4CC4B

Complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
67
structure length
67
Chain Sequence
GPEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTEYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Cell invasion
molecule keywords INLC PROTEIN
total genus 10
structure length 67
sequence length 67
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4cc4B00
2EPDA 4ZNXA 3VS6A 1KSWA 3VS1A 1NLOC 2EYWA 1TG0A 3TSWA 2OAWA 4J9HA 2L3QA 1Z9ZA 2CH4A 4AFQC 4AFUC 2RN8A 3EG2A 3GBQA 2KYBA 1PNJA 1E6GA 2VKNA 1SEMA 1G83A 2DL7A 2RQVA 3REBB 1EFNA 3SEMA 2BZYA 4JJBA 2JM8A 2W0ZA 1ZBJA 2LQNA 1MV3A 1ABOA 2CT4A 2EQIA 3VS0A 4Z89A 1G2BA 2KRMA 2E5KA 1PHTA 1H8KA 1CKBA 4K11A 1K4US 2EGAA 4FSSA 2DILA 3I5RA 4JPBW 2O9SA 1ARKA 2A28A 2D0NA 5ECAA 1WX6A 5FWCA 1HSQA 1YWPA 2MOXA 2X3XD 4IIOA 4AFSC 2RQRA 2LNHB 1S1NA 3I9QA 2EKHA 2FPEA 1E7OA 2DRKA 2EBPA 1NG2A 1ZUYA 3A98A 1VYTA 2DMOA 3M0TA 1JXMA 2RF0A 1OEBA 3EG0A 3THKA 2FRYA 1AZGB 1PKSA 2RQTA 2CSIA 1WYXA 5I11A 4LUEA 1SRMA 1V1CA 3JV3A 1T0HA 1JXOA 2JW4A 4JZ3A 4R0KA 2YT6A 2HEQA 2DYBA 1YP5A 2RMOA 1SHFA 2D8HA 1GFDA 2G6FX 5IHNA 4CC3A 3REAB 2LZ6B 3M0UA 4HVWA 4J9FA 1E6HA 2YDLA 2EYXA 3H0FA 3VRYA 2RQWA 1JO8A 5IHIA 3NPFA 1KIKA 1AWWA 2F2WA 1AWOA 4AG2C 3FJ5A 2B86A 1AWJA 2RQUA 2BZXA 2K79A 1UGVA 2AK5A 1M27C 1Y0MA 2GBQA 1VA7A 2O9VA 2J6KA 4E6RA 1WFWA 2DVJA 3VS5A 3UATA 2EVRA 2J05A 3IQLA 5FW9A 4AG1C 1SHGA 1WXBA 1GCQA 2HCKA 2D1XA 4J9IA 4Z8AA 3VS4A 5EC7A 2CSQA 1U3OA 2FEIA 2L0AA 2YUNA 4JJDA 4AFZC 1MV0B 2KR3A 4CC2A 2FPFA 2L3PA 1FYNA 1RUWA 1UECA 1I07A 1W6XA 3PVQA 2A08A 2ED0A 1QLYA 2AZVA 2EGCA 2H8HA 2JS2A 2RNAA 1X69A 2DLPA 4HVUA 2SEMA 2ROLA 2CH4W 2KNBB 3EGUA 2ECZA 3I35A 4RTUA 5IXBA 3EG1A 1NLPC 2EW3A 2ED1A 2DL4A 1X6BA 1NYGA 3QWXX 1NM7A 1ZUUA 1M8MA 1B07A 2KYMA 3CQTA 1WIEA 1X43A 2JMAA 1M30A 2W10A 3NHNA 1RLQC 2PNIA 1K76A 2JXBA 2K3BA 1M3BA 2LX7A 1X27A 3U23A 2CUDA 1AVZC 3VRZA 1K1ZA 2LJ3A 2YUOA 4RTWA 2KGTA 2QDLA 2KT1A 3SHWA 4QT7A 1ZUKA 1A0NB 1YN8A 3NGPA 1SPKA 3TSZA 1J3TA 1Y57A 1AZEA 2O88A 1FMKA 1W70A 3M0QA 2YUPA 4F14A 4KRTA 2KRNA 2DJQA 2DNUA 2EYZA 2KROA 1B3QA 2GNCA 2L2PA 1X2QA 1IO6A 1TUDA 4LE9A 4J9GA 2IIMA 3UF4A 2M51A 1UFFA 3RNJA 1WXUA 1X2KA 2DL5A 3EHRA 1KJWA 2KE9A 4A63B 1N5ZA 1UDLA 1YWOA 1M3CA 2C0OA 2P4RA 1SRLA 2BTTA 1KFZA 1WI7A 2DBMA 1YCSB 1OPKA 2CUBA 3M0RA 4LNPA 4OMMA 2AKKA 5FWBA 2KBTA 1NYFA 2DL3A 4RTTA 2O31A 1GCPA 1K0XA 2ABLA 4RTYA 2JTEA 4OMLA 1CKAA 2CREA 2CDTA 2V1RA 3VS2A 1PRLC 3H41A 2J7IA 1ABQA 2I0NA 4LN2A 4X1VA 2MIOA 5IXFA 3O5ZA 2OI3A 2F2VA 1PWTA 1Z9QA 4OMOA 1K9AA 2YUQA 1GL5A 4J9BA 1ZX6A 4GLMA 4OMQA 2JMCA 4RTVA 2NUZA 1UE9A 2HSPA 2K6DA 1UHCA 1M3AA 3UA6A 2GTOA 2J6OA 4JZ4A 2GGRA 2D8JA 1VYUA 2XMFA 2KXCA 1GBQA 3RBBB 1QWEA 1AWXA 1QWFA 1SSHA 2FO0A 1WXTA 2PZ1A 3ZL7C 4DEXA 1T0JA 2GTJA 2ESWA 4D8DA 1OOTA 2NWMA 1UTIA 1U06A 2OJ2A 1PKTA 1TUCA 1ZSGA 4HCKA 2F2XA 2V1QA 1T3SA 2EGEA 2VWFA 4J9EA 4HVVA 2DRMA 3NMZC 5IHKA 1YNZA 1CSKA 1AOJA 2HBWA 4ESRA 1LCKA 4CC7A 1HD3A 3PE0A 2PTKA 2JT4A 2LMJA 3VS3A 2DL8A 1T3LA 4M4ZA 4WCIA 1HJDA 2KEAA 1OV3A 2YSQA 4CC4B 4ORZA 2DX1A 4RTXA 5I22A 2VVKA 1MUZA 3H0IA 1W1FA 2LQWA 2J6FA 4JJCA 1AEYA 4F17A 2HDAA 2ENMA 1JEGA 1GRIA 2J06A 2DBKA 1UUEA 4D8KA 1GCQC 2LJ0A 5GJVB 1AD5A 4GBQA 1BK2A 2X3WD 2DF6A 2KT8A 1RI9A 1WLPB 3KFVA 1XOVA 1H92A 4IIMA 2O2OA 3EG3A 2MCNA 1NEGA 1JQQA 1UJ0A 3C0CA 4EIKA 3PVLA 4RTZA 1H3HA 1JU5C 5GJWB 1K0SA 2LCSA 3QWYA 2A37A 4LUDA 1QKWA 1WA7A 3R6NA 2DE0X 2GQIA 2FG0A 2FRWA 1GBRA 3LH5A 4DEYA 2FPDA 2ROTA 4OMNA 2DM1A 3I5SA 2L3SA 4J9DA 2C0IA 1OPLA 1RLPC 2DA9A 1WDXA 2A36A 2M0YA 1BBZA 1GFCA 1QKXA 2JM9A 2CT3A 4F16A 1PRMC 2BZ8A 2KXDA 1UJYA 2SRCA 4Z88A 1BU1A 1X6GA 2C0TA 3M0PA 3UA7A 4J9CA 3EHQA 1ZLMA 4Y92A 1I1JA 1QCFA 2EYYA 1UG1A 3H0HA 1UHFA 2AZSA 2K2MA 1VYVA 2K7AA 1NEBA 2K9GA 2LJ1A 4RUGA 1BB9A 2RPNA 4OMPA 3VS7A 1U5SA 5L23A 3TVTA 3ULRB 4HXJA 5IH2A 2JS0A 2KRSA 2AKLA 3M0SA 5HCKA 2LP5A 1I0CA
chains in the Genus database with same CATH superfamily
1VQKQ 3PMTA 3D7SB 4ZNXA 2EWNA 1R77A 1JJ2A 1WHKA 4BI4A 3CCVQ 2RHZA 5KYYB 3RERA 3EFOA 1RADB 3TSWA 4J9HA 3CCST 2CP0A 4AFQC 4AFUC 4M7AG 2LDMA 2RN8A 1M2VB 4C8QF 1G83A 3REBB 3WVEB 4BB7A 1LVKA 4JJBA 5LJ3j 1BI2A 2OX7A 1MV3A 2DEUA 5CKBA 2E5QA 3CCSA 3VS0A 1G2BA 2KRMA 2JZ2A 3CMEQ 3OYAA 1WJSA 4DOVA 5FLXE 5KYWB 2E5KA 1KD1U 3GPLA 4J6XA 1CKBA 4NL3A 2EGAA 1S72A 2M9UA 4FSSA 2DILA 5LJ5g 2VYTA 1JBMA 1WX6A 2DZCA 3CCMT 3UT1A 3FIFA 1IHWA 3ZBDA 2RQRA 1S1NA 1M1FA 3JCMV 1ZSZC 4ZGJB 3QKJA 1WGSA 1NG2A 2EBPA 3JCMf 4JS4A 1VYTA 2R57A 1VQKA 2FRYA 4OB3B 1X75C 5CKHA 1N27A 5I11A 5I2MA 3Q1JA 1SRMA 1VQ4Q 2LCLA 2BIVA 1JXOA 1YITQ 3DB3A 4R0KA 2YT6A 1YP5A 2RMOA 1SHFA 3MEVA 1N6AA 1QVGS 4J7IA 4ZGDB 3EH2A 1Q95G 1VQKT 4GY5A 4OB1B 1KHCA 2YLCA 2LZ6B 3M0UA 4FW2A 1VQ9A 4N4HA 1E6HA 1V76A 2EYXA 2CZ6B 5IHIA 3NPFA 1NJIU 1KIKA 3CCLA 2F2WA 5GMKe 3G6EA 3OSVA 2B86A 2RQUA 4PJOD 1M27C 1Y0MA 2GBQA 2QXFA 2J6KA 2DVJA 5CCAA 3L1AA 4PJJA 3VS5A 3OYLA 1WQWA 2J05A 3G71A 4C92C 4AG1C 2P4TA 1WJRA 3SWNC 4C8QE 4ZN1A 4PJOF 3RMQA 1SSFA 4IURA 1GCQA 5KYXB 4J9IA 3JCMg 3HPWA 5EC7A 2CSQA 3E1SA 4LDVA 1QVFS 1WNLA 2YUNA 4ELYC 2COWA 2L3PA 4M7DA 4M7AC 1FYNA 1I07A 3OYMA 2DXTA 2B8AA 3OS2A 4IUTA 3CCEQ 4KUDK 1WHLA 4MDXA 2RNAA 4C0ZA 3JCMc 2E6NA 1U8RA 3I35A 2ROLA 2CH4W 2KNBB 3EGUA 3OYIA 2K5FA 3PIPA 3CC7A 1RAIB 3MEUA 1Q7YC 3QWXX 3M57A 3QJ6A 1WIEA 1X43A 5CVIA 5CQXA 1VQ8T 5GAOm 2K3BA 1M3BA 1UGQB 1QVGA 2LX7A 3FRNA 1AVZC 4OB2B 3OW2A 1NJIC 2DD4A 1K1ZA 4XK8E 5GAMj 3URGA 5KE2A 3L2QA 1Q81U 4Z02A 4PFPA 3SHWA 3QYGB 1MMAA 3OBWA 1YJWT 2E41A 5FU6B 5C0MA 4DBRA 1AZEA 4F14A 3CD6A 5HY6A 3VJPA 4A4HA 1SKUB 2FZGB 2DXBA 4F04B 4M7DD 2GNCA 2EJ9A 1X2QA 1IO6A 1G3SA 3OYFA 4XTVA 1M1KR 5LJ5j 2ATCB 2DL5A 2QQSA 2FZKB 1Y71A 1N5ZA 5M9OA 3OA6A 1M3CA 2QAZA 2E64A 3OYBA 2KVQG 3L2RA 1PG5B 2PVDB 4KBMB 1VUBA 1M1GA 4M7AF 5FWBA 4RTTA 1SF9A 3RR6A 1GCPA 4E7KA 4M7DE 5FU6C 4OMLA 1Y96B 1K8AU 4PFOA 2V1RA 5FROA 1PRLC 4B6MA 2IPOB 1ABQA 2FZCB 2I0NA 4M77B 1PM3A 4X1VA 2X35A 4Y91A 4M7AD 5KH6A 1QCOA 4O6JA 3QG1A 1M2VA 3QJYA 1PWTA 1Z9QA 2HZYA 4N4GA 4OMOA 3CC4T 4OGCA 4J9BA 4GLMA 2ZZDA 4OMQA 2QEXT 3C94A 3JCMP 1MNDA 2NUZA 2MYSA 3EFOB 1UHCA 3VU3C 3MKDA 1QW1A 4C92D 2D8JA 1VYUA 4FYWB 2XMFA 2KXCA 