4CC4C

Complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
263
Chain Sequence
b'SESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSALSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKVNEPVKYQPELYITNTVKDPDGRWISPAAISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INLC PROTEIN
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Cell invasion
total genus 82
structure length 263
sequence length 265
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08191 LRR_adjacent LRR adjacent
C PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4cc4C02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4cc4C01
1XEUA 4LI1A 4LXRA 4QC0A 3G3BA 4OQTA 2OMXA 4P91A 1DCEA 4CNMA 4B8CD 4Z64C 4CNCA 3ULAA 3FAXA 1OTOA 3W3LA 3E3ZA 4ARRA 4XOSA 1XKUA 1H6UA 1PGVA 3WPBA 2P1MB 2OMZA 4NKHA 4Q3GA 3RGXA 1OT4A 2RA1A 1W8AA 3ZYOA 4FMZA 3KJ4A 4CC4C 2BNHA 3GOZA 4J0MA 3C6OB 3ULUA 4FS7A 5GQRK 1SQ0B 4IM6A 1O6VA 1LYQA 4UFRA 1XWDC 3OJAA 5B4PA 4FCGA 4KNGA 1QYYA 2JE1A 4BV4R 1DFJI 4PERA 5FTTB 1FS2A 1U0ND 4U09A 3FAWA 4LSXA 2OMYA 4BSSA 3W3NA 4R5CA 2R9UA 2V9TB 4R6AA 3C6NB 2WQVA 4NKGA 5ICUA 2C9QA 5IJDA 1KOOA 5HDHA 2RA8A 3RW6A 2Z7XA 4BSRA 4CP6A 4FDWA 3WPGA 4L3FA 3SB4A 3WN4A 4BSUA 4R6FA 4U7LA 2WQWA 3UL9A 3RJ0A 1OTNA 5GMGA 5HZLB 5AWCA 2P1QB 5A5CA 3E6JA 4YEBB 2P1PB 4LSCA 3CIGA 4AQ1A 4MN8B 3RFEA 1Z7XW 2OMTA 3PMHG 5IYXC 2BEXA 3FXIA 5AWAA 3ZYNA 4C2AB 3E2JA 2Q4GW 3O6NA 3UN9A 4RCWA 1A4YA 5B0NA 1M9SA 3RFSA 2CA6A 1M42A 5IJCA 4U06A 2ELLA 1OOKG 2ASTB 3RW7A 4R6GA 4R09A 4C2BB 5AZ5A 1FQVA 4K17A 3OGKB 2Z64A 2WFHA 2OMVA 3WPIA 4AY9X 1M0ZA 3ZYIA 3BZ5A 3VQ1A 4LSAA 2OMUA 2O6QA 3G04C 3CVRA 3M19A 3UL8A 1LTXA 4WYKA 4XGOA 2C9RA 1KOHA 1OGQA 3VQ2A 3G3AA 2P1NB 2Y5QA 4TZHA 4Q62A 1IX2A 4ECOA 5LFNA 3OJAB 3WPHA 4V2CA 1O6SA 4ARNA 3O53A 3E4GA 5GMFA 4M7EA 1P8TA 1FO1A 1D0BA 3G39A 3TSRE 4Z8GA 2Z63A 4Y61B 4G8AA 3JB9j 4R07A 3WPCA 5IJBA 5GMHA 3CIYA 1K5GC 4Z79A 4LSXC 3W3JA 4RWTC 3G06A 3BCFA 2Z7XB 4KT1A 3W3KA 1WWLA 3DZEA 3REZA 4PSJA 1XCDA 4FD0A 4R08A 4I6JB 2IFGA 4P8SA 2JQDA 4ECNA 2WQXA 4PKIG 3WPEA 4XSQA 2YA1A 5CMNA 4Z61C 4CC4A 1P9AG 4V2EA 1OZNA 4V2DA 4MQWX 2WQUA 4PEQB 1XECA 2Z66A 4J4LA 4CILA 4GT6A 2ASSB 3W3GA 3WPDA 4R5DA 1A9NA 5CMPA 4AW4A 1ZIWA 3RGZA 1P8VA 2Z62A 1GWBA 2XWTC 4R58A 1K5DC 1JL5A 1M10B 5GS0A 4QBZA 4LXSA 3OGLB 3RIZA 2Z82A 2V70A 4KXFB 2P1OB 3WPFA 1FT8A 4R0AA 1YRGA 1NM4A 3RFJA 5AWBA 4EZGA 3P72A 2XOTA 3C6PB 5AWDA 4LI2A 5B0TA 1H6TA 3BCDA 4GLPA 2OMWA 4U08A 4R6JA 4L3AA 3W3MA 1O6TA 2ID5A 4Z94G 2Z81A 4HQ1A 4H09A 1OTMA 2JE0A 5D3IA 4WP6A 4QXEA 1IO0A 2Z65A 3OGMB 3BC9A 3UL7A 4RCAB 2O6RA 2UZXA 2UZYA 1M9LA 2O6SA 4PQ8A 3M18A 1DS9A 4FHOA 2V9SA 2RR6A 2A0ZA 4Q3IA 3A79B 5GS2B 1G9UA 2FT3A 4M7EC 3ZYJA 3ULVA 2C9PA
chains in the Genus database with same CATH superfamily
4YDNA 3ALPA 4KUCD 4JZJA 3NMEA 1M7XA 1N6UA 3RZCA 1MJUH 1OP9A 2HKHH 2VW7A 2WY3B 1JNJA 2IOIA 4LLVB 4E5XB 1Q90A 4P5SA 2XWJA 1JXJA 2DZEA 4BA8A 3VYPA 1F58L 5D93B 3P30L 3TNMA 5HBBA 2PKDA 4CNMA 2HT3D 2ZNWA 4M1DL 3SJVB 2CMRL 1AE6H 1I31A 2E7MA 4CNCA 3HZKB 1BBJA 3ULAA 5ICXA 3OAUH 4J23A 4WJG3 1XGUB 2B2XL 1YY9C 1WZKA 4JJHA 4NM8H 5FYLL 2QR0A 3WG7B 3ZT5A 4BWTA 3GPEA 1M6OA 2LOEA 1FL5B 5TE7L 4WHYH 2VW4A 5AZ2L 4JHUA 3IBEA 3Q1SL 2IO5A 2R1YA 3OJ2C 2E8ZA 4HX1A 1R3JB 5B1CA 3F12B 1YEGH 3O3UN 2G2RA 4YVUA 4PMEA 4RZCA 2DI7A 3KVDD 5E9DA 3VX1A 1XF5B 4XMPL 4WEUD 4XPGL 5I8EA 2F54B 3HBQA 3KAAA 3TEWA 2WOYA 4NC0B 3GS0A 1JNNH 4EQ3A 5JIKA 1HXYB 5FYJU 4CC4C 3TBCA 1I8IA 1SYSB 1B4LA 1C7SA 2IALA 4XT1C 3SBQA 4UAOB 5DEFB 3FOMA 2N01B 1BJMA 3BFQG 1OE3A 4F8NA 1B2WL 1CL7H 3FSVA 1YQ2A 1M71A 5IT2H 3QZOA 4I77L 1FVCB 1QYYA 3B7SA 1MEXH 3EJJX 2NY1B 4EUPG 1NINA 4RZCB 4N2KA 3VD2A 3VGBA 3VTMA 3KPTA 2Q2LA 3GS7A 5I8EB 4DTGH 2J5LB 2ZUWA 2YGOA 2ZUSA 4WWKD 3MI6A 4UT9A 3RWEA 1GIGL 4RGOH 4YE4H 2A6IB 5CKAA 4AUJA 5DQJB 4L29B 4DGWC 3H7BA 3S4SA 1S7VA 4JGUA 4LCCB 1GSKA 3LZRA 4YSDA 4WCYL 1TQWA 1AANA 4JFVA 5EZLB 1RZJC 4PJCF 4W1TA 5G4MA 4BFRA 1ZHKB 4GAYB 2GTQA 4R6AA 2EXWC 1M71B 2HZHA 3CDFA 4NSKA 3DGDA 4PSPA 1IKFH 4M62L 3GO1H 3T5WA 2JKSA 3FONA 4Z7OE 4RAUB 3MZGB 3ULUE 4RFNB 2X4RA 2OQJB 1MOEA 3FB5B 5KZCD 3N44F 1G6RB 5KW9H 3EUDA 2HKAA 3TYGH 4P3CL 3TV3L 3ATAA 4IOSA 3EFDH 4QLWA 3VD4A 4LSPL 2ADYA 4Y0GA 4NB7A 2ZUQB 5FO9B 3SQBA 2P8MB 1CFTB 2UWEF 3S4SB 2ODIA 5ABAA 3DYMA 3RDTC 2NY0D 4AWJC 4R7DA 2B59B 1Q72L 4Y19B 2W0FB 4J8RB 4ODUB 4U6XB 5TTRA 2JCCF 2ADGA 4R4BA 5IMMA 1J0HA 2JH2A 1JGUH 4X5WB 1C16B 2DQUL 3CZFB 4IIQA 1LK3H 2NTSP 4K9JA 1U3HD 5HJ3B 2HLEB 1ZGLM 3H0TA 5A5CA 1ETJA 4YEBB 1P7QD 4B5ZA 2LR4A 3B2MA 3GQFA 2ZAGA 2YWYA 4GO8A 3ARZA 4P4KC 1P4LA 2DJMA 3D7PA 3CIGA 5JHLH 2XQBH 1TVDA 3N1PC 3O2DL 3CFEA 3VD0A 4S1SL 4BH8A 3RFEA 4TMPA 5IBLC 3F85A 3CVIL 4Y9CA 5ADPH 1CFMA 1CGYA 1B0GA 4R7DB 4Q97A 2FQGA 5I1DA 1UZ8A 1I7RA 2D0GA 2ADGB 5DK0B 3E2JA 3KGSA 3O6NA 1QLEH 5BOZG 3GINA 3EH1A 3D5OF 4I48B 4OD3L 4P23C 4NNXB 4HV8B 5KSVB 1AHWB 1DDHA 2H0EA 2Q10A 4BINA 1A4YA 1X7TA 2EDYA 2LU5A 1E27A 2VLLB 1S6NA 4MD0B 3ARDB 1FAIH 1WT5A 1BIIA 2Z0UA 4NQCD 2WB1A 3CFEB 1UQSB 4GBXD 3LOWA 4XN1A 1VENA 3VWJB 3LN5B 4FFYH 5FW6A 4BH8B 5BZDA 5FCSH 5LBSA 1I9RH 2SODB 4YBLC 3OV6A 