4CC4C

Complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
263
Chain Sequence
SESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSALSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKVNEPVKYQPELYITNTVKDPDGRWISPAAISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INLC PROTEIN
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Cell invasion
total genus 82
structure length 263
sequence length 265
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08191 LRR_adjacent LRR adjacent
C PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4cc4C02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4cc4C01
1XEUA 4PSJA 4CILA 3UL7A 2BEXA 3ZYOA 3REZA 2UZXA 5IYXC 4KXFB 2P1MB 2ASTB 5AWCA 4Q62A 3CIYA 3BCDA 3RW6A 2P1OB 4AY9X 2OMWA 3RIZA 3DZEA 4C2AB 1OZNA 1WWLA 3A79B 2CA6A 4Z94G 4R0AA 4V2CA 3WN4A 4U06A 5GMFA 2XOTA 3OJAA 3WPGA 2O6QA 2V9SA 5CMPA 2WQUA 5GMHA 2R9UA 3ZYJA 3UL9A 5B0TA 3ULVA 4R08A 3W3NA 3W3GA 4V2EA 1A4YA 3E4GA 3P72A 4P91A 3RGXA 1M0ZA 4MN8B 2JE1A 4WYKA 2Z63A 4XGOA 2ID5A 1H6TA 3UL8A 4FCGA 3UN9A 1OOKG 2JQDA 4J0MA 3M19A 2ASSB 1G9UA 1P8VA 2RA8A 4BV4R 4FD0A 4CP6A 2Q4GW 4HQ1A 3ULUA 2Z64A 4R6AA 1QYYA 3E2JA 4R5DA 4V2DA 4CNCA 3RJ0A 4R58A 4XSQA 4YEBB 1H6UA 5IJBA 2RR6A 4CNMA 2WQWA 3WPDA 4QC0A 5LFNA 1XECA 1IX2A 2Z82A 3CIGA 1M42A 4NKGA 3W3LA 4UFRA 3RFSA 4ARNA 4GLPA 4U7LA 3G04C 4FHOA 1M9SA 3O53A 3OJAB 4OQTA 2O6SA 4U08A 4BSUA 4LSCA 3OGMB 2C9RA 1DFJI 1XWDC 4NKHA 3SB4A 1A9NA 1P9AG 4G8AA 2FT3A 5AWDA 4I6JB 3WPBA 5CMNA 4QXEA 4R09A 3W3KA 3JB9j 1O6SA 4AQ1A 4WP6A 4LI1A 3C6NB 4XOSA 2P1NB 1FT8A 4RCAB 3RW7A 4Z79A 1NM4A 2P1QB 1KOOA 2OMXA 3FAWA 1K5GC 4ARRA 3G39A 1DCEA 4LSAA 1OT4A 5IJDA 3FXIA 3M18A 1M10B 1XKUA 5D3IA 1M9LA 2Y5QA 2Z65A 3TSRE 1IO0A 1O6VA 3OGLB 4FMZA 2OMTA 4R5CA 4Z8GA 4H09A 4KNGA 2Z81A 5FTTB 1JL5A 4R07A 4J4LA 5HZLB 5A5CA 2OMYA 2Z62A 3RGZA 3C6OB 3PMHG 3W3MA 3KJ4A 1LTXA 1U0ND 4QBZA 4ECNA 3CVRA 1FQVA 3WPFA 3C6PB 4EZGA 4LSXA 3G3AA 2OMVA 4CC4A 2IFGA 5AWAA 4FS7A 3ZYNA 3VQ1A 4Y61B 3E6JA 3RFJA 3BZ5A 2Z7XA 5AZ5A 1OTMA 1DS9A 5B0NA 1LYQA 4CC4C 2RA1A 4M7EA 4L3FA 4RWTC 3BC9A 4LXSA 4AW4A 1Z7XW 3BCFA 2O6RA 5GQRK 2BNHA 5ICUA 2C9PA 4M7EC 2UZYA 1P8TA 4Z61C 4Z64C 4KT1A 2WFHA 2V9TB 1GWBA 2WQXA 4MQWX 3OGKB 2P1PB 1FO1A 5AWBA 5GS2B 3W3JA 3G06A 4K17A 5GMGA 1PGVA 4Q3IA 1D0BA 2XWTC 1ZIWA 3RFEA 1XCDA 2OMZA 3VQ2A 4BSSA 1YRGA 2A0ZA 4FDWA 5B4PA 3O6NA 4PKIG 5IJCA 3GOZA 5GS0A 2Z66A 2ELLA 3ZYIA 2V70A 4PERA 4R6JA 4GT6A 3E3ZA 2Z7XB 4C2BB 1O6TA 1SQ0B 4R6FA 1OTNA 3FAXA 2OMUA 4L3AA 1OGQA 1FS2A 4LXRA 3WPHA 4R6GA 2WQVA 1KOHA 4IM6A 4Q3GA 1OTOA 2C9QA 1K5DC 4LSXC 4TZHA 1W8AA 3G3BA 4PQ8A 4ECOA 4B8CD 4PEQB 4BSRA 4LI2A 4U09A 3WPCA 3WPEA 4RCWA 2YA1A 5HDHA 2JE0A 3ULAA 3WPIA 4P8SA
chains in the Genus database with same CATH superfamily
3LRMA 4N20A 4CILA 3WDHA 4OM1H 2XG5B 4B50A 2DQGL 3LHAA 3VGAC 3SKUD 3F7KA 3S36L 3ZQWA 3U4KA 1U8PA 3U6XS 1Z0MA 2HRGA 1PSKH 1XZWA 3NEOA 2WAQA 4Q62A 4DEPB 5L2JB 5G55A 1BZEA 4JM2A 3GB7B 1TDQA 2RFXB 3ECBB 2ZXEB 2HTKC 1T5XA 2AQTA 1QR1A 5CJ8A 4E36A 2P46B 1YEJL 3CPLA 1G1OA 1MRCH 1VEOA 4WFGD 5F1NB 1ZLSL 2EXWD 1B88A 3B9KA 2B08A 2DIAA 4LDLB 1CU4H 3OKYA 1E4KA 4Q58C 2EC8A 5H94B 4JFFA 2QKIB 1JOIA 3DXAD 4XBGB 4MMXC 5FYJL 3VXMD 5C0FB 5DRXA 3VXUD 1AOHA 3KWVA 4PJXE 4Y2DB 3DV6B 3NAAL 3S37L 3MFGB 5DJAB 3V79C 1R46A 1EEQA 3U9UA 2Y72A 3OMZA 3ARXA 5EIIA 4L5FL 1KPVA 1ZS8A 1AHKA 4I9XA 4AV4A 2CUIA 1HH9B 5E2VL 3NIGE 4ELME 1BYNA 1CURA 1DSWA 1D5IL 1RIHH 5FK9A 3S3BB 4KRLB 2NXZB 2HT4D 4R0LA 4NZRH 3EYSL 4PP1C 4MN8B 5HD8C 3DJSA 2MCPH 3A67L 3L1FA 3M1OA 4X80H 4O4YL 1RK0A 1WAPA 2QHRL 2JCCE 5DR5L 1PZ2A 3VFSB 2O6EA 2XV6B 3N9GL 3ZTCC 1N10A 1XGUB 4GI6A 3ZDYF 4WIQA 3GRWA 5E9DA 3NACL 5EEWA 3CFMA 4ZPVA 5C6PB 4M93B 1WFNA 5I66A 4PWGA 3M19A 3QDJA 1NCCH 2RA8A 1SDYA 4X5RA 3BSZA 4LVOB 4KXAA 2D3JA 1I3RA 3SQRA 1HL5A 2HYMA 4LHUB 1Z6JT 5FDYA 2OYLA 5JORB 4S1RL 4F91B 2BRQA 3BQUD 5D5MB 3FMGL 1SHWA 3HMXH 4MJ6A 2A2QT 2Z64A 1V54B 3REVB 2FEEL 5CWSB 4FTVB 4UQ3B 1PLCA 2WSKA 1EVUA 3RUGF 3AG4B 4LARH 3U48A 3HUJB 3NJFA 3V0WL 2APFA 1ZTXE 1MCSA 4G1EB 1OTTD 3E38A 4BSVA 1QBMH 3NIDF 3I6SA 3LKPB 2J7LA 1U8NA 2A6JB 5HDBE 3TA4D 3SDAB 4CNMA 3S3SA 2NW3A 2OL3A 4NWTH 3BSZL 5LQBH 3BJ91 1BEYH 5HVWA 2YD6A 4NEHB 4LCCB 4LBEA 5KG9A 4OGAD 4H8WL 2Z82A 5LAXA 4AZ8A 3TVMD 4DPRA 2Q9OA 4K2UL 1YYML 1BF2A 4ELKB 1S9YB 4PJAB 1NGXB 3TYFB 1MOEA 1CFQA 1FVCA 5KBMA 3V5KB 2VN5A 4DFHA 3EGSA 2ZIDA 3VI3E 4YO0A 4H13C 4V1DA 4PJ6A 5I6XB 4F57L 5J56B 5MHSE 3O53A 5E8EB 3FQTA 3EYUL 3MX0A 1BJ8A 1NGZA 4JRYB 1L3WA 2ZAHA 5AW3B 2DD8L 2X09A 1T1WA 1IAKB 3US9A 4Z3EA 4WO4A 4LSRL 3MREB 5GS1B 2B1OA 3IDYC 4U08A 2OL3L 4PIBA 5DEFB 2AS5M 1TJGL 3BO8B 1GSMA 3F65A 4LSVL 5HGAA 3VGGA 5EEZA 1VFAB 1G9MC 2H6UA 1W8OA 3F6LA 3BUIA 3DGGA 3E80A 1DVFB 1OB1A 4OF7A 1W72H 4PRPA 4WY7H 3HMWL 3MPCA 1JXFA 2OX5B 2MCAA 4FYTA 1OP3H 4DAGL 3QUHA 5CCHE 3P2DA 5AENA 4JY6A 4LB8A 4Y2OA 2BRRH 4P3DA 3KL5A 1YNLL 1N5AA 3ZLQC 1ZMYA 3L17A 4F8TA 3GIVA 1HXKA 4R4FH 3BPLC 5MEOB 1DUZB 2QR0B 3MACL 4LE8A 5C0AD 3ARGA 5CSZB 4RCAB 4Z79A 2XJKA 1M1XA 4UAOB 4ZNCD 1NMAL 5IMKB 2JELH 3M17A 1JVOA 3V9EA 2HPOA 1BQ5A 2E4FA 4M8VA 3VFTB 