4XAXB 2PUOB 3A8HB 1WXTA 3CCJA 2QEXA 4ZGEB 3C95A 4JJNK 1F1BB 1K73R 2NWMA 5LJ5h 3CPWS 1TUCA 2PUKB 2MPXC 4OB0B 5GAN4 2QTXA 3MP1A 3N5BB 2VWFA 3RKYA 4A4GA 3TQ7P 3OYKA 2MWOA 5L8RE 2JTMA 4J9EA 5LJ3e 1BI3A 1LCKA 5A0GA 4D6WA 1WHGA 2PTKA 4E7JA 1MGQA 3VUZA 2JT4A 3VS3A 1BCMA 4J83A 2NUPA 3BW1A 1HJDA 4JRIA 2EJFA 2RJDA 2YSQA 1UGPB 2XG8D 5GAMg 1Y7XA 3PMIA 4RTXA 5KYYA 2VVKA 3CBMA 3S6WA 2BUDA 3MEWA 4ATOA 4C0FA 5KE3A 2XIDA 3CXCA 2K3XA 4HKEA 1OZ2A 2HDAA 2ENMA 2I2LA 2X9HA 2LTOA 4JUVA 2P0PA 4D8KA 1IGUA 1D09B 4GBQA 3X26B 2X3WD 1TH7A 2KT8A 2V8IA 3EGXB 1RI9A 2DPPB 1I8FA 2LT1A 1XOVA 3JCMe 2OTLT 3MP8A 3QDFA 4IIMA 2V26A 4A4KA 2A37A 1QKWA 4M78G 1Q81C 2WSEE 2GQIA 2QA4A 4QW2A 5IT9E 4DA4A 3HFOA 2ROTA 1MHNA 4J9DA 4E7IA 2A36A 2MWPA 3X24B 4F16A 2SRCA 3CC7T 3H6ZA 3LW5E 3UA7A 1O9SA 2FVUA 4J9CA 1ZLMA 1M90R 1QCFA 2V8JA 4MZTA 3SB2A 2AZSA 2QYZA 3BY7A 2K7AA 3MPUB 1PSEA 1OULA 3X28B 1K8AR 1YI2Q 1PCXA 3ULRB 1QP2A 3OS0A 4HXJA 3CCEA 5IH2A 1YITA 1N8RU 2AKLA 2YHTA 5HCKA 2BKDN 1Q81R 3L2UA 5LJ3g 3JRZA 3KXTA 2A0FB 3JB9J 2A7YA 2HQXA 1YHQA 3VS6A 2FL7A 2RO0A 1KSWA 1ZA2B 1M90U 1VQ5A 1NLOC 3OYHA 3ASKA 2OAWA 2KYBA 2EFIA 2QGGA 3PGGA 2CP3A 3HRTA 1NPRA 5GAMe 4M78E 1C6VX 2JJ9A 4PJOE 5GAMd 1H8KA 1YIJQ 3L2WA 1V29B 1YI2A 4M75E 2DAQA 2A28A 1VQPA 3T9NA 5FWCA 1YIJA 2MOXA 2X3XD 3BDLA 2HKQB 1VIFA 2LNHB 2EKHA 2CZ7B 1E7OA 1WQ7A 3A98A 2DMOA 3HKSA 2COYA 1JXMA 4PJMA 2X4XA 3EG0A 4PKCC 3V8JA 4XQ3A 3DB4A 4MDWA 4EPCA 1QVFP 1VQPT 1WYXA 4LUEA 3MEAA 2DFUA 3CC2Q 1T0HA 3FJPA 2M16A 4JZ3A 3GIBA 4R55A 3G6ET 2QTVA 5IHNA 4KUIA 3ER0A 2DTIA 4X9CA 2O01E 2F69A 4HVWA 4QVZA 5DLOA 2LNVA 3VRYA 5GANh 2CZ0B 5FU7B 2RI5A 2VGMA 1VQNA 3C12A 1VA7A 4WF2A 5KYWA 3CCQQ 2D6FA 3UATA 3A8OB 1SHGA 4ZTJA 3OB9A 1M4ZA 1D1CA 1JJ2S 3JB9G 4ZTFA 5GAOq 4KGVB 4Z8AA 3RKWA 4FYXB 4IUPA 4AFZC 4BY6B 2KR3A 1H3ZA 4CC2A 2FPFA 2CP6A 3PVQA 4EMKB 4C0GA 5GMKh 1VQMA 1W2BS 1JRIA 3JCMd 1S72T 1WHMA 2AZVA 5CKFA 2DYIA 2H8HA 1BIBA 4JLGA 4UC4A 3I56Q 3M59A 4RTUA 3OW2P 1NLPC 1Y07A 2R5AA 2HAXA 1YI2T 4KGZB 2AT1B 3R6OA 2KYMA 3CQTA 1TU0B 1M30A 3NHNA 1RLQC 2JXBA 4KULA 3JB9F 5CIUA 1FWZA 2M0OA 4M7AB 2KGTA 1NBEB 4AT1B 2EKOA 1UGSB 4EMKC 5LJ3f 4A54A 1AT1B 1B34A 2QDLA 3M5AA 4LDYA 2KT1A 2PVGB 2OAUA 3DKMA 4PFZA 1ZUKA 1A0NB 1YN8A 4M7AE 3NGPA 2QGFB 3FLGA 4OF1A 1LPLA 1J3TA 1Y57A 1LNXA 2O88A 1W70A 3EAEA 2YUPA 4KRTA 1G3TA 3QYHB 2DNUA 2NUTA 2E6ZA 1VQ9Q 1RAFB 2KROA 4PK4A 3FB9A 4IKFA 1TUDA 4LE9A 3UF4A 2IIMA 4FW1A 1X2KA 3EHRA 4PLLA 2EAYA 4RCCA 5GAN6 4M77D 4J6YA 4Y28E 1YWOA 3LWHA 2P4RA 2QQBA 4QQ6A 1SRLA 1YITT 1H641 1YCSB 2EQMA 2QASA 1VQNT 2KQWA 4LNPA 4OMMA 3L2VA 2KBTA 3G71T 2DL3A 3CCRT 2O31A 2WACA 3MP6A 1YCYA 4QQDA 5A0LA 2XKOC 2CREA 1Q7YU 2CDTA 3E9FA 3H41A 3CC7Q 5KCHA 2E65A 2GQVA 2MIOA 1OX8A 2H3JA 1K9AA 1GL5A 1ZX6A 3G6EQ 1LOJA 2KMTA 1KC8R 2CZ1B 2KY9A 1RAAB 4RTVA 2MK5A 1UE9A 4MMLA 2HSPA 4FU6A 3CMAT 2OTLQ 3UA6A 3OYCA 4C5GA 1NPPA 2HL3A 3H9NA 5CR2A 4LDXA 1GBQA 1RAGB 3RBBB 3ZL7C 1T0JA 4FL6A 1OOTA 3MHXA 2IG0A 3CMAA 3CCMA 3CCQT 1ZSGA 4HCKA 1XNIA 4IUVA 2AHJB 1T3SA 4M77C 3V8LA 4FCYA 1M1KC 4J6WA 5GAN2 2XK0A 2DRMA 4C0DC 4CC7A 3E2UA 1BI0A 1HD3A 5J26A 1UEBA 3EG9B 2LMJA 1HYOA 3CBOA 4KGXB 2CS7A 1UB4A 2HBPA 2XDBA 1OV3A 4A4FA 2CP2A 4CC4B 3CXCP 3CMET 3RMSA 3CCRQ 2DX1A 5I22A 1FMWA 2OTJQ 1HXDA 2LRQA 1WJQA 1KD1R 4C5EA 1KQ2A 3M56A 1W1FA 2LQWA 4PJOB 3MCAB 2J6FA 1ZSZA 3MO8A 3JSCA 4M78B 1R0CB 4F17A 3VUBA 1YJ9A 4M77A 1YJWQ 1NJIR 3J7AF 1GRIA 4X34A 1M9SA 2J06A 4DBQA 4C0DB 4M7AA 1GCQC 4M7DC 3OYNA 2DF6A 3LGFA 3QIIA 2NYSA 1VQ7A 2FB7A 3G4SA 5IAYA 4LXCA 3JAME 4J5YA 2YRDA 3EG3A 2K2VA 1JQQA 1AHJB 5LJ3d 3JCMX 2V8KA 3JB9D 3JB9H 2LT4A 1G3YA 3PVLA 5D6YA 1H3HA 3CD6Q 4J7FA 2LCSA 2MAMA 5GANg 3I56A 2ZPIB 2FRWA 4DEYA 1DJ7B 4M75G 4OMNA 5GANf 2C0IA 1OPLA 2EIFA 1GFCA 1QKXA 4M7DF 3OMGA 2JM9A 2HD0A 4JLIA 2CT3A 4M7DB 1PRMC 1RL2A 1UJYA 1OX9A 2HQEA 1BU1A 2C0TA 1MMDA 1W2BA 1YBYA 3CCJT 4Y92A 1I1JA 4XTYA 4F7UB 2RH2A 3CCET 3MJXA 3O8VA 3P8DA 3ME9A 3HRSA 3G71Q 1TOVA 3PT9A 2EQKA 2RPNA 4OMPA 2QK0A 4EMGA 3KBGA 5KYUA 3V8KA 3QBYA 1XJWB 4M78A 2F5TX 3RUXA 4E7ZA 3I55T 1OI1A 1VQ8Q 4HCCA 1RACB 1OU8A 4C8QD 2LX9A 5CQYA 2RM4A 3L2ZA 2ZGWA 3M9QA 2NUTB 2H3EB 1ZHIA 3OYDA 1X01A 3EGXA 2CH4A 3EG2A 4II1A 3GBQA 2RQVA 5GAN7 1EFNA 3SEMA 2F5KA 3CPWA 2CT4A 4DQ2A 1Q86C 4JS5A 3LH0A 4ANJA 5DLQE 2K5LA 4BE0A 1D3BA 1K4US 3VYHB 4JPBW 2DKGA 2RHXA 5ECAA 3V7RA 1KQSS 3CC2T 1K8AC 4AFSC 3OW2S 1KC8U 3M4GA 3M53A 4E47A 2DRKA 1VQ4A 1M2OA 1QVGP 1JJ2P 3QZ5B 2JOYA 3PFSA 1OEBA 3THKA 1NE8A 1AZGB 1Q82R 1PKSA 4C92A 2CSIA 4BACA 3A8MB 1VQLA 3X25B 3DLLA 2JW4A 3CEYA 1EIFA 4C8QB 4C92G 1TS9A 2GFAA 3TCJA 2HEQA 2DYBA 1TUGB 5GAOn 2D8HA 5I21A 1GFDA 1VQ5Q 2BE9B 3A8LB 1G5VA 1P92A 2X4WA 3TU4K 4QQGA 2DD5A 2QA4Q 3HHTB 1JO8A 3HP9A 4JRQA 3HFNA 3CCSQ 4PJNA 1FMVA 1AWJA 1OU9A 2BZXA 4HT9A 2O9VA 3OY9A 1Q86U 1D1BA 2JNGA 2EVRA 4ELZC 1PC0A 1WHHA 3IQLA 4VUBA 5FW9A 1IGQA 1B7TA 1YHQT 4LDWA 4M77E 3CCUT 1WXBA 3S3MA 1KHIA 2LQKA 2D1XA 4XTWA 1QP3A 2QQRA 2FEIA 2KK4A 2G3RA 4XU2A 4JJDA 4N4IA 2WSFE 5GMKj 4HCBA 4RMOA 1IRXA 1RUWA 2HSEB 1W6XA 1PD1A 2O4XB 1M5Q1 2Y4XA 3CCMQ 2A08A 2ED0A 1QLYA 2EGCA 2XHCA 4OVAA 5DM7R 2JS2A 4GLKA 2SEMA 5IXBA 2ECZA 3EG1A 4KH1B 2HQHA 2OTLA 2EW3A 1YJ9Q 2ED1A 1X6BA 3AHUA 1VQ6T 1M8MA 2CP7A 1B07A 3EGDA 2D9TA 2JMAA 5GANd 4KT0E 2W10A 4PL6A 3I56T 4M78D 2PNIA 3U23A 4BY6C 2CUDA 1WZOA 1ZA1B 2LJ3A 4RTWA 2YUOA 2E10A 3GLXA 2XU8A 3EFSA 3PNWC 1VQ6A 4E7HA 4NOYA 5CK9A 2PQWA 4QT7A 3CPFA 2QG9B 3M0QA 2RJEA 3OS5A 2COZA 2IVWA 1I81A 2EYZA 3EH1A 2JVVA 2KDSA 1RAHB 1B3QA 2KAFA 2L2PA 1Q82C 4X9DA 3QUIA 2OTJA 3BDUA 4HT8A 3QDRB 1C1AA 4N0AA 2GFUA 4IUQA 1UFFA 3RNJA 1WXUA 8ATCB 1KJWA 3GF5A 4M75B 3CCRA 1VQPQ 3LLRA 3CXCS 1UDLA 2C0OA 3RESA 2BTTA 1KFZA 1WI7A 4M7DG 1OPKA 3GOXA 2CUBA 3M0RA 5FRNA 1KQSA 3A1PA 2EQJA 2DVEA 1NYFA 4PLIA 4PNOA 4F7UF 3UWNA 3SDZA 4RTYA 1BI1A 2JTEA 5FRMA 1I5OB 1MNEA 4E2FB 4BI8B 4XU1A 5AT1B 1Y96A 2X4JA 2L5QA 1R0BG 4TVRA 2E12A 3BE3A 4LN2A 1IXDA 3CMAQ 1BKBA 1RI0A 3M4YA 5IXFA 1M90C 2OI3A 2F2VA 2ZPBB 1EX4A 2YUQA 4FYYB 2L89A 4XTXA 3TEEA 2JMCA 4MMKA 5IN1A 4RKUE 1M3AA 2FYKA 2GTOA 2XDPA 2J6OA 4JZ4A 1VQ8A 2GGRA 2QA4T 1QWFA 2FO0A 5GAOl 4DEXA 5J39A 4D8DA 5GMKm 1UTIA 3UPUA 1U06A 2RB6A 1VQOQ 9ATCB 4OMFB 