4CC4B

Complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
67
structure length
67
Chain Sequence
b'GPEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTEYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INLC PROTEIN
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Cell invasion
total genus 10
structure length 67
sequence length 67
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4cc4B00
3LH5A 1M3AA 2HDAA 3EGUA 3VS1A 2EVRA 4HVVA 4LE9A 1FMKA 4AFUC 3ULRB 1WFWA 1BK2A 4OMMA 4F17A 1K9AA 3H0FA 4J9BA 1T0JA 2K3BA 4J9DA 4K11A 1AWWA 1MUZA 4J9CA 1NEBA 2DF6A 2KYMA 2KRMA 4J9EA 2NWMA 1K0XA 2BZXA 1AD5A 1MV0B 2LJ1A 2DA9A 1Z9QA 1MV3A 1SRLA 4JPBW 2V1QA 1WA7A 1I07A 2DYBA 1G83A 2BZ8A 1W6XA 1V1CA 2DL3A 3I35A 3I5RA 2RQWA 1AWJA 4RTWA 4J9HA 2PNIA 1HJDA 2DL8A 3UA6A 1AEYA 1NEGA 3SEMA 2F2WA 2LZ6B 1E6GA 1W70A 2VWFA 3EHQA 3CQTA 4HCKA 2ESWA 2EBPA 4OMOA 4LUDA 2KT8A 1OV3A 2O88A 4R0KA 1XOVA 2JTEA 2J6KA 1X69A 2EYZA 1WDXA 5L23A 1ABOA 1K0SA 4GBQA 1ZBJA 1FYNA 1WYXA 4IIOA 1M8MA 1QKXA 2KT1A 1X43A 2CT3A 3VRZA 3M0RA 1X6GA 1GCPA 3H41A 1UJYA 1ZUYA 4J9GA 2JMAA 5IHKA 1UG1A 1BB9A 1KSWA 2RNAA 2V1RA 2KRSA 5IHIA 2FO0A 3GBQA 4LUEA 2YUOA 4Z8AA 5IH2A 1E7OA 1JQQA 2F2XA 2KROA 2D1XA 2HEQA 1N5ZA 2DRKA 1WXTA 1PNJA 1RLPC 3KFVA 4AG2C 1X6BA 1T3SA 1GBRA 2D0NA 2EGCA 5GJWB 2CUBA 1WIEA 2M51A 1QWFA 2BTTA 2C0IA 4FSSA 3QWYA 4JZ4A 4CC3A 4D8KA 1GRIA 2FRWA 2LQNA 2DL5A 2JM9A 3TVTA 2A36A 4DEXA 2CDTA 3A98A 2KXCA 1QCFA 5ECAA 2CT4A 2EGAA 4OMLA 4OMPA 2K9GA 1NG2A 1UJ0A 3O5ZA 1I1JA 1WXBA 1AWOA 1X27A 2EPDA 2LJ0A 3H0IA 5IHNA 2J7IA 4E6RA 3M0SA 2EYYA 1PRMC 1HD3A 2GTJA 1JEGA 1AWXA 1WLPB 2M0YA 4RTVA 4RTUA 1SRMA 2VKNA 3THKA 1VYVA 4F14A 1TUCA 1BU1A 4Z89A 2AZSA 1H3HA 1OPLA 2EGEA 2GGRA 2C0OA 1YP5A 3EHRA 4CC2A 2EKHA 1UHCA 1GCQA 2X3XD 2KYBA 1B07A 1Y0MA 2HCKA 2RQVA 1GL5A 1GCQC 2D8HA 1PHTA 2JMCA 2CSQA 2LQWA 2YUNA 2AKLA 2K7AA 2RQTA 1H92A 2RN8A 2ED0A 3VS3A 3M0UA 3NMZC 2X3WD 2YDLA 2JT4A 1AOJA 5IXBA 1UHFA 4KRTA 1KIKA 3UA7A 2JS2A 1UE9A 2FPDA 2RQRA 2JW4A 5FWCA 1M3BA 2DX1A 1SPKA 4QT7A 2KGTA 1HSQA 1GBQA 4Z88A 3EG3A 2YSQA 2L3QA 2GNCA 1NLOC 2GBQA 2QDLA 1OEBA 2DRMA 2DBMA 4JJCA 1YN8A 1NYFA 4AFZC 2DBKA 1TG0A 2LX7A 4RTTA 2W0ZA 5FW9A 2H8HA 2RQUA 2L3SA 2EYXA 1U3OA 5I11A 2AKKA 2XMFA 1J3TA 1NM7A 2DE0X 1WI7A 2FEIA 1JXMA 3EG1A 1NLPC 5HCKA 4CC4B 5FWBA 2ECZA 2J05A 1SHFA 3VS5A 3ZL7C 1S1NA 1WXUA 3H0HA 2HBWA 1RI9A 1KJWA 2CSIA 2A37A 2GQIA 2SRCA 5I22A 2OAWA 3NHNA 4Y92A 3M0PA 1T0HA 2DM1A 1A0NB 3JV3A 2NUZA 2LP5A 4AG1C 2DLPA 1OPKA 2DL7A 1QLYA 3EG0A 2KE9A 1ZUUA 1I0CA 1JU5C 4JZ3A 3RBBB 4WCIA 4EIKA 2ROLA 4DEYA 2SEMA 2MCNA 2DILA 1YNZA 1YCSB 2DMOA 3TSWA 2CH4A 2YUPA 2OJ2A 2OI3A 1CKAA 4ORZA 3VS6A 2E5KA 5EC7A 1K1ZA 1H8KA 2L0AA 1K76A 1PRLC 2KNBB 4AFSC 3UATA 3VS7A 2MOXA 4RTYA 4J9IA 5GJVB 1ARKA 2ABLA 3M0TA 1PKSA 1K4US 4M4ZA 2LJ3A 3NPFA 4ZNXA 2FG0A 4RTXA 2K79A 1UDLA 2HSPA 1JXOA 1W1FA 1GFCA 2LNHB 4J9FA 2YT6A 3EG2A 2RF0A 4JJDA 4JJBA 2IIMA 1M3CA 1WX6A 1IO6A 1U06A 1M27C 3VS4A 2EYWA 2KXDA 3REAB 1VYUA 4IIMA 1SEMA 2KRNA 2LMJA 4OMNA 3UF4A 2YUQA 4GLMA 1BBZA 2C0TA 4CC7A 2CH4W 1AZGB 1E6HA 2D8JA 2A28A 1JO8A 3VRYA 1OOTA 2LCSA 1NYGA 2A08A 2G6FX 2L3PA 1TUDA 3PE0A 2K6DA 2PTKA 1RUWA 1VA7A 1QKWA 2KEAA 2I0NA 1UECA 1UFFA 3VS0A 1X2KA 4HVUA 2RMOA 2ROTA 3TSZA 1ZLMA 1ABQA 1EFNA 2DJQA 3VS2A 2RPNA 2AK5A 1PKTA 4HVWA 3IQLA 2K2MA 1UTIA 3PVLA 1B3QA 2BZYA 2VVKA 3PVQA 2JM8A 3REBB 1ZX6A 4X1VA 1UGVA 4AFQC 1RLQC 4HXJA 1SHGA 1GFDA 1ZUKA 2DNUA 1AVZC 3SHWA 1ZSGA 1CKBA 5IXFA 1YWOA 1CSKA 2P4RA 3M0QA 1Y57A 1PWTA 2EW3A 1Z9ZA 2ENMA 2O9SA 2DVJA 2ED1A 1VYTA 2O31A 2EQIA 3NGPA 3C0CA 1SSHA 1T3LA 2KBTA 2L2PA 3QWXX 2DL4A 4A63B 2AZVA 2F2VA 3R6NA 2JS0A 1U5SA 2JXBA 2J06A 2J6FA 2O2OA 2CUDA 1KFZA 2W10A 2GTOA 2PZ1A 3FJ5A 3I9QA 4F16A 1LCKA 1G2BA 2J6OA 2FRYA 1M30A 4ESRA 3RNJA 1X2QA 2FPEA 4OMQA 4D8DA 2B86A 2MIOA 1UUEA 3I5SA 4RTZA 1AZEA 2FPFA 1QWEA 2KR3A 4LNPA 2O9VA 4LN2A 3U23A 4RUGA 2CREA 1YWPA
chains in the Genus database with same CATH superfamily
4M7DG 2A3LA 3L2ZA 5FU7B 4WF2A 4ZGDB 3CPFA 1BK2A 2X4WA 4J9BA 2K3BA 3ZBDA 4J9DA 2KMTA 4K11A 5IN1A 4BDZA 1N9SA 3JCMd 2E64A 2RHIA 1K0XA 4PL6A 2BZXA 1AD5A 1ZQ1A 1MV0B 4E47A 2DXCA 4PJOA 2LJ1A 4BE0A 2V1QA 6AT1B 4PLIA 4Y91A 3ME9A 3I35A 3I5RA 2LTOA 3QUIA 4XQ3A 3VV0A 3SWNC 1IGQA 2H3EB 4L5GA 3CPWP 3CCLQ 2PNIA 4C0FA 3NTIA 1AEYA 2HL3A 3SEMA 2LZ6B 2DJZA 2VWFA 3OYMA 4KULA 4XAXB 2P4TA 3CQTA 3JCMQ 4M77F 1C1AA 3G7ZA 1D0ZA 4OMOA 2VXEA 1OV3A 2AIRB 2O88A 3WVEB 1NJIR 3MP8A 1X69A 2EYZA 5GAOr 1ZBJA 5GAN3 4EPCA 1FYNA 2K5LA 5LJ5d 3CCRQ 3C94A 2DYIA 3RR6A 1M8MA 1YJWT 2HKQB 4OB3B 3JB9F 4Q5WA 1VQ9Q 4OP0A 1KD1U 3JCMg 3VRZA 2LX9A 1GCPA 3AT1B 3P8BB 1ZUYA 5IHKA 5KYNA 2QG9B 1UG1A 3G71A 1BB9A 3H8ZA 4M7AD 2DXUA 4JRKA 3VJPA 4DBFA 3RUXA 3CCQQ 1PC0A 3GBQA 4A4KA 5IH2A 4C8QG 4F7UG 5KYWA 2EAYA 3JCMc 1X6BA 2VXFA 4HCZA 3OYYA 1RAIB 5GJWB 5GAOp 2CUBA 1M1KC 2DIGA 3OSSC 1QWFA 4BI3A 3QYGB 4FSSA 4PJOB 4D8KA 1QCNA 3HP9A 2DPPB 5GAN6 1B7TA 2QDYB 1ZA2B 2LQKA 3L42A 2A36A 3A98A 5I2MA 3O5ZA 4ZN1A 1OU9A 1Q7YR 5EG2A 1X27A 2D9TA 1EIFA 3X24B 3G6ET 2HAXA 5LJ5g 2EYYA 5LJ3f 1AWXA 1WLPB 1BI3A 3UDCA 3CPWA 4ZGJB 4O5VA 3CCEA 5FROA 3CC7A 3MEAA 4QVZA 3RMSA 3EFSA 2JJ9A 4FYVB 1OQKA 2V26A 4FW1A 2V8JA 2JTMA 1OPLA 2C0OA 1UHCA 1Y7XA 5GMKh 3QDFA 1GL5A 3BDUA 2LQWA 5CIUA 3HHTB 5GMKj 3RKXA 2K7AA 2RQTA 1M90R 4N0AA 2RN8A 3NMZC 1N6AA 1WHGA 2JT4A 1Q82U 2PU9B 2EQUA 1UEBA 1UE9A 2CP5A 2RQRA 2D6FA 3J7AF 3P8HA 5FWCA 1M3BA 3QJYA 1SPKA 4QT7A 4DOVA 4E7JA 2KGTA 4M7AE 1HSQA 4OF1A 1TSFA 2FYKA 5KYWB 1YIJA 1VQ8T 2YRVA 2DRMA 3WVDB 5GAMd 4AFZC 2DBKA 1R0BG 2LX7A 5FW9A 1WHMA 5FLXE 1MHNA 3KXTA 2RQUA 2FEIA 3M53A 2RJEA 5HCKA 3VYGA 5CKFA 1OYXA 1VQPQ 2J05A 3ZL7C 1S1NA 3S3OA 1VQ6Q 3QXEB 2HBWA 1RI9A 1K9MU 2A37A 1R77A 1RADB 3JCMf 1U1TA 2FVUA 5HY6A 1VQOT 4ELZC 1I8FA 3M0PA 2DM1A 1YITT 3JSCA 1OZ3A 1WZOA 2RJDA 1RI0A 5DLOA 1LJOA 1N8RR 2E3HA 5KE3A 3OYJA 3X25B 2QTXA 3HPWA 4IKFA 2OTLQ 4MMLA 4WCIA 2ROLA 3M58A 1IGUA 2MCNA 1ACMB 5GAN4 2DD4A 2ZZDA 5KYYA 1NZ9A 2X4YA 5GAMg 2OI3A 3VS6A 1H8KA 2L0AA 4PJOG 4RTYA 4QQ6A 3UWNA 3VUZA 1KD1C 3UPUA 5LJ5f 5I21A 2V8IA 4XTUA 4LDUA 2LJ3A 3NPFA 2OAUA 4M7DD 2K79A 1VQKT 4PNOA 5C6SA 2RF0A 5GMKm 2COZA 4EMGA 