4CC4C

Complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
265
structure length
263
Chain Sequence
SESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAGMQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSALSRLFLDNNELRDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWIDLTGQKVNEPVKYQPELYITNTVKDPDGRWISPAAISNGGSYVDGCVLWELPVYTDEVSYKFSEYINVGETEAIFDGTVTQPIKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INLC PROTEIN
publication title Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
pubmed doi rcsb
source organism Listeria monocytogenes egd-e
molecule tags Cell invasion
total genus 82
structure length 263
sequence length 265
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08191 LRR_adjacent LRR adjacent
C PF12799 LRR_4 Leucine Rich repeats (2 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4cc4C02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4cc4C01
1SQ0B 2Z65A 5B0TA 4QC0A 1P8VA 1OGQA 3UL9A 5GS0A 5GMFA 1O6TA 4M7EA 4CNCA 4RCWA 3WPEA 3G3BA 4Q3GA 3OGMB 2WQUA 1DCEA 1XEUA 2C9QA 1FQVA 4Z61C 4ARNA 4R07A 3WPCA 2Z66A 2C9PA 3UL7A 1FO1A 5B0NA 2JE0A 4XSQA 4LSCA 2UZXA 4C2BB 4YEBB 5GMHA 3G3AA 1M9LA 1IX2A 5GQRK 2O6RA 3ULVA 1O6SA 5IJCA 3RJ0A 3PMHG 2UZYA 3E6JA 1P9AG 4V2DA 2Z81A 4KXFB 2OMUA 4C2AB 4XOSA 5AWAA 4FD0A 5B4PA 3RW7A 3BZ5A 4Y61B 3W3LA 4PERA 1OTMA 1M10B 3WPBA 4LXSA 4CNMA 4G8AA 4RWTC 3BCDA 4K17A 3TSRE 3O6NA 1A4YA 2XWTC 1KOOA 3RIZA 3UN9A 4V2CA 3ZYOA 2Z7XB 5AZ5A 1GWBA 2A0ZA 4R5DA 1OZNA 4CP6A 5CMPA 4BSRA 3FXIA 4I6JB 3W3NA 4UFRA 4OQTA 4ECOA 3P72A 4L3FA 5FTTB 2IFGA 3JB9j 2P1MB 3E2JA 4Z94G 2OMVA 3WPGA 3BC9A 4U09A 2RR6A 4Q3IA 4BSSA 3RW6A 1KOHA 4NKHA 5HDHA 2Y5QA 3FAWA 3ZYJA 1H6TA 2FT3A 3C6PB 4PKIG 3E4GA 2ASSB 3ZYIA 4XGOA 4RCAB 2P1OB 5AWBA 5AWDA 3WPFA 2WFHA 4R6FA 3ZYNA 1K5DC 2V70A 4ECNA 1LTXA 3RFJA 4J0MA 4LI2A 3ULAA 4FCGA 4M7EC 4P8SA 4PEQB 2RA8A 4Q62A 4WYKA 5D3IA 1JL5A 3SB4A 2Z63A 4R5CA 2O6SA 4MQWX 4TZHA 1Z7XW 4CC4A 2OMXA 3REZA 2Z64A 1H6UA 1OOKG 4AQ1A 3BCFA 3A79B 3OJAB 3RFSA 2ASTB 4FDWA 5GS2B 3M18A 5HZLB 3C6NB 3M19A 2CA6A 1G9UA 2V9SA 5IYXC 1M42A 4ARRA 1K5GC 4CILA 4LXRA 4P91A 1LYQA 2Z82A 3UL8A 1XKUA 2XOTA 2OMWA 4U7LA 1O6VA 3W3GA 1XECA 2V9TB 2P1PB 4CC4C 4J4LA 3G39A 4GLPA 4PSJA 3VQ2A 3C6OB 3VQ1A 3FAXA 2Z7XA 2JE1A 5GMGA 3ULUA 5A5CA 3O53A 1W8AA 1IO0A 3DZEA 5LFNA 1D0BA 4LSXA 4BV4R 5AWCA 2OMZA 4H09A 4KNGA 4NKGA 4QBZA 3KJ4A 3RGXA 4QXEA 3W3JA 2RA1A 1DFJI 1YRGA 1M0ZA 4R0AA 3G04C 2WQXA 4FMZA 3OGKB 5IJDA 4B8CD 4LI1A 1FS2A 2O6QA 3WN4A 4R6GA 3CIYA 3RFEA 1DS9A 4Z79A 5IJBA 2R9UA 4LSXC 1OTOA 4FS7A 3E3ZA 2BEXA 1FT8A 4R09A 5ICUA 1U0ND 3WPHA 4GT6A 1NM4A 1P8TA 1XCDA 3OGLB 2JQDA 2P1NB 4AW4A 4V2EA 4FHOA 2C9RA 2Z62A 4KT1A 4PQ8A 5CMNA 2WQVA 2BNHA 3GOZA 3WPDA 2OMTA 3CIGA 4U08A 1QYYA 4WP6A 4MN8B 2WQWA 3OJAA 4HQ1A 4Z8GA 4L3AA 1WWLA 4U06A 2OMYA 4R6AA 2YA1A 2ID5A 4R08A 4EZGA 3CVRA 4R58A 1OT4A 4R6JA 4Z64C 1OTNA 1PGVA 1A9NA 3WPIA 4AY9X 3W3KA 4BSUA 1ZIWA 3G06A 4IM6A 4LSAA 1XWDC 2P1QB 2Q4GW 3W3MA 2ELLA 1M9SA 3RGZA
chains in the Genus database with same CATH superfamily
4UT9L 2VLRE 1SJVA 1NTDA 5FYJH 1MCCA 1N8OE 2EQDA 2VQUA 2R1YA 4NXSA 5B1AB 3WBDA 5K59F 2OZ4L 4F7MA 2UWEE 1R34A 3S8FB 1MHCB 3UL9A 3U2JA 1YNLL 3H55A 1XGUA 3VQLA 1WZMA 2X0VA 5J1SC 4GUOA 3P0GB 2AJ3B 3IXTB 4LSTH 4PRBA 3ECBA 5EA0L 4AZUA 4BK5A 1GMEA 2CGRL 4ONFH 3V6OE 1VF5C 4O2CB 1HOCB 3O2VH 1OOWA 4GRLB 3C8KA 4JDTL 1SMOA 4QRAA 4YL9A 3VFGH 1MI5B 4NP9A 5GGVY 3O6FD 1R6VA 1NICA 2AJ3A 3AITA 3IXTA 4KVCH 3DDFA 3MVSA 3CN1A 3SGEH 4UQ9A 1H0DB 4O2CA 1HOCA 1JZDC 5T1KB 3RWFB 4C47A 1AXSB 1QWHA 5EN2B 3QK0A 2D7PA 4XO4A 1MI5A 3E9TA 4ZOCA 1YNTB 1QO3B 5J5EA 1JWUB 4FFVD 1DVFC 1OPOA 3S5LG 2C9PA 2F19H 1NFAA 5E0FA 5FM5O 3V0WH 4FAAB 1B2WH 1H0DA 2OJEB 4Y4KB 3RWFA 4YFLF 1R19A 4PJCF 5EN2A 1XCTA 1I3RA 4LHUA 2EDRA 1YNTA 3WTYA 1QO3A 2EH7H 3WJMB 2BIQA 2DQGL 1JWUA 2YIHA 3UAEA 3ARBC 4DEWA 4BRVA 4TVSa 4A2FA 2FLRT 3ZTJH 3I3EA 4Y4KA 2OJEA 4EEEA 4GMTL 5HDOA 4Q52A 3EH1A 2ICEC 5E00B 3ROLA 3X3FL 1FRGH 5H37A 2VNCA 3CC5A 3VW3H 4GO9A 3BVUA 1PY9A 3L3KB 4HPOL 3QFDB 1J12A 3WJMA 1JG9A 4MJIA 4BZ2A 3D3VB 4B7LA 5T3XD 1JGUH 4MA1C 4OLEA 2Z8WC 4UIMB 1LO3L 2NW3B 2IV8A 3O0RH 5E00A 1VFOA 4W81A 3A47A 4M6OL 3BUPA 3L3KA 3QFDA 2X3BA 5T3ZE 2UXTA 5CJXA 1CIUA 3D3VA 1X5FA 1QLEL 1CXHA 1U8LB 4UIMA 2ZNXA 3PREA 2NW3A 5JOPD 1G5GA 3LVEA 4MAYB 4U6VH 2CQVA 4XVJL 1UM6L 4Q4IA 2DQHL 1AQHA 3SKUD 4J12A 4L8SB 3EFDH 3OKEA 3VUAA 4XNUL 1GTFA 4FYSA 4XCCL 1NOLA 4Y9EA 3REWA 5EUKA 2R0LL 4GI9A 2DOCA 3WPBA 1SRDA 1U8LA 1HHJA 5AVRB 4IKIA 4MAYA 3RGVC 5IB1B 3PV7A 4G8AA 3CZKA 4N85A 5KOMC 3E3QE 1V55B 5C2BH 3SJVE 3UO8B 4KRPB 4UINH 5IBUG 5EEUA 1JGEB 4Y4HC 1RFDL 1B6DA 1QFOA 4NZUH 4JFUA 3RIZA 4WU7B 1NCUA 1I85C 1DVSA 2Y6SC 3MNZB 2XA8L 3POHA 4LLAA 1OZNA 5ID1B 5CMPA 1D2PA 2WBJD 1JGEA 1L0QA 1Q38A 3VWKA 4JE4B 5MENE 2EJ1A 5D96B 1NGXB 3MNZA 1CXEA 3CAFA 4NS0A 4FNTA 3BT2L 4YHZL 5ID1A 4PJFB 3HRZB 3C8HA 4DTGH 3QG7H 4S10A 1O9VA 1EK3A 1OB0A 1E8WA 1NGXA 2AJUH 4XWGL 3NK3A 3TN0C 4LCIL 4LCCC 4DNLA 2NNRA 1DBBL 1M6OA 2F68X 1VPOH 2GFBB 1HK6A 2EVIA 4PJFA 1GGIL 1E5CA 1A7OL 3HRZA 1IGFH 4FP8H 2DMKA 1ZLVK 4YBLB 1E0OB 4LLDB 1GHFL 4LE8A 2BCMA 2GFBA 4QMEA 