4CC4C

Complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
263
Chain Sequence
SESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSALSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKVNEPVKYQPELYITNTVKDPDGRWISPAAISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Cell invasion
molecule keywords INLC PROTEIN
total genus 82
structure length 263
sequence length 265
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08191 LRR_adjacent LRR adjacent
C PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4cc4C02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4cc4C01
2R9UA 1PGVA 2V9SA 4FDWA 2RA1A 2CA6A 3REZA 3OGLB 2XOTA 3DZEA 3UL9A 4Z79A 3OJAB 4FCGA 4K17A 1ZIWA 4NKHA 3ZYOA 1M9LA 4LSXC 2P1OB 4M7EA 4J0MA 1D0BA 4Q3IA 1H6TA 3P72A 4Z61C 4R0AA 2Z64A 4LI1A 3E2JA 3ULVA 4Q62A 4CNMA 2UZXA 3VQ1A 3FAXA 2OMVA 2Z7XB 4MQWX 4B8CD 2JE0A 4J4LA 4PSJA 5B0TA 4HQ1A 2RA8A 4ARNA 3WPCA 1QYYA 4H09A 3W3NA 3BCFA 4R07A 5IJCA 4XSQA 5GMGA 3C6OB 1O6TA 2V70A 3OJAA 5A5CA 1FO1A 4C2AB 2OMTA 3M18A 4FS7A 4FHOA 2OMZA 1DS9A 4R6GA 1FQVA 1FT8A 2OMUA 2OMWA 3RFJA 3WPFA 4MN8B 2ELLA 3WPHA 4UFRA 3ZYJA 4KT1A 1H6UA 1M42A 2Z63A 3WN4A 4Z8GA 3W3LA 3W3KA 4CC4C 3WPEA 2C9QA 2WQUA 1LTXA 2P1MB 3C6PB 4KXFB 2C9PA 3G06A 4FMZA 5CMPA 3RGXA 2O6QA 1OTNA 1OZNA 1G9UA 2JQDA 3RW7A 2ID5A 4LXRA 3E4GA 4YEBB 3RFSA 1XKUA 2Z65A 2OMXA 2Q4GW 5CMNA 1OT4A 4QC0A 3C6NB 5ICUA 2V9TB 4IM6A 3WPGA 4FD0A 3O53A 4BSRA 2XWTC 3E3ZA 4QBZA 3CIGA 3CIYA 3A79B 5AWDA 4PERA 4U09A 4GLPA 4AY9X 1Z7XW 1O6VA 3CVRA 1M9SA 4M7EC 4WP6A 5FTTB 4OQTA 4Q3GA 4R09A 3W3GA 2FT3A 1DFJI 4AW4A 1M10B 5GMFA 4TZHA 1M0ZA 3BZ5A 2P1QB 3ULUA 1KOHA 2WFHA 2Z62A 4LSCA 3ZYNA 1XCDA 4XOSA 4CNCA 1P8TA 2YA1A 1IO0A 4ECOA 3RW6A 3W3JA 4R08A 3BCDA 4XGOA 3M19A 3ZYIA 1OTOA 3PMHG 2WQVA 4P91A 3OGKB 3VQ2A 3RGZA 1LYQA 2ASTB 4RWTC 4Z64C 5GS0A 3WPBA 2O6SA 5AWAA 1OGQA 5GS2B 2C9RA 4PQ8A 4LSXA 5HDHA 3SB4A 4C2BB 5HZLB 2BEXA 4KNGA 4R6JA 4CP6A 3JB9j 1W8AA 2Z81A 3G39A 2Z66A 1P8VA 2Z82A 1GWBA 3G3BA 4R5CA 5LFNA 3UL7A 3W3MA 3WPDA 4QXEA 4PKIG 1NM4A 3TSRE 5IJBA 2WQWA 4V2DA 2UZYA 1FS2A 4BSSA 1O6SA 4ARRA 4R6AA 4LXSA 4V2CA 4P8SA 5AWBA 3RFEA 5B0NA 5AZ5A 4BV4R 3BC9A 4U08A 1KOOA 3GOZA 4Z94G 1XWDC 4R58A 3UL8A 1SQ0B 2O6RA 3FXIA 1K5GC 4PEQB 3RIZA 5D3IA 1XECA 1U0ND 1A9NA 4R5DA 2BNHA 5GQRK 4L3FA 2WQXA 4AQ1A 2P1PB 4I6JB 1YRGA 4ECNA 2RR6A 4R6FA 3UN9A 2A0ZA 5IYXC 4CC4A 1OOKG 1JL5A 1WWLA 4G8AA 2JE1A 4NKGA 4Y61B 3G04C 3O6NA 4RCWA 3KJ4A 4BSUA 1XEUA 3OGMB 4RCAB 4U06A 4U7LA 3RJ0A 5GMHA 2OMYA 2IFGA 5B4PA 2P1NB 3ULAA 3E6JA 2ASSB 4LI2A 5AWCA 4L3AA 4V2EA 5IJDA 4WYKA 1IX2A 1K5DC 3G3AA 4GT6A 1A4YA 3FAWA 1DCEA 1P9AG 4LSAA 4CILA 2Z7XA 2Y5QA 4EZGA 1OTMA 3WPIA
chains in the Genus database with same CATH superfamily
4EF3A 1A7PH 1EO7A 3BKJL 5JOPD 4XPTL 1K72A 4NKHA 2W65B 1TEGA 5FB8B 4QHLB 5F0LB 1UXWA 3ZTNH 4K0OA 5I28A 4WJG3 3MRJA 1WT5C 4E5XG 2FT7A 3IDMA 5FUOL 1SXNA 4NUJA 5EOCJ 5DEGA 4YDVB 2DDQH 3KL0A 4F7PA 3NJNA 4B8CD 5KVEE 4Y9GA 1CGSL 2ORBL 5HBBA 1NCUA 1AACA 3D85B 4WO4D 4PRAB 4U1HB 4OIFA 1MFAL 1DYZA 2VSKB 4XN9A 1FT8A 2GKIA 2RCSL 3NRQA 4OCRL 2ICCA 3MYJB 4HJGA 5HGBA 3SYCA 1GMEA 3C08L 1RU9L 3NIDE 5CNHA 4B9YA 3TV3L 4K15A 3KJ4B 1IAOA 4YBHA 4PJ7A 1NCHA 4XMKH 3UTTD 3V0VB 3WIHA 2ZAHA 5DUMH 3TVMB 2KLRA 4AZ8B 1WCQA 2V17L 3JV5A 3DHPA 4NQDE 4OFVA 1E8YA 4X7SH 5GRXG 5IMOA 2G0KA 3POHA 1ZTXE 2EDLA 1BM3H 5HTSA 3FXIC 4HIPA 4LOVA 1N2RB 4UQ2B 1YEFL 4HHAA 4JM0A 4L37A 4PLOB 4OZGA 3NSDA 4EI0A 4OV5A 2HTLD 2NR6A 2Z62A 3MKGA 2X7LA 3ILDA 4PD4J 4PCSA 1CN4A 1DE4A 3EGSB 1R5IB 1TXKA 1DJZA 1A6PA 3T71A 3C5JA 3IDNA 1AQKH 1QAWA 4JMXA 4HHAB 2OXHA 3FB6B 4L37B 2IG2L 4MAYB 4NENA 2X4NA 4I0CC 1UUSA 1YEJH 4R9HA 2GBAA 3HB3C 1WZMA 3OHXB 4LKCA 3KCWA 1F1GA 2V7HB 3MA9L 4P46B 2WYIA 2VYRE 1JGEB 3EXJA 1ACZA 5AWNH 4OJFH 4X80L 4ZTPH 3EFFB 2XWDA 1MCNA 4OD2A 5LGYA 4FQ2L 1ASOA 2JLPA 4K2UL 2VC2B 1BVNP 4G8GB 4E42A 3UC2A 5E8OB 2J5WA 1BBDL 3TCLB 5I1IH 1WWLA 4WU7B 4G8AA 5F9AC 2CIKA 4XNMA 2HT4D 5EZJB 1TDQA 4FQJL 3RIAF 1OW0C 5IJVB 4RCAB 3L4UA 3TYGH 4UQIM 5BZDA 3QULB 5E8DH 4JR9H 4MRBA 3MMEB 4YGAB 1T83C 3LY6A 5GS3A 4AYEC 2JH2A 1QSEB 3VSUA 3LNHA 4PB0L 4YN3A 5C0GA 4YSQA 5C3IA 1B2WL 1QOKA 3F58L 5JORB 1UEMA 1OE1A 1Z9NA 4QRTB 2RA1A 2BWDA 4AH2A 2YPVA 3OKYA 3EOTH 4NJAL 3C60B 5IQ9A 1JN6B 2XYBA 2VXVL 2ZWNA 3GRGA 3SY0A 1KYAA 1I7RA 2FT8A 5F6HI 3AGVA 3DC0A 3S35L 4MB3A 1BDYA 2IBGA 3FQNB 3VXRA 2YEQA 4GAYA 5DD0H 3MLPA 4M6NH 3EYOB 3L4CA 1HZHH 4KTDL 5B7EA 4Y2DD 3HZVB 2WLMA 2BY0A 3CDCA 1A1OA 4J3OF 1K6QL 2OMTA 5FA4A 1KCLA 1S7RB 2KERA 5BS0B 5DJYB 5JLZA 1BQKA 1XBDA 3NACL 25C8H 4WO4A 3AG2B 2WQUA 3ARPA 2ZZUT 4M6AA 3QDGA 3QWNA 3MNZA 3NFNA 3SKJL 3W0WB 1E67A 3QUMB 1OIOA 2CUAA 5C0AE 3FOLA 4MRCA 1R3IL 5GS1C 4S1QH 3IJSA 4HDIA 2A74B 4BD4A 5SWSD 3QQDA 4KZDH 3ZUNC 1CYGA 4ORGA 4EIBA 3KBHE 5F7BA 1IZJA 5ISZA 1E4KC 4QT5B 1WIPA 2NY5H 2DOCA 1LDSA 3HA0A 5IBUB 5AWDA 1KIPB 2AJXL 4LT7A 1JDCA 2BC4B 4Y89A 5AQ0A 4N85A 2X1OA 1BVKA 3K1KC 1QSFE 1TQCB 2DTMH 3Q9PA 3X2QB 4G71B 2YQGA 1PAZA 5E5RB 3S8WA 4KO7A 3N85L 3H42L 4FG4A 5LN8A 4L48A 1MWAL 2N3JA 2LW3A 1OTUD 4L8CA 2K3HA 1EDYA 3TVMD 4PRNA 1AGEB 4G72B 4EUPA 