3S98A 5EB9A 5EO1B 2IH3A 2XKNB 5I1DB 5IJVA 4AC4A 1NMCC 1FQVA 2F08A 4CSTA 4HIPA 2ATPA 4M00A 2WVTA 5KSAD 3FOLB 1KENL 3MLYL 4XP1L 5IQ7L 2K3TA 2K9FB 4W9IC 1DDHB 3VA6A 4JFTA 3FRPA 4FQXC 3VFOA 5TQ0L 5ACZB 4YLCA 4ZOEA 2Z7WA 1E27B 3BZ5A 4N3TA 4ES8A 3X11A 3WJLC 3HRZB 2BP0B 4Z5RB 4N28A 1BIIB 1OAJA 2EILB 3HAEB 4JFUA 2KH2B 3IXTB 2PWGA 3U2SB 1H15A 4K8RH 4LSTH 1BAFH 1AYRA 2NSQA 1MCHA 2WW8A 4DEUA 4MHHG 1JYWA 3M88A 5F1NA 4KC3B 1H3VA 1H5BC 3LNDA 3LX9A 4O2FB 1G94A 1PNCA 1K8IB 1AR1D 2DLFL 4NIKB 1WTGT 3SD2A 4PRDA 1JERA 1G0XA 3QHZH 4JFOA 4WW2C 3G3AA 1TVHA 4TYUA 2R2CA 2J2ZB 4WFGE 4HA1A 4BQ8A 4FCAA 5A3ID 4NKDB 4AGOA 3TO4C 1AO7D 2PCPA 2IANB 3IMWA 5K9OB 2R2BB 2BFGA 4OGZA 5EULV 4ERSH 1UFGA 3H56A 1RURL 1J1XL 3FB8A 4HSQA 2BJMH 4FI6A 5CUSL 3T8MA 5IK3B 4MWFB 1EUUA 1ZTMA 3PL6A 1R75A 1AGBA 3EJCA 1UJTA 4JFDA 1NCWL 4V2CA 5GS1B 4BRJA 3K6SB 4ORGB 3RI5F 1T4WA 2BVTA 5EZIL 5HYIA 5J11C 4CC1A 1MJ7L 2LU4A 3HG3A 4ICWA 3VWKD 1JZIA 5EA0H 1ZLWK 5CKGA 4NC2B 4BFIA 1V55B 3JUZA 3MDJA 3QUZD 4J1UA 4FQHB 3AG2B 1SEQH 3CVCA 3WFEL 4PRDB 2GG1A 3IDYC 4JFOB 3S8WA 2N0KA 2YA2A 5C07A 3JVFC 2IG2H 5FX3A 4Y89A 1U8QB 1YSOA 1ETA1 3FQTA 1FO0A 3MRGA 4M4RA 3Q2CA 3SKJL 5GPRA 4PJGF 3ZMEA 5KG9A 4PJHE 3ENEA 4IRSC 3UPRA 3TOPA 4R7XA 2W38A 2XN2A 3KE0A 4HFWB 1BZOA 3BUIA 5ANME 2ERJB 3HR6A 3BP4A 2WXGA 5INDB 2ZPKH 3PRZA 3U0WL 3SDDB 3SQOH 4PJFB 1GS7A 3FSOA 2B1AH 3DUSA 1B4TA 2V5YA 3B2VL 3EXLA 4WGKA 1GS8A 1L4IA 1RIVH 3VXRD 2H7WA 4L4TE 4GBXA 4HKJB 5AL0A 1QSZA 4LKXB 1Q0YL 5IW6A 1MCQA 1BGXH 1FP5A 3MRGB 4P04A 1WWLA 1ZE3H 4QRPB 2XZZA 4GUCA 4M03A 1ZA6B 3DDGA 5E99L 1E4WL 2WUCH 2YD9A 1Y6KR 3B37A 3C5ZD 3C6LD 1Z3GL 3FTZA 1F4YH 4ECNA 4XNYH 4JE0A 1CFSB 3OKDA 4XVJL 2I60L 1K4CB 1PYWB 2BP8A 3US0A 1FL3B 1BFSA 1U8NB 1WZ1H 3B7RL 5FS5A 1JZHA 2DQHH 2Y1YA 3CPLB 1LP9F 3GSRA 1QWHA 3UG5A 2O6PA 5F9WC 1M1XB 4ZS6C 4E5XG 1PLGH 2R2HB 4XN4A 5BV7H 1A9NA 2DM4A 2R2EA 2X89D 2EO9A 3FT3B 2FBOJ 3T77B 4U0QB 3OG6B 4NKMA 3AWFA 2K7QA 2V5RA 2W65A 2BY2A 4C83A 4FLSA 4ZMPA 3Q6FA 3STZB 3BH8B 4TPRL 3RVWD 3UZEC 4AQ1C 2NX5D 2QVTA 4JDZB 4OTXL 2QADD 3HTLX 5JOPE 4QBZA 4LXSA 2J3SA 2A6DA 2K7PA 1CD1B 2K9UA 2UY7B 2BY3A 2QGCA 3W38A 5I0VA 3ZIYA 4JPWH 5T1LD 5E6ID 4E9SA 1X9QA 3QCVH 3MNZA 5L6YL 4MA1C 2UX6A 3ABKB 3DXAB 3MLZL 3MXVH 2FATL 2R2EB 2PXYC 5HVFB 4PFEA 5ADOH 1UC6A 5C7XL 1BQHA 1NEZA 2N56A 3NCJH 4PRPE 4PVBA 4R0AA 5T3ZH 1NM4A 4YMPA 1SY6A 5AVRB 2F5AH 1AGEB 1CYGA 5DTFA 3UIYA 1GGBH 1I3GL 4YXHH 1Q9OA 5DSCB 3GMPA 3BKYL 5A2FA 2VM3A 2W07A 1WA0X 4KXBA 1Z9SB 3ECWA 1BG9A 3ZKMC 1TO5A 5HDBB 3RWCB 2LE9A 1ZLUH 5I1KL 3VI3E 3EYOA 4P46D 1UXMA 1AGCA 3GM0A 1RPKA 3GSOA 4HBCH 5KBMA 1UGKA 2J71A 5I2IA 2OR8A 2BHUA 5EFIA 2IBGA 1E9QA 1IM3B 1FIGH 4FLHA 3UTTD 2IVFC 3BJLA 1GC1C 4DQOH 3NSXA 1YEFH 4R0LC 1UH2A 1F4WL 4JM2F 3MRCA 4QDGA 5FYKE 4IU2A 1EEQA 2FGWL 4MQXC 4G1EA 4LCUA 1JGLH 1Q9OB 3APCA 5H94A 3TWYA 5CEZD 4HQ1A 2B1HH 4OZFA 4Y4HB 3HNVL 2ZKXA 1BAWA 1CXEA 3IFPB 1UXSA 5I6LA 4ZK8A 1XBRA 3TVMC 1DQMH 2Y7LA 3NVQA 4H8WC 3RNQA 1A4KB 2QHRL 4KTEL 4W9LC 4MVBD 3V10A 2JELL 3VH8A 4CU7A 2H2PC 2BRQA 4OLXL 2Z93B 2DRUA 2ZKHL 1S9VB 2F8VA 3D85D 5D1QB 3NN8B 3O3DB 2W5PA 1E0OB 5DDHA 1AHKA 5C71A 2WJ7A 1T66C 1EMTH 5DJCB 1AD0A 2R0ZL 3AADB 3T2OA 1J0KA 1S5HB 1G7HB 2EDBA 4XODA 3SE4C 5JPMA 4XPTL 4OCLC 5D7IE 3QI9B 3M07A 4OZFB 4X99A 3QJHB 3HRPA 4FNTA 1OGAA 3S4SG 5J4MA 3QDGA 4EI0A 1UXSB 2Y6TE 1KNOA 1R17A 2X89A 3L9BA 1FNHA 1G9UA 1DBBH 2YPLD 1L7IH 2V7NB 3KPOB 1FG9C 3HG1A 2R15A 5DRWB 3S36X 4EI5C 1P5UB 1EX0A 4MBRA 5AAWC 3BT2H 4L8DB 3V4PH 4PBWD 2OX5A 3A22A 4DP2X 1SMAA 1IZKA 1INQB 3L4VA 2VXVL 3RUGF 3ZRCC 5J3HD 4ZJ9A 1CFNA 3CMOL 2QSCL 2AQ1A 3CC5A 1QSVA 1IGFL 3L7EB 4ZZFA 2H0JA 2HLAA 3P0VH 4OQTA 3TXAA 3IBOA 3GLZA 5JPMB 4PJXE 1MCPL 4P91A 3QNYB 4RMSA 4ZSOA 1DBAH 4PV8A 5T1LA 1A3RH 3U0TA 7CGTA 2YEZB 1ODUA 4M1GH 3BQUA 5CJ8A 3FF8A 3QDGB 3RHWK 5IHLB 5H35A 3OJMB 4OCRH 3OXRA 1MI5A 2YN5A 1GOFA 4LSVL 3JWNH 3NIGB 4MXQC 1JGVH 5KYUA 2J4WL 3LSOA 4NCDA 3NTCL 5C09E 5DRNB 4AK1A 4RNRB 4JY6B 1T0NA 4X7SH 1KV7A 1JI1A 3GGWA 2FQFA 3L5IA 3MNVB 3LN4B 5DFTA 3K2UH 1OSPL 3GBNL 3LQAH 3MO1B 4N0FA 1LDPH 2PYED 2X09A 3A6BH 5IEHA 3ULVE 4JZNB 3RVXD 1KIRA 4D0DA 4Q6IA 3U0TB 4A7GA 1IC1A 2FX7L 4P46A 3IDUA 2J8UA 2CK0L 2PTTA 3E1ZA 3Q5OA 3FDWA 4PD4J 4WTQA 4HWUA 1A6TB 5GSVB 4RMUA 3OF6D 4U3SB 4DESA 4W81A 3HI1B 3LSOB 4YDKH 1MNUH 2EYSB 1IIKA 4URTB 1IBFA 2VDPB 1XGQA 4XNDA 4OD2B 2HTKC 2X6MA 3T1FA 1QI5A 1T0NB 3ET9F 2VR9A 4QHUB 2AJUH 5AAMA 2IWEA 1EJOL 5BQDA 4S10A 4U6VH 3IJYB 3DSNB 1SQ2N 2C7FA 4LAJH 3FQYA 4HJGB 4IGBC 3QDAA 1A7RH 2WXPA 2AGJL 1YUKB 3AXLA 3HAEG 3GSNB 4GY4A 3MLTB 5MP6H 5JNYA 1JV5A 1CVRA 5GJTL 2XZAL 1H6EA 2F5BL 3D85A 4GRLB 4WY7H 4UIKL 1WIOA 1TTRA 2IOOA 5IB1B 3S8GB 5BXFA 5GS0C 3H9HB 3K72B 1E28B 4MTMA 4PU2A 3SKUD 2A9ML 4BD4A 5HSFA 2LGNA 5GGUA 5F6HI 1IO4C 3FB7A 4C56E 2EAEA 4RFOL 5DRZA 4X6CF 1F11B 4ZW8A 1XCQB 5H37A 1S9YA 2YQ2A 3QC5X 3B9KB 4JRLA 4KRPC 1A65A 2FE0A 3E80A 2NNAA 3OKNA 2KZBA 1E4KC 2PPEA 1BYNA 1NTDA 2AEQL 1FZJB 2C9QA 4J3OH 3U2JA 5KSBF 1RHFA 4FNSA 4YHYB 2ZUUA 1OF2B 3OLGA 4FFVC 2XLLA 1CBVH 2C4FT 2AV1A 4JFYA 1I75A 2WO2B 3BJ91 4B7LA 4X6BB 4XCCL 1CDIA 2WQWA 4LVHC 2C26A 2P24B 3FB7B 4ZYKA 