2F2XA 1VQ9T 4M75D 2EQUA 4BDYA 1VIEA 2DJZA 4HVVA 2AIRB 2HBWA 4ESRA 2JTFA 4PJOG 3V7SA 3G4SQ 3FC3A 3PE0A 4M77F 2L3RA 2DTOA 2DL8A 3WVDB 1T3LA 1RABB 1VQ6Q 4WCIA 1I5LA 1KQ1A 3INZA 1S72Q 4ORZA 3LX7A 3OQ5A 2L8DA 3HTRA 5KYXA 5KYUB 1G3WA 5LJ5f 1N8RR 1BCOA 3QSUA 1YFNA 3TREA 4JJCA 4C8QA 3M58A 4WTOB 2LCCA 3I55Q 1VQ5T 5EG2A 1JEGA 3J81E 3HRUA 2VUBA 1KQSP 1JB0E 1M8VA 5D6XA 2DETA 3NTKA 5GJVB 1AD5A 2F1LA 1BK2A 1N9RA 2Y4YA 2QEXQ 1WLPB 1VQMQ 2RHUA 3QPHA 3CBPA 5J3BA 2MCNA 2XDDA 1NEGA 1UJ0A 1BIAA 5GAN5 3C0CA 3OYEA 2KI7A 2RHIA 2Y90A 5GJWB 1K0SA 2LC4A 3R6NA 1WA7A 3F70A 2DE0X 1VQMT 2XI9A 4PJOC 1VQOT 2E3HA 2DM1A 3I5SA 1YJNA 5GAN3 4BUGA 2ZCFB 1Q86R 1RLPC 4C8QC 1WDXA 1TTHB 1U1SA 4C92E 4EDUA 1IB8A 4M78F 1YJWA 2K3YA 5GAMf 2DK3A 2A3LA 2BZ8A 4FT2A 1Q82U 1K73U 4Z88A 1X6GA 2RA2A 2M02A 3M0PA 3GP8A 4JRPA 5D6WA 3EHQA 3EG9A 3JCMQ 1YJNT 3LGLA 1UG1A 3H0HA 5HK3A 5CO7A 1UHFA 5FU7C 2K9GA 4RUGA 5CKEA 1BB9A 1U5SA 1VOMA 2CP5A 3J80E 4M75A 5L23A 3CCVT 1EZZB 1ZBXA 4JRKA 2VXFA 2JS0A 2KRSA 3M0SA 2GF7A 4QKUA 1TXQA 4BE1A 2EPDA 4F7UG 3EFRA 4N0AC 2JUFA 3NTHA 3CMEA 4E7SA 1XTDA 1QVFA 4FYVB 3VS1A 2EYWA 3NTIA 1TG0A 2K57A 3JCMb 2FHDA 3ZEHA 2L3QA 1Z9ZA 2ZPGB 4V2SA 5A0DA 1K9MC 4A53A 7AT1B 1ZSZB 1PNJA 1E6GA 2VKNA 1SEMA 1VQ7T 2DL7A 8AT1B 5A2QE 2BZYA 3CC4A 2D0QB 1RAEB 2JM8A 2W0ZA 1ZBJA 2LQNA 3LWIA 3JCMJ 1ABOA 2EQIA 3CCUQ 4Z89A 4NS5A 2QDYB 2E3IA 4OGEA 2MI6A 1K73C 3NFCA 1PHTA 4K11A 2EJGA 3JB9I 2DTHA 3I5RA 2O9SA 1ARKA 2VC8A 4LDUA 1IHVA 2D0NA 2ZPFB 3RIRA 4XU0A 1VQNQ 2VGNA 1HSQA 1YWPA 4IIOA 3I9QA 3BFMA 4JDSA 2FPEA 5KCOA 2C06A 2QQ9A 1ZUYA 3M0TA 2RF0A 2QQAA 2RQTA 2E1HA 5GMKl 1V1CA 3JV3A 5I2SA 2LVMA 2NUPB 4DBHA 4CRIA 1OYXA 3CD6T 3QXEB 2G6FX 5CKDA 4CC3A 3REAB 4J9FA 1OZ3A 2YDLA 2DXUA 3H0FA 2RQWA 2X51A 2K5IA 3CCVA 2EYQA 5LJ3h 1AWWA 3CCUA 1AWOA 4AG2C 3FJ5A 5GANj 1UGRB 1M1KU 2K79A 1UGVA 2AK5A 4DBFA 4E6RA 1WFWA 2ZPHB 2HCKA 3VS4A 1U3OA 2O4XA 2L0AA 2YWWA 5C6SA 3L42A 1MV0B 4EMKA 1UECA 1WHJA 1TWBA 1YJ9T 4ME7A 1YJNQ 3OYGA 1D0YA 2RJFA 2VXEA 4DOWA 3HSBA 1N9SA 4HVUA 1X69A 2DLPA 2M1HA 3CC2A 4AMCA 3RKXA 1D3BB 2RHYA 2E70A 1ZQ1A 4PJOA 2VV5A 3G4ST 3V7CA 2MF2A 1VQ4T 2DL4A 1MMNA 1NYGA 1I4K1 1PSFA 2RK2A 1NM7A 4BI3A 1ZUUA 2PU9B 3SWNA 4HCZA 5GMKi 3OYYA 5DY9A 4A4EA 5CAIA 1OQKA 3QZ9B 1K76A 1N8RC 1X27A 1QMCA 3VRZA 2CGHA 1VQOA 4XU3A 1FX7A 2PVOB 4C92F 2DERA 5GAN8 3OS1A 2DIQA 5GAMh 1B34B 1QCNA 2DZ9A 1FXXA 4EMHA 1SPKA 3QHSA 3TSZA 1KG1A 1XQHA 1FMKA 2KRNA 1W2BP 2DJQA 4F7UA 3M54A 3C4SA 3DLMA 4LD6A 4J9GA 2M51A 3SD4A 2ZAEA 4M78C 3A5ZB 2CYZB 2KE9A 4A63B 4RG2A 3AT1B 6AT1B 3M55A 2VASA 4MZPA 4XTZA 3RDVA 2DBMA 2E4HA 4C5IA 1KD1C 1VQLQ 3I55A 4ZN3A 4P5NA 2AKKA 3PIOA 1K9MR 2YXYA 3VKIA 3OYJA 1K0XA 2ABLA 5D7UA 2P0KA 3VYGA 2YLBA 4QVDA 1CKAA 1TSFA 4C8QG 4C92B 4FSXA 3SWNB 3WXMB 3VS2A 1D1AA 4BDZA 2DEQA 3FDRA 2J7IA 5LJ5d 3OSSC 5LJ5e 2DIGA 2JN0A 4L5GA 1BYMA 3O5ZA 5AYFA 3P8HA 3E19A 4M75C 3EGDB 1K9MU 3LYIA 4FM4B 2R58A 2R5MA 2K6DA 1W4SA 1NZ9A 4NL2A 3SFMA 4E7LA 1LJOA 3G1JA 1QWEA 1AWXA 1D0ZA 1SSHA 3X20B 2PZ1A 4OP0A 2X4YA 2GTJA 2ESWA 3UDCA 3OMCA 2OJ2A 1PKTA 3META 4CI0C 3PTAA 1C0MA 2RI2A 2V1QA 2EGEA 1WPYA 2NLUA 4L59A 4O5VA 4B9XA 4RCBA 3NMZC 5IHKA 1YNZA 1IREB 1CSKA 1AOJA 5HK0A 5LL6S 2P0QA 1R8OB 1VQ7Q 3HL8A 3CPWP 2OTJT 1G8XA 1O75A 4KH0B 4J8OA 3S3OA 4M4ZA 3P8BB 1U1TA 2KEAA 1Q7YR 2P84A 4BD3A 1HK9A 1PD0A 1QQJA 2WSCE 3G7ZA 3JCMh 3GNGA 1D0XA 1MUZA 4FT4A 3S3NA 4Q5WA 2K4YA 2XICA 2RK1A 3E9GA 3H0IA 5GANe 4F7UE 1X6OA 2LQ8A 4YTLA 1AEYA 2ZPEB 2VB6A 2QI2A 2DBKA 1UUEA 4B9WA 2LJ0A 2YRVA 1GXIE 2RD1A 4XTUA 2HMAA 4QVCA 3KFVA 5GAOr 4L6V5 4R56A 2O2OA 2HKNA 4FIBA 1H92A 2MMPA 4EIKA 2BE7D 2CKKA 4RTZA 3GNFB 1JU5C 1IZ6A 4PJLA 3QWYA 4LUDA 3ZFJA 4HA8A 2FG0A 3A8GB 4C5HA 1GBRA 3LH5A 4LD9K 3CCJQ 2GCXA 2XD0A 5HKCA 2FPDA 3FEOA 4M75F 2HNIA 2L3SA 1YIJT 1MMGA 2DA9A 3OBYA 2RJCA 1BBZA 2M0YA 2RI3A 3JCMW 3CCQA 1SG5A 2YRCA 3QO3A 2KSSA 4MZMA 2KXDA 1QVPA 4RG8A 3CCLQ 3H8ZA 1YHQQ 2EYYA 1VQLT 3CC4Q 5KYNA 2K2MA 4IUUA 1VYVA 2Z0WA 2LJ1A 1NEBA 1KC8C 2DO3A 3VS7A 4BE2A 4M77G 3TVTA 2HL5C 2DXCA 3CCLT 1ACMB 1KK7A 3VV0A 5GAOp 2LP5A 1I0CA 3KUFA
chains in the Genus database with same CATH topology
2EPDA 4ZNXA 3VS6A 1KSWA 3VS1A 1NLOC 2EYWA 1TG0A 3TSWA 2OAWA 4J9HA 2L3QA 1Z9ZA 2CH4A 4AFQC 4AFUC 2RN8A 3EG2A 3GBQA 2KYBA 1PNJA 1E6GA 2VKNA 1SEMA 1G83A 2DL7A 2RQVA 3REBB 1EFNA 3SEMA 2BZYA 4JJBA 2JM8A 2W0ZA 1ZBJA 2LQNA 1MV3A 1ABOA 2CT4A 2EQIA 3VS0A 4Z89A 1G2BA 2KRMA 2E5KA 1PHTA 1H8KA 1CKBA 4K11A 1K4US 2EGAA 4FSSA 2DILA 3I5RA 4JPBW 2O9SA 1ARKA 2A28A 2D0NA 5ECAA 1WX6A 5FWCA 1HSQA 1YWPA 2MOXA 2X3XD 4IIOA 4AFSC 2RQRA 2LNHB 1S1NA 3I9QA 2EKHA 2FPEA 1E7OA 2DRKA 2EBPA 1NG2A 1ZUYA 3A98A 1VYTA 2DMOA 3M0TA 1JXMA 2RF0A 1OEBA 3EG0A 3THKA 2FRYA 1AZGB 1PKSA 2RQTA 2CSIA 1WYXA 5I11A 4LUEA 1SRMA 1V1CA 3JV3A 1T0HA 1JXOA 2JW4A 4JZ3A 4R0KA 2YT6A 2HEQA 2DYBA 1YP5A 2RMOA 1SHFA 2D8HA 1GFDA 2G6FX 5IHNA 4CC3A 3REAB 2LZ6B 3M0UA 4HVWA 4J9FA 1E6HA 2YDLA 2EYXA 3H0FA 3VRYA 2RQWA 1JO8A 5IHIA 3NPFA 1KIKA 1AWWA 2F2WA 1AWOA 4AG2C 3FJ5A 2B86A 1AWJA 2RQUA 2BZXA 2K79A 1UGVA 2AK5A 1M27C 1Y0MA 2GBQA 1VA7A 2O9VA 2J6KA 4E6RA 1WFWA 2DVJA 3VS5A 3UATA 2EVRA 2J05A 3IQLA 5FW9A 4AG1C 1SHGA 1WXBA 1GCQA 2HCKA 2D1XA 4J9IA 4Z8AA 3VS4A 5EC7A 2CSQA 1U3OA 2FEIA 2L0AA 2YUNA 4JJDA 4AFZC 1MV0B 2KR3A 4CC2A 2FPFA 2L3PA 1FYNA 1RUWA 1UECA 1I07A 1W6XA 3PVQA 2A08A 2ED0A 1QLYA 2AZVA 2EGCA 2H8HA 2JS2A 2RNAA 1X69A 2DLPA 4HVUA 2SEMA 2ROLA 2CH4W 2KNBB 3EGUA 2ECZA 3I35A 4RTUA 5IXBA 3EG1A 1NLPC 2EW3A 2ED1A 2DL4A 1X6BA 1NYGA 3QWXX 1NM7A 1ZUUA 1M8MA 1B07A 2KYMA 3CQTA 1WIEA 1X43A 2JMAA 1M30A 2W10A 3NHNA 1RLQC 2PNIA 1K76A 2JXBA 2K3BA 1M3BA 2LX7A 1X27A 3U23A 2CUDA 1AVZC 3VRZA 1K1ZA 2LJ3A 2YUOA 4RTWA 2KGTA 2QDLA 2KT1A 3SHWA 4QT7A 1ZUKA 1A0NB 1YN8A 3NGPA 1SPKA 3TSZA 1J3TA 1Y57A 1AZEA 2O88A 1FMKA 1W70A 3M0QA 2YUPA 4F14A 4KRTA 2KRNA 2DJQA 2DNUA 2EYZA 2KROA 1B3QA 2GNCA 2L2PA 1X2QA 1IO6A 1TUDA 4LE9A 4J9GA 2IIMA 3UF4A 2M51A 1UFFA 3RNJA 1WXUA 1X2KA 2DL5A 3EHRA 1KJWA 2KE9A 4A63B 1N5ZA 1UDLA 1YWOA 1M3CA 2C0OA 2P4RA 1SRLA 2BTTA 1KFZA 1WI7A 2DBMA 1YCSB 1OPKA 2CUBA 3M0RA 4LNPA 4OMMA 2AKKA 5FWBA 2KBTA 1NYFA 2DL3A 4RTTA 2O31A 1GCPA 1K0XA 2ABLA 4RTYA 2JTEA 4OMLA 1CKAA 2CREA 