK2A 2D0PA 1NGEA 4IG3A 3VGMA 2ZGZA 4DHYA 3OBYA 4NYFA 4GV9A 1JKHA 5AQXA 2HHUA 5LY3A 2HMPA 4M3RA 2GUIA 4AILC 1RDBA 4CJPA 1NU0A 1YITN 1DEJA 3L2WA 1NGAA 3DM2A 3V4IA 1VQKN 4YDUA 4CEBA 3A5LC 1WSEA 2YNHA 3CD6N 3R1XA 3SAGA 2E6MA 3AAPA 4Z0UA 4DTSA 1NBWA 5I3UA 5KGWA 3OYAA 1HPMA 4LF9K 4KAZA 3LPTA 3T3FA 3VF4A 4K8ZA 2O8FB 1NK8A 1Q9YA 1IBMK 1U04A 3R8EA 1EQYA 1L5UA 4Z4FA 3QESA 3VQ5A 3E9OA 4WQ4A 4M41A 2GWKA 3NGZA 3WUHA 3I0SA 3OYDA 4PUOA 3AGKA 4BRIA 3V1OA 1O1WA 1NGIA 4M3YA 3U9DA 3K5MA 3SJHA 1B9DA 1GLLO 2YNIA 4WQ4C 3T1YK 3OS0A 4LF7K 3ITHA 1B92A 3WXLA 2QW9A 4H5RA 4OO1J 2P51A 5AQLA 5D3GA 4MQ3A 1NK9A 1BDGA 1LWFA 1OH7A 2JWKA 5AQVA 4QS7A 3CETA 3EE8A 1KXPA 4CK1A 1WSGA 1IBKK 3CYGA 1QHAA 3IRXA 5A2QO 1BCOA 5LJWA 2PFUA 4DSJA 3A0IX 4CW7B 4E0DA 2JWLA 4EHUA 1CXUA 3M3ZA 4BR4A 3SQ4A 2A5XA 4CCHA 4DFPA 3UIQA 4IKFA 2VG6A 3AAQA 2FXUA 3VEZA 4M42A 2PBDA 1HJOA 4JKAA 4QAGA 2HSTA 2VWKA 4JKGA 4FLTA 1ITGA 1U4BA 4FZYA 1WSJA 1IO2A 4KHQA 5AZJA 4JK9A 2D0AA 5E26A 1X9JA 3QIPA 5C42A 3F73A 3T1HK 4IXCA 2BH1A 4LSNA 4HCBA 4B9NA 2G8WA 3OHRA 2VQFK 3H1VX 3TTDA 3TABA 4W5NA 4BVOA 2LSNA 4AM6A 1U45A 4CJLA 1YIJN 4U67L 3BP8A 4J8FA 3KD1E 2HBLA 4Z94A 5AZIA 2HBMA 3QBXA 3L3UA 4WF9L 3ZSOA 2E8AA 4FLXA 4H5TA 3O9RA 4CJWA 4JS5A 3NVMA 4FJLA 4IOXA 2BUPA 5BPMA 3ULEA 5BN9A 5EX5A 3QEWA 1CXQA 1J5EK 1O13A 4MDBA 3FZHA 1JCFA 3V9XA 4FLZA 2O8EA 3DLRA 2O8FA 2KW4A 1EP4A 4EIAA 4FO0A 4Z4EA 4IDHA 4FJXA 4DUYK 4ISGA 2DFFA 1ZYQA 4PHTX 2WUSA 4E3SA 3QINA 3SCXA 4DCHA 3VGLA 3SI6A 2OTJN 3D2EA 4BR9A 5M1KA 1R59O 4DQPA 5I9EB 1HLUA 3VA0A 2D1KA 1OH8A 4NCGA 3QEVA 4Z4GA 1NGHA 5JVHL 4I6MA 4FWSA 2Q0RA 5AQWA 1S72N 4CJFA 3C7NB 1MDUB 4MLHA 3CJ1A 1LAVA 1TVRA 4KRFA 3CI5A 3LP0A 4A57A 4CJKA 1NOYA 2P9PB 3R6MA 1V4SA 1DTTA 4CEDA 5HP1A 4CF9A 3AO2A 1YHQN 4BRAA 5HRNA 3PY8A 4M45A 1J9AA 1U2VA 5EU7A 1VSIA 5FPNA 1NKCA 3SQ0A 1VQ8N 2GTDA 4B3TK 4F4KA 4M7YA 4R5PA 3CJCA 3QBWA 2F9WA 2YI1A 1RDWX 4WQ5C 4KHNA 2RN2A 1JLEA 3CPEA 1BUPA 1S1UA 3HJFA 4B3RK 1RT4A 4FJ5A 3E1YA 2BANA 1J54A 3ZT4A 4CEQA 3HI0A 4ELTA 4J2EA 3VENA 3L4QA 4CE9A 3KJVA 2GELA 3CIPA 5AQMA 2F96A 2YJFA 4HTLA 3ZSRA 4FJ9A 3QLHA 3WEEA 1RT1A 2CH6A 3M8QA 5LMNK 5LMUK 3MN7A 2AP1A 2IGIA 2D5RA 1HX1A 1U47A 3DLBA 1NJYA 1L3VA 4EZ6A 4JI4K 1UA0A 4OKKA 3MECA 3PSFA 3KWGA 1YJ9N 3H3OB 3CHWA 3TWHA 2QTDA 3SUOA 5KPTA 3CFOA 2X6NA 4EP5A 2NRTA 3TSPA 1GLCG 3CCJN 4HUFA 1CZAN 1IKYA 3SMSA 4DTJA 2UU9K 4BRKA 1ZBUA 3BF1A 3IKMA 4IG0A 1XHXA 2ETJA 1KFDA 3SNNA 3EE9A 3O4WA 2P1JA 1HNZK 3T1AA 2E20A 4ZTFA 1WB9A 4DQRA 2ZJQL 3ZX0A 4DKWA 2RF2A 4IFVA 1T6DA 3BDPA 1P8ZA 3VGKA 4EAHD 5J1EA 3OYKA 4MLEA 4CBWA 5E41A 5C12A 4CEFA 3K58A 3HRGA 1GOBA 4DR6K 2NRZA 5HRSA 4L8RB 4DF8A 3AA5X 1Z6RA 4CJVA 1U2VB 4UY8O 4CJ3A 4O4GA 5F0XA 4RW7A 2FBYA 2YNFA 5AFUA 1LW2A 3HXMA 5AQOA 3KLEA 2NRVA 4N47A 4RW6A 4OKEA 2VGNA 2IDOA 1LCUA 3MN9A 4V19S 1HYZA 3PO5A 1HNXK 2O8EB 3SMPA 4FWRA 3SPYA 1XC9A 5HL7L 3H6EA 3G71N 4FWNA 4BC3A 4CJEA 2HHQA 3CG7A 5BRFA 4FL9A 4DTOA 2OPQA 1X3MA 4PKGA 1KLNA 3HM8A 3O3FA 4OJRA 3ZT0A 3AV9A 3U3GA 3VQEA 3VQ4A 2O4IA 1VQPN 5HRPA 3TAPA 4CJQA 3ENOA 2IIRA 3AVLA 4DTUA 4ID5A 4LH4A 4EHTA 1W9HA 3OBWA 2VG5A 2KZMA 3OJSA 3AVAA 1NGDA 1HNWK 4O55A 3CERA 1ATSA 3ULEB 4RCHA 1U6ZA 3V81A 4NCBA 3C94A 3HSCA 1FKPA 3VEOA 4WQ5A 4QS9A 4K41A 4DV3K 5I42A 4DSLA 3ZT2A 3LDNA 3OTOK 1LAWA 4JD2B 3VERA 1X9MA 2HHWA 4PKHA 1RBUA 4BECA 4IBNA 3HSTB 4DQIA 3U6FA 3HO1A 4YOYA 3ZYYX 3ENHA 3ID6A 4BY9C 3SBTA 2O8BA 3C6AA 1XUPO 1NGJA 3HPGA 3TTFA 3O4QA 3CCVN 3P38A 4E7JA 3U8XA 5BPNA 3WNGA 2PAVA 4WE1A 3QETA 1SZ2A 2V51B 4GKKK 3L8BA 3GG4A 3TSQA 1VQON 2PYJA 4B1ZA 4E1MA 4KTWA 4Q0BA 3RMBA 1KAXA 3D6RA 4FM2A 1Z05A 4KTQA 1VQ4N 1VQ7N 3LWMA 4DTXA 5AQFA 1YVUA 4H0YB 2P9UA 2P5GA 1NWKA 4Y1DA 1YUWA 2NZTA 3OYLA 3D7EO 4XH1A 4JRQA 3DOLA 3I0RA 5AZIB 3VQCA 4CHQA 4E1JA 2HNYA 1ZBSA 5AQZA 5KI6A 3O3HA 2W42A 4O0JA 3SZ2A 3E9PA 2QXFA 1TAUA 1H1VA 4CJ5A 4B9UA 1TGOA 3PLAA 4CHYA 5FPDA 1KQSM 1VQ6N 2P9KB 2WONA 2A40A 4E7IA 1V4TA 4K42A 3MX2A 4JRPA 3OJUA 4DTMA 1DT9A 5IWAK 4WFNL 2XY8A 4FWLA 4LY7A 2P9LA 5CYMA 4IFYA 3SV4A 3RSEA 3DI6A 4CEEA 1X1PA 3NMUA 5HOOA 1QSSA 4CVNE 1XMOK 3C0BA 4DG1A 4DS4A 4RW8A 5BR9A 3L3VA 1S5JA 4E7LA 1T7PA 1X9WA 3HPOA 4RW4A 4JI6K 3SJJA 3VEWA 3DJCA 4E72A 2HF4A 4N41A 3K2PA 1J53A 2NRWA 2F7TA 2W41A 1HNVA 4BRNA 3LDLA 3DMJA 4DV4K 3SPZA 3CM6A 2RHKA 2Q2RA 4HTUA 3F2KA 4FOIA 4B9LA 2IAJA 1WLJA 1QHTA 3DRSA 3UKRB 4FXDA 4A61A 1NJZA 1DKGD 1S6QA 1HNIA 1Y97A 1HRHA 1EWQA 2NUBA 1RCHA 3LM9A 4B3MK 2E2OA 4JI1K 3NGYA 2WBNA 3LALA 1KRPA 1HQEA 4WFBL 4OPKA 4PL8A 1G99A 3MCAB 4A59A 1UWBA 4BR2A 2HOEA 3FE1A 4ILGB 4AHSA 1R0AA 1EETA 4CF1A 3QICA 2YHXA 4AHVA 3U4LA 3QEXA 3NF9A 1WOQA 1LWEA 3EKUA 5AQRA 4IOCL 1C1AA 4Z4HA 3S9HA 1D5AA 4EZ9A 1EWRA 3ASMA 4FLWA 4O5FA 4AM7A 2FBTA 3I33A 4DV2K 4DFJA 3V9ZA 3EO3A 3ZEUB 1K73O 3O8MA 4FPAA 4B9MA 4E89A 4IJAA 4JI2K 2YNGA 3LM2A 5AQYA 2P9NA 1MWMA 5M1OA 1D9FA 3QFPA 4JS4A 1RTIA 3DLKA 1KVCA 5M1NA 1VK0A 3QNNA 3TAFA 4M3XA 3DWLA 2CGKA 5GINA 4C8LA 2PY5A 1JLQA 3IAYA 4C8NA 4IOAL 1GOCA 1SL2A 3FLCO 4AHRA 3CCMN 3J80O 4FK0A 3VF2A 1N6QA 2DY4A 5CR4A 5CZ1A 1BIUA 2O4GA 2KQ2A 4BACA 2KFNA 2C1GA 3MX5A 3V6DA 3KLIA 4H03B 4CECA 3LDOA 3RTVA 2G8HA 3GDQA 1VSLA 3UKRA 2YHYA 2YV0X 3V9WA 3PV8A 3O1BA 4BRQA 1VSKA 4O0IA 3QB0A 1OH5A 4MFBA 3WXMB 4RWTA 1BWFO 2F8TA 1CZ9A 1NK7A 3O5BA 4KB1A 5SZTA 2XY5A 1X9SA 1SQKA 2I7PA 4OPAA 2QEXN 3AVFA 4IWVA 3J81O 3LZIA 3AY9A 4DFMA 3OYMA 4M63C 3CPWM 3THYB 4BC2A 1Q82O 4JAXA 3D2FB 5BPLA 3VPZA 3TARA 2QI2A 1REVA 3J7ZO 1RT7A 3M5RA 2R7YA 3SUNA 1VQ5N 4NYNA 2G8UA 4N56A 4PY5A 3D2FA 5F2RA 1YJNN 3K57A 4J2BA 1Q86O 5FDLA 4FW1A 5ADXA 2OANA 4GV3A 2G8VA 5FLXO 3VQDA 5J2QA 4KB0A 2GBZA 4IO9L 3THXA 2ZWHA 3MK6A 3E66A 4Y1CA 3CQXA 3AVCA 4CZFA 1L3SA 1QTMA 3WQUA 5MLCQ 4CIGA 3NDKA 3QNOA 4DS5A 3NCIA 2FBVA 1RDUA 1VSDA 4BREA 3L2QA 1SKWA 4DR4K 4CZIA 1C1CA 4IEIA 1T05A 3UKUA 3DRPA 1JCEA 4I9LA 4BGAA 1N32K 3AGRA 4GNIA 1L3UA 3CF5L 3J7AP 4WYBA 4CGDA 4FVUA 4YNQA 1DGKN 3RMDA 2ZD1A 4CK2A 4BROA 4IEEA 3K5OA 3D45A 1J6ZA 4I6MB 2E88A 3M8RA 1C0TA 2ASMA 1BG3A 3LAMA 2XO7A 5HLFA 3B6PA 4K8XA 3ZT1A 3ZETA 4E1NA 1ASWA 4BRCA 4PL7A 2WOMA 2ZJRL 3BZCA 2HNDA 1C6VA 2A1RA 2ITGA 4A5BA 4F2SA 4FJIA 5AQPA 3AO5A 3MWPA 4YOWA 2UXBK 4CHNA 4M3WA 5DK5A 2FF6A 3EN9A 3N4PA 1QS4A 4M7XA 4CESA 4EP4A 3KLFA 3KD5E 4RTFD 2BGGA 4LF5K 3IMXA 2BE2A 1JLFA 1YVNA 3VQPA 3G10A 5JLHA 4Q5VA 1DLOA 1NMNA 1BGXT 4K43A 4GY2B 5CY4A 4NO7A 5K14A 4JKDA 3FZMA 3HZ6A 4I2QA 3DYAA 1P90A 3P39A 2Z1GA 4IFEA 3MXIA 4BEBA 2P9IB 4AF1A 5GAHP 4JLHA 4CEZA 3TAGA 4BQZA 1ZXOA 4KFBA 2VYPA 4ICLA 4ZHRA 3GOIA 4FPBA 4JKBA 3KTQA 3L4IA 4CGJA 2P9KA 4DLGA 1UOCA 