2XN9B 5LDSA 1OTTD 4J27A 4ORGA 4RMRA 2AXHA 2QTVA 3LH2L 1B4JH 4JQXA 5GGSB 1BQHG 3P4MB 4HWZB 3KCPB 4B9IA 2JQMA 3TT3L 3X3FH 4IDJL 5KUMA 1QW9A 1G9NC 1THAA 1A4CA 4HPOH 4ANWA 1BMWA 5J06A 2P5EB 3Q05A 4PJCE 3ETBJ 4YSDA 3P4MA 4HWZA 3E9UA 1LO3H 1KLUA 4MS6A 3VGFA 5EV7A 2Y1ZA 4B9FA 4BA0A 2V17L 1GCYA 4QHNB 5A3IC 2DL9A 2JJSC 1YRKA 1OP4A 2NY0B 3RUGA 4Z8FL 3IPEA 4U1GC 2GHZA 5I18H 4JNXA 2Q2EB 3FQ1A 3ESUF 1KYDA 3O3BB 3ARFC 4PJIB 1PLCA 1LL1A 4QXVA 1SMDA 2HKFL 4QHNA 4U1NB 5J89A 5D1ZI 4J3BA 1EHAA 2AJVL 5FS5A 1QI5A 1P6AB 1KNOB 2PXYB 3S3PA 2Z63A 4WHYG 4O02H 3P1VA 4FQJL 3O3BA 3QNFA 4PJIA 4PJ9C 3ESOA 1KGWA 4OH2A 3CXHK 5I1KH 1CLOL 3REZA 1NA8A 3BZ4B 4YL4A 1G94A 3FH7A 1BWWA 1GYVA 1T7YA 5E6IC 3SGKA 4RWYL 3DMMD 1KNOA 3A79B 1VFMA 1KXTA 1JZGA 3MCYA 1DYZA 1DVUA 4MJ5B 4RFEB 1H3WM 1DANT 3RNQB 3W0WE 2WQSA 1MCIA 2BRQA 2CBPA 4ZAKB 3Q44A 4MD0B 3F7VA 5H2BB 1KCWA 2WLZA 1TSHA 3BZ4A 1ZXQA 3MXWH 3B2VL 2WC7A 5LGHL 4Q9QL 3HE7B 5FUZH 4UV4L 4FQLH 4MJ5A 3STLB 3UROR 1IIIA 3RNQA 1QFWH 1Z5YD 4K8RC 4PRDB 4ZAKA 5H2BA 4MD0A 3ULUD 1ZLUH 3TZVC 3GK8H 2JKWA 3BT2H 5FGBC 4UZSA 4G6AC 1RZJL 4KJPC 1E4XI 4KROD 2VR5A 5I30L 4G9FD 3HE7A 2VQ4A 2WPGA 3BP7A 4U7SA 3STLA 4PRDA 4XWGH 3PXLA 4CC4C 1SDAB 4B6ZA 4NQED 4ENEC 4D0BB 1UWGL 1DEDA 3TBSB 3TBBA 3WEAA 2XVKA 4P2OC 1T0MB 5DD0L 5FFGA 1ACZA 4HW6A 3OTTA 5CEXB 3VQ2A 1G7JB 1TTBA 1A3QA 2ZXWB 1SXAA 2VAAB 3A4AA 3TJPA 2X53A 4QHMB 2GBUA 4PY8I 4YSTA 2QZQA 1J0ZA 1CS6A 2F8IA 4D0BA 3TBSA 1T0MA 2Z4QB 1KUMA 1FA4A 5CEXA 2Z4TA 3OSKA 4LBAA 1G7JA 3H7BB 4R0LC 2G3ZA 3H42H 1LEKB 2IV9A 2EEDA 4IBZA 1IE5A 2VAAA 1A3RL 2YAOA 4QHMA 3CQQA 3ETSA 4LLQB 4Y1AB 3NA4A 4IDJH 3WFBH 4DWHA 1E9QA 2F58L 4PBXA 3CQFA 1FCGA 5JIKA 3H7BA 4PJBF 1E90A 5DEGB 1W8OA 1LEKA 1EBPA 2R56L 4LLQA 2E9BA 3O6MH 3AY4C 4Y1AA 1J18A 5EH1A 1IT9H 4H7VA 1JS4A 3MX0B 2AZAA 3O2DL 4W70A 4IIQC 5DEGA 1A4AA 2WV3A 3T0EC 1PBYA 1MCLA 2VDOB 2IOMA 4XP5L 2WTPA 3AB0C 5J13C 4KX9A 5CCKH 1C9SA 2FEEI 3SO3C 5C9JB 2EIZB 1YYML 2F54D 1MCDA 3RA7H 1UM5H 3EAKA 4FZEL 4PGDB 1FS2A 5TD4A 3TP4A 4E41B 4PIBA 1UQSB 3QORD 4PPTA 4HJ0C 3F7QA 2WK2A 4UM9D 4A7GF 4M8RA 3T09A 5HHVL 2EIZA 1LWHA 4FQJH 1E2WA 3ABGA 3IU4H 4XNAA 5AL0A 4PGDA 1NKRA 3M17B 3KLLA 1VENA 1OV8A 1DJXA 4K2UL 4RMVA 3QR1A 4ZO6A 4X6DF 4E41A 1JK9B 3WUZA 5I0ZA 3ARGD 2VXQL 5DD5L 3IT8D 3FO0L 3MA9H 1XCDA 5IIEA 2I60H 3VMNA 2JKJA 1JK9A 1B0IA 4GLRH 4Z7IA 4Q9QH 3D4CA 1LMKA 3A5VA 2QPUA 3BN9D 2IWEA 3K0WA 4NKMB 3S36L 5F0JB 2YRZA 5CF3A 5I8KH 2BNHA 1C1EL 2G9HB 4FMFA 4X0KA 3DX4A 2UVEA 4XGZB 4L3CA 3RIFK 4QRPD 4PU2A 1RZJH 4KQ3L 2DWXA 4QNPF 1WA0X 4NKMA 5D6DA 3MSPA 4NZFA 2DYPB 3HR6A 3V4VB 1BVNP 2G9HA 1BJ1J 5B3SB 3BGFC 4XGZA 5H94A 1OM3H 3UAAA 1L9RA 2FECL 4JO4L 2PCXA 1NMBH 3BAIA 1W16A 3ZDXB 2B16A 5D9SB 1V05A 1WHOA 5JQ6L 3QRGL 3V4VA 1WWLA 3S5ZA 3QJFB 3N44B 4G43A 5L4FA 1UYWL 3D9AH 4UV7L 1AS7A 1RURL 3NN8B 1T6VN 4X8GA 2O6CA 4HCGA 4IU3B 2D3JA 3PIQB 4UF7C 5D7LE 5KVMC 1G84A 5D9SA 4GXUN 5CP3H 1FV1B 4WIQA 4NLHA 3QJFA 4JRYD 1KJ3L 4HIXL 3ETBF 2NPLX 1RZGB 4OLZL 4R7NB 5CGYD 3WAJA 1PGVA 2F58H 4GSDL 1PNCA 4LOUD 4XMZA 1J5HA 1I82A 4KZEH 4IU3A 1Q9KB 3PIQA 3QYNA 3HBGA 2CAKA 3FU7B 4RBPK 1FV1A 3S37X 4MTMA 1D5MB 2R56H 1OSPL 2VN3A 3SQOL 1HKLH 1HH6B 4R7NA 1RZGA 5IOPB 5F3HB 4XMKL 4IMLB 1G87A 3RB5A 3EJTA 4NWTH 4KKCC 4DZBB 3PP3K 1MJJB 1Q9KA 4J3TA 4P57B 5F2FA 1S8DB 1KC5L 3FU7A 5JUEH 1D5MA 5D4HA 2PO6C 4JVUA 4ONOA 1HH6A 3CWGA 1MCSA 3NSDA 1I8MB 5F3HA 1AC0A 2ZX9A 5KAQG 2Z8VC 3ABZA 5D70H 5T5NG 4DZBA 4G3YL 5EO0A 4P57A 1KV3A 1S8DA 3LXBA 1K4DB 4AI7A 5ISZD 2PKDA 4PD4K 2AEWA 4NHUB 3G9VA 1GW0A 3ZT7A 1WD8A 2EDXA 1CD0A 3BKCL 4R4BB 3L3GB 1ADQA 1K4DA 2JNZA 3DTDA 4IBSA 5GS2H 2ETWA 4NHUA 4JRFA 5DD5H 3HS0C 4KJQC 4QOKD 1DQKA 1AD0B 1XEUA 3EOTL 5GRVL 1IM3B 1RZIB 2HMID 1JXJA 4R4BA 4DAGL 2H32A 3U6RB 4GXUM 1Z0MA 3E2HB 1DVQA 3L16A 3INUL 1JYWA 5AYUH 2BVPB 1XQ4A 4P05A 5EBWB 4W9KC 3S36H 1AD0A 2Z92B 4X6DE 1HAWA 1RZIA 1XAUA 1KEGH 2F7IA 1SDDA 3H4FA 3PHOB 3OLGA 2DIJA 3U6RA 4OD2B 2PETA 1TJGH 1U2YA 3LKPB 4JFZL 5FWRA 3KG5A 5D1QC 2BVPA 3FONB 4DVBB 2IMNA 2A73B 5C1MB 2BZCA 4BD4A 2Z92A 4XB3A 1LE9B 3HHMA 3WLBB 4G7SB 4JJHA 2B7DT 3PHOA 5JIDA 4GUPB 3T04D 1CE6B 1U4FA 3KPSD 4OD2A 1DFXA 2VWEC 3FFDB 3B9KC 3LKPA 4JFTA 4X6CF 3DSFL 3FONA 3L5JA 5CSGA 1EDHA 5I1JL 4DVBA 2ZP8A 1BCIA 2A73A 4IOFD 3ATFA 3MBED 3FQNB 1DJGA 4OFYD 3WLBA 5I19L 1U3HB 1UYWH 3PWPD 4GUPA 3A6BL 2GY7B 1CE6A 3QEQB 3FFDA 2HFGL 3LKSA 3KXFE 3QI9D 2ZUYA 5F9OL 1JPFB 4YQXH 3GSUB 1E5BA 4NO0D 4AE1A 1BZQK 3GO1H 1E50A 1U3HA 4OLZH 4OLWL 3IFNL 2DQFB 1YLBB 3OF6A 4ELKB 1JPSL 1U8QB 4GO8A 3P3RA 5LGKA 1F8TH 1O5PA 1IBGL 1FH5H 2VLJB 4DZ8B 1JPFA 2H41A 3LH8A 5HY9A 5AWAA 2ZUSA 5B21A 3MV7E 4DP0X 1BA9A 1FHGA 2C5DC 4K94L 1CF8H 1LILA 2DQFA 3EZ8A 5DVMA 5SWSA 3SPIA 3UH8A 4ELKA 1U8QA 5T1JA 3LN4B 4GMSL 5TH2A 3W9EB 1H5BC 5FUCC 2VLJA 4PG2C 4RGNC 4K3HA 4DZ8A 3AWGA 1IGML 3FQUB 1YMHB 1T22B 1E4HA 4LEEA 1P4LB 1RUKH 2IFFL 2XYBA 2ZJSL 4XHJC 4Y8DC 5IW1B 3E6HB 1KB9J 2PR4H 3LN4A 2NY1C 4F91B 2XWTC 4L1TA 2PYEE 2NY3C 4JFSA 1OP5K 3QUYC 4X6EB 1TPXB 4BSWA 1YMHA 1BX2B 3V4UL 3U4BL 2Y22A 4JN1L 2V8LA 1OAKH 1NCBH 1P4LA 3ISYA 4JY6A 2J1YA 5IW1A 5E8NB 3E6HA 1YEKL 1XGRB 3C5XA 4Y16D 2BY2A 4UMGA 4UNVA 2WLLB 1OCZB 4X6EA 3R0NA 