3OYDA 4JJDA 2IIMA 1M3CA 1WX6A 1IO6A 2QEXT 1M27C 5CQYA 3VS4A 2EYWA 2KXDA 1VQMA 3HL8A 4IIMA 3OBWA 3UF4A 1KQSP 3E9FA 1TXQA 2C0TA 3M54A 4CC7A 1S72Q 3L2QA 2MWPA 3EFOA 5KCOA 3QYHB 1JO8A 1OOTA 3CCET 5CK9A 3I55Q 4EMHA 2E10A 1TU0B 2G6FX 4C92C 4CI0C 3CC4T 1FXXA 2K6DA 1BYMA 4M7AF 3KBGA 4ELYC 2M16A 3CD6Q 1VA7A 4A4GA 2M1HA 1QMCA 3CCVT 4ZGEB 4Z02A 1VQLQ 2K5FA 1TS9A 2RB6A 2AK5A 3MHXA 5GANd 4HVWA 4A4EA 2RHXA 2BZYA 2PVGB 5KYYB 2OTJA 3REBB 1ZX6A 1TWBA 1F1BB 2HMAA 4M78C 1Q7YC 3SHWA 1TH7A 3FC3A 3HFNA 2P4RA 1I5OB 1YWPA 3CCLA 2YRDA 4X9CA 2EW3A 2LVMA 3M4GA 1P92A 2O9SA 3CCST 2ED1A 8ATCB 2CZ0B 2EQIA 4EDUA 3NGPA 4A4HA 1SSHA 1T3LA 4MMKA 4NS5A 4EMKC 3RKYA 1M1GA 2L2PA 2BE9B 5CVIA 4M7DE 4IURA 3SB2A 2XG8D 1VOMA 1YJNQ 5DY9A 3R6NA 2JS0A 4C8QD 1QVGP 2WSFE 2PZ1A 3FJ5A 3I9QA 1LCKA 2J6OA 1JB0E 1RAGB 2QASA 3EFOB 3CCRA 3RNJA 5CQXA 5GANg 4KUDK 3JCMV 3DLLA 2B86A 4RG8A 3C12A 2CP0A 4A54A 4FM4B 4RTZA 2ZPEB 2MWOA 4X9DA 1VQ9A 2FPFA 2EQKA 2KR3A 1VQ5Q 4D6WA 3MKDA 4LN2A 2M0OA 2GFAA 2QQ9A 1D1AA 3LH5A 5KYXA 3LW5E 2BIVA 4DQ2A 3CCMT 3VS1A 2EVRA 3WXMB 4HVVA 1X01A 5HK3A 4F17A 1K9AA 4J6YA 4RCBA 2JZ2A 2QQSA 5D6XA 3ER0A 4AMCA 3M9QA 1AWWA 1MUZA 4J9CA 2Z0WA 1XNIA 2NWMA 2Y90A 2JTFA 3L1AA 2DA9A 1Z9QA 4JPBW 5CO7A 1ZHIA 1I07A 2DYBA 2EFIA 2A7YA 2DL3A 1V1CA 1SF9A 4KUIA 2DERA 3QIIA 4RTWA 4HCBA 1DJ7B 4BUGA 1PSFA 2L5QA 2D0QB 3OYBA 4QQDA 2E70A 3EHQA 3EAEA 2GF7A 2BUDA 1VQNT 4LUDA 2KT8A 1OULA 4R0KA 3E19A 3V8LA 5C0MA 4C8QE 4JLIA 2E12A 4F7UE 1WDXA 2QQAA 1K0SA 1WYXA 3RKWA 1UGSB 1YHQQ 4OB2B 2FHDA 2DFUA 1X43A 4LDXA 2EIFA 3EG9A 1QVGA 4N4GA 4M77B 3MJXA 1SSFA 1X6GA 1YJ9Q 3EH2A 1VIEA 4RKUE 5KYXB 2JOYA 1Q86U 1M2VB 3G6EA 2AHJB 4M7DF 3SD4A 4JRQA 1JQQA 2RK1A 2YLCA 2D1XA 2HEQA 2O01E 1WXTA 2DKGA 3G4SQ 3KFVA 4OGCA 4AG2C 1GBRA 1YI2Q 2EJGA 2M51A 4JZ4A 3OBYA 3CCLT 1TTHB 3FLGA 2DL5A 2NYSA 1BI1A 2JM9A 2YHTA 2CDTA 4MZMA 1K73U 3H9NA 1QCFA 1H641 1VQPA 2EGAA 4OMPA 1NG2A 5J39A 2LCCA 4M77C 2RM4A 2LJ0A 3O8VA 3H0IA 1G3WA 2J7IA 3TEEA 1PRMC 2DAQA 2GTJA 1JEGA 3CMAQ 4PJOD 2M0YA 4RTVA 2X35A 1SRMA 2LT4A 4F14A 3VYHB 5KE2A 3CCRT 5KYUB 2OTLA 5LJ3e 1H3HA 2DXBA 4CC2A 1YP5A 1VQ8A 1VQ9T 2KYBA 1B07A 7AT1B 5GAOn 4XTYA 3EG9B 2GCXA 2AKLA 3DB4A 2C06A 5M9OA 1H92A 3CCQT 2X3WD 4VUBA 5IXBA 1I5LA 3HFOA 3URGA 1C0MA 2L3RA 4MDXA 2NUTB 2NLUA 2R57A 1BCMA 1KD1R 2DX1A 1OX9A 2EJ9A 1IHWA 1VUBA 1VQOA 2QA4Q 3GIBA 4C5EA 2XIDA 3MP6A 1FWZA 3EG3A 4M75D 1YITA 2KQWA 2L3QA 2GBQA 3PTAA 1OEBA 4JJCA 1YN8A 4C8QF 4F7UF 4J6XA 3OYNA 2L3SA 3LGLA 1BI2A 4JRPA 1J3TA 4J7FA 4HKEA 1JXMA 2PVOB 1NLPC 4LD9K 4CC4B 5FWBA 3JB9H 2B8AA 1WXUA 2CSIA 2DD5A 1V76A 3CCJQ 5I22A 3E1SA 1M8VA 2EKOA 3HKSA 3JV3A 2NUZA 2DLPA 4PJOE 1OPKA 2KDSA 1QVFS 3JAME 3LWIA 1QLYA 1BIBA 2KE9A 1NJIU 2ZPIB 3JCMe 1JU5C 4TVRA 4JZ3A 4HCCA 1QVPA 4XU2A 2XK0A 1VQKA 3DB3A 5D6WA 1IHVA 2K5IA 3RERA 1YCSB 3OS5A 4BACA 1SG5A 3TSWA 3CBOA 2QEXA 5GAN7 2PUKB 3CC2Q 1H3ZA 2OJ2A 4M7AA 3UT1A 1CKAA 3JB9G 4FYWB 5EC7A 1K1ZA 2ZGWA 3OYKA 1V29B 3GP8A 1VQ7Q 3L2VA 2ABLA 3M0TA 4C0GA 1Y71A 1Q82R 4ZNXA 1AT1B 5CKEA 3X28B 5CR2A 3CC4A 3EGXB 3CXCS 1W1FA 4J9FA 4M75E 2HQXA 4KGXB 1VQPT 4JJBA 3OMCA 1D1BA 3CCVA 1HYOA 1U06A 5LJ5e 1VQ6T 2MI6A 1VYUA 3FDRA 2LDMA 1JRIA 4GLMA 2MK5A 1U8RA 2DIQA 2CZ1B 5KH6A 1M5Q1 1AZGB 1E6HA 2CH4W 2D8JA 3OYLA 4IUUA 2FL7A 1KQ1A 3VU3C 3OY9A 2A28A 2ZPHB 1Q81U 1K73C 2RK2A 2EYQA 4C92A 1NYGA 1VQ4Q 1O9SA 2L3PA 5GAN8 4JRIA 2OTLT 1K9MR 3OYFA 1QKWA 5KCHA 1MMNA 2R58A 1UECA 1UFFA 4BE2A 4HVUA 4E7ZA 4RMOA 3CCSA 2ROTA 1EFNA 4C0DC 3VS2A 1VIFA 3JB9I 3FIFA 2ZCFB 3KUFA 1NPRA 3IQLA 1LNXA 3META 1B3QA 4PK4A 4M78A 3JB9J 1UGVA 4HXJA 1SHGA 1GFDA 2DNUA 2E3IA 2XU8A 4M7AB 1ZSGA 5CKHA 2K57A 3J81E 2CP2A 3OYAA 3M5AA 2VC8A 2CZ6B 1BKBA 1Y57A 3OSVA 1PWTA 4DBRA 1Z9ZA 4FU6A 4DA4A 1EZZB 2O31A 4EMKA 3C0CA 2DETA 3CXCA 2ZPBB 2COWA 2O4XA 2DL4A 1JJ2S 3DKMA 3CCMA 2AZVA 4OB0B 3ZFJA 2JXBA 1S72T 2J06A 5LL6S 2J6FA 5GAOm 1K8AU 2O2OA 1KFZA 3V7RA 1WPYA 1WJRA 1WJSA 4A4FA 3EH1A 1N27A 4ESRA 4KH0B 4O6JA 4M7AC 3JCMP 3CD6T 2XI9A 4C92B 4C5IA 2MMPA 2P0QA 1D1CA 4LNPA 1YJ9A 3CBMA 2K3XA 3N5BB 2RD1A 3U23A 1VQLT 2CREA 2JVVA 3A1PA 1RAFB 3A8GB 2HDAA 2X4JA 4LE9A 5GANh 1FMKA 3QHSA 1WFWA 2VGNA 5GAMe 4M75F 4XTVA 3H0FA 3D7SB 2XKOC 3MPUB 3G4SA 2VB6A 1NEBA 2DF6A 3NFCA 4M78B 1VQNA 1YI2A 4HT8A 2QAZA 4JUVA 1WA7A 3L2UA 1W6XA 3NTHA 5J3BA 2RQWA 3PT9A 2VGMA 1R8OB 2R5MA 3NTKA 4FL6A 3V7SA 2HQEA 1HJDA 5L8RE 3UA6A 2HZYA 3VKIA 4NL3A 2LRQA 4EMKB 4XK8E 1YJNT 1XJWB 1GXIE 3F70A 2RA2A 1OZ2A 1PD0A 3G71Q 4ATOA 2M02A 2O4XB 3A8LB 2WSEE 4HCKA 1G3YA 2EBPA 3OQ5A 3TQ7P 2QGFB 2RJFA 1D3BA 3LX7A 1XOVA 3HSBA 2J6KA 1KC8U 2FZCB 1VQ5T 2X51A 4X34A 1RABB 4B9XA 2KT1A 4PJLA 2YRCA 3A5ZB 3RESA 2LNVA 2CT3A 2KVQG 2RO0A 3HRUA 2P84A 3M0RA 1Q82C 1Y96B 3GF5A 4J9GA 2JMAA 2IVWA 1Q81C 1WHHA 1Y07A 1KSWA 4E2FB 2LC4A 3SFMA 2KRSA 3TREA 2YUOA 1E7OA 3OS2A 2QA4A 2KROA 3CCEQ 1N5ZA 2DRKA 4ME7A 3CC7Q 3BFMA 3LGFA 3X26B 3PMTA 1T3SA 2D0NA 2EGCA 3V8KA 1AHJB 4IUVA 1IXDA 2V8KA 1D0YA 3QBYA 2C0IA 2IG0A 3QWYA 1IREB 1GRIA 2FRWA 2LQNA 5J26A 2E6NA 3S3NA 3TVTA 3CMEQ 4JJNK 2KXCA 3OA6A 4M77A 2CT4A 2MAMA 2K9GA 3TU4K 1UJ0A 2BKDN 1ZSZB 1K9MC 1WXBA 3GLXA 4QKUA 4E6RA 2FB7A 3M0SA 3JB9D 3JRZA 3M56A 3I56Q 3CCJA 3CCQA 1HD3A 1M2VA 4PLLA 4A53A 1UGPB 2CYZB 3HTRA 5GMKl 3THKA 1R0CB 1QW1A 4FYYB 4J6WA 5GANe 3M59A 4C92G 1VYVA 3Q1JA 5LJ3h 4E7IA 4JS4A 1TUCA 1BU1A 1D3BB 4J8OA 1YHQT 5A0DA 5LJ3j 3MCAB 3OYGA 1YIJQ 4E7LA 1B34A 3OYIA 5FRNA 2HSEB 2EGEA 2GGRA 1QP3A 3EHRA 1QP2A 1IZ6A 1PCXA 1YJ9T 4ZTFA 1GCQC 2JMCA 2X4XA 4OVAA 2EJFA 3A8MB 4FCYA 3CC2A 2ED0A 3M0UA 3DLMA 4M78G 4M7DC 1AOJA 3OMGA 1ZSZC 2E41A 1KIKA 5AYFA 2JS2A 4RG2A 3G4ST 1PM3A 1VQ7A 4F04B 3CCUQ 1YI2T 1GBQA 3QO3A 1YCYA 1Q86R 4LDVA 2GNCA 5KYUA 2DBMA 1NYFA 1W2BS 2W0ZA 2K2VA 2H8HA 1M1KU 2EYXA 3PMIA 1U3OA 5I11A 2RH2A 2ZPGB 4LDWA 2XMFA 2DE0X 2MF2A 1BCOA 4OGEA 4PFOA 1PSEA 2QGGA 1SHFA 3VS5A 3H0HA 3CMAT 1KJWA 2NUTA 1KG1A 1K73R 1TOVA 2RI2A 2GQIA 2SRCA 1W4SA 1VQ4A 3NHNA 4C8QB 4F7UB 1XTDA 2LP5A 4AG1C 3JCMh 4FT2A 4UC4A 2DL7A 2RI3A 2PQWA 3EG0A 1B34B 3OYEA 3X20B 4B9WA 4DEYA 4QVCA 1RAAB 2SEMA 5CAIA 2KSSA 3HRSA 2DILA 4C0ZA 2COYA 1PD1A 4XU1A 1VQMQ 1VQ6A 2XDPA 5FRMA 2YUPA 1IRXA 2EQMA 2E5KA 1KK7A 2QA4T 3EGDA 2IPOB 3QSUA 1PRLC 