1BQNA 3CCUN 3QERA 3M1FA 2Q3SA 3VOVA 3UKUB 4PQUA 2UUBK 1YXQA 3HTVA 4WCEL 1KCFA 3Q7CA 4HCCA 3ZSXA 2WC9A 4C8MA 1YF5L 3ZSWA 1Q7YO 1ZBIA 4KKOA 2HB5A 4H0XB 3I56N 1YTUA 3KIOA 1E4GT 3MCPA 4G1QA 4BE2A 4CZJA 4BRPA 2ZJPL 2KTQA 1YT3A 3K59A 3KK1A 4LFAK 3P5JA 4AHUA 1K6YA 3JSMA 1K8KB 1XNRK 2FSNA 3VQ8A 1G15A 1TUYA 3K9KA 3PSIA 3O9SA 2OZMA 4OGCA 1NK0A 1VSHA 4OLAA 5J2PA 3OYHA 4FWOA 1S1VA 4CGFA 1E4FT 1TK0A 1SAZA 2ZQBA 3O80A 1BQMA 5KRSA 2AJQA 4R79A 2D0OA 1VQLN 1I39A 3BZKA 4M3TA 3C6UA 3TR8A 2IVOA 3E01A 4JN4A 4DU4A 1U48A 2HMIA 2Q36A 2O8BB 3O6WA 3TAEA 3SUPA 3EYZA 3DAWA 3KLHA 4BDZA 2ZM6K 1LV5A 3MXJA 4KBOA 1RTJA 3KKSA 3THWA 1ATRA 2NLXA 4C8KA 3SLCA 4FWQA 4DV7K 3V1RA 3LWLA 4JK8A 3CQ8A 3NH1A 3CCLN 3FZFA 4B1XB 5AZJB 4NXMK 4CF2A 3SAFA 4DMNA 4XH5A 1GLBG 4H4MA 4H4OA 5EXWA 2Y1JA 1VAZA 4CFCA 4X64K 5C2FA 3S3OA 2W6KA 3A8YA 4FJ7A 2O8DB 1EXQA 4B1VA 1MA9B 3OS2A 3VQ6A 4PKIA 4C1NI 4FZZA 1QQMA 1KLMA 3R9PA 4ISEA 4CJ7A 3CQYA 4BRDA 5C25A 5F1XA 4FJNA 3HOSA 2E4LA 1IV0A 1Q81O 3T69A 1Y64A 3C95A 3AO4A 3EKSA 3RMCA 3UE5A 1Z25A 3ZEUA 3MAQA 4UQGA 3NF6A 3ULDA 2H3GX 1C0UA 3DXMB 3F5TA 4BE0A 1D9DA 5AFUH 1QVGM 2KFZA 3CMEN 1K8AO 3OYGA 1GLJO 2XY7A 1QQOA 2DPNA 1SL0A 3AVKA 3RR8A 3AVIA 4DTRA 3DXKA 1NGBA 4CFAA 3RR7A 1ESVA 1RBRA 4AH9A 4JI5K 1U49A 4LF6K 2P9SA 3TAQA 4KH6A 4BR7A 1S6PA 1FKOA 4B9QA 3T7ZA 3T19A 4CF8A 3P4IA 3DLGA 4BR5A 3ENBA 4JI8K 4BGBA 1EX4A 1BA0A 3PX6A 3O9UA 4B8AB 2ASPA 4U7BA 3G4SN 3D0PA 1E3MA 3CC7N 1Z26A 4C8OA 3Q7BA 3B8AX 3VN5A 3BUZB 2D0CA 3L6QA 5KPRA 3HK2A 1SKSA 2X6SA 3JAMO 3FZLA 1ZBFA 2UYTA 1VSEA 3F9KA 5AQHA 2QKKA 3PX4A 3CXCM 2UXCK 4CGIA 4KHUA 5BR8K 4Z4CA 4PA1A 4CEAA 1RGIA 3IFRA 4IJNA 1JLCA 3KK2A 4E7KA 4DR7K 2A3ZA 4ID1A 1NMDA 4NXNK 4BRFA 3KZBA 3E9LA 3WEEB 4XEIA 2XRIA 4BR0A 4B1UB 4KH5A 4FWKA 3O08A 2IS3A 1KVBA 1HKBA 3THVA 4O8UA 2VQEK 4CD3A 1NJWA 3U3YA 3QEIA 1WSIA 4MO5A 3DLEA 5AQNA 4AHTA 3CCRN 3LDPA 2OYQA 3LPUA 2KZZA 3HP6A 3O9QA 2W6LA 4B3SK 2ASOA 2O8CB 4GKJK 4FJHA 2QWNA 5DMRA 3NFAA 2IOCA 2NRXA 2HBKA 1Q9XA 1SS6A 1Q18A 3MXMA 3VA3A 4FVMA 4GW6A 1IG8A 4JKHA 4ILJA 4KHPK 5JVGL
chains in the Genus database with same CATH topology
3LDQA 2OTJN 3D2EA 3VEYA 4BR9A 3MN5A 4IOAL 2ZF5O 1R59O 5M1KA 3FLCO 4H0PA 3A5OC 3CCMN 5I9EB 1QZ5A 2RE2A 1HLUA 3VF2A 2D1KA 5CR4A 1NGHA 3A5NC 1WUAA 5JVHL 4I6MA 1W97L 4FWSA 3SBGA 2Q0RA 5AQWA 2QWLA 1S72N 2C1GA 3MX5A 3C7NB 1MDUB 4MLHA 5AQIA 3CJ1A 3PIOL 1S22A 3ATUA 1BO5O 4H03B 3CI5A 3KWIA 4A57A 3LDOA 3WXJA 2P9PB 3R6MA 2QWMA 3GDQA 4CD1A 1V4SA 3UKRA 1YJWN 2YHYA 1YHQN 2QWOA 4BRAA 2VCPA 4NB4A 3O1BA 4BRQA 3H1QA 3OA9A 5AQKA 1U2VA 5KPZA 3H3NO 3QB0A 1C0GA 5FPNA 4CZLA 5AQQA 3WXMB 5BREA 3WQTA 1VQ8N 4RWTA 2GTDA 1BWFO 4M7YA 3CJCA 3QBWA 3RVCA 3O5BA 4BVPA 4H0VB 2F9WA 2YI1A 3FR0A 1RDWX 1SQKA 1KAZA 2CH5A 4WQ5C 3W3DA 4EFHA 2I7PA 3CPEA 4OPAA 5CE3A 3QDKA 2QEXN 1BUPA 1T6CA 4IWVA 3HBTA 3AY9A 3E1YA 3CPWM 4M63C 1M90O 4BC2A 1Q82O 4JAXA 3D2FB 4H5VA 5BPLA 1S3XA 3O9TA 3HI0A 3VENA 3LL3A 4ISFA 4KH4A 3VPZA 2QI2A 3J7ZO 3M5RA 5B8HA 1VQ5N 3L4QA 5AR0A 2GELA 3D2FA 3CIPA 5F2RA 1YJNN 1HUXA 3FZKA 5AQMA 2E1ZA 2YJFA 4HTLA 3WEEA 1Q86O 2OTLN 2CH6A 2EWSA 5ADXA 2AA4A 2OANA 3VTIA 3EZWA 4GV3A 3HOTA 1ILYA 4A2BA 5E84A 4NLCA 2FLOA 4MDAA 4F9OA 1QZ6A 2E2NA 3MN7A 2AP1A 1QQNA 3IUCA 4YOVA 4IO8A 3DXMA 4IO9L 4CBUA 1HX1A 3PIPL 4BRLA 4K25A 2ZWHA 1D4XA 3MK6A 4L3QA 3E66A 3CQXA 4CZFA 1XC3A 4YOTA 3MN6A 4JNEA 3J8AA 3KWGA 3VEVA 3WQUA 1YJ9N 5JLFA 3S41A 3H3OB 5MLCQ 3CJAA 3OW2M 3CHWA 2QTDA 3WXKA 4B1WB 5KPTA 4DB3A 4BC4A 1RDUA 2NRTA 3TSPA 1IJJA 2VGMA 1NGCA 4BREA 2KKZA 1KC8O 1GLCG 3CCJN 4CZIA 1CZAN 4IEIA 3SMSA 3UKUA 4BRKA 1GLEG 4XJXA 3BF1A 1JCEA 3IKMA 1HKGA 4BGAA 3TU5A 4H0OA 5BN8A 2QWQA 3AGRA 3MDQA 4GNIA 4YDUC 3TTCA 5GIPA 3CF5L 4WYBA 4FVUA 3EE9A 3O4WA 1M1KO 3L0QA 5FPEA 2ZGYA 1DGKN 3DLLL 3FGUA 4H5WA 3VESA 2E20A 2HF3A 4IEEA 4BROA 1J6ZA 3ZX2A 2ZJQL 3ZX0A 1MWKA 2YCHA 4DKWA 3KK7A 1T6DA 3N4QA 4I6MB 1P8ZA 3VGKA 1QVFM 2Q31A 2E88A 4JD2A 4A5AA 3BF3A 2ASMA 4EAHD 1GLAG 5CHIA 1BG3A 4CI6A 4MLEA 2FSKA 4JEPA 3FFKB 4CBWA 5C12A 3ZETA 3TPQA 4CZGA 5M1QA 4BRCA 4PL7A 2ZJRL 3HRGA 2E2QA 2V7ZA 5M1PA 4YOXA 4JKEA 2NRZA 4A2AA 2KHOA 1NJIO 2Q1NA 4A5BA 1Z6RA 3ZETB 1K9MO 2NNWA 1U2VB 4UY8O 5AQPA 3EL2A 3MWPA 3ZX3A 1XQSC 4YOWA 4NLBA 5TKWA 5F0XA 5GADP 4BRHA 4YOUA 5AFUA 1TUUA 4GV6A 3JS6A 2FF6A 3EN9A 5AQOA 3N4PA 4M7XA 2NRVA 2Q0UA 4RTFD 3R3LA 3IMXA 2VGNA 4HWIA 1LCUA 1YVNA 3MN9A 3C6HA 3CJ9A 3CC2N 2F9TA 5AQGA 4OPHA 5JLHA 5C0YA 3H45C 2BTFA 5M1FA 1X3NA 4XH4A 4K43A 4MO4A 4GY2B 2P9NB 1EO1A 4NO7A 3SMPA 2P9IA 4FWRA 4DQ8A 4JKDA 5GIOA 3FZMA 3HZ6A 3ID8A 5EY4A 1P90A 3P39A 5HL7L 1N8RO 4IFEA 3H6EA 4B1YB 4BEBA 2P9IB 3QFUA 3G71N 2YX6A 4FWNA 4Y0WA 4BC3A 3A5MC 4AF1A 5GAHP 4BG9A 4LC9B 4BQZA 1ZXOA 5JMVA 4CZEA 2VYPA 5C15A 5BRFA 3GOIA 4FPBA 4JKBA 3D2EB 3CJ7A 3L4IA 4FL9A 2P9KA 3JXUA 1X3MA 4PKGA 3CCUN 3HM8A 2A6AA 4JKFA 5AQTA 3M1FA 3VOVA 3F9MA 3UKUB 3SAHA 1YXQA 3HTVA 3VF6A 4WCEL 5BRDA 3GE1A 3Q7CA 2GEMA 4JK7A 3G6EN 2WC9A 2C1IA 5EOYA 1VQPN 1YF5L 3ENOA 2IIRA 1Q7YO 3SK3A 1YAGA 4H0XB 3I56N 3RSEB 1E4GT 2YJEA 3MCPA 4EHTA 2IVNA 3OBWA 3AARA 4CZJA 4BRPA 1NGGA 3KHYA 2ZJPL 1NGDA 3WXIA 5JICA 3CERA 3O1WA 3VMFB 2NRRA 1ATSA 1K8KB 4RCHA 1U6ZA 3ULEB 2FSNA 3NVKA 1T44A 1GLFO 3HSCA 3GL1A 4O8KA 2P9LB 2E2PA 3MMVA 5ELZA 1TUYA 3K9KA 4WQ5A 3O9SA 4QS9A 4K41A 3VEOA 1NM1A 1T3VA 3LDNA 2I7NA 2QM1A 4JHDA 4C1NK 3QMLA 4FWOA 4H5NA 4JD2B 3VERA 1E4FT 1SAZA 4PKHA 1LOTB 3O80A 4BECA 3VEXA 3H46O 5EVZA 2KLAA 4JHDB 4R79A 1OKJA 2D0OA 2J4RA 4BRMA 1VQLN 4YOYA 3ZYYX 4H0TB 4CZMA 3CMAN 2P9SB 3ATVA 2Q97A 3C65A 1NLVA 3ENHA 5C2DA 3ID6A 5DM6L 3UB5A 2CGLA 4BY9C 3I8BA 4FWPA 3SBTA 5KQDA 4IZ9A 3C6AA 1XUPO 3W0LA 1GLDG 2IVOA 4JN4A 1NGJA 2A41A 3TTFA 1JJ2M 3CCVN 3P38A 2CGJA 1NGFA 3U8XA 2Q36A 3O6WA 5BPNA 3G25A 2PAVA 4A62A 1SZ2A 4C23A 2V51B 1W2BM 3GG4A 3TSQA 1VQON 5TKYA 3DAWA 2D0PA 1NGEA 4B1ZA 3VGMA 2ZGZA 4DHYA 3OBYA 1KAXA 2P9UB 2ITMA 3D6RA 4GV9A 5AQXA 2IVPA 1Z05A 4KBOA 2P9PA 5LY3A 2HMPA 1VQ4N 1VQ7N 3U9ZA 4CBXA 3GBTA 1ATRA 5AQFA 2NLXA 4H0YB 1YITN 2P9UA 3SLCA 4FWQA 1NWKA 1YUWA 2NZTA 1DEJA 3D7EO 2WFBA 1NGAA 4CZHA 4JK8A 1VQKN 4XH1A 4YDUA 2YHWA 3A5LC 5FPMA 3CCLN 5AZIB 3FZFA 4B1XB 5AZJB 4E1JA 1ZBSA 5AQZA 3SAFA 3CCQN 3CD6N 3E9PA 3R1XA 1BOTO 1H1VA 1GLBG 4XH5A 3SAGA 5EXWA 3PLAA 1VAZA 5H1SQ 5FPDA 3AAPA 1KQSM 1VQ6N 1BU6O 2P9KB 2QWRA 2A40A 1NBWA 5C2FA 2QXLA 3A8YA 1V4TA 5ADXH 4K42A 2GX9A 3MX2A 4B1VA 1MA9B 1HPMA 4BG8A 4PKIA 1DT9A 3KVGA 2D4WA 4C1NI 1VQNN 4WFNL 1QQMA 4FSVA 4FWLA 3R9PA 4ISEA 4CJ7A 5LJVA 3CQYA 3VF4A 2P9LA 4BRDA 5F1XA 3HOSA 3RSEA 3T69A 1Q81O 1Y64A 2FF3B 3EKSA 4G9ZA 3R8EA 3UE5A 