4CC4B

Complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
67
structure length
67
Chain Sequence
GPEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKGYVPSNYIRKTEYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INLC PROTEIN
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Cell invasion
total genus 10
structure length 67
sequence length 67
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4cc4B00
1G2BA 2L2PA 1GRIA 2KEAA 2RNAA 4JZ4A 2LP5A 2W0ZA 1UHFA 4J9HA 2EYZA 3NMZC 2DBKA 2YSQA 1K4US 1ZBJA 2K79A 1WA7A 1SHFA 2PTKA 1CKBA 1FMKA 1BBZA 2X3XD 4OMQA 3UATA 4AG2C 5IXFA 2KYMA 2RF0A 2HSPA 1MV3A 1NEGA 2EQIA 3SEMA 2KYBA 4AFSC 1PRMC 4J9IA 1ZUYA 4CC4B 3VS0A 2P4RA 3PVQA 1BK2A 1X2QA 3TSZA 3VS1A 2O9SA 1GCQC 4RTUA 1TUDA 4OMMA 3EHQA 2KROA 5IHNA 3UF4A 1W6XA 4JZ3A 4LNPA 1W70A 5EC7A 2NWMA 1JXMA 2FPEA 1WFWA 2EBPA 3UA6A 2VVKA 2ROTA 2RQUA 3TVTA 1G83A 2RPNA 2JXBA 1AWXA 3M0SA 1GFDA 1NM7A 4R0KA 4Y92A 2BZ8A 2A37A 4OMPA 3VS7A 3I35A 1NEBA 1JQQA 1WX6A 4HCKA 4HXJA 1ZSGA 1KFZA 1WXBA 2ED1A 3VS2A 2K3BA 1GL5A 2KGTA 1M3AA 1FYNA 1AWJA 1UTIA 1AVZC 4D8DA 1T3LA 2GTOA 2LQWA 1AOJA 2SRCA 3UA7A 2EPDA 2RN8A 1K0SA 2HCKA 4FSSA 2CH4W 1IO6A 1BB9A 1UFFA 1T0HA 1JU5C 3PVLA 1M27C 1AWOA 1Z9QA 1X43A 2BZYA 3EG0A 2J6FA 1OPLA 2BTTA 2JT4A 2RQVA 1W1FA 2CDTA 1K76A 4GBQA 1M8MA 1QKWA 1H3HA 5HCKA 3A98A 3C0CA 1SPKA 4OMLA 1HJDA 1KJWA 4ESRA 2FRYA 1VYUA 1UG1A 2DBMA 4LN2A 5FW9A 1N5ZA 2LMJA 4KRTA 2O31A 3TSWA 2F2XA 1X69A 2C0OA 1YWOA 2DYBA 5GJWB 1KIKA 1X27A 2C0TA 1GBRA 2XMFA 2QDLA 1KSWA 1YWPA 2EW3A 3JV3A 4ZNXA 2RMOA 1ARKA 1QWEA 1CSKA 4JJCA 3RBBB 2O2OA 2EGAA 1YN8A 3FJ5A 2M51A 1K1ZA 2CUDA 3NHNA 4HVVA 3VS5A 2E5KA 3O5ZA 1WDXA 2V1QA 1T0JA 2OAWA 2VWFA 3M0UA 2YUPA 1JEGA 4M4ZA 1BU1A 1H8KA 5FWCA 2K6DA 4AFQC 2JMCA 3M0TA 1TG0A 3SHWA 1JO8A 1QKXA 3I9QA 2X3WD 5IHKA 2D8HA 1M3BA 2DILA 2KT8A 4CC7A 4A63B 4GLMA 2AKKA 1AEYA 2J7IA 2RQRA 2SEMA 2LJ3A 1ABQA 3THKA 3VRZA 2FEIA 1PKTA 2HEQA 1YNZA 5L23A 1M30A 4LUEA 3I5RA 2L0AA 2RQWA 2J6OA 3ULRB 1PKSA 2EGEA 3VS6A 4JJBA 2EYWA 4RTXA 1I1JA 2JMAA 1VYTA 2ENMA 2KRNA 1XOVA 2ROLA 4X1VA 2LJ0A 5IHIA 4JJDA 3GBQA 4WCIA 1SEMA 1U5SA 2GTJA 2JM8A 1UHCA 1ABOA 2DMOA 2J06A 2AK5A 2DL4A 1S1NA 2CH4A 3VS4A 2LJ1A 3VS3A 2VKNA 1RUWA 2DLPA 4HVUA 1B07A 1Y0MA 1H92A 2KR3A 1NYFA 4J9CA 4IIMA 2DL8A 2MOXA 4F16A 2DJQA 2FPFA 1QCFA 1HSQA 1WI7A 4CC2A 1PRLC 2G6FX 2GQIA 2JW4A 1OPKA 2CSQA 3EG3A 4E6RA 2ABLA 2EVRA 1I07A 4JPBW 1UUEA 2F2WA 4CC3A 2DX1A 2YDLA 5ECAA 2KXCA 2FO0A 1OV3A 2CUBA 5IXBA 4AFUC 2J6KA 1PWTA 2GBQA 2AKLA 1QLYA 4J9DA 3EG1A 2NUZA 3RNJA 1UJ0A 4QT7A 4AFZC 2LCSA 4J9FA 1PHTA 4J9EA 3R6NA 2I0NA 2O9VA 1J3TA 4RTVA 3REBB 3H0FA 2EKHA 2ESWA 2V1RA 4J9BA 2DM1A 1NYGA 2W10A 4Z88A 1EFNA 1AZGB 3QWYA 4RTYA 2D0NA 4LUDA 1NLOC 2EYXA 1YP5A 1E7OA 4ORZA 2D1XA 4RTZA 3ZL7C 1VA7A 2DF6A 2M0YA 2L3SA 3H0HA 3KFVA 2HBWA 1WLPB 1WYXA 2LQNA 2YT6A 1OEBA 1UECA 1U06A 4IIOA 4DEYA 3M0PA 1NG2A 3H0IA 4K11A 2MCNA 1AWWA 2AZSA 2LZ6B 2KBTA 4Z89A 3M0RA 2RQTA 2JS2A 2KNBB 2L3PA 2A08A 3IQLA 4OMNA 2DA9A 1UDLA 2A36A 3VRYA 2FG0A 2LNHB 4F14A 3EHRA 1K9AA 5I22A 4DEXA 1T3SA 3LH5A 2GGRA 2AZVA 2DL7A 4OMOA 1AZEA 2J05A 4HVWA 2OJ2A 1GCQA 2CSIA 1ZUUA 1ZLMA 2MIOA 5GJVB 1MUZA 2PNIA 1Z9ZA 1GBQA 1NLPC 3NPFA 2CREA 1JXOA 4RUGA 1MV0B 5I11A 2FPDA 2JTEA 4EIKA 1E6GA 2CT4A 2K7AA 1X2KA 2YUOA 2DVJA 1I0CA 2JM9A 2PZ1A 1X6GA 1SHGA 1UJYA 2ECZA 2IIMA 1AD5A 1RLQC 1TUCA 1OOTA 2D8JA 2HDAA 3I5SA 3NGPA 1V1CA 2BZXA 1E6HA 1UGVA 2YUNA 1U3OA 1WIEA 2DL5A 1ZX6A 2DE0X 2OI3A 2K9GA 3U23A 2O88A 2B86A 5IH2A 2KE9A 2KRSA 2KXDA 2GNCA 2DNUA 2KRMA 2CT3A 1SRMA 4RTTA 1GFCA 1PNJA 3PE0A 4Z8AA 2C0IA 2JS0A 3H41A 2ED0A 1QWFA 1M3CA 2DRKA 1RI9A 2F2VA 2LX7A 2FRWA 2DL3A 1UE9A 1Y57A 3CQTA 1K0XA 1ZUKA 2A28A 2EGCA 2YUQA 4J9GA 2DRMA 4AG1C 2H8HA 1GCPA 3EG2A 4RTWA 1WXTA 1SRLA 1HD3A 1SSHA 2EYYA 3REAB 2K2MA 1LCKA 4LE9A 2L3QA 5FWBA 1CKAA 2KT1A 1RLPC 1B3QA 1X6BA 3QWXX 3EGUA 1VYVA 4F17A 1WXUA 3M0QA 1A0NB 4D8KA 1YCSB
chains in the Genus database with same CATH superfamily
5KCOA 4M77B 2PVDB 2KEAA 4RG2A 2RNAA 2LTOA 1KQSA 4JZ4A 4M75G 3DLMA 1KC8U 1EIFA 2V8JA 2YSQA 1K4US 2NYSA 2K79A 1QVFA 1WA7A 4Q5WA 2RF0A 2FB7A 1NEGA 3SEMA 3G71Q 4E47A 2OAUA 4C92F 4R55A 3V7RA 1G3YA 5GMKe 2JNGA 3M4GA 4HCCA 4OMMA 2QA4A 2ZPGB 3UF4A 3PGGA 4IUQA 3C12A 1ZSZB 3CMAA 2I2LA 3CCJQ 3JB9I 3OW2P 1M9SA 1JXMA 3RDVA 1D1CA 5CVIA 4JRPA 1QP3A 3G4SQ 2RQUA 1W4SA 2RPNA 2R5MA 3I55A 3CD6T 2RI2A 2HSEB 1NM7A 4R0KA 3EGDA 2BZ8A 3OSVA 2OTLT 4OMPA 2DKGA 4E7HA 1QVGS 4PJOC 3WVEB 5GANg 4M75F 1ZSGA 3OYLA 4M7DB 1KFZA 3HP9A 4E7ZA 1Q81R 3G6EA 4Z02A 5HKCA 2DIQA 3L1AA 4JLGA 4Y91A 4D8DA 2DPPB 1VQ5A 1KC8R 2EPDA 1K0SA 4XU2A 1VQPT 3JCMW 2HQXA 2QQ9A 2M9UA 2E6NA 2JTMA 5AYFA 2MWOA 1IO6A 2CYZB 1JBMA 1T0HA 1JU5C 1AWOA 4ELYC 1Z9QA 2ZPIB 2FL7A 3EG0A 2EQJA 1I5OB 2KMTA 1B7TA 1U1SA 3OYDA 2VXEA 3CC4Q 1IXDA 3QDRB 3O8VA 1RAEB 3A98A 1VOMA 1SPKA 4QQDA 3S3MA 5DM7R 4LDVA 1VYUA 2E4HA 4JJNK 3ZFJA 1D1AA 5FRNA 3DB3A 1N5ZA 1XQHA 2A7YA 5LJ5h 2O31A 2DYBA 4KULA 1KQ1A 1Y96B 5GJWB 3BY7A 3QZ9B 3RIRA 3OS1A 1KIKA 2C0TA 4FCYA 2XMFA 2EW3A 4ZNXA 4OVAA 1RI0A 1ARKA 1QWEA 3RBBB 1VQNA 5D6YA 3OYIA 2A3LA 2RD1A 2X4XA 4C8QG 2MWPA 1VQ9A 3PIOA 2EJ9A 1IZ6A 3MP6A 2ZZDA 5GMKm 3TCJA 1IRXA 4C92B 2M51A 3MEWA 1X01A 1K1ZA 2EWNA 2CUDA 1DJ7B 2YRDA 2V1QA 2XIDA 1D09B 4D6WA 1R0CB 5GAOr 1BU1A 1Q7YC 1MNDA 5FWCA 3E9GA 2K6DA 3OBWA 3A5ZB 1JO8A 4ZGJB 5IHKA 3CD6Q 3CCQA 1R77A 4CC7A 3VYGA 3OYAA 2M1HA 4GLMA 1NPRA 4BB7A 2OTLQ 4FYVB 1UGRB 3JCMQ 3CCRT 3CC2A 3RKXA 2RQRA 1WJQA 1ABQA 1RAHB 3OQ5A 2P84A 3SWNA 2DVEA 1PKTA 3ASKA 2HEQA 2QQAA 3VJPA 2R57A 4LUEA 1HK9A 2HZYA 2L0AA 3ULRB 2CP3A 1PKSA 2XK0A 1N9RA 2QEXT 1VQPQ 3Q1JA 2EYWA 4RTXA 1I1JA 1Q7YU 1VYTA 3X25B 3C94A 2DD4A 3GBQA 1YITA 3CCVA 1BI2A 1KD1U 5KYWB 2JM8A 2V8IA 1JJ2P 2J06A 3RKYA 2AK5A 5CO7A 1TU0B 4C0FA 4J6YA 1B34A 3VS3A 2DLPA 2KR3A 4J9CA 2MOXA 1QCFA 1HSQA 4CC2A 3EFSA 3BFMA 7AT1B 4M7AB 2CKKA 4M77A 4BDZA 2E1HA 1TH7A 1YI2T 1N9SA 1JJ2A 4BD3A 3EG3A 3JB9D 2DXBA 5CK9A 1TWBA 3MEVA 2DX1A 2DAQA 2YDLA 3EFOB 5KCHA 3UWNA 1YJNA 2DK3A 1WPYA 1Y7XA 2AHJB 2BIVA 5KYNA 4L6V5 1I5LA 2NUZA 3RERA 1G8XA 4LD6A 2EJFA 1PHTA 1PD1A 4BY6B 2O9VA 4RTVA 2V1RA 1RAFB 3QXEB 1UB4A 3E19A 1RACB 1OQKA 