4H2CA 2E6PA 2DMBA 3KPMB 4LP8A 5DQJA 3KPPA 4K3HA 3LEVH 5IMLB 1NANH 5A7EA 3BH8B 2WQRA 1Z9NA 3MJ8B 5FDWA 4PJXF 4W9HC 1MCHA 2ZAGA 5FO7B 4NLHA 3K8MA 3VMOA 5ABAA 4Y16C 3L2MA 1AP2B 1AKJA 3EIFA 3LRSA 5FKPA 3V5DB 1GA2A 3G3LA 4EAEA 2RR3A 1M1SA 1O6VA 3SN6N 3NIGF 3WIFA 4ELMF 4LLMA 1BVNT 1SMDA 2OMTA 1RL1A 3DK0A 1UA6L 4NHCH 4YC2C 5TFSH 4LDCA 5LGKA 2DBLL 32C2A 3QRGL 4WO4D 3DV4B 3DX9A 4ZUWA 5HHOD 5K9JL 2XVBA 3U46B 4E5XG 1AQ8A 4W6YB 1ZKAA 3MNWB 5T1DL 5A5CA 1NKGA 5JIMA 2OMYA 3IM1A 2JCCF 4EI6A 3SDCA 4K71C 4OLEA 2EEXA 1ZT1B 2GABA 2VL4A 4AIOA 3EG9B 4MDJA 4PS4H 1DQQA 4TNFA 4NRYA 2RGSA 4KK8C 3IDNA 1K5NA 4JR9H 5D1XB 4KTEL 3TZVC 4UNUA 5I30L 4H8HA 3VNYA 3V7MA 1ETZB 4AQ8C 4QLWA 1KTLB 2XI9A 2XIIA 1FIGL 3V4PA 2YFOA 5DT1H 4K8RL 2OZ4A 1QNIA 3CVRA 4ZO8A 4BQCA 1B0GB 4KPHH 4MRBA 4WFFE 5AYUH 3T77B 2EO9A 4LVHB 1PVHA 2ZKHH 4N0FB 2F54E 4XPTH 4ESKA 5LNDA 1KYOJ 1XL4A 4U6TA 5E99H 2EUZA 4JHWL 3IMRA 1JI1A 3DO7A 3WEMA 5A3ID 1QTSA 4ACPA 1XIWD 1AH1A 5DVNA 2ILLA 1A1MA 3NSYA 2YN3A 3PL6B 2HB0A 2E46A 5JR1H 3AJ7A 4WSJA 4GXVH 4Y5XC 1NBYB 1UURA 2GSGB 4WWNA 1CT8B 5E0FA 5HDBF 3TIDA 1QNZH 2DQFA 5EBMB 5FECA 2HZHA 3WMSA 1MNUL 3N85L 1AXSA 2B2XH 1KN2H 2HXAA 2HH0L 4S10A 2O5ZH 1JGUL 1TQCC 1I1FB 2EE3A 3V4PL 1DS9A 4I77L 2ZYHA 4PPTA 1BZOA 2OZ4L 4FCHA 1D6VL 3GSNB 3OJ2C 4RBPH 3BZ4B 4PRBB 4ODHL 3RVWD 1ZEAH 1ONQA 2SEBA 1M05A 2Z35B 4JFQB 4L3FA 3VI3F 1W91A 4M7EA 4TQ8A 4HX1B 4WI0B 4OZHA 2CR6A 4FLHA 1QUNB 5D7KD 3S5LA 4UV7H 1JHKL 5CP3A 5KANG 3QRFM 1CDBA 3QHFH 2ZJSL 1QSZA 1JHTA 2LLNA 4WDIA 1ZJBA 2VLJB 3TEYA 5EUOB 2UZYA 1F4WL 3L4XA 4PMEA 3MRCA 3MRRA 3LDBB 1KTKE 1EV2E 2X4TA 4FFYH 4AG4L 3IAQA 2G3NA 1NL0L 4F1SA 5I1GL 2O5XH 1T7ZA 3F6JA 3BN3B 4OQTL 2XQBL 3BD3A 1EDQA 3CD4A 3EOYG 1U3HA 4NDMA 3FYIB 4YSTA 3IETA 3WTUA 3QWOA 2EEFA 4NZTM 2JIXA 5DC2A 5FGSA 1KF9B 1OW0C 1C5DB 5C07D 4GW4B 2GFBB 1A7PL 1U95A 2GBTA 3DROA 3V2AR 4OFYA 3WGUB 3G6JA 5EC2A 1RKRA 1Y6KR 4IK6A 4DKFL 5MENB 2BX5A 5IBUB 3O2WH 2NUTB 3VFPA 5C0GB 1BMZA 1HHIA 2R0WL 1L9TA 3DVNA 3FB7B 3VXOA 1XCDA 1DE4B 5CMAB 3VQ2A 2Y6SC 2VITB 4FKKA 3DLQR 5GQBA 5JZ7C 1AGFB 1DDTA 1E4WH 3GUFA 5TE4H 1JWSA 5C3IA 1ZIAA 2JTYA 4I1PA 4EEEA 2ZKWA 2NNAA 5TE7H 1SRDA 5AVYB 1YYLL 1SVZA 2ELLA 3UZVB 1ZLEA 3CMGA 2VDNH 4HIIA 4KY1H 1NOLA 3ARRA 4HWBL 4RA3A 1H9VA 3UIYA 1YN6B 2JLPA 4J4PA 1TSHA 4AM0Q 3RJQB 4PERA 2FX7L 4UQBA 2ZP9A 3EJTA 1DLFL 1OAYL 3GMLA 4NOBA 2CXKA 3MR9B 5ERWA 2NY2B 4BZ2H 2WXMA 3CXHJ 4FI8A 2F7IA 2Z4QB 1F3JB 3TBYB 4G6FB 4FKHA 1MLBA 3EDKA 5A16B 3GLEA 4IRSA 1WD8A 2AAAA 5C1MB 5I1EL 4KITB 1U8CB 1FDLH 1S5IH 4WAFA 4HEME 2OMUA 1U3HD 1KIQB 1GJUA 4A66A 2Z31C 2FT8A 4BK5A 4KKZA 1HOCB 2JIXD 2V6HA 4NSKB 1QLEB 1HXMA 1AGCA 4LCWE 5CSBA 3ZO0A 3THMH 3K1DA 3NYKA 4HZ1A 1KOHA 3QUYC 1TTFA 1KIRA 3BT2H 2D7TH 2FD6L 3FRUA 3MA7A 2VC2B 3O3DB 4P23A 4X4ME 3FSOA 3RQ3A 3PXJA 2NYYC 3OKEA 4PRHE 3GNMH 5F7EL 5DQDH 3VD9A 1ZTMA 4UOZA 3W9EB 4CVXB 1HNYA 4EMZA 4PQ8A 3EJQA 4ZW5A 2W65A 1G5AA 2Z93B 5E56A 3BIAX 2NY1B 2VIRB 4FQXA 3LTVA 4LZKA 3VDCA 4JO4L 3R1GH 3Q8EA 4NYLA 3VRIA 1IM9A 1K4CB 2OMWB 4PJEA 3RFZB 4U09A 1FFPB 2AJYH 2LLLA 2FEDC 3VRLE 5K9QG 4X6DA 4Z0BH 4PJCA 3ARYA 1U4EA 4R90H 3TCTA 3ZRSA 2JQZA 1KENL 4P46B 4IQHA 5KUKA 3R8QA 3PS6A 4J4PD 5MI0C 1ANUA 4G72B 1S5HA 4PSJA 3LEYL 1BZ9A 1FLRH 2DL2A 1B9KA 1RMFL 3W5MA 2W81C 4HYTB 3W3BA 4KXFB 3RDTD 3WNOA 3BP4B 4DVRL 1M3IA 3STZA 1KYOK 1YYCA 3CFQA 4OCRH 4XRCB 3BWSA 4U6HB 3T1FB 2DLFH 4QJ4B 3HR5A 3KPRB 5C86A 3BCDA 5F96H 1AAJA 3L3JB 3U4EA 2AK4B 2QT6A 1OB0A 1MHEA 2H6PB 1E67A 1MVFA 4HU8A 5CEZD 4JPVH 3DGCR 4P2YA 2O5YH 2BHYA 1OARH 4IGBD 1J8HA 4KK9D 5KS9E 3B6SA 3VFNA 5DLLA 2H4EA 1OLZA 4K7FB 2VQ4A 1BOGB 5I16B 3Q13A 4M02A 3BN9C 4BZ1H 4XXWA 5AB9A 1GGBL 1WBYA 3FN0L 2X6VA 5IOPA 2F1EA 3MUHL 2Z7WA 3F7LA 1SXCA 3KGTA 4PI2A 4XX1G 5IIEB 4CMMA 3S34L 2CM6A 1UZGA 4TVPL 3V4VL 3V0VA 3IE4A 1YEIH 2CK0H 3PJSA 3X3FL 2R0KL 4YH6A 1EEZA 3P2BA 3W3GA 2WLLA 3BFWA 4HUCA 4BH8A 4Z95L 4ZUSB 2IG2L 4QRUB 3C5JA 4S0TD 1U92B 4BE5A 1BFOB 4GSDH 4W70A 5F7BA 5D2NA 4HVBA 1M2OA 3J7HA 2QTEA 1H6EA 5LAPA 4I13B 4U6YB 3KPLA 1YEFL 5EU6B 4UNVA 4XGOA 5DJ8B 1HWWA 3P30L 2JJVA 2EZ0C 2YD7A 3L5WA 5D1QB 4RISH 3CFJB 4YHYB 1EAQA 5SX4H 3MRLB 3WY4A 5KSVB 3QUML 2R69A 3MGOA 3IPEA 4C56E 3MBED 4DGUA 1TTUA 5CKGA 1OCCB 3S96B 3TJEL 4ODSH 2GEEA 4Y4HB 4I2XB 4MWFA 4OJAA 1KELL 1OGAE 1KNOA 3L3GB 4YSQA 3U2SB 1OHQA 4LSTH 4ONHB 4ZD3L 4FABL 2ASSB 4KXZI 1ZRUA 3MCKA 3LIZA 1M7UA 4JM4L 5IV2A 2C9AA 5CCGE 3NJKA 2ZONA 3VXRE 1SYVA 1FL3B 4KZEH 3VB8A 1U8QB 1RJYB 2QV4A 2EYTA 4RNRB 1TLMA 4ETQB 4HV8A 1RURL 3ISRA 3WFBL 4I0CC 4HFWB 1FFQA 4ZSOA 4JO1H 3WAJA 4A2GA 1BVZA 4R97B 3I2CH 4LOUD 1CICB 5LBSA 4GT0A 4KHXL 4L9LB 3SO3B 2C1PA 5DEGB 1NIFA 3LZFL 4M61A 1MIML 1KTDA 2DAVA 4UILH 4FL4C 1G6RB 3A4EA 3G08B 2JTDA 2OJEB 5D2LA 1KCKA 4GKNB 3BVVA 4IOSA 1YJDL 5GISL 1DSYA 4LSSH 1BBDL 1C12B 4PGDB 3WPDA 4OJFL 3FQYA 5IROA 1U3ZA 3GS7A 1QSFE 3GSRA 3LIZL 3SDDD 2LTQC 1CYGA 5T1LD 4X99B 3AWGA 4OBSA 1FH5L 3HG5A 2OXGA 2Y2TA 2Z1PA 1M6OB 3GGWA 3FCGA 2VDRB 2DWDB 2VXSL 3CXHK 3DX1A 5BS0A 5IJBC 5JXEA 1AS8A 4V2CB 5E5LA 2K45A 3EFOB 3DX8B 3GJFH 1G94A 2XTSA 4W9ZA 5ADPH 2QVKA 3MV7A 1WHOA 4NUMA 2P5WA 1OVZA 5LBSL 2BIPA 1NAMH 4ODXA 