2CDTA 2V1RA 3VS2A 1PRLC 3H41A 2J7IA 1ABQA 2I0NA 4LN2A 4X1VA 2MIOA 5IXFA 3O5ZA 2OI3A 2F2VA 1PWTA 1Z9QA 4OMOA 1K9AA 2YUQA 1GL5A 4J9BA 1ZX6A 4GLMA 4OMQA 2JMCA 4RTVA 2NUZA 1UE9A 2HSPA 2K6DA 1UHCA 1M3AA 3UA6A 2GTOA 2J6OA 4JZ4A 2GGRA 2D8JA 1VYUA 2XMFA 2KXCA 1GBQA 3RBBB 1QWEA 1AWXA 1QWFA 1SSHA 2FO0A 1WXTA 2PZ1A 3ZL7C 4DEXA 1T0JA 2GTJA 2ESWA 4D8DA 1OOTA 2NWMA 1UTIA 1U06A 2OJ2A 1PKTA 1TUCA 1ZSGA 4HCKA 2F2XA 2V1QA 1T3SA 2EGEA 2VWFA 4J9EA 4HVVA 2DRMA 3NMZC 5IHKA 1YNZA 1CSKA 1AOJA 2HBWA 4ESRA 1LCKA 4CC7A 1HD3A 3PE0A 2PTKA 2JT4A 2LMJA 3VS3A 2DL8A 1T3LA 4M4ZA 4WCIA 1HJDA 2KEAA 1OV3A 2YSQA 4CC4B 4ORZA 2DX1A 4RTXA 5I22A 2VVKA 1MUZA 3H0IA 1W1FA 2LQWA 2J6FA 4JJCA 1AEYA 4F17A 2HDAA 2ENMA 1JEGA 1GRIA 2J06A 2DBKA 1UUEA 4D8KA 1GCQC 2LJ0A 5GJVB 1AD5A 4GBQA 1BK2A 2X3WD 2DF6A 2KT8A 1RI9A 1WLPB 3KFVA 1XOVA 1H92A 4IIMA 2O2OA 3EG3A 2MCNA 1NEGA 1JQQA 1UJ0A 3C0CA 4EIKA 3PVLA 4RTZA 1H3HA 1JU5C 5GJWB 1K0SA 2LCSA 3QWYA 2A37A 4LUDA 1QKWA 1WA7A 3R6NA 2DE0X 2GQIA 2FG0A 2FRWA 1GBRA 3LH5A 4DEYA 2FPDA 2ROTA 4OMNA 2DM1A 3I5SA 2L3SA 4J9DA 2C0IA 1OPLA 1RLPC 2DA9A 1WDXA 2A36A 2M0YA 1BBZA 1GFCA 1QKXA 2JM9A 2CT3A 4F16A 1PRMC 2BZ8A 2KXDA 1UJYA 2SRCA 4Z88A 1BU1A 1X6GA 2C0TA 3M0PA 3UA7A 4J9CA 3EHQA 1ZLMA 4Y92A 1I1JA 1QCFA 2EYYA 1UG1A 3H0HA 1UHFA 2AZSA 2K2MA 1VYVA 2K7AA 1NEBA 2K9GA 2LJ1A 4RUGA 1BB9A 2RPNA 4OMPA 3VS7A 1U5SA 5L23A 3TVTA 3ULRB 4HXJA 5IH2A 2JS0A 2KRSA 2AKLA 3M0SA 5HCKA 2LP5A 1I0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPD A;  4ZNX A;  3VS6 A;  1KSW A;  3VS1 A;  1NLO C;  2EYW A;  1TG0 A;  3TSW A;  2OAW A;  4J9H A;  2L3Q A;  1Z9Z A;  2CH4 A;  4AFQ C;  4AFU C;  2RN8 A;  3EG2 A;  3GBQ A;  2KYB A;  1PNJ A;  1E6G A;  2VKN A;  1SEM A;  1G83 A;  2DL7 A;  2RQV A;  3REB B;  1EFN A;  3SEM A;  2BZY A;  4JJB A;  2JM8 A;  2W0Z A;  1ZBJ A;  2LQN A;  1MV3 A;  1ABO A;  2CT4 A;  2EQI A;  3VS0 A;  4Z89 A;  1G2B A;  2KRM A;  2E5K A;  1PHT A;  1H8K A;  1CKB A;  4K11 A;  1K4U S;  2EGA A;  4FSS A;  2DIL A;  3I5R A;  4JPB W;  2O9S A;  1ARK A;  2A28 A;  2D0N A;  5ECA A;  1WX6 A;  5FWC A;  1HSQ A;  1YWP A;  2MOX A;  2X3X D;  4IIO A;  4AFS C;  2RQR A;  2LNH B;  1S1N A;  3I9Q A;  2EKH A;  2FPE A;  1E7O A;  2DRK A;  2EBP A;  1NG2 A;  1ZUY A;  3A98 A;  1VYT A;  2DMO A;  3M0T A;  1JXM A;  2RF0 A;  1OEB A;  3EG0 A;  3THK A;  2FRY A;  1AZG B;  1PKS A;  2RQT A;  2CSI A;  1WYX A;  5I11 A;  4LUE A;  1SRM A;  1V1C A;  3JV3 A;  1T0H A;  1JXO A;  2JW4 A;  4JZ3 A;  4R0K A;  2YT6 A;  2HEQ A;  2DYB A;  1YP5 A;  2RMO A;  1SHF A;  2D8H A;  1GFD A;  2G6F X;  5IHN A;  4CC3 A;  3REA B;  2LZ6 B;  3M0U A;  4HVW A;  4J9F A;  1E6H A;  2YDL A;  2EYX A;  3H0F A;  3VRY A;  2RQW A;  1JO8 A;  5IHI A;  3NPF A;  1KIK A;  1AWW A;  2F2W A;  1AWO A;  4AG2 C;  3FJ5 A;  2B86 A;  1AWJ A;  2RQU A;  2BZX A;  2K79 A;  1UGV A;  2AK5 A;  1M27 C;  1Y0M A;  2GBQ A;  1VA7 A;  2O9V A;  2J6K A;  4E6R A;  1WFW A;  2DVJ A;  3VS5 A;  3UAT A;  2EVR A;  2J05 A;  3IQL A;  5FW9 A;  4AG1 C;  1SHG A;  1WXB A;  1GCQ A;  2HCK A;  2D1X A;  4J9I A;  4Z8A A;  3VS4 A;  5EC7 A;  2CSQ A;  1U3O A;  2FEI A;  2L0A A;  2YUN A;  4JJD A;  4AFZ C;  1MV0 B;  2KR3 A;  4CC2 A;  2FPF A;  2L3P A;  1FYN A;  1RUW A;  1UEC A;  1I07 A;  1W6X A;  3PVQ A;  2A08 A;  2ED0 A;  1QLY A;  2AZV A;  2EGC A;  2H8H A;  2JS2 A;  2RNA A;  1X69 A;  2DLP A;  4HVU A;  2SEM A;  2ROL A;  2CH4 W;  2KNB B;  3EGU A;  2ECZ A;  3I35 A;  4RTU A;  5IXB A;  3EG1 A;  1NLP C;  2EW3 A;  2ED1 A;  2DL4 A;  1X6B A;  1NYG A;  3QWX X;  1NM7 A;  1ZUU A;  1M8M A;  1B07 A;  2KYM A;  3CQT A;  1WIE A;  1X43 A;  2JMA A;  1M30 A;  2W10 A;  3NHN A;  1RLQ C;  2PNI A;  1K76 A;  2JXB A;  2K3B A;  1M3B A;  2LX7 A;  1X27 A;  3U23 A;  2CUD A;  1AVZ C;  3VRZ A;  1K1Z A;  2LJ3 A;  2YUO A;  4RTW A;  2KGT A;  2QDL A;  2KT1 A;  3SHW A;  4QT7 A;  1ZUK A;  1A0N B;  1YN8 A;  3NGP A;  1SPK A;  3TSZ A;  1J3T A;  1Y57 A;  1AZE A;  2O88 A;  1FMK A;  1W70 A;  3M0Q A;  2YUP A;  4F14 A;  4KRT A;  2KRN A;  2DJQ A;  2DNU A;  2EYZ A;  2KRO A;  1B3Q A;  2GNC A;  2L2P A;  1X2Q A;  1IO6 A;  1TUD A;  4LE9 A;  4J9G A;  2IIM A;  3UF4 A;  2M51 A;  1UFF A;  3RNJ A;  1WXU A;  1X2K A;  2DL5 A;  3EHR A;  1KJW A;  2KE9 A;  4A63 B;  1N5Z A;  1UDL A;  1YWO A;  1M3C A;  2C0O A;  2P4R A;  1SRL A;  2BTT A;  1KFZ A;  1WI7 A;  2DBM A;  1YCS B;  1OPK A;  2CUB A;  3M0R A;  4LNP A;  4OMM A;  2AKK A;  5FWB A;  2KBT A;  1NYF A;  2DL3 A;  4RTT A;  2O31 A;  1GCP A;  1K0X A;  2ABL A;  4RTY A;  2JTE A;  4OML A;  1CKA A;  2CRE A;  2CDT A;  2V1R A;  3VS2 A;  1PRL C;  3H41 A;  2J7I A;  1ABQ A;  2I0N A;  4LN2 A;  4X1V A;  2MIO A;  5IXF A;  3O5Z A;  2OI3 A;  2F2V A;  1PWT A;  1Z9Q A;  4OMO A;  1K9A A;  2YUQ A;  1GL5 A;  4J9B A;  1ZX6 A;  4GLM A;  4OMQ A;  2JMC A;  4RTV A;  2NUZ A;  1UE9 A;  2HSP A;  2K6D A;  1UHC A;  1M3A A;  3UA6 A;  2GTO A;  2J6O A;  4JZ4 A;  2GGR A;  2D8J A;  1VYU A;  2XMF A;  2KXC A;  1GBQ A;  3RBB B;  1QWE A;  1AWX A;  1QWF A;  1SSH A;  2FO0 A;  1WXT A;  2PZ1 A;  3ZL7 C;  4DEX A;  1T0J A;  2GTJ A;  2ESW A;  4D8D A;  1OOT A;  2NWM A;  1UTI A;  1U06 A;  2OJ2 A;  1PKT A;  1TUC A;  1ZSG A;  4HCK A;  2F2X A;  2V1Q A;  1T3S A;  2EGE A;  2VWF A;  4J9E A;  4HVV A;  2DRM A;  3NMZ C;  5IHK A;  1YNZ A;  1CSK A;  1AOJ A;  2HBW A;  4ESR A;  1LCK A;  4CC7 A;  1HD3 A;  3PE0 A;  2PTK A;  2JT4 A;  2LMJ A;  3VS3 A;  2DL8 A;  1T3L A;  4M4Z A;  4WCI A;  1HJD A;  2KEA A;  1OV3 A;  2YSQ A;  4CC4 B;  4ORZ A;  2DX1 A;  4RTX A;  5I22 A;  2VVK A;  1MUZ A;  3H0I A;  1W1F A;  2LQW A;  2J6F A;  4JJC A;  1AEY A;  4F17 A;  2HDA A;  2ENM A;  1JEG A;  1GRI A;  2J06 A;  2DBK A;  1UUE A;  4D8K A;  1GCQ C;  2LJ0 A;  5GJV B;  1AD5 A;  4GBQ A;  1BK2 A;  2X3W D;  2DF6 A;  2KT8 A;  1RI9 A;  1WLP B;  3KFV A;  1XOV A;  1H92 A;  4IIM A;  2O2O A;  3EG3 A;  2MCN A;  1NEG A;  1JQQ A;  1UJ0 A;  3C0C A;  4EIK A;  3PVL A;  4RTZ A;  1H3H A;  1JU5 C;  5GJW B;  1K0S A;  2LCS A;  3QWY A;  2A37 A;  4LUD A;  1QKW A;  1WA7 A;  3R6N A;  2DE0 X;  2GQI A;  2FG0 A;  2FRW A;  1GBR A;  3LH5 A;  4DEY A;  2FPD A;  2ROT A;  4OMN A;  2DM1 A;  3I5S A;  2L3S A;  4J9D A;  2C0I A;  1OPL A;  1RLP C;  2DA9 A;  1WDX A;  2A36 A;  2M0Y A;  1BBZ A;  1GFC A;  1QKX A;  2JM9 A;  2CT3 A;  4F16 A;  1PRM C;  2BZ8 A;  2KXD A;  1UJY A;  2SRC A;  4Z88 A;  1BU1 A;  1X6G A;  2C0T A;  3M0P A;  3UA7 A;  4J9C A;  3EHQ A;  1ZLM A;  4Y92 A;  1I1J A;  1QCF A;  2EYY A;  1UG1 A;  3H0H A;  1UHF A;  2AZS A;  2K2M A;  1VYV A;  2K7A A;  1NEB A;  2K9G A;  2LJ1 A;  4RUG A;  1BB9 A;  2RPN A;  4OMP A;  3VS7 A;  1U5S A;  5L23 A;  3TVT A;  3ULR B;  4HXJ A;  5IH2 A;  2JS0 A;  2KRS A;  2AKL A;  3M0S A;  5HCK A;  2LP5 A;  1I0C A; 