2ZPBB 1Q7YR 2DM1A 1NJIC 4M77D 2FVUA 4BE1A 3TEEA 1VQ7A 3VYHB 1AZGB 4DOWA 2D0NA 1NLOC 1O75A 3JCMb 1E7OA 1MMDA 3F70A 1VA7A 2L3SA 3H0HA 3HRTA 4JRQA 2EQMA 5I2MA 4ME7A 5FLXE 2VB6A 1LOJA 5LJ5j 3CCRQ 4M7DA 1D0YA 3M0PA 1NG2A 4K11A 3TQ7P 3JCMc 2GFAA 1VIEA 1HXDA 4KUIA 4Z89A 3SWNC 4XQ3A 2KNBB 2L3PA 2E41A 3IQLA 4XTWA 4M78G 3N5BB 2DA9A 4XU1A 2KAFA 1NJIU 2E10A 2LNHB 2QEXQ 2R5AA 4F14A 2X4YA 4PFOA 1K9AA 2F69A 1VQKT 4NL3A 3MP8A 4X9DA 3CMET 1VQOT 2AZVA 1PSEA 1AZEA 1SSFA 3E2UA 5GAN7 2OJ2A 4C8QB 2BUDA 4WTOB 1M1FA 2QI2A 1ZUUA 3CPWS 4RUGA 1MV0B 4FSXA 2RB6A 2DO3A 2FPDA 2QDYB 4M7DD 2EIFA 2DVJA 2JM9A 1IGQA 5IT9E 1SHGA 4M77C 5CQXA 1YI2Q 2EFIA 5CIUA 2DXCA 2VASA 1Y96A 2HDAA 2QTVA 1YHQT 1KQSS 1P92A 4JUVA 1V1CA 3CBPA 4FYYB 2CS7A 2BZXA 2YUNA 4XTYA 1X6OA 4EMGA 3S6WA 1WIEA 3A8MB 3HTRA 1NZ9A 1QVFS 2EKOA 5GAOq 4X34A 5GANd 2GNCA 2DNUA 5A0LA 2CGHA 1GFCA 1PNJA 2RI3A 4Z8AA 1WHHA 1QWFA 1M3CA 2F2VA 3HRSA 1ZSZC 4FIBA 2BE7D 1K0XA 2A28A 2QQRA 4J9GA 5CKFA 3D7SB 2HQHA 3EG2A 2DIGA 1W2BP 2M16A 3VUBA 3VKIA 2OX7A 5DLQE 4QQ6A 3CCMT 1UGPB 1WNLA 1CKAA 2DTHA 1X6BA 3EGUA 1VYVA 3M0QA 1A0NB 5AT1B 1W2BA 4M7DC 3PMTA 2MAMA 1GRIA 1IGUA 2ZCFB 4C92D 3JCMg 3VU3C 4KH1B 2W0ZA 1UHFA 3NMZC 1QVPA 3MJXA 1ZBJA 2KSSA 2H3EB 1SHFA 2JUFA 1CKBA 1BBZA 4OMQA 3CMAT 4AG2C 5IXFA 4DBQA 1OU9A 2HSPA 3CPFA 1AHJB 1VQKQ 2CZ0B 4E7IA 5GANe 2RM4A 4AFSC 5IN1A 3CCUA 3CMEQ 5KYWA 1VQOQ 3QHSA 3VS0A 4A4EA 3VS1A 4RTUA 3I55T 2QXFA 5LJ3e 3RMQA 2K4YA 4M7AA 1VQ6A 1BYMA 2K3XA 3FC3A 3PTAA 1I4K1 4KGZB 1XTDA 2EBPA 2VVKA 1KHCA 3MEUA 3C95A 4DOVA 1VQ8A 4A4KA 1YHQQ 1ACMB 4XAXB 2X4JA 2V26A 1VQ5T 2HBPA 3L2UA 1NEBA 1JQQA 5A0GA 3MCAB 4N4GA 4HXJA 2K5FA 4OGCA 1U8RA 2XICA 4HCZA 1WXBA 2ED1A 2K3BA 1BIAA 4QVDA 4X9CA 4M78B 3OYNA 2HL5C 2H3JA 4C92C 2RN8A 5I21A 4FSSA 4HT8A 3ZBDA 4M7AD 1ZA2B 2CH4W 3G7ZA 2EQUA 1BB9A 1UFFA 4EMKB 4QKUA 4C0ZA 1X43A 2XDBA 2J6FA 2LVMA 5CR2A 4AT1B 4M7AE 4GBQA 5GAN5 1QKWA 3CCMQ 5HCKA 4C5EA 4VUBA 2E3IA 4ESRA 3H6ZA 3CC7A 3V7SA 4PFZA 3GLXA 5FW9A 2LMJA 1VQNT 4KRTA 4PJNA 3A8OB 1VQ9T 1QCOA 2C0OA 4J7IA 2ZPFB 1GBRA 4QVZA 1KSWA 3FRNA 4QVCA 4RCCA 1Q81U 3CMAQ 3LGFA 1BI3A 5GANh 4PJOE 1XNIA 2MPXC 1CSKA 3L2QA 3CCST 1VQ4A 2B8AA 2O01E 1MMNA 4JS5A 3FJ5A 1WHMA 1FX7A 3I55Q 5I2SA 4HVVA 3CCQT 1WDXA 3LWHA 1VQLA 1T0JA 4J6XA 3MEAA 3HRUA 1TS9A 2FZKB 2RHXA 2YUPA 2ZAEA 2PVGB 3HSBA 4M7AC 5KE3A 5GAMd 4E7SA 3MKDA 4AFQC 1Q82C 1QCNA 1QKXA 1JJ2S 4JDSA 3M9QA 3PIPA 2KT8A 2JJ9A 1HYOA 1VQ5Q 1I81A 3HPWA 3PFSA 1IB8A 2J7IA 2NUPB 2SEMA 4C8QD 3J7AF 1WHLA 4ZTJA 5L23A 5FU7B 3OW2A 2EQKA 1YITT 4BY6C 3PMIA 2RQWA 2J6OA 3OYYA 2AIRB 4F7UB 3OYFA 4MZPA 3P8DA 2KRNA 2RHYA 1XOVA 3J80E 4FT2A 4JJDA 5LJ3g 2Y4XA 2COWA 1U5SA 4IURA 2Y4YA 3NFCA 1S1NA 2CH4A 3EG9B 1YCYA 2VKNA 2WSEE 4HVUA 1YJNT 4IIMA 2DL8A 4F16A 2QGFB 2LCLA 3S3OA 3CCJA 2YLCA 1WI7A 2COZA 5GAOl 3SB2A 5GAMe 1Q86C 2E12A 3QJ6A 5GANf 4PJOG 3G4SA 4E6RA 2DETA 4OF1A 2EVRA 1H3ZA 2MYSA 1VQNQ 1VQ9Q 4FYXB 2FO0A 2CUBA 5DLOA 2J6KA 1M90C 3VV0A 4QQGA 2AKLA 3OYBA 2RK1A 1QLYA 2XI9A 4J9DA 3LGLA 1VQ7T 3CCSQ 4AFZC 2RHUA 4C8QC 5CKBA 1S72A 4J9EA 2I0NA 5GAOp 2QASA 3UPUA 3CCQQ 1BCOA 3RR6A 2W10A 3QUIA 5GMKh 1Q82R 5GAN4 2QK0A 3JB9J 3JCMX 4GY5A 3ZEHA 2G3RA 4KGVB 2EYXA 1YP5A 5KYXB 4ORZA 2D1XA 4PJMA 2LT4A 3TU4K 1M1KC 1Y07A 4XTVA 2DERA 2HBWA 1LVKA 4PJOF 2YT6A 1OEBA 1U06A 4DEYA 2MCNA 4DA4A 2AZSA 2LZ6B 3MHXA 3P8HA 3FB9A 4M78A 4OMFB 4OMNA 1YITQ 5GANj 2A36A 4A4HA 1KK7A 3JCMd 3OYKA 1I8FA 2FG0A 3PNWC 4L5GA 5GAOn 3EHRA 3M58A 4II1A 4EMKA 3M5AA 5KYYB 1WHJA 5I22A 4M75B 3LH5A 3SFMA 3QPHA 2PQWA 4UC4A 2J05A 2QQBA 1GCQA 2CSIA 2MIOA 5GJVB 1MUZA 5J3BA 1JRIA 1NLPC 2CREA 3KBGA 2CZ7B 4FT4A 3OY9A 1YJNQ 1Q86R 5GAMh 2DTOA 3M53A 2PZ1A 2M0OA 1X6GA 4BACA 2ECZA 3JCMP 2IIMA 1W2BS 1AD5A 4M78D 1G5VA 1M2VB 2DZCA 3I5SA 3L42A 1M90R 4N4IA 3SDZA 1U3OA 2OTLA 2K9GA 1OX9A 3U23A 2CP2A 1OX8A 5IH2A 2DZ9A 4FU6A 1VQ7Q 2CT3A 1PM3A 1N27A 1XJWB 2K5LA 3JCMe 3FIFA 2ED0A 2WSCE 1Y71A 4LXCA 5C0MA 1O9SA 2DL3A 1D1BA 3CQTA 4IUVA 1ZUKA 4J7FA 2YUQA 3I56T 2D9TA 4N0AC 4RTWA 1SRLA 5A2QE 3CCEA 1ZSZA 1QVGP 1M1KR 3REAB 2R58A 1LCKA 5GAMg 4DBRA 4E7KA 3NTHA 1G3TA 2HKNA 4LE9A 1K9MC 5FWBA 1BI0A 1FMVA 2P4TA 1M8VA 3QWXX 3FEOA 2JVVA 1WXUA 3A8LB 3EGXB 2K3YA 8AT1B 1SG5A 5L8RE 4M77E 1QQJA 3CCUT 2LP5A 4M78C 4F7UA 4J9HA 2EYZA 5CKEA 3MP1A 2DBKA 3JRZA 2YWWA 1ZBXA 2PTKA 2X3XD 2O4XB 3UATA 1MMAA 2VV5A 2KYMA 1YIJA 4EMKC 3L2WA 1MV3A 5GAMf 1ZQ1A 4J9IA 1ZUYA 5D6XA 3PVQA 1LJOA 3EH2A 1BK2A 4B9WA 2O9SA 1GCQC 5C6SA 5GMKj 4MDWA 5HY6A 2F5TX 1PD0A 2X9HA 4JZ3A 4LNPA 1D3BB 5EC7A 2NWMA 3HFNA 3UDCA 1BI1A 1FWZA 1QW1A 2FPEA 2L89A 1WFWA 2LQKA 4A54A 3TVTA 1K8AC 2JXBA 1M5Q1 4PFPA 1AWXA 2EJGA 4ZN1A 1F1BB 3CCLT 3EAEA 1OU8A 1WX6A 5CCAA 3DLLA 2CP0A 4HCKA 4RG8A 4F7UE 2F5KA 1D0XA 3LYIA 4M7DE 5M9OA 1GL5A 1AWJA 2FZGB 1AVZC 3JCMh 2A0FB 1T3LA 3LW5E 1AOJA 4RCBA 2E6ZA 2M02A 2HCKA 2LX9A 3EH1A 3M56A 3I56Q 1K8AU 4C92A 1M27C 2RA2A 3KUFA 1OPLA 2BTTA 5GAMj 5KYXA 5LJ3d 2RQVA 1W1FA 4M77G 1K9MR 2DXTA 2CDTA 1M8MA 1H3HA 3C0CA 1KJWA 2FRYA 1KHIA 1LPLA 2YRCA 1UG1A 2XDDA 3OMGA 3OSSC 2DBMA 4JLIA 5FU7C 1PCXA 2KK4A 2QG9B 1VQ4T 3V8KA 1YI2A 2E3HA 1MGQA 4BE2A 3CCUQ 3JB9F 3OW2S 1RL2A 2F2XA 1X69A 3QZ5B 2RJFA 1VQMA 2ZPEB 1EZZB 4AMCA 5KYYA 2E64A 1VQLT 4M75A 5FROA 2RMOA 4R56A 4JJCA 5J26A 2PVOB 2O2OA 2QA4T 2EGAA 1BIBA 1OULA 2VUBA 1YN8A 1KG1A 2FZCB 3RUXA 3BE3A 4C92E 3NHNA 4BI8B 3O5ZA 2E5QA 2VWFA 3GF5A 3M0UA 1JEGA 5FU6B 2CP6A 1K8AR 2DTIA 4M77F 3URGA 1H8KA 2RHZA 1M2VA 1BCMA 3M0TA 1TG0A 4IUUA 4M7DG 3I9QA 4OGEA 3WVDB 1M3BA 2DILA 3JCMf 4A63B 3CCLQ 4M75D 1AEYA 4FW1A 4XTXA 3GP8A 1WHGA 2LJ3A 3EFOA 3VRZA 2Y90A 3DB4A 3G6ET 3PT9A 2FEIA 1M4ZA 4PJJA 1YNZA 5LL6S 3OYMA 1QMCA 3JB9H 4OP0A 1MHNA 2DFUA 2QYZA 4XTZA 3I5RA 3MPUB 4M75E 3BDUA 4FL6A 3VS6A 4JJBA 3FDRA 4PKCC 2L5QA 2ROLA 4X1VA 1K73C 2LJ0A 5IHIA 1VQKA 1VIFA 1N8RC 3CMEA 2PUKB 1SEMA 1OI1A 1ABOA 4XU0A 2DMOA 6AT1B 2DD5A 2DL4A 4LD9K 2RJCA 2YHTA 5CAIA 1RUWA 1H92A 1B07A 1Y0MA 1NYFA 5HK3A 4C5GA 4ZTFA 2FPFA 1PRLC 2G6FX 1AT1B 3EGXA 4M7DF 2X35A 2JW4A 3M4YA 1OPKA 2CSQA 1R0BG 1OZ3A 2ABLA 4JPBW 3ER0A 1VQ4Q 4CC3A 1S72T 4RMOA 1X75C 3OS5A 1IHVA 4B6MA 1IHWA 1OV3A 5IXBA 2E70A 2WACA 5DY9A 2O4XA 3L2ZA 1YJ9A 1RAGB 1K73U 3TREA 3H8ZA 4NOYA 