1BX2A 4Y4FB 3SPGA 3P4OB 2GEQA 3MMEB 5FV2A 1JP5A 2K4AA 4EUPG 4LIQL 3C6LD 1XGRA 1A7RH 2O6EA 3HZYB 4ALAC 5E2VH 3Q7JA 2WLLA 2XXMB 5CGMA 1RZKH 5AOJA 4Y4FA 2BRRL 2QADD 4HU8A 3TBCA 4WI2A 3WENA 3P4OA 1LE5B 1ZT7B 4F9LC 3MMEA 2BOLA 3QEGL 1G7IB 1HESA 3QQ4B 3BH8B 4XPGL 4ADIA 3SYOA 4Q3IA 4GP5B 3HZYA 1IQDB 2DM4A 2C3WA 3ML8A 3JV5A 4NKHA 3IU3A 2BFVL 3V0EA 1QBAA 1LE5A 1HZHH 1ZT7A 1KZQA 4IBUA 3W5NA 4OLYH 4ODWB 2XTJC 3U83A 5AZEH 3VM5A 1G7IA 3QQ4A 3Q2VA 5TQ2H 5SWQB 4HCRA 3QWQB 4XGOA 1IQDA 4KO6A 2LAAA 4JS7A 4NKQB 4Y0GA 5IW3A 5E1GA 4ELDA 2X4OB 4H0LC 5JHBA 5IWLC 1N6UA 2YD0A 3DSFH 1SLVA 1OAZL 4ODWA 2IVFC 2QV4A 2GBTA 3MYJB 2NY6C 4ISVB 4XBGA 5I8OH 3T2PA 3EDKA 5E08L 1A5FH 5SWQA 4HHAB 3HC3L 2P5WE 4BFGA 5AVYB 1GZHC 3Q3GB 1S3KL 1YEFH 1QSED 4JGUA 3QUZB 1MCWM 4MMXB 3MLYL 5F44A 2LLNA 3MJGX 3V0VB 1CDYA 4AITA 3MYJA 4XVSL 4ISVA 5D7JD 4J0MA 2KH2B 1KXQA 2EYTB 5EBLB 4BBWA 2B39A 4HHAA 4D9QE 5I17B 4X6CE 3ZKSD 2WKOA 6FABL 2EO7A 1JGDB 3X1GA 4PEQB 4J3VA 3Q3GA 2BSRB 4UT7L 2P28B 3QUZA 3U2IA 3UO1L 1BQKA 4XOCA 1YEHH 4YOKA 3KPNB 4F80A 1FL5B 1HNYA 4LPTA 4S0SD 1DDHB 5EBLA 5JORB 5I17A 1QUNB 4RBPH 5F7KC 1DHKA 4I88A 1KFAH 1SYSB 4ILDA 1JGDA 4O51B 5IB3B 2AEQL 2YPLA 4I18C 3JVFC 4HJJL 3LRHA 4Z0BL 3FCSB 1NKGA 2EYSB 3V9FA 4NC1C 1FL5A 3IMTA 1U6AL 4B0MB 1DDHA 32C2B 4BA8A 5JORA 4L4VD 1BM7A 1QUNA 2J55A 4FQ1L 1SYSA 4O51A 5IB3A 1OOKG 1TQCC 1UOVA 2IFFH 3ARZA 3TBVB 1ZIBA 3KCWA 3RFZB 3BCFA 3GRWA 3LQAL 4FQ2H 2ASTB 1J1PL 3FCSA 2EYSA 5ACLA 2EZ0C 5CAYB 1EAPB 1R46A 32C2A 2XZAL 1IGYB 3FN0H 4FLHA 3JTSA 4JN1H 4MS8D 1OM9A 3BPOC 1VCBC 3PY9A 5CEZH 3UEZA 2WLHA 3F85A 2GEEA 4G8GE 1GZQA 1YJDL 4BCYA 1YEKH 4OFQA 2AERT 1I7UB 4OV5B 2A6KB 3L3OA 4HGWA 2DBLL 3SE9H 3SB3A 5EZIL 3KLSA 3Q9QA 4MCMA 3IF1B 3MJ9L 1CDJA 5BQ7B 4GS7B 4HJTA 1H3TA 1I7UA 5KG9A 2A6KA 4EZMA 3UJTL 1B0GA 4PFEA 5LCVA 1MQKH 4LMQI 1QA9B 4JQVA 5DC4B 5L7XL 1RZQA 2NXZD 2QGCA 1IRAY 3IF1A 5T33L 1UWXH 3MV8D 5BQ7A 3SQBB 2Z7XA 5EUOF 1URLA 4G83A 3EG9B 2GJ6D 2R39A 3QDAA 3FFCD 4ODXA 4TNEA 4A2MA 2O61A 1ES0A 4QWWC 4IRSC 3VD1A 1DJYA 2QSCH 3C60C 4W9EC 1NCCH 4PRIE 2E9WA 1WTLA 3SQBA 4BZ2H 2HTKC 4KI1A 1H8OA 4LSQH 3EG9A 1DVFB 5DUMH 4CJ0A 2IAMB 4ZX3A 2D9QB 5IBTH 2H0PA 1FSKC 5J12C 1NWPA 1XO8A 5L88H 3ARPA 3GSXB 5E08H 3GI8H 1EA9C 5FA3B 3HC3H 3IMUA 3LIZL 2IAMA 2VDLB 3CX5K 4FZ8L 4Q58C 5J6GB 4LLMB 3T4YB 1A22B 2ICEB 4N2OA 4FEIA 5JXAH 3FT0A 3WIIH 3GSXA 3RTQD 5FA3A 4Q97A 3HAEB 3KPRA 1OTSC 1EXGA 1A7NH 1JDCA 3DVFA 3HNTL 1BEYL 1E8XA 5FO2A 5J6GA 1S7SA 4EMZA 3WTVA 5FO7B 3UO1H 2YBGA 3T4YA 2JIXB 2F1BA 2ICEA 5D7EA 4MYPA 1ZKAA 1Q1JH 4XCFL 1GA2A 4M56A 3MUGB 1AHMA 1ZS8B 2HN7A 3NCBB 4E9RA 4OCYL 1XB8A 5I74C 2AEQH 3HAEA 3PXHA 2ZP9A 3QDMB 4J3OF 3FTWA 1MUJB 1YECL 4HJJH 5T8IA 3MRBB 1U93B 1UWEL 1H3PH 3OZKA 4NCC2 2JIXA 1RSYA 4MDIB 1IBFA 5TE4H 1U6AH 4JFWA 1NBZB 2XZQL 1ZS8A 3RKPA 4G6ML 1W72B 2BSCA 3BT0A 3WIAA 1MUJA 3UMNA 3OKLB 3MRBA 1SY6L 1FFTB 3WY4A 1PD1A 2JELH 4MDIA 4KHTL 3MGAA 2ZTBA 3UJJH 3RGVB 1KIRB 1BFSA 3JV6B 1NBZA 2EC9T 4JRXD 1DVXA 4I0CC 2IANE 4XN1A 4JHBA 5C0AE 5MEPB 3IE9A 1SEQL 2O5YL 1SJMA 1MFUA 2OR9H 3RGVA 3RZCC 1KIRA 4H40A 3JV6A 4WHCA 4ACPA 4L1HA 1EGJL 2P8LB 5EZIH 4GP8B 4JQIL 1F2QA 2PCPB 3QQ9C 4AV5A 2W95A 3GXNA 1J05B 4Y5VC 1SOKA 4DUWA 5CEYB 4YSEA 3O9WC 2ZCLL 5DUPH 4L05A 2P8LA 5L7XH 1MOEA 3P4LA 1I85A 1L4IA 1NAMB 2NQ3A 4Y88A 2PCPA 2X2JA 1UCBH 4QTIH 5SX4H 1CLCA 4U3SB 1KCBA 3UBHA 4O9HH 3IMVA 5D7SL 4HK3J 1WP6A 4R6AA 3NQIA 3BQUD 2YA1A 1A6UH 3Q8FA 4LARH 2QHRL 2VDPB 4CA4A 1CBVL 1NAMA 5HI4D 1ZVYA 3MKGA 4EZKA 3QDGE 4MZ2A 3ARED 3RX9A 2EDKA 3AQYA 4DIXA 5HYQB 1DSWA 2WYHA 2PTTB 2ZXGA 4QXTB 5EEYA 5A7BA 2BVYA 3DIFB 4PJ7A 5C97A 2BP0B 3U1SL 3GHBL 3T77B 3GXTA 2AGJL 2K78A 4WY7H 4NWUL 3IFLL 1ZWIB 3MLRL 5GS0L 5EUOE 3I85A 2VUYA 3QWRD 3W3KA 1WFOA 3HLAB 2EDTA 3LIZH 1D9KD 4WO0A 2PTTA 1WZKA 4U05A 4DOHB 3T3MF 2QQLL 3HE6C 3MLVL 2BP0A 1IVLA 1ET8A 2ICWJ 4ODVH 3T77A 3N6YA 5ALBL 2ZQKA 4IGBC 1ZWIA 3MLSH 4AMXA 2HCZX 3HUJF 1QQDA 3FL7A 1OW0C 3DOSB 4H25A 3HLAA 4K3JH 1KIUA 2J1KA 5GISH 2EDMA 3HG1B 1OF2B 3E8UL 1D5XB 3RJOA 5E5LA 4M8QB 5TF1L 5BXFA 2WLKA 5MI0C 2FJFB 2CJUH 4OFIA 4R5TA 2ELLA 1HE8A 4PRAB 5F96H 1PYWB 2GHWB 1N10A 2LFEA 2QGDA 1ASOA 3B3IB 3DOSA 5E24E 5I76B 4RDQG 5GGVL 5EU3A 3RY6A 4XO3A 3UEQA 3HG1A 1MG2C 1OF2A 2JJWA 1D5XA 1U30A 4U4BA 5T1LD 3X2QB 4M8QA 1P8VA 4U1GB 3EYQC 1GXEA 2B5IB 2XUWA 1N64L 2Z1KA 3CPLA 4PRAA 4NAJA 1PYWA 2BC4A 4Q2ZA 4QRSB 2XZQH 1JHKH 4OU3A 4V33A 3HMXA 4Z77A 2ATKB 5I76A 2CZNA 5CP7B 1ZHLB 1CICA 3NAAH 4KVNH 4P2RD 5KSVB 4HGKC 4GG6F 7FABL 1OKEA 5IHUH 3L9EA 3VXRD 1ACYH 2JXMB 1KN2L 4KHTH 4LOFA 4JRWA 4MB3A 4QRSA 1FLRL 3PPEA 4PJ9B 3RX7A 6TAAA 2ATKA 2BK8A 1FQVA 5I6LA 1ZHLA 2WN3A 4QY8B 1F18A 3FT2B 4X5QA 5E6IB 4WNJA 3HEIB 5IHBA 3O4LE 4NUGL 1G0XA 2JXMA 1WVZA 4U1KB 1ZPLA 3G6DL 4HF5H 1NCNA 1JZ5A 4OJYA 1G7MA 3LNFA 2VN4A 4PJ9A 3NYKA 3QEUA 3SDYL 4C56B 1XCWA 5E94B 4QY8A 1F97A 3FT2A 5E6IA 4LSSH 1S5IL 2JCCF 1EIBA 4V1DB 4U1KA 1H6FA 2FX7H 2GJRA 2ZCLH 5C7ZA 3WJLC 3DVIA 1O6SB 1N0XL 2FTAA 4F5CA 3WD5H 4C56A 2HFFB 4GOSA 4J8RB 4LNRB 1M9LA 3TZVB 1KLFB 3CHSA 1MFEL 1RK0B 3W56A 3BAEL 5EZJB 1YMMB 4P4RB 3VXUE 3BRDA 4XE0A 1JNLL 2EDBA 4TXVB 1CD9B 4RLDA 1O6SA 2NY5L 3D85D 4MNQB 1GOGA 2ZWZA 