4OJDH 4XNQA 2ZWSA 1ZVSB 1W0YT 1FGNH 3NJNA 2H6PB 1V3KA 4HJTA 4MCYA 4PREB 3V0AC 5IVNA 1ZGLA 1MJ8L 2JI3A 2GBVA 3GZPA 3TX4A 4YHNB 2P1QB 3OKNB 4O02H 3F7PC 3H3PH 1MDAA 4YSOA 2K78A 1L7TH 2GFBB 2JCWA 4FNPA 4KXAA 4NZJA 3GUTA 4X83A 4AQ8C 1I1AC 3G5ZA 4W9KC 3HNSL 2P1PB 4JFED 4OLWL 3EO9H 3ARFD 4PB0H 2SEBB 2AV1B 2DDQL 1XBDA 5D1XA 2QQNH 1T89C 2K4WA 1FC2D 2ZCLH 4N5EC 2BEXA 1U8KA 4WI0A 1VGKB 4PVLA 3QUKB 3DPDA 5CINH 4ZO8A 4Z3JA 1ND0B 3QZMA 1P4BH 4WTWA 3EBAA 2VN7A 4GMTL 1KYAA 2F7OA 4Z7WF 1OWWA 3CDZA 3RKDD 4R2GD 3WMPA 2YAHA 2D31A 2XQYG 4XCEB 3UL4A 2YZ1A 1NLBL 4APQC 1N0LA 1IFHL 1RZKH 2HUHA 5HHQA 1QUNB 3HE7A 3QXVA 1GVIA 1DVTA 4FZ8L 1RJLB 3RW7A 5ECJE 5EWIL 2AS5M 1QEXA 2Y7NA 1R9FA 4MNHA 4YWGL 3UTPE 2DJUA 4UMGA 1T3FA 2FEJA 4JREC 2M1KA 4G7SB 3TJEH 4FX5A 4FC3E 3V9CA 1TTGA 1ICTA 1KGWA 2EYTB 3F7LA 1BQKA 5GRZA 3ZXAC 3TBSA 3KPNA 3QXUA 5H2BA 3O6FD 4WO4B 4F33A 1Q9WA 4KI5E 2EXYD 5T5FH 3VXUB 2FL5B 2VH5H 1OVZA 2ZJSL 5KTEH 3SGKC 1J5OH 3LDBB 3TO2B 1EAPB 1SN5A 2Y1VA 2L4OA 2R0WL 3C87A 3HE7B 5AEAA 1JYNA 3G6JA 5CZVH 3QIWA 3UL8A 4TQPA 1IIIA 2QZQA 4GO6B 3SO3C 1PKOA 1KOHA 3N41F 1WFTA 3WKML 3KEHA 1P6AB 2FHBA 3D4YA 3GDCA 4LSSL 2ED6A 3I2CH 2YXFA 4YDLB 1XCTA 5F1IB 3M7OA 4FZEL 1DP0A 3QCUL 5C08A 4OFVA 5CHNB 2MPAL 4X2UA 1IX2A 1J05A 3L2LA 4G43B 2E46A 2P44B 5KJ4A 1RKRA 2HT4C 2DYPB 2ZX7A 3INUL 2KZKA 3UYRH 1CGWA 1A3LH 5J06A 4M7LH 1BVLB 5KYWA 2X4PB 1KXTB 4LL4A 4KNTA 3UTZB 3CN1A 1ZS8A 1MHHA 4M9OA 2ZIDA 1GY1A 1E9PB 3MNWB 2XTJC 5C9KA 5MEQB 4ARNA 4KX9A 3IFOB 3WSQH 4EZLA 3U9PH 3BDYL 5TFSL 3IGFA 1E6OL 4A2MA 2ZOKB 4WU7B 1MW2A 1RHHB 2ADJA 3V4VL 1FO1A 2J1YA 4NJ9H 4WV1C 1FFQA 4F58H 4OZIA 2EDTA 2WYHA 3WUWB 3PFQA 1XCTB 1QD0A 2TSBA 3U30B 4C57C 4N0YL 2HRLA 3D39A 12E8H 3B1TA 3ML9A 4PG2C 1BWMA 5EN2A 4H8HA 4O5LH 4G8AA 4XPAL 2Q2EB 5F3HA 4IJ3B 3TC9A 5FM5O 5I5MA 2BH0A 1GRWA 2BXZA 2W80C 2GSGA 4MAUL 4UINL 3WN5A 3UERA 5JIHA 4F93B 5E94B 2ALWA 1KGYE 2LLNA 3OWEA 1SXBA 3VFGL 3QGVA 1K5GC 1YMMB 4O00A 1Z5LA 4K3EH 5C2BL 5HPOA 4APXA 1BX2A 4AH2B 1CPUA 2ADJB 1ZHNA 1COBA 3KDMB 3BUYB 4KTDL 1EEZA 3UJIH 3UOAB 3ZTDC 3LNHA 3ZZQA 2BM3A 2EE9A 5DVNA 5EBLB 4K55A 3VXTA 5BO0D 1I8MB 3DTUB 3BIKA 4Z7QF 5EO9B 2HSIA 1A9BB 3D39B 4OM0L 2XY1A 1K6QH 3GMMB 1Z66A 4JRYB 2IDQA 3ATEA 4WI2A 1VDGA 3ETSA 4MZ3A 3HS0C 1N64L 4XOBA 1II4E 3W0WE 5CD3A 1EZVY 1WAAE 3K5SA 2NSXA 3BWAA 1ILUA 3HJ0A 4KJQD 4U7MA 2BC4A 2ZCKL 3N85L 4OZFG 4P5TB 3HC2A 2YA0A 2HH0H 1TPXC 2C4FU 2QTEA 1ZDSA 5BVPL 3FL7A 4OLUL 4APXB 1TEYA 1BX2B 2YPVH 3NIDE 1EA9C 3VH8G 4BM7A 5EU3B 1ZHNB 4PI0A 1XH3B 1PZBA 2D3JA 1MQ8A 5FKPA 5F72S 4V2EA 4MA7L 3VXTB 2H1XA 4NO2A 4Q2ZB 5LBSH 3ZPDA 1W0VB 2FEDC 3DX7A 2XWBA 4RAVA 2Q3ZA 4PJ7B 3IN2A 2GJRA 4BZ1A 3BPCB 3EGDB 4TNGA 5JLZA 5B1JA 4ZZKA 2WNXA 2MQCA 4X7FC 2F8IA 4XI5D 3CZJA 3LH2H 1I1FA 3FUDA 4DN3H 1Z0MA 4JMXA 4IKIA 1ODAA 3HLAA 3O6ML 5FKPB 4YN3A 1CJYA 3CFUA 5AW0B 5BRZA 3QJTB 4KX8A 4L3CA 2NXYD 2ICEB 1CDYA 3MNDA 5ALCL 4ZQKA 3TBTA 4XZUB 5F9OH 1LD9B 2EYRB 4OB5L 5IB2B 2FO1A 4PJCA 2WINA 2RQEA 1MZZA 2EVHA 4AV0A 3ESNA 2VUKA 1VF5C 3MFFB 2QVFB 3QDJA 5DD6A 1JHTB 3RBSA 4AE0A 1JV2A 4P5RA 2ZOTA 5FXCH 4D9LL 5D7LB 4UQCA 5E8PB 3IF1B 4IRZL 3THMH 1IFGA 1SF3A 1VFBB 5JO5B 3SDYL 1KB5B 1D6VH 3GI9L 2R9HD 1IGIL 2A77H 4N0UE 1OPGL 1KGCE 2M8XA 5SWSB 5I71B 4U4IA 5INCA 3MREA 4L3CB 2OMBA 3WLBA 2Q20A 4P2RE 4QXGH 4JJ5B 4ZW7A 4WFGD 1CR9L 2UWEA 3V6ZA 1CLCA 1W0WA 3T4YB 2IIJA 4GS7C 4M43H 3WV0A 3CK0H 2YXVA 2MOQA 3QDJB 1EQWA 2JCCA 3SPJA 4LP4A 3GB7A 4K23L 2MH4A 3AY4C 4H20H 3I9IA 2EZ0D 3M1CA 4UTBH 1SM3L 3L6FB 4PWJA 4WWID 3FO2A 4OW6A 1FO0H 2LU7A 4NI3A 1DUYA 3ARGD 3FFCA 2Z7ZA 4BZ2A 1S9WA 1ZPUA 1QBMH 2CRZA 3QHTC 3EDJA 3MUZ1 4DWHA 4KO5A 4ODWA 1SVBA 3H8NA 4OCSL 5I19L 4HXAL 2IF7A 2H47C 2NUTB 4X4YB 3OC5A 5CLWA 4N26A 3OGMB 5AYUH 1U8OB 1KJMA 4M48H 5HHVL 2PTVA 3MGOA 4KX7A 4OAWA 43C9B 2AJZB 4KKLD 4U1GC 4PG9B 3D9AH 4F91B 5L2KB 2K0RA 4RDQG 4EPSA 4AQEA 5E8DL 3QZWB 2DQTL 3BVDB 3M18A 3DPBB 1QTSA 1KDJA 4TVPL 2DD8L 4HC1L 4I9XA 1AS8A 4LCWB 3T6XA 5LAXB 1R47A 1S9WB 2HAZA 5AOJA 2WLZA 4EOWH 5AB0A 1OAQH 5HGBA 4L4TD 5ICZB 3VI4E 4LHUA 5EU6A 2PO6A 1S8DA 4RFEA 4OAWB 3U7AA 1DJXA 4AENB 4MMYA 3RY4A 4GSXA 3V6OC 3VFSB 5F7WC 5C0BA 3HB3D 4HWZB 2V5MA 1AMYA 3VFTA 1TJIH 3VSUA 4JKPL 4Y5YA 2EDWA 2PR4L 1BZQK 5FGSA 5IJBC 4JFSA 2ZP0T 3G04A 3CD4A 4J4PC 4DGVH 3PF2A 4L5FL 5K9QI 2E5EA 2XYBA 1YEWA 3D8MA 5GIRA 2UUDK 3EGXB 2GT9B 1L9SA 2X4SB 1JWMA 2ZCZA 1FWXA 2CGZA 1CE6B 4AEHH 5LHDA 4L3EB 5F7BA 3A3YB 2C9XA 5EU6B 1BVNT 3KPSB 1R3LA 1X5KA 3KXFB 1V7NL 2YRZA 4IU3A 4ZFZA 4LARL 1XQ4A 5D2LF 3R06A 4MMYB 3OKOA 1EO8H 1GL4B 5BO1L 3NFPB 5LCVL 2HTLD 4LBAA 1DEEB 1VFAA 4FYQA 3ARWA 4H8PA 1XKUA 3AQZA 4HEME 4Z7IA 3DUUB 4AMKH 2CDGB 1D5XB 2D4DA 3T2PA 4ELMA 1ZSDB 2CUMA 1MVYA 3X12B 2X4UB 4AYFB 2R29H 4YZFF 4I7ZC 4YOKA 3K71B 3MCYA 4I18C 5JW5A 1UGNA 4D9QE 1SY6H 2AJYH 2ED7A 3JVGA 4GFXA 4K73A 2BNHA 2E9GA 5HDOA 5L8KB 2W92A 1J0JA 3RY6C 3BE1H 2FO4B 1T7YA 3VGAB 2YMOA 3B3BA 1MHEB 4FS7A 2XA8H 4UT7L 3PHOB 1E3ZA 5LAPA 2B8OT 4AVJA 1LYQA 3TL5A 1RZGB 5MENE 3GJFA 4RLDA 3F6JA 3ARBC 4PRPD 1QLRB 4Y1TA 3PAVA 3OKYA 2C1PB 3NG5A 2GCYA 3PPSA 4H13C 3HMWL 2X6UA 2C3VA 5L9DL 3PXHA 5T1MA 4UILL 4G9FA 4Y7OC 