4CC5A

Fragment-based discovery of 6 azaindazoles as inhibitors of bacterial dna ligase
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
308
structure length
308
Chain Sequence
ADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title Fragment-Based Discovery of 6-Azaindazoles as Inhibitors of Bacterial DNA Ligase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 109
structure length 308
sequence length 308
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4cc5A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4cc5A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4cc5A02
1XK5A 4DV1B 3W5OA 3VNNA 1I94B 5D1PA 2ZM6B 3RTXA 1TA8A 4AQYB 1P8LA 4DV3B 3GB8B 5D1OA 5FPRA 1DGSA 4DV4B 1XMOB 4JI7B 4NXNB 4JI0B 1XMQB 3SGIA 2UU9B 2HIVA 2Q2TA 3KYHC 3JSLA 2VQEB 3T1YB 2CFMA 2UUBB 2E5LB 4LFCB 2VQFB 1S68A 1N33B 4X65B 4JI4B 4UCRA 2HHHB 1IBKB 4EFBA 4TOIA 4JI5B 1HNZB 1XDNA 3NBYB 4GKJB 4JI6B 4PZ6A 4LFBB 4LH7A 4YHHB 4B3MB 1FJGB 4JI8B 4LFAB 4X64B 4UCTA 4DV0B 4UCSA 4LF5B 2F4VB 2HIXA 1CKNA 4CC5A 5BR8B 4DR5B 3NBZB 2HVSA 4DR1B 3L2PA 3S24A 4B3RB 1IBMB 4LF9B 3UQ8A 4LF7B 1N32B 4GLXA 1A0IA 5IWAB 4B3SB 4JV5B 2Q2UA 4X66B 3BABA 5D1OB 4DR4B 2UUAB 3TY8A 4DV2B 4JYAB 2UXCB 4UCVA 4JI3B 3NC0B 3GJXB 4LF8B 4UCUA 1HNWB 1XNRB 1N34B 1B04A 4NXMB 2VUGA 1ZAUA 4DR6B 2OWOA 5FPOA 2UXDB 1FVIA 4JI1B 5DISC 4OX9B 4UCOA 4JI2B 1X9NA 4DUZB 3BA9A 4EFEA 3T1HB 4EEQA 4DV5B 1TAEA 4B3TB 4DV6B 3QWUA 2UXBB 1IBLB 4LH6A 5LMNB 4K0KB 1P16A 3JSNA 4LF4B 1VS0A 4E6NA 4UFZA 3W1BA 4DV7B 4DRFA 1HR0B 4KHPB 3TY5A 3GDEA 4EQ5A 3W1GA 1XNQB 3BA8A 4DUYB 1CKMA 4DR3B 4DR2B 1CKOA 4CC6A 3PN1A 3OTOB 1V9PA 1J5EB 3TY9A 1CKNB 3BAAA 5LMUB 4GKKB 2UUCB 2HVRA 3RR5A 1HNXB 4YY3B 4PZ8A 1N36B 2HVQA 4PZ7A 4LF6B 4X62B 4DR7B
chains in the Genus database with same CATH superfamily
1AJNA 4O7ZA 1CE8A 1QR9A 5D1PA 3JAMN 3CHXA 4DR2O 1R3KC 3CX5F 4ZOLF 4NZMA 1GLVA 5IYZF 1SYXB 5KFUA 2A0LA 4O4IA 2XGPA 2R7ZG 2XAQA 2C2EA 2QM8A 2VWKA 3I56V 4I9QA 2FMAA 4MAMA 1SA0B 1YHQV 1Y74B 2IJJA 1IDSA 1NBMG 1AP5A 2I8CA 1N8RW 2ASDA 4DRXA 1QR8A 5L3FA 3KYHC 2R84A 2Y0PA 3JSLA 5KHGA 2XUMA 4PA9A 4A3FG 5LXTB 4ICGA 4N23A 5JH7B 1S68A 2YIBA 5EZYB 1KKDA 3HT5A 1FFXA 1N33H 4FFOA 3C0FB 5FD5A 5IT9W 4ED8A 4X89A 4NXNO 1Z2OX 1Q8IA 3GTMA 1YEWA 3FYEB 2V9WA 4O3PA 3JYCA 3JAKA 1WB7A 4QWDA 2ALZA 1XBLA 4MVUA 3T5KA 5KG6A 1HW7A 2FYUH 4WFFA 3KTMA 2JJ2G 2V58A 1FKAO 2WA3A 2CNUA 3CQZA 1R6KA 2F4VB 3LSUA 2FE3A 3RVZA 5BR8B 3THOA 5D8DA 2WSSG 2RCVA 4LF5H 1YJ9V 4L1KA 1A0IA 3ORRA 4JASA 1Y4MA 4O4IB 3JCUZ 4X66B 4TM5A 1QLEC 4UCVA 3T7AA 1ZWIC 2ZD9A 4QIWE 4LFBO 4LC1A 3EPIA 3CVZA 4DRXB 1B04A 4IWYA 4A3DG 1ZAUA 4JAVA 2GPSA 3R66A 3G80A 3RN4A 4O4JF 4YAJB 3AW8A 1DF5A 2FPIB 4DR5O 3RB6A 4JI6H 2WAQE 1OJHA 4PDMA 1NQTA 4YHHH 1T3NA 2WLHA 4LF7O 1KJJA 4B3SO 3SJAC 3G8CA 2DWEC 2QWNB 3JSNA 2JEFA 2RF4A 3OSNA 4Q44A 3JAKB 2DW4A 4UFZA 3T9FA 3JD1A 3GIDA 5A9GA 1M5IA 4J7ZA 3LDCA 1KBHA 4M9UA 2XCAA 4N21A 5L3DA 1HR0H 4DR6O 1XNQB 4CBCA 3U55A 4J9SA 2F66C 1VF6A 5LHGA 2H94A 4DR2B 2RDIA 1N0NA 1QLEB 2XCLA 5IYDO 2CNQA 2P6JA 1NH2D 1F7YA 2EJRA 1KBLA 4P30A 1RPOA 4CZZA 3E8GA 3O9OA 4B08A 5CB4F 3Q8PB 1M4UA 4UV9A 3OEHG 2X0LA 4TWKA 1XHZA 4KHPO 1JJ2U 4MV9A 3SI8A 1Y1WG 2CKZB 1G6UA 1W96A 1VF7A 5KA5A 4JAAA 4OPAA 3ORQA 2DJVA 3CWBH 1NU1H 4NXNB 3GWKC 5K3WA 4YR2A 4DR3H 4QW8A 1WRVA 1MZEA 2R8JA 4B7KA 3KG2A 4J7JA 3RAQA 4ED7A 1VQPV 3PO2G 3HKEA 2NVYA 3H20A 1Q6IA 3GIJA 2COGA 2VQFH 3N40P 2LGWA 4UCRA 3NR7A 2DLNA 5KG1A 4FFRA 4QE9A 2XAJA 1COWG 4CKBA 1XDNA 3CCEV 4JF3A 2Z04A 5L3EA 4PZ6A 4LFBB 4I0XA 2OLSA 5BWUA 4DK1A 4XYMB 1H2SB 3FB6C 1Q43A 5CA0F 1I2KA 4CC5A 4DR5B 4RAZA 1BNCA 4PV1B 3PO3G 4LF7B 4LR3A 2DYRB 3LUTB 2W6OA 4B3SB 1K1QA 5EWEA 2UUBH 1DLBA 2Y0SA 4RNOA 4EYIB 4DW0A 4PI0A 4A3KG 1V55C 2IJIA 2W71A 4DR6B 2W8KA 1KB9F 2GTSA 5EIBD 3N27A 1AJPA 5GONA 3CCLV 2X5RA 4DR1O 3PFFA 2W6NA 3HKEB 2W6JG 2NR5A 4RUEA 4J9QA 4JI8H 3DC6A 2W9AA 1MABG 2IH3C 4LH6A 3RT3C 4O7RA 3TINA 2KSWA 5CR5A 4JTCB 3PVXA 4BXXG 3LWBA 2GUZA 3K59A 4KHPB 3QF7A 2PUSA 4ZI7F 4DL6A 4EYHB 1GN3A 1K3EA 4CE5A 2CTWA 3E22A 4DR4H 2C2AA 2UXDO 3LDEA 3ZHSA 1OHHG 5A2QN 2H8PC 4PA3A 4DV0O 3U0GA 1IBLO 4C2MA 1V55B 1OBDA 1F23A 1P4RA 4FM0A 2YW2A 3JAWA 5CBHA 4DV5H 4ZKIA 4O2AA 5DAAA 3L4JA 4DV1B 5KG5A 4AHCA 2W7OA 5KFAA 4QGPA 1MG1A 4TQRA 2V4DA 5BWRA 5KFVA 5KFRA 5KX5F 4ZOLA 3LDDA 5GONB 1XL4A 2M6YA 2VWJA 5LYJF 5T14A 4GKKO 3QQMA 4TUYF 3T54A 3TW6A 3QO8A 2DOSA 5BXZA 4U3JA 1R6TA 3HKDA 1K8AW 1SETA 2JS5A 1M1KW 1CPYA 5DEDA 3G6VA 2RDCA 3IG0A 4Q8FA 4O81A 2YZGA 3L75H 4DLKA 3E22B 3K0DA 3JATA 4IZOA 2ZT9B 2JEUA 4LSXA 1T5EA 2NU9B 2ZKOA 3JAMW 1MNGA 3IAYA 5CAEB 4JI5H 2UU9O 1PNMA 4HYKA 2W9BB 4MS2A 1VQMV 3JAWB 1DK1A 2R93A 2JVDA 3FD9A 4O2AB 3BVOA 2P7TC 4X65O 3QG5A 4RU9A 4DR1B 2FK2A 5F2VO 1Z2NX 4ZOLB 2W9CA 1PX2A 5IYZB 5DLFA 4JV1A 4I55F 5I5XA 4JV5H 3PR4A 2Q7EA 4R50A 1SERA 4W4KA 4U3JB 4DV2H 1XDCA 3HKDB 1QQCA 1SQGA 2IW5A 4MV6A 4X64O 2W57A 3OUZA 1EHIA 1BQZA 1RJQA 5FPOA 2UXDB 2B9ZA 1KJQA 1K97A 2JA8G 3BEHA 3C3SA 4GX5A 3ZHQA 2VUMA 2GQRA 1XHXA 4MVZA 3CRMA 4X88A 3QZ7A 4MA0A 2CDYA 3K04A 3JATB 3TEKA 5I47A 2P4KA 3T1HH 4MTXA 1IBLB 4ECWA 1NT2B 4HR7A 5IJ9A 1V4YA 2JRIA 3CRCA 4Q0YA 4LF4B 5LL6Y 3CE2A 2YCHA 1PP9H 2I80A 1HNWO 4JTDB 2BSKA 3W7WA 3I4NG 5IWAH 1EKFA 3MWEA 5BYBA 2XC9A 2P67A 1WA8A 4ED2A 4JYAH 2WLLA 1FPOA 3JZFA 3V6KA 2BR0A 1TWFA 4LF8H 1V9PA 3RVYA 4GZRB 5KFEA 4NLGA 2CUGA 3SNOA 5KT5A 4GKKB 2W9CB 4IHJF 1RFYA 3RW0A 4B3RO 4PZ8A 3MHSC 2F93B 4MV8A 5C8YF 4RB0A 4RNNA 4UUJC 5LGTA 2WE6A 5EC1C 3M9MB 2WPDG 5I5SA 3A2FA 5JVDF 5KFCA 2FLPA 4WFAV 3BCCH 1QBZA 4MSWC 4NR1A 3PZPA 4PA6A 