1UGRB 4AFSC 5CKBA 1PG5B 2MOXA 4AT1B 4J9IA 5GJVB 1ARKA 4C8QC 2E5QA 4MZPA 1PKSA 4ZN3A 3G1JA 2WACA 4M4ZA 1QCOA 3J80E 4J5YA 2FG0A 4FW2A 4RTXA 4IUQA 2HSPA 5LJ5h 1W2BA 1GFCA 3M55A 2QQRA 2YT6A 3EG2A 5LJ5j 2E1HA 4GLKA 4N4HA 2CS7A 3TCJA 1C6VX 3PNWC 5AT1B 3REAB 4MZTA 9ATCB 1RAHB 2KRNA 2LMJA 2OTJQ 2YUQA 3CCJT 1TUGB 4BD3A 2KY9A 1BBZA 4Y28E 2DZ9A 4L59A 2RHUA 3GOXA 3VRYA 5D7UA 4BE1A 2L89A 2A08A 3GNGA 2ZPFB 4XTXA 1WHKA 3PE0A 8AT1B 2M9UA 2PTKA 2KEAA 2DEUA 2CKKA 3EGXA 3FEOA 4MDWA 3VS0A 3A8OB 3TSZA 2XHCA 1ABQA 2DJQA 3A8HB 3OW2P 4OMFB 5FU7C 5GAN2 1U1SA 3M4YA 4E7HA 3CC2T 1G8XA 3HRTA 3L2RA 3QKJA 3CPWS 2CP3A 2FZKB 3PVQA 2JM8A 4X1VA 1RLQC 3BY7A 1S72A 3OW2S 1MMAA 1ZUKA 4BI8B 1QVFP 1VQ7T 5IXFA 1MMGA 2QXFA 3I55A 3EGDB 4M75A 1Q95G 2DO3A 3CD6A 2DVJA 1VYTA 4M77G 5FU6B 1VQLA 2KBTA 4IUPA 4FSXA 2PVDB 4DBHA 4A63B 2F2VA 3L2WA 2L8DA 3C4SA 3PGGA 3E2UA 4DOWA 2FZGB 2AT1B 1YFNA 2GTOA 2XD0A 1VQ4T 1MMDA 2HQHA 1M30A 4BY6B 3CXCP 3EFRA 1MNDA 4OMQA 3MO8A 2MIOA 4KT0E 3C95A 1X6OA 3I5SA 1AZEA 5A2QE 3V8JA 4CRIA 1YJWQ 5GAMh 1Q81R 1M3AA 2F5KA 4C0DB 3EGUA 3V7CA 1Q86C 3JCMJ 3T9NA 5FU6C 5GAMj 4AFUC 3ULRB 4N4IA 4OMMA 1YJNA 4JLGA 3JCMW 2QYZA 1T0JA 2G3RA 4J7IA 4C92D 1LVKA 2KRMA 2KYMA 3S6WA 4J9EA 3OW2A 4LDYA 1MV3A 1SRLA 2ATCB 1Q7YU 3R6OA 2VASA 2LCLA 1BI0A 4PJNA 2I2LA 1G83A 4BY6C 3CMEA 3QZ9B 3QJ6A 2BZ8A 4PJOC 4NL2A 1VQ5A 1AWJA 4M75B 3H6ZA 4J9HA 4JS5A 2VUBA 2HBPA 3PIPA 2DL8A 4PFPA 1QVFA 3JCMb 4M78D 1NEGA 2F2WA 2EWNA 4II1A 1E6GA 3I56A 4HA8A 1W70A 4LXCA 2ESWA 3MEVA 3G6EQ 5IT9E 2JTEA 3OB9A 2F1LA 1FX7A 1YBYA 2CP6A 4FT4A 3AHUA 2HD0A 5L23A 1ABOA 4GBQA 3SDZA 1M90U 3JCMX 3OS0A 4IIOA 4BB7A 1QKXA 2X9HA 4FYXB 1K8AR 1JJ2P 5IAYA 3VUBA 2HKNA 4M75C 2DXTA 1G3TA 4PJOF 3H41A 1UJYA 4XTWA 3MEWA 1D0XA 1WGSA 1KHCA 1EX4A 2RNAA 3LH0A 4L6V5 2E65A 2V1RA 5IHIA 2FO0A 4LUEA 4Z8AA 3CCUA 3E9GA 2F2XA 1N9RA 1PNJA 3INZA 1RLPC 2RHYA 3ZEHA 2RI5A 3I55T 3FJPA 4C92E 1WIEA 1WQWA 1YHQA 2BTTA 3OS1A 1LOJA 2VYTA 1HXDA 4CC3A 1VQ8Q 2DTIA 2DTHA 4DEXA 5I2SA 2KAFA 2CZ7B 1OU8A 3FRNA 5ECAA 2Y4XA 4OMLA 2BE7D 3G71T 1NPPA 2CGHA 1Y96A 2P0PA 2MYSA 1I1JA 1AWOA 1BIAA 2EPDA 5IHNA 1UB4A 2YLBA 2DTOA 3LYIA 2LQ8A 1N8RU 4M78E 5GANj 4RTUA 3RIRA 2VKNA 2EQJA 1M4ZA 1KHIA 1VQOQ 4Z89A 4PFZA 2AZSA 3S3MA 4XU3A 1NJIC 1YITQ 2ZAEA 2OX7A 1MGQA 2P0KA 2DK3A 2EKHA 1GCQA 2X3XD 1Y0MA 2HCKA 5A0GA 2JN0A 4KGVB 4BDYA 2RQVA 2D8HA 1PHTA 3BE3A 2CSQA 4R56A 1G3SA 1M2OA 2HNIA 4M7DA 2YUNA 1D09B 1KC8R 5GMKe 1ZSZA 1LPLA 3PFSA 3VS3A 2XDDA 2XICA 2NUPA 2YDLA 4N0AC 1UHFA 1ZA1B 4KRTA 3UA7A 4LD6A 3CMAA 1JJ2A 2FPDA 4PJMA 3CC7T 2JW4A 1KQSS 1XQHA 1HK9A 1FMWA 4Z88A 4M75G 2YSQA 1NLOC 2QDLA 4B6MA 3RDVA 3CMET 2E4HA 1TG0A 5GAOq 4RTTA 2K4YA 4YTLA 1QQJA 1SKUB 3CBPA 2AKKA 1VQKQ 4C5HA 2MPXC 1NM7A 2RJCA 1WI7A 3EG1A 3LLRA 2ECZA 3OYHA 3I56T 4PJJA 2DVEA 2QEXQ 5HK0A 5GMKi 4M7AG 3M57A 2OAWA 4Y92A 4R55A 1T0HA 1YIJT 1A0NB 4ZTJA 4ANJA 1M9SA 3FB9A 2A0FB 4PKCC 4M77D 5HKCA 5A0LA 5GAOl 1ZUUA 4C92F 1I0CA 3CC4Q 2GFUA 4E7KA 2XDBA 3GPLA 3RBBB 3BDLA 4EIKA 4RCCA 4XU0A 1YNZA 3CCVQ 2DMOA 2F5TX 4M7DB 2CH4A 2H3JA 1M90C 4KH1B 2NUPB 3OYCA 4ORZA 3CCUT 2JNGA 2YXYA 4GY5A 2HL5C 4C8QA 2Y4YA 1K76A 4F7UA 2KNBB 3UATA 3VS7A 5GAMf 4M78F 1IB8A 2KK4A 1I81A 1QVGS 1KQSA 4JDSA 1K4US 5GAN5 2JUFA 1UDLA 4NOYA 1JXOA 1X75C 2LNHB 4WTOB 3CCSQ 4XTZA 3QG1A 2LT1A 3MEUA 1OI1A 4C5GA 2E6ZA 2DZCA 1ZBXA 3PIOA 4DBQA 1K8AC 3QZ5B 1NBEB 1SEMA 1UGQB 4OMNA 2K3YA 1M1KR 2CP7A 2PUOB 3BW1A 5DM7R 3LWHA 1W2BP 2LCSA 4V2SA 3SWNA 1OX8A 1TUDA 1RAEB 1YJWA 1M1FA 2DEQA 1O75A 1RUWA 2I0NA 1X2KA 1WNLA 2RHZA 2RMOA 1ZLMA 1N8RC 2GQVA 2RPNA 4M77E 1VQMT 1PKTA 5CKDA 1WHJA 2K2MA 3CCMQ 1UTIA 3PVLA 2VVKA 2F69A 3ASKA 4AFQC 4P5NA 5LJ3d 1NE8A 4QW2A 4E7SA 2QI2A 1AVZC 1RACB 2YWWA 1CKBA 3GNFB 1YWOA 1CSKA 3QPHA 3M0QA 2KI7A 5D6YA 1G5VA 4QVDA 3CEYA 1WJQA 2ENMA 1RL2A 2VV5A 1KQ2A 1WHLA 2QK0A 2QQBA 3QWXX 3MP1A 2OTJT 3QDRB 1MNEA 5DLQE 4BI4A 1U5SA 4J83A 4QQGA 2WSCE 4HT9A 2CUDA 5CCAA 2W10A 1KC8C 1VQNQ 4KGZB 4F16A 1JBMA 1G2BA 1WQ7A 2FRYA 3P8DA 3RMQA 1X2QA 4OB1B 2FPEA 4D8DA 4KBMB 1UUEA 3SWNB 4FIBA 1FMVA 1QWEA 2R5AA 2O9VA 2QTVA 5GANf 5LJ3g 1I4K1 4RUGA 4IUTA
chains in the Genus database with same CATH topology
3LH5A 1M3AA 2HDAA 3EGUA 3VS1A 2EVRA 4HVVA 4LE9A 1FMKA 4AFUC 3ULRB 1WFWA 1BK2A 4OMMA 4F17A 1K9AA 3H0FA 4J9BA 1T0JA 2K3BA 4J9DA 4K11A 1AWWA 1MUZA 4J9CA 1NEBA 2DF6A 2KYMA 2KRMA 4J9EA 2NWMA 1K0XA 2BZXA 1AD5A 1MV0B 2LJ1A 2DA9A 1Z9QA 1MV3A 1SRLA 4JPBW 2V1QA 1WA7A 1I07A 2DYBA 1G83A 2BZ8A 1W6XA 1V1CA 2DL3A 3I35A 3I5RA 2RQWA 1AWJA 4RTWA 4J9HA 2PNIA 1HJDA 2DL8A 3UA6A 1AEYA 1NEGA 3SEMA 2F2WA 2LZ6B 1E6GA 1W70A 2VWFA 3EHQA 3CQTA 4HCKA 2ESWA 2EBPA 4OMOA 4LUDA 2KT8A 1OV3A 2O88A 4R0KA 1XOVA 2JTEA 2J6KA 1X69A 2EYZA 1WDXA 5L23A 1ABOA 1K0SA 4GBQA 1ZBJA 1FYNA 1WYXA 4IIOA 1M8MA 1QKXA 2KT1A 1X43A 2CT3A 3VRZA 3M0RA 1X6GA 1GCPA 3H41A 1UJYA 1ZUYA 4J9GA 2JMAA 5IHKA 1UG1A 1BB9A 1KSWA 2RNAA 2V1RA 2KRSA 5IHIA 2FO0A 3GBQA 4LUEA 2YUOA 4Z8AA 5IH2A 1E7OA 1JQQA 2F2XA 2KROA 2D1XA 2HEQA 1N5ZA 2DRKA 1WXTA 1PNJA 1RLPC 3KFVA 4AG2C 1X6BA 1T3SA 1GBRA 2D0NA 2EGCA 5GJWB 2CUBA 1WIEA 2M51A 1QWFA 2BTTA 2C0IA 4FSSA 3QWYA 4JZ4A 4CC3A 4D8KA 1GRIA 2FRWA 2LQNA 2DL5A 2JM9A 3TVTA 2A36A 4DEXA 2CDTA 3A98A 2KXCA 1QCFA 5ECAA 2CT4A 2EGAA 4OMLA 4OMPA 2K9GA 1NG2A 1UJ0A 3O5ZA 1I1JA 1WXBA 1AWOA 1X27A 2EPDA 2LJ0A 3H0IA 5IHNA 2J7IA 4E6RA 3M0SA 2EYYA 1PRMC 1HD3A 2GTJA 1JEGA 1AWXA 1WLPB 2M0YA 4RTVA 4RTUA 1SRMA 2VKNA 3THKA 1VYVA 4F14A 1TUCA 1BU1A 4Z89A 2AZSA 1H3HA 1OPLA 2EGEA 2GGRA 2C0OA 1YP5A 3EHRA 4CC2A 2EKHA 1UHCA 1GCQA 2X3XD 2KYBA 1B07A 1Y0MA 2HCKA 2RQVA 1GL5A 1GCQC 2D8HA 1PHTA 2JMCA 2CSQA 2LQWA 2YUNA 2AKLA 2K7AA 2RQTA 1H92A 2RN8A 2ED0A 3VS3A 3M0UA 3NMZC 2X3WD 2YDLA 2JT4A 1AOJA 5IXBA 1UHFA 4KRTA 1KIKA 3UA7A 2JS2A 1UE9A 2FPDA 2RQRA 2JW4A 5FWCA 1M3BA 2DX1A 1SPKA 4QT7A 2KGTA 1HSQA 1GBQA 4Z88A 3EG3A 2YSQA 2L3QA 2GNCA 1NLOC 2GBQA 2QDLA 1OEBA 2DRMA 2DBMA 4JJCA 1YN8A 1NYFA 4AFZC 2DBKA 1TG0A 2LX7A 4RTTA 2W0ZA 5FW9A 2H8HA 2RQUA 2L3SA 2EYXA 1U3OA 5I11A 2AKKA 2XMFA 1J3TA 1NM7A 2DE0X 1WI7A 2FEIA 1JXMA 3EG1A 1NLPC 5HCKA 4CC4B 5FWBA 2ECZA 2J05A 1SHFA 3VS5A 3ZL7C 1S1NA 1WXUA 3H0HA 2HBWA 1RI9A 1KJWA 2CSIA 2A37A 2GQIA 2SRCA 5I22A 2OAWA 