#chains in the Genus database with same CATH topology
 1VQK Q;  3PMT A;  3D7S B;  4ZNX A;  2EWN A;  1R77 A;  1JJ2 A;  1WHK A;  4BI4 A;  3CCV Q;  2RHZ A;  5KYY B;  3RER A;  3EFO A;  1RAD B;  3TSW A;  4J9H A;  3CCS T;  2CP0 A;  4AFQ C;  4AFU C;  4M7A G;  2LDM A;  2RN8 A;  1M2V B;  4C8Q F;  1G83 A;  3REB B;  3WVE B;  4BB7 A;  1LVK A;  4JJB A;  5LJ3 j;  1BI2 A;  2OX7 A;  1MV3 A;  2DEU A;  5CKB A;  2E5Q A;  3CCS A;  3VS0 A;  1G2B A;  2KRM A;  2JZ2 A;  3CME Q;  3OYA A;  1WJS A;  4DOV A;  5FLX E;  5KYW B;  2E5K A;  1KD1 U;  3GPL A;  4J6X A;  1CKB A;  4NL3 A;  2EGA A;  1S72 A;  2M9U A;  4FSS A;  2DIL A;  5LJ5 g;  2VYT A;  1JBM A;  1WX6 A;  2DZC A;  3CCM T;  3UT1 A;  3FIF A;  1IHW A;  3ZBD A;  2RQR A;  1S1N A;  1M1F A;  3JCM V;  1ZSZ C;  4ZGJ B;  3QKJ A;  1WGS A;  1NG2 A;  2EBP A;  3JCM f;  4JS4 A;  1VYT A;  2R57 A;  1VQK A;  2FRY A;  4OB3 B;  1X75 C;  5CKH A;  1N27 A;  5I11 A;  5I2M A;  3Q1J A;  1SRM A;  1VQ4 Q;  2LCL A;  2BIV A;  1JXO A;  1YIT Q;  3DB3 A;  4R0K A;  2YT6 A;  1YP5 A;  2RMO A;  1SHF A;  3MEV A;  1N6A A;  1QVG S;  4J7I A;  4ZGD B;  3EH2 A;  1Q95 G;  1VQK T;  4GY5 A;  4OB1 B;  1KHC A;  2YLC A;  2LZ6 B;  3M0U A;  4FW2 A;  1VQ9 A;  4N4H A;  1E6H A;  1V76 A;  2EYX A;  2CZ6 B;  5IHI A;  3NPF A;  1NJI U;  1KIK A;  3CCL A;  2F2W A;  5GMK e;  3G6E A;  3OSV A;  2B86 A;  2RQU A;  4PJO D;  1M27 C;  1Y0M A;  2GBQ A;  2QXF A;  2J6K A;  2DVJ A;  5CCA A;  3L1A A;  4PJJ A;  3VS5 A;  3OYL A;  1WQW A;  2J05 A;  3G71 A;  4C92 C;  4AG1 C;  2P4T A;  1WJR A;  3SWN C;  4C8Q E;  4ZN1 A;  4PJO F;  3RMQ A;  1SSF A;  4IUR A;  1GCQ A;  5KYX B;  4J9I A;  3JCM g;  3HPW A;  5EC7 A;  2CSQ A;  3E1S A;  4LDV A;  1QVF S;  1WNL A;  2YUN A;  4ELY C;  2COW A;  2L3P A;  4M7D A;  4M7A C;  1FYN A;  1I07 A;  3OYM A;  2DXT A;  2B8A A;  3OS2 A;  4IUT A;  3CCE Q;  4KUD K;  1WHL A;  4MDX A;  2RNA A;  4C0Z A;  3JCM c;  2E6N A;  1U8R A;  3I35 A;  2ROL A;  2CH4 W;  2KNB B;  3EGU A;  3OYI A;  2K5F A;  3PIP A;  3CC7 A;  1RAI B;  3MEU A;  1Q7Y C;  3QWX X;  3M57 A;  3QJ6 A;  1WIE A;  1X43 A;  5CVI A;  5CQX A;  1VQ8 T;  5GAO m;  2K3B A;  1M3B A;  1UGQ B;  1QVG A;  2LX7 A;  3FRN A;  1AVZ C;  4OB2 B;  3OW2 A;  1NJI C;  2DD4 A;  1K1Z A;  4XK8 E;  5GAM j;  3URG A;  5KE2 A;  3L2Q A;  1Q81 U;  4Z02 A;  4PFP A;  3SHW A;  3QYG B;  1MMA A;  3OBW A;  1YJW T;  2E41 A;  5FU6 B;  5C0M A;  4DBR A;  1AZE A;  4F14 A;  3CD6 A;  5HY6 A;  3VJP A;  4A4H A;  1SKU B;  2FZG B;  2DXB A;  4F04 B;  4M7D D;  2GNC A;  2EJ9 A;  1X2Q A;  1IO6 A;  1G3S A;  3OYF A;  4XTV A;  1M1K R;  5LJ5 j;  2ATC B;  2DL5 A;  2QQS A;  2FZK B;  1Y71 A;  1N5Z A;  5M9O A;  3OA6 A;  1M3C A;  2QAZ A;  2E64 A;  3OYB A;  2KVQ G;  3L2R A;  1PG5 B;  2PVD B;  4KBM B;  1VUB A;  1M1G A;  4M7A F;  5FWB A;  4RTT A;  1SF9 A;  3RR6 A;  1GCP A;  4E7K A;  4M7D E;  5FU6 C;  4OML A;  1Y96 B;  1K8A U;  4PFO A;  2V1R A;  5FRO A;  1PRL C;  4B6M A;  2IPO B;  1ABQ A;  2FZC B;  2I0N A;  4M77 B;  1PM3 A;  4X1V A;  2X35 A;  4Y91 A;  4M7A D;  5KH6 A;  1QCO A;  4O6J A;  3QG1 A;  1M2V A;  3QJY A;  1PWT A;  1Z9Q A;  2HZY A;  4N4G A;  4OMO A;  3CC4 T;  4OGC A;  4J9B A;  4GLM A;  2ZZD A;  4OMQ A;  2QEX T;  3C94 A;  3JCM P;  1MND A;  2NUZ A;  2MYS A;  3EFO B;  1UHC A;  3VU3 C;  3MKD A;  1QW1 A;  4C92 D;  2D8J A;  1VYU A;  4FYW B;  2XMF A;  2KXC A;  4XAX B;  2PUO B;  3A8H B;  1WXT A;  3CCJ A;  2QEX A;  4ZGE B;  3C95 A;  4JJN K;  1F1B B;  1K73 R;  2NWM A;  5LJ5 h;  3CPW S;  1TUC A;  2PUK B;  2MPX C;  4OB0 B;  5GAN 4;  2QTX A;  3MP1 A;  3N5B B;  2VWF A;  3RKY A;  4A4G A;  3TQ7 P;  3OYK A;  2MWO A;  5L8R E;  2JTM A;  4J9E A;  5LJ3 e;  1BI3 A;  1LCK A;  5A0G A;  4D6W A;  1WHG A;  2PTK A;  4E7J A;  1MGQ A;  3VUZ A;  2JT4 A;  3VS3 A;  1BCM A;  4J83 A;  2NUP A;  3BW1 A;  1HJD A;  4JRI A;  2EJF A;  2RJD A;  2YSQ A;  1UGP B;  2XG8 D;  5GAM g;  1Y7X A;  3PMI A;  4RTX A;  5KYY A;  2VVK A;  3CBM A;  3S6W A;  2BUD A;  3MEW A;  4ATO A;  4C0F A;  5KE3 A;  2XID A;  3CXC A;  2K3X A;  4HKE A;  1OZ2 A;  2HDA A;  2ENM A;  2I2L A;  2X9H A;  2LTO A;  4JUV A;  2P0P A;  4D8K A;  1IGU A;  1D09 B;  4GBQ A;  3X26 B;  2X3W D;  1TH7 A;  2KT8 A;  2V8I A;  3EGX B;  1RI9 A;  2DPP B;  1I8F A;  2LT1 A;  1XOV A;  3JCM e;  2OTL T;  3MP8 A;  3QDF A;  4IIM A;  2V26 A;  4A4K A;  2A37 A;  1QKW A;  4M78 G;  1Q81 C;  2WSE E;  2GQI A;  2QA4 A;  4QW2 A;  5IT9 E;  4DA4 A;  3HFO A;  2ROT A;  1MHN A;  4J9D A;  4E7I A;  2A36 A;  2MWP A;  3X24 B;  4F16 A;  2SRC A;  3CC7 T;  3H6Z A;  3LW5 E;  3UA7 A;  1O9S A;  2FVU A;  4J9C A;  1ZLM A;  1M90 R;  1QCF A;  2V8J A;  4MZT A;  3SB2 A;  2AZS A;  2QYZ A;  3BY7 A;  2K7A A;  3MPU B;  1PSE A;  1OUL A;  3X28 B;  1K8A R;  1YI2 Q;  1PCX A;  3ULR B;  1QP2 A;  3OS0 A;  4HXJ A;  3CCE A;  5IH2 A;  1YIT A;  1N8R U;  2AKL A;  2YHT A;  5HCK A;  2BKD N;  1Q81 R;  3L2U A;  5LJ3 g;  3JRZ A;  3KXT A;  2A0F B;  3JB9 J;  2A7Y A;  2HQX A;  1YHQ A;  3VS6 A;  2FL7 A;  2RO0 A;  1KSW A;  1ZA2 B;  1M90 U;  1VQ5 A;  1NLO C;  3OYH A;  3ASK A;  2OAW A;  2KYB A;  2EFI A;  2QGG A;  3PGG A;  2CP3 A;  3HRT A;  1NPR A;  5GAM e;  4M78 E;  1C6V X;  2JJ9 A;  4PJO E;  5GAM d;  1H8K A;  1YIJ Q;  3L2W A;  1V29 B;  1YI2 A;  4M75 E;  2DAQ A;  2A28 A;  1VQP A;  3T9N A;  5FWC A;  1YIJ A;  2MOX A;  2X3X D;  3BDL A;  2HKQ B;  1VIF A;  2LNH B;  2EKH A;  2CZ7 B;  1E7O A;  1WQ7 A;  3A98 A;  2DMO A;  3HKS A;  2COY A;  1JXM A;  4PJM A;  2X4X A;  3EG0 A;  4PKC C;  3V8J A;  4XQ3 A;  3DB4 A;  4MDW A;  4EPC A;  1QVF P;  1VQP T;  1WYX A;  4LUE A;  