4M75C 4J83A 2FHDA 4YTLA 4QT7A 2CZ1B 2KDSA 3QIIA 2LCSA 4J9FA 4ANJA 4OB0B 4XK8E 3R6NA 2QA4Q 1UEBA 4E2FB 3OYGA 3REBB 1D3BA 1YFNA 3H0FA 2ESWA 2RK2A 1KQSP 1D0ZA 4C8QA 2RI5A 9ATCB 1EFNA 2IG0A 5GAN3 4LDUA 3LWIA 3QWYA 3FJPA 5LJ3h 5GAN6 1QVFP 2NUTB 5GAN2 2LNVA 3QYHB 2QGGA 3KXTA 3KFVA 3CC2T 4MDXA 5FRMA 3CCMA 1WLPB 2LQNA 5LJ5e 1PSFA 1UECA 4V2SA 4IIOA 1YJWA 4PLIA 3OYJA 1C0MA 5GMKl 3L2VA 3H0IA 1AWWA 2FYKA 2XDPA 3META 3G6EQ 2JS2A 2OTJA 1N6AA 3AT1B 3CEYA 3HKSA 1UDLA 1H641 4J5YA 3VRYA 5KYUB 2CP5A 1RAIB 1K73R 4FYWB 1N8RR 3CCVT 2JTFA 4OMOA 4M7AG 4N4HA 4C8QE 2EAYA 1Z9ZA 1GBQA 2DYIA 2CZ6B 3QBYA 1JXOA 4A4FA 3SD4A 1Q82U 2JN0A 1E6GA 2CT4A 2K7AA 1X2KA 3G71A 1IREB 1JB0E 1WGSA 1UJYA 2HNIA 3QJYA 1TUCA 1OOTA 2D8JA 3JAME 1UGSB 2MF2A 3NGPA 1S72Q 1E6HA 1UGVA 1PG5B 2D0QB 3M59A 2DL5A 2Z0WA 1ZX6A 3GIBA 2OI3A 3C4SA 3INZA 2O88A 3EFRA 2B86A 2DEQA 2XD0A 4J6WA 3QKJA 2KE9A 2KRSA 2KXDA 2KI7A 4O6JA 3A8HB 4RTTA 3OS0A 3CCET 3WXMB 3PE0A 5LJ3f 2YRVA 2JS0A 4FM4B 1RI9A 2FRWA 1NPPA 2K5IA 4M7AF 5CKDA 2EGCA 4AG1C 4FW2A 3M54A 4PJLA 3OA6A 1WQWA 3HHTB 1RADB 4IUPA 4MZTA 3NTKA 3CXCP 4MZMA 2EYYA 1Q86U 3V7CA 2HL3A 2LC4A 4N0AA 3VUZA 4IKFA 3CC2Q 4OB3B 2KT1A 1B3QA 2K2VA 5CQYA 4ZGEB 4F17A 3QG1A 1WHKA 2QAZA 4D8KA 1YIJT 3CXCA 1G2BA 2L2PA 3CC4A 3FLGA 4PL6A 1M90U 4C0DB 1SF9A 2P0PA 2C06A 4HT9A 5EG2A 1FMKA 4OB2B 2EQIA 2VYTA 2KYBA 2NLUA 3CCVQ 1PRMC 4CC4B 2P4RA 1X2QA 3TSZA 3CCSA 2BE9B 1WJRA 5D6WA 5A0DA 1TUDA 3EHQA 2KROA 5IHNA 1W6XA 4ELZC 3QDFA 5LJ3j 1C1AA 1W70A 3A1PA 3JCMJ 1KD1C 2VXFA 2XKOC 4HA8A 4B9XA 1M1KU 1V76A 2D6FA 2RJEA 3UA6A 2ROTA 1G83A 2RJDA 1ZA1B 5LJ5g 2LT1A 3M0SA 1GFDA 3R6OA 4Y92A 2GQVA 2A37A 2ATCB 1WZOA 3A8GB 3VS7A 3I35A 1UGQB 4MMLA 2IPOB 4MMKA 4DBHA 3VS2A 4C8QF 3CD6A 2KGTA 1M3AA 1FYNA 1UTIA 5GAOm 2RO0A 3CCEQ 2GTOA 2LQWA 2SRCA 3UA7A 2WSFE 4M78E 2YLBA 5FU6C 5LJ5f 3J81E 3PVLA 5KH6A 1TXQA 1ZHIA 4ZGDB 2NUTA 2BZYA 2PU9B 2JT4A 1VQPA 2HQEA 1K76A 3CBMA 2HD0A 3LLRA 4OMLA 1HJDA 3OYCA 1VQMT 1NE8A 1EX4A 2HKQB 3JSCA 2VC8A 1PC0A 2P0QA 3E1SA 4LN2A 1YIJQ 3CBOA 3TSWA 2NUPA 1YWOA 1X27A 2KQWA 5KYUA 2CP7A 2GF7A 2HMAA 4NL2A 2QDLA 1QVGA 2DEUA 1YWPA 4PJOB 3JV3A 4BE0A 4EMHA 2XU8A 3GOXA 2XHCA 3OMCA 4Y28E 4JRKA 4EDUA 2QTXA 1GXIE 1KD1R 4OB1B 4LDWA 4RKUE 4GLKA 1VQ6T 3VS5A 2E5KA 1KQ2A 2LQ8A 2OAWA 4M4ZA 3X20B 3EG9A 2YXYA 1K9MU 2JMCA 1VUBA 1VQ8T 3SHWA 4C5IA 3GNGA 3GPLA 2X3WD 2D8HA 4DQ2A 4XU3A 1M1GA 4CRIA 2AKKA 2L3RA 3OB9A 2EYQA 3NTIA 3ME9A 3JCMV 4EPCA 3THKA 1M2OA 1M30A 2K57A 4BI4A 4A53A 3E9FA 4PLLA 3RESA 3X26B 3JB9G 1R8OB 1TSFA 2EGEA 3CCRA 3RMSA 1RAAB 3QSUA 2MMPA 4KUDK 2JMAA 2ENMA 1WJSA 3UT1A 4J8OA 4WCIA 2GTJA 1UHCA 2L8DA 3OBYA 5IAYA 1C6VX 2QEXA 3VS4A 2LJ1A 8ATCB 1V29B 3AHUA 4XTUA 3CC7T 2DJQA 1VQMQ 1YJ9T 3T9NA 2GQIA 2JZ2A 2KY9A 5KE2A 2HAXA 1I07A 4M78F 1LNXA 1UUEA 2F2WA 3QO3A 5ECAA 2KXCA 1YBYA 2X51A 4AFUC 1PWTA 3EGDB 2GBQA 4JS4A 3G1JA 2PUOB 1NJIR 3EG1A 3RKWA 2ZGWA 1OZ2A 2V8KA 3RNJA 1UJ0A 1MNEA 3V8LA 2XG8D 4HCBA 2AT1B 1OYXA 1J3TA 3LX7A 2EKHA 4J9BA 1VQ6Q 1NYGA 4Z88A 1SKUB 1YJWT 3I56A 4LDYA 4E7LA 4RTYA 2MI6A 4LUDA 1VQ8Q 2OTJT 4A4GA 5J39A 4RTZA 4KH0B 3ZL7C 2DF6A 2M0YA 4KGXB 4JRIA 1WYXA 4F7UG 1NBEB 4WF2A 1G3WA 4KBMB 1FMWA 1U1TA 4HKEA 1TUGB 4NS5A 2KBTA 3M0RA 3S3NA 2RQTA 3OYEA 1WQ7A 2A08A 2BKDN 3DKMA 2QQSA 4P5NA 4PK4A 2RH2A 1Q95G 4ATOA 3V8JA 2ZPHB 4CI0C 1QP2A 1G3SA 2GFUA 3G71T 4DEXA 1T3SA 2GGRA 4F04B 2DL7A 3GNFB 4QW2A 4HVWA 3M57A 3HL8A 4PNOA 1MMGA 2X4WA 1RABB 3QYGB 1ZLMA 2PNIA 3P8BB 4TVRA 2P0KA 3NPFA 5I11A 3CCJT 2JTEA 4EIKA 3CC7Q 2COYA 2MK5A 4L59A 2YUOA 4IUTA 4DBFA 1VQOA 1YJ9Q 1I0CA 1BKBA 4C0GA 3G4ST 5GMKi 2VGNA 3OS2A 1RLQC 3HFOA 3CXCS 3BDLA 3BW1A 5GAN8 4F7UF 4C0DC 1TTHB 3LH0A 5LJ5d 2VGMA 3OYHA 4PJOA 2DE0X 1TOVA 2LDMA 3CCLA 4C5HA 2DXUA 4O5VA 2LCCA 3X24B 1FXXA 3SWNB 3H9NA 2KRMA 1SRMA 1YHQA 1Q81C 2F1LA 2C0IA 3X28B 3H41A 4C92G 2JOYA 2GCXA 2DRKA 3CPWP 3M55A 2LX7A 1VQLQ 1KC8C 4ZN3A 1N8RU 3MO8A 1UE9A 1Y57A 3L2RA 2DRMA 2H8HA 1GCPA 5D7UA 2DJZA 2LRQA 2E65A 1WXTA 1YJWQ 1HD3A 1SSHA 4BUGA 4E7JA 5CKHA 3CC4T 4BDYA 2K2MA 3CPWA 2OTJQ 2L3QA 4BI3A 4PJOD 1B34B 2IVWA 1RLPC 2KVQG 2RHIA 5HK0A 4LDXA 4KT0E 1YCSB
chains in the Genus database with same CATH topology
1G2BA 2L2PA 1GRIA 2KEAA 2RNAA 4JZ4A 2LP5A 2W0ZA 1UHFA 4J9HA 2EYZA 3NMZC 2DBKA 2YSQA 1K4US 1ZBJA 2K79A 1WA7A 1SHFA 2PTKA 1CKBA 1FMKA 1BBZA 2X3XD 4OMQA 3UATA 4AG2C 5IXFA 2KYMA 2RF0A 2HSPA 1MV3A 1NEGA 2EQIA 3SEMA 2KYBA 4AFSC 1PRMC 4J9IA 1ZUYA 4CC4B 3VS0A 2P4RA 3PVQA 1BK2A 1X2QA 3TSZA 3VS1A 2O9SA 1GCQC 4RTUA 1TUDA 4OMMA 3EHQA 2KROA 5IHNA 3UF4A 1W6XA 4JZ3A 4LNPA 1W70A 5EC7A 2NWMA 1JXMA 2FPEA 1WFWA 2EBPA 3UA6A 2VVKA 2ROTA 2RQUA 3TVTA 1G83A 2RPNA 2JXBA 1AWXA 3M0SA 1GFDA 1NM7A 4R0KA 4Y92A 2BZ8A 2A37A 4OMPA 3VS7A 3I35A 1NEBA 1JQQA 1WX6A 4HCKA 4HXJA 1ZSGA 1KFZA 1WXBA 2ED1A 3VS2A 2K3BA 1GL5A 2KGTA 1M3AA 1FYNA 1AWJA 1UTIA 1AVZC 4D8DA 1T3LA 2GTOA 2LQWA 1AOJA 2SRCA 3UA7A 2EPDA 2RN8A 1K0SA 2HCKA 4FSSA 2CH4W 1IO6A 1BB9A 1UFFA 1T0HA 1JU5C 3PVLA 1M27C 1AWOA 1Z9QA 1X43A 2BZYA 3EG0A 2J6FA 1OPLA 2BTTA 2JT4A 2RQVA 1W1FA 2CDTA 1K76A 4GBQA 1M8MA 1QKWA 1H3HA 5HCKA 3A98A 3C0CA 1SPKA 4OMLA 1HJDA 1KJWA 4ESRA 2FRYA 1VYUA 1UG1A 2DBMA 4LN2A 5FW9A 1N5ZA 2LMJA 4KRTA 2O31A 3TSWA 2F2XA 1X69A 2C0OA 1YWOA 2DYBA 5GJWB 1KIKA 1X27A 2C0TA 1GBRA 2XMFA 2QDLA 1KSWA 1YWPA 2EW3A 3JV3A 4ZNXA 2RMOA 1ARKA 1QWEA 1CSKA 4JJCA 3RBBB 2O2OA 2EGAA 1YN8A 3FJ5A 2M51A 1K1ZA 2CUDA 3NHNA 4HVVA 3VS5A 2E5KA 3O5ZA 1WDXA 2V1QA 1T0JA 2OAWA 2VWFA 3M0UA 2YUPA 1JEGA 4M4ZA 1BU1A 1H8KA 5FWCA 2K6DA 4AFQC 2JMCA 3M0TA 1TG0A 3SHWA 1JO8A 1QKXA 3I9QA 2X3WD 5IHKA 2D8HA 1M3BA 2DILA 2KT8A 4CC7A 4A63B 4GLMA 2AKKA 1AEYA 2J7IA 2RQRA 2SEMA 2LJ3A 1ABQA 3THKA 3VRZA 2FEIA 1PKTA 2HEQA 1YNZA 5L23A 1M30A 4LUEA 3I5RA 2L0AA 2RQWA 2J6OA 3ULRB 1PKSA 2EGEA 3VS6A 4JJBA 2EYWA 4RTXA 1I1JA 2JMAA 1VYTA 2ENMA 2KRNA 1XOVA 2ROLA 4X1VA 2LJ0A 5IHIA 4JJDA 3GBQA 4WCIA 1SEMA 1U5SA 2GTJA 2JM8A 1UHCA 1ABOA 2DMOA 2J06A 2AK5A 2DL4A 1S1NA 2CH4A 3VS4A 2LJ1A 3VS3A 2VKNA 1RUWA 2DLPA 4HVUA 1B07A 1Y0MA 1H92A 2KR3A 1NYFA 4J9CA 4IIMA 2DL8A 2MOXA 4F16A 2DJQA 2FPFA 1QCFA 1HSQA 1WI7A 4CC2A 1PRLC 2G6FX 2GQIA 2JW4A 1OPKA 2CSQA 3EG3A 4E6RA 2ABLA 2EVRA 1I07A 4JPBW 1UUEA 2F2WA 