4EBEA 2UVUA 3GTKA 4DV3H 2WDTA 5CMUA 3JZ6A 2AQ4A 3G6BA 5IJ9B 2UU9B 4PHZA 3U11A 1B6SA 4LF6O 4A2BA 5LMNO 4EBCA 3RAXA 3OUUA 5I5YA 1FXKA 2CFMA 2YICA 2ZM6O 4RQFA 1IOWA 4X65B 5BWWA 2R6FA 1WA8B 3H1JH 3GIQA 3FX7A 1UC9A 2J9GA 2QTSA 1B3QA 4NTWA 4EFBA 4DV4O 1IBKB 1FXKC 3JD3A 3L73H 3SJCC 3N44B 5GTIZ 3R5HA 3EYYA 3FAVA 4FPPA 2FLNA 4WFHA 3L70H 2H3OA 3WO1A 2GDSA 4BY1G 2Y69C 4X64B 4GLWA 4B3MH 2E5LO 4LFCO 2SCUB 2B63G 2GHYA 2DE0X 3RUPA 2A7WA 2NU7B 2HR3A 4DL4A 3DSQA 4BR6A 2XHBA 2XTAA 3OGCC 3GILA 3BABA 3AG2C 3WB0A 4F6RA 2B1IA 5KFWA 1HNWB 1VQ4V 3H3VH 4RCNA 4LFAO 5ITZA 4O4LF 1YVWA 1EN4A 4XYLB 4CMDA 1N34H 1FXKB 4ECUA 4UCOA 3VBBA 4WD3A 3N2KA 4IRCA 4H33A 4LF9O 5L3BA 1TAEA 1KU9A 3K5NA 5BPHA 3SPHA 1WCMA 2JEIA 3GB7C 2Y0IA 1GM7A 2IU0A 1YJWV 2UUAO 2Y69B 4MT8A 4GYCB 5CA1F 2ZCEA 1P16A 2HVKC 1YZBA 1XL6A 2VR1A 4O3RA 1ZL8A 1XNRO 3FAVB 3TY5A 4ZI7A 4DV7H 3UO2A 3CJHA 4BBRG 3AG2B 2HVJC 1E1QG 2UVRA 1AI5A 1J5EH 5DLGA 1Y1VG 4NTXA 5KHIA 3RR5A 4O4HF 5DGAA 3MHHC 3K3PA 2NVXA 2R9RB 4LF6B 1GRJA 1NR7A 4H37A 4FK5C 2ADQB 4F6RB 5KFLA 3DGEA 2IMWP 2DQ0A 4B3TH 1D5NA 1ZUQA 2ZM6B 2QKAA 5ITZB 1R3IC 5IYBO 2CZGA 1EFRG 2CGOA 5D5PA 4AQYB 2VQDA 3N2KB 2YIDA 3KZIZ 4XDLA 4Q4DA 3L4KA 4DV4B 4O7WA 1I1MA 5JQGA 3CEBA 1TUEB 2YIAA 3SGIA 2YS7A 2XOKG 4P2ZA 1Q86W 3CC4V 5A2QW 1XMOH 1G4YB 3D8CA 5LHIA 1GTOA 4A2AA 4KP4A 1WP7A 1ZL8B 2HKOA 1K9MW 4ZI7B 4LFCB 1I08A 1I94O 2E5LB 3RV3A 2QYZA 1URFA 3KHHA 2CTRA 3IJ4A 1I7NA 4G27B 3APQA 1I2LA 2WLJA 1K4DC 5KFKA 1YTFD 3HPLC 1BHBA 1VQ7V 2HHHH 2F1MA 1VBGA 5IYCG 1W0KG 1V51A 5J2UF 4ED1A 4ED6A 2EILC 1I1KA 2HHFA 3GWOA 1TUBA 4LFAB 3OGIB 5I60A 4UCSA 1WPXA 3STLC 4DR7O 3N8DA 4LF9B 1BMFG 2VQEH 1AB3A 3K5OA 2IM9A 4LNUA 3K57A 5KMGA 5LYJB 2UUAB 2JA5A 4I55A 3T5HA 1JR9A 3CSWA 3NC0B 4I50F 5JQGB 5EWGA 1F4NA 4O7TA 4JI6O 4FS1A 2AZ2A 2UXCH 3ETGA 1XNRB 1W2BU 3HKZA 4DIMA 4XX0B 1GN2A 5EOYA 4KUMA 2R92A 3DTUB 5C4XG 1JVMA 2A3QA 5I5TA 2DIKA 2ZE7A 3ZX6A 4AYBE 1S3JA 1IBMO 2F23A 5B1AC 4JGSA 4LMYA 2EILB 4DUZH 4C5AA 1Y76A 4O82A 1NTMH 5LL6b 4JI3O 3CC7V 2Q4PA 5JJEB 1YDXA 2A9HA 4G3IA 5FNVF 5DMXA 1SQPH 2AW9A 1SC5B 3EVKA 2HHFB 3ICXA 5K1XA 1CQJB 4O7LA 4DL5A 2BCCH 1TUBB 1VQ9V 4JV0A 4MV1A 3RGBA 2YS6A 2VPQA 3RB4A 3PN1A 3K58A 5FR9A 3K5HA 1Y6XA 2PVPA 4PA4A 1JKJB 3S3XA 4PELA 4A3BG 5KMGB 1UNNC 4MTDA 4J9NA 4I55B 4MVRA 5J9PC 3P3PA 4YJ3F 4X1YA 1N36H 4DV6H 5B1AB 4IRDA 1I94B 5JUMA 3VPBA 1U97A 3R5XA 3JARA 5F9LA 5EZYA 3TIIA 5FPRA 3WB2A 1RSOA 3CCRV 2RGVA 5L1LA 1Y76B 2MW2B 4FFBB 2JK5C 3ZCCA 2JDIG 1OV9A 1A32A 3TXSA 1WPBA 2RMKB 1QLNA 3F7VC 2WYOA 4X62O 1YI2V 2Q2TA 1JLLB 3WU2Z 2C22A 1AROP 2YYAA 3B2EE 3W7TA 2CQYA 4PJ0Z 5KFYA 4QWAA 1XNQO 4I7ZB 5GTHZ 2X6AA 2MK3A 4XDJA 2BOCC 3QO7A 4A3EG 1L0LH 1XMQO 3U9TA 3S3WA 5CE8A 5C3EG 3E35A 5KFMA 4JI6B 2DMXA 4RZQA 4YHHB 3J80N 1EM1A 4TV8F 4WBNF 4X1YB 2UUBO 1AP6A 2GSMB 5JVDB 2EJ7A 4RUAA 3OEEG 3ETJA 4KL1A 3JARB 1IBMB 3RYFA 1HWYA 2N74A 3E89A 1S72V 2Q2UA 2CTPA 5DG9A 1K4CC 1RSOB 3A0HZ 1AI4A 1P49A 4GKJO 4JI3B 1S77D 2W6ZA 1B33N 4FLZA 1MZFA 2EIYA 3T9DA 4ECYA 5KUKA 3HXLA 4J9RA 4Y8VB 2LGQA 4J42A 2B1GA 4FMTA 4JI8O 2QSAA 4FFPA 1VAJA 3DAAA 1JDBB 5DISC 5I5WA 3Q4HA 3BA9A 4Q6GA 5KAFZ 3GQCA 3U54A 4JI2H 1Q90D 3ZRSA 3ZMZA 4O7NA 4F4YA 3T99A 2AGQA 3M8AA 4DR4O 5DGBA 4UV8A 1XI1A 3OHAA 4Q20A 1UFIA 5CA1A 1H8HG 3H1IH 4I7HA 1SQFA 3HBLA 2LJ2A 4NXMO 3K9AA 3NXSA 3GTJA 4DR3B 3W7SA 4QIWA 3TW7A 1V54C 4IIJA 1YJNV 1AN7A 3E2EA 4DV5O 4X8AA 1SF9A 2UXBO 3RYFB 5C1OA 2XT9A 4RB2C 4DXWA 3QFFA 2F43G 2WAQA 4RB1A 5C5JA 4YY3H 4IR1A 4X62B 4TQFA 1WB8A 1AI6A 1Y66A 1M93A 2N04A 3ZJZA 2BQRA 1VQ5V 2AHYA 3RTXA 4IWXA 3FB8C 1Q3EA 4TQDA 4CH3A 3MR5A 1JQ0A 2V4QA 2NUAB 3HOUG 5KFZA 1XREA 1EUCB 1WR2A 3GTLA 3Q4HB 3CB2A 5AG2A 3D3QA 1R73A 1XMQB 5DG7A 2DYSC 4G2KA 4J9YB 3TCUA 3ZHRA 3RYHA 1IURA 5CA1B 1V54B 2HJWA 3R5FA 1YITV 2W7PA 4TV9A 1KTAA 3WB1A 4FLYA 2UUBB 1WH2A 1A48A 5DQIA 4ECSA 4L87A 3CMAV 4IIJB 5BYAA 4APMA 1VQ8V 3G6YA 4JI0O 3T1CA 1B6RA 4NTYA 1EYZA 5BWVA 4GUNA 4GKJB 4U7NA 4QPJA 4FE2A 2XCPA 3ABMC 5J2UA 3H1KH 3T1YO 4JI8B 4JI7H 2IP4A 4J7KA 3TQ1A 1AR4A 2YXYA 4R8CA 5JJJB 1A3GA 2DYSB 5KFPA 4DV1O 2F4VH 4HN2A 4QWCA 4PDRA 5BR8H 1SZTA 5DQHA 1HNZO 4DR4B 4X66H 3CCSV 4I50A 1PM9A 4K6NA 3RYHB 1PNLA 1PNKA 5FL7G 4NXMB 1KJIA 1UPGA 1W0JG 4TV9B 1E1RG 2JEXA 4BW9A 1OBGA 1N56A 4DV5B 2OYQA 4XDKA 2R8GA 5IWAO 2UXBB 1NVPD 2ZE8A 3NGDA 2IBKA 4J9MA 4JYAO 3N2GA 4A3LG 2QWRB 5BZBA 5DGIA 4LF8O 2C35B 3L71H 3V4SA 4TT3G 3MWMA 2YZMA 2YI9A 4Z2WA 5FNVA 3K06A 1N32H 5J2UB 3MAQA 2YRXA 3SYOA 1LNQA 4CS2A 2LW1A 1GYFA 1K7DA 5B1NA 3AK1A 1VQKV 1KP2A 1CS0A 2J6TA 4DR2H 4BIOA 2HG8A 1I7LA 3G4SV 5L3CA 2WTFA 2R93G 4RO2A 4RAIA 1M90W 4JI1H 4K0KO 2LW7A 4FBUA 1KKCA 1US6A 4G28B 1F51A 4J9OA 1KYOF 3EHBB 1WNSA 2Q73A 3ABUA 4I50B 1O9GA 1MSDA 2LO1A 5EBMC 3WG7C 4ZHQA 2COJA 3T9CA 3T5LA 2E3CA 1JPXA 3T9EA 3KCYA 3M9OB 3ETQA 2PYLA 4YB8B 2Y4RA 3WWIA 1DGSA 3ETDA 2Q68A 4RUCA 4JI0B 3FDSA 1Q5OA 1P84F 2DWCA 1HNXO 4A3CG 3ABLC 2VUMG 2HIVA 3N2GB 2ZIOA 4A3JG 4PBCA 2QGNA 3I12A 3ZMVA 3H0GA 3T1YB 5J2TF 2PMZE 5FNVB 2W9BA 2V4RA 5DQGA 4LF4O 5HV6A 4D6TH 5H2FZ 3MWDA 1FKAH 1C30A 2DABA 2K1EA 3ABTA 3T9BA 5K1PA 3DXRA 1R1BA 1WLEA 5B1OA 4FLTA 2Q7DA 4A3GG 2JA7A 2FB9A 4HQ6A 2Q5ZA 1HNZB 1S97A 2GLTA 4Q8EA 4CHIA 3WG7B 5IYZA 2ODMA 4WHXA 5DG8A 4FIPC 4CH4A 1MA1A 1BSMA 3QZ8A 1JDEA 2LQTA 2YUAA 2ARHA 2R8KA 2QA4V 3GTOA 3E5NA 4ZHQB 3RBZA 3NBZB 3UFXB 3ABLB 1ZTEA 3PR5B 4DYLA 5KT6A 3MR2A 1SESA 4GLXA 4UVCA 3R23A 5IWAB 4U7CA 5KG3A 4YQWA 4LF7H 3KALA 2HGXA 1KC8W 2OIEA 4B3SH 4JYAB 1Z5WA 4LF8B 3B09A 3N41B 3Q8QB 2GPWA 2YDEA 1TGOA 2VPSA 3GV8B 1Y67A 3CSXA 1N0JA 4DR6H 1ZSPA 5FJ8G 3J80W 3SYQA 3M7MX 4GX2A 