5FFLA 4FXKC 4WUKL 2ZG1A 4N86A 3O3UN 3SE9H 1JZ5A 3ZMEA 2NY5L 4UTBL 5IM7A 5BQ7B 5AAWA 4JKPL 1U41A 4Q6IC 3WNKA 3ETBF 4PJBB 1BVKB 3IFNH 3VRLF 3ECUA 3TPUB 2IXQB 4X9YA 5C9JA 5EZOL 1XWDC 2XU9A 1AGDA 3NCJH 2EXYD 3VJ6B 3QEUA 2W9LA 2VDLL 5GGTA 3UL4A 4PGCB 5D7SL 2HUEA 3QUZB 4JPKL 1PJ9A 5I1JH 3GJEA 4NJAL 3IGAB 4Y2NA 2E75C 3A23A 1J1PH 1RUQL 3N41B 5J3HD 2Y5EA 4HMDA 4PLJD 1G4MA 4I5BB 1WAEA 1Y7VA 3SE8L 3P11L 2ZX9A 3CMOH 3FS9A 3FUKA 2HPTA 2XQYA 1ERNA 1ACZA 1QPPA 4PJ7A 3QCVH 1C5CH 5HYJB 2J88L 3Q44A 3VDAA 4MQTB 5MP6L 3ELQA 3AXLA 4DN3H 2AXGA 1N12A 3VWJC 1X5JA 4N68A 2P43B 1FH2A 1UXSB 2OMXA 2Q2EB 3HC0B 3MOBL 4LFHD 4ARRA 2APWA 1HHGA 5GGTL 1QPXA 2C4XA 5F6IC 4F7EA 1OT4A 5F7HA 5KS9F 2V3EA 4Q9CA 3M18A 3O0RH 1ET5A 4P3CL 1OPOA 2XFGB 3UBFA 2VM4A 2PXYB 4XNMB 2QTVA 2A9ML 1RK7A 2WHVA 4HJJH 5K1NA 1UM6L 1FZOB 3KLLA 1D5BA 4ZS7H 1G9NH 2IAMD 4BGDA 5I0XA 3QJTB 5E08L 4HIHA 1MZZA 4AIZA 2B4CL 3WMPA 3G5ZA 3MV7D 1LO4H 1LK3H 5LCVH 1YCSA 3FCSB 2ITDA 4WU5B 4R6UA 3CCHB 5KYUB 5KYYA 3S88L 1FYTE 2B3IA 2CCVA 1EJ8A 4PJ5B 3A6BL 1DSFL 4Z8GA 1YMMB 1M7XA 1IT9H 1PW3A 4JFEA 2GJ6A 4NNYA 4XHQA 4R07A 3DPDA 2IPKA 3BPNB 1ZA6A 2NOYA 3OGCB 5F89B 5F9OH 1F4AA 4LHJB 2ROYA 4XP6L 1JIBA 4FEMA 1JRHL 2CG9X 2ZXCA 1C08B 2DF3A 3ML8A 1E4XH 2ZUQB 5FS5A 4GI8A 2AFNA 1ZGLA 2DM3A 4NZTL 2L4OA 1KTCA 4YWGH 5IQOA 3UEZA 4Q7DA 2BVEA 2PTVA 4DN4L 5JMOC 4YSOA 4OD1L 5F7WC 1P1ZB 3FFDA 1JGDA 4QRPA 2YPVA 7FABH 5DS8A 4JGJA 4N0UB 2UZIL 3H3PH 4F7KA 4XP5L 2FJHA 3KJ4C 5F88A 1JNJA 4PG9A 3QORB 1IJNA 3WAKA 1KJMA 1N6UA 4R96A 3I6KA 4RGNE 1IBGL 2FUQA 4PV8B 1ITBB 1BREA 4UT9H 5DD3L 4IBUA 3V5HA 4U1KB 4O5LH 1WGVA 3NTCH 3MZGB 4ZBJA 3U0PB 1JZ4A 4AGNA 4FMFA 3ZE0E 4P2QB 4RDBA 5E8PB 4QHLA 5JHDD 4XP9H 3RFJA 4BHUA 2W9EH 1E8YA 1G1CA 5C08B 4M7ZC 1MPAL 4XH2A 4DWHA 1LE9B 3GRGA 3QEGL 1BDYA 2PO6A 1GYUA 3KHQA 2YPVL 1PLGL 2EIMB 1YUHB 1FO0H 5F9JA 4NT6B 3CN0A 2V7HA 5BZWA 3CSFA 2GHWB 4Y4KB 2QPDB 2NX5B 3DOSB 2XWBB 3QG6B 2HJLB 4JZJA 3BVNA 5GS0D 1B0RB 1F45A 1KC5H 1KGCE 2BXZA 3UBXB 1FV1B 1I9JH 3W5NA 2BIMA 2GJ6D 3BX7C 5LWYL 3OHXA 4HGWA 1EHLH 5B3JE 4MXQD 4FULA 3NJMA 1GY2A 4WW1B 3L4TA 4FLOA 3O2DH 2FX9L 5DJDA 2HMID 4LAQL 3DI2B 1Z2KA 4JFPA 1AXTL 3LS5H 3WHE0 5BXFB 1O7DE 1SLUA 3AT8A 3WN5A 4FE9A 2G9HB 1HESA 4JZNB 3PJLA 4AEHL 3ESOA 3T65A 2V9TB 2J44A 4PSPA 4EN3B 3W0WE 4HCRA 4GAFB 5EULV 1UWXH 2WANA 2BNRA 1R33A 5IVXE 1ZY9A 3RU8L 2P1PB 3AS0A 4KDTA 3RIAF 1WBXB 2R56H 3OZKA 5GJSL 3INUL 3KYMA 3L95A 4JRFA 5IBLD 4MRCA 3EOBB 5DVLA 6TAAA 5HI5D 4MD0B 4LESA 2XRAH 3D0LA 1I31A 3LSOA 4ZZKA 3MNZB 5I17B 4A2FA 1E4XI 2P45B 1E2ZA 2TRYA 1KEGH 2XG5A 3ZJAA 2XKSA 3FO1B 3DVIA 4Z78A 4NZDA 5T3XE 1JPEA 4DVBA 4HGMA 3WYRA 1FFRA 2Y9RT 4HCRL 3Q2CA 2XPYA 5CGYD 1DEEB 5BMFH 1EJFA 3LNFA 2PO6D 4G7YL 1G5GA 3GB7A 2WZ0A 1Q94B 1P5UB 2VDQH 2WBJA 1H3UA 5HDRA 3DX4A 3E0GA 3KBPA 5A6LA 4HFUH 4G2AA 5E4EB 4QJ5B 3MFFB 2ZQKA 2KPNA 1G7HB 2GT9A 4FLRA 1SJVA 3T71A 4KRPD 5D70H 1JYXA 2KUTA 5IJCC 2X87A 1DBKL 3DBXB 1D9KB 3QFDB 4OB5L 3HG1E 3LB6D 4XPHH 2Z7XB 2QKIA 4N25A 1HJBC 1CXIA 3EFDH 1SF3A 4N8CL 4TQIA 1SOKA 3FQRB 3T6VA 3TT3L 1EUTA 3DV6A 3LXAA 2G3ZA 4YDKL 3UYOD 2KQNA 2E7LC 4BFJA 2P5EB 2ZYRA 3KWUA 4A7GF 1NWOA 2MJWA 5FW8A 3SDXB 4LXRA 1QHQA 2ZUWA 1ET7A 1B4JH 4GQ9H 3O6KH 2BNRD 3QNXA 5FYLD 5I8OL 2VSMB 4FA7B 1UCTA 3DX6B 5FR3A 1SN5A 1B90A 5K1VA 1U8OB 3LKSA 4K9EC 4KNQA 4Q3GA 4UM8A 1NFDE 4GS7B 3GEWB 1UT2A 2DQGH 2H3NA 1N6QH 1PLAA 4RGOL 3D4ZA 4XVJL 2VXQL 1EMTL 4PLKC 1N59A 3S36H 5D6DC 5E2WL 4I1NB 4X0NA 2PWHA 1FWXA 5BCAA 2VOTA 4TZHA 3GMMB 5HVFB 5IP4A 2WNKA 3ESUF 4JJOA 4DKDC 2CHDA 3OLGA 2APTA 3OTTA 3UPAA 3WELA 4MSWB 1YEJH 1BG9A 1AS7A 1LXMA 1P4BL 4IBWA 3TA3A 1ZLSH 3RJDA 1S7UA 4JHAL 2H1PL 4HU2A 1A6ZB 3RVVD 3VWKC 1MUJB 3DMMB 5D96B 5JPMB 4N90D 5D5MA 1INEL 3HI1A 3ZE0F 1WIPA 4U1GC 4M7KL 3O9WA 3REVA 4G9DB 1TEGA 3F84A 4FTVA 4NN6B 4UQ3A 3J8F7 3WPIA 5FYJH 1Z9LA 4XXCC 2BW5A 4YHOL 4F33B 3F01A 2MSPA 1XGYL 1AZBA 3G6AB 3NAAH 3S37H 5I75B 1GYCA 1X3DA 4G1EA 4L5FH 2CXGA 1D7FA 1WTGT 3U4BL 3V6ZA 5F9DC 1UZ6E 4G7SB 3LKPA 3UG3A 2ASTB 4UBDC 3J27A 2A6JA 3X17A 3GD1C 1FVDA 4EZLA 4H88H 1GCYA 3QJXA 1D5IH 1D3CA 1SLXA 4Y2DD 2YD1A 3W2DL 3HOGA 1BV8A 3SPCA 2IDCA 5B3JF 3EYSH 4AY9X 1GR7A 3KWTA 3FHQA 3AM8C 3OLEA 4M7JL 5DJ6B 4G59C 2PWFA 3A67H 4BK8A 5FO8A 5E4OA 2J8HA 4O4YH 1NGXA 1Z9MA 4PJAA 2QHRH 3TYFA 1TPXB 1MHHB 5DR5H 3V5KA 3VH8B 3N9GH 2NXZD 4WJG3 5IFHL 2J73A 3NACH 4X8CA 4B0MM 2E7DA 3AXHA 4POZC 2WXGA 5IVXF 3B37A 2R0ZL 2WQUA 1IAKA 3IRCA 4JPIB 5TH2B 1W6WA 3LY6A 5GS1A 3LJ3A 5D7IE 4F9LA 1TJHL 1K8DB 3EJZD 4F80A 4S1RH 3APFA 1IE5A 3FMGH 4DKAA 1BBJA 3K6IA 3F12B 4CKVX 4ISVB 5FLUA 3P72A 4P91A 1Z9SA 3RGXA 1ND0A 5HDOA 4LHUD 2EDEA 3V0WH 2PTUA 1JI2A 4X8JB 1JPGA 2BNUB 2EUWA 3GMPB 2AJSL 3BUYA 4Z0XB 2XZCL 1CGTA 2CLZA 4FTVD 2X28A 4NKOB 2VR9A 5CUSL 4P48A 3O6FC 5IVZB 3P77A 4B41A 1BWMA 1G9EA 3FSVA 3OJMB 7PCYA 5IZ7A 3BSZH 5MEOA 1DUZA 2UVEA 2BZ7A 4H8WH 2ERJC 4RCAA 5KBKA 2NR6A 2H9GA 4K2UH 2J5LB 4YSPA 1YYMH 4PCSA 5IMKA 5CLWA 3S8FB 3OJAB 3SDAD 3D87B 4GEJA 4EF3A 3QIWC 2QADC 1Y18B 1EUUA 2UWEE 3GBML 3VFTA 1KDIA 3ULUA 3KPMA 4F57H 3GFUA 5DD0H 4R5DA 5T5NF 3MJ8A 3PV6B 1T0PB 4MQSB 2DD8H 1V5JA 3NUKA 5FO7A 1SJMA 1MVYA 