4CBUG

Crystal structure of plasmodium falciparum actin i
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
125
structure length
125
Chain Sequence
MVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Differences Explain Diverse Functions of Plasmodium Actins.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Motor protein
molecule keywords ACTIN-1
total genus 44
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2013-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 4cbuG00
2FF6G 4KEEA 1CFYA 1AK6A 1KCQA 1VFQA 2KVKA 3EFOB 1M4JA 1F7SA 5KYYB 5L6WC 3FG7A 1WNJA 2I2QA 3EG9A 3TU5B 4BEX1 3CJCG 1YAGG 3EH2A 1NLVG 2QTVA 2LJ8A 1TVJA 1NMDG 2FGHA 3EFOA 1M2OA 2MP4A 2VILA 3EH1A 3EGXB 1RGIG 2XF1A 2NUTB 1SVQA 3Q2BA 4PKHB 1HQZ1 1C0GS 3FFKA 1SVRA 1M2VA 4PKGG 4PKIG 3A5NS 3A5MS 4Z94G 1J72A 1QPVA 1Q8XA 1CNUA 1JHWA 3CJBG 1PD0A 1WM4A 4LIZA 1ESVS 1C0FS 1H1VG 2MV2A 1P8XA 3EGDA 1T3YA 1TMWA 1PD1A 2VACA 1M2VB 4JD2H 4CBWG 5KYYA 1PCXA 1NM1G 3DAWB 5KYUA 1UDMA 2D8BA 5KYNA 3A5OS 2FH4A 2LLFA 5KYUB 1P8ZG 1AHQA 1DEJS 1COFA 1T2LA 1WFSA 5DD2A 5KYWB 3CI5G 5FAEA 2W0IA 1V6FA 4S10C 1YVNG 3EGXA 3EG9B 2NUTA 1Q8GA 5KYXB 3L50A 2XFAA 1MDUA 1T3XA 1D4XG 2VIKA 1D0NA 2HD7A 5KYWA 1X67A 3CIPG 2FH2A 5IVUA 3FG6A 4CBXG 2L72A 2FH1A 5FAFA 4KEDA 3EGDB 2NUPB 2LXXA 5KYXA 4KEFA 5A1MA 1NPHA 1T44G 4CBUG 5HVKD 2NUPA 1AK7A 1SVYA 3FFNA 1VKKA 2FH3A 5HVKB 1EQYS 2MOTA 3A5LS 2FF3A
chains in the Genus database with same CATH superfamily
2FF6G 4KEEA 1CFYA 1AK6A 1KCQA 1VFQA 2KVKA 3EFOB 1M4JA 1F7SA 5KYYB 5L6WC 3FG7A 1WNJA 2I2QA 3EG9A 3TU5B 4BEX1 3CJCG 1YAGG 3EH2A 1NLVG 2QTVA 2LJ8A 1TVJA 1NMDG 2FGHA 3EFOA 1M2OA 2MP4A 2VILA 3EH1A 3EGXB 1RGIG 2XF1A 2NUTB 1SVQA 3Q2BA 4PKHB 1HQZ1 1C0GS 3FFKA 1SVRA 1M2VA 4PKGG 4PKIG 3A5NS 3A5MS 4Z94G 1J72A 1QPVA 1Q8XA 1CNUA 1JHWA 3CJBG 1PD0A 1WM4A 4LIZA 1ESVS 1C0FS 1H1VG 2MV2A 1P8XA 3EGDA 1T3YA 1TMWA 1PD1A 2VACA 1M2VB 4JD2H 4CBWG 5KYYA 1PCXA 1NM1G 3DAWB 5KYUA 1UDMA 2D8BA 5KYNA 3A5OS 2FH4A 2LLFA 5KYUB 1P8ZG 1AHQA 1DEJS 1COFA 1T2LA 1WFSA 5DD2A 5KYWB 3CI5G 5FAEA 2W0IA 1V6FA 4S10C 1YVNG 3EGXA 3EG9B 2NUTA 1Q8GA 5KYXB 3L50A 2XFAA 1MDUA 1T3XA 1D4XG 3DA7A 2VIKA 1D0NA 2HD7A 5KYWA 1X67A 3CIPG 2FH2A 5IVUA 3FG6A 4CBXG 2L72A 2FH1A 5FAFA 4KEDA 3EGDB 2NUPB 2LXXA 5KYXA 4KEFA 5A1MA 1NPHA 1T44G 4CBUG 5HVKD 2NUPA 1AK7A 1SVYA 3FFNA 1VKKA 2FH3A 5HVKB 1EQYS 2MOTA 3A5LS 2FF3A
chains in the Genus database with same CATH topology