4CC3A 2DX1A 2YDLA 5ECAA 2KXCA 2FO0A 1OV3A 2CUBA 5IXBA 4AFUC 2J6KA 1PWTA 2GBQA 2AKLA 1QLYA 4J9DA 3EG1A 2NUZA 3RNJA 1UJ0A 4QT7A 4AFZC 2LCSA 4J9FA 1PHTA 4J9EA 3R6NA 2I0NA 2O9VA 1J3TA 4RTVA 3REBB 3H0FA 2EKHA 2ESWA 2V1RA 4J9BA 2DM1A 1NYGA 2W10A 4Z88A 1EFNA 1AZGB 3QWYA 4RTYA 2D0NA 4LUDA 1NLOC 2EYXA 1YP5A 1E7OA 4ORZA 2D1XA 4RTZA 3ZL7C 1VA7A 2DF6A 2M0YA 2L3SA 3H0HA 3KFVA 2HBWA 1WLPB 1WYXA 2LQNA 2YT6A 1OEBA 1UECA 1U06A 4IIOA 4DEYA 3M0PA 1NG2A 3H0IA 4K11A 2MCNA 1AWWA 2AZSA 2LZ6B 2KBTA 4Z89A 3M0RA 2RQTA 2JS2A 2KNBB 2L3PA 2A08A 3IQLA 4OMNA 2DA9A 1UDLA 2A36A 3VRYA 2FG0A 2LNHB 4F14A 3EHRA 1K9AA 5I22A 4DEXA 1T3SA 3LH5A 2GGRA 2AZVA 2DL7A 4OMOA 1AZEA 2J05A 4HVWA 2OJ2A 1GCQA 2CSIA 1ZUUA 1ZLMA 2MIOA 5GJVB 1MUZA 2PNIA 1Z9ZA 1GBQA 1NLPC 3NPFA 2CREA 1JXOA 4RUGA 1MV0B 5I11A 2FPDA 2JTEA 4EIKA 1E6GA 2CT4A 2K7AA 1X2KA 2YUOA 2DVJA 1I0CA 2JM9A 2PZ1A 1X6GA 1SHGA 1UJYA 2ECZA 2IIMA 1AD5A 1RLQC 1TUCA 1OOTA 2D8JA 2HDAA 3I5SA 3NGPA 1V1CA 2BZXA 1E6HA 1UGVA 2YUNA 1U3OA 1WIEA 2DL5A 1ZX6A 2DE0X 2OI3A 2K9GA 3U23A 2O88A 2B86A 5IH2A 2KE9A 2KRSA 2KXDA 2GNCA 2DNUA 2KRMA 2CT3A 1SRMA 4RTTA 1GFCA 1PNJA 3PE0A 4Z8AA 2C0IA 2JS0A 3H41A 2ED0A 1QWFA 1M3CA 2DRKA 1RI9A 2F2VA 2LX7A 2FRWA 2DL3A 1UE9A 1Y57A 3CQTA 1K0XA 1ZUKA 2A28A 2EGCA 2YUQA 4J9GA 2DRMA 4AG1C 2H8HA 1GCPA 3EG2A 4RTWA 1WXTA 1SRLA 1HD3A 1SSHA 2EYYA 3REAB 2K2MA 1LCKA 4LE9A 2L3QA 5FWBA 1CKAA 2KT1A 1RLPC 1B3QA 1X6BA 3QWXX 3EGUA 1VYVA 4F17A 1WXUA 3M0QA 1A0NB 4D8KA 1YCSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2B A;  2L2P A;  1GRI A;  2KEA A;  2RNA A;  4JZ4 A;  2LP5 A;  2W0Z A;  1UHF A;  4J9H A;  2EYZ A;  3NMZ C;  2DBK A;  2YSQ A;  1K4U S;  1ZBJ A;  2K79 A;  1WA7 A;  1SHF A;  2PTK A;  1CKB A;  1FMK A;  1BBZ A;  2X3X D;  4OMQ A;  3UAT A;  4AG2 C;  5IXF A;  2KYM A;  2RF0 A;  2HSP A;  1MV3 A;  1NEG A;  2EQI A;  3SEM A;  2KYB A;  4AFS C;  1PRM C;  4J9I A;  1ZUY A;  4CC4 B;  3VS0 A;  2P4R A;  3PVQ A;  1BK2 A;  1X2Q A;  3TSZ A;  3VS1 A;  2O9S A;  1GCQ C;  4RTU A;  1TUD A;  4OMM A;  3EHQ A;  2KRO A;  5IHN A;  3UF4 A;  1W6X A;  4JZ3 A;  4LNP A;  1W70 A;  5EC7 A;  2NWM A;  1JXM A;  2FPE A;  1WFW A;  2EBP A;  3UA6 A;  2VVK A;  2ROT A;  2RQU A;  3TVT A;  1G83 A;  2RPN A;  2JXB A;  1AWX A;  3M0S A;  1GFD A;  1NM7 A;  4R0K A;  4Y92 A;  2BZ8 A;  2A37 A;  4OMP A;  3VS7 A;  3I35 A;  1NEB A;  1JQQ A;  1WX6 A;  4HCK A;  4HXJ A;  1ZSG A;  1KFZ A;  1WXB A;  2ED1 A;  3VS2 A;  2K3B A;  1GL5 A;  2KGT A;  1M3A A;  1FYN A;  1AWJ A;  1UTI A;  1AVZ C;  4D8D A;  1T3L A;  2GTO A;  2LQW A;  1AOJ A;  2SRC A;  3UA7 A;  2EPD A;  2RN8 A;  1K0S A;  2HCK A;  4FSS A;  2CH4 W;  1IO6 A;  1BB9 A;  1UFF A;  1T0H A;  1JU5 C;  3PVL A;  1M27 C;  1AWO A;  1Z9Q A;  1X43 A;  2BZY A;  3EG0 A;  2J6F A;  1OPL A;  2BTT A;  2JT4 A;  2RQV A;  1W1F A;  2CDT A;  1K76 A;  4GBQ A;  1M8M A;  1QKW A;  1H3H A;  5HCK A;  3A98 A;  3C0C A;  1SPK A;  4OML A;  1HJD A;  1KJW A;  4ESR A;  2FRY A;  1VYU A;  1UG1 A;  2DBM A;  4LN2 A;  5FW9 A;  1N5Z A;  2LMJ A;  4KRT A;  2O31 A;  3TSW A;  2F2X A;  1X69 A;  2C0O A;  1YWO A;  2DYB A;  5GJW B;  1KIK A;  1X27 A;  2C0T A;  1GBR A;  2XMF A;  2QDL A;  1KSW A;  1YWP A;  2EW3 A;  3JV3 A;  4ZNX A;  2RMO A;  1ARK A;  1QWE A;  1CSK A;  4JJC A;  3RBB B;  2O2O A;  2EGA A;  1YN8 A;  3FJ5 A;  2M51 A;  1K1Z A;  2CUD A;  3NHN A;  4HVV A;  3VS5 A;  2E5K A;  3O5Z A;  1WDX A;  2V1Q A;  1T0J A;  2OAW A;  2VWF A;  3M0U A;  2YUP A;  1JEG A;  4M4Z A;  1BU1 A;  1H8K A;  5FWC A;  2K6D A;  4AFQ C;  2JMC A;  3M0T A;  1TG0 A;  3SHW A;  1JO8 A;  1QKX A;  3I9Q A;  2X3W D;  5IHK A;  2D8H A;  1M3B A;  2DIL A;  2KT8 A;  4CC7 A;  4A63 B;  4GLM A;  2AKK A;  1AEY A;  2J7I A;  2RQR A;  2SEM A;  2LJ3 A;  1ABQ A;  3THK A;  3VRZ A;  2FEI A;  1PKT A;  2HEQ A;  1YNZ A;  5L23 A;  1M30 A;  4LUE A;  3I5R A;  2L0A A;  2RQW A;  2J6O A;  3ULR B;  1PKS A;  2EGE A;  3VS6 A;  4JJB A;  2EYW A;  4RTX A;  1I1J A;  2JMA A;  1VYT A;  2ENM A;  2KRN A;  1XOV A;  2ROL A;  4X1V A;  2LJ0 A;  5IHI A;  4JJD A;  3GBQ A;  4WCI A;  1SEM A;  1U5S A;  2GTJ A;  2JM8 A;  1UHC A;  1ABO A;  2DMO A;  2J06 A;  2AK5 A;  2DL4 A;  1S1N A;  2CH4 A;  3VS4 A;  2LJ1 A;  3VS3 A;  2VKN A;  1RUW A;  2DLP A;  4HVU A;  1B07 A;  1Y0M A;  1H92 A;  2KR3 A;  1NYF A;  4J9C A;  4IIM A;  2DL8 A;  2MOX A;  4F16 A;  2DJQ A;  2FPF A;  1QCF A;  1HSQ A;  1WI7 A;  4CC2 A;  1PRL C;  2G6F X;  2GQI A;  2JW4 A;  1OPK A;  2CSQ A;  3EG3 A;  4E6R A;  2ABL A;  2EVR A;  1I07 A;  4JPB W;  1UUE A;  2F2W A;  4CC3 A;  2DX1 A;  2YDL A;  5ECA A;  2KXC A;  2FO0 A;  1OV3 A;  2CUB A;  5IXB A;  4AFU C;  2J6K A;  1PWT A;  2GBQ A;  2AKL A;  1QLY A;  4J9D A;  3EG1 A;  2NUZ A;  3RNJ A;  1UJ0 A;  4QT7 A;  4AFZ C;  2LCS A;  4J9F A;  1PHT A;  4J9E A;  3R6N A;  2I0N A;  2O9V A;  1J3T A;  4RTV A;  3REB B;  3H0F A;  2EKH A;  2ESW A;  2V1R A;  4J9B A;  2DM1 A;  1NYG A;  2W10 A;  4Z88 A;  1EFN A;  1AZG B;  3QWY A;  4RTY A;  2D0N A;  4LUD A;  1NLO C;  2EYX A;  1YP5 A;  1E7O A;  4ORZ A;  2D1X A;  4RTZ A;  3ZL7 C;  1VA7 A;  2DF6 A;  2M0Y A;  2L3S A;  3H0H A;  3KFV A;  2HBW A;  1WLP B;  1WYX A;  2LQN A;  2YT6 A;  1OEB A;  1UEC A;  1U06 A;  4IIO A;  4DEY A;  3M0P A;  1NG2 A;  3H0I A;  4K11 A;  2MCN A;  1AWW A;  2AZS A;  2LZ6 B;  2KBT A;  4Z89 A;  3M0R A;  2RQT A;  2JS2 A;  2KNB B;  2L3P A;  2A08 A;  3IQL A;  4OMN A;  2DA9 A;  1UDL A;  2A36 A;  3VRY A;  2FG0 A;  2LNH B;  4F14 A;  3EHR A;  1K9A A;  5I22 A;  4DEX A;  1T3S A;  3LH5 A;  2GGR A;  2AZV A;  2DL7 A;  4OMO A;  1AZE A;  2J05 A;  4HVW A;  2OJ2 A;  1GCQ A;  2CSI A;  1ZUU A;  1ZLM A;  2MIO A;  5GJV B;  1MUZ A;  2PNI A;  1Z9Z A;  1GBQ A;  1NLP C;  3NPF A;  2CRE A;  1JXO A;  4RUG A;  1MV0 B;  5I11 A;  2FPD A;  2JTE A;  4EIK A;  1E6G A;  2CT4 A;  2K7A A;  1X2K A;  2YUO A;  2DVJ A;  1I0C A;  2JM9 A;  2PZ1 A;  1X6G A;  1SHG A;  1UJY A;  2ECZ A;  2IIM A;  1AD5 A;  1RLQ C;  1TUC A;  1OOT A;  2D8J A;  2HDA A;  3I5S A;  3NGP A;  1V1C A;  2BZX A;  1E6H A;  1UGV A;  2YUN A;  1U3O A;  1WIE A;  2DL5 A;  1ZX6 A;  2DE0 X;  2OI3 A;  2K9G A;  3U23 A;  2O88 A;  2B86 A;  5IH2 A;  2KE9 A;  2KRS A;  2KXD A;  2GNC A;  2DNU A;  2KRM A;  2CT3 A;  1SRM A;  4RTT A;  1GFC A;  1PNJ A;  3PE0 A;  4Z8A A;  2C0I A;  2JS0 A;  3H41 A;  2ED0 A;  1QWF A;  1M3C A;  2DRK A;  1RI9 A;  2F2V A;  2LX7 A;  2FRW A;  2DL3 A;  1UE9 A;  1Y57 A;  3CQT A;  1K0X A;  1ZUK A;  2A28 A;  2EGC A;  2YUQ A;  4J9G A;  2DRM A;  4AG1 C;  2H8H A;  1GCP A;  3EG2 A;  4RTW A;  1WXT A;  1SRL A;  1HD3 A;  1SSH A;  2EYY A;  3REA B;  2K2M A;  1LCK A;  4LE9 A;  2L3Q A;  5FWB A;  1CKA A;  2KT1 A;  1RLP C;  1B3Q A;  1X6B A;  3QWX X;  3EGU A;  1VYV A;  4F17 A;  1WXU A;  3M0Q A;  1A0N B;  4D8K A;  1YCS B; 