1VEPA 5CZXC 3CAFA 2CK2A 4XP4L 4W9DC 1U58B 1BFSA 4LASL 3C5ZB 2OL3H 3V5DA 5CIPH 2E47A 4HKBB 1HIML 1TJGH 3VAEA 4JRYD 4RMVA 1K6QL 4LSVH 3VSUA 4QRBA 3TIEB 5LXGL 3V8CA 3DV4A 2CAKA 1M42A 1L0QA 1NFDF 3HMWH 1WBZB 1FSKC 1U0QA 1R9FA 4DAGH 1ZT7A 2CNYA 3NSXA 3ULUL 1JZFA 1ETJA 4J3OH 4WFGE 1YNLH 5E1AA 5DC4B 2DI9A 2UY7A 1DVFD 2ED7A 4G6KL 5EOQL 2W0FB 1QRKA 3DBSA 1Y1UA 1S7VB 5DZVA 5E8NB 3MV01 3MACH 2R4RL 3FUEA 2ENQA 5D1XA 4FQJL 2CUMA 3NZUA 2XQYK 3VXME 1DO6A 3WTWA 3RP1A 1NMAH 2D7PA 4XO8A 3VXUE 4ZFFB 1GYAA 3RIKA 4N2EA 2YZ1A 1YVLA 1N7ML 2IPUK 3CQPA 3MLYL 2C34A 2Q6WB 2I26N 3P54A 3RRQA 3BD5A 3O8XC 4JQVA 2ED8A 1NBZA 2ZCLL 4HIPA 4XI5C 4U6XB 4PJDE 2Y06L 1EPFA 2VLLB 4N0FA 5EO0B 2G60L 2JE8A 3JV5A 3KLDA 3WPBA 4P2OB 1FP5A 3DWTA 4XN5A 3ZR6A 3QDGB 1NCTA 3FT9A 3ZKMD 4IIQC 5FWQA 4CAGA 3MGAA 4AYSA 2WP3O 2NXYC 3ARUA 1UZ6F 5KOMC 1NBYA 1DQTA 1CT8A 1F02I 1AY1L 5EBMA 3BI9X 2WM0A 4WENB 1UA6H 5GJTL 4WP6A 2DY2A 3ILQC 2DBLH 3QRGH 1Z9OA 1AZNA 4BRJA 4HF5L 3E2HB 1X44A 3P0VL 5K9JH 2P3YA 4O2FA 3W56A 4NUGL 1QWUA 4DZBA 5IB3B 1UFGA 5T1DH 1CR9L 2UY6B 2X3AA 3GSNA 2HT3D 5IW1B 3C60C 3BZ4A 2EYSB 4PRBA 5C2UB 1YY8B 5J11B 1JE6A 3DIFB 2Z35A 4JFQA 4TSCL 4HX1A 2ZZUT 4FFVD 4DEWA 4N5ED 1GHFL 3L4ZA 3QCUL 1M10B 1EGJA 2VCOA 1NTDA 1MCWM 4PJ9A 2WWMD 4Y2LA 5ANHA 5I30H 4ABVA 1OP9A 1AQMA 2VLJA 5CILL 1FORH 1ETB1 4NS0A 1A02N 4HEPG 3C6LA 4M00A 4GUQA 2RQ8A 2JV6A 5D7IF 1K2DA 1PCXA 4K8RH 1IO0A 1LEGA 1QSVA 3QJOA 3C08L 1IGTB 3NSCA 3P9LB 3ZDXB 2DQHL 3GMOB 5BUAA 2ZG2A 5HY9B 1XF1A 5D1XD 5B39G 1ILUA 3BVTA 3NP4A 2YC1B 3GM0A 5L4MA 2ZCKH 3QQ4B 3LHPL 4JHWH 4ZYKA 4ZOCA 5GGSY 3TV3L 2F53B 1L9RA 1L5GB 3DJRA 1C5DA 4GW4A 3SOTA 4C4KO 2MKLC 3QS3A 5MENA 2Y1VA 2CDEB 1UACL 4IOFC 2ENYA 1BVLA 1MNUH 3N85H 5E6IB 3UCRA 2K6YA 2NUTA 2I9LB 3V55A 2QSCL 2HH0H 2Z91A 1JGUH 5C0GA 3PL6D 2YGOA 2NY6B 3V4PH 2ZXQA 2F9BT 1T22A 3IVKA 2OZ4H 5T3ZL 4CN6A 2VITA 4CNIA 2XXCB 1A7NL 4ODHH 1MCIA 2HRPL 2VERN 3O4LA 1AGFA 4U0RC 7TAAA 4AUYA 1CFSB 4P5MB 4G6AD 2UWEF 5EWIL 2D7NA 5E9DE 4PRIA 4JNXA 2IBGA 4JFXB 3OPZL 5IHLB 1CLYL 1JHKH 4HOXA 1LWHA 1FNFA 3CHSA 3QDJE 3ZYZA 3L16A 3U0TB 2ZJSH 2ZOLA 3G3AA 2BSBA 3NN8B 3ESNA 1F4WH 2FGZA 3L3OA 3BDBA 3D85B 4I18C 4AENB 4AG4H 3IJ8A 4AY0A 1NL0H 4M8RA 2IMNA 5I1GH 4FS7A 4OQTH 2IJ0C 5G4OA 3MR9A 3E6JA 1CXFA 2ZAIA 1BEXA 2Z4QA 1F3JA 2AXHA 1AG6A 1ID2A 2VLJD 4OQ1A 4PR5B 5DD1L 3UX9B 4JANB 1H5BC 3V52L 3KJ6L 1ID5I 4N6RB 5A16A 1VZGA 3VVWA 4WHCA 4QT5A 3WHXB 2N0MA 3D2TA 5LBVA 1HH6B 1XH1A 4OJCA 1CXLA 4DKFH 1KIQA 3GQFA 1XGPB 3FBKA 3WUWB 1HOCA 1BD2B 4B53A 5AW5B 4NSKA 1WP6A 2IPTL 4HCGA 4NCC2 3VX1A 4H40A 1PD0A 4BH7B 3HPLB 1DVYA 3BCFA 4F37F 1CLCA 2OMZB 4K3EL 2O26U 3VMNA 1T2QL 1C16B 2DZEA 2H0FA 4WEEA 1F11A 4O00A 3UTSB 1S9WB 4ZW7A 2WFHA 1YECL 4KO5A 4V1DE 4JJ5B 4PJDF 2CRMA 1BXVA 1MXGA 3HHMA 1YYLH 2Z93A 5GGRB 5JIPA 3FCBA 5IFJA 1AGEB 4HWBH 4QOKD 3ZXAC 3HAEA 5DMYA 2LFEA 3KBFA 5HHOE 3EHBC 4HUUB 5LGYA 3P4MA 3RFZA 1FFPA 1FJ1B 2FX7H 3RZCC 1R3LB 2R1YB 1OALA 1DLFH 1OAYH 4H44C 4Z7OE 1WFUA 5KWYC 4LL1A 3VFRB 4MS6A 4P46A 2WNWA 4QPEA 4PRPE 4WUUB 4NZFA 3JWDC 3FJTA 3H6JA 3HCVA 4XWGH 4C57C 1WCQA 4GRWH 4NAMA 1T21B 3ABZA 5I1EH 2NY2D 3BP4A 3MAWA 4XRCA 1OL0A 3RTQC 1J8KA 4X6EB 4RFNC 2VMDA 1H3GA 3Q8BA 4G6FD 3QQ9D 3B5GA 4ZT1A 3T1FA 1TVBB 3GUTB 4N8UA 1UUNA 3L3JA 4OCSL 4N8VB 1GTNA 4WQOA 2BOCB 5ALCL 4IU2B 1ZJAA 1BVOA 1KACB 2V70A 1U2CA 4NQDB 2FD6H 4JAMB 2YQ3A 4YR6B 3NCCB 2PP8A 3OKLB 2MMXA 3BKYL 5GRJL 5I6PA 5F7EH 3T6QC 4QGTA 4K7FA 4BFEA 1BOGA 5I16A 1XFPA 4H0HB 4XZ4A 5HDWA 2FYYA 4UOQA 4A7UA 5DO2D 3PAVA 2FO4B 3WNPA 3RGVB 1XCTB 3SB3A 1I53A 1DQLL 4YUEL 4IJ3B 4I3RH 1U8LB 2W5PA 5F72S 1MCEA 1JPFB 5DU7A 2NY1D 4MZRA 4U6VL 3ULAB 5C7XL 1KENH 5DRZA 5JUEL 2NTSP 3SQBB 3MMEB 1KCSL 5I5RA 4QRUA 2AEIT 3ZTJG 1U92A 2C9XA 5DLML 3R0NA 3ERXA 4RGMC 5HGGS 3EH2A 1RMFH 4WLCA 4HUNB 3RL1B 1F56A 1PG7X 3AMKA 1K5DC 3HC2A 3FHAA 3L45A 4U6YA 4XNYL 4CGUB 3M7OA 5D7JB 5DJ8A 3DURB 3S4SG 4LSXC 2JKXA 4NPYB 5D1QA 3G3BA 4PYGA 5CGTA 2R8SL 1PIFA 1X5YA 2XACC 3S96A 5TDPB 3NH7L 3LNDA 4NZUH 5H37H 3KWWB 1I9RL 3KZ8A 1KBWA 5C07E 4Y16D 1HTYA 1FL3A 1T0MA 1YN7A 2CJUL 3KPRD 4OKVB 1UADC 2LU4A 3WO3B 4ETQA 4EUPA 1RPQA 4ZOEA 5CAYB 2AK4D 5JDJA 2JWYA 5C97A 1E2WA 5I1CH 2R27A 1CGWA 5IR1B 1TETL 5DD5L 4BA8A 4HUVB 1GGBH 2DTSA 1NCUA 3FN0H 3QHTC 3ZYOA 3S5ZA 3MOAL 2FO1A 2IBBA 4XVUC 5DEGA 3S34H 3V4VH 4L3EA 1I8KB 1EAOA 5DURB 2V9UA 3X3FH 4GKNA 2R0KH 3SKOB 2FSDA 1ROCA 4G8FB 5I1LB 3QZPA 4PGDA 2IG2H 2CPUA 1KBKA 3FPYA 4MA1B 3UAJD 1B3JA 4HHAB 3RIZA 2W0PA 3BEVB 3RNQA 3IAGC 1OZNA 4XVOA 5TF0A 2Y4SA 1YEFH 4X5LA 3ARPA 1CGXA 2YBRB 4W93A 4FFZA 4V2CA 3NJHA 4QAMB 4MD5A 3DX8A 2H3KA 3E7JA 1P0SE 3QUMH 2VDKH 4H2AA 2I7OA 4PREB 3TJEH 1GS6X 2DJSA 1I3GL 2B9AA 4K94C 5EU6D 4ZD3H 5IFAL 4FABH 5KVFH 4DPCX 3KE0A 3T0DA 5BQ7A 2XWDA 3WLWD 2R9UA 2JKLA 4ENED 4PJBA 4Z7NB 1BVKA 1HCFX 1QZ1A 3TPUA 2ARJA 4NO0A 2IXQA 4Z7OF 4Y4HD 1MRDL 1RURH 3IN2A 5D1ZC 5J06A 3WFBH 4NBXB 3FO0L 3QUZA 4KJWC 4PH8A 3BEWA 2BP0B 4DTGL 1OEZW 2N7AA 1YLBB 4F1ZA 1KGIA 3ZIMA 3EADA 4FFZL 1BZ8A 4KHXH 2ESVB 1HILA 4I5BA 4L23A 5IJKC 2Z63A 3QI9B 1BIIA 3PABB 3NCYP 1MIMH 4Z76B 5T33H 1YJDH 2Z6FA 4JO3L 4G9FD 1BBDH 2JQDA 2X6MA 4OJFH 4D94A 