1LO0L 2HFFA 4J8RA 1ED3B 3NABL 4JFEE 2DLFL 4LNRA 4XAKE 5ENWB 1KLFA 3TZVA 1MLBB 4P2OB 5DS8B 5FGBA 1RK0A 4HPYH 4JM2B 4L5FE 1YMMA 4P4RA 4ZUWB 4ZNEA 1UB6B 3GBLA 3BVWA 2DL2A 2R23B 3VA2C 4PJEB 4D9RE 1ED3A 1PD6A 1TYJA 2VXQA 1MLBA 1WYJA 2D4DA 1YEJL 5DS8A 5LG1A 4JM2A 5IJVB 4AM0Q 1UB6A 3TF4A 4ZRGA 1A14L 5D8JH 1KTRL 5ESAB 3MLVH 2R23A 3B83A 1GRWA 4PJEA 2GI0A 2OA9A 2E59A 3L7EA 2RHEA 4LMQE 5IJVA 5IUSA 3S9DB 2BW4A 4GO6B 1KGCE 4XBPA 1MKFA 1TDQA 2WP3T 4EN2A 5ESAA 1YPZF 2IIJA 1UZGA 2IBZX 3WFDH 4FFVC 4KUZL 5TF1H 4CU6A 5HHMD 3JWNC 2IADB 3L1OH 5E99H 3L2LA 2X87A 3T3ME 2EAEA 4Z7WB 1A3LH 4IIQB 4HXAL 5GGVH 1NEUA 1QBLL 1XF4B 2GBVA 5F21B 4WEBH 2AKRB 1QX1A 5I6XC 4ZZKA 3UYRL 5J13B 3HUJE 1KCKA 2AK1H 2G5BB 3QJHB 3SO3B 4PY7A 2NNAB 2IADA 4R83A 4Z7WA 4U3HA 4GW5B 3ULVE 1XF4A 1DQIA 2AKRA 2R2HB 4OKDA 3RY4A 2XG5B 2J43A 3FMGL 3R0MA 3QJHA 4YHYB 1JI1A 1CFSB 4GXVH 3B3BA 2NNAA 2P1MB 1PZCA 1UH4A 2HRGA 5IMOA 2MWCA 4R7LA 4TOYL 2BM3A 4KTDL 3VRJB 4NNXB 5EU6D 1P7QD 5GRJL 1CFSA 1CZ8L 3C2AH 3BZFB 3BWZA 1YEWA 1I1CA 4GG6E 4YZFF 3JWOH 1ZA3A 3QULB 4WI0B 3E80A 5F7YC 2VLME 4PJXF 3VRJA 3NFSL 4NNXA 4IRJC 4PKIG 3V4VH 1F4YL 5BNXD 1OOAA 4TULL 2O6PA 1ZHBB 3BZFA 1N0XH 3AJ7A 3RNKB 5EB9A 5KBMA 3CH8A 4DJMA 5G55A 4KKNA 3QULA 3FTSA 1ML0A 4K5PA 3FU6A 1F4WL 2PCFB 5L0QC 3I2CH 4JKWA 5B38A 4AZ8B 3EOBA 5DQDH 3ZKMD 3LYRA 1WWWX 2B1HH 1AGCB 5TE7L 1JNLH 3U82B 5B7MA 2YD7A 4I3RH 5IREA 3RNKA 1WK0A 3BP4B 1LQBC 1ZVSA 2JCCE 3BE1H 3BGFB 3GHEL 1YSOA 4NP4L 5L2KD 1A1OB 1TEYA 3BD5A 5F8RC 4H26B 3VFOB 1BF2A 3EOAB 4AZ8A 1AGCA 5FYLH 3BP4A 3JT0A 3JZ7A 2VZSA 3BLBA 3BGAA 3HIZA 3W82A 1WTGT 4WTZA 4KMLB 5HGBB 3RJQB 3FQTB 4LCWA 1T5XB 1JZHA 4Q0XL 1I1YB 1X9RA 3VFOA 1ERNA 4H26A 3EOAA 5HYJD 1A14H 2P4AB 3S3SA 2OMXB 3I02B 2GC4C 1PMYA 4FGMA 5D3IA 1X4YA 4MZRA 3ZR5A 3FQTA 1RIUL 2MOVA 3FTVA 1IO4C 3GJFH 5GS2D 1FPTH 3QWOB 2MHAB 2EE2A 1OD7A 4P5TD 2OMXA 3E3QC 3I02A 1ESOA 4TPRL 1XBRA 5J7CC 1LVEA 1VA9A 4ZNCD 1KBBA 3NRQA 1MCKA 3VTMA 3BPNC 2CCLA 2MHAA 5FECB 2Y69B 4FCAA 4WQOA 5KVEE 1AGDB 3L6FB 4NSKB 1OTTC 2FWSA 1ZGLA 2PO6B 2E8YA 3I50L 3PAUA 5B1JA 1LDPL 1GJUA 4TSAH 1XF5B 1ET7A 3EBHA 4XOAA 3VQMA 4BSJA 1UZ6E 3QJXA 4B41A 2EO1A 1VJSA 5FECA 1JV2B 1YPZE 4H8PA 4L23A 3QPKA 5AOKA 1AGDA 1SQ2N 3AWEA 3IDYC 3L6FA 3VU1A 4NSKA 5C70A 1K5GC 1GS7A 4P91A 2X4PB 4JHWL 1BJMA 4O00A 5HDWA 1XF5A 3NA9H 1Z1WA 5GS1C 5IFJB 2ED8A 3TFBA 1Y6KR 1JV2A 5INCB 1BD2E 3IETA 2JB5H 1RJCA 1PKQE 4PJAF 2J88H 1MWAB 4HCIA 3T6XA 4EJ1C 5KSAB 4OF6A 5DWPA 3VFSB 2X4PA 4KJYA 2YPVL 4OSUL 5DR5H 5JIHA 4BFNA 5IFJA 3CGTA 1BVLA 3Q48A 3VQ1A 4HKBA 2HLAB 1F0LA 2DW5A 4OT1L 1F3DJ 5T3ZL 1H3UA 3X3GL 1MWAA 1X44A 4P3CH 4X0NA 5KSAA 3MAWA 2R0KL 3VFSA 5CILL 2NR6D 2OL3B 3O53A 1GY1A 2OMZB 4IBYA 2L7EA 4UDTB 4GAFB 1UKQA 1PKOA 4AEIH 3MCKA 7PCYA 1XD0A 1IC7H 2F5AL 3CN3A 3WFHB 5T5FH 1JVOA 3CDCA 1OAXL 3QG6A 3WDIA 1P4BH 4ZS7L 4KMTH 5D1QB 2OL3A 5B1KA 4FG6D 4YZFE 2OMZA 1U3ZA 2LT9A 1LEGB 1A7PL 4NRZB 5LNEA 4PJXE 3WYRA 2WIIB 3EXJA 4X4KA 5D5MF 3WFHA 5B8CA 3WKPA 1XL4A 2VC2L 3B9KB 3T0DA 5D1QA 1KXHA 1QLFA 4A2GA 3LHAA 4Y1TA 1LEGA 2NX5E 4E0RB 1S46A 2WIIA 5ERWB 3SDXB 1PF3A 1HWGB 1YAIA 3D18B 3QXAB 3U4AA 3EJJX 3S2AA 3ULUC 3B9KA 4G5AA 5D71H 2YR3A 4AIOA 4X7TB 4AE0A 4KROC 3IRZA 3SD2A 1P9MC 4JFXB 3TL5A 4E0RA 2XVBA 4IRZH 3CIYA 3UZEC 5ERWA 5BS0D 4IHBA 5L2JB 2COVD 1CFMA 1KXVA 3RWIB 3D18A 3QXAA 4XAWL 2WWKT 3HTLX 4G8EB 1S9YA 4JLRB 4J5VA 2KLTA 4LVHC 3F7LA 4JFXA 3BJ91 3R8QA 1HQRA 3WS3B 3S5YA 4TNWK 2RCSL 2KZ1B 4PV9B 4JLRA 2GJZA 3V5HB 5JXEC 4RGNB 4Y9BA 1TCRB 5IT2H 5KVDH 2MOGA 4QPEA 1PZSA 2PP9A 5F1IA 4G1MB 1IC4L 1EPFA 1LDPH 1W2KT 2ODHA 3EO9H 3WS3A 5IQ9B 3QCTL 4N0YL 5K39A 4XO9A 2EIEA 3AG3B 5ILTH 1EJ8A 1JPTH 2XWTB 2P45B 1KENH 3V5HA 2NY3B 4DKEL 5DD6B 1NBQA 3QUYB 4G6FD 1TCRA 3GOZA 4I2XB 2Y1VA 1O7VA 2ZSWB 3PGCB 3NIGB 5DD3L 1I1FB 5B1BB 5IQ9A 4UQAA 1QPPA 5IVXE 1DVTA 4F8QA 1Q0EA 3FTUA 4OCSH 4YHLL 3CIGA 4E68A 2XWTA 4HEPG 5DD6A 3QUYA 3MV9D 4I2XA 2I5YL 4Z0XA 4M5SA 3PGCA 1I1FA 3EOYG 4H1LG 2QL1A 3KHOA 3IS1X 2VDQL 1KIQB 5ABAA 1VHPA 4ONGL 3VX1A 5IESL 1ZSDB 3J8F7 5KANI 2AJXL 4YHPB 3X3GH 3WDHA 1PZBA 4QI3A 1AANA 3K74B 4I0PD 4H8HA 4WENB 1WH0A 1P69B 1MCJA 3KLDA 4L1DA 1CTMA 2EUVA 1KIQA 4PJAE 2ZOLB 5IHZB 1ZSDA 1DBJL 2K9FB 4HKXA 4FFTA 2NXYD 3CDZA 3FQRB 3PWVA 4KTEL 4LHJB 1BPLB 4HJEA 4HETA 4L1BA 1R24B 2XTJB 4TF4A 1MY5A 3ARGC 3H2QA 5L8KB 4QIRA 4H0IA 4DSYA 3UPRB 1JGIA 4E9LA 1I7RB 3V8CA 1MJ8H 3FQRA 4BH8A 1K2DB 2XRAH 2G3NA 4PCTA 2F8XC 2N7SA 3A24A 1AQDB 4XMPL 5FM4A 2XVGA 3TOPA 3BN9C 5C6TL 2N56A 3OKDB 3BWUF 3FULA 3U9WA 1QTYT 5DK2B 3UPRA 1UURA 1DQLL 2P1QB 2ESVB 1BFVH 3LN5B 3EGXB 4RFOH 2N0KA 1HAUA 4MD5B 5CEZD 3ZHFA 4W9CC 4JZNB 3ZKND 1AQDA 4HG4J 3TH2T 1IV8A 1WAAA 5DYOB 3OKDA 3U7YL 4Y5XC 1N5YH 2ESVA 3LN5A 2Z93B 3EGXA 2B9AA 3UDWC 2FJGB 1MI5D 3FPYA 3GIVB 5I1GH 1T66D 1PG7X 2HH0L 5EOQH 4BFFA 4PJ5B 1BZ9B 5AB0A 7CGTA 3V9EA 4HX1B 5DYOA 1VCAA 5DLMH 3ZL2A 5T1DH 4TSCH 3MGOA 4KV5F 2Z93A 1EHLH 3OAWA 2FJGA 2RCSH 2GABA 4LHUD 4I18B 3ZKXB 4U1SB 1TOXA 4HEMA 3IDNA 4PJ5A 1BZ9A 2HT2C 3CSTA 1MF2L 4MYWB 4HX1A 4JM0A 3WS6C 2R7EA 5C0RL 3LKNB 4DGYH 1KFGA 3NZHL 3QDJA 3QCTH 1TQCB 1DUYB 2HVKB 1NCWH 3KLKA 4JKPL 4I18A 5HHOB 4U1SA 1BQHB 4P48A 4LOUC 5DO8A 4MJID 