3ZEUA 1EQYA 3NMUA 5HOOA 3E9OA 4WQ4A 3C0BA 2GWKA 3CCSN 5BR9A 3WUHA 3AGKA 4BRIA 2H3GX 2V52B 3K9JA 1NGIA 3DXMB 3U9DA 3F5TA 1VQ9N 2E1YA 5AFUH 3SJHA 1GLLO 4WQ4C 1QVGM 3BEXA 3VEWA 3DJCA 3CMEN 1K8AO 2HF4A 1GLJO 3WXLA 2FSJA 2QW9A 5KQ8A 1BA1A 4H5RA 4BRGA 1ATNA 1QQOA 2DPNA 2NRWA 5DM7L 4OO1J 4BE7B 5AQLA 2F7TA 1YI2N 1BDGA 2NRHA 1KD1O 2JWKA 3DXKA 1NGBA 5AQVA 2W41A 1ESVA 5AQSA 3VTHA 4QS7A 3CETA 3VETA 4BRNA 3LDLA 2P9SA 2RHKA 2Q2RA 2A42A 3EE8A 1KXPA 4KH6A 3F2KA 3WT0A 4BR7A 3DXKB 1QHAA 3T7ZA 4B9QA 4FOIA 5LJWA 2PFUA 3P4IA 4BR5A 3A0IX 3ENBA 3UKRB 4A61A 2JWLA 4EHUA 2QA4N 1DKGD 4BGBA 1BA0A 5C10A 3C7NA 3O9UA 1C0FA 3M3ZA 4JKGB 5AQJA 5GAEP 2ASPA 4BR4A 4U7BA 2A5XA 3IDHA 3LM9A 3G4SN 3AAQA 2FXUA 2E2OA 3VEZA 2W00A 3CC7N 3Q7BA 2PBDA 2WBNA 3B8AX 1HJOA 3BUZB 4JKAA 4YORA 2HSTA 4JKGA 3L6QA 5KPRA 4JKCA 4WFBL 4PL8A 2GUPA 1G99A 5AZJA 3MCAB 4A59A 3FZLA 4JK9A 2UYTA 5E26A 5AQHA 1X9JA 4GVEA 4BR2A 2V7YA 2HOEA 1VQMN 2QWPA 3FE1A 4ILGB 4IXCA 3CXCM 2BH1A 4WFAL 3QICA 5GAGP 2YHXA 1ZC6A 3OHRA 4BQLA 3H1VX 3TTDA 3U4LA 4BVOA 4AM6A 4FWMA 4U67L 1YIJN 3BP8A 4J8FA 2HBLA 1WOQA 4FOEA 5AZIA 4Z94A 3CC4N 1RGIA 2HBMA 3EKUA 3IFRA 4IJNA 5AQRA 4IOCL 3P31A 3QBXA 4BC5A 2A3ZA 1NMDA 4ILHA 4WF9L 2E8AA 4O5FA 3KZBA 4AM7A 3E9LA 4BRFA 3WEEB 4H5TA 3O9RA 3I33A 3NVMA 4XEIA 4BR0A 1OVYA 4IOXA 4B1UB 2BUPA 1RFQA 2HBJA 4KH5A 2VWBA 4FWKA 5BPMA 1K8KA 3O08A 5BN9A 5EX5A 3ULEA 3EO3A 3ZEUB 3CJBA 1HKBA 1K73O 1O13A 4O8UA 4CD3A 1TYQA 4CZKA 1JCGA 3O8MA 4MDBA 3FZHA 4FPAA 4MO5A 5AQNA 1JCFA 3CCRN 1HKCA 3LDPA 4IJAA 5AQUA 3O9QA 3LM2A 5AQYA 2ASOA 2P9NA 1MWMA 3MWTA 5M1OA 5BRHA 3QFPA 1TYQB 2QWNA 2NRXA 4EIAA 3M6GA 4FO0A 2HBKA 4QS8A 1SS6A 4IDHA 5M1NA 3CCEN 1Q18A 3I55N 2W40A 3DWLA 4ISGA 1KAYA 4PHTX 2WUSA 1IG8A 2CGKA 4ILJA 4JKHA 5GINA 3TSUA 4DCHA 5JVGL 3VGLA 2GWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDQ A;  3D2E A;  3VEY A;  4BR9 A;  3MN5 A;  2ZF5 O;  1R59 O;  3FLC O;  4H0P A;  3A5O C;  5I9E B;  1QZ5 A;  1HLU A;  3VF2 A;  2D1K A;  1NGH A;  3A5N C;  1WUA A;  4I6M A;  4FWS A;  2Q0R A;  5AQW A;  2QWL A;  3C7N B;  1MDU B;  4MLH A;  5AQI A;  3CJ1 A;  1S22 A;  3ATU A;  1BO5 O;  4H03 B;  3CI5 A;  3LDO A;  3WXJ A;  2P9P B;  3R6M A;  2QWM A;  3GDQ A;  4CD1 A;  1V4S A;  3UKR A;  2YHY A;  2QWO A;  4BRA A;  2VCP A;  4NB4 A;  3O1B A;  4BRQ A;  3H1Q A;  5AQK A;  1U2V A;  5KPZ A;  3H3N O;  3QB0 A;  1C0G A;  5FPN A;  4CZL A;  5AQQ A;  5BRE A;  3WQT A;  4RWT A;  2GTD A;  1BWF O;  4M7Y A;  3CJC A;  3QBW A;  3O5B A;  4BVP A;  4H0V B;  2F9W A;  2YI1 A;  3FR0 A;  1RDW X;  1SQK A;  1KAZ A;  2CH5 A;  4WQ5 C;  3W3D A;  4EFH A;  2I7P A;  5CE3 A;  3QDK A;  1BUP A;  1T6C A;  4IWV A;  3HBT A;  3AY9 A;  4M63 C;  4BC2 A;  4JAX A;  3D2F B;  4H5V A;  5BPL A;  1S3X A;  3HI0 A;  3VEN A;  3LL3 A;  4ISF A;  3VPZ A;  5B8H A;  5AR0 A;  2GEL A;  3D2F A;  3CIP A;  5F2R A;  1HUX A;  3FZK A;  5AQM A;  2E1Z A;  2YJF A;  4HTL A;  3WEE A;  2CH6 A;  2EWS A;  5ADX A;  2AA4 A;  2OAN A;  3EZW A;  4A2B A;  5E84 A;  2FLO A;  4F9O A;  1QZ6 A;  2E2N A;  3MN7 A;  3IUC A;  2AP1 A;  1QQN A;  4IO8 A;  3DXM A;  4CBU A;  1HX1 A;  4BRL A;  4K25 A;  2ZWH A;  1D4X A;  3MK6 A;  4L3Q A;  3CQX A;  4CZF A;  1XC3 A;  3MN6 A;  4JNE A;  3J8A A;  3VEV A;  3WQU A;  5JLF A;  3S41 A;  3H3O B;  3CJA A;  3CHW A;  3WXK A;  4B1W B;  5KPT A;  4DB3 A;  4BC4 A;  1IJJ A;  1NGC A;  4BRE A;  1GLC G;  4CZI A;  1CZA N;  3SMS A;  3UKU A;  4BRK A;  1GLE G;  3BF1 A;  1JCE A;  1HKG A;  4BGA A;  3TU5 A;  4H0O A;  5BN8 A;  2QWQ A;  3MDQ A;  4GNI A;  4YDU C;  4WYB A;  3O4W A;  3L0Q A;  5FPE A;  2ZGY A;  1DGK N;  3FGU A;  4H5W A;  3VES A;  2E20 A;  2HF3 A;  4BRO A;  1J6Z A;  3ZX2 A;  3ZX0 A;  1MWK A;  2YCH A;  1T6D A;  4I6M B;  1P8Z A;  3VGK A;  2Q31 A;  2E88 A;  4JD2 A;  3BF3 A;  2ASM A;  4EAH D;  1GLA G;  1BG3 A;  4CI6 A;  4MLE A;  2FSK A;  3FFK B;  4CBW A;  3ZET A;  3TPQ A;  4CZG A;  4BRC A;  4PL7 A;  2E2Q A;  2V7Z A;  4A2A A;  2KHO A;  2Q1N A;  1Z6R A;  3ZET B;  1U2V B;  5AQP A;  3EL2 A;  3ZX3 A;  1XQS C;  5F0X A;  4BRH A;  5AFU A;  1TUU A;  3JS6 A;  2FF6 A;  3EN9 A;  5AQO A;  4M7X A;  2Q0U A;  4RTF D;  3IMX A;  4HWI A;  1LCU A;  1YVN A;  3MN9 A;  3CJ9 A;  2F9T A;  5AQG A;  5JLH A;  3H45 C;  2BTF A;  1X3N A;  4XH4 A;  4K43 A;  4MO4 A;  4GY2 B;  2P9N B;  4NO7 A;  3SMP A;  2P9I A;  4FWR A;  4DQ8 A;  3FZM A;  3HZ6 A;  3ID8 A;  5EY4 A;  4B1Y B;  3H6E A;  2P9I B;  3QFU A;  4FWN A;  4Y0W A;  4BC3 A;  3A5M C;  4BG9 A;  4LC9 B;  4BQZ A;  1ZXO A;  5JMV A;  4CZE A;  2VYP A;  5BRF A;  3GOI A;  4FPB A;  3D2E B;  3CJ7 A;  3L4I A;  4FL9 A;  3JXU A;  2P9K A;  1X3M A;  4PKG A;  3HM8 A;  2A6A A;  5AQT A;  3M1F A;  3VOV A;  3F9M A;  3UKU B;  1YXQ A;  3HTV A;  3VF6 A;  5BRD A;  3GE1 A;  2GEM A;  5EOY A;  3ENO A;  2IIR A;  3SK3 A;  1YAG A;  4H0X B;  3RSE B;  1E4G T;  2YJE A;  3MCP A;  4EHT A;  2IVN A;  4CZJ A;  3AAR A;  4BRP A;  1NGG A;  3KHY A;  1NGD A;  3WXI A;  5JIC A;  3CER A;  3O1W A;  1ATS A;  1K8K B;  4RCH A;  1U6Z A;  3ULE B;  2FSN A;  1T44 A;  1GLF O;  3HSC A;  3GL1 A;  4O8K A;  2P9L B;  2E2P A;  3MMV A;  5ELZ A;  1TUY A;  4WQ5 A;  3VEO A;  4QS9 A;  4K41 A;  1NM1 A;  3LDN A;  2I7N A;  2QM1 A;  4JHD A;  3QML A;  4FWO A;  4H5N A;  4JD2 B;  3VER A;  1E4F T;  1SAZ A;  4PKH A;  1LOT B;  3O80 A;  3VEX A;  3H46 O;  5EVZ A;  4JHD B;  1OKJ A;  2D0O A;  2J4R A;  4BRM A;  4H0T B;  4CZM A;  2P9S B;  3ATV A;  2Q97 A;  1NLV A;  3ENH A;  3UB5 A;  2CGL A;  3I8B A;  4FWP A;  5KQD A;  4IZ9 A;  1XUP O;  3W0L A;  1GLD G;  2IVO A;  4JN4 A;  1NGJ A;  2A41 A;  2CGJ A;  1NGF A;  3U8X A;  2Q36 A;  3O6W A;  5BPN A;  3G25 A;  2PAV A;  4A62 A;  1SZ2 A;  4C23 A;  2V51 B;  3GG4 A;  5TKY A;  3DAW A;  2D0P A;  1NGE A;  4B1Z A;  3VGM A;  2ZGZ A;  4DHY A;  1KAX A;  2P9U B;  2ITM A;  5AQX A;  2IVP A;  1Z05 A;  4KBO A;  2P9P A;  5LY3 A;  2HMP A;  3U9Z A;  4CBX A;  3GBT A;  1ATR A;  5AQF A;  2NLX A;  4H0Y B;  2P9U A;  3SLC A;  4FWQ A;  1NWK A;  1YUW A;  2NZT A;  1DEJ A;  3D7E O;  1NGA A;  4CZH A;  4XH1 A;  4YDU A;  2YHW A;  3A5L C;  5FPM A;  5AZI B;  3FZF A;  4B1X B;  5AZJ B;  4E1J A;  1ZBS A;  5AQZ A;  1BOT O;  1H1V A;  1GLB G;  4XH5 A;  5EXW A;  5FPD A;  3AAP A;  1BU6 O;  2P9K B;  2QWR A;  2A40 A;  1NBW A;  2QXL A;  3A8Y A;  1V4T A;  5ADX H;  4K42 A;  4B1V A;  1MA9 B;  1HPM A;  4BG8 A;  4PKI A;  3KVG A;  2D4W A;  1QQM A;  4FSV A;  4FWL A;  3R9P A;  4ISE A;  4CJ7 A;  5LJV A;  3CQY A;  3VF4 A;  2P9L A;  4BRD A;  5F1X A;  3RSE A;  1Y64 A;  2FF3 B;  3EKS A;  