3ZHFA 1PSKH 4WUKH 4NP4L 1T22A 2R1XA 5DZNA 5E6YA 5C0AB 4WUUA 4KH2A 5IBLC 1FHGA 1T1ZA 4IOIA 3CTTA 2Z82A 3FQXA 1A25A 2IAAC 3KPSE 3TESA 5DD5H 1D6EB 2NOYA 3ELAT 2O5NA 2V6HA 4F33B 1P6AB 5DWPA 1HXYB 4JY5L 2FO4B 1EMTL 1J1XH 4Y5XC 3THMH 4XXWC 2DW5A 2Y0SA 4JFHE 3UTOA 3GK8L 1W15A 1E3FA 3UBFA 1HFUA 1MLCA 1TZHB 3DA0A 2XKSA 3UTSD 5EZJA 5FS5A 3UBXG 4M7JH 4Y1SA 2AGJL 4JQXA 3IS0X 4ODTL 5KTEL 3KWTA 3LPPA 4KUZH 1YZZA 3HS0B 4EE2A 1DQDL 1G6RA 5HGHA 4B9ZA 5F71A 4J6IA 2AK4E 4LNRA 2CRYA 5D4IA 3QDMB 2E76C 4L8SA 3PL6D 3KPTA 3V6OC 4B53A 2IBZX 2UZIH 1JNHB 4GSUA 4P23A 4XVJH 3WKMH 4FHJA 1YYML 1MKFA 4IGBC 3T0EE 2E9BA 2DKSA 2BY1A 5EO9B 1E5AA 1I85C 2GFBB 3CDYA 1G9NC 3H6AA 1TQBB 4YHIB 4QTIL 4P8QA 3NJFA 3P3UA 2BSEA 5ACZB 2V3EA 1T04A 2XVKA 1RPQA 1IAKA 3WFZA 2YD0A 5J4MA 1ETZA 3IPBA 5BVJA 1IQDB 3IGFA 2VLRA 5D7LD 1AP2B 3ECUA 2XG5A 5EIQA 1QSED 1U92A 1G6VK 2IBBA 2CR6A 3BAEH 4E41E 5DUJA 1SHSA 2HLEB 1Z0NA 5AVSB 4XTRD 1INEL 2JI3A 4LCWE 4UINH 5D1QD 1F6FB 1IGTA 3LQMA 3HC3L 5D7JC 3JV4B 3QT2A 4Z8GA 4TLKA 3WPEA 1AHWB 5F7LB 1UT1A 3BOVA 5DJAB 4JRXE 4OFIA 4N8VA 3WKNA 4XCFL 1KXVC 2GI0A 1TETL 1OPOA 5BV7B 5C97A 2GY5A 2P7TA 2X4PA 4O2EB 3U6RA 1ED3B 1G7LB 3VQ1C 4RDBA 5E6ID 1A3QA 3QZMA 4U09A 4M3HA 3GLEA 2WN3A 4LVOC 2HT2C 5I5JA 1YY8A 1WWWX 1IJ9A 2UWEE 3W0WD 3ARYA 4JHZA 3KLQA 4WI4A 1FL3A 3GJFB 3SB3A 3PGFL 5FCUH 1JK9A 5JW5A 1KXQA 3D85A 2YMXH 1SDDB 3LRSB 4YBLB 5J8OA 3OGKB 1E2WA 4UMSA 5GGTA 2QSTA 4I13B 3U0WL 2VDPB 1JWUB 5ID1B 3BVVA 2OTWA 2V7NA 3CLFL 3BFQG 4C58B 3WNMA 5ISZB 1HK6A 1ICTA 1BLNB 3GI8L 4POZD 5DJ6A 5TDPA 4HUKB 3JVFC 2QKSA 2YRLA 4WTZA 4XO4A 4AEEA 4CA4A 4LLAA 5DJ8B 1BQUA 1T2QL 4AIZA 1ZT1B 2AZUA 2VDML 4YBQD 2F5BL 3BP6A 1J9SA 3VFVB 4HWBH 5AW6B 4AQ1A 1NGQH 3GM8A 3NZSA 2DWDB 3ATEA 4NWUH 1HS6A 1N3NA 4YZFE 3TYFA 3VG0L 1I75A 5F9WC 4F7EB 1NC4B 2EH7L 1M3IA 2W0PA 1MDTA 3U4BL 1E9PB 2AJYL 1X7SA 1YYMH 3VJ6A 1GZPB 1NCBL 1AO7E 3BP6B 4CNIA 4F1SA 2BVPB 4UNVA 3QQXA 3V2AR 2WXKA 4GAYB 4XNZB 4U3CA 3CZEA 2VAAA 3I6LD 5BZZA 1AR1B 1FFOA 3NBNA 4NRZB 4A6YL 4F5CE 3ZYOA 1I82A 4GRLB 1NUNB 3QORD 2Q7YB 3MCYA 2QQNH 1PX4A 1H5BB 3UABA 2MRYA 4OCWL 4N26A 1U8QB 4DWHA 1J0KA 4J4PA 3RVUD 4JDTL 4DOHE 1LO2H 1I4FA 5DDHB 1I1AC 1AZNA 2VQ1B 1D7BA 4FGMA 2ICWA 2WINB 5BZDB 2K78A 4ANUA 1KCUH 2XN9B 5IMKA 3IXTA 1EXHA 5D6CA 4AKOA 2QZQA 1CDCA 2DS4A 3QIBA 3LEVL 5E8OA 1H8NA 2H3XC 2F7RA 3L3GA 3POCA 4I7ZC 5C2BL 4RH4A 3NJXA 2G60L 3RWFA 3FCTA 2CJUL 3MLWL 5AZ2L 3EIFA 1RZJH 2BO0A 4KVCL 4OZIF 1CR9L 3BPNB 4G5ZL 3AROA 2X4RA 4UTBH 2EDRA 3TBVA 3IJYB 5A6LA 6PCYA 1DO6A 4Y5VC 1YEJL 5CU9A 1D5MA 3UBXA 1DZ0A 1WD8A 2KZ1B 1OT2A 5DC4B 4TVPD 5GSRB 4MNGE 2BY2A 1A3LL 4Y1TA 1U91A 4JPWL 5DD3H 5LXGL 3O3EB 1NH6A 4LCWB 2VITB 1AFVH 1TSHA 4HGWB 3L13A 4TLSA 1LP9A 1DE4B 1OHZA 1K9TA 3NK4A 3DGGA 4QHNB 4H88H 4N2MA 4JRXB 15C8H 3CK0L 4AUJA 3ML9A 4W9CC 2WD0A 1EZSA 3RY6C 1L9TA 3VM7A 2GUOB 1J0JA 5A7EA 2DTSA 4HMDA 2AXFB 4P59L 1UYWH 3G6AB 5D9SA 4NNYB 4NKMA 3FSAA 3LXUX 2CKBH 4FQCH 4PAZA 3WSQH 2VQUA 1AC0A 3OJ2C 1CD1A 3OMNB 2VZVA 3TNNA 3G04B 1FNGA 3HG1B 5K9KB 1FVEA 4R6UA 1T0PB 4GW5A 3ILPB 3FXIA 2DYPA 5C9KA 1A9NA 1BEXA 3GMQA 2ZYSA 1BQ5A 3EH2A 4HXAL 2O6FA 4X4ME 4DO6A 3FPYA 3OMIB 2JVUA 4XNQA 4FFYH 1G9ML 1T1XB 2EDTA 3MR9B 4P5RA 2EDMA 5C0BA 3VD2A 4RCWA 4H2AA 4OFKA 3U46B 2H6UA 3O45A 4U1HA 3GGWB 1E9OA 3FQTA 3OB8A 3ZE2E 1AJ7H 1A6UH 5EZLA 2Z7XA 3PHQA 2ZNXA 4NUJB 1S6NA 3DZEA 3QHZL 2PWHA 2XX0A 5BXFA 5KYNA 2JKNA 2J21A 4LSXC 2KI6A 3IMWA 1V3LA 2BRRL 1A7PL 4YVNA 1N0XH 1JV2B 1A21A 2YIHA 2ZD0A 3AXIA 3CQQA 4PEEA 1TIUA 1TTFA 3EH3B 4L5FH 2B1OA 1MJ7H 2EEDA 2O6CA 1DEEA 4OJFL 4Z3TA 1DSWA 5I76B 4KNTA 4R90L 5CD3A 4RGMC 1ZAGA 4YSUA 5FO8B 1EXGA 3QDJE 1WZLA 1FF5A 2OZNA 2R0LL 4PJHB 4DT2A 5CCKL 4A39A 2Y7MA 1AKPA 1NBYA 3GHEL 1FFPA 4OM1H 1U95A 1RSFA 1Z5HA 5C71A 3OVUB 1KTJA 5CS7A 5F1NB 4WI6A 4JUTA 2W95A 3FNKA 3N42B 5IVXA 3DXAE 4CSZA 3O4LA 1N7MH 4YDLC 4JY4A 5F3HB 2DIAA 1YQVH 4ZK8A 3PIQA 2Y2WA 3J8F7 1OAYH 4OV6F 3IJSB 4HDIB 2VDPH 4XNUL 1FV1A 2WN2A 1V10A 2ZOKA 4LSPH 3PIQB 4E0RB 3O41B 5IFHL 4FLSA 4BFEA 4F1ZA 4LQFL 4Y8AA 2F74B 1ACXA 1M7XA 5DGRA 1K3IA 5DYOA 2I60H 3UZEC 3OPZH 3VM5A 4X5PA 2E75C 4X4YA 2BVOA 1I8MA 1RK7A 2CRZA 5BV7L 1IFHL 1KGYE 3HBZA 4NOFA 4EN3C 4U05A 4KRNA 1CXFA 4MD4B 2VM3A 4V33A 1A1OB 1UACH 2I7SA 4A2EA 1PU0A 1J18A 5EO1B 1JWMA 1NFDE 4YPGA 2NTFB 2CXKA 3B2XA 1DFBL 4ZFOA 3TEUA 1CO1A 3QE5A 4GSRA 3NCFB 4QD2E 4B5ZA 3I85A 4NO3B 1OAKH 1CDGA 4A2DA 4G83A 1F0LA 4QGTA 1T21B 4BWTA 3II2A 1OP5K 1I8LC 2G5UA 5D1QE 1DVQA 3U1SH 4LXSA 3QDGD 4G8IB 4A7GF 1B0GB 1SUJA 3D51A 4U2YA 3DSFH 5ALCL 1HSAB 3IWUA 4JFQB 4QRSA 1UCTA 1OAJA 1D5ZB 1WFTA 5TE7H 2BOBB 3PWPD 1N4XL 1XF5A 4Y1AD 5D2LB 5HHPA 2RQ8A 4HX1A 1H6EA 4Y2DC 5C0BB 5GGVY 2A0ZA 3DUSB 1F42A 1MY7A 2OMXB 3BZ4A 1UWYA 4MJ5B 3VDAA 4LP4A 2Q8BL 3QA3A 1IAMA 4YDMA 4OT1H 2GVYA 4MZIA 1WK0A 4HZLA 4U1NA 4DKEL 1S7QA 1CFNA 3V5KA 4YHOL 1UD6A 4PLNC 7CGTA 3V4UH 2I9LB 1CFSB 5L8LB 1CMOA 4FULA 2P80D 2P45B 2DBJA 3BD5A 2BSCA 3MJ9A 3PPSA 3Q5TA 1RSYA 3ASOB 2X2JA 3LRMA 4MD0B 5AAWC 2NUPB 4JKPL 4NLHA 2BS9A 1J1PH 4PJIE 1TYRA 1KYOJ 4I0PC 4NKMB 5AKSA 4LF3A 5EUOB 4M56A 3QNYB 3N1MC 3CFNA 1TKWA 2BCKA 5DK2B 4QTHA 1NL0H 1JZFA 