#chains in the Genus database with same CATH topology
 5KCO A;  4M77 B;  2PVD B;  2KEA A;  4RG2 A;  2RNA A;  2LTO A;  1KQS A;  4JZ4 A;  4M75 G;  3DLM A;  1KC8 U;  1EIF A;  2V8J A;  2YSQ A;  1K4U S;  2NYS A;  2K79 A;  1QVF A;  1WA7 A;  4Q5W A;  2RF0 A;  2FB7 A;  1NEG A;  3SEM A;  3G71 Q;  4E47 A;  2OAU A;  4C92 F;  4R55 A;  3V7R A;  1G3Y A;  5GMK e;  2JNG A;  3M4G A;  4HCC A;  4OMM A;  2QA4 A;  2ZPG B;  3UF4 A;  3PGG A;  4IUQ A;  3C12 A;  1ZSZ B;  3CMA A;  2I2L A;  3CCJ Q;  3JB9 I;  3OW2 P;  1M9S A;  1JXM A;  3RDV A;  1D1C A;  5CVI A;  4JRP A;  1QP3 A;  3G4S Q;  2RQU A;  1W4S A;  2RPN A;  2R5M A;  3I55 A;  3CD6 T;  2RI2 A;  2HSE B;  1NM7 A;  4R0K A;  3EGD A;  2BZ8 A;  3OSV A;  2OTL T;  4OMP A;  2DKG A;  4E7H A;  1QVG S;  4PJO C;  3WVE B;  5GAN g;  4M75 F;  1ZSG A;  3OYL A;  4M7D B;  1KFZ A;  3HP9 A;  4E7Z A;  1Q81 R;  3G6E A;  4Z02 A;  5HKC A;  2DIQ A;  3L1A A;  4JLG A;  4Y91 A;  4D8D A;  2DPP B;  1VQ5 A;  1KC8 R;  2EPD A;  1K0S A;  4XU2 A;  1VQP T;  3JCM W;  2HQX A;  2QQ9 A;  2M9U A;  2E6N A;  2JTM A;  5AYF A;  2MWO A;  1IO6 A;  2CYZ B;  1JBM A;  1T0H A;  1JU5 C;  1AWO A;  4ELY C;  1Z9Q A;  2ZPI B;  2FL7 A;  3EG0 A;  2EQJ A;  1I5O B;  2KMT A;  1B7T A;  1U1S A;  3OYD A;  2VXE A;  3CC4 Q;  1IXD A;  3QDR B;  3O8V A;  1RAE B;  3A98 A;  1VOM A;  1SPK A;  4QQD A;  3S3M A;  5DM7 R;  4LDV A;  1VYU A;  2E4H A;  4JJN K;  3ZFJ A;  1D1A A;  5FRN A;  3DB3 A;  1N5Z A;  1XQH A;  2A7Y A;  5LJ5 h;  2O31 A;  2DYB A;  4KUL A;  1KQ1 A;  1Y96 B;  5GJW B;  3BY7 A;  3QZ9 B;  3RIR A;  3OS1 A;  1KIK A;  2C0T A;  4FCY A;  2XMF A;  2EW3 A;  4ZNX A;  4OVA A;  1RI0 A;  1ARK A;  1QWE A;  3RBB B;  1VQN A;  5D6Y A;  3OYI A;  2A3L A;  2RD1 A;  2X4X A;  4C8Q G;  2MWP A;  1VQ9 A;  3PIO A;  2EJ9 A;  1IZ6 A;  3MP6 A;  2ZZD A;  5GMK m;  3TCJ A;  1IRX A;  4C92 B;  2M51 A;  3MEW A;  1X01 A;  1K1Z A;  2EWN A;  2CUD A;  1DJ7 B;  2YRD A;  2V1Q A;  2XID A;  1D09 B;  4D6W A;  1R0C B;  5GAO r;  1BU1 A;  1Q7Y C;  1MND A;  5FWC A;  3E9G A;  2K6D A;  3OBW A;  3A5Z B;  1JO8 A;  4ZGJ B;  5IHK A;  3CD6 Q;  3CCQ A;  1R77 A;  4CC7 A;  3VYG A;  3OYA A;  2M1H A;  4GLM A;  1NPR A;  4BB7 A;  2OTL Q;  4FYV B;  1UGR B;  3JCM Q;  3CCR T;  3CC2 A;  3RKX A;  2RQR A;  1WJQ A;  1ABQ A;  1RAH B;  3OQ5 A;  2P84 A;  3SWN A;  2DVE A;  1PKT A;  3ASK A;  2HEQ A;  2QQA A;  3VJP A;  2R57 A;  4LUE A;  1HK9 A;  2HZY A;  2L0A A;  3ULR B;  2CP3 A;  1PKS A;  2XK0 A;  1N9R A;  2QEX T;  1VQP Q;  3Q1J A;  2EYW A;  4RTX A;  1I1J A;  1Q7Y U;  1VYT A;  3X25 B;  3C94 A;  2DD4 A;  3GBQ A;  1YIT A;  3CCV A;  1BI2 A;  1KD1 U;  5KYW B;  2JM8 A;  2V8I A;  1JJ2 P;  2J06 A;  3RKY A;  2AK5 A;  5CO7 A;  1TU0 B;  4C0F A;  4J6Y A;  1B34 A;  3VS3 A;  2DLP A;  2KR3 A;  4J9C A;  2MOX A;  1QCF A;  1HSQ A;  4CC2 A;  3EFS A;  3BFM A;  7AT1 B;  4M7A B;  2CKK A;  4M77 A;  4BDZ A;  2E1H A;  1TH7 A;  1YI2 T;  1N9S A;  1JJ2 A;  4BD3 A;  3EG3 A;  3JB9 D;  2DXB A;  5CK9 A;  1TWB A;  3MEV A;  2DX1 A;  2DAQ A;  2YDL A;  3EFO B;  5KCH A;  3UWN A;  1YJN A;  2DK3 A;  1WPY A;  1Y7X A;  2AHJ B;  2BIV A;  5KYN A;  4L6V 5;  1I5L A;  2NUZ A;  3RER A;  1G8X A;  4LD6 A;  2EJF A;  1PHT A;  1PD1 A;  4BY6 B;  2O9V A;  4RTV A;  2V1R A;  1RAF B;  3QXE B;  1UB4 A;  3E19 A;  1RAC B;  1OQK A;  2ZPB B;  1Q7Y R;  2DM1 A;  1NJI C;  4M77 D;  2FVU A;  4BE1 A;  3TEE A;  1VQ7 A;  3VYH B;  1AZG B;  4DOW A;  2D0N A;  1NLO C;  1O75 A;  3JCM b;  1E7O A;  1MMD A;  3F70 A;  1VA7 A;  2L3S A;  3H0H A;  3HRT A;  4JRQ A;  2EQM A;  5I2M A;  4ME7 A;  5FLX E;  2VB6 A;  1LOJ A;  5LJ5 j;  3CCR Q;  4M7D A;  1D0Y A;  3M0P A;  1NG2 A;  4K11 A;  3TQ7 P;  3JCM c;  2GFA A;  1VIE A;  1HXD A;  4KUI A;  4Z89 A;  3SWN C;  4XQ3 A;  2KNB B;  2L3P A;  2E41 A;  3IQL A;  4XTW A;  4M78 G;  3N5B B;  2DA9 A;  4XU1 A;  2KAF A;  1NJI U;  2E10 A;  2LNH B;  2QEX Q;  2R5A A;  4F14 A;  2X4Y A;  4PFO A;  1K9A A;  2F69 A;  1VQK T;  4NL3 A;  3MP8 A;  4X9D A;  3CME T;  1VQO T;  2AZV A;  1PSE A;  1AZE A;  1SSF A;  3E2U A;  5GAN 7;  2OJ2 A;  4C8Q B;  2BUD A;  4WTO B;  1M1F A;  2QI2 A;  1ZUU A;  3CPW S;  4RUG A;  1MV0 B;  4FSX A;  2RB6 A;  2DO3 A;  2FPD A;  2QDY B;  4M7D D;  2EIF A;  2DVJ A;  2JM9 A;  1IGQ A;  5IT9 E;  1SHG A;  4M77 C;  5CQX A;  1YI2 Q;  2EFI A;  5CIU A;  2DXC A;  2VAS A;  1Y96 A;  2HDA A;  2QTV A;  1YHQ T;  1KQS S;  1P92 A;  4JUV A;  1V1C A;  3CBP A;  4FYY B;  2CS7 A;  2BZX A;  2YUN A;  4XTY A;  1X6O A;  4EMG A;  3S6W A;  1WIE A;  3A8M B;  3HTR A;  1NZ9 A;  1QVF S;  2EKO A;  5GAO q;  4X34 A;  5GAN d;  2GNC A;  2DNU A;  5A0L A;  2CGH A;  1GFC A;  1PNJ A;  2RI3 A;  4Z8A A;  1WHH A;  1QWF A;  1M3C A;  2F2V A;  3HRS A;  1ZSZ C;  4FIB A;  2BE7 D;  1K0X A;  2A28 A;  2QQR A;  4J9G A;  5CKF A;  3D7S B;  2HQH A;  3EG2 A;  2DIG A;  1W2B P;  2M16 A;  3VUB A;  3VKI A;  2OX7 A;  5DLQ E;  4QQ6 A;  3CCM T;  1UGP B;  1WNL A;  1CKA A;  2DTH A;  1X6B A;  3EGU A;  1VYV A;  3M0Q A;  1A0N B;  5AT1 B;  1W2B A;  4M7D C;  3PMT A;  2MAM A;  1GRI A;  1IGU A;  2ZCF B;  4C92 D;  3JCM g;  3VU3 C;  4KH1 B;  2W0Z A;  1UHF A;  3NMZ C;  1QVP A;  3MJX A;  1ZBJ A;  2KSS A;  2H3E B;  1SHF A;  2JUF A;  1CKB A;  1BBZ A;  4OMQ A;  3CMA T;  4AG2 C;  5IXF A;  4DBQ A;  1OU9 A;  2HSP A;  3CPF A;  1AHJ B;  1VQK Q;  2CZ0 B;  4E7I A;  5GAN e;  2RM4 A;  4AFS C;  5IN1 A;  3CCU A;  3CME Q;  5KYW A;  1VQO Q;  3QHS A;  3VS0 A;  4A4E A;  3VS1 A;  4RTU A;  3I55 T;  2QXF A;  5LJ3 e;  3RMQ A;  2K4Y A;  4M7A A;  1VQ6 A;  1BYM A;  2K3X A;  3FC3 A;  3PTA A;  