1HWHB 2ALAA 5TFSH 3T0EB 5L6YH 4PG9B 5AFAA 3LKNA 2CLRA 2C4FT 4WUUA 1DUYA 3V5DA 2HVKA 2DI7A 3F84A 4XCEB 5HHOA 1BQUA 1BQHA 3FQ2A 3MRJB 4AGOA 3TESA 2MPVA 4LSCA 1T1YB 4H8WH 1G7HB 1O9ZA 2D2OA 4KNQA 1TNNA 1G9MC 3D3VD 3ESMA 5D55A 5FHBH 4KX7A 3T0EA 4PG9A 4J7RA 3G3LA 4LSUH 2LU4A 4XX1G 3DPBB 5IJDC 3MRJA 1MHPL 1J5CA 1T1YA 1G7HA 3AC0A 4JJOA 2AJXH 4ADJA 3DYMA 1LO2H 1DQMH 1CDGA 1ORSB 2NCEA 4CGUB 1EHNA 1QNZH 4BHUA 3QVAA 5ABZA 4JCWA 2H3KA 4H13C 4Z7UB 4DP1X 4P07A 4MAYD 5DT1H 1M4KA 3DPBA 2EUWA 1XGPB 4GEJA 2PWHA 3D4YA 1DBJH 3R1GH 5C6PB 2ENPA 3Q8EA 2FNBA 4FG0A 1ORSA 1WBXB 4EDWL 4FTVB 2FDBP 1SY6A 2Z3FA 1RZPA 4IRSB 3BIBX 3I9GL 4Z7UA 5CGBA 3JSSA 4HH8A 1XGPA 2VDLH 4NFDA 2XPYA 5AW8B 4Z18A 5JHLL 1RI8A 2XZCL 4JFFE 4QKXB 2HMIC 4KRPD 2FGZA 4FTVA 1I3GL 1OTMA 1FSKB 1J7VR 3P2BA 1QFHA 1D6VL 3VWKD 1QHOA 4WEUD 5C6TH 1EGJA 2EVJA 3NIFB 1E5YA 3NJXA 1OQXA 4HC1L 3PDGA 4E9XA 3VX0A 3T08A 3TSRE 3EBGA 3Q2LA 1V7MH 4KY1L 2DD8H 4FQHB 1YYLL 1NGQL 5CWSB 3K81A 1U8MB 3DHUA 1F13A 2P48B 1GMIA 2WINA 4GBXA 4M5YL 2XWBB 3ZHNA 1L9QA 1OE1A 3SCMB 4LPXA 1TJIL 4FQHA 1R0AL 5CWSA 3LKQA 5HPOA 1QRNE 1U8MA 4UFRA 2R2EB 2OMBA 4HIIA 2APXA 1W72H 2FHFA 4IOFC 4OQTA 2W92A 3MBEC 2K7QA 5I74B 5C0CB 2GYSA 2XWBA 3VGGA 1CE1L 3SCMA 1JYXA 3ETTA 4BGLA 3A67L 5JQIB 2G0KA 2YFNA 25C8H 1E6OH 1XGZA 2A5UA 2R2EA 1CI5A 3QI9C 5JW3L 1JFHA 4LRNH 5C0CA 2WWKO 5DZLA 1J8SA 2G4GA 1D5IH 4JKPH 3HA0A 3NH7L 2I07A 3MPCA 1MQ8A 2I7OA 4PHZA 3POCA 3FUIA 4YR6A 4PJHA 3BX7C 2X6UA 1THCA 4KV5E 4ZMTA 1JJUA 4MA7H 5I1DA 5IFHH 3QJZA 4PJ8A 3H3PL 4WJKB 1R1CA 2H6PB 3ZU8A 3IMBA 3BFQG 5D1ZC 5GS3A 4Z78B 4JFDE 1N4XL 3T3PF 2FB4L 3RZCB 3H7LA 5C7XL 1NAMH 1UA6H 4YDZA 3B9AA 3PV6B 4KOBA 5AWDA 3BIKB 2X1XR 3CVBA 1JXFA 4S1RL 4UILH 3QFJA 4OB5L 1RV6X 3QH3B 3O6KL 1KF9B 2FO1A 4Z7OE 4NJ9L 2VDPH 3O9WB 4B97A 2DM2A 3CIAA 3BIAX 1DN2A 5HSFA 1Y6MR 1YCSA 5AOIA 3PV6A 2NY0D 4BFIB 3BIKA 2M26A 1ETJA 1LTXA 1WC7B 3PYCA 4OZIF 4S1QH 3VVVA 3QH3A 3L8QA 2EDOA 2YLKA 1MELA 2IH3B 1JYVA 2MOQA 3REVB 1M57B 1EVUA 3O9WA 4Y16C 4MHHG 1FDLH 3DETD 4HMDA 3RWJB 1T4WA 4NZTL 4J6RH 4F20A 4BFIA 4KKRA 4TNVF 3WE6B 1AZNA 1WC7A 2SEBB 4PH8A 4YWGH 3GLEA 3GT6A 5F0MB 2NLJB 4DK6A 2H0JA 3GBMH 3IFPB 5CMAB 3NIDF 3RTLA 3WEBA 3Q6GL 2CKBL 1DL7H 1NAKH 3LSOB 3QUML 3M7FB 4JY4B 3RWJA 3DO7B 1EHXA 5DJXB 2A74C 1G9NH 2E75C 1R17A 4LPVA 2QADC 3U7WL 5D4IA 1JMZA 5KS9B 1EFQA 2SEBA 3O2WH 4MQWX 1DQDH 3MNWB 3N41B 4NBXB 4OGXL 3V0AC 2O6DA 1AO7E 2NLJA 4WCYL 4ZAKD 1EWHA 3UBXG 5CMAA 4HC1H 4NQDE 3U46A 2Z64A 1S78D 3CSFA 1FFRA 3LSOA 4JY4A 2BNQE 4WTWA 3DO7A 2HWZH 1I8IB 1NGQH 2J5LC 2WM0A 1A8JH 4IGBB 5KS9A 3V79C 3KL3A 1TLMA 1EH9A 5BVPL 3MNWA 4UT6A 2O1AA 3FYEB 5HZLB 1EDYA 3U79A 5IQOA 5GRWA 3RB7A 1DBMH 4OIIL 4EVNB 1WDAA 2PLTA 5ALCL 5ISZE 2XYCA 3LXCA 1I8IA 4ABWA 1GC1L 5MI0B 3HHRB 2R83A 4BCZA 4OGAD 2B4CL 4Y9CA 4WI4A 1MH5A 2BP8B 5BZWB 3P2TA 5JOEA 4MNGE 1LXMA 4LF3B 1Z6JT 4EVNA 2VLKB 2Y7MA 1LYQA 1I8UA 3MI6A 5IVZB 1N7ML 4G7YH 3ILDA 5E6RB 1DSFH 3NJMA 2X1OA 2EECA 4U6TA 1J0HA 3V95A 3RFRA 2EXWD 1MVUB 1X5MA 4FQCL 5BZWA 3S7GA 4YXLH 4B9ZA 5D7JC 4LF3A 1P5VB 2VLKA 3G39A 1SBBA 3HLKA 2VT0A 4LXFA 4M62L 2JCWA 5DEFB 2YD2A 2ED7A 2JE1A 3VO0A 1MVUA 4N9OB 4P59H 5IKCB 1MCHA 4Y1AD 3AGVA 1MFNA 1P5VA 2EIDA 1JXKA 3FSOA 1CTOA 5HDQL 2K9UA 4HIQA 4B3VA 1LHZA 2L7JA 4WO4C 3IAQA 4K8RH 2Q76B 1N4XH 2YQ2A 3G6JB 4WF7A 2OFQA 5IKCA 2DTMH 5LFNA 1INEH 3NPSC 4OD3H 5DJCB 4F8LA 4A6YB 4LPYA 1K5NB 5DURB 2X44D 2ZKMX 2A38A 3JZYA 2Q76A 4NJ9H 3U0TB 3CCHB 4XC1H 4HKJB 2M1KA 4O58L 4KI5D 4P9HC 2EIBA 2QSVA 3BPCB 1INDL 4JFQB 3HS9A 3QO0B 3CXFA 3MLPA 4MS8C 5DJCA 3T3PE 4NPKA 4A6YA 4YX2L 3RDJA 1K5NA 2BOBB 4Y89A 4G82A 5KW9L 1A6AA 3OLDA 3WJLA 1FI8C 4E41D 4HKJA 3HPJB 4K71C 1ZE3C 2BOCB 1YRGA 1PIFA 3AG1B 3CZUB 4EKJA 4JFQA 2NDGA 4X7EC 1FAIL 5I1HH 1BGXL 2R0ZL 2AFNA 5LB1A 3KYAA 5IB5B 2HT3C 3VI3F 2X9ZA 2CKBH 3NMEA 3HPJA 3KPOB 2BOCA 1KN4H 1MFDL 4PJDB 2JE8A 3DURA 4I3SL 3ZL4H 4OZIE 4LQ1A 5AW9B 3IDIB 4JY5L 1S9XB 1FO0B 4YE4H 4F2ME 8FABB 2NXZC 4HUCA 4UDUB 3ORJA 5IB5A 3U30C 3KLAB 35C8L 3X1BA 5KSBF 4PJDA 5E5RB 3ALPA 3IDIA 4XNDA 1YNKL 4KUCF 2WSDA 1OGAB 1FO0A 1JWSB 8FABA 3NIDE 5GSRB 4CC1A 4UDUA 5D1XE 3MOBH 4TNGA 1F45A 3BMVA 5EWIL 4MA8H 2Y2WA 3BAYA 3WG7B 2P1NB 5TTRA 4HXBL 1W0WB 4L3EB 1OGAA 4GAJL 1JWSA 1CVRA 2CPUA 5A7EA 4YO0A 2GQHA 2VLRB 4PP1C 1XBDA 2PPEA 4B9GA 1MWOA 3FNKA 1B4RA 5FYKH 5I1LB 5I6XB 2UWEB 5EZPA 5CZRA 3UABA 4ERSL 3ZT5A 5FA4B 2MQ3A 5IG7B 4L3EA 2KERA 4HYTB 2XKNB 4NUPA 1XF3B 3MLZL 2WO2B 4K3DL 1A02N 2VLRA 2OMYB 3A6CH 3TJEH 3TPUB 2DYRB 4UQ2B 2XHNA 3RTQC 5I1LA 1RHFA 4UU9B 5CJOL 2UWEA 5BRPA 2JH2A 3VD7A 2VN5A 2VSKB 1NCGA 5FA4A 4N8VB 1Q0XL 4R90L 2YWZA 4FQIL 4L3AA 5FCUH 1B4TA 1XF3A 2QPEB 5DZNA 2BHYA 1RULL 4U06A 2PCYA 3LS4H 2OMYA 3TPUA 4UQ2A 5HDQH 2DKUA 4YHMH 4R08A 4EIGB 4N8VA 3CVRA 4UQIM 3GKWH 1DANU 2JV6A 4TUKH 5CM1A 4GH7B 2KPNA 4OI7A 5B39B 5CS7A 5E6UB 1UKTA 2D7MA 3LAFA 4RETB 2X4SA 4FNRA 3PUCA 4ODHL 5D7KE 4PYHA 4IRJB 4HBQA 1BXXA 4ZODA 2JJTC 5D2NE 2WZPA 4AY9X 1IGCH 2GJJA 4N2GA 1UZ8B 3AT0A 5IEHA 2YD9A 2VDRL 3CSYA 1H15B 4YDJA 5KVFE 5B39A 5DD1H 1JF1B 4HOWA 1ZEAL 5GZNC 5L0QB 2ICWB 4IRJA 5IFAH 5GJTL 1A7QH 2AEIT 1QASA 3PAZA 3N9GH 1UZ8A 2A2QT 4OIAA 1H15A 2FATH 1G1OA 1JF1A 