3NHNA 4Y92A 3M0PA 1T0HA 2DM1A 1A0NB 3JV3A 2NUZA 2LP5A 4AG1C 2DLPA 1OPKA 2DL7A 1QLYA 3EG0A 2KE9A 1ZUUA 1I0CA 1JU5C 4JZ3A 3RBBB 4WCIA 4EIKA 2ROLA 4DEYA 2SEMA 2MCNA 2DILA 1YNZA 1YCSB 2DMOA 3TSWA 2CH4A 2YUPA 2OJ2A 2OI3A 1CKAA 4ORZA 3VS6A 2E5KA 5EC7A 1K1ZA 1H8KA 2L0AA 1K76A 1PRLC 2KNBB 4AFSC 3UATA 3VS7A 2MOXA 4RTYA 4J9IA 5GJVB 1ARKA 2ABLA 3M0TA 1PKSA 1K4US 4M4ZA 2LJ3A 3NPFA 4ZNXA 2FG0A 4RTXA 2K79A 1UDLA 2HSPA 1JXOA 1W1FA 1GFCA 2LNHB 4J9FA 2YT6A 3EG2A 2RF0A 4JJDA 4JJBA 2IIMA 1M3CA 1WX6A 1IO6A 1U06A 1M27C 3VS4A 2EYWA 2KXDA 3REAB 1VYUA 4IIMA 1SEMA 2KRNA 2LMJA 4OMNA 3UF4A 2YUQA 4GLMA 1BBZA 2C0TA 4CC7A 2CH4W 1AZGB 1E6HA 2D8JA 2A28A 1JO8A 3VRYA 1OOTA 2LCSA 1NYGA 2A08A 2G6FX 2L3PA 1TUDA 3PE0A 2K6DA 2PTKA 1RUWA 1VA7A 1QKWA 2KEAA 2I0NA 1UECA 1UFFA 3VS0A 1X2KA 4HVUA 2RMOA 2ROTA 3TSZA 1ZLMA 1ABQA 1EFNA 2DJQA 3VS2A 2RPNA 2AK5A 1PKTA 4HVWA 3IQLA 2K2MA 1UTIA 3PVLA 1B3QA 2BZYA 2VVKA 3PVQA 2JM8A 3REBB 1ZX6A 4X1VA 1UGVA 4AFQC 1RLQC 4HXJA 1SHGA 1GFDA 1ZUKA 2DNUA 1AVZC 3SHWA 1ZSGA 1CKBA 5IXFA 1YWOA 1CSKA 2P4RA 3M0QA 1Y57A 1PWTA 2EW3A 1Z9ZA 2ENMA 2O9SA 2DVJA 2ED1A 1VYTA 2O31A 2EQIA 3NGPA 3C0CA 1SSHA 1T3LA 2KBTA 2L2PA 3QWXX 2DL4A 4A63B 2AZVA 2F2VA 3R6NA 2JS0A 1U5SA 2JXBA 2J06A 2J6FA 2O2OA 2CUDA 1KFZA 2W10A 2GTOA 2PZ1A 3FJ5A 3I9QA 4F16A 1LCKA 1G2BA 2J6OA 2FRYA 1M30A 4ESRA 3RNJA 1X2QA 2FPEA 4OMQA 4D8DA 2B86A 2MIOA 1UUEA 3I5SA 4RTZA 1AZEA 2FPFA 1QWEA 2KR3A 4LNPA 2O9VA 4LN2A 3U23A 4RUGA 2CREA 1YWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LH5 A;  1M3A A;  2HDA A;  3EGU A;  3VS1 A;  2EVR A;  4HVV A;  4LE9 A;  1FMK A;  4AFU C;  3ULR B;  1WFW A;  1BK2 A;  4OMM A;  4F17 A;  1K9A A;  3H0F A;  4J9B A;  1T0J A;  2K3B A;  4J9D A;  4K11 A;  1AWW A;  1MUZ A;  4J9C A;  1NEB A;  2DF6 A;  2KYM A;  2KRM A;  4J9E A;  2NWM A;  1K0X A;  2BZX A;  1AD5 A;  1MV0 B;  2LJ1 A;  2DA9 A;  1Z9Q A;  1MV3 A;  1SRL A;  4JPB W;  2V1Q A;  1WA7 A;  1I07 A;  2DYB A;  1G83 A;  2BZ8 A;  1W6X A;  1V1C A;  2DL3 A;  3I35 A;  3I5R A;  2RQW A;  1AWJ A;  4RTW A;  4J9H A;  2PNI A;  1HJD A;  2DL8 A;  3UA6 A;  1AEY A;  1NEG A;  3SEM A;  2F2W A;  2LZ6 B;  1E6G A;  1W70 A;  2VWF A;  3EHQ A;  3CQT A;  4HCK A;  2ESW A;  2EBP A;  4OMO A;  4LUD A;  2KT8 A;  1OV3 A;  2O88 A;  4R0K A;  1XOV A;  2JTE A;  2J6K A;  1X69 A;  2EYZ A;  1WDX A;  5L23 A;  1ABO A;  1K0S A;  4GBQ A;  1ZBJ A;  1FYN A;  1WYX A;  4IIO A;  1M8M A;  1QKX A;  2KT1 A;  1X43 A;  2CT3 A;  3VRZ A;  3M0R A;  1X6G A;  1GCP A;  3H41 A;  1UJY A;  1ZUY A;  4J9G A;  2JMA A;  5IHK A;  1UG1 A;  1BB9 A;  1KSW A;  2RNA A;  2V1R A;  2KRS A;  5IHI A;  2FO0 A;  3GBQ A;  4LUE A;  2YUO A;  4Z8A A;  5IH2 A;  1E7O A;  1JQQ A;  2F2X A;  2KRO A;  2D1X A;  2HEQ A;  1N5Z A;  2DRK A;  1WXT A;  1PNJ A;  1RLP C;  3KFV A;  4AG2 C;  1X6B A;  1T3S A;  1GBR A;  2D0N A;  2EGC A;  5GJW B;  2CUB A;  1WIE A;  2M51 A;  1QWF A;  2BTT A;  2C0I A;  4FSS A;  3QWY A;  4JZ4 A;  4CC3 A;  4D8K A;  1GRI A;  2FRW A;  2LQN A;  2DL5 A;  2JM9 A;  3TVT A;  2A36 A;  4DEX A;  2CDT A;  3A98 A;  2KXC A;  1QCF A;  5ECA A;  2CT4 A;  2EGA A;  4OML A;  4OMP A;  2K9G A;  1NG2 A;  1UJ0 A;  3O5Z A;  1I1J A;  1WXB A;  1AWO A;  1X27 A;  2EPD A;  2LJ0 A;  3H0I A;  5IHN A;  2J7I A;  4E6R A;  3M0S A;  2EYY A;  1PRM C;  1HD3 A;  2GTJ A;  1JEG A;  1AWX A;  1WLP B;  2M0Y A;  4RTV A;  4RTU A;  1SRM A;  2VKN A;  3THK A;  1VYV A;  4F14 A;  1TUC A;  1BU1 A;  4Z89 A;  2AZS A;  1H3H A;  1OPL A;  2EGE A;  2GGR A;  2C0O A;  1YP5 A;  3EHR A;  4CC2 A;  2EKH A;  1UHC A;  1GCQ A;  2X3X D;  2KYB A;  1B07 A;  1Y0M A;  2HCK A;  2RQV A;  1GL5 A;  1GCQ C;  2D8H A;  1PHT A;  2JMC A;  2CSQ A;  2LQW A;  2YUN A;  2AKL A;  2K7A A;  2RQT A;  1H92 A;  2RN8 A;  2ED0 A;  3VS3 A;  3M0U A;  3NMZ C;  2X3W D;  2YDL A;  2JT4 A;  1AOJ A;  5IXB A;  1UHF A;  4KRT A;  1KIK A;  3UA7 A;  2JS2 A;  1UE9 A;  2FPD A;  2RQR A;  2JW4 A;  5FWC A;  1M3B A;  2DX1 A;  1SPK A;  4QT7 A;  2KGT A;  1HSQ A;  1GBQ A;  4Z88 A;  3EG3 A;  2YSQ A;  2L3Q A;  2GNC A;  1NLO C;  2GBQ A;  2QDL A;  1OEB A;  2DRM A;  2DBM A;  4JJC A;  1YN8 A;  1NYF A;  4AFZ C;  2DBK A;  1TG0 A;  2LX7 A;  4RTT A;  2W0Z A;  5FW9 A;  2H8H A;  2RQU A;  2L3S A;  2EYX A;  1U3O A;  5I11 A;  2AKK A;  2XMF A;  1J3T A;  1NM7 A;  2DE0 X;  1WI7 A;  2FEI A;  1JXM A;  3EG1 A;  1NLP C;  5HCK A;  4CC4 B;  5FWB A;  2ECZ A;  2J05 A;  1SHF A;  3VS5 A;  3ZL7 C;  1S1N A;  1WXU A;  3H0H A;  2HBW A;  1RI9 A;  1KJW A;  2CSI A;  2A37 A;  2GQI A;  2SRC A;  5I22 A;  2OAW A;  3NHN A;  4Y92 A;  3M0P A;  1T0H A;  2DM1 A;  1A0N B;  3JV3 A;  2NUZ A;  2LP5 A;  4AG1 C;  2DLP A;  1OPK A;  2DL7 A;  1QLY A;  3EG0 A;  2KE9 A;  1ZUU A;  1I0C A;  1JU5 C;  4JZ3 A;  3RBB B;  4WCI A;  4EIK A;  2ROL A;  4DEY A;  2SEM A;  2MCN A;  2DIL A;  1YNZ A;  1YCS B;  2DMO A;  3TSW A;  2CH4 A;  2YUP A;  2OJ2 A;  2OI3 A;  1CKA A;  4ORZ A;  3VS6 A;  2E5K A;  5EC7 A;  1K1Z A;  1H8K A;  2L0A A;  1K76 A;  1PRL C;  2KNB B;  4AFS C;  3UAT A;  3VS7 A;  2MOX A;  4RTY A;  4J9I A;  5GJV B;  1ARK A;  2ABL A;  3M0T A;  1PKS A;  1K4U S;  4M4Z A;  2LJ3 A;  3NPF A;  4ZNX A;  2FG0 A;  4RTX A;  2K79 A;  1UDL A;  2HSP A;  1JXO A;  1W1F A;  1GFC A;  2LNH B;  4J9F A;  2YT6 A;  3EG2 A;  2RF0 A;  4JJD A;  4JJB A;  2IIM A;  1M3C A;  1WX6 A;  1IO6 A;  1U06 A;  1M27 C;  3VS4 A;  2EYW A;  2KXD A;  3REA B;  1VYU A;  4IIM A;  1SEM A;  2KRN A;  2LMJ A;  4OMN A;  3UF4 A;  2YUQ A;  4GLM A;  1BBZ A;  2C0T A;  4CC7 A;  2CH4 W;  1AZG B;  1E6H A;  2D8J A;  2A28 A;  1JO8 A;  3VRY A;  1OOT A;  2LCS A;  1NYG A;  2A08 A;  2G6F X;  2L3P A;  1TUD A;  3PE0 A;  2K6D A;  2PTK A;  1RUW A;  1VA7 A;  1QKW A;  2KEA A;  2I0N A;  1UEC A;  1UFF A;  3VS0 A;  1X2K A;  4HVU A;  2RMO A;  2ROT A;  3TSZ A;  1ZLM A;  1ABQ A;  1EFN A;  2DJQ A;  3VS2 A;  2RPN A;  2AK5 A;  1PKT A;  4HVW A;  3IQL A;  2K2M A;  1UTI A;  3PVL A;  1B3Q A;  2BZY A;  2VVK A;  3PVQ A;  2JM8 A;  3REB B;  1ZX6 A;  4X1V A;  1UGV A;  4AFQ C;  1RLQ C;  4HXJ A;  1SHG A;  1GFD A;  1ZUK A;  2DNU A;  1AVZ C;  3SHW A;  1ZSG A;  1CKB A;  5IXF A;  1YWO A;  1CSK A;  2P4R A;  3M0Q A;  1Y57 A;  1PWT A;  2EW3 A;  1Z9Z A;  2ENM A;  2O9S A;  2DVJ A;  2ED1 A;  1VYT A;  2O31 A;  2EQI A;  3NGP A;  3C0C A;  1SSH A;  1T3L A;  2KBT A;  2L2P A;  3QWX X;  2DL4 A;  4A63 B;  2AZV A;  2F2V A;  3R6N A;  2JS0 A;  1U5S A;  2JXB A;  2J06 A;  2J6F A;  2O2O A;  2CUD A;  1KFZ A;  2W10 A;  2GTO A;  2PZ1 A;  3FJ5 A;  3I9Q A;  4F16 A;  1LCK A;  1G2B A;  2J6O A;  2FRY A;  1M30 A;  4ESR A;  3RNJ A;  1X2Q A;  2FPE A;  4OMQ A;  4D8D A;  2B86 A;  2MIO A;  1UUE A;  3I5S A;  4RTZ A;  1AZE A;  2FPF A;  1QWE A;  2KR3 A;  4LNP A;  2O9V A;  4LN2 A;  3U23 A;  4RUG A;  2CRE A;  1YWP A; 