2FF6G 4KEEA 1CFYA 1AK6A 1KCQA 1VFQA 2KVKA 3EFOB 1M4JA 1F7SA 5KYYB 5L6WC 3FG7A 1WNJA 2I2QA 3EG9A 3TU5B 4BEX1 3CJCG 1YAGG 3EH2A 1NLVG 2QTVA 2LJ8A 1TVJA 1NMDG 2FGHA 3EFOA 1M2OA 2MP4A 2VILA 3EH1A 3EGXB 1RGIG 2XF1A 2NUTB 1SVQA 3Q2BA 4PKHB 1HQZ1 1C0GS 3FFKA 1SVRA 1M2VA 4PKGG 4PKIG 3A5NS 3A5MS 4Z94G 1J72A 1QPVA 1Q8XA 1CNUA 1JHWA 3CJBG 1PD0A 1WM4A 4LIZA 1ESVS 1C0FS 1H1VG 2MV2A 1P8XA 3EGDA 1T3YA 1TMWA 1PD1A 2VACA 1M2VB 4JD2H 4CBWG 5KYYA 1PCXA 1NM1G 3DAWB 5KYUA 1UDMA 2D8BA 5KYNA 3A5OS 2FH4A 2LLFA 5KYUB 1P8ZG 1AHQA 1DEJS 1COFA 1T2LA 1WFSA 5DD2A 5KYWB 3CI5G 5FAEA 2W0IA 1V6FA 4S10C 1YVNG 3EGXA 3EG9B 2NUTA 1Q8GA 5KYXB 3L50A 2XFAA 1MDUA 1T3XA 1D4XG 3DA7A 2VIKA 1D0NA 2HD7A 5KYWA 1X67A 3CIPG 2FH2A 5IVUA 3FG6A 4CBXG 2L72A 2FH1A 5FAFA 4KEDA 3EGDB 2NUPB 2LXXA 5KYXA 4KEFA 5A1MA 1NPHA 1T44G 4CBUG 5HVKD 2NUPA 1AK7A 1SVYA 3FFNA 1VKKA 2FH3A 5HVKB 1EQYS 2MOTA 3A5LS 2FF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FF6 G;  4KEE A;  1CFY A;  1AK6 A;  1KCQ A;  1VFQ A;  2KVK A;  3EFO B;  1M4J A;  1F7S A;  5KYY B;  5L6W C;  3FG7 A;  1WNJ A;  2I2Q A;  3EG9 A;  3TU5 B;  4BEX 1;  3CJC G;  1YAG G;  3EH2 A;  1NLV G;  2QTV A;  2LJ8 A;  1TVJ A;  1NMD G;  2FGH A;  3EFO A;  1M2O A;  2MP4 A;  2VIL A;  3EH1 A;  3EGX B;  1RGI G;  2XF1 A;  2NUT B;  1SVQ A;  3Q2B A;  4PKH B;  1HQZ 1;  1C0G S;  3FFK A;  1SVR A;  1M2V A;  4PKG G;  4PKI G;  3A5N S;  3A5M S;  4Z94 G;  1J72 A;  1QPV A;  1Q8X A;  1CNU A;  1JHW A;  3CJB G;  1PD0 A;  1WM4 A;  4LIZ A;  1ESV S;  1C0F S;  1H1V G;  2MV2 A;  1P8X A;  3EGD A;  1T3Y A;  1TMW A;  1PD1 A;  2VAC A;  1M2V B;  4JD2 H;  4CBW G;  5KYY A;  1PCX A;  1NM1 G;  3DAW B;  5KYU A;  1UDM A;  2D8B A;  5KYN A;  3A5O S;  2FH4 A;  2LLF A;  5KYU B;  1P8Z G;  1AHQ A;  1DEJ S;  1COF A;  1T2L A;  1WFS A;  5DD2 A;  5KYW B;  3CI5 G;  5FAE A;  2W0I A;  1V6F A;  4S10 C;  1YVN G;  3EGX A;  3EG9 B;  2NUT A;  1Q8G A;  5KYX B;  3L50 A;  2XFA A;  1MDU A;  1T3X A;  1D4X G;  2VIK A;  1D0N A;  2HD7 A;  5KYW A;  1X67 A;  3CIP G;  2FH2 A;  5IVU A;  3FG6 A;  4CBX G;  2L72 A;  2FH1 A;  5FAF A;  4KED A;  3EGD B;  2NUP B;  2LXX A;  5KYX A;  4KEF A;  5A1M A;  1NPH A;  1T44 G;  4CBU G;  5HVK D;  2NUP A;  1AK7 A;  1SVY A;  3FFN A;  1VKK A;  2FH3 A;  5HVK B;  1EQY S;  2MOT A;  3A5L S;  2FF3 A; 
#chains in the Genus database with same CATH topology