3QZWB 4H20L 1CICD 1P4LA 4ZW3A 1AZZC 1MW2A 5EEYA 5CZVH 4I9WD 1G9UA 1X5AA 3BGMB 5M95B 4YSEA 1FH5H 3R0MA 3HC0A 3K74B 4GRLC 3WV0A 3WENA 2AEWA 1AD9B 3I3DA 3MNVB 3DHPA 1CIDA 1HDMB 3FT4B 5E70A 4MHHI 1NDMA 1RZ7L 1Q1PA 2E5EA 2X53A 3Q0HA 2X2JA 2OR8A 4TUKL 4WUKH 2WXQA 1RJCA 2HRHA 5TK4A 4LLQB 3MXVH 4UTBH 3D50A 1I8IB 4JKPH 1RJLA 1IBFA 1YNTB 3SCMC 3GF8A 3P0GB 4XB3A 2ZSWB 4WVRA 5EZOH 5T1KA 2YPLD 4AOFA 4JX0A 5GRWA 3FCSA 3GXMA 1XB6A 2PYEA 3IJHB 4WU5A 2C7UB 2X44D 1CD9B 1G1YA 2VDLH 5KYUA 5I0DA 4QRRB 5D7SH 4JPKH 3QFJB 3WJLA 1IZKA 1F90L 5JDSB 2BVPB 1YMMA 4NJAH 4MMXB 1FL5B 4NQQA 2ORBL 4PTTB 1RUQH 4Y4FC 2WB1A 1KLFB 2FBRA 3OGCA 5F89A 2VXVH 3KYAA 3P11H 5F97E 3SE8H 4YEEA 1OV8A 2XWXA 3MODH 5CEZE 5A2JH 3VD2A 1YEWA 2YD2A 2VDOL 1BAFL 1ZPUA 4L4VB 4N1CA 5DJCA 1C08A 3X12B 3UZQB 1XR8B 2HLFC 2J88H 2XWEA 1OTSC 5MP6H 5DFWH 2DIJA 2XBDA 3V4UL 3QJUB 4JDEB 4AGQA 4MA7L 1KIUB 1A8ZA 1EHXA 5A2LH 3K4AA 3MOBH 4PVNA 3SGKC 1QI5A 3CHXA 3QO0B 4NBZB 4BSUA 5HYJD 4MMYA 2JJWA 3NQIA 3PWNB 4QHMA 5DK0A 1ZA3B 5GGTH 4BFKA 4L05A 3GZQA 3ELAT 1D2OA 1IKNC 4J28A 4P3CH 4ZDHA 3EJJX 3TURA 2X41A 3OMIB 4PN6A 2AF2A 1JZ8A 2A9MH 1H8OA 3AMLA 1UM6H 1NGWB 4CVUA 3OSKA 4X0KB 2VTFA 5DO8A 1PKQA 5E08H 4KK5C 2B4CH 4U1KA 1Y0LA 2P28B 4Z7WB 3IYLW 2PXYD 1NMBL 1I1RA 5ELIA 5E8PA 1IBDA 4XP1L 3CZNA 4LI1A 4GW1B 3PDOB 3S88H 2HLAB 1WHPA 2P1NB 3A6BH 2LGNA 1HX0A 1NM4A 4QTHB 5I1HL 4DKTA 1HCZA 3B1TA 4JQIA 2PCYA 4A2DA 4KOCA 3FB5B 1YUHA 2DWXA 2IGTA 5L2KB 2AJZB 4XP6H 4BYHA 5KYNA 3WE6B 1DCEA 2NYYD 4OH2A 3TBSB 4UIMA 5FYKD 2HJLA 4TVPE 4PJ5D 1Q72L 2H47C 5AOJA 3NJXA 2B7DT 4J1UB 1P5VB 3MRJB 3QEQA 1ZVYA 4G8GB 2ED9A 3A24A 3DTXB 3ZT7A 3U9PL 3RWEB 3VYOA 1A6WL 4WI2A 4DN4H 3AT9A 5CS7A 4ZFOB 2WQ8A 3X1GA 5JNYB 3AXIA 5AZEL 4U1MA 1DANU 2DW5A 2UZIH 2YEZB 1E9OB 3G7TA 4XP5H 4XNBA 1NCGA 4MAYA 3CZGA 2AC0A 2ZWLT 4U05A 3ZIYA 1ZOXA 3NA9L 5KJRL 3DJTA 2WVVB 1JBJA 1FG2B 3LN5A 4F92B 1ZVNA 3VSQA 1IBGH 3ARDA 1A9EA 4JG0L 5DD3H 5IESL 2WV3A 2G30A 4N85A 4WI3A 2G5BB 4X7DC 1CS6A 4B5ZA 3LXUX 1T0NA 5ACZB 3QORD 3JWOL 1CC3A 3L3IA 1AD0A 1MPAH 3L3DA 2R59A 1DJYA 3MNZA 1AJ7L 4RGNC 1N9PA 5I17A 1TYRA 2XYBA 4ODVL 3QEGH 1YEHH 4K23H 3W11D 5I5MA 2YPVH 1A14L 4NENA 4ZFZB 4C55A 3R19A 1PLGH 4GH7B 1Z3RA 4MB4A 3FO1A 4P2QD 1BA9A 1X9UA 5I2IB 2P48B 5C08D 1AC0A 1ILSA 1DEEA 4XR8C 3ZT5A 4ACTA 4E9XA 2XXFA 2P8MB 5LWYH 1Q94A 1P5UA 4S1DD 3QJSB 2AZAA 3T8XB 3HZKB 1M56B 3IT8D 3KBHE 4JQXA 3WTTA 3ATAA 5E4IA 4MCYA 4Y4KD 1G7HA 2FX9H 3MO1B 1FGNH 5F7LB 2NX5D 3GI8L 4LAQH 3IGKA 1FNEB 1XH3B 3DJZA 3MHZA 1CD1A 5CEYB 3HPJB 3QJZA 1AHWC 1PZCA 1OK8A 3HBGA 3WS3B 5HJBA 3QEHB 3KPSB 3HHSA 5B8CA 3QFDA 2HA1A 4AEHH 2A73A 1GZHC 2VAAB 2Z7XA 2Y7LA 1Q1JL 5EU4B 3VO0A 3QULB 5ALBL 5TE6L 3FQRA 1TT6A 2XV2A 3RU8H 3BAIA 3VYNA 5AVSB 1FBIH 4Q9RL 1LL1A 1O7DC 4KO9A 5CKAA 4R3SB 3RWJB 5GJSH 1SQ2N 1CTMA 3Q6FB 3INUH 4XT1C 5D2LE 2F8XC 4L37B 1EVTC 3SDXA 4EN3D 5JOEA 4F8OA 5D4IA 1NDTA 3WGVB 4KXDA 3CUPB 3K5RA 3QIUB 4Y9FA 4AW4A 1JRHI 3ARFC 3FUMA 3HN8A 3X1EA 2CO6A 5JQ6L 2BNHA 3VFOB 3PU7A 4I48B 4TQHA 3QXAB 3L4CA 4LRIA 4BK4A 2CCLA 1AQHA 3Q06A 5IB4B 1W0VB 1J9SA 4KT1A 2NNXA 1NIEA 2CHWA 4UDUA 5F7FA 4G8AC 4Y7OC 1PZSA 4HCRH 5HI3D 2R83A 4JS7A 3CC5A 3MV7E 3GMMA 4G7YH 3B7RL 1OCWH 3DX7A 4I85A 3VD7A 4MQWX 3KVQA 4LKCB 3CZJA 1ZK9A 4GNKB 1Q0YL 2PWEA 1G7IA 2YWYA 1R3HB 4P04A 1E40A 2VDNB 5F6HJ 4WHTB 3C5SA 1DCLA 2OV0A 3L9EA 3ROOA 3SBWC 3WDIA 1EAPA 4K3JL 5IK3B 1A6ZA 5FKAB 3TO4A 1ZLWK 5JPMA 1DBKH 4OB5H 1Z5YD 2F61A 4X8XA 4DKEH 1IC0A 3ZE2B 4N8CH 3ZRCC 2HWZL 1CF8H 3TT3H 3G6AA 2FECL 5FUZL 3N50A 4PRAB 3UROR 3JYBA 1D9KD 4MNQA 3IE9A 4GLRH 4CBZA 4BWWA 3FXIC 1U2HA 2BSDA 3H6AA 4LIQL 4DUWA 2DQEL 1URLA 4MQXC 4PJ7E 4AMWA 5J7CC 4BXSV 4OJYA 4GAJH 4UF7C 3LPWA 2EADA 1MFUA 1GKOA 2JCWA 2XVKA 2IH1B 2P5ED 2XN9A 4WEMB 3ZT6A 3ES6B 4APQA 1AZUA 2XKUA 1A6TB 4OJEH 1WWWX 4RGOH 35C8L 4XVJH 2VXQH 1EMTH 1I9IL 2OMVB 3PCYA 1R47A 3O3AB 5E2WH 4PEEA 1MHHA 1NCDL 4BQBA 5ISZA 1KN4L 2FJGA 1OXYA 1YHPA 1RZJL 2WUBL 3QUXC 4BHUI 4RRPG 4PCKA 1MFDL 2BP8B 4NQEA 4M29A 1JWUB 4DOHE 1OF2B 2H26B 3RKDC 2J57A 1YPZB 4PJIA 1ZWIB 4Y5VA 4DUXA 1P4BH 2XY1A 4FG6C 4IKLA 5E5MA 4JHAH 4IEFA 4TKWA 4TL5A 4ETYA 4GI9A 4E9VA 4UUJA 4F2ME 4M7KH 4R6GA 4ALAC 3F12A 1VJSA 3WFHA 4ISVA 4BJLA 1PEZA 3O2VL 3H9HB 3ASOB 4YHOH 2GJ6E 1XGYH 1A22B 3DMMD 5MEQB 4L4JA 1LWRA 1MKFA 2BNUA 3B3BA 4XNZC 2MPVA 4FHKA 1F3RB 5BJTA 5CD5C 3WEBA 2ODHA 2GBAA 4NRZB 5BV7C 4NFCA 5IVZA 2HFEB 1CD0A 1XB8A 2OZNA 3W2DH 4KHTL 4MXVE 2WD0A 3HNSL 1QSEB 3U2JA 3ZPDA 2IH3B 1IE4A 1K72A 4M5TA 4M7JH 3GSOB 4HIEB 3RWIA 4AK1A 4LI2A 3SJVB 3WPEA 2YWZA 5HDHA 1KJVB 4M9PA 5B4MD 4HS6A 4W9KC 3BKML 3OLDA 1Y18A 4LLDB 2OSLB 4JPWL 4OFVA 5IFHH 2GUOA 5FIEA 4C58B 1JGEB 4XC1L 3TJHD 2J8OA 2K3TA 2HVKB 1UGNA 2WLIB 4ANVA 4ZMYA 2XPZA 3PV6A 4TSAL 2CRZA 2WXNA 1EHKB 3MRFB 2R0ZH 3MRPB 3Q9QA 1TJHH 3F04A 1NIBA 3GDBA 1BFVH 4HBCL 5D2LF 4AT6A 1S7RA 4M7LT 2NZ9C 4HKBA 3UGUA 4DPAX 3P3SA 1MJJA 4BIKA 1U42A 5ANMB 3H54A 2WIIB 1DQDL 5MEPB 1BG1A 2EH8L 3NSFA 2J20A 3U79A 1R34A 3BPCB 1OM9A 1CI5A 3GXDA 2DL9A 4L2YA 1MH5A 3HZYA 1KY7A 2AJSH 2NY3B 4KJYB 4OLYL 4GBXC 3QIBB 3AREA 1RFDL 2UXTA 4HULB 3CHPA 4UTAA 5E8NA 5FOJA 1PAZA 4NZRM 2ZWYA 