1YEEL 1G0YR 5FYJE 5DHYB 2MPAH 4N2NA 4M3KB 2O72A 4Q9CA 1H9DA 3LEXB 3DIVA 4V11A 4MSWB 4MNHB 4N8UA 3UG5A 3T0BA 4S1SL 1MFDH 1Q0YH 3RI5F 4ZMXA 3MRFB 4WUKL 3SOBL 2WQRA 2ZXQA 1OHQA 2QQNH 3B2PA 1R3LB 2CUIA 4U49A 3S96A 2WB7A 3LEXA 1SOXA 4TS6A 3D4ZA 1RVFL 2YWYA 4MSWA 3M46A 4MNHA 4DN4H 4LSVH 1AOHA 2W94A 2WZ5A 3W9DB 4BWTA 3DV6B 3LMJL 3MRFA 3AM8C 5C07E 3S37L 5EIVA 2J6EH 1DCEA 5GSVB 3TT1H 2VW4A 1C8QA 2ZYHA 2TSAA 3VI3E 1WZ1H 1R3LA 1AMYA 1WA2X 3EF7A 3Q5OA 1QTSA 3FUKA 5CJBA 1JSYA 2E3VA 1ZT4B 3AREC 5E1AB 3W9DA 5DQJA 1MXDA 3SJVB 3DV6A 4WI3A 2AXJA 2B77A 4LHUG 1BOGB 1N18A 2C7UB 2FEDD 3BPNB 5KSBE 2DB8A 2XU9A 2UZXB 4FX5A 4ZFFB 4GIAA 4HIJB 3IGLA 1ZT4A 4HS6A 1F42A 3KS0J 5E1AA 3SJVA 2Z65C 5AZ2L 3MXVL 3VFTB 3E1F1 3ZKQD 4H20L 3TO4A 3PHQB 5H37G 1BOGA 1JPEA 2C7UA 4PCYA 5MENB 3MLZH 4CSZA 1MWAH 1XCQB 2UZXA 4ZFFA 4N2EA 1FBIL 1MIEL 1U3HD 3IDYB 2GK0A 4NKOA 3OF6D 3QQ3B 1OALA 5C0FA 4TSBL 4QCIB 1KGXA 3VFTA 2OXGB 1Q0XH 4R90H 1TVHB 5GS1B 4X7DC 1KELH 5MENA 3QXDB 1UD3A 1XCQA 2A6IB 3RJ0A 1UD4A 5SWSD 2OL3H 1U95B 5CIPB 3QQ3A 5ABDE 5C6WH 1JCKA 4RZCA 4QCIA 2D7QA 4ZW5A 4DP5X 3N85H 2OXGA 3CE1A 1RZFH 1TVHA 4NZRM 2VLJD 5GS1A 3PDOB 2ZYSA 3QXDA 3W37A 3WJJC 4BRJA 4YHKL 4ZTPL 2VUKA 1PAZA 2ZKHH 2Y07H 1MFCL 1TKWB 3VXQA 1U95A 2ZXCA 5CIPA 4OCLC 1UXLA 4KO5A 4OLVH 4GQ9L 2NY7L 3TV3H 4JPWL 5ANME 4FD0A 4KK9C 2X6VA 4K9EL 1WD9A 4KTGA 1UKSA 1TKWA 5H8DA 4CBPA 4PERA 3FZUD 1HSBB 1IEHA 1WAPA 4FEMA 4GP4B 4W9HC 5GJTH 4NOFA 4GEIA 1I1AA 1FN4B 2YGQA 2YGPA 3N91A 4NRYB 4PWEA 3IDMA 4HSCX 3A4FA 5TJWK 1J48A 3BCDA 4ANXA 1X5IA 5CSZA 4I0KA 2VDNL 4WEMB 1FP5A 3O6NA 1HSBA 3BH4A 4AMKL 4ODUA 1FG9C 1MPAL 3W39B 5GGQL 1HDMB 2YUVA 1FN4A 4KDWA 4S1SH 4YLQT 3H0TB 1NLBL 4LP5A 4Y4FD 2AJZA 5AZ5A 1GWBA 1X9QA 3U2SB 4KO9A 3GXUB 1S7QB 3LRGA 3O3EB 3TC9A 4BKTC 2KL6A 2ENSA 2CJ3A 4C83B 1JHLH 3W39A 4AC2A 3BAXA 4ZTOH 4BUGA 2KMWA 4MQXD 1X5ZA 2I25N 3NCCB 3JV4A 2KDYA 12E8L 3U2SA 2YD5A 1S7QA 3IPFA 5C8JB 3O3EA 5FM8A 4G6KL 3BUYB 3DYOA 2FYYB 4RVBA 5CFAA 1RIVH 2DWEB 2KZKA 4HQQL 4LVHB 2XWRA 3A22A 4YSCA 1P9MA 3KJ6H 1VFAB 3UZEA 5LAXB 1SHMA 1JZ3A 1BM3H 4UQDA 1TETH 5C8JA 2FZ3B 4NQXB 3HCVB 3BUYA 1CU4L 1AZRA 2FYYA 3W0WB 2DWEA 4EAEA 3W38A 3ZDYE 2UY7B 3GSNL 3B43A 1HU8A 1G7QA 4CL7A 5LAXA 3ZYJA 5ADPL 4H20H 1RY7B 4NO5B 5AQ0A 1UH2A 3US9A 1LGVA 1TQBB 2FZ3A 3OLEA 4NQXA 4X4XB 3HCVA 3ZO0A 3E4GA 1IAIM 4IOSA 1BJ1H 1H9VA 3RG1C 3W0WA 1MIEH 2PWDA 4DERA 5HYIA 1FVEB 5JXEA 2EDHA 4XT1C 2GI7A 3QQXA 3R8BB 2UY7A 1BZDA 4JFOB 1JF6A 4FFZA 1LK3H 4NO5A 3DXAE 3UADA 4ALAH 4X4XA 2JKTM 3F8UB 4HZAA 3S36X 4N22A 5E6ZA 4ELMF 5MP6L 2GAZB 2I26N 1MW0A 2GSIB 2V5TA 1XGQB 5LQBH 3N2JA 2YPLD 4JFOA 4S1DD 3MRDB 4X8CA 1TTRA 4ECNA 5EEXA 1HI6A 3ML9A 2B1OA 2VJ8A 3EYUH 3PWJB 5CINH 3RFJA 3P73B 3T2NH 3APFA 3GRGA 1QLRB 1QKZL 4YHKH 2GAZA 1DR9A 2F54B 4X7FC 3V5KB 2GSIA 1MFCH 3CZEA 2DTSA 3FT9A 2G60H 3H9SE 1MJUH 4KK8D 3MRDA 3NCFB 1Z32X 3PWJA 2Q7NA 5FGRA 3GDBA 2NY7H 3P73A 1E8ZA 2DI8A 1BG9A 3LS5H 3U6XS 1QLRA 2AK4E 4N0CD 2FECI 2F54A 3ATAA 3UCQA 3V5KA 1GYCA 2J72A 4G2AA 1TZAA 3JV0A 5IJKA 4LASH 3BXNB 2FIRT 3OAUH 4TVPL 4PBVC 1IJNA 4PCKA 3ARGB 3QBTB 4L37B 5GGTA 3BKMH 4QAWA 3HI6H 3X12B 2NNFA 3HBQA 1E42A 1HKFA 3L3HB 3BXNA 4GAGL 5GGQH 4EI5C 3B9EA 1Z2KA 2BVEA 3ARGA 3WMSA 2A4CA 2B8OT 3ALWA 4L37A 3FQXB 1A6WH 1C5DB 3C6NB 1NPUA 3IN0A 5E5UB 4WFHE 2CA6A 3L3HA 5ITBL 4FLQA 2V9SA 5I1CH 4PBDA 4W9LC 1U8JA 1A4KB 1AS6A 3ULVC 3IBOA 5BQDA 3FBQA 3S8GB 5EORH 4JW3A 4XNQB 3ZKMC 3UPCA 2HG5B 5EFIB 1C5DA 4P2RE 2BSDA 4Y5XB 1XKUA 4G6KH 4HJUA 3EHBB 1FNEB 2V5SA 2AQSA 2A9BA 1RZ8B 3NZSA 3T1FB 2DZEA 1A4KA 3W1ZA 5A2BA 4FABL 1U0QA 4XNQA 5DTFB 2HG5A 5EFIA 2CRZA 4UTBA 5BV7B 4NGHL 4Y5XA 4AYFB 2FO8A 4YSOA 4YDNA 1VACB 3Q8BA 4FOMA 1CU4H 1RZ8A 5JHLA 4OM0H 4O4YH 3T1FA 2RTTA 4L5FL 1ZHNB 3WO4C 4B53A 2IAMD 3ATDA 3F2LA 3AROA 3DX1A 5DTFA 5JO5A 2XWJB 3DHPA 3LD8C 2WCSA 1F2XK 4AYFA 1CFVL 3WN6A 1L9PA 1VACA 2WSPA 3BAWA 3VG0L 2FYVA 4MZIA 1WRFA 3V0DA 2ZPKL 3Q0HA 1J8HB 1GR7A 1ZHNA 4RMSA 1MCWW 3BI9X 3BWAB 3KPRD 3BOVA 2ALWA 2BPBA 3HPLB 4P5TC 5KANG 3FF8A 4M6MH 2XWJA 4WFFE 1YUHB 2IQAB 4I5BB 3SKMB 3SKNB 1RK1B 3T0AA 3QHFH 3MOAL 4RESB 5FO8B 1BJ8A 3UZQB 5L9DL 1IFRA 3QPXL 1J8HA 4J6IA 3BWAA 3HPLA 3I6GB 3SE3A 1YUHA 2JIXD 1M1SA 3SKNA 5J6SA 2VSCA 3PE9A 5ESVB 3TYGH 3RGXA 5FO8A 1B3IA 5A2LH 3UZQA 5I0WA 3ZW3A 4PD4J 3G5ZB 3UIZA 3V2AR 3BSGA 3H85A 2HRPH 3I6GA 4H0HB 3WSQL 2WQXA 4ELME 1L6XA 2KQMA 2ADIB 5ESVA 3ZIYA 5IJDA 1VZGA 5IEKB 2W9EH 3EYSL 1UXSB 4N4YB 3G5ZA 1W8EA 1RCYA 5IHWA 4TVPH 4HCFA 4LSXC 4PRPE 5D7LA 2ZWSA 3RGVD 4HS8H 2YGOA 4FXKC 4GRMA 3PFUA 1CL7H 2OCCB 2XWZA 2Z1PA 3ECWA 4YN3A 1U2HA 3VXTB 3OR6A 3GLDA 2XBTA 2XG4B 1HIMH 2YK1L 4GAGH 1CDIA 1P1VA 1U8IB 2C9AA 2E74C 3QE5A 4OQTH 3QQDB 2NR6C 4P2QE 3PG2A 2YQGA 4JG9A 5IQ7H 2E7DA 4YXHL 4FERA 1PLBA 2J4WL 1I4FB 2F7QA 1AFVL 5TDPB 2YOCA 2DDQL 2XG4A 1A6VH 4FA6A 3LEYL 3W5MA 5IZ7A 1U8IA 3DGDA 4OIFA 5LBSA 1L9SA 5E9DE 4B5ZA 1UEMA 1KIPB 3UTPD 1J9TA 4QAMB 4IBTA 1PX3A 4HD5A 3VYNA 1BAFH 4NKIH 2FR4A 1I4FA 2QTEA 1FIEA 5GHWH 4MDJB 5TDPA 3KPSB 3DDGA 3LXAA 2WJ7A 1E67A 3QUGA 2ORBL 1DCLA 1KIPA 2J8UF 2R9HC 1MCPL 3P9MB 3MBEB 1IEAB 3ZE1B 4MN8B 2IJ0C 4LGRB 3T6WA 2AEPL 5IY5B 2WQWA 4AY0A 1SN0A 4MDJA 3EO1B 4NBZB 