 2FF6 G;  4KEE A;  1CFY A;  1AK6 A;  1KCQ A;  1VFQ A;  2KVK A;  3EFO B;  1M4J A;  1F7S A;  5KYY B;  5L6W C;  3FG7 A;  1WNJ A;  2I2Q A;  3EG9 A;  3TU5 B;  4BEX 1;  3CJC G;  1YAG G;  3EH2 A;  1NLV G;  2QTV A;  2LJ8 A;  1TVJ A;  1NMD G;  2FGH A;  3EFO A;  1M2O A;  2MP4 A;  2VIL A;  3EH1 A;  3EGX B;  1RGI G;  2XF1 A;  2NUT B;  1SVQ A;  3Q2B A;  4PKH B;  1HQZ 1;  1C0G S;  3FFK A;  1SVR A;  1M2V A;  4PKG G;  4PKI G;  3A5N S;  3A5M S;  4Z94 G;  1J72 A;  1QPV A;  1Q8X A;  1CNU A;  1JHW A;  3CJB G;  1PD0 A;  1WM4 A;  4LIZ A;  1ESV S;  1C0F S;  1H1V G;  2MV2 A;  1P8X A;  3EGD A;  1T3Y A;  1TMW A;  1PD1 A;  2VAC A;  1M2V B;  4JD2 H;  4CBW G;  5KYY A;  1PCX A;  1NM1 G;  3DAW B;  5KYU A;  1UDM A;  2D8B A;  5KYN A;  3A5O S;  2FH4 A;  2LLF A;  5KYU B;  1P8Z G;  1AHQ A;  1DEJ S;  1COF A;  1T2L A;  1WFS A;  5DD2 A;  5KYW B;  3CI5 G;  5FAE A;  2W0I A;  1V6F A;  4S10 C;  1YVN G;  3EGX A;  3EG9 B;  2NUT A;  1Q8G A;  5KYX B;  3L50 A;  2XFA A;  1MDU A;  1T3X A;  1D4X G;  3DA7 A;  2VIK A;  1D0N A;  2HD7 A;  5KYW A;  1X67 A;  3CIP G;  2FH2 A;  5IVU A;  3FG6 A;  4CBX G;  2L72 A;  2FH1 A;  5FAF A;  4KED A;  3EGD B;  2NUP B;  2LXX A;  5KYX A;  4KEF A;  5A1M A;  1NPH A;  1T44 G;  4CBU G;  5HVK D;  2NUP A;  1AK7 A;  1SVY A;  3FFN A;  1VKK A;  2FH3 A;  5HVK B;  1EQY S;  2MOT A;  3A5L S;  2FF3 A; 
#chains in the Genus database with same CATH homology
 2FF6 G;  4KEE A;  1CFY A;  1AK6 A;  1KCQ A;  1VFQ A;  2KVK A;  3EFO B;  1M4J A;  1F7S A;  5KYY B;  5L6W C;  3FG7 A;  1WNJ A;  2I2Q A;  3EG9 A;  3TU5 B;  4BEX 1;  3CJC G;  1YAG G;  3EH2 A;  1NLV G;  2QTV A;  2LJ8 A;  1TVJ A;  1NMD G;  2FGH A;  3EFO A;  1M2O A;  2MP4 A;  2VIL A;  3EH1 A;  3EGX B;  1RGI G;  2XF1 A;  2NUT B;  1SVQ A;  3Q2B A;  4PKH B;  1HQZ 1;  1C0G S;  3FFK A;  1SVR A;  1M2V A;  4PKG G;  4PKI G;  3A5N S;  3A5M S;  4Z94 G;  1J72 A;  1QPV A;  1Q8X A;  1CNU A;  1JHW A;  3CJB G;  1PD0 A;  1WM4 A;  4LIZ A;  1ESV S;  1C0F S;  1H1V G;  2MV2 A;  1P8X A;  3EGD A;  1T3Y A;  1TMW A;  1PD1 A;  2VAC A;  1M2V B;  4JD2 H;  4CBW G;  5KYY A;  1PCX A;  1NM1 G;  3DAW B;  5KYU A;  1UDM A;  2D8B A;  5KYN A;  3A5O S;  2FH4 A;  2LLF A;  5KYU B;  1P8Z G;  1AHQ A;  1DEJ S;  1COF A;  1T2L A;  1WFS A;  5DD2 A;  5KYW B;  3CI5 G;  5FAE A;  2W0I A;  1V6F A;  4S10 C;  1YVN G;  3EGX A;  3EG9 B;  2NUT A;  1Q8G A;  5KYX B;  3L50 A;  2XFA A;  1MDU A;  1T3X A;  1D4X G;  3DA7 A;  2VIK A;  1D0N A;  2HD7 A;  5KYW A;  1X67 A;  3CIP G;  2FH2 A;  5IVU A;  3FG6 A;  4CBX G;  2L72 A;  2FH1 A;  5FAF A;  4KED A;  3EGD B;  2NUP B;  2LXX A;  5KYX A;  4KEF A;  5A1M A;  1NPH A;  1T44 G;  4CBU G;  5HVK D;  2NUP A;  1AK7 A;  1SVY A;  3FFN A;  1VKK A;  2FH3 A;  5HVK B;  1EQY S;  2MOT A;  3A5L S;  2FF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...