1I4K 1;  4KGZ B;  1XTD A;  2EBP A;  2VVK A;  1KHC A;  3MEU A;  3C95 A;  4DOV A;  1VQ8 A;  4A4K A;  1YHQ Q;  1ACM B;  4XAX B;  2X4J A;  2V26 A;  1VQ5 T;  2HBP A;  3L2U A;  1NEB A;  1JQQ A;  5A0G A;  3MCA B;  4N4G A;  4HXJ A;  2K5F A;  4OGC A;  1U8R A;  2XIC A;  4HCZ A;  1WXB A;  2ED1 A;  2K3B A;  1BIA A;  4QVD A;  4X9C A;  4M78 B;  3OYN A;  2HL5 C;  2H3J A;  4C92 C;  2RN8 A;  5I21 A;  4FSS A;  4HT8 A;  3ZBD A;  4M7A D;  1ZA2 B;  2CH4 W;  3G7Z A;  2EQU A;  1BB9 A;  1UFF A;  4EMK B;  4QKU A;  4C0Z A;  1X43 A;  2XDB A;  2J6F A;  2LVM A;  5CR2 A;  4AT1 B;  4M7A E;  4GBQ A;  5GAN 5;  1QKW A;  3CCM Q;  5HCK A;  4C5E A;  4VUB A;  2E3I A;  4ESR A;  3H6Z A;  3CC7 A;  3V7S A;  4PFZ A;  3GLX A;  5FW9 A;  2LMJ A;  1VQN T;  4KRT A;  4PJN A;  3A8O B;  1VQ9 T;  1QCO A;  2C0O A;  4J7I A;  2ZPF B;  1GBR A;  4QVZ A;  1KSW A;  3FRN A;  4QVC A;  4RCC A;  1Q81 U;  3CMA Q;  3LGF A;  1BI3 A;  5GAN h;  4PJO E;  1XNI A;  2MPX C;  1CSK A;  3L2Q A;  3CCS T;  1VQ4 A;  2B8A A;  2O01 E;  1MMN A;  4JS5 A;  3FJ5 A;  1WHM A;  1FX7 A;  3I55 Q;  5I2S A;  4HVV A;  3CCQ T;  1WDX A;  3LWH A;  1VQL A;  1T0J A;  4J6X A;  3MEA A;  3HRU A;  1TS9 A;  2FZK B;  2RHX A;  2YUP A;  2ZAE A;  2PVG B;  3HSB A;  4M7A C;  5KE3 A;  5GAM d;  4E7S A;  3MKD A;  4AFQ C;  1Q82 C;  1QCN A;  1QKX A;  1JJ2 S;  4JDS A;  3M9Q A;  3PIP A;  2KT8 A;  2JJ9 A;  1HYO A;  1VQ5 Q;  1I81 A;  3HPW A;  3PFS A;  1IB8 A;  2J7I A;  2NUP B;  2SEM A;  4C8Q D;  3J7A F;  1WHL A;  4ZTJ A;  5L23 A;  5FU7 B;  3OW2 A;  2EQK A;  1YIT T;  4BY6 C;  3PMI A;  2RQW A;  2J6O A;  3OYY A;  2AIR B;  4F7U B;  3OYF A;  4MZP A;  3P8D A;  2KRN A;  2RHY A;  1XOV A;  3J80 E;  4FT2 A;  4JJD A;  5LJ3 g;  2Y4X A;  2COW A;  1U5S A;  4IUR A;  2Y4Y A;  3NFC A;  1S1N A;  2CH4 A;  3EG9 B;  1YCY A;  2VKN A;  2WSE E;  4HVU A;  1YJN T;  4IIM A;  2DL8 A;  4F16 A;  2QGF B;  2LCL A;  3S3O A;  3CCJ A;  2YLC A;  1WI7 A;  2COZ A;  5GAO l;  3SB2 A;  5GAM e;  1Q86 C;  2E12 A;  3QJ6 A;  5GAN f;  4PJO G;  3G4S A;  4E6R A;  2DET A;  4OF1 A;  2EVR A;  1H3Z A;  2MYS A;  1VQN Q;  1VQ9 Q;  4FYX B;  2FO0 A;  2CUB A;  5DLO A;  2J6K A;  1M90 C;  3VV0 A;  4QQG A;  2AKL A;  3OYB A;  2RK1 A;  1QLY A;  2XI9 A;  4J9D A;  3LGL A;  1VQ7 T;  3CCS Q;  4AFZ C;  2RHU A;  4C8Q C;  5CKB A;  1S72 A;  4J9E A;  2I0N A;  5GAO p;  2QAS A;  3UPU A;  3CCQ Q;  1BCO A;  3RR6 A;  2W10 A;  3QUI A;  5GMK h;  1Q82 R;  5GAN 4;  2QK0 A;  3JB9 J;  3JCM X;  4GY5 A;  3ZEH A;  2G3R A;  4KGV B;  2EYX A;  1YP5 A;  5KYX B;  4ORZ A;  2D1X A;  4PJM A;  2LT4 A;  3TU4 K;  1M1K C;  1Y07 A;  4XTV A;  2DER A;  2HBW A;  1LVK A;  4PJO F;  2YT6 A;  1OEB A;  1U06 A;  4DEY A;  2MCN A;  4DA4 A;  2AZS A;  2LZ6 B;  3MHX A;  3P8H A;  3FB9 A;  4M78 A;  4OMF B;  4OMN A;  1YIT Q;  5GAN j;  2A36 A;  4A4H A;  1KK7 A;  3JCM d;  3OYK A;  1I8F A;  2FG0 A;  3PNW C;  4L5G A;  5GAO n;  3EHR A;  3M58 A;  4II1 A;  4EMK A;  3M5A A;  5KYY B;  1WHJ A;  5I22 A;  4M75 B;  3LH5 A;  3SFM A;  3QPH A;  2PQW A;  4UC4 A;  2J05 A;  2QQB A;  1GCQ A;  2CSI A;  2MIO A;  5GJV B;  1MUZ A;  5J3B A;  1JRI A;  1NLP C;  2CRE A;  3KBG A;  2CZ7 B;  4FT4 A;  3OY9 A;  1YJN Q;  1Q86 R;  5GAM h;  2DTO A;  3M53 A;  2PZ1 A;  2M0O A;  1X6G A;  4BAC A;  2ECZ A;  3JCM P;  2IIM A;  1W2B S;  1AD5 A;  4M78 D;  1G5V A;  1M2V B;  2DZC A;  3I5S A;  3L42 A;  1M90 R;  4N4I A;  3SDZ A;  1U3O A;  2OTL A;  2K9G A;  1OX9 A;  3U23 A;  2CP2 A;  1OX8 A;  5IH2 A;  2DZ9 A;  4FU6 A;  1VQ7 Q;  2CT3 A;  1PM3 A;  1N27 A;  1XJW B;  2K5L A;  3JCM e;  3FIF A;  2ED0 A;  2WSC E;  1Y71 A;  4LXC A;  5C0M A;  1O9S A;  2DL3 A;  1D1B A;  3CQT A;  4IUV A;  1ZUK A;  4J7F A;  2YUQ A;  3I56 T;  2D9T A;  4N0A C;  4RTW A;  1SRL A;  5A2Q E;  3CCE A;  1ZSZ A;  1QVG P;  1M1K R;  3REA B;  2R58 A;  1LCK A;  5GAM g;  4DBR A;  4E7K A;  3NTH A;  1G3T A;  2HKN A;  4LE9 A;  1K9M C;  5FWB A;  1BI0 A;  1FMV A;  2P4T A;  1M8V A;  3QWX X;  3FEO A;  2JVV A;  1WXU A;  3A8L B;  3EGX B;  2K3Y A;  8AT1 B;  1SG5 A;  5L8R E;  4M77 E;  1QQJ A;  3CCU T;  2LP5 A;  4M78 C;  4F7U A;  4J9H A;  2EYZ A;  5CKE A;  3MP1 A;  2DBK A;  3JRZ A;  2YWW A;  1ZBX A;  2PTK A;  2X3X D;  2O4X B;  3UAT A;  1MMA A;  2VV5 A;  2KYM A;  1YIJ A;  4EMK C;  3L2W A;  1MV3 A;  5GAM f;  1ZQ1 A;  4J9I A;  1ZUY A;  5D6X A;  3PVQ A;  1LJO A;  3EH2 A;  1BK2 A;  4B9W A;  2O9S A;  1GCQ C;  5C6S A;  5GMK j;  4MDW A;  5HY6 A;  2F5T X;  1PD0 A;  2X9H A;  4JZ3 A;  4LNP A;  1D3B B;  5EC7 A;  2NWM A;  3HFN A;  3UDC A;  1BI1 A;  1FWZ A;  1QW1 A;  2FPE A;  2L89 A;  1WFW A;  2LQK A;  4A54 A;  3TVT A;  1K8A C;  2JXB A;  1M5Q 1;  4PFP A;  1AWX A;  2EJG A;  4ZN1 A;  1F1B B;  3CCL T;  3EAE A;  1OU8 A;  1WX6 A;  5CCA A;  3DLL A;  2CP0 A;  4HCK A;  4RG8 A;  4F7U E;  2F5K A;  1D0X A;  3LYI A;  4M7D E;  5M9O A;  1GL5 A;  1AWJ A;  2FZG B;  1AVZ C;  3JCM h;  2A0F B;  1T3L A;  3LW5 E;  1AOJ A;  4RCB A;  2E6Z A;  2M02 A;  2HCK A;  2LX9 A;  3EH1 A;  3M56 A;  3I56 Q;  1K8A U;  4C92 A;  1M27 C;  2RA2 A;  3KUF A;  1OPL A;  2BTT A;  5GAM j;  5KYX A;  5LJ3 d;  2RQV A;  1W1F A;  4M77 G;  1K9M R;  2DXT A;  2CDT A;  1M8M A;  1H3H A;  3C0C A;  1KJW A;  2FRY A;  1KHI A;  1LPL A;  2YRC A;  1UG1 A;  2XDD A;  3OMG A;  3OSS C;  2DBM A;  4JLI A;  5FU7 C;  1PCX A;  2KK4 A;  2QG9 B;  1VQ4 T;  3V8K A;  1YI2 A;  2E3H A;  1MGQ A;  4BE2 A;  3CCU Q;  3JB9 F;  3OW2 S;  1RL2 A;  2F2X A;  1X69 A;  3QZ5 B;  2RJF A;  1VQM A;  2ZPE B;  1EZZ B;  4AMC A;  5KYY A;  2E64 A;  1VQL T;  4M75 A;  5FRO A;  2RMO A;  4R56 A;  4JJC A;  5J26 A;  2PVO B;  2O2O A;  2QA4 T;  2EGA A;  1BIB A;  1OUL A;  2VUB A;  1YN8 A;  1KG1 A;  2FZC B;  3RUX A;  3BE3 A;  4C92 E;  3NHN A;  4BI8 B;  3O5Z A;  2E5Q A;  2VWF A;  3GF5 A;  3M0U A;  1JEG A;  5FU6 B;  2CP6 A;  1K8A R;  2DTI A;  4M77 F;  3URG A;  1H8K A;  2RHZ A;  1M2V A;  1BCM A;  3M0T A;  1TG0 A;  4IUU A;  4M7D G;  3I9Q A;  4OGE A;  3WVD B;  1M3B A;  2DIL A;  3JCM f;  4A63 B;  3CCL Q;  4M75 D;  1AEY A;  4FW1 A;  4XTX A;  3GP8 A;  1WHG A;  2LJ3 A;  3EFO A;  3VRZ A;  2Y90 A;  3DB4 A;  3G6E T;  3PT9 A;  2FEI A;  1M4Z A;  4PJJ A;  1YNZ A;  