4GP4B 4PJCE 4HS6B 4MCYB 5FYKH 4TNVK 2X7LB 1ADQH 1DL7H 1PEWA 3GYRA 1BXUA 4KU1A 3OJAA 2O61B 2WUCL 3HCVA 4HWZB 4RZCA 4J3XA 3AM8A 3DDGA 5ES4B 1OP5H 2J8OA 5TF0A 4QYOA 3IETB 5JPMC 2BVUA 1RVFH 2EXTA 4BA8A 5DZAA 5I1IL 4ALAC 3S7GA 3F85A 4NDMB 5LO7A 4KX9A 1F02I 3FHQA 4LXRA 4K2UH 3TBVB 2OP4L 2PPDA 3SOTA 1QVOA 1P7QA 5I18H 1N6QH 2E8YA 3W5MA 3NFPB 4TUJB 1FGVH 5A2BA 4BELD 5TF1L 2VLKE 3UZVB 1G7IA 2ZYIA 1ZTXH 4WJKB 5HYFA 5MP6L 4ZS6C 3FB8A 4ETYA 1JZ3A 3DX6B 2ZCKL 5D2NB 4H26B 2NNFA 2IWEA 2AK1H 3I6LE 2XRAL 3T3PF 2BP8A 5GJSH 3OGCB 4TZHA 3NIFB 5KYUA 2N56A 4KV5E 4ZZKA 1FFTB 2WBJC 2RH0A 4DZBA 1KTBA 1MDAA 1V54B 2BNQB 2E46A 4M5ZH 1XGQB 3VXOA 4E36A 5DEGB 4W9DC 1JXJA 2LTQC 4ZX4A 1Y07A 3LIZA 5EMYA 1A14L 4GG8B 4RX4D 3U9UB 4ZMYA 4U4IA 1I1YA 4A2LA 1NCWH 2NSMA 2YPVH 2C9AA 2EYSA 1KB9K 4XAWL 4HUXB 3TEYA 3HS9A 2H8PB 4WQOA 5IJBA 3SDXA 5I74C 3L4VA 4ZAKA 3CDGB 1OQXA 3O8XD 5LDUA 2CU9A 3MV8A 4U1KB 3RNQB 3ULUC 3JWDH 3TO4A 1BOGA 1CE1H 2XJKA 3OXSB 5KSBB 2AJVH 2JJTA 2X4OA 3D4GA 5J89A 2DQJH 2R4SL 4KXBA 1FO0A 3VU1A 1AJ7L 4H1LA 4YUEL 1XZ0A 1URZA 1MW3A 4AL8L 5JXAH 1B0RA 4EI5B 2XUWA 1UKQA 1OE3A 5CEZL 3Q7JA 2W9LA 2EKSA 3A47A 3FF8A 4JDZA 4P5TB 4GLRI 4URKA 3E6JA 1N6QL 4F37F 5IQ7L 4WYKA 3NIDB 3O3DA 3QRGL 3RGHA 3PWPB 3N50A 1SY6L 4YSPA 4Y2DB 4RGNE 5BQDA 3RL1B 2F7IA 4JFEE 8FABB 1FJ1A 1S46A 4KDWA 4PLJD 5J7CC 3TURA 1VZIA 1D0BA 3SGJA 1MJUL 3P72A 2F5AH 1BIHA 5J5EA 3WHE0 2A6IB 3MJWA 1OAUH 4PV8B 3MKKA 5DJ2A 1AE6H 1NGZA 1XH3A 3QUYD 3UTSE 3FH7A 1AGBA 2JE0A 3HG5A 3V9CA 3BDBA 4AYFA 2ICEB 1I3GH 2QGDA 5H35B 3QISA 1VACB 4Z9KB 3MBED 1JPSL 3FUKA 3D0AA 1A4CA 3O6FC 1YY8B 2A6KA 2QKIA 3TJPA 3UTPD 4NAMA 2ORBH 2ELLA 1X4ZA 1HHHB 1S5IL 5DSCA 4PRPB 3W3KA 4IMLA 4MJ2A 3PWUB 1LTXA 1G1YA 3KYOB 2P8PB 3ZO9A 5BUGA 1WA1X 3OKLB 1G7QA 3PWUA 1G7JB 5D7HA 3E4GA 1OB1A 4Z8FH 2CKBL 4FQCL 4PLKD 3FT1A 2J6EH 3K2UL 4FFWC 4WCYL 5JIPA 3B3BA 3QCUH 5BUAA 2BIIA 1L3NA 2A77H 4G6KL 3W38A 4UM9B 3PWNA 3RJQB 3UMNA 3EJSA 2P42B 4GP8B 2X6VA 2H4EA 4C83B 3X17A 1FG9C 1GOHA 1FGNH 5SWZA 3VSVA 3RWIB 4R8WH 3BT0A 5DRXB 1NGWB 4O02B 4YSCA 5C08D 2YS4A 4R7XA 1IQDA 4K07A 4D0DB 1QFUH 5C86A 1OGQA 2X1QA 1OM9A 3MRLA 3NA9L 3V8CA 2AKRB 1OM3H 1AMXA 4YHIA 1K2DA 3NDYE 4PJDF 5HYQA 3BPLC 3UP6A 3RE0A 2EKSB 2VQ4A 3HOGA 1KTDB 5TE7L 4LKXA 1ZSDA 1PW3A 2A4EA 3KYMA 3RVXD 3QZNA 4ELME 5H2BB 2AFNA 5AW1B 2PPFA 3WY2A 4G8EB 1P7KB 3P4OB 5IJKC 2L7EA 4H2CA 3BP4A 3GO1H 4KI5D 2WK2A 1GC1L 4W4OC 3OLDA 1T20B 1YEHH 4E9LA 5D8JL 4LVHB 5CR8A 1E6JH 4X80H 2UZYB 3MA7A 1KGIA 4N0UE 3A6CH 4OQTL 1IM9B 1EVTC 4GMTH 1G84A 2QQQA 3QJVB 5AD0A 2Y6SC 2GEEA 4KKLD 4TRPL 3ARFB 1HHGA 3QEGH 1HEZB 1UB6B 1E27B 1D6EA 2Z31D 2H2PD 2XVBA 4Q0XH 3GSUB 1FH5L 3EJYD 5I75B 2VDKB 3K3QA 4GQPH 5EA0L 5CEXA 2Z64A 2R51A 3E1F1 5KN5B 4X7TA 1NEZA 1NKOA 5IB2B 2HT3C 4UT9L 3TC9A 3QIUD 3O11A 3FQ2A 4N1CA 2W60A 1RULL 2E7BA 3CZGA 3BZDA 3GUTA 3ULVH 4TVPH 2RFXB 1XV8A 4Y2LA 2EUWA 2HXAA 1WUNT 4ODXB 3FUMA 3VFUA 3NJKA 2ARJB 4ZW5A 2J72A 3QCUL 4IK6A 4MNHB 3EZJB 4M4RA 2Z93B 5FW6A 4A6YB 3IDJA 3GSNA 4NPYB 3R8QA 1GS6X 3B8SA 1RIHL 3BP5B 4DH2A 5I17A 2BDNL 1I9JH 1CYXA 1FNSL 2ROYA 3ESPA 3DYPA 3OD3A 4PJFA 4QRPA 5FGCE 3B83A 1XF3A 4BWUA 4DHLA 3PV6B 1JPTL 2AXJA 2ENJA 4L0PB 4M93B 4KRPB 3CDZA 4ALAH 1L7TL 3QJXA 2JCCF 5I1CL 1MFAH 3D69B 4H0HB 5EC1A 1QLEB 3TA4D 4AVJA 5GZND 4AW4A 1KPVB 1CJYA 1YNTB 3MRPB 2DM7A 1KOHA 5DFWH 3QBTB 2WHVA 4NZUL 3HZVA 4H4NA 3KL3A 5INDB 1R3LB 5K59F 2W0KA 1RZ8A 4H0GA 2Q9OA 5EUOE 1C5DA 2IGFH 5ANME 5I1DB 3GZKA 3QQ4B 4AQEB 5KJ7E 1D5RA 3QIWA 1M6OA 4LRNH 5HPMA 3EHBC 4BH7B 1FO0L 3U83A 5CJOL 3DV4B 3FRPG 4E41D 3PWVB 5IV2A 2FSDA 1IKNA 4EZJA 3L3IA 4G9FE 4OUUB 4WKXA 3QXWA 4K3DL 4YK4C 4XP1L 1AC6A 3ESNA 1A47A 5HI4C 2VDRB 3GB7A 5C08B 3QARA 1K5GC 1UH3A 1NANI 1AMYA 1U0ND 3RX8A 1DBMH 3K6DA 3AY4C 3UN9A 4JG5A 1HOCB 1RLWA 3DLQR 4GRLD 5IP4A 3WLWC 1BVZA 1JYNA 5A2JH 5IQNA 3ETTA 2XZQL 3HLAA 3LNGA 2MWCA 1EUTA 2EIJB 3QXAB 4UOQA 3PWLB 4LSSL 4Y4KB 7FABH 5CGMA 4XOCA 3FCSA 5B21A 4F8NA 1W91A 4DN3L 3WUWG 5ICXA 3PP4H 5AVZB 5C0FA 3C5ZA 3ECVA 1A6AB 2X0UA 1Z9LA 1ZHBB 4OLZL 1JWMB 3CC1A 3UERA 1R47A 2NY3C 1J8SA 4ORZC 2YSSA 3GDBA 3X3FL 1PL3A 4BZ2L 4NNPH 4K7PX 1KDIA 1ZLSL 2AP2A 4I9XA 3T4YA 4C4KO 5EC1B 4FQ1L 4JQVC 3RDTD 4P5KB 4HD9A 4UUJB 3FO2B 4ODSL 4HQ1A 1EJFA 3GMOA 3ARFD 3HI1A 1BVLB 1GYCA 3MNWB 4L2LA 5AW7B 4PJFB 1PZUB 4KVNH 4ZFQA 2OAAA 4UIKH 2C3VB 1R17A 2GITB 2OMUA 3MLXH 3QQNA 4APQD 3CN3A 2C3GA 2Q8AL 3PXJA 5TH2B 2NT1A 3OJVC 1AQ8A 1C08A 3HG3A 3TIDA 4AMKH 3FTSA 3D18A 1F4YH 2ZXBA 4AI7A 1RZPA 3O6ML 5CINH 3SO5A 2BCMA 1P9MC 2ZG2A 3R1GH 1YHPA 4GUPA 4JVPA 1MVYA 2JV6A 2AJYH 3T2NH 1V55B 1U36A 2YD3A 2AITA 1Y6MR 4F9PC 4I87A 1MQKH 1T0MA 3EXLA 4PTTB 3I9GH 1AQHA 3BXNB 1B4LA 3QDJD 4JMNA 4OQTA 5EZIL 5AAPA 3JV6A 2Q3ZA 4LSSH 4NC2B 5KN5A 3M7FB 3CVIL 4LSUH 1DVZA 4R7VA 1KTLB 1UWXK 3FUFA 3VMOA 4BQ8A 3P4NB 5F6HJ 2WLIB 3HBGA 2R83A 1S9XB 2QSQA 3L7EB 4JPKH 1MFUA 2CK0L 4P57A 4MKMA 3GS7A 3PHQB 4Q97A 5F7AA 3OTTA 4FRWA 3L7EA 3NFSL 5H37H 1EDHA 4ZXBC 2D03L 2WLIA 2ATPA 5TDOA 2J8UF 4DK3A 2IBZY 1E9OB 1KPRB 1S7VB 5I0VA 3D1MC 4WFED 2XLLA 4JHWL 4OGAC 3MRRB 4RVBA 3TBSA 3LKSA 4LLQB 4HUWB 2YD1A 3D3VE 4NJAH 3QUXB 4PG9A 4X50A 