3TXQA 5K2MA 2AGAA 3KXYT 2BE3A 3P30A 3DXRB 3DTFA 1K1SA 5FLXN 4K0KB 3ZHTA 4H0LB 1IBKO 1E4EA 2RNBA 3UM7A 3ZS8C 1NI8A 2Q8VA 1S5JA 1BJTA 4QNHB 4KHPH 1EBOA 3RFRA 3VQYA 2FPPB 4TV8B 3E86A 1ROPA 2PI5A 2YXHA 2ITCC 3GTQA 2R7LA 3E8HA 4GCZA 4X9QA 4B3TO 4I4TF 4O4JA 3F5TA 3MD0A 1HNXB 4RQEA 3AK2A 1O9HA 2HVQA 2FKXA 3B8MA 2Y4TA 1PKXA 5KUMA 4J9PA 2JA6A 2F95B 5LHHA 1GK9A 4J11A 4RAYA 1L1FA 4JZGA 1SRYA 1SQXH 2ZNIA 3SPCA 4C7UA 2AHZA 3Q8SB 3OAAG 2W0XA 5LMUO 2W70A 3VOTA 3T4ZA 2Q9LA 3VPCA 2IBZH 2EIJC 2VOBA 5B3SC 4FM2A 3OTOH 1C3OA 1E4EB 1M56C 2XNDG 5CB4A 2VA2A 3HKCA 1EKVA 2Q7HA 5LA6F 1CEZA 4O4JB 1N4CA 2WB1E 1QVGU 4D7TA 2E74B 1Q6HA 2JGDA 4LH7A 2YIBD 1KEEA 3FKSG 2XD4A 1K83A 5IP9G 1D2DA 1VEWA 1K92A 4WCEV 4GX0A 4FFMA 1BCCH 3UYYA 2EIJB 4MVSA 2HVSA 3L2PA 1EKPA 3RGXA 3ZHUA 4O7YA 4DR1H 3ABKC 4MTGA 3GIIA 3N43B 4AQYO 5B1BC 3JALA 4MTFA 2R8HA 4JI4H 5BMVF 1N48A 1GO3F 1BQ0A 3E83A 3AYHB 2MCTA 1FJGO 1ZX3A 5IE9A 1JX4A 1JOYA 3JRWA 3U10A 1VQOV 5CB4B 1AI7A 4HNUA 4YR3A 4FS2A 1GSOA 4P9OA 2UXDH 4EEQA 2W6PA 3HKCB 5CA0A 4B3TB 1HDJA 3QWUA 4DV0H 5KFJA 3VQVA 3AK3A 4DL2A 4RNMA 1IBLH 1VS0A 2ZINA 1GH6A 3OE7G 3LMLA 3BY6A 4E2LA 2CTQA 3TGUH 2JGDB 1W93A 1X4TA 1Z2PX 2A1HA 1WSCA 1U96A 1T36A 1YIJV 3ABKB 4ZIBA 3DTGA 5JWPA 3KHGA 3MFHA 4OX9O 1VP7A 4CC6A 1H2MA 5B1BB 2XGQA 1GM9A 1P7BA 5HFMA 4DV6O 2P0AA 1K33A 4BW5A 5LMUB 1QNMA 2YEVA 5IYBG 2R8IA 3R9RA 4GKKH 4YXWG 2X6BA 1RYRA 2EZOA 3JALB 5H80A 3LP8A 1G8MA 3OD4A 4J9KA 2ITDC 3VNNA 5IJ0A 3JD0A 3RGZA 2OCHA 2EJ0A 1WAZA 4ZQIA 4JUZA 5LGUA 2X7RB 4R8UA 4C5CA 4UVAA 3L74H 3GVMA 3TQTA 2VA3A 1NS1A 2PN1A 1K5QA 4DW1A 5CA0B 3A0RA 2I87A 5KFIA 1FS0G 2ZIMA 1I50A 2R92G 3PW0A 1FYJA 1NH2B 4PWQA 2UU9H 3H01A 1YXBA 2L6LA 2VQEB 1RPRA 3MFIA 3FB5C 4ECQA 4MW8A 1GAXA 4JV2A 4RWUA 4F50A 2P4VA 4X65H 3WNZA 4HNTA 1VQLV 4QJFA 5KX5A 4HAMA 5CM0A 3RB0A 2YEVB 2YS8A 5LYJA 1M57C 1R3JC 3J81N 3UZBA 2JEGA 1I1LA 4TUYA 4ECTA 1FJGB 3TIGA 3GTPA 2BTQA 4DL3A 1N33O 1DV2A 5KLVH 2XASA 1CKNA 5IJ0B 4QWBA 3W7UA 2HDKA 4NYEA 3SR2C 3VA7A 1RJPA 4R8UB 2YI8A 4FLWA 2YL2A 4X1KA 2DAAA 3TY8A 1H2NA 1Q82W 4UCUA 3FKIA 2V1DA 2PGGA 2WWWA 4HNAA 5EIBC 3SPIA 1HNWH 2YZNA 4I5SA 4H44B 4LF5O 3CRAA 1FVIA 5J2TB 4OX9B 4QPKA 3IFXA 4U7OA 1IXBA 2C28A 3GTGA 5EBWC 4AILC 4IYHA 3RJ0A 5KFFA 4ED0A 1M57B 1QCEA 3F8NA 5H5NA 2WLMA 4DV6B 2R7MA 1I6UA 3WFVA 4IGGA 4YR0A 4NB5A 1AR1B 4WFGA 4QJFB 1IYEA 2FJZA 5KX5B 4B3RH 2FTKA 4DRFA 3CXCU 1EUDB 4EGQA 2YXLA 2NN4A 3JD4A 4R7CA 2HP8A 5L1JA 4C5BA 4TUYB 2EBOA 4CKCA 4R6ZA 1K73W 2Q67A 4YHHO 2B5UA 2BTQB 3P32A 1CKOA 1VKZA 2V7QG 1CKNB 1NKDA 3LSQA 2ATKC 1D5AA 3H4BA 4I4TA 5CN0A 3K03A 5KFSA 3BFRA 1AILA 4AYBA 4X1KB 4PZ7A 1HR0O 4FFBA 5L1IA 3HB3B 5KS8A 4LF6H 5FLXW 4MV3A 1ENVA 4M7EA 5LMNH 1S9FA 2R7NA 4HNAB 2R86A 4FLXA 3SYCA 1GN6A 1RK5A 4ECZA 3V6HA 2ZM6H 2UXNA 2AZ0A 2CAZC 3GB8B 1GGOA 1WN7A 4DUYH 4H13B 2JEJA 4MA5A 2CW8A 1NTKH 1KUQA 2J6SA 5EK0A 5JQWA 1OZ0A 5LOVF 4IHJA 5C8YA 1R9TA 1N33B 3CCQV 1XOUA 2E5LH 2G38A 5I5VA 4LFCH 1GN4A 2OTJV 4O86A 4DR3O 5JVDA 1M7JA 2KKWA 4TOIA 2FB5A 4I4TB 3EXAA 3X2QC 2ZDGA 3RBEA 1I5XA 3GIMA 1VF5B 1K34A 2Z5UA 3ML0A 3RIZA 5KT4A 1JCHA 5GONF 4ECXA 3LQSA 2FPGB 4EBDA 4M0JA 3BPZA 2JJ1G 3ZRWA 4NZOA 2HEPA 2VQFO 4LF5B 4LFAH 1KUTA 4O7SA 4BIUA 3K3WA 2QWQB 4MVOA 4O2BF 1AVMA 2OH2A 3ZBHA 2CW7A 5KT2A 3JASB 3F5WC 2DQ3A 3K5LA 5BMVA 1GO3E 3FMAA 5KFBA 4RZRA 4UXNA 2Z02A 1L2ZA 4YAKB 4PD4F 3ETHA 4IHJB 1XNRH 3J7AK 3IC9A 4CS3A 1RJRA 5C8YB 4JTAB 3X2QB 4FBTA 2KQXA 1TWAA 4BY7G 5KA6A 4J9ZB 4FZ1A 5EC2C 3M4IA 2QF7A 3W1BA 2XIGA 2M05A 4DO2A 1HR0B 1FAFA 5CBGA 1S0OA 3UZOA 2W8LA 4JI1O 3M99B 3ZRWB 1BT8A 3CCUV 3AX6A 2IJKA 3P3NA 3SYAA 4O4LA 3A8TA 5E1AC 1XUQA 2ASLA 3QVNA 1H2KA 3K5MA 3KAJA 1E4FT 4WF9V 3H1HH 5H6QA 3OMNB 1S0NA 4CMFA 1KC7A 4X1IA 3KAKA 1IZ3A 5BMVB 1L0NH 3FFQA 5IYDG 3MR3A 4ECVA 3B40A 1S03G 3QO5A 1DIKA 3QTCA 4QW9A 4OGQB 1I94H 2WLNA 3RYCA 4GC7A 4JI7B 3ZIAG 3F7YC 3OM3B 3OMIB 3T2MA 4FVMA 3OUFA 4HYOA 3GLKA 4ED3A 2EULA 4J0MA 2EJ3A 3KHRA 3ZMUA 4FM9A 1M0TA 4E4TA 4O4HA 2UUCH 2YWVA 2VQFB 3CXHF 1BXRA 3GV7B 3BJYA 3AEIA 1KT8A 1BL8A 3GIPA 4DR7H 5I5UA 4O4LB 1CP9A 5FLMG 5KG0A 4IYIA 5B5EZ 1GMGA 2FMLA 3K79A 4IR9A 2ABJA 2CNVA 1SCUB 3BACA 2R85A 3CD6V 4D7SA 3OFNG 3G8DA 4UCTA 4X1IB 1FFXB 2RJZA 4PDBA 5JVLA 1H2GA 2NLJC 3CEIA 2Q0AA 2R9AA 1VQNV 1N32B 3BHPA 3RYCB 4JI5O 3CS5A 1IBMH 3T9AA 2UVWA 2BOBC 2L35A 1IXMA 3U0ZA 1BS3A 4PDLA 3UT5A 4Z1VA 4AI8A 3TJTA 2R7ZA 1Z5VA 4JI3H 3HB9A 1ORQC 3Q8RB 4QSHA 3HOWG 1AUXA 2JS3A 2OWOA 2W6MA 2O03A 4O4HB 4JI1B 4IAJA 5KG4A 2E2HA 2Z0AA 1QHTA 3QNEA 5BPFA 3J81W 3CCMV 4B7EA 5GW7A 2WA4A 1CXZB 3I55V 1VF6C 1W59A 3IGAC 4JV5O 3H0GG 3RF2A 1PD3A 4CS4A 3VPDA 3HR0A 4DV2O 3K9SA 4A5UB 4GC6A 1FFTB 1EZ1A 4J41A 1UC8A 4K3AA 2HJDA 2QM7A 3RFCA 3T4DA 2JA7G 2R72A 4LWSA 2YC0A 4J9LA 3PW2A 5LGNA 2HGWA 3T1HO 1FXHA 1AJQA 3ASOC 1CQIB 3HOVG 5KG2A 2NU6B 4WFEA 2DYRC 2IU3A 4ZBMA 2C2DA 4O7VA 2DPIA 3ABMB 2R9IA 3UT5B 1YSCA 5BWXA 4X62H 3SJQC 4GT1A 1O75A 1SEIA 1LR1A 4J80A 3VQWA 3OTOO 2BQUA 4QE7A 3UO3A 5C93A 5D1OA 4FFKA 1XNQH 1Y14B 3W7XA 4ME6A 1BHAA 2QWPB 2P06A 3PJSK 3BQ0A 1DTOA 1XMQH 1I0HA 2CH7A 4BIZA 3JD2A 5LOVA 3ASOB 1KQSU 2Y48A 1JIHA 1T94A 3ASNC 3CRQA 2Y0SE 2RQ6A 2NNUA 4LWSB 4YJ3A 1F4MA 4YJ2F 4DV3O 1L8DA 2PBZA 2FK1A 1OCRC 1S10A 4W4LA 4JI5B 4F4ZA 1JJOA 2C00A 5L3GA 3HOYG 4YBZB 4F6EA 3PW4A 2V59A 4MVQA 4GKJH 2Z3YA 1ZLZA 3OMAB 1ULZA 4O84A 4NXNH 3OUSA 1G1XB 3SYPA 2XAHA 5KHHA 1ET0A 4P9PA 4O3NA 3CCVV 4JI4O 1IOVA 5KFDA 1DAAA 2PMZA 2P5OA 4O2BA 1Y1WA 1GKFA 2WLKA 4JV5B 4O83A 5D1OB 2YZLA 3WWHA 3HKBA 4I0XB 3K0GA 4DV2B 1WP8A 2JA6G 1XILA 5DM6V 1H2LA 3ASNB 4B3MO 1YTFB 2CH7B 1SQVH 1G2WA 2BQ3A 