3R8E A;  3UE5 A;  3ZEU A;  1EQY A;  4WQ4 A;  3C0B A;  2GWK A;  5BR9 A;  3WUH A;  4BRI A;  2H3G X;  2V52 B;  1NGI A;  3DXM B;  3U9D A;  2E1Y A;  5AFU H;  3SJH A;  1GLL O;  4WQ4 C;  3BEX A;  3VEW A;  3DJC A;  2HF4 A;  1GLJ O;  3WXL A;  2FSJ A;  2QW9 A;  5KQ8 A;  1BA1 A;  4H5R A;  4BRG A;  1ATN A;  1QQO A;  2DPN A;  5AQL A;  1BDG A;  2NRH A;  5AQV A;  3DXK A;  1NGB A;  2W41 A;  1ESV A;  5AQS A;  4QS7 A;  3CET A;  3VET A;  4BRN A;  3LDL A;  2P9S A;  2Q2R A;  2A42 A;  1KXP A;  3WT0 A;  4BR7 A;  3DXK B;  1QHA A;  4B9Q A;  4FOI A;  5LJW A;  3P4I A;  4BR5 A;  3A0I X;  3UKR B;  4A61 A;  4EHU A;  1DKG D;  4BGB A;  1BA0 A;  3C7N A;  1C0F A;  3M3Z A;  5AQJ A;  2ASP A;  4BR4 A;  2A5X A;  3IDH A;  3LM9 A;  3AAQ A;  2FXU A;  2E2O A;  3VEZ A;  2PBD A;  3B8A X;  1HJO A;  3BUZ B;  3L6Q A;  5KPR A;  4PL8 A;  2GUP A;  1G99 A;  5AZJ A;  3FZL A;  2UYT A;  5E26 A;  5AQH A;  1X9J A;  4BR2 A;  2V7Y A;  2HOE A;  2QWP A;  3FE1 A;  4IXC A;  3QIC A;  2YHX A;  1ZC6 A;  3OHR A;  4BQL A;  3H1V X;  3U4L A;  4BVO A;  4AM6 A;  4FWM A;  3BP8 A;  4J8F A;  1WOQ A;  4FOE A;  5AZI A;  4Z94 A;  1RGI A;  3EKU A;  3IFR A;  4IJN A;  5AQR A;  3QBX A;  4BC5 A;  2A3Z A;  1NMD A;  2E8A A;  4O5F A;  3KZB A;  4AM7 A;  4BRF A;  3WEE B;  4H5T A;  3I33 A;  4XEI A;  4BR0 A;  4B1U B;  2BUP A;  1RFQ A;  2VWB A;  4FWK A;  5BPM A;  1K8K A;  3O08 A;  5BN9 A;  5EX5 A;  3ULE A;  3EO3 A;  3ZEU B;  3CJB A;  1HKB A;  4CD3 A;  1TYQ A;  4CZK A;  1JCG A;  3O8M A;  3FZH A;  4FPA A;  4MO5 A;  5AQN A;  1JCF A;  1HKC A;  3LDP A;  4IJA A;  5AQU A;  3LM2 A;  5AQY A;  2ASO A;  2P9N A;  1MWM A;  5BRH A;  3QFP A;  1TYQ B;  2QWN A;  4EIA A;  3M6G A;  4FO0 A;  4QS8 A;  1Q18 A;  2W40 A;  3DWL A;  4ISG A;  1KAY A;  2WUS A;  1IG8 A;  2CGK A;  4DCH A;  3VGL A;  2GWJ A; 
#chains in the Genus database with same CATH topology
 4DSE A;  3MN5 A;  2ZF5 O;  2XHB A;  1XNQ K;  5KGX A;  4LSL A;  1TAQ A;  1A5W A;  5JEN A;  3A5N C;  3OYE A;  1WUA A;  1W97 L;  3ZSV A;  5CZ2 A;  4E7H A;  3ATU A;  1BO5 O;  5JS2 A;  1VSF A;  3KWI A;  4DU1 A;  4OPJ A;  1FJG K;  2EHG A;  1YJW N;  5C24 A;  1QQC A;  2QWO A;  2VCP A;  2B6A A;  4NB4 A;  3H1Q A;  3OA9 A;  5AQK A;  5KPZ A;  1FK9 A;  1LWC A;  5AQQ A;  5BRE A;  3WQT A;  3SQ1 A;  4B9S A;  3THY A;  3BGR A;  3FR0 A;  3W3D A;  4EFH A;  5CE3 A;  1UAX A;  3QDK A;  1T6C A;  1XMQ K;  1RIL A;  2YKN A;  1S3X A;  3AVH A;  3O9T A;  5CYQ A;  4B08 A;  5J2N A;  2Z1H A;  5B8H A;  2E6L A;  1NK6 A;  5AR0 A;  1IBL K;  4N76 A;  3NF8 A;  4B8C A;  1HUX A;  3FZK A;  3ZSZ A;  2OTL N;  3L2U A;  3PX0 A;  1RTD A;  3VTI A;  4HUE A;  3HOT A;  1ILY A;  4A2B A;  2EX3 A;  5E84 A;  1HR0 K;  4NLC A;  2FLO A;  4MDA A;  4F9O A;  2E2N A;  3IUC A;  1QQN A;  3DXM A;  3JYT A;  4DV0 K;  2QKB A;  2UUC K;  4BRL A;  4K25 A;  1NK5 A;  3BY5 A;  4QCL A;  4F3O A;  1TV6 A;  4YOT A;  4CIE A;  2X74 A;  3J8A A;  3AVB A;  3VEV A;  3S41 A;  1JL1 A;  2Z1J A;  2RPI A;  4DB3 A;  4BC4 A;  2VG7 A;  5IT9 O;  4JYA K;  1C1B A;  2JGU A;  3HP9 A;  3TU5 A;  5BN8 A;  2QWQ A;  5GIP A;  1BIZ A;  3TTC A;  3CFP A;  4I9Q A;  5FPE A;  3DLL L;  3FGU A;  3AVJ A;  4H5W A;  4DSF A;  4JV5 K;  4PWD A;  3ZX2 A;  3KK7 A;  2Q31 A;  4A5A A;  2ZE2 A;  3BF3 A;  2Z1I A;  1TKD A;  4NCA A;  5CHI A;  4CI6 A;  4JEP A;  3V9S A;  3I8D A;  3TPQ A;  1TL1 A;  5M1Q A;  2E2Q A;  4AHC A;  4JKE A;  3ZLJ A;  4Z4I A;  1NJI O;  1WN7 A;  2Q1N A;  1K9M O;  1NKE A;  3OYC A;  3EL2 A;  5JS1 A;  5TKW A;  3WNH A;  5GAD P;  1XHZ A;  3VQ7 A;  4BRH A;  4YOU A;  1NNE A;  1FW6 A;  1N33 K;  1TUU A;  3JS6 A;  2OCE A;  3AA4 A;  2Q0U A;  1NOZ A;  3SYZ A;  4CGH A;  3C6H A;  4OVL A;  3DLH A;  2F9T A;  4M3Z A;  5AQG A;  3OYJ A;  4OPH A;  1RDD A;  3K5N A;  5M1F A;  1X3N A;  4FJK A;  2X78 A;  2HHV A;  1EO1 A;  3TAM A;  3ID8 A;  5EY4 A;  2DTU A;  1N8R O;  4B1Y B;  2YX6 A;  4DV1 K;  3A5M C;  1VRU A;  4LC9 B;  5JMV A;  3M8P A;  4CZE A;  5C15 A;  1N34 K;  3JXU A;  4JKF A;  5AQT A;  4BE1 A;  3ISN C;  2O8D A;  3F9M A;  3SAH A;  3GE1 A;  3G6E N;  4X66 K;  1A5V A;  2C1I A;  1WNS A;  3V9U A;  3AO3 A;  3RSE B;  4KI6 A;  2IVN A;  1NGG A;  3KHY A;  4CFD A;  2PZS A;  3WXI A;  4YY3 K;  3O1W A;  1NJX A;  1JXE A;  4CHP A;  3VMF B;  4J2A A;  3LAN A;  1RT6 A;  4FJ8 A;  4O8K A;  2P9L B;  5KTQ A;  2PYL A;  3MMV A;  5ELZ A;  4KHW A;  4DU3 A;  1T3V A;  4W5Q A;  2QM1 A;  2YHB A;  3A2F A;  4H5N A;  4CHO A;  3IS9 A;  1LOT B;  3VEX A;  2KLA A;  1RBT A;  1S9G A;  4IDK A;  2P9S B;  1NLV A;  2Y1I A;  1TKZ A;  2CGL A;  4FWP A;  4IZ9 A;  3S5T A;  2HHX A;  1GLD G;  2YKM A;  1S1W A;  1JL2 A;  1JJ2 M;  1ZBH A;  3S3N A;  3G25 A;  1QE1 A;  3ZT3 A;  4A62 A;  2RKI A;  3NE6 A;  5TKY A;  3SQ2 A;  1A5X A;  5FRN A;  4HHT A;  4H8K A;  2P9U B;  2ITM A;  4LFB K;  2IVP A;  4FCY A;  2P5O A;  2P9P A;  4W5O A;  3U9Z A;  2HHT A;  4CBX A;  1IKW A;  3GBT A;  3OYB A;  1VSJ A;  1TKX A;  4B9V A;  4FJJ A;  2UXD K;  2WFB A;  5HBM A;  4CZH A;  2E5L K;  3HPH A;  2YHW A;  3DOK A;  5FPM A;  3HM9 A;  1W0H A;  2DFH A;  5FRO A;  4DSK A;  3CCQ N;  1BOT O;  5H1S Q;  1TK8 A;  1SKR A;  4BWJ A;  3SUQ A;  1BU6 O;  2QWR A;  3LDS A;  2QXL A;  1JLA A;  5ADX H;  2G8K A;  2GX9 A;  2HHI A;  4BG8 A;  4FYD A;  3KVG A;  2D4W A;  3HYF A;  1VQN N;  4FSV A;  5LJV A;  1HYV A;  4DF4 A;  1UA1 A;  3B6O A;  4DQS A;  3M8S A;  2FF3 B;  4G9Z A;  3PUF A;  4GMJ B;  4CGG A;  1CZB A;  1BI4 A;  2YHA A;  1GOA A;  2F8S A;  3CCS N;  3OS1 A;  2OA8 A;  2V52 B;  3MEE A;  3K9J A;  4TSX A;  1WAF A;  4CJU A;  1VQ9 N;  1TKT A;  2E1Y A;  3BEX A;  4XIU A;  4FLV A;  4KV8 A;  3O3G A;  3ZCM A;  4F3T A;  5KQ8 A;  1BA1 A;  4BRG A;  3NHG A;  1ATN A;  4BE7 B;  5DM7 L;  4RG8 A;  3HL8 A;  1YI2 N;  2NRH A;  4BWM A;  3TI0 A;  3EZ5 A;  1KD1 O;  5AQS A;  3VTH A;  3VET A;  1ASU A;  5HRR A;  2A42 A;  5J2M A;  3WT0 A;  1IG9 A;  3DXK B;  3K5L A;  5T7B A;  3S3M A;  3NAE A;  3VQ9 A;  2QA4 N;  1F21 A;  3AA3 A;  1RNH A;  4QOZ B;  5C10 A;  3C7N A;  1C0F A;  4JKG B;  5AQJ A;  5GAE P;  3IDH A;  2IC3 A;  2W00 A;  4J2D A;  3MED A;  1S1X A;  1SL1 A;  4YOR A;  1RDA A;  4JKC A;  4JI3 K;  2GUP A;  1N5Y A;  4DTN A;  4GVE A;  2V7Y A;  1VQM N;  2QWP A;  4WFA L;  5GAG P;  4BQL A;  1ZC6 A;  4CHZ A;  4RW9 A;  1RT5 A;  4FWM A;  3CC4 N;  4FOE A;  1C0M A;  1OH6 A;  1HJR A;  4K0K K;  3P31 A;  4BC5 A;  4KRE A;  2B4J A;  4ILH A;  4FZX C;  3L2V A;  3OYN A;  3NH2 A;  1WBB A;  2BDP A;  1OVY A;  1RFQ A;  2HBJ A;  2VWB A;  1K8K A;  1WSH A;  3CJB A;  3VQQ A;  3IG1 