5LL6 S;  3OYM A;  1QMC A;  3JB9 H;  4OP0 A;  1MHN A;  2DFU A;  2QYZ A;  4XTZ A;  3I5R A;  3MPU B;  4M75 E;  3BDU A;  4FL6 A;  3VS6 A;  4JJB A;  3FDR A;  4PKC C;  2L5Q A;  2ROL A;  4X1V A;  1K73 C;  2LJ0 A;  5IHI A;  1VQK A;  1VIF A;  1N8R C;  3CME A;  2PUK B;  1SEM A;  1OI1 A;  1ABO A;  4XU0 A;  2DMO A;  6AT1 B;  2DD5 A;  2DL4 A;  4LD9 K;  2RJC A;  2YHT A;  5CAI A;  1RUW A;  1H92 A;  1B07 A;  1Y0M A;  1NYF A;  5HK3 A;  4C5G A;  4ZTF A;  2FPF A;  1PRL C;  2G6F X;  1AT1 B;  3EGX A;  4M7D F;  2X35 A;  2JW4 A;  3M4Y A;  1OPK A;  2CSQ A;  1R0B G;  1OZ3 A;  2ABL A;  4JPB W;  3ER0 A;  1VQ4 Q;  4CC3 A;  1S72 T;  4RMO A;  1X75 C;  3OS5 A;  1IHV A;  4B6M A;  1IHW A;  1OV3 A;  5IXB A;  2E70 A;  2WAC A;  5DY9 A;  2O4X A;  3L2Z A;  1YJ9 A;  1RAG B;  1K73 U;  3TRE A;  3H8Z A;  4NOY A;  4M75 C;  4J83 A;  2FHD A;  4YTL A;  4QT7 A;  2CZ1 B;  2KDS A;  3QII A;  2LCS A;  4J9F A;  4ANJ A;  4OB0 B;  4XK8 E;  3R6N A;  2QA4 Q;  1UEB A;  4E2F B;  3OYG A;  3REB B;  1D3B A;  1YFN A;  3H0F A;  2ESW A;  2RK2 A;  1KQS P;  1D0Z A;  4C8Q A;  2RI5 A;  9ATC B;  1EFN A;  2IG0 A;  5GAN 3;  4LDU A;  3LWI A;  3QWY A;  3FJP A;  5LJ3 h;  5GAN 6;  1QVF P;  2NUT B;  5GAN 2;  2LNV A;  3QYH B;  2QGG A;  3KXT A;  3KFV A;  3CC2 T;  4MDX A;  5FRM A;  3CCM A;  1WLP B;  2LQN A;  5LJ5 e;  1PSF A;  1UEC A;  4V2S A;  4IIO A;  1YJW A;  4PLI A;  3OYJ A;  1C0M A;  5GMK l;  3L2V A;  3H0I A;  1AWW A;  2FYK A;  2XDP A;  3MET A;  3G6E Q;  2JS2 A;  2OTJ A;  1N6A A;  3AT1 B;  3CEY A;  3HKS A;  1UDL A;  1H64 1;  4J5Y A;  3VRY A;  5KYU B;  2CP5 A;  1RAI B;  1K73 R;  4FYW B;  1N8R R;  3CCV T;  2JTF A;  4OMO A;  4M7A G;  4N4H A;  4C8Q E;  2EAY A;  1Z9Z A;  1GBQ A;  2DYI A;  2CZ6 B;  3QBY A;  1JXO A;  4A4F A;  3SD4 A;  1Q82 U;  2JN0 A;  1E6G A;  2CT4 A;  2K7A A;  1X2K A;  3G71 A;  1IRE B;  1JB0 E;  1WGS A;  1UJY A;  2HNI A;  3QJY A;  1TUC A;  1OOT A;  2D8J A;  3JAM E;  1UGS B;  2MF2 A;  3NGP A;  1S72 Q;  1E6H A;  1UGV A;  1PG5 B;  2D0Q B;  3M59 A;  2DL5 A;  2Z0W A;  1ZX6 A;  3GIB A;  2OI3 A;  3C4S A;  3INZ A;  2O88 A;  3EFR A;  2B86 A;  2DEQ A;  2XD0 A;  4J6W A;  3QKJ A;  2KE9 A;  2KRS A;  2KXD A;  2KI7 A;  4O6J A;  3A8H B;  4RTT A;  3OS0 A;  3CCE T;  3WXM B;  3PE0 A;  5LJ3 f;  2YRV A;  2JS0 A;  4FM4 B;  1RI9 A;  2FRW A;  1NPP A;  2K5I A;  4M7A F;  5CKD A;  2EGC A;  4AG1 C;  4FW2 A;  3M54 A;  4PJL A;  3OA6 A;  1WQW A;  3HHT B;  1RAD B;  4IUP A;  4MZT A;  3NTK A;  3CXC P;  4MZM A;  2EYY A;  1Q86 U;  3V7C A;  2HL3 A;  2LC4 A;  4N0A A;  3VUZ A;  4IKF A;  3CC2 Q;  4OB3 B;  2KT1 A;  1B3Q A;  2K2V A;  5CQY A;  4ZGE B;  4F17 A;  3QG1 A;  1WHK A;  2QAZ A;  4D8K A;  1YIJ T;  3CXC A;  1G2B A;  2L2P A;  3CC4 A;  3FLG A;  4PL6 A;  1M90 U;  4C0D B;  1SF9 A;  2P0P A;  2C06 A;  4HT9 A;  5EG2 A;  1FMK A;  4OB2 B;  2EQI A;  2VYT A;  2KYB A;  2NLU A;  3CCV Q;  1PRM C;  4CC4 B;  2P4R A;  1X2Q A;  3TSZ A;  3CCS A;  2BE9 B;  1WJR A;  5D6W A;  5A0D A;  1TUD A;  3EHQ A;  2KRO A;  5IHN A;  1W6X A;  4ELZ C;  3QDF A;  5LJ3 j;  1C1A A;  1W70 A;  3A1P A;  3JCM J;  1KD1 C;  2VXF A;  2XKO C;  4HA8 A;  4B9X A;  1M1K U;  1V76 A;  2D6F A;  2RJE A;  3UA6 A;  2ROT A;  1G83 A;  2RJD A;  1ZA1 B;  5LJ5 g;  2LT1 A;  3M0S A;  1GFD A;  3R6O A;  4Y92 A;  2GQV A;  2A37 A;  2ATC B;  1WZO A;  3A8G B;  3VS7 A;  3I35 A;  1UGQ B;  4MML A;  2IPO B;  4MMK A;  4DBH A;  3VS2 A;  4C8Q F;  3CD6 A;  2KGT A;  1M3A A;  1FYN A;  1UTI A;  5GAO m;  2RO0 A;  3CCE Q;  2GTO A;  2LQW A;  2SRC A;  3UA7 A;  2WSF E;  4M78 E;  2YLB A;  5FU6 C;  5LJ5 f;  3J81 E;  3PVL A;  5KH6 A;  1TXQ A;  1ZHI A;  4ZGD B;  2NUT A;  2BZY A;  2PU9 B;  2JT4 A;  1VQP A;  2HQE A;  1K76 A;  3CBM A;  2HD0 A;  3LLR A;  4OML A;  1HJD A;  3OYC A;  1VQM T;  1NE8 A;  1EX4 A;  2HKQ B;  3JSC A;  2VC8 A;  1PC0 A;  2P0Q A;  3E1S A;  4LN2 A;  1YIJ Q;  3CBO A;  3TSW A;  2NUP A;  1YWO A;  1X27 A;  2KQW A;  5KYU A;  2CP7 A;  2GF7 A;  2HMA A;  4NL2 A;  2QDL A;  1QVG A;  2DEU A;  1YWP A;  4PJO B;  3JV3 A;  4BE0 A;  4EMH A;  2XU8 A;  3GOX A;  2XHC A;  3OMC A;  4Y28 E;  4JRK A;  4EDU A;  2QTX A;  1GXI E;  1KD1 R;  4OB1 B;  4LDW A;  4RKU E;  4GLK A;  1VQ6 T;  3VS5 A;  2E5K A;  1KQ2 A;  2LQ8 A;  2OAW A;  4M4Z A;  3X20 B;  3EG9 A;  2YXY A;  1K9M U;  2JMC A;  1VUB A;  1VQ8 T;  3SHW A;  4C5I A;  3GNG A;  3GPL A;  2X3W D;  2D8H A;  4DQ2 A;  4XU3 A;  1M1G A;  4CRI A;  2AKK A;  2L3R A;  3OB9 A;  2EYQ A;  3NTI A;  3ME9 A;  3JCM V;  4EPC A;  3THK A;  1M2O A;  1M30 A;  2K57 A;  4BI4 A;  4A53 A;  3E9F A;  4PLL A;  3RES A;  3X26 B;  3JB9 G;  1R8O B;  1TSF A;  2EGE A;  3CCR A;  3RMS A;  1RAA B;  3QSU A;  2MMP A;  4KUD K;  2JMA A;  2ENM A;  1WJS A;  3UT1 A;  4J8O A;  4WCI A;  2GTJ A;  1UHC A;  2L8D A;  3OBY A;  5IAY A;  1C6V X;  2QEX A;  3VS4 A;  2LJ1 A;  8ATC B;  1V29 B;  3AHU A;  4XTU A;  3CC7 T;  2DJQ A;  1VQM Q;  1YJ9 T;  3T9N A;  2GQI A;  2JZ2 A;  2KY9 A;  5KE2 A;  2HAX A;  1I07 A;  4M78 F;  1LNX A;  1UUE A;  2F2W A;  3QO3 A;  5ECA A;  2KXC A;  1YBY A;  2X51 A;  4AFU C;  1PWT A;  3EGD B;  2GBQ A;  4JS4 A;  3G1J A;  2PUO B;  1NJI R;  3EG1 A;  3RKW A;  2ZGW A;  1OZ2 A;  2V8K A;  3RNJ A;  1UJ0 A;  1MNE A;  3V8L A;  2XG8 D;  4HCB A;  2AT1 B;  1OYX A;  1J3T A;  3LX7 A;  2EKH A;  4J9B A;  1VQ6 Q;  1NYG A;  4Z88 A;  1SKU B;  1YJW T;  3I56 A;  4LDY A;  4E7L A;  4RTY A;  2MI6 A;  4LUD A;  1VQ8 Q;  2OTJ T;  4A4G A;  5J39 A;  4RTZ A;  4KH0 B;  3ZL7 C;  2DF6 A;  2M0Y A;  4KGX B;  4JRI A;  1WYX A;  4F7U G;  1NBE B;  4WF2 A;  1G3W A;  4KBM B;  1FMW A;  1U1T A;  4HKE A;  1TUG B;  4NS5 A;  2KBT A;  3M0R A;  3S3N A;  2RQT A;  3OYE A;  1WQ7 A;  2A08 A;  2BKD N;  3DKM A;  2QQS A;  4P5N A;  4PK4 A;  2RH2 A;  1Q95 G;  4ATO A;  3V8J A;  2ZPH B;  4CI0 C;  1QP2 A;  1G3S A;  2GFU A;  3G71 T;  4DEX A;  1T3S A;  2GGR A;  4F04 B;  2DL7 A;  3GNF B;  4QW2 A;  4HVW A;  3M57 A;  3HL8 A;  4PNO A;  1MMG A;  2X4W A;  1RAB B;  3QYG B;  1ZLM A;  2PNI A;  3P8B B;  4TVR A;  2P0K A;  3NPF A;  5I11 A;  3CCJ T;  2JTE A;  4EIK A;  3CC7 Q;  2COY A;  2MK5 A;  4L59 A;  2YUO A;  4IUT A;  4DBF A;  1VQO A;  1YJ9 Q;  1I0C A;  1BKB A;  4C0G A;  3G4S T;  5GMK i;  2VGN A;  3OS2 A;  1RLQ C;  3HFO A;  3CXC S;  3BDL A;  3BW1 A;  5GAN 8;  4F7U F;  4C0D C;  1TTH B;  3LH0 A;  5LJ5 d;  2VGM A;  3OYH A;  4PJO A;  2DE0 X;  1TOV A;  2LDM A;  3CCL A;  4C5H A;  2DXU A;  4O5V A;  2LCC A;  3X24 B;  1FXX A;  3SWN B;  3H9N A;  2KRM A;  1SRM A;  1YHQ A;  1Q81 C;  2F1L A;  2C0I A;  3X28 B;  3H41 A;  4C92 G;  2JOY A;  2GCX A;  2DRK A;  3CPW P;  3M55 A;  2LX7 A;  1VQL Q;  1KC8 C;  4ZN3 A;  1N8R U;  3MO8 A;  1UE9 A;  1Y57 A;  3L2R A;  2DRM A;  2H8H A;  1GCP A;  5D7U A;  2DJZ A;  2LRQ A;  2E65 A;  1WXT A;  1YJW Q;  1HD3 A;  1SSH A;  4BUG A;  4E7J A;  5CKH A;  3CC4 T;  4BDY A;  2K2M A;  3CPW A;  2OTJ Q;  2L3Q A;  4BI3 A;  4PJO D;  1B34 B;  2IVW A;  1RLP C;  2KVQ G;  2RHI A;  5HK0 A;  4LDX A;  4KT0 E;  1YCS B; 