#chains in the Genus database with same CATH topology
 4M7D G;  2A3L A;  3L2Z A;  5FU7 B;  4WF2 A;  4ZGD B;  3CPF A;  1BK2 A;  2X4W A;  4J9B A;  2K3B A;  3ZBD A;  4J9D A;  2KMT A;  4K11 A;  5IN1 A;  4BDZ A;  1N9S A;  3JCM d;  2E64 A;  2RHI A;  1K0X A;  4PL6 A;  2BZX A;  1AD5 A;  1ZQ1 A;  1MV0 B;  4E47 A;  2DXC A;  4PJO A;  2LJ1 A;  4BE0 A;  2V1Q A;  6AT1 B;  4PLI A;  4Y91 A;  3ME9 A;  3I35 A;  3I5R A;  2LTO A;  3QUI A;  4XQ3 A;  3VV0 A;  3SWN C;  1IGQ A;  2H3E B;  4L5G A;  3CPW P;  3CCL Q;  2PNI A;  4C0F A;  3NTI A;  1AEY A;  2HL3 A;  3SEM A;  2LZ6 B;  2DJZ A;  2VWF A;  3OYM A;  4KUL A;  4XAX B;  2P4T A;  3CQT A;  3JCM Q;  4M77 F;  1C1A A;  3G7Z A;  1D0Z A;  4OMO A;  2VXE A;  1OV3 A;  2AIR B;  2O88 A;  3WVE B;  1NJI R;  3MP8 A;  1X69 A;  2EYZ A;  5GAO r;  1ZBJ A;  5GAN 3;  4EPC A;  1FYN A;  2K5L A;  5LJ5 d;  3CCR Q;  3C94 A;  2DYI A;  3RR6 A;  1M8M A;  1YJW T;  2HKQ B;  4OB3 B;  3JB9 F;  4Q5W A;  1VQ9 Q;  4OP0 A;  1KD1 U;  3JCM g;  3VRZ A;  2LX9 A;  1GCP A;  3AT1 B;  3P8B B;  1ZUY A;  5IHK A;  5KYN A;  2QG9 B;  1UG1 A;  3G71 A;  1BB9 A;  3H8Z A;  4M7A D;  2DXU A;  4JRK A;  3VJP A;  4DBF A;  3RUX A;  3CCQ Q;  1PC0 A;  3GBQ A;  4A4K A;  5IH2 A;  4C8Q G;  4F7U G;  5KYW A;  2EAY A;  3JCM c;  1X6B A;  2VXF A;  4HCZ A;  3OYY A;  1RAI B;  5GJW B;  5GAO p;  2CUB A;  1M1K C;  2DIG A;  3OSS C;  1QWF A;  4BI3 A;  3QYG B;  4FSS A;  4PJO B;  4D8K A;  1QCN A;  3HP9 A;  2DPP B;  5GAN 6;  1B7T A;  2QDY B;  1ZA2 B;  2LQK A;  3L42 A;  2A36 A;  3A98 A;  5I2M A;  3O5Z A;  4ZN1 A;  1OU9 A;  1Q7Y R;  5EG2 A;  1X27 A;  2D9T A;  1EIF A;  3X24 B;  3G6E T;  2HAX A;  5LJ5 g;  2EYY A;  5LJ3 f;  1AWX A;  1WLP B;  1BI3 A;  3UDC A;  3CPW A;  4ZGJ B;  4O5V A;  3CCE A;  5FRO A;  3CC7 A;  3MEA A;  4QVZ A;  3RMS A;  3EFS A;  2JJ9 A;  4FYV B;  1OQK A;  2V26 A;  4FW1 A;  2V8J A;  2JTM A;  1OPL A;  2C0O A;  1UHC A;  1Y7X A;  5GMK h;  3QDF A;  1GL5 A;  3BDU A;  2LQW A;  5CIU A;  3HHT B;  5GMK j;  3RKX A;  2K7A A;  2RQT A;  1M90 R;  4N0A A;  2RN8 A;  3NMZ C;  1N6A A;  1WHG A;  2JT4 A;  1Q82 U;  2PU9 B;  2EQU A;  1UEB A;  1UE9 A;  2CP5 A;  2RQR A;  2D6F A;  3J7A F;  3P8H A;  5FWC A;  1M3B A;  3QJY A;  1SPK A;  4QT7 A;  4DOV A;  4E7J A;  2KGT A;  4M7A E;  1HSQ A;  4OF1 A;  1TSF A;  2FYK A;  5KYW B;  1YIJ A;  1VQ8 T;  2YRV A;  2DRM A;  3WVD B;  5GAM d;  4AFZ C;  2DBK A;  1R0B G;  2LX7 A;  5FW9 A;  1WHM A;  5FLX E;  1MHN A;  3KXT A;  2RQU A;  2FEI A;  3M53 A;  2RJE A;  5HCK A;  3VYG A;  5CKF A;  1OYX A;  1VQP Q;  2J05 A;  3ZL7 C;  1S1N A;  3S3O A;  1VQ6 Q;  3QXE B;  2HBW A;  1RI9 A;  1K9M U;  2A37 A;  1R77 A;  1RAD B;  3JCM f;  1U1T A;  2FVU A;  5HY6 A;  1VQO T;  4ELZ C;  1I8F A;  3M0P A;  2DM1 A;  1YIT T;  3JSC A;  1OZ3 A;  1WZO A;  2RJD A;  1RI0 A;  5DLO A;  1LJO A;  1N8R R;  2E3H A;  5KE3 A;  3OYJ A;  3X25 B;  2QTX A;  3HPW A;  4IKF A;  2OTL Q;  4MML A;  4WCI A;  2ROL A;  3M58 A;  1IGU A;  2MCN A;  1ACM B;  5GAN 4;  2DD4 A;  2ZZD A;  5KYY A;  1NZ9 A;  2X4Y A;  5GAM g;  2OI3 A;  3VS6 A;  1H8K A;  2L0A A;  4PJO G;  4RTY A;  4QQ6 A;  3UWN A;  3VUZ A;  1KD1 C;  3UPU A;  5LJ5 f;  5I21 A;  2V8I A;  4XTU A;  4LDU A;  2LJ3 A;  3NPF A;  2OAU A;  4M7D D;  2K79 A;  1VQK T;  4PNO A;  5C6S A;  2RF0 A;  5GMK m;  2COZ A;  4EMG A;  3OYD A;  4JJD A;  2IIM A;  1M3C A;  1WX6 A;  1IO6 A;  2QEX T;  1M27 C;  5CQY A;  3VS4 A;  2EYW A;  2KXD A;  1VQM A;  3HL8 A;  4IIM A;  3OBW A;  3UF4 A;  1KQS P;  3E9F A;  1TXQ A;  2C0T A;  3M54 A;  4CC7 A;  1S72 Q;  3L2Q A;  2MWP A;  3EFO A;  5KCO A;  3QYH B;  1JO8 A;  1OOT A;  3CCE T;  5CK9 A;  3I55 Q;  4EMH A;  2E10 A;  1TU0 B;  2G6F X;  4C92 C;  4CI0 C;  3CC4 T;  1FXX A;  2K6D A;  1BYM A;  4M7A F;  3KBG A;  4ELY C;  2M16 A;  3CD6 Q;  1VA7 A;  4A4G A;  2M1H A;  1QMC A;  3CCV T;  4ZGE B;  4Z02 A;  1VQL Q;  2K5F A;  1TS9 A;  2RB6 A;  2AK5 A;  3MHX A;  5GAN d;  4HVW A;  4A4E A;  2RHX A;  2BZY A;  2PVG B;  5KYY B;  2OTJ A;  3REB B;  1ZX6 A;  1TWB A;  1F1B B;  2HMA A;  4M78 C;  1Q7Y C;  3SHW A;  1TH7 A;  3FC3 A;  3HFN A;  2P4R A;  1I5O B;  1YWP A;  3CCL A;  2YRD A;  4X9C A;  2EW3 A;  2LVM A;  3M4G A;  1P92 A;  2O9S A;  3CCS T;  2ED1 A;  8ATC B;  2CZ0 B;  2EQI A;  4EDU A;  3NGP A;  4A4H A;  1SSH A;  1T3L A;  4MMK A;  4NS5 A;  4EMK C;  3RKY A;  1M1G A;  2L2P A;  2BE9 B;  5CVI A;  4M7D E;  4IUR A;  3SB2 A;  2XG8 D;  1VOM A;  1YJN Q;  5DY9 A;  3R6N A;  2JS0 A;  4C8Q D;  1QVG P;  2WSF E;  2PZ1 A;  3FJ5 A;  3I9Q A;  1LCK A;  2J6O A;  1JB0 E;  1RAG B;  2QAS A;  3EFO B;  3CCR A;  3RNJ A;  5CQX A;  5GAN g;  4KUD K;  3JCM V;  3DLL A;  2B86 A;  4RG8 A;  3C12 A;  2CP0 A;  4A54 A;  4FM4 B;  4RTZ A;  2ZPE B;  2MWO A;  4X9D A;  1VQ9 A;  2FPF A;  2EQK A;  2KR3 A;  1VQ5 Q;  4D6W A;  3MKD A;  4LN2 A;  2M0O A;  2GFA A;  2QQ9 A;  1D1A A;  3LH5 A;  5KYX A;  3LW5 E;  2BIV A;  4DQ2 A;  3CCM T;  3VS1 A;  2EVR A;  3WXM B;  4HVV A;  1X01 A;  5HK3 A;  4F17 A;  1K9A A;  4J6Y A;  4RCB A;  2JZ2 A;  2QQS A;  5D6X A;  3ER0 A;  4AMC A;  3M9Q A;  1AWW A;  1MUZ A;  4J9C A;  2Z0W A;  1XNI A;  2NWM A;  2Y90 A;  2JTF A;  3L1A A;  2DA9 A;  1Z9Q A;  4JPB W;  5CO7 A;  1ZHI A;  1I07 A;  2DYB A;  2EFI A;  2A7Y A;  2DL3 A;  1V1C A;  1SF9 A;  4KUI A;  2DER A;  3QII A;  4RTW A;  4HCB A;  1DJ7 B;  4BUG A;  1PSF A;  2L5Q A;  2D0Q B;  3OYB A;  4QQD A;  2E70 A;  3EHQ A;  3EAE A;  2GF7 A;  2BUD A;  1VQN T;  4LUD A;  2KT8 A;  1OUL A;  4R0K A;  3E19 A;  3V8L A;  5C0M A;  4C8Q E;  4JLI A;  2E12 A;  4F7U E;  1WDX A;  2QQA A;  1K0S