1CMOA 3K1KC 1NL0L 5HJDA 4S2SA 4MA3B 2VWEC 4PJGA 1ED3A 1XGYL 1HKLH 4NN5C 1LNUA 5IM7B 3GM8A 4POZC 3TONA 5CBAA 2VE6B 3GJEA 1UUNA 5J6GB 3BOVA 3P4LA 4EE2A 1UKSA 3QJOA 5GZOD 1JFQL 3BAKA 1HHKA 2BOBB 1SEBA 3TU6A 5A1AA 2R9UA 1H3PL 1RULL 2WXIA 3GJFB 4JPQA 5E5RB 4U1NB 5DWPA 2YD5A 1ZRUA 2GCYB 4R6UA 5I8OL 4KMTH 3RL1B 2IPUG 2C3VB 2X70A 3ATBA 5FYKD 5IQNA 1JZJA 3I6KA 3CXDL 3T0VA 3PGFH 5IWLC 3K8LA 3VQ2C 2IH9A 2Z91A 2WSKA 1DUZB 4FHBD 1JCVA 2E6JA 4G5ZL 3SYPA 3DVNA 3VXOA 4LPUA 2VDLL 3GJEB 4YO0A 4AJ0A 2CPCA 2Q8AH 4KZDL 4ZDHA 1UCTA 2O5NA 4FTVB 4DKDC 4J2XA 1WFUA 3JV6B 4JDTH 1G9NL 2VMEA 4GIAA 2E8YA 4NWUH 3GSXA 1NBCA 3VQLA 3WUWG 4NHCL 4N8VA 1JZ5A 3LB6C 3LEXA 4BELD 4FA7B 3UL9A 5HHXH 3KNBA 1HEJC 1SHMA 4NFBA 1ZTXE 3CJJA 5ABZA 1CDCA 3S34L 4GEIA 4TV3A 5LJYH 4EZKA 3MACH 4GSDH 2RCSH 4PI2A 3ZL2A 2AJ3A 1X5AA 4PJ9C 4BK8A 1RIUL 2YD4A 3EHBC 2EIZA 3HC3L 3JV0A 2MMXA 2VDNL 3C8KA 1JZ7A 4HUXA 3SPVA 3GYRA 2EVGA 5LNDA 2X7LB 2JKXA 3BEWA 3CDCA 2HKFH 4NQUA 2CKBL 3U4AA 1BF5A 3AB0C 4OQTH 3BGFC 3BKMH 4HOXA 5JIDA 2FCBA 3VM5A 4ZDHB 2C9VA 1JK9B 2WNWA 2GTZA 4M7JH 2PP9A 3EH4B 3W11D 2E27H 3KPRD 5HYJE 4HT1L 1X5YA 4N8VB 3Q44A 4Y5XA 3WFBL 1F3RB 1JPGA 2BW4A 4R4ND 4Y4FA 2F0CA 4NQDE 4HJEA 2XN9B 4NN6C 4XTRC 5DMGC 5EOTB 4ZXBC 4DHLA 1JHKL 1QP1A 2VM9A 1U58B 4WI6A 3PV6A 5JXED 1LP9B 4XHJD 3ULUL 1CLVA 2R4SL 3DYPA 3L16A 4DGIL 1ONQB 1D3CA 4HUXB 3WN6A 4OBSA 3L3JA 1MH5B 2O5YH 2FSEA 3BEWB 3CBJB 3ZSTA 4IDJH 1I8AA 2DMKA 1Q9KA 1NDGB 4FP8H 4IYKA 4QRFA 3V4PB 3ALWA 1J5IA 1RI8A 5GS3A 2A9AA 4KGLA 1AS6A 4PJIE 2MCAA 3EO1A 1AHMA 5D8JH 3ROLA 2P80D 4NO3A 1LO3L 1L9MA 2LHAA 2OXGA 3BD3A 3FJTA 3O2DA 3RVUD 2IWFA 5I1CL 3M46A 2XZCL 1G7PA 4DFHA 2W9LA 3ZTNH 1QFUH 4KJYA 4Y4FB 2MTAA 1FIEA 3L1EA 4QHMB 3SGJC 4FMKA 1P69B 5AZEL 1HOCA 4AEIH 4K3JH 4PS8A 4BE5A 4ETQA 2D3VA 5JW3L 5KVMC 3HFML 3I75B 3ULVD 5DZAA 4UOJA 4KTYA 4HZAA 4JPVH 5TQ2L 1R5IB 4R9HA 5CEZH 1A66A 5IQOA 3FNKA 2PN5A 1T04A 4MAYD 2FSEB 1MWAL 3HC4L 4M8QB 1J9SA 1BJ8A 4FFWC 2Z9TA 3FTGB 3V5DB 3O11B 5K9JL 4GP8B 4JM2A 3LQZB 3ROLB 4GXVL 3QEUA 4AZUA 5I9QC 4JNXA 4XGOA 1CBJA 1DZBA 3WFHB 2R1WA 2H2SC 4QT5A 1WJ3A 4IBSA 1TKWA 4NCC2 4V1DA 4NM4H 2PETA 3AUWB 1F4HA 3ZQXA 2W91A 3BYTA 3FUHA 4U1HB 1KBKA 3MCKB 1HS6A 4Q62A 5DJXA 3RA7L 3UYPA 5HHOA 3MGAA 4XRCB 5E2UH 5H37H 2VZTA 3A4FA 3NZ8B 1W2KT 1DQKA 2IXQB 3GKZA 4DKFL 3RURA 2VTFA 3HA0A 4LDOB 1CGXA 1R19A 1VZHA 4ELDA 1HZKA 3P4MB 3B9EA 4YQXH 1KEMH 3KJ6L 1OLLA 3S0PA 2XXGA 4V1DB 1HTYA 1NKRA 4M6NL 1T22A 4ALAH 1JRHI 5LBVA 3RILA 4P9ML 1MFDL 5I16A 1PMYA 4Z8GA 3I9GH 3LV3A 1XF4A 4ZOBA 3V7MA 3B5TA 2IWGA 5FUCC 1TVBB 5AW4B 5DMKA 5EEYA 3KPRA 3DX9A 3HUJB 3RUGA 1JWUB 3WPCA 4K8RC 1AGFB 1TJGL 1YEHH 2F7PA 2NT0A 3TIEA 3MGTA 4E9YA 3BW9B 3BVWA 5FF6A 2ENSA 3DOSA 4PGZA 2AERT 3OKLB 5E70A 5F7MC 3V9EA 5DHYA 3V0HA 5IVOA 4X6EB 4Z79A 1OEZW 5AVTB 3DX6B 3MBXL 4UOQA 5AOKA 2H3XC 1XR9B 5HJBA 1DR9A 3NSDA 3L1OH 4XO5A 4CL7A 4I2XE 1TYEB 2W95A 4S0SD 4P2OB 3STBA 5A7EA 1FZOB 2KLRA 4PP2B 1SQMA 1ET7A 3UZQB 5F3BB 2X3AA 3MV7B 1N10A 3FQ1A 5IVXA 1SXSA 1UTDA 2P80A 3DKHA 2DQGL 5DMKB 3QZWG 4YDIH 5IVZB 4DK5A 1QPXA 5LWYL 1KIUA 4S1RL 5E51A 5LN8A 5CBEA 4FD0A 4OCWL 4P2YA 5FM4A 4I6JB 3QIUB 5E08H 1S4IA 4R26H 1YN6A 4JKWA 2CH8A 1VFOA 1XSIA 2UYLA 5I18H 1RU9L 3B7TA 1UD6A 4KPHL 5AKVA 3B9VA 4LIQH 3P40A 1UCBH 4MAYA 5EORL 5GRUL 3X3FH 3PFUA 4ZUUA 2WQUA 2ZSWA 2PW1A 4XB3A 2XWTB 3KW8A 4KO9A 1EDQA 2WXMA 1P4UA 1VFMA 4ODSH 3QEQD 1DJZA 3ZUNC 4R5DA 4M3KB 4QRRB 5D9SB 3MV8A 5IESL 2AFNA 2OR9L 5A16A 3C60A 1KIUB 3AT0A 1FBIH 4QTHA 3KYOA 2R27A 3QVAA 4QHKI 1ASQA 1HH9B 4ORZC 2R1XA 1OF0A 3ABZA 5KAQF 2JF1A 1NGZB 1GWBA 1YN6B 4NZFA 1FYTE 2BSTB 2L7QA 43CAB 3NCFB 3CZNA 4LVNB 1YPZE 3SZKC 1NGWB 3MRKB 5CP7B 2Y3AA 3FTVA 1FDLL 5FYJL 3WUZA 2ZSWB 1QO3A 4WHCA 5B4MD 4K7PL 1RJYA 3O8XC 5HYQB 1WPCA 2EEDA 3LD8B 3KH3A 4XMLH 2P1OB 3UP1A 1OAUH 4V2BA 4KUZL 3RAJL 2KZ1B 3EOYG 2I85A 3AREB 4HQQH 2FYYB 4LQFH 1AY1H 1YMHB 4KDTA 4X6CA 1BVZA 3KYOB 4NRXB 2CDEB 2XN0A 5IB4A 1U8PB 2CGRL 2R1XB 4TUKH 4DO6A 1P2CB 3QEGH 4WIQA 1ZA3B 4PGEA 1KBPA 1S7XA 1L3NA 4W6XB 2GEQA 3E7JA 1XGTA 3G6DL 1JUFA 3AU1B 2XZQL 5JW4N 1H6TA 4CW1B 4LLWB 1KYUA 3QJQB 4IS6A 2PW2B 4D3CH 5D2NA 1GYCA 3LZFL 4HIXH 4P9HH 3CFDA 2Z64C 5ERWB 2Y06H 3ULUF 3NPSC 1ZCRA 3RJQB 2KC0A 1G7IA 1CLOL 2VXUH 3ZSSA 3FHQA 4F7CA 2QMKA 1A7NL 1D6EB 3S37L 2X6BA 3T0AA 3CVBA 3E8UL 4IBWA 3QR1A 2HVJB 4QPEA 5KSBB 1LO0L 2JMRA 2XBZA 4MDIA 1A02N 1CDBA 4OGYL 3IEAA 3ELAT 2EE6A 5I15H 5D3IA 2YGNA 1IL1B 1IO0A 4E42B 1B0IA 1KJVB 3P4OA 2DICA 1JPSL 1J1OL 5GGQH 3A21A 5D70H 3JYCA 1O6SB 1T6VN 1M7IB 1NZRA 3CN4A 4F9PA 1SOQA 4P57B 1UB5A 4LASL 5MEOB 1I3UA 4HGWA 3OD3A 4XMKL 1WD8A 4KKPA 4XZ4A 3V9FA 4DK6A 1HHHB 4Z7WA 1KTRL 2AK4A 2JJSA 4DN4H 1G1CA 4HGMA 4JM4L 3R8BB 4F8TA 2IQAB 3VM7A 1XCXA 3MRMB 4YPGA 4PJAA 3MLSH 3GI8H 2BDNL 3BPNB 1T1XA 4BBWA 1MW0A 1DVFC 2VAJA 2X88A 1N6QL 3PWPE 2XIDA 4AXWB 1Q1JL 2MCPH 3U1QA 4AGMA 3UTOA 3ZRFC 4DUXA 4ZT1A 3ZDXE 4NGHH 1CGTA 3EOBA 1X4XA 1XEUA 1WS8A 3L9RB 1QKZH 3PWUA 3BH9A 2WP3O 3BEVB 1HCZA 1UD3A 4LI1A 5EUOE 3EGSA 4XP6H 3G3BA 2A83A 2OMXA 2YD1A 4BZ1H 3K80A 4NNYA 4Z7WB 5C2UB 1U36A 5BJTB 5ITFA 1BM3H 1PJWA 3ZE0E 4MKTA 5I1AB 3U6XA 5FOJA 