2P22C 4O3QA 2RDJA 1OCRB 1KMIZ 3BRCA 5LOVB 4NXMH 2Q6AA 4JYCA 1B6QA 4F4WA 1X9NA 4LFBH 1TWCA 2ZXWC 3T1HB 4WBNA 4TV8A 2ODTX 4YJ3B 4FZ0A 2HLDG 3CYOA 3VQXA 5KKNB 5KFTA 1NZ6A 2UXBH 2ZE5A 2KG7A 1RM1C 4DR5H 1EZJA 3K08A 5KAIZ 4A3MG 1TWHA 1MZBA 3R65A 1TVKA 1PL0A 2PY5A 4EQ5A 2FLLA 1N34O 1M9NA 4RUFA 4DQNA 3BA8A 5KFQA 1TWGA 5HNEA 3VMMA 1PPJH 4GX1A 5JQGF 4HBNA 3LSSA 3OTOB 2QE7G 4X20A 2VS0A 1A9XA 2YU9A 1S5HC 4O2BB 3CMEV 1MSWD 2BTOA 3UKMA 2GUZB 3L72H 4CH5A 2A06H 3HKBB 4FLVA 4DV7O 5JCOA 2ZXWB 1SFOA 1XK5A 1Q81W 4FFLA 4JZ2A 3AG7A 4NKGB 3H4DA 4NYKA 4MV4A 1H8EG 5IP7G 1PK8A 4WFBV 3K3VA 1J5EO 1RM1B 4JYYA 1P8LA 5JCOC 4DV3B 3BQ1A 1LUVA 1IVSA 1OCCC 5L1KA 4WBNB 4ECRA 2ZNJA 2Y4UA 5LP6F 3SJBC 4JI0H 2E76B 4A3IG 3ZMSA 3TETA 2KG7B 2Q7GA 2QM4A 3CCJV 4ASUG 1TVKB 3BQ2A 1OCOC 3IN5A 4XBFA 2W6QA 4PA7A 1HP8A 2NU8B 1X59A 3V6JA 2D2CB 3T1YH 3ZMTA 3N42B 4XZ3B 2PTMA 5H6RA 4A93G 4JI4B 2ZDIA 4FGRA 4EB6A 2EX3A 3KKYA 4DV1H 1VIBA 4X20B 1XMOO 1K5SA 3LNNA 3VOUA 2QEXV 2CGNA 3NBYB 1JA8A 1HNZH 2FL4A 3Q2OA 4FJCC 2ZDIC 3ZEDA 4B3MB 1KECA 5F9NA 3V4ZA 1OCCB 4DV0B 2Q69A 3ZHVA 2PYJA 2YRWA 2PF4E 5KT7A 1WCMG 3IC7A 3JCZA 2HHHO 2ZR2A 5EYPA 5IY5C 2AU0A 5KFHA 1KJ8A 1JMKC 5EWFA 3RB3A 1OCOB 2EIMC 2R70A 4U6PA 4EEYA 5D5QA 2ZJTA 2HG5C 3O65A 1N34B 2ADPA 4YIOA 3MJFA 3AG3C 2VUGA 2FKLA 4MW3A 1EZVH 2UXXA 5CBFA 2WB1A 2X6CA 3EPGA 3GV5B 2QDOA 4I9WA 2VQEO 3RWRD 4O3SA 3G6XA 4EB6B 1ZQ7A 5HFLA 1RP3B 1THZA 5B3SB 2UXCO 1RK6A 3TK1A 4E6NA 4K0KH 4DV7B 5LXTF 1M56B 5JH7F 3KHLA 4Q43A 5EZYF 3SPGA 5IY5B 5FD6A 1CKMA 4F4LA 2DN9A 2EIMB 5KHJA 1EN5A 4DUZO 1J5EB 4LBEC 4UB8Z 2UVVA 4LSAA 2M7WA 1VBHA 4EG0A 3AG3B 5EYPB 3UCSC 2BSKB 4JYBA 2DPJA 2IH1C 1OWTA 1HNXH 4DL7A 3B8NA 2ZDHA 3LULA 3ETEA 1IYDA 2WLLB 5IT9N 2QWOB 3W5OA 2KSDA 4DUYO 3FYIB 3AG4C 3CP1A 1BE3H 4LF4H 5L9XA 3ZRVA 4FM1A 1KP3A 1MMMA 4O4IF 4NZNA 4K8ZA 3OTFA 1VQ6V 5E79Z 4UUGA 3FKIG 1SZXA 1XMOB 3JZIA 4E4EA 1VARA 2E75B 2WLIA 1N36O 4MV7A 2XAGA 1AUVA 3HOZG 3G6EV 2QB5A 1AR5A 2OTLV 2FP4B 2D3OW 1ZHSA 2IJHA 3C90A 1Z2GA 1R6NA 4JAUA 1SS3A 5H9CA 4YJ2A 2HHHB 2GTAA 2AGPA 3SE7A 5KG7A 2JA5G 3ZN0A 5IDJA 3AG4B 1BZKA 2EZPA 2FK3A 2K9PA 1B06A 4NVPA 1SQBH 2QK4A 3KREA 1XEQA 4EKWA 1GSAA 2RGRA 3ZRXA 2YSUB 2HIXA 2R82A 4EGJA 4KXRA 3SPJA 2J6UA 4BAYA 5J2TA 4B3RB 4BBSG 3UQ8A 4OXSA 2LFSA 1ZHQA 4MTOA 1OCZC 4QWEA 1NR1A 1S0MA 3J7AU 4IL6Z 2ZE6A 2UXCB 2JGUA 3CC2V 4QIWF 5KT3A 2WLIB 2LP7A 2QR4A 4IIJF 1IBKH 4TVIA 3G71V 3AG1C 4JPRA 3GIKA 3RYIA 4DUZB 4EFEA 5EDWA 3HO8A 2A79B 4X64H 2AXTZ 4YJ2B 5LMNB 3E8FA 1DF4A 2OIGA 1JFFA 3U9SA 2O57A 1BGWA 1XQ8A 2QTOA 2C2RA 3GDEA 3W1GA 1LUWA 1OCZB 1S76D 4DUYB 5KFXA 4BWAA 2R87A 3RV4A 4JI2O 5HBRB 3A0BZ 3H9VA 2XAFA 1J95A 1QU7A 3APOA 3TY9A 4Q4CA 4HNVA 3T5JA 3KCXA 5KHKA 1NTZH 1PV0A 3H1LH 1DV1A 3OR7C 3NUAA 3BAAA 4IRKA 2B63A 1YCIA 4TV9F 2HVRA 3AG1B 3C3TA 5LMUH 1N36B 2GV9A 3DF7A 3N6XA 3OT7A 1FD9A 5C1PA 2EINC 3WO0A 3CPWU 5BY1A 3CJHB 3B77A 1EN6A 1NVPB 4Q45A 1JX9A 4ABMA 4DAAA 4F4XA 3D36A 4U3FH 2ZDQA 2W6IG 2QJ1A 1TA8A 3RYIB 4OPHA 3D3IA 3OSPA 3L9DA 4UB6Z 2UUCO 3I5DA 4UVBA 2R7KA 1P7GA 4CH6A 4KFMA 1Q6UA 4YY3O 3D36C 5B66Z 3E8BA 5LP6A 2ZQMA 1I7FA 2HFEC 4CKEA 4K8XA 5KFOA 1JFFB 3MR6A 1SKVA 2ZR3A 2ILMA 1GM8A 1VMGA 1S5LZ 4JXUA 2CK3G 1I5YA 4IT5A 1S0VA 3MDSA 1E79G 3BG5A 1H38A 5LP6C 2V5AA 4YIPA 1NJIW 2KB1A 5DN6G 2P90A 2EINB 3HKZE 1UJWB 4TQSA 2ETNA 1A0GA 5LBQA 2WAMA 2EJ2A 3JASA 5TISZ 2HGSA 2OCCC 4O3OA 4AQYH 1YF2A 2LFRA 2E2IA 3G67A 4DV4H 1Y1VA 5KFGA 4MVMA 1I3QA 1E4GT 1R3LC 3LNMB 2ASJA 1FJGH 5IYCO 4Z1MG 2GBOA 4FLUA 1FXVA 3S24A 1ZETA 2N05A 1IX9A 5EBLC 4PDVA 4FFNA 4LCUC 4L8JA 1RYSA 5JJNB 2HJFC 2VRZA 1M6VA 4YP3A 4BWSC 4K35A 5CA3A 3WWJA 3GJXB 5LA6A 1GSHA 1MOFA 2QKCA 4TSFG 2OT5A 4JI7O 2IA6A 3HOXG 5LP6B 2AGOA 3EFFK 3H40A 5DGHA 2COIA 5C44G 3B4SA 2F4VO 3OHBA 3ZN1A 2ATLA 1JXLA 2W0FC 5BR8O 4JI2B 3FB7C 1KJ9A 2EIKC 1WJZA 2PI4A 5E25A 4RB3C 4LNUB 2OCCB 4ETSA 4OX9H 3RBDA 1QVFU 1SA0A 4X66O 1Y74A 3OR6C 2ZGIA 1KD1W 4J10A 4MTEA 3M9NB 4FU0A 4ZHQF 1Q7YW 2CE4A 1M0WA 1SQQH 4HZ3A 5DECA 4DK0A 4LF9H 4LP8A 2DZDA 5LXTA 5JH7A 1PL4A 2X0SA 2UUAH 3N6RA 2DWDC 3OW2U 2GQSA 3K5IA 3PW7A 4PI2A 3I4MG 3DC5A 1BGYH 2PZSA 2UUCB 3SDLA 4YY3B 2RN9A 3JRXA 3PW5A 2Q0OC 1N32O 3Q1KA 4R7RA 3STZC 3CRRA 4O2AF 2JIZG 5KFNA 5LA6B 2EIKB 2QKSA 5BWTA 4DR7B
chains in the Genus database with same CATH topology
4X62H 1O75A 2F95B 5D1PA 3CHXA 2ZM6B 1SEIA 5ITZB 4RAYA 3VQWA 5D5PA 1SYXB 4AQYB 2ZNIA 3N2KB 4O4IA 5D1OA 3L4KA 4DV4B 2VWKA 4I9QA 1XNQH 5JQGA 1SA0B 2YIAA 3SGIA 5A2QW 1XMOH 2VOBA 4FM2A 3OTOH 1XMQH 4DRXA 4A2AA 3KYHC 3JSLA 5LOVA 5KHGA 5CB4A 5LXTB 4ZI7B 4LFCB 5JH7B 2E5LB 2YIBA 1S68A 5EZYB 2RQ6A 1FFXA 4YJ3A 3HKCA 1N33H 2Q7HA 3C0FB 1L8DA 5FD5A 5IT9W 1Z2OX 1Q8IA 4JI5B 1YEWA 1JJOA 2HHHH 2F1MA 4O4JB 3JAKA 4D7TA 4LH7A 1HW7A 4GKJH 2YIBD 1TUBA 4LFAB 4NXNH 4UCSA 2F4VB 2FE3A 5KHHA 5BR8B 3THOA 2HVSA 3L2PA 4LF5H 4LF9B 3RGXA 2P5OA 4O2BA 2VQEH 1A0IA 4DR1H 3K5OA 4JV5B 2IM9A 4O4IB 4X66B 4LNUA 3K57A 5D1OB 5KMGA 3HKBA 5LYJB 2UUAB 4I55A 3N43B 4DV2B 3NC0B 3JALA 4UCVA 5JQGB 4JI4H 2UXCH 1XNRB 3CVZA 2MCTA 4DRXB 1B04A 5EOYA 1ZAUA 2P22C 1KMIZ 3BRCA 5LOVB 4NXMH 3U10A 5CB4B 1X9NA 4JI6H 2UXDH 4LFBH 3T1HB 4EEQA 4WBNA 4TV8A 4LMYA 4YJ3B 4YHHH 4DUZH 3HKCB 5CA0A 4B3TB 3QWUA 3VQXA 4DV0H 3SJAC 3VQVA 5LL6b 2UXBH 1IBLH 3JSNA 1VS0A 5JJEB 4DR5H 3JAKB 2ZINA 4UFZA 1MZBA 1TVKA 3LMLA 1M5IA 2PY5A 4EQ5A 1Z2PX 1X4TA 3ICXA 5K1XA 1HR0H 1XNQB 3BA8A 4ZIBA 1TUBB 3RGBA 2F66C 4DR2B 4CC6A 4HBNA 3PN1A 3OTOB 3K58A 4X20A 5LMUB 4O2BB 2BTOA 4B08A 4CH5A 5KMGB 3HKBB 4MTDA 1M4UA 4GKKH 4I55B 4FLVA 3JALB 5JCOA 1XHZA 4X1YA 1N36H 4MV9A 4DV6H 1XK5A 3VNNA 5IJ0A 