A;  1DTQ A;  4CJT A;  1TYQ A;  4CZK A;  1JCG A;  4N5S A;  4DSI A;  1ASV A;  1HKC A;  2OZS A;  5AQU A;  5FRM A;  2D0B A;  3MWT A;  5BRH A;  1TYQ B;  3CM5 A;  2OPS A;  3KKR A;  3M6G A;  4QS8 A;  3AA2 A;  3RWU A;  4LD0 A;  1QSY A;  3CCE N;  1HYS A;  3I55 N;  2W40 A;  4KPY A;  1XI1 A;  1BI4 B;  4DLE A;  1KAY A;  3TSU A;  2GWJ A;  2FSJ A;  3LDQ A;  1S1T A;  1JLG A;  1I3A A;  3VEY A;  4FK4 A;  1JLB A;  4LF8 K;  4FM0 A;  4H0P A;  4FJM A;  3A5O C;  1QZ5 A;  2RE2 A;  5KRT A;  2OPP A;  4DTP A;  4ELV A;  4HVJ A;  3SBG A;  3P83 D;  1WAJ A;  2QWL A;  2G8F A;  4CJS A;  5AQI A;  3OVN A;  2F4V K;  3PIO L;  1S22 A;  3LAK A;  4LFC K;  3WXJ A;  2QWM A;  3ZSQ A;  4CD1 A;  1EKE A;  3KK3 A;  3THW B;  2HW3 A;  1NKB A;  3VQA A;  1WBD A;  4CFB A;  3J7Y P;  1JXB A;  3H3N O;  3MEG A;  1C0G A;  2HHS A;  4CZL A;  4KO0 A;  4OLB A;  3AO1 A;  3RVC A;  3NF7 A;  4BVP A;  4OX9 K;  4H0V B;  2GV9 A;  3LP1 A;  3OYI A;  2CH5 A;  1KAZ A;  2XY6 A;  4KHS A;  4DFK A;  3HBT A;  4ELU A;  3RRG A;  4E19 A;  1M90 O;  3QEP A;  4LF4 K;  3O4N A;  2HNZ A;  4H5V A;  3LL3 A;  4ISF A;  1HPZ A;  4KH4 A;  3WNE A;  2FC0 A;  3CYM A;  4GVM A;  1VHX A;  4YFU A;  4JI7 K;  2E1Z A;  4X65 K;  2EWS A;  4FLY A;  2AA4 A;  3EZW A;  3WNF A;  4CK3 A;  4YHH K;  1QZ6 A;  4YOV A;  4IO8 A;  4CBU A;  3PIP L;  1D4X A;  4L3Q A;  1VRT A;  2WTU A;  3C6T A;  4DR2 K;  1T8E A;  2O8C A;  1XC3 A;  1TL3 A;  3MN6 A;  4JNE A;  5JLF A;  1LW0 A;  1SUQ A;  3HVT A;  3CJA A;  3OW2 M;  1RBS A;  3WXK A;  4JI0 K;  4B1W B;  1RTH A;  1IKV A;  4CF0 A;  4BDY A;  5AJ3 K;  4ZTJ A;  1IJJ A;  2VGM A;  1NGC A;  2KKZ A;  3AVG A;  3NBP A;  4OGE A;  1KC8 O;  3FFI A;  1CLQ A;  1GLE G;  4XJX A;  1BL3 A;  1HKG A;  4HUG A;  4H0O A;  3MDQ A;  4YDU C;  2QK9 A;  2G8I A;  1M1K O;  3L0Q A;  2ZGY A;  3VES A;  2HF3 A;  1RBV A;  1SV5 A;  3P1G A;  3VQB A;  1OVQ A;  4F8R A;  1MWK A;  2YCH A;  3N4Q A;  1QVF M;  4JD2 A;  4DR3 K;  1GLA G;  2FSK A;  3SV3 A;  1KVA A;  3FFK B;  3AVM A;  4CZG A;  1L3T A;  4W5T A;  1RDC A;  2V7Z A;  5M1P A;  4YOX A;  3TAN A;  1W7A A;  1RT3 A;  4A2A A;  2KHO A;  2DFE A;  1I94 K;  4KI4 A;  3ZET B;  2NNW A;  4CJ4 A;  4LH5 A;  3ZX3 A;  3LP2 A;  4CJR A;  1XQS C;  3PO4 A;  4NLB A;  1BCM A;  4W5R A;  2JLE A;  4GV6 A;  3EEQ A;  3H08 A;  4F2R A;  3HT3 A;  1ZBL A;  4DR1 K;  3AVN A;  1J5O A;  4B9T A;  5HRO A;  1VSM A;  3R3L A;  3K0S A;  1IKX A;  4O5B A;  4OKJ A;  3CFR A;  4HWI A;  3CJ9 A;  3ALY A;  5LL6 Z;  1NG9 A;  3CC2 N;  3EY1 A;  4AQY K;  5C0Y A;  3H45 C;  2BTF A;  4XH4 A;  4DUZ K;  4MO4 A;  1XWL A;  2P9N B;  1D8Y A;  2P9I A;  1YTA A;  4DQ8 A;  4DQQ A;  1NK4 A;  4DWI A;  5GIO A;  3THX B;  1N36 K;  1WSF A;  1BHL A;  4DR5 K;  4FLU A;  3QIO A;  3QFU A;  4Y0W A;  2HVI A;  4BG9 A;  1KFS A;  1T03 A;  3DRR A;  3LZJ A;  4I7F A;  1MU2 A;  2B5J A;  3D2E B;  3CJ7 A;  2A6A A;  3L2R A;  4KHY A;  3VF6 A;  5BRD A;  4JK7 A;  2GEM A;  1IH7 A;  4FW2 A;  5EOY A;  1HQU A;  3SK3 A;  4CEO A;  1YAG A;  2A1S A;  2HVH A;  2YJE A;  1TK5 A;  3NH0 A;  3AAR A;  3ZSY A;  3QO9 A;  3KLG A;  2VWJ A;  2HHH K;  5JIC A;  2OPR A;  4O44 A;  2NRR A;  4FM1 A;  1KTQ A;  3NVK A;  1T44 A;  1GLF O;  3GL1 A;  2E2P A;  3OYF A;  4FJG A;  4B3O A;  1NM1 A;  4I2P A;  2I7N A;  2ATQ A;  4JHD A;  4C1N K;  3QML A;  1B9F A;  1BIS A;  1S9E A;  3H46 O;  5EVZ A;  2FBX A;  4CIF A;  4JHD B;  5SWM A;  1QSL A;  1FXX A;  1Q8I A;  3NGI A;  1OKJ A;  3LP3 A;  2J4R A;  4BRM A;  3RRH A;  4H0T B;  4CZM A;  3CMA N;  1HMV A;  3ATV A;  2Q97 A;  3C65 A;  4BDP A;  5C2D A;  5DM6 L;  3UB5 A;  3I8B A;  5KQD A;  3V1Q A;  3OY9 A;  3W0L A;  4DV5 K;  3G0Z A;  4DV6 K;  2A41 A;  4X62 K;  2CGJ A;  4KTZ A;  1NGF A;  4M3U A;  2I5J A;  1KSP A;  3HVR A;  1RT2 A;  4C23 A;  1W2B M;  3RMA A;  4CER A;  2UUA K;  4FK2 A;  2D0P A;  1NGE A;  4IG3 A;  3VGM A;  2ZGZ A;  4DHY A;  3OBY A;  4NYF A;  4GV9 A;  1JKH A;  5AQX A;  2HHU A;  5LY3 A;  2HMP A;  4M3R A;  2GUI A;  4AIL C;  1RDB A;  4CJP A;  1NU0 A;  1YIT N;  1DEJ A;  3L2W A;  1NGA A;  3DM2 A;  3V4I A;  1VQK N;  4YDU A;  4CEB A;  3A5L C;  1WSE A;  2YNH A;  3CD6 N;  3R1X A;  3SAG A;  2E6M A;  3AAP A;  4Z0U A;  4DTS A;  1NBW A;  5I3U A;  5KGW A;  3OYA A;  1HPM A;  4LF9 K;  4KAZ A;  3LPT A;  3T3F A;  3VF4 A;  4K8Z A;  2O8F B;  1NK8 A;  1Q9Y A;  1IBM K;  1U04 A;  3R8E A;  1EQY A;  1L5U A;  4Z4F A;  3QES A;  3VQ5 A;  3E9O A;  4WQ4 A;  4M41 A;  2GWK A;  3NGZ A;  3WUH A;  3I0S A;  3OYD A;  4PUO A;  3AGK A;  4BRI A;  3V1O A;  1O1W A;  1NGI A;  4M3Y A;  3U9D A;  3K5M A;  3SJH A;  1B9D A;  1GLL O;  2YNI A;  4WQ4 C;  3T1Y K;  3OS0 A;  4LF7 K;  3ITH A;  1B92 A;  3WXL A;  2QW9 A;  4H5R A;  4OO1 J;  2P51 A;  5AQL A;  5D3G A;  4MQ3 A;  1NK9 A;  1BDG A;  1LWF A;  1OH7 A;  2JWK A;  5AQV A;  4QS7 A;  3CET A;  3EE8 A;  1KXP A;  4CK1 A;  1WSG A;  1IBK K;  3CYG A;  1QHA A;  3IRX A;  5A2Q O;  1BCO A;  5LJW A;  2PFU A;  4DSJ A;  3A0I X;  4CW7 B;  4E0D A;  2JWL A;  4EHU A;  1CXU A;  3M3Z A;  4BR4 A;  3SQ4 A;  2A5X A;  4CCH A;  4DFP A;  3UIQ A;  4IKF A;  2VG6 A;  3AAQ A;  2FXU A;  3VEZ A;  4M42 A;  2PBD A;  1HJO A;  4JKA A;  4QAG A;  2HST A;  2VWK A;  4JKG A;  4FLT A;  1ITG A;  1U4B A;  4FZY A;  1WSJ A;  1IO2 A;  4KHQ A;  5AZJ A;  4JK9 A;  2D0A A;  5E26 A;  1X9J A;  3QIP A;  5C42 A;  3F73 A;  3T1H K;  4IXC A;  2BH1 A;  4LSN A;  4HCB A;  4B9N A;  2G8W A;  3OHR A;  2VQF K;  3H1V X;  3TTD A;  3TAB A;  4W5N A;  4BVO A;  2LSN A;  4AM6 A;  1U45 A;  4CJL A;  1YIJ N;  4U67 L;  3BP8 A;  4J8F A;  3KD1 E;  2HBL A;  4Z94 A;  5AZI A;  2HBM A;  3QBX A;  3L3U A;  4WF9 L;  3ZSO A;  2E8A A;  4FLX A;  4H5T A;  3O9R A;  4CJW A;  4JS5 A;  3NVM A;  4FJL A;  4IOX A;  2BUP A;  5BPM A;  3ULE A;  5BN9 A;  5EX5 A;  3QEW A;  1CXQ A;  1J5E K;  1O13 A;  4MDB A;  3FZH A;  1JCF A;  3V9X A;  4FLZ A;  2O8E A;  3DLR A;  2O8F A;  2KW4 A;  1EP4 A;  4EIA A;  4FO0 A;  4Z4E A;  4IDH A;  4FJX A;  4DUY K;  4ISG A;  2DFF A;  1ZYQ A;  4PHT X;  2WUS A;  4E3S A;  3QIN A;  3SCX A;  4DCH A;  3VGL A;  3SI6 A;  2OTJ N;  3D2E A;  4BR9 A;  5M1K A;  1R59 O;  4DQP A;  5I9E B;  1HLU A;  3VA0 A;  2D1K A;  1OH8 A;  4NCG A;  3QEV A;  4Z4G A;  1NGH A;  5JVH L;  4I6M A;  4FWS A;  2Q0R A;  5AQW A;  1S72 N;  4CJF A;  3C7N B;  1MDU B;  4MLH A;  3CJ1 A;  1LAV A;  1TVR A;  4KRF A;  3CI5 A;  3LP0 A;  4A57 A;  4CJK A;  1NOY A;  2P9P B;  3R6M A;  1V4S A;  1DTT A;  4CED A;  5HP1 A;  4CF9 A;  3AO2 A;  1YHQ N;  4BRA A;  5HRN A;  3PY8 A;  4M45 A;  1J9A A;  1U2V A;  5EU7 A;  1VSI