1R9FA 1CLZH 3G7TA 3KPSA 4OZGF 2FBJH 5TPWH 4C58B 1ID5I 1WT5C 2XC8A 3FB5A 1NSNL 3F58L 2FT8A 2CH8A 3P9MA 3MBEA 1IEAA 2V0AA 3B4NA 1OWWA 4NO0B 3DO4A 2VH5H 5GRYA 4F57H 3EO1A 2ZAHA 4XN2A 2ZPKH 1GGCL 4CMMA 5D2LB 1A4JB 3ZDZF 2N1KA 1RU9L 1YHPA 3S88H 5I1EH 1QSVA 2ZICA 1MFBL 3B1TA 2OTUA 1XTMA 2LTQB 5D1ZB 2YA0A 5IQLA 5EEWA 5L9DH 1UGKA 2ROYA 4KH9A 3TU6A 1A4JA 2F7RA 3WUWB 3HG1D 4HOMA 1JIBA 2TRHA 1I9JH 3CU1A 2WNGA 1U91A 3PJSA 5ETUA 2XQ0A 1H3VA 2DV6A 5D1ZA 3T8MA 3VFRB 3F12B 1GAFH 1EUTA 2MTAA 4GQRA 4EOWH 3UIYA 4CW1B 1CICD 3WUWA 3ZE2F 3B37A 2ZX8A 1D5BA 3HI1B 3WNLA 4P06A 2G4EA 4ETYA 3KXFB 4PREA 4HP5A 1Y1UA 1VFUA 1CBJA 1KTKE 4LPCA 1FZKB 3F12A 1NCDH 3EYSH 3RGZA 4EN3C 2VL4A 1F4HA 1U41A 4GI8A 4CW1A 4HA1A 4KKAC 3MRHB 3HI1A 4TUJB 4UT6H 4AVJA 2F53E 3KXFA 2IG2H 3EJRA 1FZKA 4LU5H 2X41A 3MYZA 4XN9A 4PJ9D 3RX8A 3RIFF 3Q1SH 4RMQA 5KTEH 4NO2A 4TQEH 1LDSA 1RUML 4JO1L 3MRHA 5E6ID 5KZCB 1JGVL 2X2UA 4L4JA 4TUJA 2CHZA 3ZYZA 4MCYB 4R5VA 5F7HA 2QADB 3GMRB 2CNZA 3EH4B 4TV3A 3Q01A 4I0PC 3CD4A 1CXKA 3LQZB 3KYKL 3L4WA 5FDWA 1J1XH 2WUCL 2C9QA 4C56D 1ZDSA 2J4WH 3DOHA 2RD0A 4FYRA 2Y2YA 3GBNH 1ND0B 3UC2A 5BZXA 3IYLW 3BVNA 1QBMH 1PU0A 4XMXA 3ESVF 3LQZA 5I0YA 5D7IF 3L4UA 4K8RD 2Y25A 2YKLL 3KMDA 1KDIA 3PQYE 3TZVD 3WLWD 3Q5YA 1YZZA 2UZIL 5BRZE 1BXUA 9PCYA 4NPJA 1ND0A 4FNQA 2Q0ZX 5F6HI 1M05B 3FC8A 2GG1A 1DBKH 4HUUB 2VSMB 2FUQA 1RIHH 1C12A 4XVTH 2GBAA 2XDHA 2C3XA 4ZOBA 3DJRA 1A6PA 4JM2D 1IC5H 4G6JH 3CMOH 2UZYB 1NCAL 1M05A 2G75B 1QZNA 1N2RA 1JCVA 4QRFA 4HUUA 3DBXB 4C4KT 3ZKNC 4F3FB 1NGZB 5D7JB 2ZSVB 3SE8L 1QHQA 4LLWB 4AEHL 3C8DA 2UZYA 2X4TB 1EMTL 1GGCH 2WVUA 1QFUL 2G75A 4D3CL 5A2IH 4ZUVB 2EC9U 3B7SA 1X5GA 1SLXA 1T66C 3DBXA 3DX6A 4F3FA 3DX8B 2NDFA 3L9BA 4YBQD 5DHDA 1Y7VA 1NGZA 2EYRB 4A6YH 4XMLH 2ZSVA 3MCG1 4LLWA 4WO4B 4F8NA 2X4TA 1CGUA 1E7UA 3JWDL 1ZLDA 4PJGB 5I6KA 3RAJL 4E9TA 2M83A 3RW7A 3K91A 3KPQA 2DQEL 3DX8A 3IJ8A 3HN3A 3RVUC 4OFPA 3NPSB 1TFHA 4OZHE 1V5JA 1QP1A 2CO6B 1VFBB 1QOKA 1RJYB 4WO4A 4HWBL 4AH2B 1GGTA 2RAMA 4JHVA 4V2CB 3L95B 2P5WB 4HBCH 4NQTA 3WKMH 1MJ7L 1YA5A 1A6ZB 5MEQB 1NIEA 2CO6A 1Z0NA 4UTAL 1VFBA 3QJSB 2ADFL 4HT1H 2WUBL 4M00A 5E9AA 4IBLT 3BSZL 2AABH 4V2CA 4X6CB 3ZXAC 3L95A 5JIPA 2P5WA 1N6QH 3WI9A 1FO0H 3BW9B 4AUUA 1A6ZA 3WXWL 4EDXB 3DLQR 4CAGA 5KYWA 5MEQA 3NEEA 4M1GL 5CJXC 5KBDA 3RL2B 4BSRA 4WWKA 4X7SL 2VXSL 3NTCL 3ZE2E 3CLFH 4X6CA 2AJYL 2A9NL 3BW9A 4ECOA 3P72A 2Z31C 4EDXA 2UXFA 1DJIA 5C0EB 1E4KA 2E6PA 3NACH 3RL2A 4AYSA 4K07A 3HC4H 3N0PB 3UTTE 3TEYA 2AHIA 4DFIA 1NFDB 2IFGA 2Y1YA 3BKYL 3U30B 2WUCH 4MAYC 4W9FC 1WWAX 2DJMA 4DP9X 3V4PB 4G8AC 3HI5L 1L0XA 2X4UA 3JWNH 5C0EA 3FFCB 4JGJA 5EOCL 5K9OA 1D7FA 5J4MA 2W0LA 1MDTA 1KGJA 4N90E 1PIGA 4Z7VB 2YKLH 1KOHA 3WTUA 3COOA 3N43F 3BP6B 2QQKH 1D2OA 3P9WB 4G8GB 3V4PA 3FDWA 5EZOH 4YSAA 1IUZA 1IZJA 5AW4B 3FFCA 1S2EA 1MFAH 4AUJA 5FHAH 4KRMB 4EF3A 2HUHA 3CX5J 5T1MA 3VWKC 3QCUL 3BP6A 2WXKA 3NJNA 4I9WE 1KULA 4PSPA 1KEMH 4G8GA 4LCWD 3DWTA 5T3XH 3VACA 4NZ8A 4D9LL 4XBMA 2Y6TE 5AWNH 2DQCL 5D7IE 3WY3A 2H2PD 3J07A 3QIWA 2WFHA 4TQIA 2EIJB 1K8DB 5FR3A 4OKVB 3BUQA 3RTQB 3WNNA 4RA3A 3SBQA 5IM7A 3ASWA 1QFUH 4FKEA 2FH6A 4MASA 1QACA 2BHFA 3L2MA 2AVGA 1K8DA 2R2BB 3K2UH 4BKSC 4OKVA 1OAJA 1JRHH 5DF0A 3NCXA 1A1MB 4IMKA 4XB8A 3SDDB 2YMXL 3ZSTA 5GXBB 3I6LE 2WYIA 3CXDL 4U1JB 3UTOA 1M2OA 3DX3A 4NZJA 1Z9OA 3CMGA 4YHNB 2R2BA 1LM8V 2OX5B 3GLAA 3MODL 2JF1A 4DETA 5C0GB 1V3MA 1A1MA 4JQXC 3S3JA 4L4TE 3W11C 4KKCD 2CR3A 1ZXKA 3SDDA 1XZWA 3QGVA 3ASNB 5F89A 1WGOA 1IFGA 4PJFF 4TZHA 2NUTB 4KKLC 4FA8A 4P23C 3JQOB 2OX5A 5C0GA 1UT1A 4JX0A 3M8OH 4OJFL 4JRXB 2J2ZA 3TPKA 3B7YA 4UTAH 3H2PA 3P3UA 4PGEB 2JJTA 2FWUA 3MRIA 3H9YA 2EH8L 3NFPB 3Q2NA 2WNWA 4TTDD 2FJSA 2QELA 2QLVB 3ZRFC 4QF1B 1ZV2A 4JRXA 1CGXA 4LGPB 5GZNA 2E7CA 3BWUC 3C5ZD 1CN4A 2CK0L 4PGEA 3ATBA 4HULB 4G11A 4H1LB 3NFPA 1WFUA 1NC4D 5G4MA 3VDCA 1HT6A 4E5XB 4LXRA 1F4XH 5KSAD 3T2OA 3FHAA 5C3LD 4RH4A 1U92B 1J5OL 4QF1A 1T2XA 2NY0C 4GRWB 1B90A 1PQZB 2VXTH 3B5GA 4H0GA 3FT3B 4I8DA 5JDSB 4YLBA 1ODAA 1ZVHA 3W3GA 2YLHA 4H1LA 4Y7MA 3DGCR 3CVDA 4E5XA 3O8XA 3V7AE 1OF0A 4L29B 4HSAC 5JW4Q 2DEWX 3DETC 3M88A 1JZ4A 2WYTA 1PQZA 1KJ2B 2VERA 3FT3A 5AVZB 5JDSA 1HL5A 2FBRA 1E9OA 3WIFA 5JHDE 1JFQL 4RGOH 2IBGA 3SSGA 4YDVB 1IGTB 4L29A 3AM8A 1KCSL 5C0AB 3MR9B 1TEFA 4MJ4A 3S3BB 2K6YA 1CUOA 1KJ2A 3UPAA 3QCUH 4PUBH 1JL8A 5E2UL 1W8AA 1IO0A 3CFBB 4YDVA 3ZDWA 4AX3A 1IGTA 1BAWA 4UB0L 2DQCH 4K3EL 5DEJA 3MR9A 5C0AA 3CVIH 1I7ZB 4S0HA 3OXSB 2PTUA 4OF0A 1E8YA 4JEGB 3CFCL 4LL9A 5CIPH 3U9PL 2IDFA 4NM4H 3UYPB 4CSPA 5DWUL 4R7DB 3CFBA 1HNFA 2QT6A 3NEXA 3K6FA 4MJJA 4X6FB 3OXSA 1RMFL 5E5MB 5AALA 2K70A 2CRYA 4OGAC 4AM0A 3HAEG 3TIDA 1SM3L 2ED9A 4R7DA 2IXQB 1O7DE 4L18A 3RKDD 4ZUTB 2VUOA 3RDTC 2YMXH 3CSGA 4JPQA 4C4KO 5T1LB 5E8EB 1S7TB 5IMKB 2EILB 4MJ6B 4R2GD 1ZV9A 2BNRD 5PAZA 1JGLL 3GXFA 2P9RA 2IXQA 3GC3A 3CLEL 3FSZA 4DGVH 4DN3H 4ZUTA 4I85A 5EUOB 3DOIA 3QDGA 5IBLD 3AZUA 5E8EA 4ZFZA 5IMKA 3WJJA 2B20A 3FFOA 4AW7A 4MJ2A 5DMIL 2GKIA 1DLFH 2BEXA 4MB5A 1DEEB 4HUXB 5EUOA 5ADOL 2CRIA 3QUYD 2AS5M 5ICZB 5HYSA 3UTZB 5FOBB 3ULUH 4XE5B 1TJHH 3OGLB 1RPQA 3EUUA 5DJ2A 2AQRA 5J1AA 4Q56A 4K4KA 2V3EA 5ACMA 2Y72A 3EKCA 3BP5B 2X89A 