4S2SB 3JTTB 4PBXA 3T6WA 3O81A 1NICA 3E6FB 4PP2B 2IAAC 3PHOB 3I02B 2JKJA 1J9QA 1E3ZA 1NA8A 2GJPA 3T2LA 5GMHA 5AEAA 3ZYJA 2XVGA 4Z7QB 3ULVA 2Y2WA 2Q6WA 4P4KB 4D7PA 4W4NA 2HX8A 3GBMH 4L48A 2CGYA 1JUFA 3N40P 1BM7A 5SWZD 3V0HA 1QX1A 1FYHB 2CD0A 5ID1A 2X2HA 5IHBA 4Q56A 2ZP8A 2BNRE 4PJHA 4BFIB 2W59A 3DO4A 4QXVA 4N3UA 2LVEA 1DVXA 3ARBD 2ZXAA 2ZCHL 4CMHC 1QFOA 4XP4H 4X4YA 1FCGA 2CKNA 5CJXC 1PNCA 4CDHA 1ZD6A 4PJ7F 4UTAL 1HIMH 4MZ3A 4JFYB 4C59B 3WFZA 1K6QH 5E6YA 4IRJC 4N6QA 3U7AA 1ZDQA 2LT9A 2J4WL 5LXGH 5AW6B 1UVQB 3FFCA 5IT2H 4JRWA 5IB3A 3MKGA 3C5ZD 1DJIA 1DO5A 1ACXA 5IW1A 2UY6A 2XX1A 3OR6B 2A77H 3OPUA 2EYSA 3GTNA 3V10A 1MFMA 5GS0L 4M6AA 5EF3A 3FHEA 3SY0B 2XBZA 4G6KH 4WF7A 1BX2B 1YDPA 4N90E 1SDDA 1SPDA 3K4DA 4GOSA 2R4RH 2EIDA 1QPKA 3TEUA 2YN5A 4FQJH 4LSQL 1NAMB 5I15H 3KM1A 1KJ3L 2EO1A 2EXWC 4WW2A 2EUVA 4D3CL 3MLYH 4UMGA 4L1LA 2WBKA 4H8PA 3P4NB 4LEBA 1IGTA 2ZCLH 4OCWL 3T4AC 4RMBA 2Y06H 4R7DB 4K73A 3LVEA 4GXFA 5HY9A 3X1FA 5DD6B 1H0DB 2G60H 1H8NA 1U9KA 3PE9A 1OAUL 4ORGB 5BOPA 4QC0A 3M1BA 1Z9PA 3G6DH 2F53A 4L8BA 5TDNB 3W3LA 2NQDA 5DS1A 5C0RL 3AB0B 2VW7A 5KVEL 2V3FA 2G2PA 1NUFA 2C3VB 1IUZA 4PJ8A 5GSVA 2I32A 5GJTH 5E6IA 1PZBA 4P2OD 1HHHA 4KKAD 4MXVF 5AW1B 3QDGD 2I9LA 2HT4C 1S3RA 4Z5RA 1RZQA 4HF5H 5A2CA 2ZSVA 3P0VH 1F6AB 1RZGA 2N56A 1MDTA 4NUGH 3NJNA 3IMUA 5AVRB 5IB2B 5CXPA 1OF0A 4MJIA 2ATAA 1C1EL 4XBEL 2AJ3B 2EIEA 3HS0B 3AT0A 4G42B 4G43B 4WWPA 1H8LA 4EIZC 4TSCH 3QHZL 5C9KA 3ZHNA 4AIXA 3OLIA 1GHFH 2JJTC 1UWGH 4JFXA 3QCUH 4XPAL 3SKMB 4OZGA 2D8KA 3WL9B 2FT3A 1TTGA 3PQYD 2BFGA 3UL9A 3N42B 2BHZA 3UMNA 3NN8A 4N2DA 5CILH 5LBGA 3K6FA 4XMZA 4R09A 3RY6A 4AENA 5D5ME 3C08H 5EU3B 3BQUC 2DQHH 3S5LG 2AITA 4OU3A 1EBPA 2FLMA 3TN0A 4FTVE 3OL2A 4L1DA 3VI4F 3LHPH 5GRXG 3LRKA 4PR5A 3RWFB 3HUJE 2GB2A 3TV3H 1COBA 2PCPB 1D6EA 3JTSB 4JANA 4IOIB 2DI7A 4N6RA 4PWIA 4JLRB 1IV8A 1K5GC 7PAZA 4DUVA 1OTTC 2R2BB 5DUPL 3K5SA 3EGDA 4FQIL 5AWNL 3QP3A 4HDIB 2R2EB 4JHVA 3MYJA 1JCVA 4W68A 5K9OA 5FYLL 1LO0H 1UD4A 1I7UA 3BDYL 1LGVA 3QJFA 2CBMA 1WLHA 5I26A 2QSCH 4BH7A 4AJ0A 4OGAC 2CSPA 5H8DA 2DLEA 4PJGB 4RX4A 2Q86B 3TVMC 5JPNB 2G3XA 4PJAE 4PRDB 5T3ZH 2BVQA 1C16A 4O02A 1P53A 4FRWA 2YAHA 3TSRE 4XN7A 1A7NH 2CRIA 2HX9A 2HRPH 4UM9B 5BVPL 1OT1A 3RG1C 5IJDC 1S9WA 3PY9A 4HIXL 1SMOA 2L8AA 3D18A 4JJ5A 4NFDA 4R0LC 5EWIH 5B1CA 5HHXL 2WXJA 4BFBD 2NY6D 4J8QA 3OPZH 4JRYE 5JLZB 1M71B 1CLYH 5HHVL 4BXVA 2C1OA 1AGEA 4RMWA 4NFBA 2ZX8A 3IJEB 1KLGA 4HZLA 3EOTL 2VQTA 3GWJA 3KCWA 4UQCA 5EZIL 2Z62A 1NEZG 1R3LA 1KXTB 2R1YA 3QR1A 3UBHA 5AKSA 4F5CA 2NW2B 3PNWB 3UDWC 4LVEA 5CJBA 4OD3H 4KUZL 3RWCA 1R5IB 1UH3A 5AVXB 3W3MA 5DD1H 4WUUA 4O02L 1YSOA 4EQ3A 1RSFA 4NKIL 2DWEA 1AIFA 1KCVL 2MKWA 3D85D 3V52H 1TJIH 2BSTA 3KJ6H 4ONGL 4LBAA 1HYRC 1T21A 3QA3A 4MMZB 3CXDL 4HWZB 4KX8A 4TMPA 1U0ND 2JQMA 1FC2D 1FO0B 2C3HA 3G5XA 3VXTB 2I69A 2IPTH 4CSPA 4YFLI 3IDXH 3O3BB 4E41B 3GUTA 1TIUA 4EVNB 4N8VA 2BOCA 5AVQB 9PCYA 4OI7A 4HPOH 4IU2A 4K3EH 3SYAA 1J0HA 1T2QH 3PUCA 3RURA 1F8TL 3A22A 1BD2D 2VLRA 2X1OA 4YR6A 3F6IA 1YECH 1RVFH 3LNGA 3ULUE 1O6SB 4KJQD 4H1LG 5DQ9A 5GGQH 4RX4D 15C8H 3FQ4A 2EXSA 4JFDA 4YDVB 1VZHA 4DCQB 2ICEC 5DJYB 3UTSD 3WU1A 1DEDA 4M4RB 5LG1A 3I3EA 3RGVA 4WK0B 3QAZC 3D05A 4D9RD 4LSUL 4Y19B 1JPFA 2DN7A 2QSQA 2YXMA 3LEXB 5DJ2B 3RVUD 3O6FD 2RALA 2VO8A 4G5ZL 2WJ7A 2H2PD 4LXSA 5FA3A 1GGIL 3QDMB 3MCYA 4WO4C 3WKYA 2F18A 2NLJA 5FOBA 4CKQA 4QHNB 3KG5A 1PZ5B 3SE4A 2C9PA 3BP7A 3AFLA 4WKXA 4Z64C 1HZHH 1KB5A 5F1OB 3RB5A 5D7JA 4XBMA 1WZKA 3ORJA 3FYEB 4N8PA 1GGCL 2CJTA 4WUUD 4YHIB 3RI5F 4ZUUB 2XVLA 2BIQA 2R2HB 2WYTA 5J12C 4IBSA 5TDPA 5D1XE 1FFNA 1OO2A 2X10A 4OCSH 3UPCA 1QA9B 1JS4A 3GXUB 5C0CA 1NCIA 2Z7UA 5DK3A 5ALCH 2VDQB 4OIAA 4GYBA 2QQKL 1IFGA 4QLRA 2IWGA 1ADQL 5E0QA 5AW2B 3BKYH 3VTTA 4Q9BA 5DHXB 5IMMB 2E27L 3D0VA 5HBBA 5EZJB 1ADWA 4HKZA 4G8IA 3P1VA 4DP9X 3HUJF 5A3IC 3BP6A 3FRPB 5IR1A 4NQDD 1ZIWA 4FXGC 3QXTA 4HUVA 1KB5L 1XIWC 3QZNA 2GJZB 3D2UB 4XMUA 3SE3A 4X7EC 5B38G 1E28A 1WA0X 4NQCB 5KSAB 4FDWA 2BS71 2I24N 1DQLH 3CVIL 1IJ9A 1LQBC 3A5VA 3RX7A 2VDPB 4XX5A 4I87A 1SXNA 2ZUSA 1V3MA 4YSCA 5J0BA 3I50L 4U6VH 1ZLWH 5C7XH 1DDHB 1RY7B 3EYOA 3U7YL 1TCRA 5JUEH 1KCSH 1WA2X 3VXNB 4BQ9A 2D7MA 1OSZA 1D5XB 4TUUA 5DLMH 4HHAA 4BINA 2JJSC 4ZMZA 5HYQB 4PJAF 2J55A 1KV7A 1IO4C 3SD2A 4XNYH 5SWSA 1CFTB 1HE7A 3RVWC 4GKLA 2YBRA 5KOVC 6CGTA 4PD4J 5A40E 3D0AA 1THCA 1U8HB 3FSAA 4W9LC 1KT2A 2R8SH 2Z7ZA 4UAHA 3NH7H 3FO9B 4WV1C 4F93B 3DUHA 2WKOF 3GSQB 3KBEA 1SQ0B 3HBZA 2VLJE 4TNVK 1OTNA 3SDCC 5EUOE 4L3CA 4NOFA 5IF0B 1YY9D 3V0FA 1FQ9C 4KQ4L 2DKSA 1I9RH 2BSED 2OW6A 4ONFL 4L3AA 1E4JA 2CJUH 5AW9B 4U4BA 2O1AA 3GBLA 1GOHA 4RVBA 2WZ5A 4I0PB 2VR4A 5EDXA 5T1JA 2J1YA 2DDQL 2EDLA 3QNFA 1TETH 2XV3A 5DD5H 2BP0A 2Y7SA 2QJDA 4CVZB 1FFTB 4XAWL 4P5TA 3FT3B 3JVFC 5MENE 1U8PB 3EF7A 4ZMLA 3SYQA 1EZVY 3UACA 5AYQA 3F3HA 3RPIA 1LDSA 1VEMA 4B27A 1E42A 1E2VA 1HQRA 2DH2A 5L88H 2C9UA 3NCBB 4JM2B 5D72H 5FC9A 4BKSC 1P7KB 1ZSDA 3HHRB 2WO2B 3HI6H 4HJ0C 3CU1A 4AYDC 2QPEB 2EDWA 1XF3A 3QG7H 4GO6B 4JPQA 3PHSA 3BGMA 2VLKA 3CPLB 3SZ6A 1CE6A 4LFHG 5DURD 5DHYB 2QPUA 3HRPA 4IM8A 1AD9A 2DEWX 1X4YA 3B9KB 3MNVA 3PFUA 