A;  5FPN A;  1NKC A;  3SQ0 A;  1VQ8 N;  2GTD A;  4B3T K;  4F4K A;  4M7Y A;  4R5P A;  3CJC A;  3QBW A;  2F9W A;  2YI1 A;  1RDW X;  4WQ5 C;  4KHN A;  2RN2 A;  1JLE A;  3CPE A;  1BUP A;  1S1U A;  3HJF A;  4B3R K;  1RT4 A;  4FJ5 A;  3E1Y A;  2BAN A;  1J54 A;  3ZT4 A;  4CEQ A;  3HI0 A;  4ELT A;  4J2E A;  3VEN A;  3L4Q A;  4CE9 A;  3KJV A;  2GEL A;  3CIP A;  5AQM A;  2F96 A;  2YJF A;  4HTL A;  3ZSR A;  4FJ9 A;  3QLH A;  3WEE A;  1RT1 A;  2CH6 A;  3M8Q A;  5LMN K;  5LMU K;  3MN7 A;  2AP1 A;  2IGI A;  2D5R A;  1HX1 A;  1U47 A;  3DLB A;  1NJY A;  1L3V A;  4EZ6 A;  4JI4 K;  1UA0 A;  4OKK A;  3MEC A;  3PSF A;  3KWG A;  1YJ9 N;  3H3O B;  3CHW A;  3TWH A;  2QTD A;  3SUO A;  5KPT A;  3CFO A;  2X6N A;  4EP5 A;  2NRT A;  3TSP A;  1GLC G;  3CCJ N;  4HUF A;  1CZA N;  1IKY A;  3SMS A;  4DTJ A;  2UU9 K;  4BRK A;  1ZBU A;  3BF1 A;  3IKM A;  4IG0 A;  1XHX A;  2ETJ A;  1KFD A;  3SNN A;  3EE9 A;  3O4W A;  2P1J A;  1HNZ K;  3T1A A;  2E20 A;  4ZTF A;  1WB9 A;  4DQR A;  2ZJQ L;  3ZX0 A;  4DKW A;  2RF2 A;  4IFV A;  1T6D A;  3BDP A;  1P8Z A;  3VGK A;  4EAH D;  5J1E A;  3OYK A;  4MLE A;  4CBW A;  5E41 A;  5C12 A;  4CEF A;  3K58 A;  3HRG A;  1GOB A;  4DR6 K;  2NRZ A;  5HRS A;  4L8R B;  4DF8 A;  3AA5 X;  1Z6R A;  4CJV A;  1U2V B;  4UY8 O;  4CJ3 A;  4O4G A;  5F0X A;  4RW7 A;  2FBY A;  2YNF A;  5AFU A;  1LW2 A;  3HXM A;  5AQO A;  3KLE A;  2NRV A;  4N47 A;  4RW6 A;  4OKE A;  2VGN A;  2IDO A;  1LCU A;  3MN9 A;  4V19 S;  1HYZ A;  3PO5 A;  1HNX K;  2O8E B;  3SMP A;  4FWR A;  3SPY A;  1XC9 A;  5HL7 L;  3H6E A;  3G71 N;  4FWN A;  4BC3 A;  4CJE A;  2HHQ A;  3CG7 A;  5BRF A;  4FL9 A;  4DTO A;  2OPQ A;  1X3M A;  4PKG A;  1KLN A;  3HM8 A;  3O3F A;  4OJR A;  3ZT0 A;  3AV9 A;  3U3G A;  3VQE A;  3VQ4 A;  2O4I A;  1VQP N;  5HRP A;  3TAP A;  4CJQ A;  3ENO A;  2IIR A;  3AVL A;  4DTU A;  4ID5 A;  4LH4 A;  4EHT A;  1W9H A;  3OBW A;  2VG5 A;  2KZM A;  3OJS A;  3AVA A;  1NGD A;  1HNW K;  4O55 A;  3CER A;  1ATS A;  3ULE B;  4RCH A;  1U6Z A;  3V81 A;  4NCB A;  3C94 A;  3HSC A;  1FKP A;  3VEO A;  4WQ5 A;  4QS9 A;  4K41 A;  4DV3 K;  5I42 A;  4DSL A;  3ZT2 A;  3LDN A;  3OTO K;  1LAW A;  4JD2 B;  3VER A;  1X9M A;  2HHW A;  4PKH A;  1RBU A;  4BEC A;  4IBN A;  3HST B;  4DQI A;  3U6F A;  3HO1 A;  4YOY A;  3ZYY X;  3ENH A;  3ID6 A;  4BY9 C;  3SBT A;  2O8B A;  3C6A A;  1XUP O;  1NGJ A;  3HPG A;  3TTF A;  3O4Q A;  3CCV N;  3P38 A;  4E7J A;  3U8X A;  5BPN A;  3WNG A;  2PAV A;  4WE1 A;  3QET A;  1SZ2 A;  2V51 B;  4GKK K;  3L8B A;  3GG4 A;  3TSQ A;  1VQO N;  2PYJ A;  4B1Z A;  4E1M A;  4KTW A;  4Q0B A;  3RMB A;  1KAX A;  3D6R A;  4FM2 A;  1Z05 A;  4KTQ A;  1VQ4 N;  1VQ7 N;  3LWM A;  4DTX A;  5AQF A;  1YVU A;  4H0Y B;  2P9U A;  2P5G A;  1NWK A;  4Y1D A;  1YUW A;  2NZT A;  3OYL A;  3D7E O;  4XH1 A;  4JRQ A;  3DOL A;  3I0R A;  5AZI B;  3VQC A;  4CHQ A;  4E1J A;  2HNY A;  1ZBS A;  5AQZ A;  5KI6 A;  3O3H A;  2W42 A;  4O0J A;  3SZ2 A;  3E9P A;  2QXF A;  1TAU A;  1H1V A;  4CJ5 A;  4B9U A;  1TGO A;  3PLA A;  4CHY A;  5FPD A;  1KQS M;  1VQ6 N;  2P9K B;  2WON A;  2A40 A;  4E7I A;  1V4T A;  4K42 A;  3MX2 A;  4JRP A;  3OJU A;  4DTM A;  1DT9 A;  5IWA K;  4WFN L;  2XY8 A;  4FWL A;  4LY7 A;  2P9L A;  5CYM A;  4IFY A;  3SV4 A;  3RSE A;  3DI6 A;  4CEE A;  1X1P A;  3NMU A;  5HOO A;  1QSS A;  4CVN E;  1XMO K;  3C0B A;  4DG1 A;  4DS4 A;  4RW8 A;  5BR9 A;  3L3V A;  1S5J A;  4E7L A;  1T7P A;  1X9W A;  3HPO A;  4RW4 A;  4JI6 K;  3SJJ A;  3VEW A;  3DJC A;  4E72 A;  2HF4 A;  4N41 A;  3K2P A;  1J53 A;  2NRW A;  2F7T A;  2W41 A;  1HNV A;  4BRN A;  3LDL A;  3DMJ A;  4DV4 K;  3SPZ A;  3CM6 A;  2RHK A;  2Q2R A;  4HTU A;  3F2K A;  4FOI A;  4B9L A;  2IAJ A;  1WLJ A;  1QHT A;  3DRS A;  3UKR B;  4FXD A;  4A61 A;  1NJZ A;  1DKG D;  1S6Q A;  1HNI A;  1Y97 A;  1HRH A;  1EWQ A;  2NUB A;  1RCH A;  3LM9 A;  4B3M K;  2E2O A;  4JI1 K;  3NGY A;  2WBN A;  3LAL A;  1KRP A;  1HQE A;  4WFB L;  4OPK A;  4PL8 A;  1G99 A;  3MCA B;  4A59 A;  1UWB A;  4BR2 A;  2HOE A;  3FE1 A;  4ILG B;  4AHS A;  1R0A A;  1EET A;  4CF1 A;  3QIC A;  2YHX A;  4AHV A;  3U4L A;  3QEX A;  3NF9 A;  1WOQ A;  1LWE A;  3EKU A;  5AQR A;  4IOC L;  1C1A A;  4Z4H A;  3S9H A;  1D5A A;  4EZ9 A;  1EWR A;  3ASM A;  4FLW A;  4O5F A;  4AM7 A;  2FBT A;  3I33 A;  4DV2 K;  4DFJ A;  3V9Z A;  3EO3 A;  3ZEU B;  1K73 O;  3O8M A;  4FPA A;  4B9M A;  4E89 A;  4IJA A;  4JI2 K;  2YNG A;  3LM2 A;  5AQY A;  2P9N A;  1MWM A;  5M1O A;  1D9F A;  3QFP A;  4JS4 A;  1RTI A;  3DLK A;  1KVC A;  5M1N A;  1VK0 A;  3QNN A;  3TAF A;  4M3X A;  3DWL A;  2CGK A;  5GIN A;  4C8L A;  2PY5 A;  1JLQ A;  3IAY A;  4C8N A;  4IOA L;  1GOC A;  1SL2 A;  3FLC O;  4AHR A;  3CCM N;  3J80 O;  4FK0 A;  3VF2 A;  1N6Q A;  2DY4 A;  5CR4 A;  5CZ1 A;  1BIU A;  2O4G A;  2KQ2 A;  4BAC A;  2KFN A;  2C1G A;  3MX5 A;  3V6D A;  3KLI A;  4H03 B;  4CEC A;  3LDO A;  3RTV A;  2G8H A;  3GDQ A;  1VSL A;  3UKR A;  2YHY A;  2YV0 X;  3V9W A;  3PV8 A;  3O1B A;  4BRQ A;  1VSK A;  4O0I A;  3QB0 A;  1OH5 A;  4MFB A;  3WXM B;  4RWT A;  1BWF O;  2F8T A;  1CZ9 A;  1NK7 A;  3O5B A;  4KB1 A;  5SZT A;  2XY5 A;  1X9S A;  1SQK A;  2I7P A;  4OPA A;  2QEX N;  3AVF A;  4IWV A;  3J81 O;  3LZI A;  3AY9 A;  4DFM A;  3OYM A;  4M63 C;  3CPW M;  3THY B;  4BC2 A;  1Q82 O;  4JAX A;  3D2F B;  5BPL A;  3VPZ A;  3TAR A;  2QI2 A;  1REV A;  3J7Z O;  1RT7 A;  3M5R A;  2R7Y A;  3SUN A;  1VQ5 N;  4NYN A;  2G8U A;  4N56 A;  4PY5 A;  3D2F A;  5F2R A;  1YJN N;  3K57 A;  4J2B A;  1Q86 O;  5FDL A;  4FW1 A;  5ADX A;  2OAN A;  4GV3 A;  2G8V A;  5FLX O;  3VQD A;  5J2Q A;  4KB0 A;  2GBZ A;  4IO9 L;  3THX A;  2ZWH A;  3MK6 A;  3E66 A;  4Y1C A;  3CQX A;  3AVC A;  4CZF A;  1L3S A;  1QTM A;  3WQU A;  5MLC Q;  4CIG A;  3NDK A;  3QNO A;  4DS5 A;  3NCI A;  2FBV A;  1RDU A;  1VSD A;  4BRE A;  3L2Q A;  1SKW A;  4DR4 K;  4CZI A;  1C1C A;  4IEI A;  1T05 A;  3UKU A;  3DRP A;  1JCE A;  4I9L A;  4BGA A;  1N32 K;  3AGR A;  4GNI A;  1L3U A;  3CF5 L;  3J7A P;  4WYB A;  4CGD A;  4FVU A;  4YNQ A;  1DGK N;  3RMD A;  2ZD1 A;  4CK2 A;  4BRO A;  4IEE A;  3K5O A;  3D45 A;  1J6Z A;  4I6M B;  2E88 A;  3M8R A;  1C0T A;  2ASM A;  1BG3 A;  3LAM A;  2XO7 A;  5HLF A;  3B6P A;  4K8X A;  3ZT1 A;  3ZET A;  4E1N A;  1ASW A;  4BRC A;  4PL7 A;  2WOM A;  2ZJR L;  3BZC A;  2HND A;  1C6V A;  2A1R A;  2ITG A;  4A5B A;  4F2S A;  4FJI A;  5AQP A;  3AO5 A;  3MWP A;  4YOW A;  2UXB K;  4CHN A;  4M3W A;  5DK5 A;  2FF6 A;  3EN9 A;  3N4P A;  