#chains in the Genus database with same CATH homology
 1G2B A;  2L2P A;  1GRI A;  2KEA A;  2RNA A;  4JZ4 A;  2LP5 A;  2W0Z A;  1UHF A;  4J9H A;  2EYZ A;  3NMZ C;  2DBK A;  2YSQ A;  1K4U S;  1ZBJ A;  2K79 A;  1WA7 A;  1SHF A;  2PTK A;  1CKB A;  1FMK A;  1BBZ A;  2X3X D;  4OMQ A;  3UAT A;  4AG2 C;  5IXF A;  2KYM A;  2RF0 A;  2HSP A;  1MV3 A;  1NEG A;  2EQI A;  3SEM A;  2KYB A;  4AFS C;  1PRM C;  4J9I A;  1ZUY A;  4CC4 B;  3VS0 A;  2P4R A;  3PVQ A;  1BK2 A;  1X2Q A;  3TSZ A;  3VS1 A;  2O9S A;  1GCQ C;  4RTU A;  1TUD A;  4OMM A;  3EHQ A;  2KRO A;  5IHN A;  3UF4 A;  1W6X A;  4JZ3 A;  4LNP A;  1W70 A;  5EC7 A;  2NWM A;  1JXM A;  2FPE A;  1WFW A;  2EBP A;  3UA6 A;  2VVK A;  2ROT A;  2RQU A;  3TVT A;  1G83 A;  2RPN A;  2JXB A;  1AWX A;  3M0S A;  1GFD A;  1NM7 A;  4R0K A;  4Y92 A;  2BZ8 A;  2A37 A;  4OMP A;  3VS7 A;  3I35 A;  1NEB A;  1JQQ A;  1WX6 A;  4HCK A;  4HXJ A;  1ZSG A;  1KFZ A;  1WXB A;  2ED1 A;  3VS2 A;  2K3B A;  1GL5 A;  2KGT A;  1M3A A;  1FYN A;  1AWJ A;  1UTI A;  1AVZ C;  4D8D A;  1T3L A;  2GTO A;  2LQW A;  1AOJ A;  2SRC A;  3UA7 A;  2EPD A;  2RN8 A;  1K0S A;  2HCK A;  4FSS A;  2CH4 W;  1IO6 A;  1BB9 A;  1UFF A;  1T0H A;  1JU5 C;  3PVL A;  1M27 C;  1AWO A;  1Z9Q A;  1X43 A;  2BZY A;  3EG0 A;  2J6F A;  1OPL A;  2BTT A;  2JT4 A;  2RQV A;  1W1F A;  2CDT A;  1K76 A;  4GBQ A;  1M8M A;  1QKW A;  1H3H A;  5HCK A;  3A98 A;  3C0C A;  1SPK A;  4OML A;  1HJD A;  1KJW A;  4ESR A;  2FRY A;  1VYU A;  1UG1 A;  2DBM A;  4LN2 A;  5FW9 A;  1N5Z A;  2LMJ A;  4KRT A;  2O31 A;  3TSW A;  2F2X A;  1X69 A;  2C0O A;  1YWO A;  2DYB A;  5GJW B;  1KIK A;  1X27 A;  2C0T A;  1GBR A;  2XMF A;  2QDL A;  1KSW A;  1YWP A;  2EW3 A;  3JV3 A;  4ZNX A;  2RMO A;  1ARK A;  1QWE A;  1CSK A;  4JJC A;  3RBB B;  2O2O A;  2EGA A;  1YN8 A;  3FJ5 A;  2M51 A;  1K1Z A;  2CUD A;  3NHN A;  4HVV A;  3VS5 A;  2E5K A;  3O5Z A;  1WDX A;  2V1Q A;  1T0J A;  2OAW A;  2VWF A;  3M0U A;  2YUP A;  1JEG A;  4M4Z A;  1BU1 A;  1H8K A;  5FWC A;  2K6D A;  4AFQ C;  2JMC A;  3M0T A;  1TG0 A;  3SHW A;  1JO8 A;  1QKX A;  3I9Q A;  2X3W D;  5IHK A;  2D8H A;  1M3B A;  2DIL A;  2KT8 A;  4CC7 A;  4A63 B;  4GLM A;  2AKK A;  1AEY A;  2J7I A;  2RQR A;  2SEM A;  2LJ3 A;  1ABQ A;  3THK A;  3VRZ A;  2FEI A;  1PKT A;  2HEQ A;  1YNZ A;  5L23 A;  1M30 A;  4LUE A;  3I5R A;  2L0A A;  2RQW A;  2J6O A;  3ULR B;  1PKS A;  2EGE A;  3VS6 A;  4JJB A;  2EYW A;  4RTX A;  1I1J A;  2JMA A;  1VYT A;  2ENM A;  2KRN A;  1XOV A;  2ROL A;  4X1V A;  2LJ0 A;  5IHI A;  4JJD A;  3GBQ A;  4WCI A;  1SEM A;  1U5S A;  2GTJ A;  2JM8 A;  1UHC A;  1ABO A;  2DMO A;  2J06 A;  2AK5 A;  2DL4 A;  1S1N A;  2CH4 A;  3VS4 A;  2LJ1 A;  3VS3 A;  2VKN A;  1RUW A;  2DLP A;  4HVU A;  1B07 A;  1Y0M A;  1H92 A;  2KR3 A;  1NYF A;  4J9C A;  4IIM A;  2DL8 A;  2MOX A;  4F16 A;  2DJQ A;  2FPF A;  1QCF A;  1HSQ A;  1WI7 A;  4CC2 A;  1PRL C;  2G6F X;  2GQI A;  2JW4 A;  1OPK A;  2CSQ A;  3EG3 A;  4E6R A;  2ABL A;  2EVR A;  1I07 A;  4JPB W;  1UUE A;  2F2W A;  4CC3 A;  2DX1 A;  2YDL A;  5ECA A;  2KXC A;  2FO0 A;  1OV3 A;  2CUB A;  5IXB A;  4AFU C;  2J6K A;  1PWT A;  2GBQ A;  2AKL A;  1QLY A;  4J9D A;  3EG1 A;  2NUZ A;  3RNJ A;  1UJ0 A;  4QT7 A;  4AFZ C;  2LCS A;  4J9F A;  1PHT A;  4J9E A;  3R6N A;  2I0N A;  2O9V A;  1J3T A;  4RTV A;  3REB B;  3H0F A;  2EKH A;  2ESW A;  2V1R A;  4J9B A;  2DM1 A;  1NYG A;  2W10 A;  4Z88 A;  1EFN A;  1AZG B;  3QWY A;  4RTY A;  2D0N A;  4LUD A;  1NLO C;  2EYX A;  1YP5 A;  1E7O A;  4ORZ A;  2D1X A;  4RTZ A;  3ZL7 C;  1VA7 A;  2DF6 A;  2M0Y A;  2L3S A;  3H0H A;  3KFV A;  2HBW A;  1WLP B;  1WYX A;  2LQN A;  2YT6 A;  1OEB A;  1UEC A;  1U06 A;  4IIO A;  4DEY A;  3M0P A;  1NG2 A;  3H0I A;  4K11 A;  2MCN A;  1AWW A;  2AZS A;  2LZ6 B;  2KBT A;  4Z89 A;  3M0R A;  2RQT A;  2JS2 A;  2KNB B;  2L3P A;  2A08 A;  3IQL A;  4OMN A;  2DA9 A;  1UDL A;  2A36 A;  3VRY A;  2FG0 A;  2LNH B;  4F14 A;  3EHR A;  1K9A A;  5I22 A;  4DEX A;  1T3S A;  3LH5 A;  2GGR A;  2AZV A;  2DL7 A;  4OMO A;  1AZE A;  2J05 A;  4HVW A;  2OJ2 A;  1GCQ A;  2CSI A;  1ZUU A;  1ZLM A;  2MIO A;  5GJV B;  1MUZ A;  2PNI A;  1Z9Z A;  1GBQ A;  1NLP C;  3NPF A;  2CRE A;  1JXO A;  4RUG A;  1MV0 B;  5I11 A;  2FPD A;  2JTE A;  4EIK A;  1E6G A;  2CT4 A;  2K7A A;  1X2K A;  2YUO A;  2DVJ A;  1I0C A;  2JM9 A;  2PZ1 A;  1X6G A;  1SHG A;  1UJY A;  2ECZ A;  2IIM A;  1AD5 A;  1RLQ C;  1TUC A;  1OOT A;  2D8J A;  2HDA A;  3I5S A;  3NGP A;  1V1C A;  2BZX A;  1E6H A;  1UGV A;  2YUN A;  1U3O A;  1WIE A;  2DL5 A;  1ZX6 A;  2DE0 X;  2OI3 A;  2K9G A;  3U23 A;  2O88 A;  2B86 A;  5IH2 A;  2KE9 A;  2KRS A;  2KXD A;  2GNC A;  2DNU A;  2KRM A;  2CT3 A;  1SRM A;  4RTT A;  1GFC A;  1PNJ A;  3PE0 A;  4Z8A A;  2C0I A;  2JS0 A;  3H41 A;  2ED0 A;  1QWF A;  1M3C A;  2DRK A;  1RI9 A;  2F2V A;  2LX7 A;  2FRW A;  2DL3 A;  1UE9 A;  1Y57 A;  3CQT A;  1K0X A;  1ZUK A;  2A28 A;  2EGC A;  2YUQ A;  4J9G A;  2DRM A;  4AG1 C;  2H8H A;  1GCP A;  3EG2 A;  4RTW A;  1WXT A;  1SRL A;  1HD3 A;  1SSH A;  2EYY A;  3REA B;  2K2M A;  1LCK A;  4LE9 A;  2L3Q A;  5FWB A;  1CKA A;  2KT1 A;  1RLP C;  1B3Q A;  1X6B A;  3QWX X;  3EGU A;  1VYV A;  4F17 A;  1WXU A;  3M0Q A;  1A0N B;  4D8K A;  1YCS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...