3MEA A;  2DFU A;  3CC2 Q;  1T0H A;  3FJP A;  2M16 A;  4JZ3 A;  3GIB A;  4R55 A;  3G6E T;  2QTV A;  5IHN A;  4KUI A;  3ER0 A;  2DTI A;  4X9C A;  2O01 E;  2F69 A;  4HVW A;  4QVZ A;  5DLO A;  2LNV A;  3VRY A;  5GAN h;  2CZ0 B;  5FU7 B;  2RI5 A;  2VGM A;  1VQN A;  3C12 A;  1VA7 A;  4WF2 A;  5KYW A;  3CCQ Q;  2D6F A;  3UAT A;  3A8O B;  1SHG A;  4ZTJ A;  3OB9 A;  1M4Z A;  1D1C A;  1JJ2 S;  3JB9 G;  4ZTF A;  5GAO q;  4KGV B;  4Z8A A;  3RKW A;  4FYX B;  4IUP A;  4AFZ C;  4BY6 B;  2KR3 A;  1H3Z A;  4CC2 A;  2FPF A;  2CP6 A;  3PVQ A;  4EMK B;  4C0G A;  5GMK h;  1VQM A;  1W2B S;  1JRI A;  3JCM d;  1S72 T;  1WHM A;  2AZV A;  5CKF A;  2DYI A;  2H8H A;  1BIB A;  4JLG A;  4UC4 A;  3I56 Q;  3M59 A;  4RTU A;  3OW2 P;  1NLP C;  1Y07 A;  2R5A A;  2HAX A;  1YI2 T;  4KGZ B;  2AT1 B;  3R6O A;  2KYM A;  3CQT A;  1TU0 B;  1M30 A;  3NHN A;  1RLQ C;  2JXB A;  4KUL A;  3JB9 F;  5CIU A;  1FWZ A;  2M0O A;  4M7A B;  2KGT A;  1NBE B;  4AT1 B;  2EKO A;  1UGS B;  4EMK C;  5LJ3 f;  4A54 A;  1AT1 B;  1B34 A;  2QDL A;  3M5A A;  4LDY A;  2KT1 A;  2PVG B;  2OAU A;  3DKM A;  4PFZ A;  1ZUK A;  1A0N B;  1YN8 A;  4M7A E;  3NGP A;  2QGF B;  3FLG A;  4OF1 A;  1LPL A;  1J3T A;  1Y57 A;  1LNX A;  2O88 A;  1W70 A;  3EAE A;  2YUP A;  4KRT A;  1G3T A;  3QYH B;  2DNU A;  2NUT A;  2E6Z A;  1VQ9 Q;  1RAF B;  2KRO A;  4PK4 A;  3FB9 A;  4IKF A;  1TUD A;  4LE9 A;  3UF4 A;  2IIM A;  4FW1 A;  1X2K A;  3EHR A;  4PLL A;  2EAY A;  4RCC A;  5GAN 6;  4M77 D;  4J6Y A;  4Y28 E;  1YWO A;  3LWH A;  2P4R A;  2QQB A;  4QQ6 A;  1SRL A;  1YIT T;  1H64 1;  1YCS B;  2EQM A;  2QAS A;  1VQN T;  2KQW A;  4LNP A;  4OMM A;  3L2V A;  2KBT A;  3G71 T;  2DL3 A;  3CCR T;  2O31 A;  2WAC A;  3MP6 A;  1YCY A;  4QQD A;  5A0L A;  2XKO C;  2CRE A;  1Q7Y U;  2CDT A;  3E9F A;  3H41 A;  3CC7 Q;  5KCH A;  2E65 A;  2GQV A;  2MIO A;  1OX8 A;  2H3J A;  1K9A A;  1GL5 A;  1ZX6 A;  3G6E Q;  1LOJ A;  2KMT A;  1KC8 R;  2CZ1 B;  2KY9 A;  1RAA B;  4RTV A;  2MK5 A;  1UE9 A;  4MML A;  2HSP A;  4FU6 A;  3CMA T;  2OTL Q;  3UA6 A;  3OYC A;  4C5G A;  1NPP A;  2HL3 A;  3H9N A;  5CR2 A;  4LDX A;  1GBQ A;  1RAG B;  3RBB B;  3ZL7 C;  1T0J A;  4FL6 A;  1OOT A;  3MHX A;  2IG0 A;  3CMA A;  3CCM A;  3CCQ T;  1ZSG A;  4HCK A;  1XNI A;  4IUV A;  2AHJ B;  1T3S A;  4M77 C;  3V8L A;  4FCY A;  1M1K C;  4J6W A;  5GAN 2;  2XK0 A;  2DRM A;  4C0D C;  4CC7 A;  3E2U A;  1BI0 A;  1HD3 A;  5J26 A;  1UEB A;  3EG9 B;  2LMJ A;  1HYO A;  3CBO A;  4KGX B;  2CS7 A;  1UB4 A;  2HBP A;  2XDB A;  1OV3 A;  4A4F A;  2CP2 A;  4CC4 B;  3CXC P;  3CME T;  3RMS A;  3CCR Q;  2DX1 A;  5I22 A;  1FMW A;  2OTJ Q;  1HXD A;  2LRQ A;  1WJQ A;  1KD1 R;  4C5E A;  1KQ2 A;  3M56 A;  1W1F A;  2LQW A;  4PJO B;  3MCA B;  2J6F A;  1ZSZ A;  3MO8 A;  3JSC A;  4M78 B;  1R0C B;  4F17 A;  3VUB A;  1YJ9 A;  4M77 A;  1YJW Q;  1NJI R;  3J7A F;  1GRI A;  4X34 A;  1M9S A;  2J06 A;  4DBQ A;  4C0D B;  4M7A A;  1GCQ C;  4M7D C;  3OYN A;  2DF6 A;  3LGF A;  3QII A;  2NYS A;  1VQ7 A;  2FB7 A;  3G4S A;  5IAY A;  4LXC A;  3JAM E;  4J5Y A;  2YRD A;  3EG3 A;  2K2V A;  1JQQ A;  1AHJ B;  5LJ3 d;  3JCM X;  2V8K A;  3JB9 D;  3JB9 H;  2LT4 A;  1G3Y A;  3PVL A;  5D6Y A;  1H3H A;  3CD6 Q;  4J7F A;  2LCS A;  2MAM A;  5GAN g;  3I56 A;  2ZPI B;  2FRW A;  4DEY A;  1DJ7 B;  4M75 G;  4OMN A;  5GAN f;  2C0I A;  1OPL A;  2EIF A;  1GFC A;  1QKX A;  4M7D F;  3OMG A;  2JM9 A;  2HD0 A;  4JLI A;  2CT3 A;  4M7D B;  1PRM C;  1RL2 A;  1UJY A;  1OX9 A;  2HQE A;  1BU1 A;  2C0T A;  1MMD A;  1W2B A;  1YBY A;  3CCJ T;  4Y92 A;  1I1J A;  4XTY A;  4F7U B;  2RH2 A;  3CCE T;  3MJX A;  3O8V A;  3P8D A;  3ME9 A;  3HRS A;  3G71 Q;  1TOV A;  3PT9 A;  2EQK A;  2RPN A;  4OMP A;  2QK0 A;  4EMG A;  3KBG A;  5KYU A;  3V8K A;  3QBY A;  1XJW B;  4M78 A;  2F5T X;  3RUX A;  4E7Z A;  3I55 T;  1OI1 A;  1VQ8 Q;  4HCC A;  1RAC B;  1OU8 A;  4C8Q D;  2LX9 A;  5CQY A;  2RM4 A;  3L2Z A;  2ZGW A;  3M9Q A;  2NUT B;  2H3E B;  1ZHI A;  3OYD A;  1X01 A;  3EGX A;  2CH4 A;  3EG2 A;  4II1 A;  3GBQ A;  2RQV A;  5GAN 7;  1EFN A;  3SEM A;  2F5K A;  3CPW A;  2CT4 A;  4DQ2 A;  1Q86 C;  4JS5 A;  3LH0 A;  4ANJ A;  5DLQ E;  2K5L A;  4BE0 A;  1D3B A;  1K4U S;  3VYH B;  4JPB W;  2DKG A;  2RHX A;  5ECA A;  3V7R A;  1KQS S;  3CC2 T;  1K8A C;  4AFS C;  3OW2 S;  1KC8 U;  3M4G A;  3M53 A;  4E47 A;  2DRK A;  1VQ4 A;  1M2O A;  1QVG P;  1JJ2 P;  3QZ5 B;  2JOY A;  3PFS A;  1OEB A;  3THK A;  1NE8 A;  1AZG B;  1Q82 R;  1PKS A;  4C92 A;  2CSI A;  4BAC A;  3A8M B;  1VQL A;  3X25 B;  3DLL A;  2JW4 A;  3CEY A;  1EIF A;  4C8Q B;  4C92 G;  1TS9 A;  2GFA A;  3TCJ A;  2HEQ A;  2DYB A;  1TUG B;  5GAO n;  2D8H A;  5I21 A;  1GFD A;  1VQ5 Q;  2BE9 B;  3A8L B;  1G5V A;  1P92 A;  2X4W A;  3TU4 K;  4QQG A;  2DD5 A;  2QA4 Q;  3HHT B;  1JO8 A;  3HP9 A;  4JRQ A;  3HFN A;  3CCS Q;  4PJN A;  1FMV A;  1AWJ A;  1OU9 A;  2BZX A;  4HT9 A;  2O9V A;  3OY9 A;  1Q86 U;  1D1B A;  2JNG A;  2EVR A;  4ELZ C;  1PC0 A;  1WHH A;  3IQL A;  4VUB A;  5FW9 A;  1IGQ A;  1B7T A;  1YHQ T;  4LDW A;  4M77 E;  3CCU T;  1WXB A;  3S3M A;  1KHI A;  2LQK A;  2D1X A;  4XTW A;  1QP3 A;  2QQR A;  2FEI A;  2KK4 A;  2G3R A;  4XU2 A;  4JJD A;  4N4I A;  2WSF E;  5GMK j;  4HCB A;  4RMO A;  1IRX A;  1RUW A;  2HSE B;  1W6X A;  1PD1 A;  2O4X B;  1M5Q 1;  2Y4X A;  3CCM Q;  2A08 A;  2ED0 A;  1QLY A;  2EGC A;  2XHC A;  4OVA A;  5DM7 R;  2JS2 A;  4GLK A;  2SEM A;  5IXB A;  2ECZ A;  3EG1 A;  4KH1 B;  2HQH A;  2OTL A;  2EW3 A;  1YJ9 Q;  2ED1 A;  1X6B A;  3AHU A;  1VQ6 T;  1M8M A;  2CP7 A;  1B07 A;  3EGD A;  2D9T A;  2JMA A;  5GAN d;  4KT0 E;  2W10 A;  4PL6 A;  3I56 T;  4M78 D;  2PNI A;  3U23 A;  4BY6 C;  2CUD A;  1WZO A;  1ZA1 B;  2LJ3 A;  4RTW A;  2YUO A;  2E10 A;  3GLX A;  2XU8 A;  3EFS A;  3PNW C;  1VQ6 A;  4E7H A;  4NOY A;  5CK9 A;  2PQW A;  4QT7 A;  3CPF A;  2QG9 B;  3M0Q A;  2RJE A;  3OS5 A;  2COZ A;  2IVW A;  1I81 A;  2EYZ A;  3EH1 A;  2JVV A;  2KDS A;  1RAH B;  1B3Q A;  2KAF A;  2L2P A;  1Q82 C;  4X9D A;  3QUI A;  2OTJ A;  3BDU A;  4HT8 A;  3QDR B;  1C1A A;  4N0A A;  2GFU A;  4IUQ A;  1UFF A;  3RNJ A;  