1I94B 3RGZA 3JARA 1G6UA 3K3VA 1VF7A 5EZYA 1P8LA 5JCOC 4DV3B 5FPRA 3WB2A 1RSOA 2RGVA 4WBNB 4NXNB 5CA0B 4DR3H 2ZNJA 2ZIMA 4FFBB 3SJBC 4JI0H 2Q2TA 1WPBA 2Q7GA 2QM4A 2WYOA 2UU9H 2VQEB 1TVKB 3T1YH 3N42B 3HKEA 3H20A 3B2EE 2PTMA 4JI4B 2VQFH 3N40P 4EB6A 4UCRA 4X65H 2EX3A 4DV1H 4X20B 5KX5A 3LNNA 1XDNA 3NBYB 1HNZH 4JI6B 5LYJA 4PZ6A 4LFBB 3ZEDA 4RZQA 4YHHB 4B3MB 4DK1A 4TUYA 1FJGB 1H2SB 4X1YB 1Q43A 4DV0B 2BTQA 1CKNA 2PYJA 4CC5A 5JVDB 5IJ0B 4DR5B 4RAZA 4KL1A 3JARB 1IBMB 3SR2C 3RYFA 4LF7B 4LR3A 2YI8A 5EYPA 4B3SB 4FLWA 2Q2UA 1JMKC 2UUBH 4X1KA 3TY8A 1P49A 2R70A 4JI3B 4PI0A 4FLZA 4UCUA 5D5QA 2ZJTA 2PGGA 3HXLA 1N34B 4HNAA 5EIBC 2VUGA 1HNWH 4DR6B 1FVIA 5J2TB 5DISC 5EIBD 5GONA 4OX9B 3BA9A 3RWRD 3HKEB 4AILC 3RJ0A 4Q6GA 4JI2H 3F8NA 4DV6B 4EB6B 4JI8H 1I6UA 4LH6A 1XI1A 2KSWA 5CA1A 4E6NA 5KX5B 4B3RH 4K0KH 4DV7B 3K59A 4DRFA 4KHPB 4I7HA 1SQFA 3QF7A 2PUSA 2YXLA 5FD6A 3E22A 4TUYB 1CKMA 4DR4H 4DR3B 2BTQB 1CKOA 5KHJA 4IIJA 1AN7A 1J5EB 1CKNB 1D5AA 4LSAA 4I4TA 3RYFB 5EYPB 4RB2C 4RB1A 4X1KB 4FM0A 4PZ7A 3JAWA 1HNXH 4YY3H 4DV5H 4O2AA 4FFBA 4X62B 4TQFA 3L4JA 4LF6H 4DV1B 1M93A 4AHCA 5FLXW 3W5OA 4M7EA 5LMNH 4HNAB 3RTXA 4FLXA 2V4DA 4TQDA 1Q3EA 4CH3A 4LF4H 4ZOLA 4FM1A 2ZM6H 5GONB 2VWJA 4K8ZA 2CAZC 3OTFA 3GB8B 3CB2A 1XMOB 1WN7A 4DUYH 1XMQB 2CW8A 4U3JA 3HKDA 4MV7A 3RYHA 5CA1B 2JS5A 4TV9A 4IHJA 3WB1A 4FLYA 3IG0A 5C8YA 2UUBB 1WH2A 1ZHSA 1N33B 3E22B 2E5LH 4LFCH 3JATA 4IIJB 5JVDA 4YJ2A 2HHHB 4APMA 2KKWA 4TOIA 4LSXA 1T5EA 3JAMW 3IAYA 4I4TB 4JI5H 4GKJB 3RIZA 5J2UA 4NVPA 3JAWB 3BPZA 4JI8B 4JI7H 2JVDA 4O2AB 2HEPA 2RGRA 4LF5B 5JJJB 2HIXA 4LFAH 3QG5A 4DR1B 2F4VH 5J2TA 4B3RB 1Z2NX 3UQ8A 1ZHQA 5BR8H 4ZOLB 2CW7A 5IYZB 3JASB 4DR4B 4JV5H 2UXCB 2JGUA 2Q7EA 4X66H 4I50A 3K5LA 4U3JB 5BMVA 3HKDB 4DV2H 3FMAA 3RYHB 1IBKH 1QQCA 1SQGA 4NXMB 2W57A 1L2ZA 1XNRH 4TV9B 4IHJB 5FPOA 3J7AK 2UXDB 3RYIA 4CS3A 5C8YB 1XHXA 4BW9A 4DUZB 4EFEA 4DV5B 2OYQA 3JATB 2UXBB 4X64H 1IBLB 3T1HH 4YJ2B 1NT2B 5IJ9A 5LMNB 1JFFA 3N2GA 1BGWA 4Q0YA 1XQ8A 4LF4B 3M4IA 2YCHA 3MWMA 3W1BA 2XIGA 2YI9A 5FNVA 1HR0B 1N32H 5J2UB 3GDEA 3MAQA 3W1GA 5IWAH 4CS2A 1GYFA 4DUYB 4BWAA 4JYAH 4LF8H 1V9PA 3TY9A 4DR2H 5KHKA 4O4LA 3BAAA 4GKKB 2HVRA 4JI1H 4PZ8A 3K5MA 2F93B 1E4FT 3KAJA 5LMUH 1N36B 2GV9A 3DF7A 3N6XA 4RB0A 2WE6A 1WNSA 4I50B 4X1IA 1O9GA 3KAKA 5BMVB 3A2FA 3FFQA 4ZHQA 1S03G 2E3CA 2QJ1A 3QTCA 1I94H 1TA8A 3ETQA 3RYIB 3RYCA 2PYLA 1DGSA 4JI7B 4JI0B 4DV3H 2WDTA 1Q5OA 4CH6A 4FVMA 5IJ9B 2UU9B 5LP6A 1I7FA 4PHZA 3U11A 4K8XA 2HIVA 1JFFB 2ZIOA 3N2GB 4A2BA 4J0MA 1SKVA 3T1YB 4FM9A 5FNVB 1M0TA 4O4HA 2CFMA 2UUCH 2VQFB 1FKAH 4X65B 5LP6C 5K1PA 4FLTA 4DR7H 1IBKB 4EFBA 4O4LB 1HNZB 3SJCC 3N44B 5IYZA 3JASA 3EYYA 2HGSA 4CH4A 4AQYH 4D7SA 4DV4H 4X64B 4B3MH 4UCTA 4X1IB 1FFXB 2RJZA 1E4GT 1FJGH 4PDBA 4ZHQB 4FLUA 3NBZB 3S24A 2Q0AA 2R9AA 1N32B 3BHPA 3DSQA 4GLXA 2XHBA 3RYCB 5IWAB 1IBMH 4L8JA 3BABA 4LF7H 5JJNB 3KALA 3WB0A 3U0ZA 4BWSC 4JYAB 1Z5WA 4B3SH 4F6RA 3UT5A 3GJXB 5LA6A 4LF8B 1Z5VA 1HNWB 5LP6B 3N41B 4JI3H 1TGOA 5ITZA 2VPSA 2OWOA 1N34H 2O03A 4O4HB 4JI1B 4IAJA 3CSXA 4UCOA 1QHTA 4JI2B 4DR6H 3J81W 3N2KA 3J80W 4RB3C 4LNUB 4OX9H 1TAEA 1KU9A 3K5NA 3M7MX 4ETSA 3KXYT 1SA0A 3RF2A 4CS4A 4GYCB 4K0KB 2ZCEA 4MTEA 1P16A 1M0WA 4LF9H 4DK0A 3ZS8C 3TY5A 5LXTA 4ZI7A 1S5JA 5JH7A 1BJTA 4DV7H 4KHPH 2UUAH 2R72A 3RFRA 3VQYA 4TV8B 4PI2A 1J5EH 4O4JA 2PZSA 2UUCB 5KHIA 3RR5A 1HNXB 4YY3B 1O9HA 2HVQA 4R7RA 4LF6B 4F6RB 3UT5B 5LA6B 4B3TH 4DR7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XK5 A;  4DV1 B;  3W5O A;  3VNN A;  1I94 B;  5D1P A;  2ZM6 B;  3RTX A;  1TA8 A;  4AQY B;  1P8L A;  4DV3 B;  3GB8 B;  5D1O A;  5FPR A;  1DGS A;  4DV4 B;  1XMO B;  4JI7 B;  4NXN B;  4JI0 B;  1XMQ B;  3SGI A;  2UU9 B;  2HIV A;  2Q2T A;  3KYH C;  3JSL A;  2VQE B;  3T1Y B;  2CFM A;  2UUB B;  2E5L B;  4LFC B;  2VQF B;  1S68 A;  1N33 B;  4X65 B;  4JI4 B;  4UCR A;  2HHH B;  1IBK B;  4EFB A;  4TOI A;  4JI5 B;  1HNZ B;  1XDN A;  3NBY B;  4GKJ B;  4JI6 B;  4PZ6 A;  4LFB B;  4LH7 A;  4YHH B;  4B3M B;  1FJG B;  4JI8 B;  4LFA B;  4X64 B;  4UCT A;  4DV0 B;  4UCS A;  4LF5 B;  2F4V B;  2HIX A;  1CKN A;  4CC5 A;  5BR8 B;  4DR5 B;  3NBZ B;  2HVS A;  4DR1 B;  3L2P A;  3S24 A;  4B3R B;  1IBM B;  4LF9 B;  3UQ8 A;  4LF7 B;  1N32 B;  4GLX A;  1A0I A;  5IWA B;  4B3S B;  4JV5 B;  2Q2U A;  4X66 B;  3BAB A;  5D1O B;  4DR4 B;  2UUA B;  3TY8 A;  4DV2 B;  4JYA B;  2UXC B;  4UCV A;  4JI3 B;  3NC0 B;  3GJX B;  4LF8 B;  4UCU A;  1HNW B;  1XNR B;  1N34 B;  1B04 A;  4NXM B;  2VUG A;  1ZAU A;  4DR6 B;  2OWO A;  5FPO A;  2UXD B;  1FVI A;  4JI1 B;  5DIS C;  4OX9 B;  4UCO A;  4JI2 B;  1X9N A;  4DUZ B;  3BA9 A;  4EFE A;  3T1H B;  4EEQ A;  4DV5 B;  1TAE A;  4B3T B;  4DV6 B;  3QWU A;  2UXB B;  1IBL B;  4LH6 A;  5LMN B;  4K0K B;  1P16 A;  3JSN A;  4LF4 B;  1VS0 A;  4E6N A;  4UFZ A;  3W1B A;  4DV7 B;  4DRF A;  1HR0 B;  4KHP B;  3TY5 A;  3GDE A;  4EQ5 A;  3W1G A;  1XNQ B;  3BA8 A;  4DUY B;  1CKM A;  4DR3 B;  4DR2 B;  1CKO A;  4CC6 A;  3PN1 A;  3OTO B;  1V9P A;  1J5E B;  3TY9 A;  1CKN B;  3BAA A;  5LMU B;  4GKK B;  2UUC B;  2HVR A;  3RR5 A;  1HNX B;  4YY3 B;  4PZ8 A;  1N36 B;  2HVQ A;  4PZ7 A;  4LF6 B;  4X62 B;  4DR7 B; 
#chains in the Genus database with same CATH topology