2ZUVA 4KVCH 3UROR 1PZ5A 3IDJA 3T3PE 3DROA 3L1GA 3U36B 3GHPA 4GSQA 4LE8A 1GW6A 1T1XB 1I3VA 2ZWZA 4N8VG 4X6DF 3VFUB 3QP3A 4NUPA 1YY9D 2Z8VC 4PRBA 3MQIA 3WIIL 4AY0A 2L0DA 2AKRB 1JZEA 2BZ7A 3MYJA 4ARRA 4W4OA 5DZ9A 3O2VH 1S7TA 4OLYL 5K1NA 4UM8B 3BZEB 3UPCA 5B8CA 3L95A 3ZL1A 3S3CB 1SRDA 3QJVB 3QWQB 3PQYA 3NJFA 4X7DC 2Q9OA 5E00B 1HHGA 4XNXH 5L8LB 3Q8AA 1BVKB 4PTUA 3DLQR 2NUPB 3DROB 2GSMB 5LXGH 1A6ZB 1I3RB 3QNZB 3KJ4A 3KCPB 2EDRA 1OAYH 4YFEA 1EXUA 1IGMH 3BZFB 1FL6A 4JDEA 1UACL 4PRID 4KY1H 3ZTEA 4WWKB 1OCWH 1JWSB 4NLHA 2V33A 4IHBA 4IK7A 4Z0XB 3N41B 3MR9B 3CQPA 4WDIB 4YHIA 4ZUTA 1W72H 4E9TA 4GXUN 4HIJA 4UFRA 4NXKA 2J1ZA 1KGUA 4RGNC 3N40P 3L95B 1GOGA 5I1JH 2Z6FA 3F62A 1VADB 4JQXA 4B3VA 1CGVA 2X9ZA 3EO0A 3UBXI 2V2WA 1A1OB 4PS4H 1KGCD 2YFNA 2P26A 3W2DL 1R6VA 4BQCA 1FS2A 3RIAK 4P2RD 4H8VA 4MJ5A 5C0NC 1QSFD 1CLYL 1OAXL 1M2VB 1XIWA 3X1BA 5KZCB 1I1YB 1ZAGA 4PJEF 1FZKA 1G87A 1OP3K 4YNYB 5HHPB 4NKQB 5B39B 4IKKA 2ZX6A 3LAFA 1D5BA 4JVPA 1KCSL 3EKCA 3GK8H 4Y2DA 3FCTA 3PP3K 4YHIB 5ELIA 1CQKA 2YZ8A 4A2EA 5JA8B 3BX7C 4Z7UA 1PQZA 1KBGL 2NY0B 3HC0B 1QNZL 2EXWD 3EYFA 4KKRA 5J12C 5DJZA 5EEZA 1IGCL 3MMEA 4AV5A 3TFBA 4X9IA 4PJHF 4L9DA 4Q6KA 1MFVA 4FQ1H 3EO0B 4I1RA 4XR8C 5DD5L 5KSUA 4B53A 1GJWA 2O5XL 4WTZG 1W9XA 1U3HB 3ZIMA 1MLCB 4RIRB 2F8XC 1FSKB 3T4AC 1N5YL 5FHAL 1P7QB 3AACA 2NY3B 3WPGA 2GJJA 1RZFL 2YUVA 1CDGA 3FBKA 4IRJC 1KZQA 1SJHB 4NQXA 2I7OA 5I5RA 3S8FB 2ESVA 4EDXA 4GMSH 1A4BA 5D5ME 2WNKA 3E3QC 3HE6A 4AG4H 3US1A 5C6WH 4IM8A 4YDVA 3RDTD 1H0DB 5GGRY 1GAFH 1TQSA 5D7SH 1KGIA 2ZZUT 3DIFB 1DSWA 3D48R 5DJZB 4FA8A 4ZO9A 2J1KA 5ESQA 4EDWL 1WH0A 2A74C 5KSUB 4LLQA 1RVFH 4EI6B 4G7YH 2G9KA 4TVSa 5IQMA 5F89A 3WL9A 3HR5B 2VMDA 5SX5K 3QIBA 1OP5H 4PH8A 1Q9LB 4KFMA 1IEHA 4NEHB 5HYSB 4P5KA 4P4KD 3MRRA 5DO8A 5C8JA 4XO4A 5IG7A 3EG9B 5CCKL 4UNIA 4NQCB 1QZ1A 2WLMA 5IBLD 5B22A 3P11H 4ZW6A 4QXUH 5F21B 5AWAA 4GAAA 32C2B 5L7XH 1WBYA 3VVVA 1ZV9A 1OM9A 1WP6A 4QI3A 1HC1A 1YJDL 3QUXC 2YAPA 1HDMB 3NESA 5TDNA 1Z2KA 2KI6A 5TH2A 5I1HL 4YSSA 1WIPA 4J3OC 2R83A 1JOIA 4P23D 5KSAB 4LLQB 4PRIA 4ZFOB 2QJDA 2ZG1A 4NNPL 4QF1B 1A6WH 5F3FA 5F44A 3LZNA 2ENPA 5FGCB 5KYXB 3S96A 5GSRB 3FQUB 2CR6A 3UO1L 2OAAA 3GRWH 3RFSA 2CA6A 1SDDA 4BFKA 1M42A 3MRFA 1QRKA 3I84A 5D93C 4OI7A 1A6UH 1A4JA 3VXPB 5IBTH 2DEXX 1BZ9B 1MF2L 4GINA 4Y9EA 1NC2D 1DVUA 4IHOB 2YK1L 4L0PB 4DEWA 3P30H 2J88H 2F61A 1ASPA 3CN2A 3CLEL 5IF0A 5TH2B 4AKQA 1QSFA 4JZJC 3VFMB 2B2XH 2FNWA 1AR1B 3RZCC 5FYLH 1VZIA 4FQXD 2ZXBA 2VXQH 1XB6A 4NQEB 1KBBA 1AO7B 5SWZE 4P2QE 1CK0H 1Z7JA 1SPDA 3GBEA 4OCXL 1Q4NX 3PWJA 5ISZA 4HJSA 3LEYL 3ABGA 1E2WA 4AIOA 2G75B 1J8KA 3NCXA 5MEND 1T7XA 3WXVH 2IPUK 4DSYA 1E3FA 2DKUA 3CLWA 4XMPH 1QRNA 1J9TA 4QJ3B 4XPGH 4H5SB 5CU9A 3VWKB 2KQNA 1I7ZB 4WK4B 4BFJA 3FCSA 2DBJA 2R51A 1GW0A 2CR0A 4HDIA 2EEAA 2A6KB 4Y4KB 1WV7T 3QUZB 3LXUX 5BOPA 4PEEA 4YFLI 5IMLA 2P5WA 1AJ7H 1ETB1 3O3AB 2C1OA 3TO4D 1FLRL 3RDTA 3IPEA 2EUZA 1QFWI 1WICA 1R24B 5DURB 2YC1B 4LXFA 2W88A 1UT9A 3U79A 2J5LC 1JN6A 4AW7A 2R7EA 3IU3A 4U1LA 2V2XA 4XBGA 1BD2A 3DVGA 1XSKA 4L4VE 1HNGA 3MBEA 3TSRE 2DH2A 4P4KA 3S5LA 1C1EH 4U1SA 3NDYE 1LO5B 4B9JA 1ECZA 2IMNA 5A2CA 2OMYB 1YCSA 2AAAA 3UG4A 5IMLB 4ODTL 5HPMA 3VXRB 5CN3A 5DT1L 2C1OB 3LRSA 2LAAA 3O6KL 4RFNC 5DD3H 1KPUA 1JVKA 3DMMA 2DLEA 4LVOB 4IRSD 2WBJB 5D72L 5AWNL 2EUWA 1NBYB 4M62H 3FQNB 3CIYA 2ENYA 5F7AA 1JRHL 2R7EB 1T0PB 2ZUQC 2WPGA 1N9PA 1YEDB 3JZYA 4P23A 4UV7H 3C6LB 2ADFL 2VDRH 3U9UA 1T03L 4YXLL 2E9WA 2KS0A 3BGMA 2PTUA 1EAOA 4KO6A 4OLVH 3V52L 2Z7XB 2OSYA 3S5LB 2V17H 4HYTB 1ZSHA 5DMIL 5FA4B 4IBZA 2QQQA 4ACPA 3QT2A 2IAMA 5D2LA 3QHFL 3KLHC 4Z77B 1G9MH 1JGDA 4R08A 3WMSA 1MCCA 4YAQB 1OTSC 4U1IA 3V6OE 4FJ6A 3VMPA 1IGJB 2CA4A 5HYJD 1R3KB 4MCZA 5JHDE 1M6UA 4LQ1A 2YD7A 3CHSA 3NP3A 1CICA 4WUUA 1ZD6A 4Z61C 3P4NA 4NQDD 3U9UB 4FQXA 5JPNA 5I6XB 4ODXB 1S9XB 2VXSL 4A66A 1JTOA 1LO2L 1QSEE 5T1KB 3V4VB 3NAAL 4QOKA 2NX5B 2Z66A 4IK6A 4K94L 1R4XA 5L4JA 3M1OA 2KLTA 1J5CA 4IIQC 1JD9A 4O4YL 3VB8A 1UVQB 2CO1A 4J3WA 4ZS6D 2QLVB 3N55A 5IREA 1AHWC 4XCFH 5E6IB 1H5BA 5TDPA 4HPOH 4DT2A 1Y7VA 1IAOA 4JZOB 3P3SA 1BBDL 4Y5VB 1BQSA 5DJAB 2V5TA 3ARDC 2YGPA 1HU8A 3CFCH 3P4NB 2TRYA 3LVEA 4QHNA 5DHDA 1YECL 2D7MA 2NY5L 4MNQA 2WLHA 3TO4A 3BWSA 3ZDZE 4JO4L 1GGIL 1OHQA 1YUHB 3QC6X 4WUKL 5E5LA 2PF6A 5DUBB 4PWGA 2XFXA 2W0KA 5ETUA 1TQCB 2OI9B 2WLKA 4HEPG 4UOZA 3NJLA 3ETTA 3JT0A 2G4GA 3UMNA 3U6RB 4KKBC 5CO1A 1FT8A 2PXYD 5J0BA 4KH9A 1IBDA 2FJGB 2YMXL 1AQKL 3MLYH 3FSAA 3BESR 4KK5C 1N8ZB 4NUJA 5IQ7H 3GHBH 1YRGA 3V0FA 1RIHL 2BX5A 1WT5C 4N1CA 2OR7A 1KYDA 4IBUA 4EZGA 5TQ0H 4R4FL 2D8KA 5I1IL 4W9DC 3PHAA 2HA1A 2MSPA 2IV9A 1SMOA 4XCNB 4N9OB 3GMQA 1FFNB 4MLSA 5AWDA 3SDAA 2VWEE 3SIKA 1NCBL 1H9VA 5I75C 1M05A 1KJ2L 4OZGF 1LLAA 4X5XB 3D51A 3ZKMD 1A2YB 1WGOA 3MUGA 2B20A 2B4CH 2Q76A 5EU5A 1UWYA 2Y6SC 3UYOD 2OMWA 3SKOB 4FL4B 4XC1L 1YYCA 2OP4L 1H8SA 4F92B 3RWIB 5HYEA 3BAEL 1SHWA 5DS8B 3VD3A 1DBKH 3WTTA 3U83A 4D0BB 1PF3A 4MQXD 4IRZA 5F1SA 3RLSA 2EVIA 3X1FA 1CLZH 1BSIA 1PZDA 5B39G 4KV5F 3LHPL 5JXAH 4GG6B 3IK2A 5GISH 4WP6A 3TVMD 4MASA 2I07B 1C5DB 3AS2A 1ESOA 3MA7A 3EOAA 1VCAA 2H2PD 3V4UH 2YPLB 1MJ7H 1ORQA 