2V2WA 5GGUB 3OKNA 1NKRA 4HMEA 4N8CH 4QKTA 4FC3E 4LCYB 2WAHA 1AQDA 1OAUL 2GC7C 3RZCD 5CCHE 3R18A 3SDAD 2ICWI 3ESUF 4XAKD 4JR9L 1J5DA 2ESVB 2RJMA 3LNIA 5ALCH 5F88A 5ITFA 4JGNA 2QGEA 3AAZB 3HZYA 1E3ZA 2Q6WA 4G7YL 5TH2A 5IBTL 4F80A 1J5HA 3SYQA 4F7CA 3IMRA 6FABL 1IC4L 2ICEC 5AVVB 2NUTA 3TBYA 3T5WA 1QG3A 4CU6A 3JZ7A 2R23A 3HKZA 4ETQB 1H15B 1YYLL 3CFCH 3DIDA 4WI2A 3D2UA 3BESR 5L0QB 3UO1H 5I1LA 3FUNA 2Q0ZX 1JRHL 3LSOB 4JPVL 1M1XB 5C6TH 3I6GA 4DW2H 5I6XB 3MROA 1XIWC 4Y4KC 3STZA 3VQ1A 3MGAA 4RGNB 4ZS7L 3EJPA 1MFMA 3ASWA 4LPUA 3RFZC 3KCPB 3VQLA 4WHCA 3WIHL 2H3NB 4MJID 4MA7L 3ZKXB 4DNLA 4F2MA 2WBJD 5F9DC 4E41A 1JGDA 4N28A 1JZHA 2GAZB 1SOXA 3D05A 5IFAH 3BT2H 4PY8J 2FJGA 3KZ8A 1SHWA 4R0LA 1D2OA 1CBJA 4G11A 3GXIA 4NS0A 4XVUC 2N4IA 1OGPA 4YEBB 1IV8A 2GTWB 3BKML 3WY1A 5DD6A 3BKCL 1RUKH 2QKIB 3MV7E 3K72B 2CBTA 5ICUA 1CDHA 1U8IB 1V7ML 5GRWA 5L2KB 1WD9A 1FC1A 4YHPA 5B38B 4I0PD 3ZO0A 4M7EC 2ZG1A 4BA0A 3CZUB 1PZBA 3FULA 1MWAB 1GYUA 3TA3A 3V0WL 1U8QA 2OJ1A 2VW7A 4HU8A 5FYLD 5HVWA 1J9TA 5I71C 4EI5C 5JHDB 1YYLH 4GRLA 4QCIB 2E59A 5C0DB 5EF1A 3NIGB 5FHAL 1XB6A 3ZDWA 4TQHA 4Z64C 3UZEA 5CKGA 2WXNA 4LEXL 4R97C 4N25A 1DVUA 5KYWA 3CD4A 4MNQB 1D5BA 3LN4A 1BD2A 3OR7A 4ZUSB 5DFAA 5E95B 4DFHA 4CVZB 1NCCL 5C70A 2J88H 3CDZB 1GCFA 1JCKA 1E4XI 2DWDA 3QIWD 1HT6A 4PB9H 4XB7A 3VGDA 5T3XL 2OP4H 3TN0D 2DLFH 2HWZH 1NLDH 2GJ6B 3OR6B 1RI8A 1DJXA 1S3RA 3LZNA 4G6ML 2Q2LA 1OSZB 4MHHI 4LVNB 1JL8A 3CDGA 4HSAC 1EAOA 4N0CC 3IEAA 5D4JA 2ATPB 5TDOB 3L7FA 1FSKB 1YEKL 1NDGA 4K9EC 4NN6C 4TF4A 3MRBA 3WNJA 1JXFA 4EAEA 3RZCC 1NAMA 1OGAE 2XOTA 4JKWA 3EUDA 1U4FA 5DHVB 1HQRB 4F7MB 1G43A 1RP8A 3SDAB 3VE0B 1M9LA 2F19L 1CQKA 3C6EA 3D9AH 5I9QB 4PGBA 3RZCA 3B9AA 4J3OD 4CMHB 1PZ5A 2HJLA 2UZXA 3KXFE 1AI1L 5AVQB 5JPMB 1BF5A 2HT2D 4EVNB 1XQ4A 1KBWA 4XNBA 4U6HA 1CLCA 1T0MB 3L48A 3QJHB 3DTXA 4K5NA 2BSTA 2AMUA 5L4FA 1O6TA 35C8H 3BPCB 3QNFA 5C3TA 5EOQH 4JM2A 4PG2C 5ECJE 1DS9A 4FABL 3JBG7 1NFDB 3QDGE 4FXTA 3V4PB 3QWQB 1ZD6A 1JPGA 2F61A 3KYNB 1N64H 5C08E 4EOWH 4RGND 3UAEA 3FFDA 2FSEA 3DGDA 4HV8B 5IESH 1AAJA 2NY7L 4LAQH 4DVRH 3CHPA 3IJHA 2ENQA 4NUGH 3S34L 2NY3B 3HCVB 4HWZA 2PP8A 4PI2A 1VFAB 5BVPL 1JF1B 3ARBB 1AZRA 1RZIA 2DRUA 5DJ0A 2G2PA 1UM5L 4U3SA 3KJ6L 1XCQA 1YMME 3AB0B 1MCOL 1O7SA 1T7XA 3OB0H 3ORJA 5CSZA 4FQXA 4PGJA 3M46A 4UZUA 4ZTPL 5CCGE 1IAKB 4GXUN 2WFHA 2XJLA 4ZBJA 2MPAH 3O8XB 4RQQB 5TQ2H 3CN2A 2QADB 2ZIDA 3B2UC 3VW3L 3ARVA 1U8KA 4QHKJ 4IKKA 2XZAH 4AQAB 4WWOA 2ZUYA 1MFDH 1UZGA 1A6WL 1EHLL 1OW0A 2LFEA 4NX0A 1WHPA 5AW3B 3FO0L 3F6IA 5JW4R 3QQ3A 1W80A 4EI5D 2AQQA 2N7AA 4QRRD 3T2LA 4H8WC 5LG6A 2WBJA 4L0YA 2BSBA 4KTGA 4NAJA 1P4LB 5DJDB 2HFEB 2HN7B 3QZPA 1OCOB 5FECA 3UP1A 2O6RA 5GGRA 4C56A 1LE9B 4PEQB 2GCYB 1LK3H 2XT1B 4XH2A 4AKPA 3WS3B 1UEYA 5C6WH 3TIEB 4YZFF 1R24B 3L5XL 4K3JL 2DQHL 3ULUD 3OB0K 3H4HA 5EBWA 5ELIA 4GRMA 4ELMA 2XTLA 5CU5A 4W9GC 1I7UA 3MLRH 4GSDL 3QIWB 2GAZA 4WRLA 1A2YA 5LDSA 5ILTL 2IDUA 2GJ6D 4M7LT 4AYSA 1UOWA 3QI9D 2J6EA 4XGZB 3MBEB 2EE2A 3TBWB 4EKJA 4IBVA 4KJYB 1JDDA 4QNPF 2MJWA 5E4OA 3O8XA 3KW7A 4M1DL 3WHXB 5A6IA 4PRPD 2NLJA 1NLDL 1ZRUA 4GW1A 1VHPA 2A9BA 3DX7B 4IRZL 4O9HH 4K9JA 4PRHE 2NW3A 3S2CA 3IFPB 5B1KA 2HJKA 5IJCA 1MJJB 1ETJA 4RBPH 1I8LA 3RL1A 1VFAA 3OKEA 4FQIH 4ODHH 2KHAA 4XO5A 4L4TE 2R23B 2YAPA 4DCQA 3WPHA 3IBEA 2AW2A 1E5CA 3H0TB 2NUTB 3EJRA 2YGPA 3DSNA 2CDGA 3OQRA 3OAWA 4FOMA 5C09A 3V0GA 3UC0H 3U9PH 3VXUA 4LHUB 5E08L 4KQ4L 5KYYA 3EHBD 1OTNA 2X6UA 1F6LL 4C54A 1JPGB 1MCIA 3CVBA 4EIZC 3DMMA 4MX7B 4KFMA 5IQOA 4AITA 5CBAA 1X4XA 3FFCA 1VEMA 1Z9SB 1SVBA 1W9XA 5FYJU 4Z78B 4GSDH 1CFVH 3QEHB 1KB5H 4PJ8D 4ZOEA 1EAQA 4RWHA 4FYTA 1NWOA 5E6SB 1A4KB 5IFJA 3BRFA 2AI0L 2H8PA 3G5XA 1H3GA 4H8QA 4OLVH 4I9WE 4K8RD 4DGVL 4H8PA 3LQAC 4F3FB 1ESOA 2L8AA 2FAUA 3N44B 3H9ZA 4AGLA 4APQA 1JNLH 5G4OA 2R39A 1IM9A 2XC8A 1OTTD 4KFZC 4PJIF 3D0VB 1JF6A 2ED9A 5B39A 2XIBA 1OGAA 5C0EB 2Y4SA 1A4KA 1HEHC 1XGTA 3UACA 5AWBA 3SGKA 4NSKA 2CGRH 3KPPA 3L5IA 4PTTA 1JGLL 3NDZE 2Q7AA 3CXDH 3RDTC 3A6BL 3L3OA 3VXSE 3CC5A 5IHUH 3OLGA 4WTZG 2YPLD 4NKIH 3TJHD 3UZVA 3UIYA 3MRNB 4OCWH 5AB2A 2HMID 3HC0B 5IROA 1A1NB 5IYXC 1I9RL 2WGXA 4GAJL 1PFOA 3B7RL 4NWTL 1W8OA 4QRRB 2DLEA 4NKGA 4JY5H 4OBRA 2ZAGA 2EDXA 1AIZA 1HE8A 1Q4NX 2VDLL 1OEZW 5HHVH 4AM0Q 2GTQA 1F2QA 1ZV5A 4JRFA 3PU7A 2CDGB 4P9HC 5CR1A 4FXGA 1A4BA 1HVXA 1RFDH 4ONHB 4RZKA 5I0XA 3MCLL 1OTMA 1T5WA 1BLIA 1UZ8B 2DWEB 4X8JA 5FWRA 1DSFH 5EC2B 4PVNA 2AXHA 4G2AA 4MCNA 2WTPA 3RWIA 4CADA 4ACPA 1LP9B 4DP8X 3H42H 4FF9A 1OAYL 4JFDD 3DX7A 3NCYS 2AERT 3PG2A 1OM3L 3BVNA 2WBKA 4UQ2A 5A16A 3I6KA 3UG3A 4GS7B 2Z7UA 3DXAA 4HUVA 2GPZA 2D3LA 4QMEA 1ZLVH 4YHPB 3CSGA 1TJHH 3MRIA 4KC3B 1MHEB 1V05A 1ZHBA 2GK2A 4Z7VE 2WY3B 4YXLH 4AL8C 3B2PA 1UH4A 1WPCA 4XP5H 1OB1B 3INUL 4W4NA 4JPKL 2PP9A 1KCSL 1ZVYA 4DO4A 1S78D 4J3TA 1NOLA 2R1WA 3EO1A 4GW4B 1JGDB 1W0WA 3BSHA 4RSVA 2HFFA 2ADGB 2VISB 4XN5A 3SE6A 2FHFA 1E40A 2WNWA 2OK0L 1JK8B 3FMGH 1PS3A 1IT9L 5GGRB 2IQAA 2ZWYA 3B7SA 4BM7A 2DAVA 3T2NL 2OMVB 4UNTA 4DJMA 4MDRA 2XN0A 4JE4B 5KSBE 1YNKL 2P52A 4RRPG 4FKKA 1R3KB 4I2XB 1NLBL 3L4WA 2R0WH 2OXGA 3V0IA 4MNGB 2PCFA 2NTSP 5I1CH 