4UYPA 4XNYL 2C9RA 1E28A 2IGFL 4PQ8A 1AC6A 2W9DL 5CMNA 4ICWA 5ICZA 3SDAB 4M7KL 5FOBA 4AOFA 2GIYA 1L6PA 2XV6B 1AE6L 4KAQH 4KI5C 4CUCA 1GPOL 2EDLA 4MQ7A 5IF0B 1E6JL 2DF3A 4HLEA 3WPDA 3BP5A 1AI1L 2ZF9A 3D39E 2BCKB 5DQ9B 4QXGL 1SXZA 2GTZB 3CZJA 4OZFB 1QYYA 3SDAA 3OKKB 1DN0B 2BO0A 3KYOB 3N5AA 2ZE0A 3LHPH 4I1PA 2OK0H 4URTB 1F02I 2WXQA 4YDIH 3EBIA 5H4YA 3RLSA 2XN9E 2BCKA 2BIOA 5DQ9A 2UZPA 4MDRA 5F9WC 1FNFA 1U2CA 1CFTB 2VOTA 4OZFA 4YEEA 3OKKA 1DN0A 2ID5A 4Y2DB 3KYOA 4UI2A 3HZ3A 5IK3B 3IAPA 4FRWA 1QMUA 1PY4A 1YEIL 4AG4L 2P5EE 3HG3A 3O81A 1CFTA 5EEZA 2W81C 1HEJC 2QSQA 5ANHA 4Y2DA 1NC2A 4AQ1C 1A9NA 3O4LA 2YAHA 5IK3A 4DQAA 3PDDA 3WPIA 3L3IB 3NRFA 1WEJL 2FQFA 4FHBD 4EZLA 4HFUL 4U1IA 4DO6A 1IKNC 1G9ML 2CO4A 4U3CA 2ESVD 3O0LA 4XZ4A 2IQ9L 1UA3A 1W9XA 4IM8A 2MNJB 2NSXA 1CMOA 3VXUB 3JVGC 2I9LB 5LXVA 5KYUB 2NW2B 1HSAB 1TEGA 2C1OA 5AUMB 2ATAA 2APWA 4JFEB 3RWDA 3U48A 3MFGB 3OC8A 4PLKC 3VSQA 2DN7A 4ZS6D 4QXUL 4OCRL 4TN9A 5GGTH 2DWYA 3VXUA 1N8ZB 1M9SA 4PJ5D 4M9OA 5KYUA 5LG6A 4H09A 3GIZH 2NW2A 1HSAA 3PWNB 4TRPL 3UX9B 4UTCA 5AUMA 1WO2A 5C0NC 4JFEA 4Q14A 4KXZI 3QDJD 1ZLSL 1SJHB 4LZKA 2F08A 4ZW3A 3KR3H 3GS7A 3BESR 2R1WA 3DJTA 2ZCHH 2DY2A 1FYTE 4G8FB 2XXCB 4GUCA 1CURA 1H3GA 1SJHA 3GSOB 4WUUD 3WPEA 1QEXA 2CBQA 4RRPA 3EDJA 1ZVNA 4BFOA 4DVRL 1FG2B 4PTTB 5HHOD 1EXHA 2WN2A 4JG0H 5EU6B 1P7QB 3SE6A 3ZDXF 4J28A 4AVHA 4DGIH 5JIIA 3QA3B 3T0ED 5LJYH 1PLGL 2OI9C 4G8FA 3F5WB 3GSQA 3N44F 4J23A 5EBMB 1A3ZA 1CFNB 2VN6A 5LDUA 1FG2A 4EI5B 5EDXA 3RPBA 3NESA 3PGFH 2W9DH 5LBVA 5TDOA 3NJJA 1RJLA 2D2CC 4WI5A 3QA3A 1SXCA 4Y19E 4QJ4B 3UL7A 4XXDB 3F5WA 4G7QB 1FO1A 1NOFA 2MCPL 4KKBD 3U4EB 4F8OA 4BQ6A 1CFNA 3MCLL 3QPQD 1KB5B 3VGDA 4EI5A 4XN4A 4N5ED 5FGCE 7TAAA 5JHMA 5I75C 4JDVB 4PB0L 4XVOA 5HGAB 4MBRA 1TVBB 2ZUVA 1TNMA 2EE3A 4BK8A 3O6LH 4XXDA 4JJ5B 4M48H 4K23H 4XX5A 3IJEA 3KEHA 3U4EA 3GNML 3VXPB 1KB5A 5L2KB 1TSRA 1HHHB 4AGNA 3ULVA 4E42B 3S97C 4JDVA 4I9XA 4WU5B 3R06B 1TVBA 2CWRA 4OZ4B 4YPGB 1R3HB 4FTVD 4JJ5A 3QIBB 3WN5C 3FCBA 1WWCA 4OCXH 1HHHA 3HBZA 5F1KC 4GG6B 3P3TA 4PRHD 4EBQL 4E42A 1G6RL 2W88A 3QO1B 3B9DA 3R06A 4L0PB 5HYJB 3TJHD 1R3HA 1J10A 5TE6H 2X6CA 4A2LA 4A67A 1S9KC 4LLYB 3AGWA 3QIBA 5E8DL 3NVQA 5EF1A 1UD6A 1XSJA 4GG6A 4GBXD 4O2FB 3QO1A 4WKZB 2MCMA 1OL0A 2X05A 2CJTA 3HNVL 3EH5B 4LLYA 3SKJL 4R7VA 2DPKA 3UC0L 4BE5A 3HB3C 4O2FA 1CFBA 2JCCB 1YN7B 3GXPA 2KYIA 1MRDH 1GKEA 1UB5B 2XJKA 4X9BA 3SCMD 2ARJB 1NGPL 2Y7LA 3MBXL 3C5SA 3OMIB 4JPVH 1KLGA 1L9TA 1KOOA 1L7IL 5HHXH 4HKZA 5DJ8B 1K6QH 2WIMA 4AIZB 1ZLSH 3GEFA 2JCCA 5C0CD 1YN7A 3X13B 4XNBA 1UB5A 4Z3GA 1U3HC 3ZK0A 4P3WA 2LQRA 1CK0L 4RMUA 4Q9BA 2NZ9D 3IGAA 1KGIA 4AIZA 2XTSA 1E30A 3TTSA 3X13A 4PJ8D 1UA7A 5LBSH 1GIGL 1CGWA 1JK8B 1I3UA 4UNIA 4YHIB 3WY2A 1W6WA 1TZGL 2XIDA 3GKZA 4UM8B 2HAZA 2F15A 3SHSA 4M7LL 3TFKD 3QFJD 4CN1A 4R4FL 3IKCB 2YEZB 1EFXB 3L13A 3L4TA 4FG4A 1ZIAA 3L3DA 4U09A 4NHCL 2VXVH 3H4HA 4X80L 4BSSA 4L8DA 4XP9L 4YHIA 4HWEH 3ARWA 5TGBB 1ITCA 1MCQA 2ZD0A 1X7TA 1ZHKB 4JO2H 1QUPA 4UM8A 1S7RB 1GKOA 2Y5QA 1T3FB 4B9PA 5B38G 2F5BL 1OT2A 2YEZA 1EFXA 3IKCA 4DW2L 3IK2A 4QRRE 3FZUC 3SPJA 4LO9A 4PWIA 3F7KA 3H53A 1B0RA 4QHUA 2YJLA 2WW8A 3TH4T 4DGUA 2GITB 1BVNT 5KVFL 5CHNB 2OSXA 3SOTA 1J86A 1T3FA 1Q72L 2AV1B 4W9GC 3D52A 4KY2A 1YPZA 4KHXH 1BD2B 1AIZA 2XQBL 3ULAB 1PKQB 5FYLE 4WTZG 1U8NB 4CDGC 2V70A 2YRPA 3T9WA 3RP1A 4JPKL 3DX0A 5FYJL 1U9KA 2AV1A 4RX4A 3AU1A 5C0BB 5KBLA 3BN3B 1V54B 4EBQH 1A4BA 1RHHB 4IEFB 1BD2A 3KPPB 2OYPA 5JPMA 3MUY1 3ULAA 1PKQA 3IB4A 4OLUH 4LSTL 4AYID 2JFCA 4MQXC 3VXSE 4ONFL 5HD8C 2XQYA 3IRPX 2OTPA 3O2VL 5C0BA 4AENA 1ETZB 2X40A 2JQZA 3BEWB 4YFLI 3VFGL 1SOSA 1RHHA 3KH4A 4IEFA 4ADGA 4F58H 2OJ1A 2UY6B 1HFUA 4KVCL 2C4FU 1MCOH 1E43A 1DP0A 3BUDA 3FTGB 4E36A 5DU7A 3FUDA 3EJPA 2R59A 5FYJU 1N26A 2R29L 3NJLA 4P9HL 1F58L 4ZMOA 3TEWA 4EI6B 5AB1A 4Q89A 2P26A 2DI9A 3H9ZA 5IGXH 2L4OA 3QEHA 4UNUA 1CDBA 2F19L 5IOKA 3V0WL 3FTGA 1B2WL 1SFDA 4H8QA 5BZZA 1KV7A 3OJAB 2VDKB 4LVEA 3M18A 5C86A 4YK4C 1CB4A 3EFOA 2VLKD 4EI6A 1SN5A 2EH7L 3VNZA 3MBWB 4XRCA 5K9QG 2EDQA 1E4XH 1II4E 4FLOA 4OF3A 1G4RA 4NUMA 1EJ6A 4OJEH 2EUZA 2PPDA 1GS8A 4EN3B 1WF5A 1FRGL 4X2UA 2J7LA 1EUUA 3VW3L 3MBWA 1A47A 3MV9B 1AJ7H 4S1DC 4QGYA 2MJWA 2QR0B 3P30H 3O0RL 4NC2B 4LKCB 4EN3A 3BUTA 1VGEH 5HJBA 1ZTXH 2EVFA 4M7LH 2WKOF 1PS3A 2J1ZA 1EZLA 4AXWB 2VISA 3LKRB 4K73A 4JM4H 4NHCH 4A68A 4XWOD 3CFEB 4A37A 1AYOA 2QR0A 4IS6B 4M3JA 4RFNC 5I8CA 2CDEB 2WCPA 4X8JB 4U6VL 4N0CC 4JZJC 4BIKA 4AXWA 3EFDL 1NPJA 2AQ3A 1WWBX 2I69A 3BEVB 3LKRA 4RAVB 5DURD 3OKMB 5L8LB 4LPUA 4XH2B 2ADGB 1GTNA 3L3OC 4JO5A 3QEQE 2CDEA 3LKOA 4X8JA 2EDFA 2JKLA 1OO2A 1W8NA 5IVXB 2R1YB 2DQIH 1D5RA 5C2BL 3BEVA 4RAVA 3OKMA 4UINL 2B0SH 4XH2A 2XQBH 5JZ7C 4PW4A 5AW2B 1PJ9A 4NZUL 4JQVC 5IVXA 2VR4A 3C8KB 2VLJE 3C09C 3UP1A 4OCNC 5CZXD 5IQNA 4GS7C 4YSRA 3T2QA 1YQ2A 5CLTA 4ZPVB 4APQC 1CXLA 4DP4X 4WFGD 5KYXA 5I1IH 2PWGA 4NDMA 4H8WC 4JDEB 2ZX6A 3CN0A 2EXYD 3SY6A 1BFOB 4WV1C 1MY7A 3IBEA 2EXTA 15C8H 1SF5A 3KDMB 1HXKA 4ZPVA 3HRPA 1T20A 4N24A 5E4AA 5B3JF 1MCNA 4DTGL 3QG7L 4ZFGL 4JKKA 1C08B 1JTOA 3WTSA 1OGAD 1WG3A 3MRQB 4JDEA 1NZRA 2AJUL 3LZLA 3OXRA 1N6VA 4R9HA 4WGKA 2R29H 1BFOA 3EJYD 4P9HH <