4POUB 1Z3RA 1WLHA 2ZKMX 3B8SA 4JR9H 2HMIC 1PKQE 1M9LA 5FB8B 3MOQA 5BRQA 3BP6B 4L23A 5ECGA 4KTGA 2EABA 4Y16A 4FTDA 3K4ZA 2AC0A 2EO7A 1T66D 2EDEA 2ZD0A 4A2HA 4YUEL 1CDHA 1DDTA 5L4IA 2V9SA 3MLRL 3PL6C 3VXSE 1TQBC 1PBYA 5IHUL 3IFNL 4H40A 3K1DA 3SKJH 4Q3IA 5GS2B 1Q94A 3DGCR 4HPHA 5DLLA 3ULVH 4I3SH 2XUWA 4R90L 4XNMA 1QQDA 1PX4A 2ICES 3ZYJA 4EI5D 4NRZA 1N12A 2O6FA 2ZF8A 1NGPL 4G70B 1J86A 1RL1A 1U8MB 1FAKT 4OZHB 3PY9A 1NC4D 2Y7QB 4GEJA 3HBZA 1W15A 4PJ8A 3V5KB 2BFVL 4FXKB 4B97A 5HYSG 4F27A 3DO3A 3U4EB 5E8EA 5FUOL 1Q0YH 3O4LD 2PYEB 4B8CD 1IB5A 1E40A 3CH1B 1IBHA 4HC1A 1FNAA 1Q94B 3DV4B 3RX8A 4NUGL 3FW6A 1E4WH 5E99H 2ITDB 3SDXB 2PXYA 3N2JA 3D18B 5IKCB 1U4FA 4L8CA 3INOA 4MXQD 3BHBA 1FNGA 3SKNB 1AI1L 4G71B 1UM5L 4O9HH 1GGTA 2ROYA 3CFKA 4DP8X 2ALAA 4KI5F 4P0DA 4Z7VB 2ICWA 3JYBA 4N2HA 4RGMC 4PJ8B 1J5DA 3FXIC 5AFAA 1FYTD 3O3EA 5DC2A 4YSEA 2AEPH 1FJ1B 2JKJA 2RGSA 1MFEH 2GEEA 5B1AB 4AYMC 1EHKB 4JFXA 3RTQB 4U6YA 1HL9A 2WVVA 4XVSH 5DQ9B 1HSAA 3VFNB 3K74B 5IUCA 2C9SA 4G1MA 5F9AC 4IQHA 4ODHL 3TPUB 4NENA 3KR3L 4MNGE 1JTPA 3Q2NA 3JWDL 4WQOA 3BHBB 3R8QA 3RIFF 3WS6C 1JXGA 4RA3A 1JZ3A 3VFRB 2BS71 4R0LA 2HTKD 4BEIA 3TJPA 3T0DA 3EH2A 3DHUA 4F8OA 1FRGL 4XXDA 3OJAA 2ZSVA 1EAQA 3NJGA 1MUJB 5LCVA 4JN1L 3ZE1F 4WFEE 4KRLB 4HALA 2XX0A 1JD7A 3FKUS 2CZNA 5L7XL 4JRXE 4IGBD 3RI5K 1CCZA 4LLMA 1HEZA 2HLFC 4NWTL 1NFDE 3BN3B 2WLLA 3MRNB 3CUPA 3GJFK 4UDUB 3QBTB 1Q0XL 1MFBL 3B43A 3QA3B 4TUUA 4U09A 3GIZL 2KL6A 2H9GB 1U4EA 3L4XA 3OAYK 1KUMA 1NCCH 1ZT4B 1BEYH 5GS0D 2VM4A 3B5HA 1OCZB 3IDIA 1EFQA 1U93B 3W3NA 2TAAA 1H3UA 4TLUA 5IOKA 4ELKB 4YEEA 2Q8BH 4CC0A 4PTTB 3E38A 3FT1A 4XXDB 1I82A 4MLIA 2R0KL 1ZDQA 2CALA 1G7QA 3BXNB 4KITB 4Z3HA 1IC4L 4JX0A 4KRPD 3V0WL 1Y6MR 3K6FA 1CN4A 2VT0A 5AAWA 2L3BA 1UADC 3X13A 4L3FA 1XWVA 4A2FA 4FFVD 2NY6C 3SYQA 5DJ2B 2FTAA 3J8F7 3KVPA 2H32A 1WC7A 2OXHA 4JFEB 3SBPA 1AKJD 1F4WH 4QRTB 1BQ5A 5DFAA 5JOFA 3ARFB 1AQHA 4JPIA 3KHQA 1MSPA 1E6JH 4GIPD 4DVBB 3AWGA 4PRNB 3O4LA 1MAKA 3HNVH 5T3XL 4N8CH 1OTTC 1G7QB 4QHLB 1WAAF 3D6GA 4KTEH 4F3FA 3VXNB 2ZWKA 2JELH 4MXVE 4FYTA 3FH8A 4OLXH 2FT6A 1RJZA 4RX4A 1DQLH 1YEJH 5GGRB 3EYVA 5JHAA 2AEIT 4JFHE 4MBOA 4OIIL 2ZKHH 3MROA 1T4KB 1RUAH 3NIDF 3F7KA 2GQHA 1I1AD 5ES4B 3F00A 4R2GB 4M6OH 2JXMB 2FWOB 3C6SB 3LNIA 1HHIA 2BMKB 2AXWA 2QFRA 3A6CH 3PWPD 1F90H 1SJXA 2ZUTA 5EEUA 3UJTL 1Z7XW 1KWGA 2OMTA 1CIUA 1CVSC 3PG2A 2R0ZH 3H1ZA 4Y8AA 3TIDA 3S5LG 4XVUC 1ZGLP 1HEHC 3IYLW 3ZYNA 3A47A 3GNML 3QNXB 3V2AR 2DWTA 3BUPA 1U21A 4PRAB 3VU1A 5LUMA 2VERA 3DV6B 4G6ML 4TTDC 2F53D 3FN0H 3WY2A 4UZGA 1KMGA 5PCYA 1RJZB 4LGRB 2NYKA 2OYPA 3W39B 5GGSA 4XGZA 1ORSA 3W9EB 1BFOA 5C0RH 1YRKA 2VXVH 4UQ2A 5JPMC 4AIEA 3O6FB 2GBTA 4APQD 4MJJA 3ZKNC 3BWZA 3UTSD 1QLFB 2QSCH 1IGFH 4D9RE 3DX2A 3FTWA 2CKBA 3F05A 1IC7L 2WCPA 1WBZA 4L05A 5GRVL 1EHLH 1TEFA 3DSFL 4QRAA 5KS9F 3DI2B 1MCPH 5FKAA 3QG7H 4KQ0A 2XXCB 1NQBA 3K0YA 3M45A 3OWRA 4XE0A 4HKZB 2Y2YA 1TQTA 3BDXA 4UMSA 1J9CT 3OKMA 3QQ3B 2W9EL 4HG4J 1JHLL 4LL1A 4HH9B 4AY9X 1HL4A 2J4WH 2XTLA 4QTIH 3BLPX 5HVHB 5MEPB 4HHWA 4GAJH 5EDSA 4U1JB 1ZLVK 1GHFH 3M7FB 1NCNA 3U25A 4KAQH 3AC0A 4ABWA 1BOGA 4DVRL 5F7UA 3TP4A 3BQUC 2AXFB 4JGNA 5SX4I 2Y1ZA 2CKBB 2DY2A 1FH5L 1WBZB 1XZWA 3QFJA 4JFPB 4AX3A 5D71L 1UG9A 5JORB 2VDQB 3WEXA 1ZHLA 5EBWA 2A9DA 2DTSA 2ZP8A 2FX7H 2NR6A 2IGFL 2AABL 2CK0H 4FXLA 1IE5A 5TJWK 4UANA 3OB0H 2OK0L 4MZRA 5DI8A 3BN9C 4W9EC 2W0PA 2YGQA 3FQ2A 4XOCA 4EXPX 5EZJB 3MOBL 1LMIA 4LCIL 4N2GA 2FHFA 4GQZA 4KMQA 4Z7OB 1AKJA 1XAUA 3M1BA 3S3SA 3T65B 3F84A 4A2LA 1PZSA 2HT4D 2VLRE 2VQ4A 4Q6IC 5CS7A 1EJOH 2DWYA 4BXVA 4DUWA 3N43F 1MWAA 4U05A 1TQVA 1W72B 3BMVA 4NQVA 4OF8A 4QYOA 4TULL 5E1IA 3U7WL 3MV9D 2UY6A 1ZHLB 4GRLC 2AGJH 4LOUC 2XTJD 3S7GA 4AIZA 1F18A 5DJ0B 1QBLL 1HINH 2EDXA 4OLEA 3RQ3A 5C0AD 1D0BA 1OGTA 1ZJBA 2XZAH 5GJTH 4FQ2H 4ONOA 3QUMH 4HHAB 4P3WA 1A6AA 3VDBA 5AAMC 4XBPA 4QHKJ 1UJ3B 2K8QA 2Z1PA 2X4TB 1B9ZA 2A9MH 5JYMA 3B9KC 1R0AL 2HJLB 5HVGB 2VLJD 4RFOH 5L8JB 3ILPA 1U8IA 2F8OA 4YSRA 1JNHA 1A21A 3L5HA 4ZMLA 4M29A 1EBAA 1MWAB 2L7UA 4AKPA 2LQRA 3D50A 4QUOA 4QYOB 3ATDA 4YHYC 4CADB 3AG4B 3AU0A 2UY6B 4ZAKB 5KVDE 3QK0A 2F53A 2ODHA 4N0CC 3KWWB 2AQQA 3H9SD 1TCRA 4MJHA 3OMIB 4ZFQA 4S1QL 3U9WA 3JQOB 4CKQA 4J3TA 5IHHA 1OOWA 4PJ5E 3W82A 2F19L 1Y6NR 4X6DA 4APQA 2F74A 2OTUB 5LGKA 5FDWA 4PRHE 3RWFA 2M26A 3FU7A 1X5FA 4XCCH 2ZYSA 1JK8A 3C9NA 3J07A 1JPTL 2A9CA 5C6TL 1BEXA 1U8IB 2ILLA 3DX1A 5A2IH 1QAWA 2CKNA 2DQIH 3C5SB 1JFHA 2P48B 4O51A 4XE5B 3TEYA 2VLKA 1MJ8H 4J28A 3MRHA 3WPEA 1JZDC 4HD5A 5CNHA 3UJJL 3B9DA 1G4RA 1TENA 5DMJB 5ESVB 4DK3A 1QTYT 1FGVL 4ADIA 4J4LA 4KROC 3VRJB 3SGKA 2PNDA 2FEDD 2DDQH 2JQAA 4NN7B 4ZD3H 3IKKA 4DERA 1EDYA 1X6LA 2NXYB 1A64A 3VYNA 2YMTA 3TFKC 1DLHA 4XPHL 1NCAL 5KN5A 5KVEL 3UC0H 1JPFB 3CFBA 35C8H 1NA8A 4M6MH 2NNXA 3MJGX 3MJ7B 1OAZL 4GMTH 3ZHNA 1RUML 1IAIM 3C09B 5IQ9B 1KB9K 3CDYA 1NCIA 2JVUA 3P77B 1RZJH 1E4XH 3DVFA 3MRJB 5D1XC 4DKAA 4ZFGL 1HWHB 4N9GA 3SE8H 1KCRL 4POYA 1IFHH 3W5MA 1G6RL 4PJEA 1X9UA 4RBPK 4K2UH 4JG0H 4JB9L 3REWB 4FZ8H 4HS6B 5G5DA 1O5DT 1YNTB 5F7YC 3FQ4A 3AJ7A 3MV9A 4JFFA 4YWGH 4TSAL 5IHWA 4H25B 4BKSC 4AK2A 5GGVH 2VDOH 