1HI6A 1YJDC 5J11B 5DUBA 1ZK9A 3D30A 4TQ8A 5FCUL 1QZNA 3FB7B 3VFNA 3DX3A 3ZYZA 2BSDA 4P2OC 1BW8A 1K3ZA 4A04A 3WMSA 5LCVH 2V2XA 3UJTL 4P2QA 5EO1A 4XNXH 1U8JB 3V6FA 3NIGE 1TQVA 1J5IA 3IE9A 3IGAB 1Q8MA 2GJJA 4Y4KD 5HYEA 1V7MH 4FA7B 4OLYL 4WGKA 1Q9LB 5CZVH 1DJGA 3PV6A 4GI9A 1ZGLB 1PGRB 4ISVA 5E5UB 3WN5B 5ACLA 3MRHA 3O41A 3ROLA 3QUXA 4I6JB 5CEZE 3HG1E 2BNQE 5ESAA 5EZOH 1JL5A 1W72L 4Z95L 5T33L 1Y0LA 1TOXA 5GRYA 1YEGH 4LSTH 4F8TA 2R9HC 3DUUA 3QNXB 4KTEH 1JNJA 5K9JL 4JY4B 1GTFA 1TJMA 4AG4L 2V33A 2EYSB 2Z93A 3WLBA 4PJCF 2IADA 3GT6A 3MXVL 3W0WE 2W1NA 2HMIC 3CVCA 5ANMA 1XGQA 4M7LH 3C8KB 1E4WH 2RFXA 4YR6A 3BW9B 3TZVB 3X13A 3H9SE 1BQSA 4TRPH 1MCKA 1YO4A 1RZFH 2JQZA 3H1ZA 4OJYA 4O2CB 4ZMLA 4KI1A 3UBXI 3BO8B 2VIRB 3IRZA 1CK0L 3ZVVA 3TNMA 3IVKA 5MP6H 5FPIA 3JUZA 3BCFA 1WZ1H 5E1IA 3VE0A 4BBWA 5IB5A 4MJHA 3NJVA 4UDTB 3WKPA 4IRSA 2SODB 3LQAL 3S88L 5EZLB 4LLDB 4D9LL 1I1AD 4N6QA 4Y8DC 1HHKA 1LO2L 4HOZA 2Z8WC 3NOIA 4LL1A 4OCSH 4M7JL 4IRSC 5CILL 1EJ8A 2WWMC 4HKXA 1FIGL 3GZPA 4G8FA 1MHPH 3LCYA 4W9ZA 1ZJBA 1A6TA 1A7OH 2VXTL 3IJEB 3QXDB 3VI4E 5C2UB 4Z7NF 2DTML 3CIYA 2CK2A 5CFAA 2VW6A 5H4ZA 5IKCA 1Q9LA 2FNWA 1F90H 4P9MH 1GXEA 5I1HL 4Z6AT 1NDMB 1S7UB 1JZ5A 1R3JA 4H8VA 3H4FA 4LSCA 3T3ME 1U6AH 3LNFA 1ZHKA 2F58L 1C5BH 1LO5B 4XP5L 5LN4A 4N9GA 3W3JA 3KVQA 4G8AC 2Z35B 5KYWB 2AXFA 1BBJB 4HSQA 3HNVH 4HA1A 4E9RA 1NDMA 1S7UA 3FU6A 3PP3H 4F9PA 2E8ZA 4XPHL 3BUBA 1ECZA 1O5PA 3WN6A 1KB9J 4DKEH 5LFNA 3VFPA 1QI5A 4GKLA 2IC2A 2ESVD 1G6RB 1NBCA 2P9RA 3FL7A 3RX7A 4JO5A 5I8OL 1YPZF 3N0PB 5KWYC 1F11B 1ITCA 3H9SB 4JB9H 4RISL 2W81C 5HHPB 2CCVA 1VEOA 2MNJB 5DRZB 5F1SA 4ZX5A 3CX2A 4ZPVA 4LSRL 2ZSWB 1IC7H 3F7RA 4MLIA 4PJDE 1ZHLB 3MJ9H 4UU9A 3VSTA 4UDTA 5CLZA 3DV4A 3ARUA 3W39A 2FJGB 3ZT6A 2GYSA 2E9WA 3B3IA 3DPDA 4Z0BH 5K59E 4UT6A 1GGUA 1OCZB 1K4CA 4MJIB 4GG6B 3SCMB 4PWFA 1EERB 1VACA 2FLRT 3VFRB 4P9ML 4I9WD 3S35H 4JQIH 1VCBC 1I8IA 2MFNA 5FKPA 4YR6B 1ADQA 2EIZB 3CN0A 3ME0B 3V4LA 2X0VA 2UWEF 4FG6D 5CWSB 5IQLA 4KKBC 5J1AA 5JIDA 1KWGA 1DBKH 3SYOA 2JLLA 5F9WB 2C1PA 1G1KA 5EWIH 2CA3A 2EQDA 4XMZA 1Y1UA 5A7BA 3OKOB 3QUZC 5AOMA 5A6MA 3CVDA 2XA8L 3B4NA 5CXPA 5D1ZI 1UACL 2FX8H 1FNEA 4MCZB 1N59B 3D6GA 4MMXC 4PRDA 4R7NA 4H8UA 4NPYA 3APDA 2ZYRA 3PE9A 5IOKA 5HHXH 2VLLA 4TNFA 1AQKL 3FBQA 4LDEB 4P2QE 5JHDD 4OZIE 2NXZD 5IUCA 4P2RE 4W9LC 2UY6B 4M4PA 2LTQB 4KHTH 1YEIL 5GJTL 5CO1A 4FFVD 4ZMWA 5IEHA 2V2WB 5KYXA 1I1AB 1NKGA 3V4VH 3WTXA 4ZDHA 5IEKA 3WL9B 5FTTB 2XZQH 3U7YH 3R19A 2TAAA 1DN0A 1XD0A 5DJ6B 1CQYA 4ZUVB 1CL7L 3LIZH 4IDLA 1QLRA 1OGSA 5GJSL 4NHUB 3S5ZA 3GSUA 1JHTA 2Y6SD 1KN2H 4WI0A 2BJML 5CGTA 5J6HA 1WAEA 4Z7QB 3SJVB 2TSBA 2ARWA 3O4LD 3IMTA 3N6YA 4GIOA 3QWRA 5HZLB 4AEHH 4YSTA 3DI2B 1MCHA 1XDTT 4XCYA 5JW5B 2Z81A 1RUML 3GSXA 1NEZG 3ZQXA 3KM1A 4UF7C 3KM2A 4J28A 5DLMH 1F3DJ 1JPTH 1T6BX 1H8SA 3DNKA 4G42B 4QXGH 2ZSVB 5E8EA 4B9PA 1YMMD 2Z34A 2DQEH 3VD0A 1AE6L 3MOBL 3S3DB 4XOBA 4PJ5D 3W9DB 5CBAB 4DGIH 4U49A 3K6SA 2H32H 5E2WH 4L29A 5B22A 2CO2A 4NO2B 2I25N 4QWWC 3OXRB 4B6ZA 1ZLDA 5I6LA 3OGMB 4QF1A 1CD1B 3IBOA 1IC0A 1LL1A 1TTUA 1HQ4A 3KBFA 3KVPA 4G59C 4IBZA 3OLEA 2NZ1A 1E7VA 3MFFA 5C92A 4QRRE 3VH8B 3SPCA 3QHFH 5TPWL 4RDQF 3MNWA 3EYUL 4QHNA 1UD4A 2OX5A 3SGKC 4HS3A 3UTSA 5C0CB 3RIAK 4OD3H 2EVGA 3EF4A 3FMGL 4HCGA 3BAEL 2IDFA 2VR4A 3QRLA 3WEAA 5ESQB 5BQ7A 5CKAA 2JB5H 5EPMA 2IDTA 5MENE 4LCVA 2FH6A 3RBGA 4OCYL 2K1MA 3QPXH 5DMGD 3P2BA 3ARBD 4O5LL 3WNKA 5ICXB 4XXCC 4BWWA 2UXTA 3A6CL 1H6UA 3C5XA 4Z18A 4MMYB 3SYPA 4LDOB 5JW3L 4JK0D 4NCC2 3W9DA 4DN4L 3GFUA 5HGHB 4M5ZL 4Q74A 1YY9C 3VGHA 3ELQA 2QDVA 3FSOA 4ONGH 4R3SA 5J57B 5EO0B 3SEPA 3OKKA 3ARED 1T66D 1UWFA 3KYKL 1PLAA 4OIIL 4RESB 2M83A 1Q94B 2P8LB 5D96B 4ENZA 5K69A 1SY6A 2WLLA 3WPGA 1CLVA 3AU1B 2DI7A 3BFWA 2F2HA 4AT6B 5D2LA 5I19L 1M7DB 2YUXA 3WTUA 1TVHA 1NFIA 4K9EL 2AV1B 5C8JA 4HS8H 1X3DA 1YUKB 1FUNA 3LPOA 4IOFC 4PRBB 5I6PA 4AQZA 3DX0A 1Z7XW 4AX3A 4YDIH 2TRYA 2RGSA 4QHMA 3ZR6A 4H0IA 4WW2F 5IHUL 4L9LC 3QJRB 5I19H 3SKOA 3LHPL 3ZTJG 1EAPB 4PBWD 2V37A 2J25A 3PWVA 1YEHL 1I1FB 3WEOA 5IV2B 4HT1H 5IBLD 1BWWA 5FYJD 3GO1L 1E9QA 4KKCD 1FFNA 4NIYE 4PD4K 1XIWA 4PRNB 4EUPB 1O7VA 3L81A 3LKOB 2PYFB 1DN0B 4R8WL 3E6FA 2A73A 4XMVA 1MPAH 2WVVA 3O2VH 5DQJB 3VQMA 1LE5A 4YPJA 4Z77B 1GZPA 1DL7L 3PFUA 4PGEA 4ODWA 1YPZE 2C4FU 1M05A 3BUIA 1FNAA 1IGFL 1FZOA 1B0IA 3Q2VA 1S8DA 3L3HB 3BH9B 4Z3HA 2QMJA 3IKCB 1WT5A 5CSBA 4ORGB 4GI6A 1PYWA 4Q6KA 1RZKC 5EN2A 4NPKA 4DESA 4RAHA 1MSPA 4DN4H 1PQZA 4FQQB 5DS8A 1FGNL 5AVWB 2Y06H 5J1SC 1CDBA 1NMBH 3IMBA 3MLZH 5EN2B 2QR0B 3M45A 4PJAF 3SDXB 4DQOL 1CGTA 1CVSC 1G0YR 4NNXB 4YHML 5AAMC 4NGHH 3SQBA 1J8HD 1HESA 1OAXL 4AK1A 5FUCE 2HKHL 2WWKO 3M1BB 1M05B 4GO8A 4XPFL 3IDGA 5JLZB 3UCQA 1QPXA 4JM2B 2R4RH 1UT2A 3B7TA 3DV6B 5CJOH 1G9EA 5JUEH 1UM4H 3AQXA 1MCBA 2B4CH 4WHYH 5BS0D 3PWJA 4OZIA 4QOKE 4F7TB 4J5VA 3ULVA 3U4AA 1ZOXA 1II4E 1KJ3H 4TQEL 4DGIL 2BP8B 3IAPA 1Z3GL 5JPNC 4C47A 2UZPA 1QYYA 3KPOB 3KAAA 4ES9A 3UG5A 5ICZA 5SWSB 1R33A 3CLWA 5F7HA 5A2CA 1MI5A 3C2AH 2G2RB 3PP3K 4QTFA 2J5LB 4X6DB 1ZVHA 2WCSA 2E9IA 4C4KT 2BRQA 5EORH 1P7QB 4HH9B 4P3DB 4CVUA 2CCWA 4RAUB 3VVVA 1QSEA 2NZ9D 1F4AA 