1QS4 A;  4M7X A;  4CES A;  4EP4 A;  3KLF A;  3KD5 E;  4RTF D;  2BGG A;  4LF5 K;  3IMX A;  2BE2 A;  1JLF A;  1YVN A;  3VQP A;  3G10 A;  5JLH A;  4Q5V A;  1DLO A;  1NMN A;  1BGX T;  4K43 A;  4GY2 B;  5CY4 A;  4NO7 A;  5K14 A;  4JKD A;  3FZM A;  3HZ6 A;  4I2Q A;  3DYA A;  1P90 A;  3P39 A;  2Z1G A;  4IFE A;  3MXI A;  4BEB A;  2P9I B;  4AF1 A;  5GAH P;  4JLH A;  4CEZ A;  3TAG A;  4BQZ A;  1ZXO A;  4KFB A;  2VYP A;  4ICL A;  4ZHR A;  3GOI A;  4FPB A;  4JKB A;  3KTQ A;  3L4I A;  4CGJ A;  2P9K A;  4DLG A;  1UOC A;  1BQN A;  3CCU N;  3QER A;  3M1F A;  2Q3S A;  3VOV A;  3UKU B;  4PQU A;  2UUB K;  1YXQ A;  3HTV A;  4WCE L;  1KCF A;  3Q7C A;  4HCC A;  3ZSX A;  2WC9 A;  4C8M A;  1YF5 L;  3ZSW A;  1Q7Y O;  1ZBI A;  4KKO A;  2HB5 A;  4H0X B;  3I56 N;  1YTU A;  3KIO A;  1E4G T;  3MCP A;  4G1Q A;  4BE2 A;  4CZJ A;  4BRP A;  2ZJP L;  2KTQ A;  1YT3 A;  3K59 A;  3KK1 A;  4LFA K;  3P5J A;  4AHU A;  1K6Y A;  3JSM A;  1K8K B;  1XNR K;  2FSN A;  3VQ8 A;  1G15 A;  1TUY A;  3K9K A;  3PSI A;  3O9S A;  2OZM A;  4OGC A;  1NK0 A;  1VSH A;  4OLA A;  5J2P A;  3OYH A;  4FWO A;  1S1V A;  4CGF A;  1E4F T;  1TK0 A;  1SAZ A;  2ZQB A;  3O80 A;  1BQM A;  5KRS A;  2AJQ A;  4R79 A;  2D0O A;  1VQL N;  1I39 A;  3BZK A;  4M3T A;  3C6U A;  3TR8 A;  2IVO A;  3E01 A;  4JN4 A;  4DU4 A;  1U48 A;  2HMI A;  2Q36 A;  2O8B B;  3O6W A;  3TAE A;  3SUP A;  3EYZ A;  3DAW A;  3KLH A;  4BDZ A;  2ZM6 K;  1LV5 A;  3MXJ A;  4KBO A;  1RTJ A;  3KKS A;  3THW A;  1ATR A;  2NLX A;  4C8K A;  3SLC A;  4FWQ A;  4DV7 K;  3V1R A;  3LWL A;  4JK8 A;  3CQ8 A;  3NH1 A;  3CCL N;  3FZF A;  4B1X B;  5AZJ B;  4NXM K;  4CF2 A;  3SAF A;  4DMN A;  4XH5 A;  1GLB G;  4H4M A;  4H4O A;  5EXW A;  2Y1J A;  1VAZ A;  4CFC A;  4X64 K;  5C2F A;  3S3O A;  2W6K A;  3A8Y A;  4FJ7 A;  2O8D B;  1EXQ A;  4B1V A;  1MA9 B;  3OS2 A;  3VQ6 A;  4PKI A;  4C1N I;  4FZZ A;  1QQM A;  1KLM A;  3R9P A;  4ISE A;  4CJ7 A;  3CQY A;  4BRD A;  5C25 A;  5F1X A;  4FJN A;  3HOS A;  2E4L A;  1IV0 A;  1Q81 O;  3T69 A;  1Y64 A;  3C95 A;  3AO4 A;  3EKS A;  3RMC A;  3UE5 A;  1Z25 A;  3ZEU A;  3MAQ A;  4UQG A;  3NF6 A;  3ULD A;  2H3G X;  1C0U A;  3DXM B;  3F5T A;  4BE0 A;  1D9D A;  5AFU H;  1QVG M;  2KFZ A;  3CME N;  1K8A O;  3OYG A;  1GLJ O;  2XY7 A;  1QQO A;  2DPN A;  1SL0 A;  3AVK A;  3RR8 A;  3AVI A;  4DTR A;  3DXK A;  1NGB A;  4CFA A;  3RR7 A;  1ESV A;  1RBR A;  4AH9 A;  4JI5 K;  1U49 A;  4LF6 K;  2P9S A;  3TAQ A;  4KH6 A;  4BR7 A;  1S6P A;  1FKO A;  4B9Q A;  3T7Z A;  3T19 A;  4CF8 A;  3P4I A;  3DLG A;  4BR5 A;  3ENB A;  4JI8 K;  4BGB A;  1EX4 A;  1BA0 A;  3PX6 A;  3O9U A;  4B8A B;  2ASP A;  4U7B A;  3G4S N;  3D0P A;  1E3M A;  3CC7 N;  1Z26 A;  4C8O A;  3Q7B A;  3B8A X;  3VN5 A;  3BUZ B;  2D0C A;  3L6Q A;  5KPR A;  3HK2 A;  1SKS A;  2X6S A;  3JAM O;  3FZL A;  1ZBF A;  2UYT A;  1VSE A;  3F9K A;  5AQH A;  2QKK A;  3PX4 A;  3CXC M;  2UXC K;  4CGI A;  4KHU A;  5BR8 K;  4Z4C A;  4PA1 A;  4CEA A;  1RGI A;  3IFR A;  4IJN A;  1JLC A;  3KK2 A;  4E7K A;  4DR7 K;  2A3Z A;  4ID1 A;  1NMD A;  4NXN K;  4BRF A;  3KZB A;  3E9L A;  3WEE B;  4XEI A;  2XRI A;  4BR0 A;  4B1U B;  4KH5 A;  4FWK A;  3O08 A;  2IS3 A;  1KVB A;  1HKB A;  3THV A;  4O8U A;  2VQE K;  4CD3 A;  1NJW A;  3U3Y A;  3QEI A;  1WSI A;  4MO5 A;  3DLE A;  5AQN A;  4AHT A;  3CCR N;  3LDP A;  2OYQ A;  3LPU A;  2KZZ A;  3HP6 A;  3O9Q A;  2W6L A;  4B3S K;  2ASO A;  2O8C B;  4GKJ K;  4FJH A;  2QWN A;  5DMR A;  3NFA A;  2IOC A;  2NRX A;  2HBK A;  1Q9X A;  1SS6 A;  1Q18 A;  3MXM A;  3VA3 A;  4FVM A;  4GW6 A;  1IG8 A;  4JKH A;  4ILJ A;  4KHP K;  5JVG L; 
#chains in the Genus database with same CATH homology
 3LDQ A;  2OTJ N;  3D2E A;  3VEY A;  4BR9 A;  3MN5 A;  4IOA L;  2ZF5 O;  1R59 O;  5M1K A;  3FLC O;  4H0P A;  3A5O C;  3CCM N;  5I9E B;  1QZ5 A;  2RE2 A;  1HLU A;  3VF2 A;  2D1K A;  5CR4 A;  1NGH A;  3A5N C;  1WUA A;  5JVH L;  4I6M A;  1W97 L;  4FWS A;  3SBG A;  2Q0R A;  5AQW A;  2QWL A;  1S72 N;  2C1G A;  3MX5 A;  3C7N B;  1MDU B;  4MLH A;  5AQI A;  3CJ1 A;  3PIO L;  1S22 A;  3ATU A;  1BO5 O;  4H03 B;  3CI5 A;  3KWI A;  4A57 A;  3LDO A;  3WXJ A;  2P9P B;  3R6M A;  2QWM A;  3GDQ A;  4CD1 A;  1V4S A;  3UKR A;  1YJW N;  2YHY A;  1YHQ N;  2QWO A;  4BRA A;  2VCP A;  4NB4 A;  3O1B A;  4BRQ A;  3H1Q A;  3OA9 A;  5AQK A;  1U2V A;  5KPZ A;  3H3N O;  3QB0 A;  1C0G A;  5FPN A;  4CZL A;  5AQQ A;  3WXM B;  5BRE A;  3WQT A;  1VQ8 N;  4RWT A;  2GTD A;  1BWF O;  4M7Y A;  3CJC A;  3QBW A;  3RVC A;  3O5B A;  4BVP A;  4H0V B;  2F9W A;  2YI1 A;  3FR0 A;  1RDW X;  1SQK A;  1KAZ A;  2CH5 A;  4WQ5 C;  3W3D A;  4EFH A;  2I7P A;  3CPE A;  4OPA A;  5CE3 A;  3QDK A;  2QEX N;  1BUP A;  1T6C A;  4IWV A;  3HBT A;  3AY9 A;  3E1Y A;  3CPW M;  4M63 C;  1M90 O;  4BC2 A;  1Q82 O;  4JAX A;  3D2F B;  4H5V A;  5BPL A;  1S3X A;  3O9T A;  3HI0 A;  3VEN A;  3LL3 A;  4ISF A;  4KH4 A;  3VPZ A;  2QI2 A;  3J7Z O;  3M5R A;  5B8H A;  1VQ5 N;  3L4Q A;  5AR0 A;  2GEL A;  3D2F A;  3CIP A;  5F2R A;  1YJN N;  1HUX A;  3FZK A;  5AQM A;  2E1Z A;  2YJF A;  4HTL A;  3WEE A;  1Q86 O;  2OTL N;  2CH6 A;  2EWS A;  5ADX A;  2AA4 A;  2OAN A;  3VTI A;  3EZW A;  4GV3 A;  3HOT A;  1ILY A;  4A2B A;  5E84 A;  4NLC A;  2FLO A;  4MDA A;  4F9O A;  1QZ6 A;  2E2N A;  3MN7 A;  2AP1 A;  1QQN A;  3IUC A;  4YOV A;  4IO8 A;  3DXM A;  4IO9 L;  4CBU A;  1HX1 A;  3PIP L;  4BRL A;  4K25 A;  2ZWH A;  1D4X A;  3MK6 A;  4L3Q A;  3E66 A;  3CQX A;  4CZF A;  1XC3 A;  4YOT A;  3MN6 A;  4JNE A;  3J8A A;  3KWG A;  3VEV A;  3WQU A;  1YJ9 N;  5JLF A;  3S41 A;  3H3O B;  5MLC Q;  3CJA A;  3OW2 M;  3CHW A;  2QTD A;  3WXK A;  4B1W B;  5KPT A;  4DB3 A;  4BC4 A;  1RDU A;  2NRT A;  3TSP A;  1IJJ A;  2VGM A;  1NGC A;  4BRE A;  2KKZ A;  1KC8 O;  1GLC G;  3CCJ N;  4CZI A;  1CZA N;  4IEI A;  3SMS A;  3UKU A;  4BRK A;  1GLE G;  4XJX A;  3BF1 A;  1JCE A;  3IKM A;  1HKG A;  4BGA A;  3TU5 A;  4H0O A;  5BN8 A;  2QWQ A;  3AGR A;  3MDQ A;  4GNI A;  4YDU C;  3TTC A;  5GIP A;  3CF5 L;  4WYB A;  4FVU A;  3EE9 A;  3O4W A;  1M1K O;  3L0Q A;  5FPE A;  2ZGY A;  1DGK N;  3DLL L;  3FGU A;  4H5W A;  3VES A;  2E20 A;  2HF3 A;  4IEE A;  4BRO A;  1J6Z A;  3ZX2 A;  2ZJQ L;  3ZX0 A;  1MWK A;  2YCH A;  4DKW A;  3KK7 A;  1T6D A;  3N4Q A;  4I6M B;  1P8Z A;  3VGK A;  1QVF M;  2Q31 A;  2E88 A;  4JD2 A;  4A5A A;  3BF3 A;  2ASM A;  4EAH D;  1GLA G;  5CHI A;  1BG3 A;  4CI6 A;  4MLE A;  2FSK A;  4JEP A;  3FFK B;  4CBW A;  5C12 A;  3ZET A;  3TPQ A;  