A;  1WYX A;  3RKW A;  1UGS B;  1YHQ Q;  4OB2 B;  2FHD A;  2DFU A;  1X43 A;  4LDX A;  2EIF A;  3EG9 A;  1QVG A;  4N4G A;  4M77 B;  3MJX A;  1SSF A;  1X6G A;  1YJ9 Q;  3EH2 A;  1VIE A;  4RKU E;  5KYX B;  2JOY A;  1Q86 U;  1M2V B;  3G6E A;  2AHJ B;  4M7D F;  3SD4 A;  4JRQ A;  1JQQ A;  2RK1 A;  2YLC A;  2D1X A;  2HEQ A;  2O01 E;  1WXT A;  2DKG A;  3G4S Q;  3KFV A;  4OGC A;  4AG2 C;  1GBR A;  1YI2 Q;  2EJG A;  2M51 A;  4JZ4 A;  3OBY A;  3CCL T;  1TTH B;  3FLG A;  2DL5 A;  2NYS A;  1BI1 A;  2JM9 A;  2YHT A;  2CDT A;  4MZM A;  1K73 U;  3H9N A;  1QCF A;  1H64 1;  1VQP A;  2EGA A;  4OMP A;  1NG2 A;  5J39 A;  2LCC A;  4M77 C;  2RM4 A;  2LJ0 A;  3O8V A;  3H0I A;  1G3W A;  2J7I A;  3TEE A;  1PRM C;  2DAQ A;  2GTJ A;  1JEG A;  3CMA Q;  4PJO D;  2M0Y A;  4RTV A;  2X35 A;  1SRM A;  2LT4 A;  4F14 A;  3VYH B;  5KE2 A;  3CCR T;  5KYU B;  2OTL A;  5LJ3 e;  1H3H A;  2DXB A;  4CC2 A;  1YP5 A;  1VQ8 A;  1VQ9 T;  2KYB A;  1B07 A;  7AT1 B;  5GAO n;  4XTY A;  3EG9 B;  2GCX A;  2AKL A;  3DB4 A;  2C06 A;  5M9O A;  1H92 A;  3CCQ T;  2X3W D;  4VUB A;  5IXB A;  1I5L A;  3HFO A;  3URG A;  1C0M A;  2L3R A;  4MDX A;  2NUT B;  2NLU A;  2R57 A;  1BCM A;  1KD1 R;  2DX1 A;  1OX9 A;  2EJ9 A;  1IHW A;  1VUB A;  1VQO A;  2QA4 Q;  3GIB A;  4C5E A;  2XID A;  3MP6 A;  1FWZ A;  3EG3 A;  4M75 D;  1YIT A;  2KQW A;  2L3Q A;  2GBQ A;  3PTA A;  1OEB A;  4JJC A;  1YN8 A;  4C8Q F;  4F7U F;  4J6X A;  3OYN A;  2L3S A;  3LGL A;  1BI2 A;  4JRP A;  1J3T A;  4J7F A;  4HKE A;  1JXM A;  2PVO B;  1NLP C;  4LD9 K;  4CC4 B;  5FWB A;  3JB9 H;  2B8A A;  1WXU A;  2CSI A;  2DD5 A;  1V76 A;  3CCJ Q;  5I22 A;  3E1S A;  1M8V A;  2EKO A;  3HKS A;  3JV3 A;  2NUZ A;  2DLP A;  4PJO E;  1OPK A;  2KDS A;  1QVF S;  3JAM E;  3LWI A;  1QLY A;  1BIB A;  2KE9 A;  1NJI U;  2ZPI B;  3JCM e;  1JU5 C;  4TVR A;  4JZ3 A;  4HCC A;  1QVP A;  4XU2 A;  2XK0 A;  1VQK A;  3DB3 A;  5D6W A;  1IHV A;  2K5I A;  3RER A;  1YCS B;  3OS5 A;  4BAC A;  1SG5 A;  3TSW A;  3CBO A;  2QEX A;  5GAN 7;  2PUK B;  3CC2 Q;  1H3Z A;  2OJ2 A;  4M7A A;  3UT1 A;  1CKA A;  3JB9 G;  4FYW B;  5EC7 A;  1K1Z A;  2ZGW A;  3OYK A;  1V29 B;  3GP8 A;  1VQ7 Q;  3L2V A;  2ABL A;  3M0T A;  4C0G A;  1Y71 A;  1Q82 R;  4ZNX A;  1AT1 B;  5CKE A;  3X28 B;  5CR2 A;  3CC4 A;  3EGX B;  3CXC S;  1W1F A;  4J9F A;  4M75 E;  2HQX A;  4KGX B;  1VQP T;  4JJB A;  3OMC A;  1D1B A;  3CCV A;  1HYO A;  1U06 A;  5LJ5 e;  1VQ6 T;  2MI6 A;  1VYU A;  3FDR A;  2LDM A;  1JRI A;  4GLM A;  2MK5 A;  1U8R A;  2DIQ A;  2CZ1 B;  5KH6 A;  1M5Q 1;  1AZG B;  1E6H A;  2CH4 W;  2D8J A;  3OYL A;  4IUU A;  2FL7 A;  1KQ1 A;  3VU3 C;  3OY9 A;  2A28 A;  2ZPH B;  1Q81 U;  1K73 C;  2RK2 A;  2EYQ A;  4C92 A;  1NYG A;  1VQ4 Q;  1O9S A;  2L3P A;  5GAN 8;  4JRI A;  2OTL T;  1K9M R;  3OYF A;  1QKW A;  5KCH A;  1MMN A;  2R58 A;  1UEC A;  1UFF A;  4BE2 A;  4HVU A;  4E7Z A;  4RMO A;  3CCS A;  2ROT A;  1EFN A;  4C0D C;  3VS2 A;  1VIF A;  3JB9 I;  3FIF A;  2ZCF B;  3KUF A;  1NPR A;  3IQL A;  1LNX A;  3MET A;  1B3Q A;  4PK4 A;  4M78 A;  3JB9 J;  1UGV A;  4HXJ A;  1SHG A;  1GFD A;  2DNU A;  2E3I A;  2XU8 A;  4M7A B;  1ZSG A;  5CKH A;  2K57 A;  3J81 E;  2CP2 A;  3OYA A;  3M5A A;  2VC8 A;  2CZ6 B;  1BKB A;  1Y57 A;  3OSV A;  1PWT A;  4DBR A;  1Z9Z A;  4FU6 A;  4DA4 A;  1EZZ B;  2O31 A;  4EMK A;  3C0C A;  2DET A;  3CXC A;  2ZPB B;  2COW A;  2O4X A;  2DL4 A;  1JJ2 S;  3DKM A;  3CCM A;  2AZV A;  4OB0 B;  3ZFJ A;  2JXB A;  1S72 T;  2J06 A;  5LL6 S;  2J6F A;  5GAO m;  1K8A U;  2O2O A;  1KFZ A;  3V7R A;  1WPY A;  1WJR A;  1WJS A;  4A4F A;  3EH1 A;  1N27 A;  4ESR A;  4KH0 B;  4O6J A;  4M7A C;  3JCM P;  3CD6 T;  2XI9 A;  4C92 B;  4C5I A;  2MMP A;  2P0Q A;  1D1C A;  4LNP A;  1YJ9 A;  3CBM A;  2K3X A;  3N5B B;  2RD1 A;  3U23 A;  1VQL T;  2CRE A;  2JVV A;  3A1P A;  1RAF B;  3A8G B;  2HDA A;  2X4J A;  4LE9 A;  5GAN h;  1FMK A;  3QHS A;  1WFW A;  2VGN A;  5GAM e;  4M75 F;  4XTV A;  3H0F A;  3D7S B;  2XKO C;  3MPU B;  3G4S A;  2VB6 A;  1NEB A;  2DF6 A;  3NFC A;  4M78 B;  1VQN A;  1YI2 A;  4HT8 A;  2QAZ A;  4JUV A;  1WA7 A;  3L2U A;  1W6X A;  3NTH A;  5J3B A;  2RQW A;  3PT9 A;  2VGM A;  1R8O B;  2R5M A;  3NTK A;  4FL6 A;  3V7S A;  2HQE A;  1HJD A;  5L8R E;  3UA6 A;  2HZY A;  3VKI A;  4NL3 A;  2LRQ A;  4EMK B;  4XK8 E;  1YJN T;  1XJW B;  1GXI E;  3F70 A;  2RA2 A;  1OZ2 A;  1PD0 A;  3G71 Q;  4ATO A;  2M02 A;  2O4X B;  3A8L B;  2WSE E;  4HCK A;  1G3Y A;  2EBP A;  3OQ5 A;  3TQ7 P;  2QGF B;  2RJF A;  1D3B A;  3LX7 A;  1XOV A;  3HSB A;  2J6K A;  1KC8 U;  2FZC B;  1VQ5 T;  2X51 A;  4X34 A;  1RAB B;  4B9X A;  2KT1 A;  4PJL A;  2YRC A;  3A5Z B;  3RES A;  2LNV A;  2CT3 A;  2KVQ G;  2RO0 A;  3HRU A;  2P84 A;  3M0R A;  1Q82 C;  1Y96 B;  3GF5 A;  4J9G A;  2JMA A;  2IVW A;  1Q81 C;  1WHH A;  1Y07 A;  1KSW A;  4E2F B;  2LC4 A;  3SFM A;  2KRS A;  3TRE A;  2YUO A;  1E7O A;  3OS2 A;  2QA4 A;  2KRO A;  3CCE Q;  1N5Z A;  2DRK A;  4ME7 A;  3CC7 Q;  3BFM A;  3LGF A;  3X26 B;  3PMT A;  1T3S A;  2D0N A;  2EGC A;  3V8K A;  1AHJ B;  4IUV A;  1IXD A;  2V8K A;  1D0Y A;  3QBY A;  2C0I A;  2IG0 A;  3QWY A;  1IRE B;  1GRI A;  2FRW A;  2LQN A;  5J26 A;  2E6N A;  3S3N A;  3TVT A;  3CME Q;  4JJN K;  2KXC A;  3OA6 A;  4M77 A;  2CT4 A;  2MAM A;  2K9G A;  3TU4 K;  1UJ0 A;  2BKD N;  1ZSZ B;  1K9M C;  1WXB A;  3GLX A;  4QKU A;  4E6R A;  2FB7 A;  3M0S A;  3JB9 D;  3JRZ A;  3M56 A;  3I56 Q;  3CCJ A;  3CCQ A;  1HD3 A;  1M2V A;  4PLL A;  4A53 A;  1UGP B;  2CYZ B;  3HTR A;  5GMK l;  3THK A;  1R0C B;  1QW1 A;  4FYY B;  4J6W A;  5GAN e;  3M59 A;  4C92 G;  1VYV A;  3Q1J A;  5LJ3 h;  4E7I A;  4JS4 A;  1TUC A;  1BU1 A;  1D3B B;  4J8O A;  1YHQ T;  5A0D A;  5LJ3 j;  3MCA B;  3OYG A;  1YIJ Q;  4E7L A;  1B34 A;  3OYI A;  5FRN A;  2HSE B;  2EGE A;  2GGR A;  1QP3 A;  3EHR A;  1QP2 A;  1IZ6 A;  1PCX A;  1YJ9 T;  4ZTF A;  1GCQ C;  2JMC A;  2X4X A;  4OVA A;  2EJF A;  3A8M B;  4FCY A;  3CC2 A;  2ED0 A;  3M0U A;  3DLM A;  4M78 G;  4M7D C;  1AOJ A;  3OMG A;  1ZSZ C;  2E41 A;  1KIK A;  5AYF A;  2JS2 A;  4RG2 A;  3G4S T;  1PM3 A;  1VQ7 A;  4F04 B;  