3ARZA 1XH0A 1B2WH 4DP6X 3KGUA 3AJ7A 3IETA 1RJZA 4JY6B 4KXZI 1K8IA 4F7KA 4ZMNA 3HB3B 3NEOA 1JGVL 2XHNA 1U0QA 5HVFB 4OVVA 4R4BB 5TDNA 1ZVSB 4JFDE 5IJDC 3CFEB 5BOPA 5DR5L 2YD4A 1BZEA 2IIJA 1K5NA 2ZX6A 3E2HB 4FQXC 1OP3H 3Q5YA 2CKNA 3TFKC 2IV9A 3VXTB 4DK6A 2XIIA 5DURD 3RL2A 5C0AD 4HSCX 4DP1X 2P5ED 1OLZA 4PJ5A 4O4YH 3QYMA 1IU1A 1MI5E 2BOCB 1KEMH 4WO0A 2HH0H 4NBYB 5DC0A 2DQMA 4ECOA 2GI7A 3GSVA 3F7LA 4J3OH 5AL0A 4ADIA 3W9EB 3DVGB 2VWEE 4HF5L 4KK8C 3ZE2F 1J48A 3ES6B 1NCNA 3BHBB 4M62L 4RWTC 2Z1PA 4MSWB 4D9QD 1ML0A 8PAZA 1RZIB 3LZLA 1X5XA 3QFJB 1F58H 5GS2H 1PCXA 2VN4A 4PKIG 3HFFA 3QXDA 2O5YL 5J3HC 2IEPA 4JFPB 3WPCA 3IJHB 4P8SA 2PWFA 2RIKA 1U91B 4KOBA 2ZWSA 1N8ZA 4YIQA 2VC2H 3QAZB 4EQ3A 3LH2L 4X8XA 1D5MB 4W1TA 2KMWA 4AYID 4JJHA 1QBBA 4D0CB 2AEPL 2H0EA 3MRGA 2F7PA 5D7IF 4AV4A 1AKJB 5IJDA 3G04C 1JPFA 2XWJA 3BPCA 2G2RA 1KJ2L 4PVLA 4TKWA 5CHNA 4EXKA 4QAMB 3ATBA 4NRXB 3ZL4L 4LI2A 4DVRL 4EKXA 3F5WA 3MDJA 4G6AD 2PYEE 4KQ3L 4XVOA 1AY1L 4EZGA 2VH5H 5CJQL 5LNEA 1J12A 3VFMA 3RIFF 5HDOA 1KPUA 1RCYA 4MAUL 1OSPH 4KKAC 1B4JH 3OAYK 4N22A 3HC4L 5K9QG 3BPLB 5BZWB 2VLKD 4YH6A 5FEBA 1NPJA 3FT4B 3FTGB 5HJ3A 1CU4H 4JFTA 2BVOB 5JW3H 4I1PA 4D7BA 1M1XA 2J57A 5E99H 4TNGA 3L2LA 5I6NA 1IEAB 1WWAX 2FBJH 5E51A 1DJIA 3LKPA 1CYWA 3WTYA 3HI6L 4LVOB 5J06A 3NCXA 1XGPB 1CDUA 2JCWA 3CK0H 3HE7D 2BIHA 2R27A 1KV7A 3SKMB 5T1KB 2ZOLA 5AZUA 1S3KH 2DLGA 1UXMA 2UYLA 3WO4B 5E1AA 4PGEB 3W11C 3QUHA 2E86A 3M17A 5T1KA 2QKIC 3DO7A 2WV3A 3CVHB 2JMRA 3OXSA 4CU8A 2Y7SA 3WY3A 3BEWB 3V4UL 3WIAA 4DUXA 3CMOL 4HUWA 2A73B 3ZL1A 4AMKL 4RAVA 5DC9B 2XTJC 1J8HA 1XCTB 4UT7L 5IW6B 2NNAB 2VR5A 2D7PA 4ZAKB 3CGTA 1WVZA 4HISA 1A1MB 4PB9L 2VRQA 1OANA 1J10A 2OTWB 2V7NB 1ZPLA 5A2KH 3CCHB 4CN4A 1BMZA 2CJUH 3MLWH 4O2FA 4ICWA 2X42A 5J1AB 3CZFB 2FLMA 3VXNB 3TF7C 5DVPA 3WTVA 1HIMH 4RMUA 3R1GL 4TSCH 3C75A 1CDYA 3SCMC 1U8IA 2ZKXA 2BSSB 3ZKSD 4CN6A 1PY0A 5AG9A 3GKWH 2WIMA 4QHKI 3AMLA 2CZNA 3WTWA 1J0HA 2QLVB 2CO3A 3II1A 5EU5B 5D7JB 1E7UA 4LLVB 1F97A 5CEZH 1EIBA 1MHPL 3RWEA 4IJ3C 4X2UA 2YARA 4GUPB 3L3KB 3ZZLA 1QYGH 1VPOL 3BAWA 4K3GA 3TZVD 4BINA 3UJJH 5HI4D 4YS4A 2JTDA 4P46A 2F53E 4WEBL 5HP5A 1LQBC 4BRJA 1DQJA 5KBDA 1SVZA 3DHUA 4IS6B 4F2MB 1JV5B 3MRIB 1JZGA 4X9IA 1OT1A 3DXAB 4NENB 1UA3A 3JV4A 4A67A 1GC1C 3EOBB 2ESVE 2C3VA 2GITA 4JFPA 5DZOA 1X5AA 1L9NA 2HJFB 2O61A 3TVMC 4G9FA 4PWKA 2QGBA 3R7RA 2IALB 3I75B 4XNUH 4AWJC 1CLOH 3S35X 4BQCA 1DQVA 3FO2A 1UFGA 4YSDA 4Y4HD 4D94A 2QTEA 4JJ5B 2Y7QB 4F8LA 4ETQA 1SM3H 4MWFB 3T0AA 3DRTA 1ZE3H 3MV9D 2Y3NA 5EF0A 2ATKA 3W57A 3BWAB 1LO5A 4MQXD 3RUGE 1QFWL 2E7DA 4DFIA 4JN1L 2APXA 4Q7DA 1FO1A 1UVQA 3BGMA 2MCAA 1MOEA 2X4RB 4FXKC 3FCSB 5MENB 1QBLH 3LMJH 3QHFL 4XP1H 1F3JA 3K71B 5B1BB 2DQUH 2YN5A 1EMTH 1AS8A 3V5DA 2C9PA 5DVMA 4FNLH 4ZMAT 4NKOA 4LLVA 5ERWB 1N0XL 3LS5H 2V17H 4JDEB 1QBAA 1XEDA 1PIGA 4FS0A 1HOCA 4K3HA 5D6CB 3ZSTA 2A9DA 3SZKC 2NY0D 1RUQH 4JGJA 2VKXA 2P3YA 3ROOA 2VCOA 3P9MA 3X1EA 4AY9X 5I8EB 3F7YB 3V6OA 3HE7B 2B2XH 3UZQA 1X9RA 5T1KD 5D2LF 3D08A 3IN2A 1FORL 4WI7A 5IB4A 1MFBH 3WEXA 2ZYHA 3ZKNC 4QHLA 1BF8A 5LBVA 4LSRH 3V9EA 1GTNA 1M6UA 4LP8A 4NP9A 4O00A 3ETBJ 4XWGH 1FFOB 3WELA 4YC2B 1MFNA 2NNAA 3LDBC 4YHZL 5I26A 1MLBB 2YQBA 4KK9C 3TEZA 1P4IL 2H1XA 2OJZH 4N0FA 5E2UH 2MKLC 1Z5YD 3BW9A 3MLRL 1YNTA 1Y1DA 3MRPA 3DV6A 4FLHA 4WENB 3C5SA 3OZ9H 3PNWA 4XODA 1UURA 4KO6A 3RFEA 1N6VA 3SGJC 3SGEI 1I8MB 1SMAA 3RJDA 3NMEA 3KW8A 4LIQH 3DPBA 3HMWL 3NACH 1BX2A 3KD4A 3BUQA 4FX5A 3Q6FA 2GJPA 2X09A 1N59A 3I9IA 4A38A 3OSKA 1EUUA 2JJWA 4IBTA 1S5HA 1SLUA 3NG5A 5TDPB 3WNNA 1OSYA 1Q0YH 5D7IE 5JW4N 1LO4H 1ET8A 1IEAA 3GMMB 3E0GA 4KO5A 3B9KA 4XNZC 2PCPB 1IKFH 2KUTA 1QI3A 4GP5B 1DDHB 3PREA 4XCEB 4ANXA 3GSQA 1M7UA 1S7RA 1NQBA 3AREC 2UY7A 1WDAA 4LSVH 3BYTA 5HHOA 5ICYB 2NY1D 1XMEB 4XN1A 1ZIWA 2O5ZH 1OCWH 4M93C 4KMLB 4TLUA 1RV6X 1BHGA 4J0MA 2WVVB 5DQJA 5M95B 4PJ7F 3MXWH 1G4RA 3P11L 5DJXB 1YN6A 3O3AB 4POZC 3LVEA 3CSYB 2FDBP 4N0YH 5GRJH 1OCWL 3LS4H 3BKYH 4J4LA 2P46B 5B0TA 4GQ9L 1PG7L 2N7SA 3V7AG 4GRMB 1ZLSH 1ED3A 5BV7H 4L3EA 1DBAL 1QHPA 1HEZA 3ZPDA 4QRTA 5IT2H 4P05A 4I3RL 3MV9A 3QRBA 2ZOOA 4CC4C 5CMAB 4IKIA 1ID2A 1IRAY 43CAB 4AT6A 2E7LC 3QULA 4KVNL 5SV4A 1G9UA 2HFFB 2F8VA 1OCCB 1T1XA 4EDXB 3QRFM 1F58L 3G5ZA 1N7ML 2V9TB 5HHNB 3P3TA 5ERWA 1WEJH 2BW4A 3ARDB 5I30L 3EDJA 5HI3C 1B3JA 3KYKH 2N1TE 5E2VL 4HOWA 5MEND 1X9LA 2XG5B 5K9KA 4X0KB 1OK0A 1MH5A 2XQ0A 5JMOC 5BVJB 1UVQB 4Y4FD 4F2EA 4QLWA 4FAAB 4KJQC 1MHEA 1IO0A 4QJ4B 3FT9A 3NCMA 4NNYA 2PWDA 3V52H 2M1KA 1KGWA 3L3DB 3HJ0A 1KPVA 2V5YA 3E2HC 4FQXB 5LB1A 4D7PA 4PJ5B 4YDZA 4R7DA 4HP5A 1PZ2A 4MZRA 2JKJA 5KZCD 2XX1A 3SPJA 5FM4A 4S1SH 1F56A 3ARBA 3EYVA 5DUPH 4HWEH 3MU3A 5B7FA 2VITA 4A2GA 1HZHL 1J0IA 1Q9OB 3ISWA 2F7OA 4HV8A 4G6FD 5GZOD 4E9SA 3MCKB 2FQFA 2D31A 5I15L 3RIZA 1INDH 4ES8A 4KQ0A 2A9AA 3U4KA 5KVDH 1QRNB 4UQ3B 1IM3B 1GHFL 3A4EA 2CRMA 3V4PA 1GYWA 4GEIA 1IC1A 1U3HD 4TL5A 5I15H 3K6SB 1UJ3C 2DMCA 4NO5A 2D7QA 3DTXB 1FBIH 2F5AL 4LPWA 4G70B 2CJSA 2PTUA 3O11B 4N3TA 2XWRA 4XBEH 4UIMA 5FUOH 3TNMB 3IVKB 1BCIA 2DQTH 3FO9A 3MSPA 4G9FD 2AQSA 5LXVA 4FTVA 1BAGA 4YE0A 2XG4A 2BWIA 4LOFA 4Z7VA 1C1EH 4P4RB 