2KBGA 4A63A 3FSWA 4YL4A 4WHYG 4C4BA 2EC9U 4JFFB 1NBVL 2QZ5A 3UO8B 4JL2A 4OLWL 4I0KA 4LARL 1QASA 5DRXB 2QL1A 4LLQA 5IFAH 2O72A 3B56A 5DJZA 3U9UB 4PB0L 1KPVB 4I7ZC 4OT1L 5CEXA 1ITCA 1QBML 1MG3C 4L0YA 1RZ8B 1YNTA 1IL1A 5LNEA 2ZSWA 4UQAA 4GB9A 2FNWA 3SSGA 4FP8L 1MRDH 2CIKB 2GSMB 3EH3B 1VFMA 4UOW0 3IJHA 5FK9B 2C7UA 4NWTL 1BEYL 3FO0H 2OULB 3BQVA 5E94B 1I9EA 5JDSA 4DTGH 3UO1L 3PHAA 4MMXA 1FL5A 3RB7A 5LN8A 3DZEA 1RK0B 2P8PA 3HBQA 1W72A 2GI0A 3GC3A 1KFGA 4NRXB 3A3YB 2Z92B 1MZYA 1U3HC 4N26A 3PFQA 5D8JL 1X6LA 4L4VA 4YN3A 4BM7A 4PHZA 1IEAA 3QUGA 3FTUA 5CSGA 4ZPVB 4H20H 4LEXL 4MLIA 2ESVD 5I66B 3QDJB 4MB5A 3ULSA 4XPGL 3QI9D 4BSWB 3DETD 4ZOBA 5CMPA 3CVHA 4R5VA 1TZAA 2ATKA 3P69A 3WTSA 3QO0A 3IJSB 4ODTL 1GTFA 2E7CA 3F7VB 1UWFA 4PLOB 4Q14A 3LXCA 1ZA3A 2WPGA 3NIFB 2XTLA 3QNYA 2AQSA 4MJ6B 4AYGA 1FGVL 4V2EA 2A83B 3DUSB 5FUOL 4WI9A 1I3VA 2V3DA 2OYPA 3CK0H 5J1TC 3N1QC 4TUKH 1W72L 1MCWW 2WZ6A 4A6YL 5B3SB 1M0ZA 2JE1A 4X6FA 4NQUA 2QVMA 2ZXBA 1NGWA 4TS6A 1OHZA 1OP4A 4MJ4A 2VR6A 1H6TA 1RSYA 2BVUA 4E0RB 1OSEA 4FCGA 3Q1EA 4Z7WA 1XF5B 2XETA 2Y07L 3QJQB 2OL3B 2VUKA 5CIPB 4GW1A 3CVHL 4J4PC 4K4KA 5JHLL 5KG9B 1F90H 5IQ9A 4YBLB 3MNDA 3DSNA 3D25B 1AO7A 2ORBH 3FF8A 5DA0B 3TV8A 2VN4A 3RDTC 2EYRA 4L1BA 1CFQB 2AJZA 2ZOUA 2VABA 3EGSB 4Y8AA 3WE6A 3TBSA 3RHWF 1R3IL 4YO0B 3UGXA 1XSKA 1BAFH 2VDOH 3BPOB 3AAZA 3IDMA 3QFJD 4QRRD 4V1DB 3KPRE 2ZG3A 5KVGL 1XD1A 3ARVA 3MJ7B 4X5PA 3V4UH 2AK4E 4MA7H 4U2ZA 5EUOF 1T1WB 3FU5A 3RWEA 4EI0A 5LJYH 1B4RA 4ZW8A 1E30A 2W88A 4L4VD 2E86A 5CN3A 2A5UA 4IGBC 4G7VH 4WGWB 3PHQA 4U3XA 1A5FL 4U1IB 3ZX1A 1E9OA 1ES0A 4YDLC 3H3BC 5HGAB 3FULA 3IXAB 2EDQA 5HVGB 5CN2A 3DGGB 3TM6A 4KJPD 2DS4A 4N0YL 4ZMWA 1E8XA 4NKGA 1E3FA 2PPAA 5BOZG 1X7QA 2FL5A 1IMHC 4FJ6A 4PD4K 1DN2A 5F7NC 1XBDA 3KL3A 3T6ZA 3APCA 3HNVL 4JY6B 4LLWA 5D4QA 3V7AG 4P3DB 4PIRF 4R2GB 3UTZB 1LK2B 1XX9C 2GUYA 2G5BA 1NMBH 4QWWD 1M9SA 1OT2A 3BLPX 5ACZA 3GIVB 4XP1H 3T08A 4XCYA 3LZQA 4TYUA 5DJ0A 1TJMA 3QS2A 1HSBA 3H42L 3KYOB 2ZUTA 3T0WA 4KY2A 4JR9L 2L7QA 1M1XB 4HJGA 2CNZA 4DO6A 5I1HH 3ZKND 5ENWA 3UG4A 3W39A 3TJPA 3M17B 1L0YA 5EU6E 4TOYL 1A7BA 4NQTA 2CGZA 5D1QE 5I2IA 3FW6A 4B7IA 4LF3A 6PCYA 3F62A 1Q72H 2ZTBA 2ZWZA 3MBEC 2P8MA 4I2XE 4NN7C 3CSPA 1HHJA 1L0PA 2K3HA 3T8XA 4W4OC 1UH4A 1UWYA 3EJYD 4N2NA 4MZ2A 4EZJA 5DMGD 2EE0A 3U9PH 1GS8A 5L2KD 3N1PC 4K7PX 3VG9B 4PRHD 5HYSG 1UM4L 5LB1A 1FNEA 1XH3A 3BKJL 5CEYA 1XB3A 5FKPB 4KKLD 3WS3A 2FVNA 1W8EA 3QEHA 3KPSA 3VUAA 5AZEH 1CWVA 4LQFL 1CB4A 3GEFA 1G9ML 4FFYA 1ECZA 2P4AB 4G8GD 2DKMA 2IEPA 2MNJB 4UANA 1WC7B 32C2B 3NA9H 3P73B 5EU4A 3WOVA 4P99A 3DX9B 5KJRH 4ZUWB 4RIRB 4JN2A 1URZA 3U30C 2G0KA 3KPNA 1KOOA 3H7BB 5F0JB 2QDWA 4LOUC 1J8RA 4U33A 1GZQB 2OMYB 2EIZB 4JG0H 4R3SA 5IESH 3E3QE 5J8OA 2K4WA 3EUDA 4CC1A 5E2UL 1GW6A 4PW9A 4HS3A 1DQQB 3JWOH 1T20B 3L3KA 4GEIA 3IDNB 5FM5O 3SDDC 5JOPE 1EQWA 1AJ7H 3QHFL 1HNFA 4ODVH 2WVSA 4DF9A 5A2KH 1A14H 4ZO7A 2DQIL 4I48A 3VFOA 4D9QE 2N3JA 4AEFA 1LO3L 1JVLA 1I7TA 1X7SA 3V4PB 4XN8A 5F6HI 1W0VA 3LD8B 4GFXA 3G5WA 5EZPA 3Q1SL 1J5HA 2GPZA 3ENEA 3UGEA 4S1SL 1M2VA 3IPBA 5LLIC 4Q2ZA 1V7NL 4PSRA 5JW4R 2GYSA 2XT1B 3PYCA 3ZKSD 3VXPA 1N8ZA 3WG7B 5FTTB 5J5EA 4WTWA 5CINL 1GXEA 1FNSL 3TZVA 1WAAA 4JY5L 4KX9A 2CMRH 2VN7A 4W6XB 3GI8H 4N9GB 4PJBE 1I7ZB 2KERA 4WHTA 3ZGIA 5CO1A 5DUML 4AQ8A 5FW7A 2FQEA 3AQDA 3R4DA 2EDHA 3TIDB 2GK0B 2EDXA 5CNHA 2DV6A 3RL2B 4RFOH 5FECB 2OI9B 2EXYC 4P06A 3ML9A 1AXSB 3IB4A 2OS7A 5ALBH 4OI9A 2Q87A 1MI5B 3C09C 1B2WH 1BAGA 5J3HC 3K72B 1O7SA 3KPSD 4PLJC 3H3KA 2JB6A 2NSXA 3BAWA 4KMTL 4UDTB 4Y5XA 2P80D 1KWKA 4OZHB 3S7GA 5HYJE 2J21A 4WNSA 5DZNA 4EZGA 3X1BA 4DP0X 2V5MA 4WDIB 3IGFA 4Z3JA 5JQ6H 4KROB 2WLYA 1SOQA 2HCZX 3V6OC 2UZYB 4MCZA 3MRRB 2X4TB 2OMVA 4ZTPL 2X12A 1F2XK 1AC6A 1VACA 3QIUD 4C56D 1OAKL 5J57B 1EO8L 3NG5A 1UT9A 1UJ3B 2UXFA 4IS6B 3IETB 4WU7A 5FV2A 5FPIA 1R75A 1JWUA 3F85A 1Q0YH 1OF2A 2H26A 2DOCA 3RY5A 1YPZA 3E8UL 3F2LA 3T09A 4CC4C 2RA1A 3DROB 2IAMC 3G6JB 3TT1L 2XN1A 4M56A 3ZU8A 4OCMC 4K3JH 4BCZA 1ZLVK 2L3BA 3AY4C 2GTWA 4FYRA 3S3DB 4W81A 5I1AB 5FYKE 3V9CA 1KJ2L 3QZOA 5FYJU 3LQAC 3VFPB 4PJ5E 3VMPA 1IVTA 1Z7XW 1YMME 2I25N 5AAWC 4H5SB 1PY0A 2XXMB 3VXOB 2HWZH 4ENZA 1KZYA 4LHUG 1J88A 1USZA 2QPFA 2BWIA 1X5MA 1OW0A 3BT2L 2D7TL 4MQ7A 5MEQA 3KYKL 3GHBL 5FHAL 4PGJA 4Z61C 1WDAA 1IM3B 3JTBA 3H8NA 5G4NA 4Z7VA 2DQEH 1PX3A 3T0VA 4GRWB 4YHLL 1NBCA 3UEQA 4PTUA 1LMKA 2DQTL 2AQ2A 3L4UA 2YEVB 2CALA 5J13B 3O6ML 5TQ0L 4LLAA 3P4OB 2IH3A 2H6OA 3MJGX 5CCKH 4HIEA 35C8H 1WCBA 5CU9A 1I9IH 3OKNA 3OMNB 3KVDD 1KJVA 1UB5B 2YPKB 1TZOA 3K80A 4N0UE 1NCDH 1BQSA 1L9PA 5C09A 1KN4H 3GMLB 3U1SL 4ZO9A 4NO2A 4AE0A 2OSLA 2WUBH 2BY3A 2OR7A 4X6CA 2WYIA 1JGEA 2WLMA 1HYSD 1MFDH 3B8SA 2HVKA 3D39A 2PW1A 5L4IA 4WI8A 2WLIA 1DVUA 2F68X 3I6GA 1MLBB 4AZUA 3A6CH 1FLRL 4TM9A 3PP4L 5IB1A 2AEPL 2HJKB 4IRSB 5GGSB 2XY2A 5HXMA 1EDYA 3MRPA 4BZ1A 3J2PA 2C9SA 3HR6A 5C3LD 2WLHA 5GGVY 4XO5A 1PEWA 1Q38A 3S98A 3EO9L 4P2QE 4N2HA 1JZDC 3QE5A 4Y7MA 1HXMB 3GOZA 4P5SA 2OTPA 5C08E 1E4HA 3MRQB 3O2VH 1ZHKA 4G6ML 3GSUA 1P7BA 1M7DB 2DMGA 3BPCA 5EA0L 1XSOA 2DMCA 2Y7NA 1BZDA 4P23B 4JPVL 3HZMB 4EKXA 2K1MA 3OKEB 1PX8A 4B97A 