1WXU A;  8ATC B;  1KJW A;  3GF5 A;  4M75 B;  3CCR A;  1VQP Q;  3LLR A;  3CXC S;  1UDL A;  2C0O A;  3RES A;  2BTT A;  1KFZ A;  1WI7 A;  4M7D G;  1OPK A;  3GOX A;  2CUB A;  3M0R A;  5FRN A;  1KQS A;  3A1P A;  2EQJ A;  2DVE A;  1NYF A;  4PLI A;  4PNO A;  4F7U F;  3UWN A;  3SDZ A;  4RTY A;  1BI1 A;  2JTE A;  5FRM A;  1I5O B;  1MNE A;  4E2F B;  4BI8 B;  4XU1 A;  5AT1 B;  1Y96 A;  2X4J A;  2L5Q A;  1R0B G;  4TVR A;  2E12 A;  3BE3 A;  4LN2 A;  1IXD A;  3CMA Q;  1BKB A;  1RI0 A;  3M4Y A;  5IXF A;  1M90 C;  2OI3 A;  2F2V A;  2ZPB B;  1EX4 A;  2YUQ A;  4FYY B;  2L89 A;  4XTX A;  3TEE A;  2JMC A;  4MMK A;  5IN1 A;  4RKU E;  1M3A A;  2FYK A;  2GTO A;  2XDP A;  2J6O A;  4JZ4 A;  1VQ8 A;  2GGR A;  2QA4 T;  1QWF A;  2FO0 A;  5GAO l;  4DEX A;  5J39 A;  4D8D A;  5GMK m;  1UTI A;  3UPU A;  1U06 A;  2RB6 A;  1VQO Q;  9ATC B;  4OMF B;  2F2X A;  1VQ9 T;  4M75 D;  2EQU A;  4BDY A;  1VIE A;  2DJZ A;  4HVV A;  2AIR B;  2HBW A;  4ESR A;  2JTF A;  4PJO G;  3V7S A;  3G4S Q;  3FC3 A;  3PE0 A;  4M77 F;  2L3R A;  2DTO A;  2DL8 A;  3WVD B;  1T3L A;  1RAB B;  1VQ6 Q;  4WCI A;  1I5L A;  1KQ1 A;  3INZ A;  1S72 Q;  4ORZ A;  3LX7 A;  3OQ5 A;  2L8D A;  3HTR A;  5KYX A;  5KYU B;  1G3W A;  5LJ5 f;  1N8R R;  1BCO A;  3QSU A;  1YFN A;  3TRE A;  4JJC A;  4C8Q A;  3M58 A;  4WTO B;  2LCC A;  3I55 Q;  1VQ5 T;  5EG2 A;  1JEG A;  3J81 E;  3HRU A;  2VUB A;  1KQS P;  1JB0 E;  1M8V A;  5D6X A;  2DET A;  3NTK A;  5GJV B;  1AD5 A;  2F1L A;  1BK2 A;  1N9R A;  2Y4Y A;  2QEX Q;  1WLP B;  1VQM Q;  2RHU A;  3QPH A;  3CBP A;  5J3B A;  2MCN A;  2XDD A;  1NEG A;  1UJ0 A;  1BIA A;  5GAN 5;  3C0C A;  3OYE A;  2KI7 A;  2RHI A;  2Y90 A;  5GJW B;  1K0S A;  2LC4 A;  3R6N A;  1WA7 A;  3F70 A;  2DE0 X;  1VQM T;  2XI9 A;  4PJO C;  1VQO T;  2E3H A;  2DM1 A;  3I5S A;  1YJN A;  5GAN 3;  4BUG A;  2ZCF B;  1Q86 R;  1RLP C;  4C8Q C;  1WDX A;  1TTH B;  1U1S A;  4C92 E;  4EDU A;  1IB8 A;  4M78 F;  1YJW A;  2K3Y A;  5GAM f;  2DK3 A;  2A3L A;  2BZ8 A;  4FT2 A;  1Q82 U;  1K73 U;  4Z88 A;  1X6G A;  2RA2 A;  2M02 A;  3M0P A;  3GP8 A;  4JRP A;  5D6W A;  3EHQ A;  3EG9 A;  3JCM Q;  1YJN T;  3LGL A;  1UG1 A;  3H0H A;  5HK3 A;  5CO7 A;  1UHF A;  5FU7 C;  2K9G A;  4RUG A;  5CKE A;  1BB9 A;  1U5S A;  1VOM A;  2CP5 A;  3J80 E;  4M75 A;  5L23 A;  3CCV T;  1EZZ B;  1ZBX A;  4JRK A;  2VXF A;  2JS0 A;  2KRS A;  3M0S A;  2GF7 A;  4QKU A;  1TXQ A;  4BE1 A;  2EPD A;  4F7U G;  3EFR A;  4N0A C;  2JUF A;  3NTH A;  3CME A;  4E7S A;  1XTD A;  1QVF A;  4FYV B;  3VS1 A;  2EYW A;  3NTI A;  1TG0 A;  2K57 A;  3JCM b;  2FHD A;  3ZEH A;  2L3Q A;  1Z9Z A;  2ZPG B;  4V2S A;  5A0D A;  1K9M C;  4A53 A;  7AT1 B;  1ZSZ B;  1PNJ A;  1E6G A;  2VKN A;  1SEM A;  1VQ7 T;  2DL7 A;  8AT1 B;  5A2Q E;  2BZY A;  3CC4 A;  2D0Q B;  1RAE B;  2JM8 A;  2W0Z A;  1ZBJ A;  2LQN A;  3LWI A;  3JCM J;  1ABO A;  2EQI A;  3CCU Q;  4Z89 A;  4NS5 A;  2QDY B;  2E3I A;  4OGE A;  2MI6 A;  1K73 C;  3NFC A;  1PHT A;  4K11 A;  2EJG A;  3JB9 I;  2DTH A;  3I5R A;  2O9S A;  1ARK A;  2VC8 A;  4LDU A;  1IHV A;  2D0N A;  2ZPF B;  3RIR A;  4XU0 A;  1VQN Q;  2VGN A;  1HSQ A;  1YWP A;  4IIO A;  3I9Q A;  3BFM A;  4JDS A;  2FPE A;  5KCO A;  2C06 A;  2QQ9 A;  1ZUY A;  3M0T A;  2RF0 A;  2QQA A;  2RQT A;  2E1H A;  5GMK l;  1V1C A;  3JV3 A;  5I2S A;  2LVM A;  2NUP B;  4DBH A;  4CRI A;  1OYX A;  3CD6 T;  3QXE B;  2G6F X;  5CKD A;  4CC3 A;  3REA B;  4J9F A;  1OZ3 A;  2YDL A;  2DXU A;  3H0F A;  2RQW A;  2X51 A;  2K5I A;  3CCV A;  2EYQ A;  5LJ3 h;  1AWW A;  3CCU A;  1AWO A;  4AG2 C;  3FJ5 A;  5GAN j;  1UGR B;  1M1K U;  2K79 A;  1UGV A;  2AK5 A;  4DBF A;  4E6R A;  1WFW A;  2ZPH B;  2HCK A;  3VS4 A;  1U3O A;  2O4X A;  2L0A A;  2YWW A;  5C6S A;  3L42 A;  1MV0 B;  4EMK A;  1UEC A;  1WHJ A;  1TWB A;  1YJ9 T;  4ME7 A;  1YJN Q;  3OYG A;  1D0Y A;  2RJF A;  2VXE A;  4DOW A;  3HSB A;  1N9S A;  4HVU A;  1X69 A;  2DLP A;  2M1H A;  3CC2 A;  4AMC A;  3RKX A;  1D3B B;  2RHY A;  2E70 A;  1ZQ1 A;  4PJO A;  2VV5 A;  3G4S T;  3V7C A;  2MF2 A;  1VQ4 T;  2DL4 A;  1MMN A;  1NYG A;  1I4K 1;  1PSF A;  2RK2 A;  1NM7 A;  4BI3 A;  1ZUU A;  2PU9 B;  3SWN A;  4HCZ A;  5GMK i;  3OYY A;  5DY9 A;  4A4E A;  5CAI A;  1OQK A;  3QZ9 B;  1K76 A;  1N8R C;  1X27 A;  1QMC A;  3VRZ A;  2CGH A;  1VQO A;  4XU3 A;  1FX7 A;  2PVO B;  4C92 F;  2DER A;  5GAN 8;  3OS1 A;  2DIQ A;  5GAM h;  1B34 B;  1QCN A;  2DZ9 A;  1FXX A;  4EMH A;  1SPK A;  3QHS A;  3TSZ A;  1KG1 A;  1XQH A;  1FMK A;  2KRN A;  1W2B P;  2DJQ A;  4F7U A;  3M54 A;  3C4S A;  3DLM A;  4LD6 A;  4J9G A;  2M51 A;  3SD4 A;  2ZAE A;  4M78 C;  3A5Z B;  2CYZ B;  2KE9 A;  4A63 B;  4RG2 A;  3AT1 B;  6AT1 B;  3M55 A;  2VAS A;  4MZP A;  4XTZ A;  3RDV A;  2DBM A;  2E4H A;  4C5I A;  1KD1 C;  1VQL Q;  3I55 A;  4ZN3 A;  4P5N A;  2AKK A;  3PIO A;  1K9M R;  2YXY A;  3VKI A;  3OYJ A;  1K0X A;  2ABL A;  5D7U A;  2P0K A;  3VYG A;  2YLB A;  4QVD A;  1CKA A;  1TSF A;  4C8Q G;  4C92 B;  4FSX A;  3SWN B;  3WXM B;  3VS2 A;  1D1A A;  4BDZ A;  2DEQ A;  3FDR A;  2J7I A;  5LJ5 d;  3OSS C;  5LJ5 e;  2DIG A;  2JN0 A;  4L5G A;  1BYM A;  3O5Z A;  5AYF A;  3P8H A;  3E19 A;  4M75 C;  3EGD B;  1K9M U;  3LYI A;  4FM4 B;  2R58 A;  2R5M A;  2K6D A;  1W4S A;  1NZ9 A;  4NL2 A;  3SFM A;  4E7L A;  1LJO A;  3G1J A;  1QWE A;  1AWX A;  1D0Z A;  1SSH A;  3X20 B;  2PZ1 A;  4OP0 A;  2X4Y A;  2GTJ A;  2ESW A;  3UDC A;  3OMC A;  2OJ2 A;  1PKT A;  3MET A;  4CI0 C;  3PTA A;  1C0M A;  2RI2 A;  2V1Q A;  2EGE A;  1WPY A;  2NLU A;  4L59 A;  4O5V A;  4B9X A;  4RCB A;  3NMZ C;  5IHK A;  1YNZ A;  1IRE B;  1CSK A;  1AOJ A;  5HK0 A;  5LL6 S;  2P0Q A;  1R8O B;  1VQ7 Q;  3HL8 A;  3CPW P;  2OTJ T;  1G8X A;  1O75 A;  4KH0 B;  4J8O A;  3S3O A;  4M4Z A;  3P8B B;  1U1T A;  2KEA A;  1Q7Y R;  2P84 A;  4BD3 A;  1HK9 A;  1PD0 A;  1QQJ A;  2WSC E;  3G7Z A;  3JCM h;  3GNG A;  1D0X A;  1MUZ A;  4FT4 A;  3S3N A;  4Q5W A;  2K4Y A;  2XIC A;  2RK1 A;  3E9G A;  3H0I A;  5GAN e;  4F7U E;  1X6O A;  2LQ8 A;  4YTL A;  1AEY A;  2ZPE B;  2VB6 A;  2QI2 A;  2DBK A;  1UUE A;  4B9W A;  2LJ0 A;  2YRV A;  1GXI E;  2RD1 A;  4XTU A;  2HMA A;  4QVC A;  3KFV A;  5GAO r;  4L6V 5;  4R56 A;  2O2O A;  2HKN A;  4FIB A;  1H92 A;  2MMP A;  4EIK A;  2BE7 D;  2CKK A;  4RTZ A;  3GNF B;  1JU5 C;  1IZ6 A;  4PJL A;  3QWY A;  4LUD A;  3ZFJ A;  4HA8 A;  2FG0 A;  3A8G B;  4C5H A;  1GBR A;  3LH5 A;  4LD9 K;  3CCJ Q;  2GCX A;  2XD0 A;  5HKC A;  2FPD A;  3FEO A;  4M75 F;  2HNI A;  2L3S A;  1YIJ T;  1MMG A;  2DA9 A;  3OBY A;  2RJC A;  1BBZ A;  2M0Y A;  2RI3 A;  3JCM W;  3CCQ A;  1SG5 A;  2YRC A;  3QO3 A;  2KSS A;  4MZM A;  2KXD A;  1QVP A;  4RG8 A;  3CCL Q;  3H8Z A;  1YHQ Q;  2EYY A;  1VQL T;  3CC4 Q;  5KYN A;  2K2M A;  4IUU A;  1VYV A;  2Z0W A;  2LJ1 A;  1NEB A;  1KC8 C;  2DO3 A;  3VS7 A;  4BE2 A;  4M77 G;  3TVT A;  2HL5 C;  2DXC A;  3CCL T;  1ACM B;  1KK7 A;  3VV0 A;  5GAO p;  2LP5 A;  1I0C A;  3KUF A; 