5SWZD 5KN5B 4P2QD 5MERA 4F7MA 2HN7A 4JKKA 5C0AA 1AP2A 4WV1A 4JO1L 4Q0XL 2G30A 4ZPTA 3HCVB 4RMBA 3HE7C 1B88A 1BV8A 1JNLL 1MELA 1XGRA 2VLJA 3ARGB 3DJZA 3EYSH 3JWNE 5D6CB 4PJDE 4PLKC 5EH1A 2PPCA 3G5XB 1FN4A 2WTPA 2R0WH 5IR1A 4G7VH 3GZOA 2FD6L 5J13C 4DKEL 4YDLC 1U92A 1A5FL 5HDQL 3LKNA 2GSIA 1TT6A 3WKMH 4Y1AE 4N2IA 4I88A 2H41A 4PWHA 5DRXA 4LSSH 3MRDB 5D7JA 3UPAA 3WNOA 4J6IA 4PJHB 1ZLDA 3OLDA 1HIML 4P06A 3RFRA 4IW4C 4BWUA 1MFCH 3QCUH 2OCJA 4I3RH 4ICXA 1NDMB 1P7BA 4L4VD 5ANMB 1HSBA 3RWJA 3QIWC 5JIPA 5TK4A 1T1WA 1KTBA 3INUH 3CC1A 3BAYA 4BK4A 4YXKL 2Z65A 25C8H 4IMLB 2DQCL 1S7WB 2PMZA 3Q9PA 2VN4A 3HJEA 4Y1SA 4L9LA 4L4TB 1CG9A 3B4NA 2A4EA 1TTBA 1HN1A 5CF3A 3BDYH 1WCBB 4AGQA 2IADA 2G9HA 5DRXB 1XAKA 1MZYA 5CMAA 3X1NA 4IJ3C 4W70A 4N0YH 1DS9A 3KLAB 5ENWB 3CDGA 2RR6A 5E8OA 5ID1A 3Q0HA 1AXSB 3DIVA 4LEOA 1BZ8A 5BVJA 4XVOA 1Z5YD 1OANA 2N59A 4K5OA 4E41A 3QORA 3WE6B 4JFQB 2YRLA 2D3LA 5LQBL 4G42A 2WVUA 4P9HC 3FO0H 4GRMA 3EOTL 4JPKH 3IJHB 3VFGH 3OHXB 5EC1A 2H4EA 1G5AA 3CGTA 3QG6B 3WCYA 5J6HB 1G84A 1DN0B 4QXTB 2IADB 4I0PA 4G8AC 1DYZA 2DW5A 2J1XA 2G60L 2JV6A 1JF1A 5BZXA 4QNPE 1CL7I 2VDRB 1J18A 4Z95L 3U7YL 1QEWB 5JHDD 1O7DC 4JCWA 3CDGB 4ISVA 5EIIA 2Y23A 15C8H 3G5VB 4J4PD 5C0CE 4E41B 1QSED 1DSFH 5CGYC 2E4FA 1R5WB 4GRMB 5F0JB 3IDMB 4YFLF 2BSRA 4FS0A 5C0GA 1QHOA 2RBLA 4LNRB 3N50A 5M94B 1KXQE 2QKIA 1HI6B 3GMLB 2UZIL 1VKXB 3KL0A 2BOCB 3MBWB 4N8PA 4M61A 4MA7H 4PYHA 1PGVA 1M9WA 5BMFH 2OMZA 2QGDA 4PRPB 2JSFA 3WDHA 4ISVB 1S7QA 1CGUA 2VQUA 3H2QA 2VDKH 3E6HA 4H0IA 1TDQA 2B5IB 4FQLH 1UKTA 5I8KL 4LLDB 1XD1A 1RUKL 2Y9RT 2WCGA 4ES9A 3ZK0A 3AY4A 4P59L 3C6OB 2GUYA 4G9DB 5C0GB 4TRPH 4AZ8B 6TAAA 3VFWB 2YHGA 1OLZA 3VI3B 3RP1A 2XPGA 2DV6A 4NC1C 1XWDC 2Q5BA 3O6MH 2B77A 1XH0A 3CXFA 4MJIA 5BNXD 5BW7A 2O5ZL 3PNWA 1NFIB 3ARBD 4PGDA 3NFNB 2CR3A 5KUKA 4CVZB 4J6RL 5B1JC 5GGVY 3JTTB 2YGVA 1FFOA 3E2HB 5CJOL 2GJZB 2ITEA 1INEL 2WIMA 2XV0A 2YRBA 4P3DA 1DFBL 3OXSA 2JJUA 5AW6B 3EUUA 4Z76A 3EDEA 2BRRH 2O61A 4B9GA 2YXMA 4POZD 5E9DE 4GLRH 5JW4R 1AZBA 4Q9CA 1S7UB 4HS8L 4LBEA 4BSSA 3SDYH 2D03L 3QS3A 4FG6C 2ZE0A 2BIMA 3H54A 3WMQA 2X41A 2VL4A 4MJIB 1NOLA 5CSGA 1IT9L 2WQVA 4G8EB 4UQEA 3CN3A 4HK0A 2QPDB 1J8HA 3LKSA 1RFDL 2XG4A 3WXWL 1CR9H 4J8QA 1EO7A 3MLWH 5GGTL 1IVLA 3VG0L 4FQJL 4G3YL 2AITA 3WNMA 4BDVB 1D5ZA 1KOOA 4P3DB 5ESAA 4P4RA 1G7JB 1ZIAA 5D7IB 5EDXA 3T8XA 4E9QA 4F7KA 1I8LA 3BRFA 4K23H 4HOMA 1BG1A 5MI0C 5DS2A 4F2MA 1T6BX 1SM3H 3L2MA 1BZ7A 3L3IB 4HSCX 1OARH 3H85A 4LHQB 4AQAA 4M8VA 4ZTOL 3LB6D 2XWZA 3BSGA 4J4PA 5I19H 4QY8B 2ZUXA 4OCSH 5HZLB 3LRMA 4KI1A 5CZKA 1U2CA 2Q6WB 2FIKB 4PJ9D 3VXSD 2N7BA 1WQVT 3W3BA 4S0TD 4R96A 3HPJB 3EHBD 3D1MC 4PJXB 2O6CA 3U6XS 3IVKB 1QFWH 4S11A 2Y1AA 8CGTA 2DQTH 2BNQA 2YAEA 4AL8L 1OV8A 5C09B 5TE6L 4HC1H 5C86A 4W6YB 1NEPA 1S7RB 3DUHA 2PWFA 4PWKA 1ZLSH 3CCHA 2D7TL 3UN9A 2VO5A 4XTRD 3II2A 5DMGD 3VNZA 4BZYA 4ZXBD 3UBHA 1D5IH 4NHUA 1X5IA 3QFDB 1E5BA 2VC2H 3EYQC 4GRWH 3TJHC 4UUJB 4YIQA 4JHBA 4FI7A 1YPZF 1GGUA 4QXWA 4H26B 1LEGA 2NLJB 4GW4A 1G43A 4TUJB 1ZT7A 3FCUB 4ONFL 5F0MB 4CDHA 2ICWJ 3VXQB 2E6QA 3G9AB 3MJ9A 4OFYA 3V6FB 3LCYA 4LSRH 4I9WD 5LKNA 4JQIL 2PO6C 3Q2LA 1RZIB 1IGYB 1UXWB 1ZT1A 4EBQL 2OMVA 4OZGA 2B14A 4FQCH 3BYYA 1CF1A 4HF5H 4NHUB 3GSUA 3CAFA 3QDMD 2EJ1A 1NAMH 2APBA 3U4KA 1V7NH 5I0WA 2BW5A 1CFVL 4JY4B 2J21A 5CLXA 3UCQA 4NZUH 5E1AA 2OMUA 4BGDA 5BO1H 3VCLA 3G04C 4FFWD 4H8WH 4HU8A 1DJWA 4HSAC 3T0EA 1HFUA 3PWNB 1B9KA 2EIEA 2X6CA 4HS3B 5AW1B 4BFOA 4E2OA 3NJHA 3UH8A 5AVVB 4L37B 3D4GA 4EVNA 1KACB 1W6LA 2JLLA 1A7OH 4H0HB 3O9WA 2H2SD 1DVSA 1AXTH 4UM9A 1C5BL 3BLKA 5KANI 3VQ2A 4C56B 3E8VA 3O2WL 4L4JA 5G55A 3VGAC 2CHDA 2A99A 4OUUA 4QO1B 4YHPA 5DEZA 4OZGB 3C5JA 3I3DA 2FJUB 2G2PA 4JRXD 3T04D 2GHWB 3VQMA 5JYLA 1KIQA 3QPXL 3W81A 2QSQA 3GMNB 5DUPL 5LFNA 4GI6A 2B9AA 4KJPC 5IOPA 2W81C 3L3KB 4EAEA 5L9DH 3QZLA 4DCQA 4UILH 2B39A 4EVNB 1U8LA 1SOKA 5GMFA 1AOHA 1AIZA 4M7EA 3QR2A 3SY0A 4UM9B 1IEBA 3LN9A 3SOBH 3NZUA 5DD1L 3CFQA 4QCIA 4D0CB 2OZ4H 3EAKA 2G4EA 2MOVA 2FQDA 3COOA 3VG9C 2CO2A 2WANA 2HFGL 2EP6A 5MHSD 1R1CA 1VACB 3OAZK 1H3PH 1RULH 3GMOA 4K8RD 4PY7B 2H26B 5I8OH 3HNTL 5ALBL 4Q9QL 5F7DB 5GMHA 2YQGA 4DCQB 3LXCA 4I89A 5L88H 1BPVA 3IGKA 3UO8B 1MHCB 3W3JA 2VXTL 2JJTA 3GIVB 2IPTH 2HJKA 3OL2A 5TGBB 3O45B 3V4LA 4RWTC 3D3VA 1GMIA 4HD9A 4N2NA 4XNUL 1JXDA 2R8SH 4JFDE 4G5ZH 4LAQH 1KG0B 4BHUA 3GZKA 5EEWA 3OR6B 3PHSA 3HHSA 4G11A 4JFHD 4LSQH 2MRYA 5IGXH 1IEAB 1XB8A 2GBAA 4Z8FH 2VDPL 4NP9A 4HUUA 5FIEA 3REZA 1FPTH 4N4YB 4F1SA 4L1BA 1WWCA 5TF1L 5C07E 1A1NB 1NMAL 4K9EL 3SGJA 2DOCA 3F3HA 4NZTL 4XNBA 1FV1B 2YA1A 1RIUH 4IEFA 4M3HA 1RZ7L 3HC3H 1U91A 1P7KB 3QO1B 2VDNH 2AK1L 2Z7UA 1V7MH 3PABA 3QDMA 4OZ4A 2HJKB 3H42L 2P1YA 3GSNL 2LABA 2ZICA 2K6ZA 3FT2A 2YS4A 4PEQB 2ZOUA 3F7YA 1S46A 4IKNA 4TUOA 1S78C 4XN8A 3ZHLA 5FECA 2GI7A 5K5YA 2X4NB 4UNUA 3I02A 3UZVA 2VABA 1GZHA 3MC0A 4N2EA 3MSPA 2J1WA 3IJEB 4LCYA 4QRSA 4X4XA 2F7RA 5GS0H 1NBZA 4LFHG 2HVKA 1RSFA 3EH3B 2R4SH 1PY9A 3IN0A 4N86A 3TBWA 4AVHA 3WKPA 3TZVA 4PSRA 2G5UA 3ZKSD 3KBEA 1TSRA 4OF5A 4Y5XC 4KQ3L 2IBZY 2BNRA 5DA0B 4Y4FC 1MCOH 3O8XD 4HMCA 2NTFA 2I9LB 4YHOH 3BO8A 1MCFA 4W68A 