1J9CT 2V5TA 5IVOA 1XH3B 3MBEC 4H88L 4Y5VB 4FI6A 2DL2A 3OX8A 4F37K 4MQWX 3FUHA 3IDGB 4PWGA 4TTGA 5DVNA 3ATFA 3OC8A 1G0DA 5FDYA 1JZ8A 4YX2H 4HUCA 3W2DH 4JG0H 1D5IL 1JHKH 1MI5D 1T3FB 1TPXB 4B27A 3KLHC 2ENPA 2A6JB 1KBPA 1B6DA 2R1YB 5MHSE 1CXIA 4WI8A 2FHBA 3MNZB 3TL5A 4OLXH 3H3PL 4P5TA 2J6WA 1A6WH 3ZDXB 2XA8H 2ID5A 1KLUA 5CLXA 2M2DA 5EEWA 4D9QE 4RA0C 4B5EA 1FO0B 2G60H 1NCIA 4WW2C 4P04A 2LABA 1S7SB 2DJ4A 1J5CA 2A99A 3NPSC 4MXVF 4OFPA 4JANB 4FXLA 5C09B 4N8VG 4L8BA 4F24A 1BZQK 4W81A 2JQAA 4IKJA 4HG4J 4LCIL 4QHUA 5H37A 2XRAH 2E56A 1LMIA 2C1PB 1JN6A 2E7MA 5JHLH 2QVFB 4HAFA 1QWUA 2OYKA 4XNXL 3KGTA 3B9KD 2XBDA 3GPEA 2GSIA 3KPSA 2YD5A 4HOMA 4PRBA 4P2CG 4NO0B 1G7HA 1BQRA 3OMAB 4DZBB 2CO4A 3GSNL 3GRWH 2CO1A 4OTXH 4PW4A 4NZTM 4ZAKC 2Y69B 5IJVA 3QQ9C 5AEAA 1FZJB 1RHHB 3MVSA 2OQJA 4ERSL 1QI4A 4B97A 3QZOA 5CN3A 4ZUTB 4HFUH 1LO4L 1ZK5A 3U4BH 3IFNH 3S4SA 1WGOA 4FQXD 4JHBA 4L9LB 2Y07H 4HGKC 4OAWB 4UU9B 5EU3A 5KW9H 3N85H 4HPHA 5DK0A 4YHYC 1J0YA 1IARB 1QFUL 1TCMA 4NDMA 5ENWA 1KLGA 4ZMOA 4DQAA 1WCBB 2P5EA 5GZOC 1KYFA 2IF7A 3D12B 4I18C 1R0AH 1SF5A 2K9FB 4GT6A 3Q44A 5ESQA 1IBFA 2HRLA 1OTOA 2VRKA 2OMZB 4A37A 2R9UA 3INUH 2KQMA 3E8UH 1IM3D 2YKKA 4BRVA 5DU7A 3UAJA 3LH8A 1NDTA 2G9HB 3A24A 4HS6A 4MCYA 4AYDC 4Z61C 8FABA 4PJEF 1ZLEA 4KXDA 3LB6C 1T5WB 1UZ8A 1MAML 4HJTA 4C56D 1IB5A 3MRFA 4YVUA 25C8L 4EBQH 4LB8A 3UAJC 2IPUG 3MZTA 4ZQKA 1KNOB 2P44B 1VCAA 3QO1A 4OW6A 4AZ8A 3SKUD 5HJDA 5JMRA 1Q72H 1YNTF 3HZ3A 5EU6A 3MUUA 3GI9H 4PB0H 3RY4A 4Z3FA 4Z3IA 3OXRA 4NEHB 1JNHA 2ENSA 2PYED 4UFRA 1VJSA 5DURB 1ZMYA 4OZHA 2NXYC 3BH8B 1J8RA 4NN5B 4R84A 4WK0B 3AWFA 5TGBA 1RFDL 4ELDA 2R69A 4HPOL 3U30B 1EZVY 3HS0A 3QPKA 1ZJAA 5GGUA 2X4TA 2Z4QA 3F83A 2QQKL 2K7PA 1HH6B 3MV8B 4U1KA 3WIIL 3ULUE 1MUJB 1V3JA 2C9SA 1SN5A 2FX9L 5DHEA 3GWJA 1U4EA 5KUMA 4OIAA 4S0TD 3KWVA 3SDCB 4PRAA 2DYRB 3BUYA 5IHHA 1RZKL 3CFDA 1LD9A 4JN1H 1R9FA 4YL4A 3UXFA 4KX7A 1DVYA 1UGKA 2YMTA 3V4PH 1ONQA 2GC4C 1BVOA 2J4WH 2YUVA 4NHUA 3U79A 3RW6A 1AS6A 1WA2X 2B0SL 2ADFL 4PPTA 5BJTA 1L0QA 2J7LA 4BKLA 3E38A 2HJLB 2VMDA 2V8LA 4JL1A 3TBTA 4MXVE 1A8JH 1KBBA 3QG6B 4YPGB 5CAYB 4LDLB 4G8GD 1W8AA 4G1MA 2J20A 4JDVB 3ECBA 2B3IA 4UQEA 3MNMA 1HZLA 4M5YH 3L54A 4FKHA 3GXNA 3TO2A 2NNRA 1Q9KB 1R3HA 1IEBA 3LNDA 3BC9A 4PYHA 1E4WL 1Q90A 5BRZB 3IU4H 3L6FB 1KJMA 3B9KB 4KK5D 3EYSH 4NNXA 3H55A 3D4YA 1MRFL 2Z31B 4N2FA 3KYAA 1JWSB 1BJ8A 4KHXL 2ODHA 3BUPA 4HGMA 1XFPA 4XO3A 3NFNB 1OAZL 2GJ6A 4NQEB 3RP1A 2I32A 2CDFA 3HNTL 4HAGA 4HJUA 5ABDE 2R59A 3IJ8A 2X28A 4UUJA 2R15A 3CH1B 3OV6A 2VDNH 4LRNL 4Z76A 1B2YA 4GW1B 3U9PL 3HG0A 3IGAA 4ABVA 2VTFA 4OLUH 2IWGA 2R29H 1T80A 5FKPB 3Q2LA 4AZUA 2YSSB 3IPFA 1LE5B 2EDKA 4M8QA 1PDKA 1U8LB 3K2IA 4NCC1 2BS8A 3H3KA 4D8PB 3JV0A 1KIRB 4PJBB 3EFDL 3LKOA 3KLLA 4KNUA 2EIBA 3TF4A 3V0JA 5CEYB 1BOYA 4UM8B 4ZW6A 4YEFA 5JHDA 4V1DA 1EAPA 3LPFA 3SDYH 4KKAD 4NKDB 2P26A 1GZQA 3K74B 5IBTH 3EDDA 2WQAA 4HK3J 2DH2A 4TULH 5I6KA 4FHOA 5E2JA 2EZ0D 3U1PA 4MJ5A 3RY5A 2EXWC 3IXAA 4WO4C 3NZHH 2XWCA 5MERA 5C8JB 1SXSA 3OZLA 3FQTB 4RRPA 3LDBB 4DGWC 3CPUA 3RWCA 2WUCH 4H40A 4C56B 1NIFA 1WE5A 2BJMH 2WNXA 1C8PA 2MH4A 5DD3L 4KRMB 3NUKA 2O26U 2MQCA 2J8UB 3REWA 5IZ7A 4EN3D 5HHQB 4N0UB 1ZE3C 2Q86A 2DI9A 4OD2B 1U93B 4KROC 4R0LB 1RUPL 5GS1B 2HKHH 1E8WA 1ID5I 3NJLA 5I0DA 1CT8A 4NGHL 4PJHF 3P0VL 4E41B 1U8KB 3CIAA 3TO4D 2B8OT 4M8QB 4MTMA 1NAKH 3WJJC 5GGQH 5TQ0L 3N04A 4WVRA 2NDGA 2X4NB 1YG9A 2OTUB 1CPUA 5D7JD 3HC4H 3TWYA 4P91A 2RTTA 2K6YA 2XQYK 4KKLC 5H94A 2EKJA 1OY3B 2VGLM 2VDLH 3T3MB 3SB4A 3UTSB 3EJZC 4U3SB 5E2TH 5L7XH 4HD5A 2ZCHH 2OPCA 1MQKL 3UEZA 1X9UA 1XXDC 2ZOKB 3IFNL 5C9JA 2QQNL 2X4SB 3PAUA 3TCTA 1LK2B 4A6YH 3DXAD 2LT9A 3QWRD 4FFVC 2BFVL 2F1AA 1KIQB 5IREA 2TRHA 1ULVA 3EG9B 1YSOA 4Z7OB 4OJAA 4UT6H 3G7TA 4B9FA 1I3RA 3LXCA 2MNWA 5I1EL 4CSSA 1KCVL 2D7OA 4MMZA 4V2BA 1MREH 3RGVB 2NY7H 2C1OB 4G1MB 3WS6A 2GIXA 2R69H 1T66C 3KPPB 4AV5A 3QJQB 1HH9B 3KLDA 1URLA 1I85A 1RMFL 5B39B 2PETA 5D7IA 4ZSOB 2D3VA 3VFTB 1S9YB 4LASH 5FGBC 4PY7A 1X5JA 1BXXA 1NAKL 1Q9WB 1XL4A 2FUQA 3OHXC 1VZHA 2R0LH 2Z7XB 3U7WH 2WTRA 3MRQA 4MCMA 2Q7YA 3KJ4C 3IAGC 2H41A 4Q56A 5FGSA 1SGKA 1LWHA 4CN1A 4WI9A 4K7PY 2NY0B 4ZUVA 4I85A 5D5MF 1PLGL 4YHYB 4LIQL 4BDVB 5I9QC 1B9ZA 5EBLA 5K39B 4GKSA 2WXJA 4Q52A 3RPIB 5A3IC 1J8KA 5JHBA 2XV6B 5IEHB 1SBSL 1BJ1J 2YOAA 3G5YB 3V4VB 3R4RA 5BO1H 3VJ6B 4PCYA 3DMMB 1M9WA 3PGCB 4MX7A 5HHME 4DW2L 3OWEA 1UFUA 3LEYH 2RHEA 4GKNA 2DWYA 1KTDA 4HYTB 1JRHH 3ULUF 3T65B 3GHBH 1IBGH 2YEVB 4U6TA 1IAIH 1K2DB 2BLFA 3QPQD 4Q9QL 3PFQA 1MEXH 4XMWA 2GUOA 3S8GB 3S37X 3HAEG 5HYSG 3B2MA 5FLUA 4JZNA 3FT3B 4X5WA 5BCAA 3ZYNA 2PNDA 5C0DA 2WYHA 3EO9L 4P99A 1UD5A 1RUAH 4J3BA 3S96B 4N0RA 4PS7A 4RMTA 4ZMVA 2NSQA 3QUXD 5TD4A 1NMCB 1F4XH 1QEWB 4LCWA 2R56L 3EYFA 3ZTNL 1NIBA 1I31A 3TN0A 1CDIA 5GS2B 2H5UA 1CL7H 3LIZL 4B50A 1L7IL 3K2KA 4ZT1A 4KJYA 1IE5A 1FL5B 3UBXB 1BJMA 3QNZA 3TJEH 2XY1A 3K8MA 1PLGH 4QRQA 1GCYA 3BIKB 4ZI8A 3IJ9A 3L9RB 3NJGA 5DD6B 3KWXA 4QTIH 5B1JA 4LCCB 4W6WB 4FI7A 1U3ZA 4YHMH 1AFVL 4RMVA 3Q8CA 4XCNA 3MN8A 1P53A 3T3PB 4LARH 3KDMB 5KVMC 3UGEA 1XSKA 1KG0B 4HWEL 5DUPL 2X4PB 1G5AA 1RQ5A 5DJZB 