 1AJN A;  4O7Z A;  1CE8 A;  1QR9 A;  5D1P A;  3JAM N;  3CHX A;  4DR2 O;  1R3K C;  3CX5 F;  4ZOL F;  4NZM A;  1GLV A;  5IYZ F;  1SYX B;  5KFU A;  2A0L A;  4O4I A;  2XGP A;  2R7Z G;  2XAQ A;  2C2E A;  2QM8 A;  2VWK A;  3I56 V;  4I9Q A;  2FMA A;  4MAM A;  1SA0 B;  1YHQ V;  1Y74 B;  2IJJ A;  1IDS A;  1NBM G;  1AP5 A;  2I8C A;  1N8R W;  2ASD A;  4DRX A;  1QR8 A;  5L3F A;  3KYH C;  2R84 A;  2Y0P A;  3JSL A;  5KHG A;  2XUM A;  4PA9 A;  4A3F G;  5LXT B;  4ICG A;  4N23 A;  5JH7 B;  1S68 A;  2YIB A;  5EZY B;  1KKD A;  3HT5 A;  1FFX A;  1N33 H;  4FFO A;  3C0F B;  5FD5 A;  5IT9 W;  4ED8 A;  4X89 A;  4NXN O;  1Z2O X;  1Q8I A;  3GTM A;  1YEW A;  3FYE B;  2V9W A;  4O3P A;  3JYC A;  3JAK A;  1WB7 A;  4QWD A;  2ALZ A;  1XBL A;  4MVU A;  3T5K A;  5KG6 A;  1HW7 A;  2FYU H;  4WFF A;  3KTM A;  2JJ2 G;  2V58 A;  1FKA O;  2WA3 A;  2CNU A;  3CQZ A;  1R6K A;  2F4V B;  3LSU A;  2FE3 A;  3RVZ A;  5BR8 B;  3THO A;  5D8D A;  2WSS G;  2RCV A;  4LF5 H;  1YJ9 V;  4L1K A;  1A0I A;  3ORR A;  4JAS A;  1Y4M A;  4O4I B;  3JCU Z;  4X66 B;  4TM5 A;  1QLE C;  4UCV A;  3T7A A;  1ZWI C;  2ZD9 A;  4QIW E;  4LFB O;  4LC1 A;  3EPI A;  3CVZ A;  4DRX B;  1B04 A;  4IWY A;  4A3D G;  1ZAU A;  4JAV A;  2GPS A;  3R66 A;  3G80 A;  3RN4 A;  4O4J F;  4YAJ B;  3AW8 A;  1DF5 A;  2FPI B;  4DR5 O;  3RB6 A;  4JI6 H;  2WAQ E;  1OJH A;  4PDM A;  1NQT A;  4YHH H;  1T3N A;  2WLH A;  4LF7 O;  1KJJ A;  4B3S O;  3SJA C;  3G8C A;  2DWE C;  2QWN B;  3JSN A;  2JEF A;  2RF4 A;  3OSN A;  4Q44 A;  3JAK B;  2DW4 A;  4UFZ A;  3T9F A;  3JD1 A;  3GID A;  5A9G A;  1M5I A;  4J7Z A;  3LDC A;  1KBH A;  4M9U A;  2XCA A;  4N21 A;  5L3D A;  1HR0 H;  4DR6 O;  1XNQ B;  4CBC A;  3U55 A;  4J9S A;  2F66 C;  1VF6 A;  5LHG A;  2H94 A;  4DR2 B;  2RDI A;  1N0N A;  1QLE B;  2XCL A;  5IYD O;  2CNQ A;  2P6J A;  1NH2 D;  1F7Y A;  2EJR A;  1KBL A;  4P30 A;  1RPO A;  4CZZ A;  3E8G A;  3O9O A;  4B08 A;  5CB4 F;  3Q8P B;  1M4U A;  4UV9 A;  3OEH G;  2X0L A;  4TWK A;  1XHZ A;  4KHP O;  1JJ2 U;  4MV9 A;  3SI8 A;  1Y1W G;  2CKZ B;  1G6U A;  1W96 A;  1VF7 A;  5KA5 A;  4JAA A;  4OPA A;  3ORQ A;  2DJV A;  3CWB H;  1NU1 H;  4NXN B;  3GWK C;  5K3W A;  4YR2 A;  4DR3 H;  4QW8 A;  1WRV A;  1MZE A;  2R8J A;  4B7K A;  3KG2 A;  4J7J A;  3RAQ A;  4ED7 A;  1VQP V;  3PO2 G;  3HKE A;  2NVY A;  3H20 A;  1Q6I A;  3GIJ A;  2COG A;  2VQF H;  3N40 P;  2LGW A;  4UCR A;  3NR7 A;  2DLN A;  5KG1 A;  4FFR A;  4QE9 A;  2XAJ A;  1COW G;  4CKB A;  1XDN A;  3CCE V;  4JF3 A;  2Z04 A;  5L3E A;  4PZ6 A;  4LFB B;  4I0X A;  2OLS A;  5BWU A;  4DK1 A;  4XYM B;  1H2S B;  3FB6 C;  1Q43 A;  5CA0 F;  1I2K A;  4CC5 A;  4DR5 B;  4RAZ A;  1BNC A;  4PV1 B;  3PO3 G;  4LF7 B;  4LR3 A;  2DYR B;  3LUT B;  2W6O A;  4B3S B;  1K1Q A;  5EWE A;  2UUB H;  1DLB A;  2Y0S A;  4RNO A;  4EYI B;  4DW0 A;  4PI0 A;  4A3K G;  1V55 C;  2IJI A;  2W71 A;  4DR6 B;  2W8K A;  1KB9 F;  2GTS A;  5EIB D;  3N27 A;  1AJP A;  5GON A;  3CCL V;  2X5R A;  4DR1 O;  3PFF A;  2W6N A;  3HKE B;  2W6J G;  2NR5 A;  4RUE A;  4J9Q A;  4JI8 H;  3DC6 A;  2W9A A;  1MAB G;  2IH3 C;  4LH6 A;  3RT3 C;  4O7R A;  3TIN A;  2KSW A;  5CR5 A;  4JTC B;  3PVX A;  4BXX G;  3LWB A;  2GUZ A;  3K59 A;  4KHP B;  3QF7 A;  2PUS A;  4ZI7 F;  4DL6 A;  4EYH B;  1GN3 A;  1K3E A;  4CE5 A;  2CTW A;  3E22 A;  4DR4 H;  2C2A A;  2UXD O;  3LDE A;  3ZHS A;  1OHH G;  5A2Q N;  2H8P C;  4PA3 A;  4DV0 O;  3U0G A;  1IBL O;  4C2M A;  1V55 B;  1OBD A;  1F23 A;  1P4R A;  4FM0 A;  2YW2 A;  3JAW A;  5CBH A;  4DV5 H;  4ZKI A;  4O2A A;  5DAA A;  3L4J A;  4DV1 B;  5KG5 A;  4AHC A;  2W7O A;  5KFA A;  4QGP A;  1MG1 A;  4TQR A;  2V4D A;  5BWR A;  5KFV A;  5KFR A;  5KX5 F;  4ZOL A;  3LDD A;  5GON B;  1XL4 A;  2M6Y A;  2VWJ A;  5LYJ F;  5T14 A;  4GKK O;  3QQM A;  4TUY F;  3T54 A;  3TW6 A;  3QO8 A;  2DOS A;  5BXZ A;  4U3J A;  1R6T A;  3HKD A;  1K8A W;  1SET A;  2JS5 A;  1M1K W;  1CPY A;  5DED A;  3G6V A;  2RDC A;  3IG0 A;  4Q8F A;  4O81 A;  2YZG A;  3L75 H;  4DLK A;  3E22 B;  3K0D A;  3JAT A;  4IZO A;  2ZT9 B;  2JEU A;  4LSX A;  1T5E A;  2NU9 B;  2ZKO A;  3JAM W;  1MNG A;  3IAY A;  5CAE B;  4JI5 H;  2UU9 O;  1PNM A;  4HYK A;  2W9B B;  4MS2 A;  1VQM V;  3JAW B;  1DK1 A;  2R93 A;  2JVD A;  3FD9 A;  4O2A B;  3BVO A;  2P7T C;  4X65 O;  3QG5 A;  4RU9 A;  4DR1 B;  2FK2 A;  5F2V O;  1Z2N X;  4ZOL B;  2W9C A;  1PX2 A;  5IYZ B;  5DLF A;  4JV1 A;  4I55 F;  5I5X A;  4JV5 H;  3PR4 A;  2Q7E A;  4R50 A;  1SER A;  4W4K A;  4U3J B;  4DV2 H;  1XDC A;  3HKD B;  1QQC A;  1SQG A;  2IW5 A;  4MV6 A;  4X64 O;  2W57 A;  3OUZ A;  1EHI A;  1BQZ A;  1RJQ A;  5FPO A;  2UXD B;  2B9Z A;  1KJQ A;  1K97 A;  2JA8 G;  3BEH A;  3C3S A;  4GX5 A;  3ZHQ A;  2VUM A;  2GQR A;  1XHX A;  4MVZ A;  3CRM A;  4X88 A;  3QZ7 A;  4MA0 A;  2CDY A;  3K04 A;  3JAT B;  3TEK A;  5I47 A;  2P4K A;  3T1H H;  4MTX A;  1IBL B;  4ECW A;  1NT2 B;  4HR7 A;  5IJ9 A;  1V4Y A;  2JRI A;  3CRC A;  4Q0Y A;  4LF4 B;  5LL6 Y;  3CE2 A;  2YCH A;  1PP9 H;  2I80 A;  1HNW O;  4JTD B;  2BSK A;  3W7W A;  3I4N G;  5IWA H;  1EKF A;  3MWE A;  5BYB A;  2XC9 A;  2P67 A;  1WA8 A;  4ED2 A;  4JYA H;  2WLL A;  1FPO A;  3JZF A;  3V6K A;  2BR0 A;  1TWF A;  4LF8 H;  1V9P A;  3RVY A;  4GZR B;  5KFE A;  4NLG A;  2CUG A;  3SNO A;  5KT5 A;  4GKK B;  2W9C B;  4IHJ F;  1RFY A;  3RW0 A;  4B3R O;  4PZ8 A;  3MHS C;  2F93 B;  4MV8 A;  5C8Y F;  4RB0 A;  4RNN A;  4UUJ C;  5LGT A;  2WE6 A;  5EC1 C;  3M9M B;  2WPD G;  5I5S A;  3A2F A;  5JVD F;  5KFC A;  2FLP A;  4WFA V;  3BCC H;  1QBZ A;  4MSW C;  4NR1 A;  3PZP A;  4PA6 A;  4EBE A;  2UVU A;  3GTK A;  4DV3 H;  2WDT A;  5CMU A;  3JZ6 A;  2AQ4 A;  3G6B A;  5IJ9 B;  2UU9 B;  4PHZ A;  3U11 A;  1B6S A;  4LF6 O;  4A2B A;  5LMN O;  4EBC A;  3RAX A;  3OUU A;  5I5Y A;  1FXK A;  2CFM A;  2YIC A;  2ZM6 O;  4RQF A;  1IOW A;  4X65 B;  5BWW A;  2R6F A;  