5I1CH 3O41A 1F2XK 1F97A 1XFPA 2GJ6D 4R3SA 4CVXB 4L8SA 2X0VA 4MA8L 4YX2H 4HZLA 4DF9A 1KTCA 5EU7E 1WBXB 1SXZA 4FG4A 4Q4EA 4XPFH 3SYAA 1ZANL 2J55A 3VFPB 5HXMA 1Z32X 5FOBA 2NQ3A 3MU3A 2NY2C 2GTWB 5JOEA 4UF7C 3PWVA 4TNWK 3T09A 4U31A 4K3DH 3L48A 3MLVL 3I74A 5GRJL 3VE0A 5B0TA 1UM4L 2JKWA 4R8WL 5K9JH 3N0PB 5FO2A 1IQDB 2BVPB 2F2HA 2R0LH 2YAFA 2HPOA 1UYWH 1OCRB 2CO3A 3S5YA 2VLRD 1EEYB 2V3DA 4G8GA 3HPLB 1E9OA 3LEVL 4ZMYA 3ULSA 4ZMAT 5HDBF 4RMQA 2FLBT 4U6HB 1JBJA 3Q9QA 3I6GB 3MRPA 1VIWA 2BIQA 4JUSA 4P2CG 2BVOA 4U2YA 3TEZA 5FHBH 2R69L 1RLBA 5I6OA 5D5MF 2Y25A 2P8PB 2E7HA 3D4ZA 4JM2C 2Y07L 3FO1B 1BF8A 1AG0A 1N5AA 3QYCA 4XX1E 1ANUA 4KXDA 2V7HB 1GKOA 3MA9H 4BV1A 5AOIA 1N4XL 2VISA 3FMGL 4WWPA 5DS1A 1MIML 5DD0L 1LK2B 1NKGA 1XL4A 1LE5B 5EU4B 1QNIA 2BSED 4WSJA 1E9OB 2HKHL 4U4BA 2WLIB 3DYOA 3QWNA 5K9QG 4M6NH 3W0WB 4DW2H 3D2UD 4GG8B 1SXAA 2MHAB 2YSSB 1JF6A 4HZ1A 4MYPA 4FHOA 3ZL4H 3F7VA 1AIFB 4KVPA 1ADQA 3R1GL 5F88A 3QWRA 1KCWA 1MAMH 1AE6L 1OKEA 3NIDB 2VIRA 4AT6A 2ENJA 4ODVH 2NT1A 1V10A 3OAUL 1I7UB 1WHPA 3PDOB 2XIIA 3MOAH 4BH7B 4NM8L 4AE1A 4PRHD 2B16A 2IFFL 4WNQB 5DZLA 4NQSB 2PWDA 4NKOA 4FQQA 1DVFD 3SDCA 1K9TA 1NCGA 1KJ2B 5KS9A 5F96H 3BP5A 1EBPA 1SMDA 4BSVB 5ICYA 1AVAA 4LOFA 4N90E 3CH8A 2B7DT 3B2DC 4WVRA 2EVFA 3OJDA 3HI5H 1P6WA 3KPLB 1NPUA 3GXNA 4A7UA 1YEGL 1IBYA 3P9MA 4NO0A 4OD1L 2F58L 1ZXQA 4QRQB 1H3WM 2DQGH 1QWNA 3CSYA 1YY8A 4DJMA 5BS0A 1A1MA 1JNNL 4YFDB 3QNZA 4KY2A 5LWYH 3B2PA 2GJ6A 1UOWA 1WEJL 1MCBA 3NBNA 4OCWH 4FQIH 2A6JB 1X7QB 3B34A 1KJ3H 3FT4A 1HCFX 4FQQB 4GW1A 4FYRA 5IEKB 4PR5B 4EUPA 1INDH 1OGAE 1HH6A 2AXGA 2VZSA 3KMDA 2VNCA 3OZ9L 5A2JH 1RU9H 3RPBA 4XOSA 4KPHH 1KV3A 5IT2L 4EZMA 4M5TA 2YIHA 3HG1E 5AVUB 2P5ED 4YSAA 5D7KE 1MEXL 5BQ7A 4BFBD 1D9KA 3LYRA 1X5GA 1XZ0B 3LKQA 4LCVA 2HX7A 2XWRA 4MS8C 1JDAA 2Y5TB 3A0OA 3GXIA 5IESH 4N0UB 3SN6N 1XMEB 4FMZA 1I4FA 2ZKWA 4A2DA 4YE4L 1WISA 5FV1L 4UZSA 4LVNC 3GOZA 4ZSOE 2ITCB 1HVXA 4P2RB 1ZWIB 3MODH 3WHE0 4OCNC 3VD7A 3HIZA 2DWEA 5GRYA 1MI5E 2R59A 1E4HA 1U2HA 3FF7A 4ZRGA 4AGPA 5A40E 4FCGA 2G5BA 2V9UA 3D69A 1IKFL 4FULA 3GO1L 1FDLH 4RGND 5FYJH 3AREC 1S7SA 3C60C 4HIEB 4YGVA 4RQQB 2JE1A 3HG4A 1ACZA 1G7MB 2WWKT 3J27A 5D1ZA 3OTTA 4PV9B 2XVKA 4F7TB 1M7DB 4W9ZA 4XNZB 3TYGL 4KUZH 1KTLA 5FGRA 3U48A 3EFDL 3R7QA 5C0ND 4C8XA 1BCIA 3TBVB 4Z3IA 1QVOB 2BZCA 4HIQA 3PGCA 2VDOB 2J8UE 3ILEA 5JDJA 3O4OC 1AZZC 5EOQL 5CEXB 4NRYA 1TNNA 4E9LA 2V9TB 4Y1AD 5AYTA 3BIAX 1JGUL 3UTTE 1ID2A 1BDYA 1LK3L 5CZRA 5DJ8B 5E5MA 5G4NA 3TYFB 2LLLA 5DC0A 4F5CE 3ESVF 3GSVB 3NEOA 4KDTC 1ZHBA 3HZMB 1QACA 3OQ3B 5DUMH 5CEZE 1DVFA 3BZ4B 1N59B 4GKZA 4Y7MA 3RG1C 5JHLL 4FDWA 3QXWA 3FU8A 4G80A 1WWWX 3QZNA 1CLOH 4K15A 4Z23A 4BSUA 4X8XA 1KCKA 3PAYA 5ADPL 4I1NB 4IRJD 1NM9A 2P7TA 5EEXA 1U8JB 4RDQF 2J73A 5DJYB 3VI4B 1MFAH 3WKNA 1LILA 2KMWA 1GOHA 5SX4H 3ETBF 4CSSA 4KRMB 3IDNA 5FEBA 3E8UH 1VEOA 3GLDA 3R4RA 3I3BA 1LO0H 3QH3A 1QLEL 1GZPA 1JXKA 1KBWA 1O7SA 2GUOA 1TETH 3FUFA 1AFVL 2H3KA 2UXTA 3DRTB 4X50A 4Y9FA 3D25B 2FZ3A 3VXMD 5AKRA 4PGJA 1C5CL 2XICA 2FJFA 5C0EB 5KYYA 3MRQB 5TDOB 1FAIL 2BSDA 3F8UB 3I6LD 5T5NG 4X9YA 5K93A 2WM0A 1H8LA 4FFYL 1MCNA 2P5EA 1I9RL 3V5HA 1DLFL 4XMKH 2P7TB 1XHHA 5HY9A 1JG9A 3BPNC 1HNFA 4GKSA 4RETB 4NZ8A 1U95A 3HI6H 4XAWH 4O2CB 1NC2B 2GUOB 5CP3H 1N19A 2O72A 4BKLB 3QUXD 4F9PC 2FZ3B 1NMCB 3UBXB 1MREH 1PY4A 5B0NA 4J3OD 2NY7H 5I8CA 4BCYA 1Q1JH 4OGXL 3L54A 2GI0A 3OKKA 4RWYL 2UXVA 5I6KA 1J1PH 3NGBB 3DO7B 1T1ZA 2JJSC 4X8CA 2ELLA 3CFIC 4HMEA 4U3HA 1FG2B 3P69A 1SN0A 4NBXB 4F8QA 3D06A 4XMXA 5AW5B 1DBJH 1CO1A 2EXSA 4NYLB 1SYVB 3OGKB 3CZEA 4P07A 2VSDA 5I73B 1WK0A 1TZIA 4NPYA 3BVTA 5D1XE 2FUQA 2IPKB 3QHZL 4HKXA 4M6AA 5MENB 1T21B 5FCUH 4BSWB 2WIIA 3WPIA 1UKQA 1RZ8A 2A38A 2OTWB 1TZHB 3NQIA 4UV4H 1OD7A 4FEIA 3RZCD 5DHVH 4M93B 2NCMA 4LP8A 4TLTA 4WW2B 3KCWA 4MQ7A 2BJML 1KLGA 4C4KO 2D3NA 1PEZA 4AMWA 5J1SC 4M8RA 4NS0A 1PG7W 5K9KA 4GP5B 4O2EB 3K6NA 4WI8A 2JJVA 3RPIB 2F54D 1OT1A 4KBPA 2YBRB 5B7EA 5EA0L 3TA3A 3QUGA 4P5MA 4B9IA 5DK2B 1SEQL 5EF0A 4AGNA 4KRNA 5I1LA 2GB2A 1AS7A 3KLSA 5J11B 3NJMA 4J2QA 1ZLWH 4W4OC 1RZ8B 4AEFA 3QUYA 3L9YA 2IG2L 5B8CC 4XC3L 3SO5A 1QABA 3IDYB 4MQ7B 1E8XA 3F5WA 3C6EA 3FN9A 2KUTA 3WPHA 5E9DD 1JPST 3PU7A 5K9KB 2WLYA 5I17B 3QULA 1L9TA 5IB5A 3DGGB 3VXMA 1T5WB 2H3NB 3KJ4C 1A9EA 5KVFE 1W6WA 4IRSB 3STLB 4RISH 3SQOL 1UA6L 4JHWH 2B1AL 1U42A 4P5MB 3SCMA 3W2DH 3JTSB 3G6JE 2CLVB 1OAXH 3LH9A 3ZE2E 3F58H 3RU8L 4YK4C 4Y61B 2CLRB 1BGXL 1ETZA 4Z78B 3FB6A 1TR7A 3NJJA 2R4RL 1OB1B 4QYAA 5CILL 3PJSB 3GEFA 2WUCL 3TNNA 1OY3B 1P1VA 2BERA 3QQ4B 3IJSA 2Z31B 3Q48A 5TPWL 1BHGA 5C08E 3SKMA 4OJFL 3OGCB 3ZKQD 4CBPA 1OOAA 4XNYL 1XIWC 2NY3C 2XKUA 2JJWA 1PGRB 4JO3H 2BCKB 4KMLB 2V2TB 2OJZL 1WWBX 3HN8A 1FNSH 5HYJB 4LLVA 2ZYHA 5JZ7C 1CZ8H 1FUNA 1WZ1L 5FHAH 1C12B 4P48A 4NQDB 5HI3C 4Y19D 3BPLC 3PIQB 3FB6B 3TWCL 1PLGL 4DP0X 5BV7L 3EH5B 3SJVA 1LEIB 3VDAA 4OZIE 2DEYX 3R18A 2OL3B 3HZKA 2KKQA 3KLHD 1XGUA 2BIPA 2QPFA 4X0KB 4G82A 5F9WB 2IFGA 3MXWH 1URLA 5DEGB 2JQDA 1OTSD 2CJTA 2VGLM 2YOCA 4IOSD 4PJIB 1L9OA 1R5VB 4WKXA 5AG8A 4B3EA 1O7DE 1UWXK 2CPUA 2BPBA 2EH8L 4F8LA 3HE6C 1AYOA 1R3JA 2NCEA 3F12A 4H4NA</