2JKRM 1WFMA 2QV4A 3L9RA 3VGAB 3F04A 1UGNA 3U2IA 2A6KB 4UV7L 5L2JA 1EXUB 3RUGA 3VXRD 2CGYA 1B9KA 1WEJL 2D7TH 3F6LA 4H13C 1WFOA 4JFYA 4QRFA 4UQ9A 1GY2A 2IANA 3LQZB 1A65A 3MUJA 4BUHA 3D5OF 3QGVA 1QYGL 1VPOH 1MY5A 3JWNG 4ODVL 2D0HA 3JTTB 1JI1A 2DJSA 1QQDB 1IGTB 2WBJB 3EYQD 3VI4A 5K9JH 1H8OA 1SYSB 3U48A 1QPKA 4X5QA 2K8MA 4YHNA 3HAEA 5HYSA 4LPXA 4FEMA 5HVHB 1N5YL 2UZIL 2ZP9A 3HFML 4KBPA 5D1XE 1SOQA 2AJSH 1U92B 3T8XA 1WQVT 3RGVD 3QQ4A 2SEBA 5KSBF 2VUYA 5I73B 3FF7A 5I30H 2XWBA 2Y6TE 1BFVL 3LEXA 4JO2H 2MCMA 3W9EA 1RZ8B 5D1XC 4N9GB 4JANA 1VESA 1KCBA 1UH2A 3VD3A 3AS2A 4RGNC 4FG6C 4UQDA 4FS7A 3KEDA 4NJ9H 4NIKB 4MN8B 1NPNA 1A7BA 3FSZA 1FP5A 2YFNA 3KLKA 3OQ3B 3CXDL 1HHJA 3GXPA 4RLDA 1RK1A 2QHLA 4LCYA 4LNRB 1QUNA 1X6LA 4G1EB 1MQ8A 4BCYA 4NZTH 4X9GA 3GS0A 3KJ6H 5DF0A 4X4XA 3CFEA 4GXVL 3UFIA 3LKNA 4V11A 5HDLA 5EBLB 5K39A 3NGBC 1L9MA 1T3FA 1DQTA 3MREB 4NQSA 2EACA 4JCLA 2GUYA 1ZLWK 1Y7VA 2DMHA 3O6KL 2PR4H 2ZXDA 1TQBC 2VR7A 4GXFA 5DD1L 1DHKA 3L3OC 5F8RC 5CZRA 5JPNB 2O5ZL 2V0AA 2QPEB 2W91A 3CNKA 1FRGH 2B15A 3LVTA 1Y6NR 5AYQA 4NFBA 1VGKA 4UYPA 1LEKA 4QXTB 4MA8L 4Z7VB 3HG1D 2BNQA 4ZXBA 3I3DA 3FRUA 5C0AA 4XN4A 4HJJL 5EU4B 4G6FB 2VIRA 4RNRB 4LLWB 3FQYA 5GGRY 2ASTB 1JDAA 2A4CA 1IGIL 2ILLA 5EHFA 1QRND 2F58H 4K23H 5FYJL 4M02A 3RX9A 5JXED 5IF0A 4UTCA 5KBNC 1LEGA 4ZPTB 4CKQA 4G9DA 1XR9B 1U3HB 1DANU 3AQDA 4UWQB 1OF2A 1TJHL 2QQLH 1V7NL 2QVKA 4YE4L 4IU3B 4AQ8C 3GOZA 1XWDC 3H85A 2G0LA 3BLBA 4WV1C 2FJFA 1UWEL 4Q6IC 1WWCA 3L5WA 1EX0A 2OMUB 1G4MA 1P9MA 5TE6H 4Y16A 4NYLB 5C0RL 3FO1B 3NRFA 3IKCA 2RAMA 1BVLA 1MCFA 4TS6A 1S8DB 3L3HA 1TKWB 2BCKB 3NJHA 4PJDB 5D6DC 2AK4A 5MEPB 2OMTB 5AKRA 4JX0A 2OSWA 4F20A 2J88L 3BX7C 5DHDA 5LHDA 2HX9A 3V6FB 5J11C 1KGCE 1ZS2A 1KENL 2F08A 2WMPB 2VZUA 1BM7A 4GI8A 4Y5XB 4Q2ZB 5FA3A 5FK9B 4L18A 2GFBA 1T0NA 5JHLL 3FQNA 4L2YA 3VXRB 3WGUB 2OM5A 1INEH 5GISL 2Q5BA 4X6EB 1QFHA 2RA8A 3GXUB 1QTSA 2IG2H 3NYKA 2NY3D 4F58L 5HHQA 3FW6A 3L1OH 1G9HA 4FCAA 1OAZH 5FFGA 2J8UA 4RMRA 1BEYL 3AB0C 5C09D 4EDXA 3II3A 4NN7C 3VUAA 3HN5A 3WG7B 2DL9A 4LLUB 4N2IA 4IK7A 3GSWA 4TN9A 5AALA 4UINL 3VXSD 4JFDA 1XH1A 3T8MA 2XZZA 2EC9T 1BM3L 3WJLA 1G9MC 5EA0H 1E28B 4G7RB 3C9NA 2VL5A 4PJIB 1AG6A 3FRPB 4WWKA 1DQDH 4FD0A 2C9XA 1SM3L 1A3RH 1D7DA 2XWXA 3KPLB 1H3XA 2P8PA 4HIJB 3BDXA 1MF2H 3DETD 3KPRA 4LL9A 2PPCA 2N7BA 3V0HA 5C6TL 5EF2A 1O9VA 1YN6B 3O3AA 1A14H 2V7HA 4UILL 4D8PA 1ZWIB 1FFRA 3OF6A 4XVJL 3GDCA 2KT6A 4GB9A 1MNNA 1B90A 1Z6JT 1I9EA 2JQMA 1RL1A 1MFCH 1HEJC 1L7IH 1JMZA 4PV8A 3CUPA 3QO0B 2GK0A 3HE7C 3LNEA 4RX4A 4APXA 2C5DC 4LRIC 2F6AA 2PLTA 5EU7C 1A6UL 3AREA 4RGMB 1TNMA 4U1IB 1M56B 3L8QA 3VYPA 1CB4A 1UWEH 1WAAA 2IGTA 5I8CA 3VD5A 5D55A 5DA0B 1GA2A 2EIDA 1F41A 3J27A 2YJLA 4ZS6D 3DTUB 1NA8A 3MJ9L 4OF5A 2PW1A 4PJ6A 3IDJB 2Y36H 4UT7H 4GBXA 1P2CA 3RTQB 4MB5A 4ZMZA 2EO1A 1QZ1A 3ZTEA 4GNKB 1CZ8H 3HN3A 5GGQL 5TQ0H 3U7YL 1Q9KA 1R3HB 2EZ0C 2VXQL 3RURA 1AQDB 1TT6A 1M2OA 3MBWB 5IR1B 2V2TA 1KZQA 2X4OB 3EBHA 4KZDL 3GI9L 4F92B 3QH3B 4H1LH 5IF0B 3WBDA 4FNTA 2XFXA 3WUZA 3B9VA 4GKSB 4P3WA 2EDBA 1UB5A 1S3KL 5EIIB 3EBAA 1CICC 2DQHH 4X9BA 3LIUA 2Z1KA 1MELA 2HTKD 2PYEB 3P9LA 4GG8A 4TVPL 3UROR 4MA3B 4BSWB 3UPRA 4Z8FL 5ECGA 1ONQB 1RK0B 1OTSC 2NRDA 3E8UL 2NQCA 5E9DA 4K23L 2EILB 2J1XA 3HE6A 5FYJH 4BSWA 3MODH 2I5YL 3IS1X 1JPEA 2J12B 3MV8D 4YDNA 4LASL 3X12A 4YHOH 5KYUB 5LBGA 4O58H 1XL6A 2OMWA 5D2NC 2QLYA 3TCLA 4HBCL 3SDCD 5TE4H 4UANA 2O6DA 4CVXA 3D07A 4GIAA 4MMZB 3AQYA 3FTUA 3T3PE 2PR4L 5T1LA 3SODB 3EKCA 1S4IA 4AVKA 3O2VL 2BNQD 5C2BH 1U8OB 2WIIA 2QSCL 5HDBB 3EG9A 4EN3A 4OGXL 5HYJE 1BD2B 2CGRL 3OR7B 3PQYD 4KI5C 4FNRA 2ATKB 5IW3A 3E8VA 3MBXL 5T5FH 3U1SL 5DMYA 2Z8RA 4MCZA 2X4SA 1N68A 1BG9A 4YDJA 3UBGA 3FT2A 3QYCA 2SEBB 4PJFF 1WBXA 4U1IA 4OLZH 2KZBA 3FCGA 3TOPA 4ZG1A 4J1UB 4MDJB 1IILE 2G9HA 2ZWZA 1HWGB 2IALA 3I75A 5BRZD 4CJ0A 3HAEB 1C7SA 1BECA 2JKTM 3MA9H 5HYSB 4IJ3B 2HJFA 2GJZB 3IYLW 4AQ1C 3GSOB 5GS0A 2BXZA 2VZTA 2NZIA 2X1XR 1N19A 4H5SB 4W9KC 1A6ZA 3QDME 3EH1A 2FK9A 3DBSA 5EOQL 1JV5A 4BEIA 1R19A 2BXYA 4QXVA 1SPDA 2Y5TA 3NZUA 4Z7UB 1HSBB 5ENWB 2BPBA 3Q2CA 1BGXL 1CFVL 1TR7A 3RUGB 3LPGA 1JE6A 1JNLL 4NQED 2W07B 2NSXA 3QHTC 3WTSA 3SPIA 3FH5A 2HT3D 3PLYA 4JFOA 1BZ7B 2JJSA 2JKLA 2VRAA 3KDMA 5CJXC 3KPLA 4LHQB 4CKVX 1KCWA 3RWFB 2F8XC 4QDGA 1C9SA 4PH8A 5F9OL 2WQRA 1N0LB 2V5RA 1KCRL 2X5PA 3REWB 2O93L 1LGVA 3P4MA 5CJXA 1IC5H 3QEUA 4LSDA 3BWUC 3HEIB 4BH8B 3HHRB 2C3WA 2OMYA 3QHZH 4ILDA 4JO3H 4JKNA 2B9AA 1A5FL 2EADA 2H3NA 4LLUA 5IM7A 4JFQA 3P1VA 5L9DL 2GSIB 3KPSB 3QFGA 4H20H 5A1AA 3NRPA 2VO8A 4YDVA 4Y2OA 3EADA 4O2FB 4F2ME 1T21A 3LXAA 1F4WL 4GRWE 5FYLH 5F9JB 3NCYP 4U6XB 2V4LA 1BZ9A 4EXPX 5LBSH 3OLIA 3WFBL 1FZKB 1PJ9A 4P4KC 3FT3A 4P9HL 3D2UB 4X5WB 4CBPA 2OULB 4F8QA 5KVDL 3HMXA 2PO6A 5HYJB 5I16B 1C5DB 4AUYA 1IAIL 2WQSA 4OLWH 5GZNC 4OZHF 4ARNA 3BGFC 3VG9B 5KG9B 3CVHA 2BVPA 2IH3A 1ZXQA 2Y72A 3SE9L 1A9EB 2MOGA 4EN3B 1MCSA 1R3JB 3VACA 2AK4B 5FX3A 5BZXA 5MEPA 3QUXC 4DUVA 2WVUA 1G1OA 2DQEL 2PTVA 1TMCB 1KLUB 3B7UX 4LSQH 5ALBH 1TETH 1D6VH 3NVQA 3P73A 3T0EB 2ZXWB 2EUZA 5JIIA 1NCAL 3MLUL 2MCG1 5JNYB 3BYYA 4JRYA 1LK3L 1F6AB 3CX5J 3TO4B 1SJVA