3CCU Q;  1YI2 T;  1GBQ A;  3QO3 A;  1YCY A;  1Q86 R;  4LDV A;  2GNC A;  5KYU A;  2DBM A;  1NYF A;  1W2B S;  2W0Z A;  2K2V A;  2H8H A;  1M1K U;  2EYX A;  3PMI A;  1U3O A;  5I11 A;  2RH2 A;  2ZPG B;  4LDW A;  2XMF A;  2DE0 X;  2MF2 A;  1BCO A;  4OGE A;  4PFO A;  1PSE A;  2QGG A;  1SHF A;  3VS5 A;  3H0H A;  3CMA T;  1KJW A;  2NUT A;  1KG1 A;  1K73 R;  1TOV A;  2RI2 A;  2GQI A;  2SRC A;  1W4S A;  1VQ4 A;  3NHN A;  4C8Q B;  4F7U B;  1XTD A;  2LP5 A;  4AG1 C;  3JCM h;  4FT2 A;  4UC4 A;  2DL7 A;  2RI3 A;  2PQW A;  3EG0 A;  1B34 B;  3OYE A;  3X20 B;  4B9W A;  4DEY A;  4QVC A;  1RAA B;  2SEM A;  5CAI A;  2KSS A;  3HRS A;  2DIL A;  4C0Z A;  2COY A;  1PD1 A;  4XU1 A;  1VQM Q;  1VQ6 A;  2XDP A;  5FRM A;  2YUP A;  1IRX A;  2EQM A;  2E5K A;  1KK7 A;  2QA4 T;  3EGD A;  2IPO B;  3QSU A;  1PRL C;  1UGR B;  4AFS C;  5CKB A;  1PG5 B;  2MOX A;  4AT1 B;  4J9I A;  5GJV B;  1ARK A;  4C8Q C;  2E5Q A;  4MZP A;  1PKS A;  4ZN3 A;  3G1J A;  2WAC A;  4M4Z A;  1QCO A;  3J80 E;  4J5Y A;  2FG0 A;  4FW2 A;  4RTX A;  4IUQ A;  2HSP A;  5LJ5 h;  1W2B A;  1GFC A;  3M55 A;  2QQR A;  2YT6 A;  3EG2 A;  5LJ5 j;  2E1H A;  4GLK A;  4N4H A;  2CS7 A;  3TCJ A;  1C6V X;  3PNW C;  5AT1 B;  3REA B;  4MZT A;  9ATC B;  1RAH B;  2KRN A;  2LMJ A;  2OTJ Q;  2YUQ A;  3CCJ T;  1TUG B;  4BD3 A;  2KY9 A;  1BBZ A;  4Y28 E;  2DZ9 A;  4L59 A;  2RHU A;  3GOX A;  3VRY A;  5D7U A;  4BE1 A;  2L89 A;  2A08 A;  3GNG A;  2ZPF B;  4XTX A;  1WHK A;  3PE0 A;  8AT1 B;  2M9U A;  2PTK A;  2KEA A;  2DEU A;  2CKK A;  3EGX A;  3FEO A;  4MDW A;  3VS0 A;  3A8O B;  3TSZ A;  2XHC A;  1ABQ A;  2DJQ A;  3A8H B;  3OW2 P;  4OMF B;  5FU7 C;  5GAN 2;  1U1S A;  3M4Y A;  4E7H A;  3CC2 T;  1G8X A;  3HRT A;  3L2R A;  3QKJ A;  3CPW S;  2CP3 A;  2FZK B;  3PVQ A;  2JM8 A;  4X1V A;  1RLQ C;  3BY7 A;  1S72 A;  3OW2 S;  1MMA A;  1ZUK A;  4BI8 B;  1QVF P;  1VQ7 T;  5IXF A;  1MMG A;  2QXF A;  3I55 A;  3EGD B;  4M75 A;  1Q95 G;  2DO3 A;  3CD6 A;  2DVJ A;  1VYT A;  4M77 G;  5FU6 B;  1VQL A;  2KBT A;  4IUP A;  4FSX A;  2PVD B;  4DBH A;  4A63 B;  2F2V A;  3L2W A;  2L8D A;  3C4S A;  3PGG A;  3E2U A;  4DOW A;  2FZG B;  2AT1 B;  1YFN A;  2GTO A;  2XD0 A;  1VQ4 T;  1MMD A;  2HQH A;  1M30 A;  4BY6 B;  3CXC P;  3EFR A;  1MND A;  4OMQ A;  3MO8 A;  2MIO A;  4KT0 E;  3C95 A;  1X6O A;  3I5S A;  1AZE A;  5A2Q E;  3V8J A;  4CRI A;  1YJW Q;  5GAM h;  1Q81 R;  1M3A A;  2F5K A;  4C0D B;  3EGU A;  3V7C A;  1Q86 C;  3JCM J;  3T9N A;  5FU6 C;  5GAM j;  4AFU C;  3ULR B;  4N4I A;  4OMM A;  1YJN A;  4JLG A;  3JCM W;  2QYZ A;  1T0J A;  2G3R A;  4J7I A;  4C92 D;  1LVK A;  2KRM A;  2KYM A;  3S6W A;  4J9E A;  3OW2 A;  4LDY A;  1MV3 A;  1SRL A;  2ATC B;  1Q7Y U;  3R6O A;  2VAS A;  2LCL A;  1BI0 A;  4PJN A;  2I2L A;  1G83 A;  4BY6 C;  3CME A;  3QZ9 B;  3QJ6 A;  2BZ8 A;  4PJO C;  4NL2 A;  1VQ5 A;  1AWJ A;  4M75 B;  3H6Z A;  4J9H A;  4JS5 A;  2VUB A;  2HBP A;  3PIP A;  2DL8 A;  4PFP A;  1QVF A;  3JCM b;  4M78 D;  1NEG A;  2F2W A;  2EWN A;  4II1 A;  1E6G A;  3I56 A;  4HA8 A;  1W70 A;  4LXC A;  2ESW A;  3MEV A;  3G6E Q;  5IT9 E;  2JTE A;  3OB9 A;  2F1L A;  1FX7 A;  1YBY A;  2CP6 A;  4FT4 A;  3AHU A;  2HD0 A;  5L23 A;  1ABO A;  4GBQ A;  3SDZ A;  1M90 U;  3JCM X;  3OS0 A;  4IIO A;  4BB7 A;  1QKX A;  2X9H A;  4FYX B;  1K8A R;  1JJ2 P;  5IAY A;  3VUB A;  2HKN A;  4M75 C;  2DXT A;  1G3T A;  4PJO F;  3H41 A;  1UJY A;  4XTW A;  3MEW A;  1D0X A;  1WGS A;  1KHC A;  1EX4 A;  2RNA A;  3LH0 A;  4L6V 5;  2E65 A;  2V1R A;  5IHI A;  2FO0 A;  4LUE A;  4Z8A A;  3CCU A;  3E9G A;  2F2X A;  1N9R A;  1PNJ A;  3INZ A;  1RLP C;  2RHY A;  3ZEH A;  2RI5 A;  3I55 T;  3FJP A;  4C92 E;  1WIE A;  1WQW A;  1YHQ A;  2BTT A;  3OS1 A;  1LOJ A;  2VYT A;  1HXD A;  4CC3 A;  1VQ8 Q;  2DTI A;  2DTH A;  4DEX A;  5I2S A;  2KAF A;  2CZ7 B;  1OU8 A;  3FRN A;  5ECA A;  2Y4X A;  4OML A;  2BE7 D;  3G71 T;  1NPP A;  2CGH A;  1Y96 A;  2P0P A;  2MYS A;  1I1J A;  1AWO A;  1BIA A;  2EPD A;  5IHN A;  1UB4 A;  2YLB A;  2DTO A;  3LYI A;  2LQ8 A;  1N8R U;  4M78 E;  5GAN j;  4RTU A;  3RIR A;  2VKN A;  2EQJ A;  1M4Z A;  1KHI A;  1VQO Q;  4Z89 A;  4PFZ A;  2AZS A;  3S3M A;  4XU3 A;  1NJI C;  1YIT Q;  2ZAE A;  2OX7 A;  1MGQ A;  2P0K A;  2DK3 A;  2EKH A;  1GCQ A;  2X3X D;  1Y0M A;  2HCK A;  5A0G A;  2JN0 A;  4KGV B;  4BDY A;  2RQV A;  2D8H A;  1PHT A;  3BE3 A;  2CSQ A;  4R56 A;  1G3S A;  1M2O A;  2HNI A;  4M7D A;  2YUN A;  1D09 B;  1KC8 R;  5GMK e;  1ZSZ A;  1LPL A;  3PFS A;  3VS3 A;  2XDD A;  2XIC A;  2NUP A;  2YDL A;  4N0A C;  1UHF A;  1ZA1 B;  4KRT A;  3UA7 A;  4LD6 A;  3CMA A;  1JJ2 A;  2FPD A;  4PJM A;  3CC7 T;  2JW4 A;  1KQS S;  1XQH A;  1HK9 A;  1FMW A;  4Z88 A;  4M75 G;  2YSQ A;  1NLO C;  2QDL A;  4B6M A;  3RDV A;  3CME T;  2E4H A;  1TG0 A;  5GAO q;  4RTT A;  2K4Y A;  4YTL A;  1QQJ A;  1SKU B;  3CBP A;  2AKK A;  1VQK Q;  4C5H A;  2MPX C;  1NM7 A;  2RJC A;  1WI7 A;  3EG1 A;  3LLR A;  2ECZ A;  3OYH A;  3I56 T;  4PJJ A;  2DVE A;  2QEX Q;  5HK0 A;  5GMK i;  4M7A G;  3M57 A;  2OAW A;  4Y92 A;  4R55 A;  1T0H A;  1YIJ T;  1A0N B;  4ZTJ A;  4ANJ A;  1M9S A;  3FB9 A;  2A0F B;  4PKC C;  4M77 D;  5HKC A;  5A0L A;  5GAO l;  1ZUU A;  4C92 F;  1I0C A;  3CC4 Q;  2GFU A;  4E7K A;  2XDB A;  3GPL A;  3RBB B;  3BDL A;  4EIK A;  4RCC A;  4XU0 A;  1YNZ A;  3CCV Q;  2DMO A;  2F5T X;  4M7D B;  2CH4 A;  2H3J A;  1M90 C;  4KH1 B;  2NUP B;  3OYC A;  4ORZ A;  3CCU T;  2JNG A;  2YXY A;  4GY5 A;  2HL5 C;  4C8Q A;  2Y4Y A;  1K76 A;  4F7U A;  2KNB B;  3UAT A;  3VS7 A;  5GAM f;  4M78 F;  1IB8 A;  2KK4 A;  1I81 A;  1QVG S;  1KQS A;  4JDS A;  1K4U S;  5GAN 5;  2JUF A;  1UDL A;  4NOY A;  1JXO A;  1X75 C;  2LNH B;  4WTO B;  3CCS Q;  4XTZ A;  3QG1 A;  2LT1 A;  3MEU A;  1OI1 A;  4C5G A;  2E6Z A;  2DZC A;  1ZBX A;  3PIO A;  4DBQ A;  1K8A C;  3QZ5 B;  1NBE B;  1SEM A;  1UGQ B;  4OMN A;  2K3Y A;  1M1K R;  2CP7 A;  2PUO B;  3BW1 A;  5DM7 R;  3LWH A;  1W2B P;  2LCS A;  4V2S A;  3SWN A;  1OX8 A;  1TUD A;  1RAE B;  1YJW A;  1M1F A;  2DEQ A;  1O75 A;  1RUW A;  2I0N A;  1X2K A;  1WNL A;  2RHZ A;  2RMO A;  1ZLM A;  1N8R C;  2GQV A;  2RPN A;  4M77 E;  1VQM T;  1PKT A;  5CKD A;  1WHJ A;  2K2M A;  3CCM Q;  1UTI A;  3PVL A;  2VVK A;  2F69 A;  3ASK A;  4AFQ C;  4P5N A;  5LJ3 d;  1NE8 A;  4QW2 A;  4E7S A;  2QI2 A;  1AVZ C;  1RAC B;  2YWW A;  1CKB A;  3GNF B;  1YWO A;  1CSK A;  3QPH A;  3M0Q A;  2KI7 A;  5D6Y A;  1G5V A;  4QVD A;  3CEY A;  1WJQ A;  2ENM A;  1RL2 A;  2VV5 A;  1KQ2 A;  1WHL A;  2QK0 A;  2QQB A;  3QWX X;  3MP1 A;  2OTJ T;  3QDR B;  1MNE A;  5DLQ E;  4BI4 A;  1U5S A;  4J83 A;  4QQG A;  2WSC E;  4HT9 A;  2CUD A;  5CCA A;  2W10 A;  1KC8 C;  1VQN Q;  4KGZ B;  4F16 A;  1JBM A;  1G2B A;  1WQ7 A;  2FRY A;  3P8D A;  3RMQ A;  1X2Q A;  4OB1 B;  2FPE A;  4D8D A;  4KBM B;  1UUE A;  3SWN B;  4FIB A;  1FMV A;  1QWE A;  2R5A A;  2O9V A;  2QTV A;  5GAN f;  5LJ3 g;  1I4K 1;  4RUG A;  4IUT A; 