1WA8 B;  3H1J H;  3GIQ A;  3FX7 A;  1UC9 A;  2J9G A;  2QTS A;  1B3Q A;  4NTW A;  4EFB A;  4DV4 O;  1IBK B;  1FXK C;  3JD3 A;  3L73 H;  3SJC C;  3N44 B;  5GTI Z;  3R5H A;  3EYY A;  3FAV A;  4FPP A;  2FLN A;  4WFH A;  3L70 H;  2H3O A;  3WO1 A;  2GDS A;  4BY1 G;  2Y69 C;  4X64 B;  4GLW A;  4B3M H;  2E5L O;  4LFC O;  2SCU B;  2B63 G;  2GHY A;  2DE0 X;  3RUP A;  2A7W A;  2NU7 B;  2HR3 A;  4DL4 A;  3DSQ A;  4BR6 A;  2XHB A;  2XTA A;  3OGC C;  3GIL A;  3BAB A;  3AG2 C;  3WB0 A;  4F6R A;  2B1I A;  5KFW A;  1HNW B;  1VQ4 V;  3H3V H;  4RCN A;  4LFA O;  5ITZ A;  4O4L F;  1YVW A;  1EN4 A;  4XYL B;  4CMD A;  1N34 H;  1FXK B;  4ECU A;  4UCO A;  3VBB A;  4WD3 A;  3N2K A;  4IRC A;  4H33 A;  4LF9 O;  5L3B A;  1TAE A;  1KU9 A;  3K5N A;  5BPH A;  3SPH A;  1WCM A;  2JEI A;  3GB7 C;  2Y0I A;  1GM7 A;  2IU0 A;  1YJW V;  2UUA O;  2Y69 B;  4MT8 A;  4GYC B;  5CA1 F;  2ZCE A;  1P16 A;  2HVK C;  1YZB A;  1XL6 A;  2VR1 A;  4O3R A;  1ZL8 A;  1XNR O;  3FAV B;  3TY5 A;  4ZI7 A;  4DV7 H;  3UO2 A;  3CJH A;  4BBR G;  3AG2 B;  2HVJ C;  1E1Q G;  2UVR A;  1AI5 A;  1J5E H;  5DLG A;  1Y1V G;  4NTX A;  5KHI A;  3RR5 A;  4O4H F;  5DGA A;  3MHH C;  3K3P A;  2NVX A;  2R9R B;  4LF6 B;  1GRJ A;  1NR7 A;  4H37 A;  4FK5 C;  2ADQ B;  4F6R B;  5KFL A;  3DGE A;  2IMW P;  2DQ0 A;  4B3T H;  1D5N A;  1ZUQ A;  2ZM6 B;  2QKA A;  5ITZ B;  1R3I C;  5IYB O;  2CZG A;  1EFR G;  2CGO A;  5D5P A;  4AQY B;  2VQD A;  3N2K B;  2YID A;  3KZI Z;  4XDL A;  4Q4D A;  3L4K A;  4DV4 B;  4O7W A;  1I1M A;  5JQG A;  3CEB A;  1TUE B;  2YIA A;  3SGI A;  2YS7 A;  2XOK G;  4P2Z A;  1Q86 W;  3CC4 V;  5A2Q W;  1XMO H;  1G4Y B;  3D8C A;  5LHI A;  1GTO A;  4A2A A;  4KP4 A;  1WP7 A;  1ZL8 B;  2HKO A;  1K9M W;  4ZI7 B;  4LFC B;  1I08 A;  1I94 O;  2E5L B;  3RV3 A;  2QYZ A;  1URF A;  3KHH A;  2CTR A;  3IJ4 A;  1I7N A;  4G27 B;  3APQ A;  1I2L A;  2WLJ A;  1K4D C;  5KFK A;  1YTF D;  3HPL C;  1BHB A;  1VQ7 V;  2HHH H;  2F1M A;  1VBG A;  5IYC G;  1W0K G;  1V51 A;  5J2U F;  4ED1 A;  4ED6 A;  2EIL C;  1I1K A;  2HHF A;  3GWO A;  1TUB A;  4LFA B;  3OGI B;  5I60 A;  4UCS A;  1WPX A;  3STL C;  4DR7 O;  3N8D A;  4LF9 B;  1BMF G;  2VQE H;  1AB3 A;  3K5O A;  2IM9 A;  4LNU A;  3K57 A;  5KMG A;  5LYJ B;  2UUA B;  2JA5 A;  4I55 A;  3T5H A;  1JR9 A;  3CSW A;  3NC0 B;  4I50 F;  5JQG B;  5EWG A;  1F4N A;  4O7T A;  4JI6 O;  4FS1 A;  2AZ2 A;  2UXC H;  3ETG A;  1XNR B;  1W2B U;  3HKZ A;  4DIM A;  4XX0 B;  1GN2 A;  5EOY A;  4KUM A;  2R92 A;  3DTU B;  5C4X G;  1JVM A;  2A3Q A;  5I5T A;  2DIK A;  2ZE7 A;  3ZX6 A;  4AYB E;  1S3J A;  1IBM O;  2F23 A;  5B1A C;  4JGS A;  4LMY A;  2EIL B;  4DUZ H;  4C5A A;  1Y76 A;  4O82 A;  1NTM H;  5LL6 b;  4JI3 O;  3CC7 V;  2Q4P A;  5JJE B;  1YDX A;  2A9H A;  4G3I A;  5FNV F;  5DMX A;  1SQP H;  2AW9 A;  1SC5 B;  3EVK A;  2HHF B;  3ICX A;  5K1X A;  1CQJ B;  4O7L A;  4DL5 A;  2BCC H;  1TUB B;  1VQ9 V;  4JV0 A;  4MV1 A;  3RGB A;  2YS6 A;  2VPQ A;  3RB4 A;  3PN1 A;  3K58 A;  5FR9 A;  3K5H A;  1Y6X A;  2PVP A;  4PA4 A;  1JKJ B;  3S3X A;  4PEL A;  4A3B G;  5KMG B;  1UNN C;  4MTD A;  4J9N A;  4I55 B;  4MVR A;  5J9P C;  3P3P A;  4YJ3 F;  4X1Y A;  1N36 H;  4DV6 H;  5B1A B;  4IRD A;  1I94 B;  5JUM A;  3VPB A;  1U97 A;  3R5X A;  3JAR A;  5F9L A;  5EZY A;  3TII A;  5FPR A;  3WB2 A;  1RSO A;  3CCR V;  2RGV A;  5L1L A;  1Y76 B;  2MW2 B;  4FFB B;  2JK5 C;  3ZCC A;  2JDI G;  1OV9 A;  1A32 A;  3TXS A;  1WPB A;  2RMK B;  1QLN A;  3F7V C;  2WYO A;  4X62 O;  1YI2 V;  2Q2T A;  1JLL B;  3WU2 Z;  2C22 A;  1ARO P;  2YYA A;  3B2E E;  3W7T A;  2CQY A;  4PJ0 Z;  5KFY A;  4QWA A;  1XNQ O;  4I7Z B;  5GTH Z;  2X6A A;  2MK3 A;  4XDJ A;  2BOC C;  3QO7 A;  4A3E G;  1L0L H;  1XMQ O;  3U9T A;  3S3W A;  5CE8 A;  5C3E G;  3E35 A;  5KFM A;  4JI6 B;  2DMX A;  4RZQ A;  4YHH B;  3J80 N;  1EM1 A;  4TV8 F;  4WBN F;  4X1Y B;  2UUB O;  1AP6 A;  2GSM B;  5JVD B;  2EJ7 A;  4RUA A;  3OEE G;  3ETJ A;  4KL1 A;  3JAR B;  1IBM B;  3RYF A;  1HWY A;  2N74 A;  3E89 A;  1S72 V;  2Q2U A;  2CTP A;  5DG9 A;  1K4C C;  1RSO B;  3A0H Z;  1AI4 A;  1P49 A;  4GKJ O;  4JI3 B;  1S77 D;  2W6Z A;  1B33 N;  4FLZ A;  1MZF A;  2EIY A;  3T9D A;  4ECY A;  5KUK A;  3HXL A;  4J9R A;  4Y8V B;  2LGQ A;  4J42 A;  2B1G A;  4FMT A;  4JI8 O;  2QSA A;  4FFP A;  1VAJ A;  3DAA A;  1JDB B;  5DIS C;  5I5W A;  3Q4H A;  3BA9 A;  4Q6G A;  5KAF Z;  3GQC A;  3U54 A;  4JI2 H;  1Q90 D;  3ZRS A;  3ZMZ A;  4O7N A;  4F4Y A;  3T99 A;  2AGQ A;  3M8A A;  4DR4 O;  5DGB A;  4UV8 A;  1XI1 A;  3OHA A;  4Q20 A;  1UFI A;  5CA1 A;  1H8H G;  3H1I H;  4I7H A;  1SQF A;  3HBL A;  2LJ2 A;  4NXM O;  3K9A A;  3NXS A;  3GTJ A;  4DR3 B;  3W7S A;  4QIW A;  3TW7 A;  1V54 C;  4IIJ A;  1YJN V;  1AN7 A;  3E2E A;  4DV5 O;  4X8A A;  1SF9 A;  2UXB O;  3RYF B;  5C1O A;  2XT9 A;  4RB2 C;  4DXW A;  3QFF A;  2F43 G;  2WAQ A;  4RB1 A;  5C5J A;  4YY3 H;  4IR1 A;  4X62 B;  4TQF A;  1WB8 A;  1AI6 A;  1Y66 A;  1M93 A;  2N04 A;  3ZJZ A;  2BQR A;  1VQ5 V;  2AHY A;  3RTX A;  4IWX A;  3FB8 C;  1Q3E A;  4TQD A;  4CH3 A;  3MR5 A;  1JQ0 A;  2V4Q A;  2NUA B;  3HOU G;  5KFZ A;  1XRE A;  1EUC B;  1WR2 A;  3GTL A;  3Q4H B;  3CB2 A;  5AG2 A;  3D3Q A;  1R73 A;  1XMQ B;  5DG7 A;  2DYS C;  4G2K A;  4J9Y B;  3TCU A;  3ZHR A;  3RYH A;  1IUR A;  5CA1 B;  1V54 B;  2HJW A;  3R5F A;  1YIT V;  2W7P A;  4TV9 A;  1KTA A;  3WB1 A;  4FLY A;  2UUB B;  1WH2 A;  1A48 A;  5DQI A;  4ECS A;  4L87 A;  3CMA V;  4IIJ B;  5BYA A;  4APM A;  1VQ8 V;  3G6Y A;  4JI0 O;  3T1C A;  1B6R A;  4NTY A;  