4CZG A;  5M1Q A;  4BRC A;  4PL7 A;  2ZJR L;  3HRG A;  2E2Q A;  2V7Z A;  5M1P A;  4YOX A;  4JKE A;  2NRZ A;  4A2A A;  2KHO A;  1NJI O;  2Q1N A;  4A5B A;  1Z6R A;  3ZET B;  1K9M O;  2NNW A;  1U2V B;  4UY8 O;  5AQP A;  3EL2 A;  3MWP A;  3ZX3 A;  1XQS C;  4YOW A;  4NLB A;  5TKW A;  5F0X A;  5GAD P;  4BRH A;  4YOU A;  5AFU A;  1TUU A;  4GV6 A;  3JS6 A;  2FF6 A;  3EN9 A;  5AQO A;  3N4P A;  4M7X A;  2NRV A;  2Q0U A;  4RTF D;  3R3L A;  3IMX A;  2VGN A;  4HWI A;  1LCU A;  1YVN A;  3MN9 A;  3C6H A;  3CJ9 A;  3CC2 N;  2F9T A;  5AQG A;  4OPH A;  5JLH A;  5C0Y A;  3H45 C;  2BTF A;  5M1F A;  1X3N A;  4XH4 A;  4K43 A;  4MO4 A;  4GY2 B;  2P9N B;  1EO1 A;  4NO7 A;  3SMP A;  2P9I A;  4FWR A;  4DQ8 A;  4JKD A;  5GIO A;  3FZM A;  3HZ6 A;  3ID8 A;  5EY4 A;  1P90 A;  3P39 A;  5HL7 L;  1N8R O;  4IFE A;  3H6E A;  4B1Y B;  4BEB A;  2P9I B;  3QFU A;  3G71 N;  2YX6 A;  4FWN A;  4Y0W A;  4BC3 A;  3A5M C;  4AF1 A;  5GAH P;  4BG9 A;  4LC9 B;  4BQZ A;  1ZXO A;  5JMV A;  4CZE A;  2VYP A;  5C15 A;  5BRF A;  3GOI A;  4FPB A;  4JKB A;  3D2E B;  3CJ7 A;  3L4I A;  4FL9 A;  2P9K A;  3JXU A;  1X3M A;  4PKG A;  3CCU N;  3HM8 A;  2A6A A;  4JKF A;  5AQT A;  3M1F A;  3VOV A;  3F9M A;  3UKU B;  3SAH A;  1YXQ A;  3HTV A;  3VF6 A;  4WCE L;  5BRD A;  3GE1 A;  3Q7C A;  2GEM A;  4JK7 A;  3G6E N;  2WC9 A;  2C1I A;  5EOY A;  1VQP N;  1YF5 L;  3ENO A;  2IIR A;  1Q7Y O;  3SK3 A;  1YAG A;  4H0X B;  3I56 N;  3RSE B;  1E4G T;  2YJE A;  3MCP A;  4EHT A;  2IVN A;  3OBW A;  3AAR A;  4CZJ A;  4BRP A;  1NGG A;  3KHY A;  2ZJP L;  1NGD A;  3WXI A;  5JIC A;  3CER A;  3O1W A;  3VMF B;  2NRR A;  1ATS A;  1K8K B;  4RCH A;  1U6Z A;  3ULE B;  2FSN A;  3NVK A;  1T44 A;  1GLF O;  3HSC A;  3GL1 A;  4O8K A;  2P9L B;  2E2P A;  3MMV A;  5ELZ A;  1TUY A;  3K9K A;  4WQ5 A;  3O9S A;  4QS9 A;  4K41 A;  3VEO A;  1NM1 A;  1T3V A;  3LDN A;  2I7N A;  2QM1 A;  4JHD A;  4C1N K;  3QML A;  4FWO A;  4H5N A;  4JD2 B;  3VER A;  1E4F T;  1SAZ A;  4PKH A;  1LOT B;  3O80 A;  4BEC A;  3VEX A;  3H46 O;  5EVZ A;  2KLA A;  4JHD B;  4R79 A;  1OKJ A;  2D0O A;  2J4R A;  4BRM A;  1VQL N;  4YOY A;  3ZYY X;  4H0T B;  4CZM A;  3CMA N;  2P9S B;  3ATV A;  2Q97 A;  3C65 A;  1NLV A;  3ENH A;  5C2D A;  3ID6 A;  5DM6 L;  3UB5 A;  2CGL A;  4BY9 C;  3I8B A;  4FWP A;  3SBT A;  5KQD A;  4IZ9 A;  3C6A A;  1XUP O;  3W0L A;  1GLD G;  2IVO A;  4JN4 A;  1NGJ A;  2A41 A;  3TTF A;  1JJ2 M;  3CCV N;  3P38 A;  2CGJ A;  1NGF A;  3U8X A;  2Q36 A;  3O6W A;  5BPN A;  3G25 A;  2PAV A;  4A62 A;  1SZ2 A;  4C23 A;  2V51 B;  1W2B M;  3GG4 A;  3TSQ A;  1VQO N;  5TKY A;  3DAW A;  2D0P A;  1NGE A;  4B1Z A;  3VGM A;  2ZGZ A;  4DHY A;  3OBY A;  1KAX A;  2P9U B;  2ITM A;  3D6R A;  4GV9 A;  5AQX A;  2IVP A;  1Z05 A;  4KBO A;  2P9P A;  5LY3 A;  2HMP A;  1VQ4 N;  1VQ7 N;  3U9Z A;  4CBX A;  3GBT A;  1ATR A;  5AQF A;  2NLX A;  4H0Y B;  1YIT N;  2P9U A;  3SLC A;  4FWQ A;  1NWK A;  1YUW A;  2NZT A;  1DEJ A;  3D7E O;  2WFB A;  1NGA A;  4CZH A;  4JK8 A;  1VQK N;  4XH1 A;  4YDU A;  2YHW A;  3A5L C;  5FPM A;  3CCL N;  5AZI B;  3FZF A;  4B1X B;  5AZJ B;  4E1J A;  1ZBS A;  5AQZ A;  3SAF A;  3CCQ N;  3CD6 N;  3E9P A;  3R1X A;  1BOT O;  1H1V A;  1GLB G;  4XH5 A;  3SAG A;  5EXW A;  3PLA A;  1VAZ A;  5H1S Q;  5FPD A;  3AAP A;  1KQS M;  1VQ6 N;  1BU6 O;  2P9K B;  2QWR A;  2A40 A;  1NBW A;  5C2F A;  2QXL A;  3A8Y A;  1V4T A;  5ADX H;  4K42 A;  2GX9 A;  3MX2 A;  4B1V A;  1MA9 B;  1HPM A;  4BG8 A;  4PKI A;  1DT9 A;  3KVG A;  2D4W A;  4C1N I;  1VQN N;  4WFN L;  1QQM A;  4FSV A;  4FWL A;  3R9P A;  4ISE A;  4CJ7 A;  5LJV A;  3CQY A;  3VF4 A;  2P9L A;  4BRD A;  5F1X A;  3HOS A;  3RSE A;  3T69 A;  1Q81 O;  1Y64 A;  2FF3 B;  3EKS A;  4G9Z A;  3R8E A;  3UE5 A;  3ZEU A;  1EQY A;  3NMU A;  5HOO A;  3E9O A;  4WQ4 A;  3C0B A;  2GWK A;  3CCS N;  5BR9 A;  3WUH A;  3AGK A;  4BRI A;  2H3G X;  2V52 B;  3K9J A;  1NGI A;  3DXM B;  3U9D A;  3F5T A;  1VQ9 N;  2E1Y A;  5AFU H;  3SJH A;  1GLL O;  4WQ4 C;  1QVG M;  3BEX A;  3VEW A;  3DJC A;  3CME N;  1K8A O;  2HF4 A;  1GLJ O;  3WXL A;  2FSJ A;  2QW9 A;  5KQ8 A;  1BA1 A;  4H5R A;  4BRG A;  1ATN A;  1QQO A;  2DPN A;  2NRW A;  5DM7 L;  4OO1 J;  4BE7 B;  5AQL A;  2F7T A;  1YI2 N;  1BDG A;  2NRH A;  1KD1 O;  2JWK A;  3DXK A;  1NGB A;  5AQV A;  2W41 A;  1ESV A;  5AQS A;  3VTH A;  4QS7 A;  3CET A;  3VET A;  4BRN A;  3LDL A;  2P9S A;  2RHK A;  2Q2R A;  2A42 A;  3EE8 A;  1KXP A;  4KH6 A;  3F2K A;  3WT0 A;  4BR7 A;  3DXK B;  1QHA A;  3T7Z A;  4B9Q A;  4FOI A;  5LJW A;  2PFU A;  3P4I A;  4BR5 A;  3A0I X;  3ENB A;  3UKR B;  4A61 A;  2JWL A;  4EHU A;  2QA4 N;  1DKG D;  4BGB A;  1BA0 A;  5C10 A;  3C7N A;  3O9U A;  1C0F A;  3M3Z A;  4JKG B;  5AQJ A;  5GAE P;  2ASP A;  4BR4 A;  4U7B A;  2A5X A;  3IDH A;  3LM9 A;  3G4S N;  3AAQ A;  2FXU A;  2E2O A;  3VEZ A;  2W00 A;  3CC7 N;  3Q7B A;  2PBD A;  2WBN A;  3B8A X;  1HJO A;  3BUZ B;  4JKA A;  4YOR A;  2HST A;  4JKG A;  3L6Q A;  5KPR A;  4JKC A;  4WFB L;  4PL8 A;  2GUP A;  1G99 A;  5AZJ A;  3MCA B;  4A59 A;  3FZL A;  4JK9 A;  2UYT A;  5E26 A;  5AQH A;  1X9J A;  4GVE A;  4BR2 A;  2V7Y A;  2HOE A;  1VQM N;  2QWP A;  3FE1 A;  4ILG B;  4IXC A;  3CXC M;  2BH1 A;  4WFA L;  3QIC A;  5GAG P;  2YHX A;  1ZC6 A;  3OHR A;  4BQL A;  3H1V X;  3TTD A;  3U4L A;  4BVO A;  4AM6 A;  4FWM A;  4U67 L;  1YIJ N;  3BP8 A;  4J8F A;  2HBL A;  1WOQ A;  4FOE A;  5AZI A;  4Z94 A;  3CC4 N;  1RGI A;  2HBM A;  3EKU A;  3IFR A;  4IJN A;  5AQR A;  4IOC L;  3P31 A;  3QBX A;  4BC5 A;  2A3Z A;  1NMD A;  4ILH A;  4WF9 L;  2E8A A;  4O5F A;  3KZB A;  4AM7 A;  3E9L A;  4BRF A;  3WEE B;  4H5T A;  3O9R A;  3I33 A;  3NVM A;  4XEI A;  4BR0 A;  1OVY A;  4IOX A;  4B1U B;  2BUP A;  1RFQ A;  2HBJ A;  4KH5 A;  2VWB A;  4FWK A;  5BPM A;  1K8K A;  3O08 A;  5BN9 A;  5EX5 A;  3ULE A;  3EO3 A;  3ZEU B;  3CJB A;  1HKB A;  1K73 O;  1O13 A;  4O8U A;  4CD3 A;  1TYQ A;  4CZK A;  1JCG A;  3O8M A;  4MDB A;  3FZH A;  4FPA A;  4MO5 A;  5AQN A;  1JCF A;  3CCR N;  1HKC A;  3LDP A;  4IJA A;  5AQU A;  3O9Q A;  3LM2 A;  5AQY A;  2ASO A;  2P9N A;  1MWM A;  3MWT A;  5M1O A;  5BRH A;  3QFP A;  1TYQ B;  2QWN A;  2NRX A;  4EIA A;  3M6G A;  4FO0 A;  2HBK A;  4QS8 A;  1SS6 A;  4IDH A;  5M1N A;  3CCE N;  1Q18 A;  3I55 N;  2W40 A;  3DWL A;  4ISG A;  1KAY A;  4PHT X;  2WUS A;  1IG8 A;  2CGK A;  4ILJ A;  4JKH A;  5GIN A;  3TSU A;  4DCH A;  5JVG L;  3VGL A;  2GWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...