2NX5E 1WUZA 1QUPA 4KJYA 5GS0C 1OGPA 2GIMA 3QXDA 4A38A 4YK4C 1A3LL 2W65B 3DRTA 4KHTH 2BK8A 4N87A 1JTTA 3HNSH 4FQXB 4RDQF 4X6BB 4MXQC 3BVUA 3JTTA 3OQ3B 4ZJ9A 3VRIB 4AV5A 4R6FA 1IM9B 1UOKA 5I1DB 4PP2A 1AGBA 4PJEB 1F41A 4BCYA 2HMIC 3S3PA 3Q8AA 3MDJA 1TMQA 4PJBF 4WHYH 1VB9A 4X6DB 4HWUA 1XGRA 4PJCB 2ICWJ 3VFWB 1B9ZA 1WFTA 1QSED 2Y5TA 1AMYA 3O3EB 4JPWH 3EKCA 1V05A 2ENSA 2ZPKL 2HTLD 4LCUB 1EERB 5BNXD 1S5HB 4BFIA 3SJVD 4IM6A 4TSAH 3BWZA 1ESOA 3PWJA 3QBTB 3N41F 4JHZA 5DI8B 2X89A 1Z5LA 2XZQL 2DKUA 2YHGA 1TQVA 2AXJA 3FCTA 2V4LA 5DZOA 2LW3A 5IBLC 4YSSA 1FUNA 1XL6A 1SBSL 1FYTD 2P1YA 4JFYA 4G6JL 3T8VA 3HR5B 3V4VB 5HI5C 3CFUA 4YDJA 1DQDH 4UT7L 2HSIA 3U4EB 1U8JA 2EH8H 3WBDA 1S9VB 4LSTL 2BMKB 1KXVA 4PEQB 2R51A 1MHEB 3KNBA 1DANT 1MDAA 2LLGA 4B9KC 4WEBL 1J8HB 3B6SB 4OLYH 2WN3A 2BERA 2JE0A 3SY0A 5CGYC 3V0JA 3L54A 2NY0B 3HA0A 2PO6C 3EXJA 3JWNE 1RUAL 2VLMD 3GJFA 1XEUA 3ABMB 4OM0L 3QUMB 4ZXBB 3OC8A 3I2CL 3NEEA 4N5UA 4OLVH 5K9KA 2NY3D 1NAMA 4HT1H 4IMKA 4LP4A 5IOPB 1R0AL 1MY7A 4KRPC 3QIBD 4UQEA 4CMMB 2CQVA 2VE6A 4MA3B 3VDBA 2WOBA 3P4NA 2WLLB 3LB6C 2Y69B 2C9VA 5FV1L 2FZ3A 5DD6A 2JXMB 3C5JB 2BSSA 4ORGA 1ASOA 4ES8A 3OF6D 3K71B 5D2NB 5DZLA 3FU7B 2P5EE 4P4KD 4FYQA 3AS3A 3EW3B 3JV0A 2WWNA 2V2TB 4LO9A 3NRPA 3SDXE 5HHQB 2X4NB 2YZ8A 3WN4A 4UTAH 1LM8V 2C3VA 2ENPA 5F7AA 3OJAA 2J4WH 4PBVC 5E5RB 1KNOB 3P2TA 4AXWA 2QVFB 2VSKB 1YEDA 2H2SD 2Y7OA 2PKDA 1HU8A 3VD3A 1HEJC 4E5XA 3CTTA 1YZZA 2A74B 3PWLA 4G43A 4EIBA 1N18A 4G42A 5GS0H 2EXTA 1XH0A 2K7PA 3FNKA 3KH3A 4HV8B 4M6OL 1Q8MA 5HVHB 1UOVA 2DIBA 4OSUL 4XPBL 4ZSOB 3WL9A 2BVTA 4JRXB 2CLRA 2IQ9H 1DN0B 1T7WA 3SGEI 4LSQH 5J1AB 2VM3A 2HUHA 3MTXA 5GGVH 4WYKA 1UXWA 1KJ3H 1QYGL 4AYEC 4M61B 4A2EA 4AMXA 4D3CH 4DEPC 1IIKA 1KTDB 1JL8A 4XAKE 2CHZA 3RVVC 3WO4B 2VISA 3CVCA 4OCWH 1ED3A 1DBBL 2V5TA 3ATEA 2E0PA 4L4TB 4PWFA 2CE6A 2FATL 5LCVA 4J0MA 3GSRB 1OAUH 2Y1ZA 2ZYIA 1KYUA 4Y9CA 4UB0L 2VDLB 3FSZA 4R5XA 2OXGB 3BKCL 1O0VA 1XCQA 4B96A 3MV9B 5C0RH 2JVUA 5BS0B 2R2BA 2QKIC 5A1AA 3PPSA 2D3NA 5KBPA 5I82A 2R2EA 4NM4L 3O0RL 3VB9A 3ATDA 4NQXA 4Y2DC 2IADB 2P5WB 4KNUA 1QFWM 2GTQA 1A7QL 4YJZL 1FNGB 4OZ4A 1P2CB 4PJGA 2Q86A 2UZPA 4L1TA 5JPNA 1CPUA 5IM7B 4PRDA 2XG4A 3KDPB 3OG6B 4ZMVA 1C1EH 1MFEL 4XBEH 3SBRA 3GXNA 4WTQA 4KDWA 5IBUG 5IJBA 2AMUA 2NXZC 1K3IA 3DVGB 3CFNA 1AGDB 3QHZH 3CDZA 5KVDE 5I19H 4U3HA 3ZR5A 4XPAH 1MRFH 2TAAA 1M71A 5JLZA 5LFNA 2Y23A 4MDIA 3G5YA 3GJEB 4O58L 3SYPA 2YIHA 4UFRA 4FXKA 4RBPK 2FNBA 4FGMA 4KI5D 2GEQA 4U2YA 3LZNA 3OXSB 3EJZC 4HK3N 2XA8L 5C8JA 4Q6IA 4UT9A 2MTPA 4FHOA 2NW2A 3PNWA 5J6HA 3IDGA 4M93C 1GRWA 2J8UA 2YK1L 3DNKA 2CKBA 4F58L 3AXLB 2AXGB 4LVOC 4DETA 3IJYA 1HI6A 1KCRL 2O6SA 1JV5A 2DWTA 2OMXB 5JHMA 3SPVB 2R23B 2Z34A 3S0PA 3D3VA 4MMZA 1A21A 1FVEB 4FQIH 4A39A 5AWNH 4F7EB 3ZO9A 2Q8AL 1FO0A 2HVBA 4D9LL 1RK1B 1AOZA 1P9AG 5I28A 5FYLH 1KLUB 1NINA 3BDYH 3O3BA 4EVNA 2YA2A 2I85A 3MV8B 5DHVH 2BCKB 3LPOA 3VWJA 1IILE 4TLUA 3BAYA 4GMTL 4HIHB 3SDAC 4RSVA 3PUUA 4PMFA 4O5LL 2OFQA 2CKBL 3JV6B 3O2DA 3WNIA 3EAKA 5HJ3B 4HIXH 1O6SA 4IU3A 4FQQB 1MHCA 2IH9A 2XWJA 2JI2A 4LCCC 5HHXH 1GGTA 1I82A 1QABA 3C6NB 5HHVH 4RMUA 4JFEB 4NNYB 4DCQA 4UM9D 4ZRGA 2D9CA 3FN3A 4FQLL 4MJJA 4WJ5A 2IPKB 4QY8A 1ZA6B 4M4RA 4XMPL 4WJKB 4WKZB 5EZIH 3KH4A 3EOAA 5I6XC 3SDXF 3FCUB 3C8HA 4Y19A 3LEXA 4PJFB 1B6UA 4KUZH 4CRPA 3LPPA 3QDMA 5E6RB 3HTLX 2ZXWB 3UP1A 5GRUL 4O02H 3RIFF 5J6SA 4NKIH 3Q5TA 1V10A 1KCVH 1L0XA 1GY1A 4GSXA 4QHNA 3DI3B 4ONGH 2AQQA 4ZAKB 3VD0A 1NMCC 4KH9A 1JGDB 4QRPB 3CXDH 2WZAA 5DS8B 4MYWB 3UAEA 4YHIA 5E51A 1DVFC 2HKFH 1OAZL 1KBPA 3D30A 4KKNA 4OLUH 2FJHB 4Z18A 5AG8A 5F88B 4J27A 5ITFB 1QA9A 1E5UI 1XZ0B 2LABA 5ILTL 3C12A 5HZLB 1RP8A 5IGXL 1F8TH 3T4YA 5LNGA 3ULVE 1A1NA 3V5HB 1ZGLM 5KUMA 4GAAA 2E7MA 1ZHBA 4E41D 2EKSB 4QHLB 3PMHG 1DVTA 1EX0A 2NR6C 1XR9A 4JJHA 4UAOC 3EH5B 1RUPL 4FQHB 4NNXA 3KJ4A 3NP3A 1NGQL 2WUCL 3QDGE 4Q74A 3TTSA 4LVNB 3CU7A 3ZKMC 3CGTA 4OFIA 4JGNA 3O41A 2V7HB 5DZPA 5BZWB 1NCHA 2VB5A 3CSYB 3TPKA 4RMRA 2P5PA 2NDFA 4Y1AA 5E2TL 4LSUH 4JZJB 4OAWB 4Q6YA 3WPFA 1IAIM 4G5ZH 3A6OA 1H6FA 1DDHA 3ILDA 1GGIH 3DGDA 2DQCL 3OHXB 4HGWB 4HUWA 2GQHA 3DPBA 2DI8A 1D5XA 1T2XA 2A0LD 5DJDB 5HYQA 3RNKA 4Y19D 5BRZB 5E7BA 1TCMA 2HT3C 2D31A 4BBWA 4JFPB 2MPAH 1CFTA 2BY0A 4F20A 2XA3A 3QDMD 1CUOA 3WN5B 1GGCH 4Y61B 4Z8FL 2Y0SA 4FFVC 3T65B 4N5EC 5EORL 3Q01A 4CSZA 1H3PL 3DVFA 3AU1A 3CZEA 4GO9A 2XWCA 3OKMA 5KEZA 4H26A 5AZ5A 2WWMC 1KYAA 4L8CB 3GSQA 2EEBA 5BVJA 2QQKH 5ESVB 4XOAA 3VQ1C 2RJMA 1PZUB 1ADQH 3ZDXE 3KYMB 2IANB 3TBVA 3OAYK 3BC9A 1UQSB 2E27H 2YD9A 3L9RA 5D1XC 2FJUB 3D0LB 4I0PA 2X9YA 3LSOB 2F53E 3HKZA 1RLWA 3UJJL 3TL5A 3RYMA 4KBPA 2GVYA 1PDKB 1KB5H 1JPTH 1QKZL 3I9PA 4CVZA 2WTRB 3CBRA 4JQVC 4D0DA 2QGEA 1N6QL 5E24E 1XMWA 3FT3A 5DK2A 3H55A 4Z78B 4GAGH 4NIKB 4DVBB 4LVHC 3CVIH 3CVBA 4DFIA 2XTJB 1LNUA 1ZLVH 2ALAA 2VMCA 3I50H 1SXBA 3U7YH 1GVIA 3UTPD 1P7KA 2WBJB 3D2UD 1ZHNB 3PL6C 3W81A 4NQCD 3OGKB 4MD4A 5KSAD 5D4JA 4TNWF 2GT9B 8FABA 2YRBA 1M4KA 1I1AB 3AITA 4NQSB 4X9FA 5DHYA 5DFVD 4KRMB 2FTAA 4G6AC 2F7PA 2LU3A 3NFNA 3WEXA 2W94A 4PAZA 3MKKA 3LS4L 2RB8A 5GMGA 2VJ0A 1SN0A 3RUGA 3T0AA 3ZBMA 2BOBB 4CUCA <