#chains in the Genus database with same CATH homology
 3LH5 A;  1M3A A;  2HDA A;  3EGU A;  3VS1 A;  2EVR A;  4HVV A;  4LE9 A;  1FMK A;  4AFU C;  3ULR B;  1WFW A;  1BK2 A;  4OMM A;  4F17 A;  1K9A A;  3H0F A;  4J9B A;  1T0J A;  2K3B A;  4J9D A;  4K11 A;  1AWW A;  1MUZ A;  4J9C A;  1NEB A;  2DF6 A;  2KYM A;  2KRM A;  4J9E A;  2NWM A;  1K0X A;  2BZX A;  1AD5 A;  1MV0 B;  2LJ1 A;  2DA9 A;  1Z9Q A;  1MV3 A;  1SRL A;  4JPB W;  2V1Q A;  1WA7 A;  1I07 A;  2DYB A;  1G83 A;  2BZ8 A;  1W6X A;  1V1C A;  2DL3 A;  3I35 A;  3I5R A;  2RQW A;  1AWJ A;  4RTW A;  4J9H A;  2PNI A;  1HJD A;  2DL8 A;  3UA6 A;  1AEY A;  1NEG A;  3SEM A;  2F2W A;  2LZ6 B;  1E6G A;  1W70 A;  2VWF A;  3EHQ A;  3CQT A;  4HCK A;  2ESW A;  2EBP A;  4OMO A;  4LUD A;  2KT8 A;  1OV3 A;  2O88 A;  4R0K A;  1XOV A;  2JTE A;  2J6K A;  1X69 A;  2EYZ A;  1WDX A;  5L23 A;  1ABO A;  1K0S A;  4GBQ A;  1ZBJ A;  1FYN A;  1WYX A;  4IIO A;  1M8M A;  1QKX A;  2KT1 A;  1X43 A;  2CT3 A;  3VRZ A;  3M0R A;  1X6G A;  1GCP A;  3H41 A;  1UJY A;  1ZUY A;  4J9G A;  2JMA A;  5IHK A;  1UG1 A;  1BB9 A;  1KSW A;  2RNA A;  2V1R A;  2KRS A;  5IHI A;  2FO0 A;  3GBQ A;  4LUE A;  2YUO A;  4Z8A A;  5IH2 A;  1E7O A;  1JQQ A;  2F2X A;  2KRO A;  2D1X A;  2HEQ A;  1N5Z A;  2DRK A;  1WXT A;  1PNJ A;  1RLP C;  3KFV A;  4AG2 C;  1X6B A;  1T3S A;  1GBR A;  2D0N A;  2EGC A;  5GJW B;  2CUB A;  1WIE A;  2M51 A;  1QWF A;  2BTT A;  2C0I A;  4FSS A;  3QWY A;  4JZ4 A;  4CC3 A;  4D8K A;  1GRI A;  2FRW A;  2LQN A;  2DL5 A;  2JM9 A;  3TVT A;  2A36 A;  4DEX A;  2CDT A;  3A98 A;  2KXC A;  1QCF A;  5ECA A;  2CT4 A;  2EGA A;  4OML A;  4OMP A;  2K9G A;  1NG2 A;  1UJ0 A;  3O5Z A;  1I1J A;  1WXB A;  1AWO A;  1X27 A;  2EPD A;  2LJ0 A;  3H0I A;  5IHN A;  2J7I A;  4E6R A;  3M0S A;  2EYY A;  1PRM C;  1HD3 A;  2GTJ A;  1JEG A;  1AWX A;  1WLP B;  2M0Y A;  4RTV A;  4RTU A;  1SRM A;  2VKN A;  3THK A;  1VYV A;  4F14 A;  1TUC A;  1BU1 A;  4Z89 A;  2AZS A;  1H3H A;  1OPL A;  2EGE A;  2GGR A;  2C0O A;  1YP5 A;  3EHR A;  4CC2 A;  2EKH A;  1UHC A;  1GCQ A;  2X3X D;  2KYB A;  1B07 A;  1Y0M A;  2HCK A;  2RQV A;  1GL5 A;  1GCQ C;  2D8H A;  1PHT A;  2JMC A;  2CSQ A;  2LQW A;  2YUN A;  2AKL A;  2K7A A;  2RQT A;  1H92 A;  2RN8 A;  2ED0 A;  3VS3 A;  3M0U A;  3NMZ C;  2X3W D;  2YDL A;  2JT4 A;  1AOJ A;  5IXB A;  1UHF A;  4KRT A;  1KIK A;  3UA7 A;  2JS2 A;  1UE9 A;  2FPD A;  2RQR A;  2JW4 A;  5FWC A;  1M3B A;  2DX1 A;  1SPK A;  4QT7 A;  2KGT A;  1HSQ A;  1GBQ A;  4Z88 A;  3EG3 A;  2YSQ A;  2L3Q A;  2GNC A;  1NLO C;  2GBQ A;  2QDL A;  1OEB A;  2DRM A;  2DBM A;  4JJC A;  1YN8 A;  1NYF A;  4AFZ C;  2DBK A;  1TG0 A;  2LX7 A;  4RTT A;  2W0Z A;  5FW9 A;  2H8H A;  2RQU A;  2L3S A;  2EYX A;  1U3O A;  5I11 A;  2AKK A;  2XMF A;  1J3T A;  1NM7 A;  2DE0 X;  1WI7 A;  2FEI A;  1JXM A;  3EG1 A;  1NLP C;  5HCK A;  4CC4 B;  5FWB A;  2ECZ A;  2J05 A;  1SHF A;  3VS5 A;  3ZL7 C;  1S1N A;  1WXU A;  3H0H A;  2HBW A;  1RI9 A;  1KJW A;  2CSI A;  2A37 A;  2GQI A;  2SRC A;  5I22 A;  2OAW A;  3NHN A;  4Y92 A;  3M0P A;  1T0H A;  2DM1 A;  1A0N B;  3JV3 A;  2NUZ A;  2LP5 A;  4AG1 C;  2DLP A;  1OPK A;  2DL7 A;  1QLY A;  3EG0 A;  2KE9 A;  1ZUU A;  1I0C A;  1JU5 C;  4JZ3 A;  3RBB B;  4WCI A;  4EIK A;  2ROL A;  4DEY A;  2SEM A;  2MCN A;  2DIL A;  1YNZ A;  1YCS B;  2DMO A;  3TSW A;  2CH4 A;  2YUP A;  2OJ2 A;  2OI3 A;  1CKA A;  4ORZ A;  3VS6 A;  2E5K A;  5EC7 A;  1K1Z A;  1H8K A;  2L0A A;  1K76 A;  1PRL C;  2KNB B;  4AFS C;  3UAT A;  3VS7 A;  2MOX A;  4RTY A;  4J9I A;  5GJV B;  1ARK A;  2ABL A;  3M0T A;  1PKS A;  1K4U S;  4M4Z A;  2LJ3 A;  3NPF A;  4ZNX A;  2FG0 A;  4RTX A;  2K79 A;  1UDL A;  2HSP A;  1JXO A;  1W1F A;  1GFC A;  2LNH B;  4J9F A;  2YT6 A;  3EG2 A;  2RF0 A;  4JJD A;  4JJB A;  2IIM A;  1M3C A;  1WX6 A;  1IO6 A;  1U06 A;  1M27 C;  3VS4 A;  2EYW A;  2KXD A;  3REA B;  1VYU A;  4IIM A;  1SEM A;  2KRN A;  2LMJ A;  4OMN A;  3UF4 A;  2YUQ A;  4GLM A;  1BBZ A;  2C0T A;  4CC7 A;  2CH4 W;  1AZG B;  1E6H A;  2D8J A;  2A28 A;  1JO8 A;  3VRY A;  1OOT A;  2LCS A;  1NYG A;  2A08 A;  2G6F X;  2L3P A;  1TUD A;  3PE0 A;  2K6D A;  2PTK A;  1RUW A;  1VA7 A;  1QKW A;  2KEA A;  2I0N A;  1UEC A;  1UFF A;  3VS0 A;  1X2K A;  4HVU A;  2RMO A;  2ROT A;  3TSZ A;  1ZLM A;  1ABQ A;  1EFN A;  2DJQ A;  3VS2 A;  2RPN A;  2AK5 A;  1PKT A;  4HVW A;  3IQL A;  2K2M A;  1UTI A;  3PVL A;  1B3Q A;  2BZY A;  2VVK A;  3PVQ A;  2JM8 A;  3REB B;  1ZX6 A;  4X1V A;  1UGV A;  4AFQ C;  1RLQ C;  4HXJ A;  1SHG A;  1GFD A;  1ZUK A;  2DNU A;  1AVZ C;  3SHW A;  1ZSG A;  1CKB A;  5IXF A;  1YWO A;  1CSK A;  2P4R A;  3M0Q A;  1Y57 A;  1PWT A;  2EW3 A;  1Z9Z A;  2ENM A;  2O9S A;  2DVJ A;  2ED1 A;  1VYT A;  2O31 A;  2EQI A;  3NGP A;  3C0C A;  1SSH A;  1T3L A;  2KBT A;  2L2P A;  3QWX X;  2DL4 A;  4A63 B;  2AZV A;  2F2V A;  3R6N A;  2JS0 A;  1U5S A;  2JXB A;  2J06 A;  2J6F A;  2O2O A;  2CUD A;  1KFZ A;  2W10 A;  2GTO A;  2PZ1 A;  3FJ5 A;  3I9Q A;  4F16 A;  1LCK A;  1G2B A;  2J6O A;  2FRY A;  1M30 A;  4ESR A;  3RNJ A;  1X2Q A;  2FPE A;  4OMQ A;  4D8D A;  2B86 A;  2MIO A;  1UUE A;  3I5S A;  4RTZ A;  1AZE A;  2FPF A;  1QWE A;  2KR3 A;  4LNP A;  2O9V A;  4LN2 A;  3U23 A;  4RUG A;  2CRE A;  1YWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...