#chains in the Genus database with same CATH homology
 2EPD A;  4ZNX A;  3VS6 A;  1KSW A;  3VS1 A;  1NLO C;  2EYW A;  1TG0 A;  3TSW A;  2OAW A;  4J9H A;  2L3Q A;  1Z9Z A;  2CH4 A;  4AFQ C;  4AFU C;  2RN8 A;  3EG2 A;  3GBQ A;  2KYB A;  1PNJ A;  1E6G A;  2VKN A;  1SEM A;  1G83 A;  2DL7 A;  2RQV A;  3REB B;  1EFN A;  3SEM A;  2BZY A;  4JJB A;  2JM8 A;  2W0Z A;  1ZBJ A;  2LQN A;  1MV3 A;  1ABO A;  2CT4 A;  2EQI A;  3VS0 A;  4Z89 A;  1G2B A;  2KRM A;  2E5K A;  1PHT A;  1H8K A;  1CKB A;  4K11 A;  1K4U S;  2EGA A;  4FSS A;  2DIL A;  3I5R A;  4JPB W;  2O9S A;  1ARK A;  2A28 A;  2D0N A;  5ECA A;  1WX6 A;  5FWC A;  1HSQ A;  1YWP A;  2MOX A;  2X3X D;  4IIO A;  4AFS C;  2RQR A;  2LNH B;  1S1N A;  3I9Q A;  2EKH A;  2FPE A;  1E7O A;  2DRK A;  2EBP A;  1NG2 A;  1ZUY A;  3A98 A;  1VYT A;  2DMO A;  3M0T A;  1JXM A;  2RF0 A;  1OEB A;  3EG0 A;  3THK A;  2FRY A;  1AZG B;  1PKS A;  2RQT A;  2CSI A;  1WYX A;  5I11 A;  4LUE A;  1SRM A;  1V1C A;  3JV3 A;  1T0H A;  1JXO A;  2JW4 A;  4JZ3 A;  4R0K A;  2YT6 A;  2HEQ A;  2DYB A;  1YP5 A;  2RMO A;  1SHF A;  2D8H A;  1GFD A;  2G6F X;  5IHN A;  4CC3 A;  3REA B;  2LZ6 B;  3M0U A;  4HVW A;  4J9F A;  1E6H A;  2YDL A;  2EYX A;  3H0F A;  3VRY A;  2RQW A;  1JO8 A;  5IHI A;  3NPF A;  1KIK A;  1AWW A;  2F2W A;  1AWO A;  4AG2 C;  3FJ5 A;  2B86 A;  1AWJ A;  2RQU A;  2BZX A;  2K79 A;  1UGV A;  2AK5 A;  1M27 C;  1Y0M A;  2GBQ A;  1VA7 A;  2O9V A;  2J6K A;  4E6R A;  1WFW A;  2DVJ A;  3VS5 A;  3UAT A;  2EVR A;  2J05 A;  3IQL A;  5FW9 A;  4AG1 C;  1SHG A;  1WXB A;  1GCQ A;  2HCK A;  2D1X A;  4J9I A;  4Z8A A;  3VS4 A;  5EC7 A;  2CSQ A;  1U3O A;  2FEI A;  2L0A A;  2YUN A;  4JJD A;  4AFZ C;  1MV0 B;  2KR3 A;  4CC2 A;  2FPF A;  2L3P A;  1FYN A;  1RUW A;  1UEC A;  1I07 A;  1W6X A;  3PVQ A;  2A08 A;  2ED0 A;  1QLY A;  2AZV A;  2EGC A;  2H8H A;  2JS2 A;  2RNA A;  1X69 A;  2DLP A;  4HVU A;  2SEM A;  2ROL A;  2CH4 W;  2KNB B;  3EGU A;  2ECZ A;  3I35 A;  4RTU A;  5IXB A;  3EG1 A;  1NLP C;  2EW3 A;  2ED1 A;  2DL4 A;  1X6B A;  1NYG A;  3QWX X;  1NM7 A;  1ZUU A;  1M8M A;  1B07 A;  2KYM A;  3CQT A;  1WIE A;  1X43 A;  2JMA A;  1M30 A;  2W10 A;  3NHN A;  1RLQ C;  2PNI A;  1K76 A;  2JXB A;  2K3B A;  1M3B A;  2LX7 A;  1X27 A;  3U23 A;  2CUD A;  1AVZ C;  3VRZ A;  1K1Z A;  2LJ3 A;  2YUO A;  4RTW A;  2KGT A;  2QDL A;  2KT1 A;  3SHW A;  4QT7 A;  1ZUK A;  1A0N B;  1YN8 A;  3NGP A;  1SPK A;  3TSZ A;  1J3T A;  1Y57 A;  1AZE A;  2O88 A;  1FMK A;  1W70 A;  3M0Q A;  2YUP A;  4F14 A;  4KRT A;  2KRN A;  2DJQ A;  2DNU A;  2EYZ A;  2KRO A;  1B3Q A;  2GNC A;  2L2P A;  1X2Q A;  1IO6 A;  1TUD A;  4LE9 A;  4J9G A;  2IIM A;  3UF4 A;  2M51 A;  1UFF A;  3RNJ A;  1WXU A;  1X2K A;  2DL5 A;  3EHR A;  1KJW A;  2KE9 A;  4A63 B;  1N5Z A;  1UDL A;  1YWO A;  1M3C A;  2C0O A;  2P4R A;  1SRL A;  2BTT A;  1KFZ A;  1WI7 A;  2DBM A;  1YCS B;  1OPK A;  2CUB A;  3M0R A;  4LNP A;  4OMM A;  2AKK A;  5FWB A;  2KBT A;  1NYF A;  2DL3 A;  4RTT A;  2O31 A;  1GCP A;  1K0X A;  2ABL A;  4RTY A;  2JTE A;  4OML A;  1CKA A;  2CRE A;  2CDT A;  2V1R A;  3VS2 A;  1PRL C;  3H41 A;  2J7I A;  1ABQ A;  2I0N A;  4LN2 A;  4X1V A;  2MIO A;  5IXF A;  3O5Z A;  2OI3 A;  2F2V A;  1PWT A;  1Z9Q A;  4OMO A;  1K9A A;  2YUQ A;  1GL5 A;  4J9B A;  1ZX6 A;  4GLM A;  4OMQ A;  2JMC A;  4RTV A;  2NUZ A;  1UE9 A;  2HSP A;  2K6D A;  1UHC A;  1M3A A;  3UA6 A;  2GTO A;  2J6O A;  4JZ4 A;  2GGR A;  2D8J A;  1VYU A;  2XMF A;  2KXC A;  1GBQ A;  3RBB B;  1QWE A;  1AWX A;  1QWF A;  1SSH A;  2FO0 A;  1WXT A;  2PZ1 A;  3ZL7 C;  4DEX A;  1T0J A;  2GTJ A;  2ESW A;  4D8D A;  1OOT A;  2NWM A;  1UTI A;  1U06 A;  2OJ2 A;  1PKT A;  1TUC A;  1ZSG A;  4HCK A;  2F2X A;  2V1Q A;  1T3S A;  2EGE A;  2VWF A;  4J9E A;  4HVV A;  2DRM A;  3NMZ C;  5IHK A;  1YNZ A;  1CSK A;  1AOJ A;  2HBW A;  4ESR A;  1LCK A;  4CC7 A;  1HD3 A;  3PE0 A;  2PTK A;  2JT4 A;  2LMJ A;  3VS3 A;  2DL8 A;  1T3L A;  4M4Z A;  4WCI A;  1HJD A;  2KEA A;  1OV3 A;  2YSQ A;  4CC4 B;  4ORZ A;  2DX1 A;  4RTX A;  5I22 A;  2VVK A;  1MUZ A;  3H0I A;  1W1F A;  2LQW A;  2J6F A;  4JJC A;  1AEY A;  4F17 A;  2HDA A;  2ENM A;  1JEG A;  1GRI A;  2J06 A;  2DBK A;  1UUE A;  4D8K A;  1GCQ C;  2LJ0 A;  5GJV B;  1AD5 A;  4GBQ A;  1BK2 A;  2X3W D;  2DF6 A;  2KT8 A;  1RI9 A;  1WLP B;  3KFV A;  1XOV A;  1H92 A;  4IIM A;  2O2O A;  3EG3 A;  2MCN A;  1NEG A;  1JQQ A;  1UJ0 A;  3C0C A;  4EIK A;  3PVL A;  4RTZ A;  1H3H A;  1JU5 C;  5GJW B;  1K0S A;  2LCS A;  3QWY A;  2A37 A;  4LUD A;  1QKW A;  1WA7 A;  3R6N A;  2DE0 X;  2GQI A;  2FG0 A;  2FRW A;  1GBR A;  3LH5 A;  4DEY A;  2FPD A;  2ROT A;  4OMN A;  2DM1 A;  3I5S A;  2L3S A;  4J9D A;  2C0I A;  1OPL A;  1RLP C;  2DA9 A;  1WDX A;  2A36 A;  2M0Y A;  1BBZ A;  1GFC A;  1QKX A;  2JM9 A;  2CT3 A;  4F16 A;  1PRM C;  2BZ8 A;  2KXD A;  1UJY A;  2SRC A;  4Z88 A;  1BU1 A;  1X6G A;  2C0T A;  3M0P A;  3UA7 A;  4J9C A;  3EHQ A;  1ZLM A;  4Y92 A;  1I1J A;  1QCF A;  2EYY A;  1UG1 A;  3H0H A;  1UHF A;  2AZS A;  2K2M A;  1VYV A;  2K7A A;  1NEB A;  2K9G A;  2LJ1 A;  4RUG A;  1BB9 A;  2RPN A;  4OMP A;  3VS7 A;  1U5S A;  5L23 A;  3TVT A;  3ULR B;  4HXJ A;  5IH2 A;  2JS0 A;  2KRS A;  2AKL A;  3M0S A;  5HCK A;  2LP5 A;  1I0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...