1EYZ A;  5BWV A;  4GUN A;  4GKJ B;  4U7N A;  4QPJ A;  4FE2 A;  2XCP A;  3ABM C;  5J2U A;  3H1K H;  3T1Y O;  4JI8 B;  4JI7 H;  2IP4 A;  4J7K A;  3TQ1 A;  1AR4 A;  2YXY A;  4R8C A;  5JJJ B;  1A3G A;  2DYS B;  5KFP A;  4DV1 O;  2F4V H;  4HN2 A;  4QWC A;  4PDR A;  5BR8 H;  1SZT A;  5DQH A;  1HNZ O;  4DR4 B;  4X66 H;  3CCS V;  4I50 A;  1PM9 A;  4K6N A;  3RYH B;  1PNL A;  1PNK A;  5FL7 G;  4NXM B;  1KJI A;  1UPG A;  1W0J G;  4TV9 B;  1E1R G;  2JEX A;  4BW9 A;  1OBG A;  1N56 A;  4DV5 B;  2OYQ A;  4XDK A;  2R8G A;  5IWA O;  2UXB B;  1NVP D;  2ZE8 A;  3NGD A;  2IBK A;  4J9M A;  4JYA O;  3N2G A;  4A3L G;  2QWR B;  5BZB A;  5DGI A;  4LF8 O;  2C35 B;  3L71 H;  3V4S A;  4TT3 G;  3MWM A;  2YZM A;  2YI9 A;  4Z2W A;  5FNV A;  3K06 A;  1N32 H;  5J2U B;  3MAQ A;  2YRX A;  3SYO A;  1LNQ A;  4CS2 A;  2LW1 A;  1GYF A;  1K7D A;  5B1N A;  3AK1 A;  1VQK V;  1KP2 A;  1CS0 A;  2J6T A;  4DR2 H;  4BIO A;  2HG8 A;  1I7L A;  3G4S V;  5L3C A;  2WTF A;  2R93 G;  4RO2 A;  4RAI A;  1M90 W;  4JI1 H;  4K0K O;  2LW7 A;  4FBU A;  1KKC A;  1US6 A;  4G28 B;  1F51 A;  4J9O A;  1KYO F;  3EHB B;  1WNS A;  2Q73 A;  3ABU A;  4I50 B;  1O9G A;  1MSD A;  2LO1 A;  5EBM C;  3WG7 C;  4ZHQ A;  2COJ A;  3T9C A;  3T5L A;  2E3C A;  1JPX A;  3T9E A;  3KCY A;  3M9O B;  3ETQ A;  2PYL A;  4YB8 B;  2Y4R A;  3WWI A;  1DGS A;  3ETD A;  2Q68 A;  4RUC A;  4JI0 B;  3FDS A;  1Q5O A;  1P84 F;  2DWC A;  1HNX O;  4A3C G;  3ABL C;  2VUM G;  2HIV A;  3N2G B;  2ZIO A;  4A3J G;  4PBC A;  2QGN A;  3I12 A;  3ZMV A;  3H0G A;  3T1Y B;  5J2T F;  2PMZ E;  5FNV B;  2W9B A;  2V4R A;  5DQG A;  4LF4 O;  5HV6 A;  4D6T H;  5H2F Z;  3MWD A;  1FKA H;  1C30 A;  2DAB A;  2K1E A;  3ABT A;  3T9B A;  5K1P A;  3DXR A;  1R1B A;  1WLE A;  5B1O A;  4FLT A;  2Q7D A;  4A3G G;  2JA7 A;  2FB9 A;  4HQ6 A;  2Q5Z A;  1HNZ B;  1S97 A;  2GLT A;  4Q8E A;  4CHI A;  3WG7 B;  5IYZ A;  2ODM A;  4WHX A;  5DG8 A;  4FIP C;  4CH4 A;  1MA1 A;  1BSM A;  3QZ8 A;  1JDE A;  2LQT A;  2YUA A;  2ARH A;  2R8K A;  2QA4 V;  3GTO A;  3E5N A;  4ZHQ B;  3RBZ A;  3NBZ B;  3UFX B;  3ABL B;  1ZTE A;  3PR5 B;  4DYL A;  5KT6 A;  3MR2 A;  1SES A;  4GLX A;  4UVC A;  3R23 A;  5IWA B;  4U7C A;  5KG3 A;  4YQW A;  4LF7 H;  3KAL A;  2HGX A;  1KC8 W;  2OIE A;  4B3S H;  4JYA B;  1Z5W A;  4LF8 B;  3B09 A;  3N41 B;  3Q8Q B;  2GPW A;  2YDE A;  1TGO A;  2VPS A;  3GV8 B;  1Y67 A;  3CSX A;  1N0J A;  4DR6 H;  1ZSP A;  5FJ8 G;  3J80 W;  3SYQ A;  3M7M X;  4GX2 A;  3TXQ A;  5K2M A;  2AGA A;  3KXY T;  2BE3 A;  3P30 A;  3DXR B;  3DTF A;  1K1S A;  5FLX N;  4K0K B;  3ZHT A;  4H0L B;  1IBK O;  1E4E A;  2RNB A;  3UM7 A;  3ZS8 C;  1NI8 A;  2Q8V A;  1S5J A;  1BJT A;  4QNH B;  4KHP H;  1EBO A;  3RFR A;  3VQY A;  2FPP B;  4TV8 B;  3E86 A;  1ROP A;  2PI5 A;  2YXH A;  2ITC C;  3GTQ A;  2R7L A;  3E8H A;  4GCZ A;  4X9Q A;  4B3T O;  4I4T F;  4O4J A;  3F5T A;  3MD0 A;  1HNX B;  4RQE A;  3AK2 A;  1O9H A;  2HVQ A;  2FKX A;  3B8M A;  2Y4T A;  1PKX A;  5KUM A;  4J9P A;  2JA6 A;  2F95 B;  5LHH A;  1GK9 A;  4J11 A;  4RAY A;  1L1F A;  4JZG A;  1SRY A;  1SQX H;  2ZNI A;  3SPC A;  4C7U A;  2AHZ A;  3Q8S B;  3OAA G;  2W0X A;  5LMU O;  2W70 A;  3VOT A;  3T4Z A;  2Q9L A;  3VPC A;  2IBZ H;  2EIJ C;  2VOB A;  5B3S C;  4FM2 A;  3OTO H;  1C3O A;  1E4E B;  1M56 C;  2XND G;  5CB4 A;  2VA2 A;  3HKC A;  1EKV A;  2Q7H A;  5LA6 F;  1CEZ A;  4O4J B;  1N4C A;  2WB1 E;  1QVG U;  4D7T A;  2E74 B;  1Q6H A;  2JGD A;  4LH7 A;  2YIB D;  1KEE A;  3FKS G;  2XD4 A;  1K83 A;  5IP9 G;  1D2D A;  1VEW A;  1K92 A;  4WCE V;  4GX0 A;  4FFM A;  1BCC H;  3UYY A;  2EIJ B;  4MVS A;  2HVS A;  3L2P A;  1EKP A;  3RGX A;  3ZHU A;  4O7Y A;  4DR1 H;  3ABK C;  4MTG A;  3GII A;  3N43 B;  4AQY O;  5B1B C;  3JAL A;  4MTF A;  2R8H A;  4JI4 H;  5BMV F;  1N48 A;  1GO3 F;  1BQ0 A;  3E83 A;  3AYH B;  2MCT A;  1FJG O;  1ZX3 A;  5IE9 A;  1JX4 A;  1JOY A;  3JRW A;  3U10 A;  1VQO V;  5CB4 B;  1AI7 A;  4HNU A;  4YR3 A;  4FS2 A;  1GSO A;  4P9O A;  2UXD H;  4EEQ A;  2W6P A;  3HKC B;  5CA0 A;  4B3T B;  1HDJ A;  3QWU A;  4DV0 H;  5KFJ A;  3VQV A;  3AK3 A;  4DL2 A;  4RNM A;  1IBL H;  1VS0 A;  2ZIN A;  1GH6 A;  3OE7 G;  3LML A;  3BY6 A;  4E2L A;  2CTQ A;  3TGU H;  2JGD B;  1W93 A;  1X4T A;  1Z2P X;  2A1H A;  1WSC A;  1U96 A;  1T36 A;  1YIJ V;  3ABK B;  4ZIB A;  3DTG A;  5JWP A;  3KHG A;  3MFH A;  4OX9 O;  1VP7 A;  4CC6 A;  1H2M A;  5B1B B;  2XGQ A;  1GM9 A;  1P7B A;  5HFM A;  4DV6 O;  2P0A A;  1K33 A;  4BW5 A;  5LMU B;  1QNM A;  2YEV A;  5IYB G;  2R8I A;  3R9R A;  4GKK H;  4YXW G;  2X6B A;  1RYR A;  2EZO A;  3JAL B;  5H80 A;  3LP8 A;  1G8M A;  3OD4 A;  4J9K A;  2ITD C;  3VNN A;  5IJ0 A;  3JD0 A;  3RGZ A;  2OCH A;  2EJ0 A;  1WAZ A;  4ZQI A;  4JUZ A;  5LGU A;  2X7R B;  4R8U A;  4C5C A;  4UVA A;  3L74 H;  3GVM A;  3TQT A;  2VA3 A;  1NS1 A;  2PN1 A;  1K5Q A;  4DW1 A;  5CA0 B;  3A0R A;  2I87 A;  5KFI A;  1FS0 G;  2ZIM A;  1I50 A;  2R92 G;  3PW0 A;  1FYJ A;  1NH2 B;  4PWQ A;  2UU9 H;  3H01 A;  1YXB A;  2L6L A;  2VQE B;  1RPR A;  3MFI A;  3FB5 C;  4ECQ A;  4MW8 A;  1GAX A;  4JV2 A;  4RWU A;  4F50 A;  2P4V A;  4X65 H;  3WNZ A;  4HNT A;  1VQL V;  4QJF A;  5KX5 A;  4HAM A;  5CM0 A;  3RB0 A;  2YEV B;  2YS8 A;  5LYJ A;  1M57 C;  1R3J C;  3J81 N;  3UZB A;  2JEG A;  1I1L A;  4TUY A;  4ECT A;  1FJG B;  3TIG A;  3GTP A;  2BTQ A;  4DL3 A;  1N33 O;  1DV2 A;  5KLV H;  2XAS A;  1CKN A;  5IJ0 B;  4QWB A;  3W7U A;  2HDK A;  4NYE A;  3SR2 C;  3VA7 A;  1RJP A;  4R8U B;  2YI8 A;  4FLW A;  2YL2 A;  4X1K A;  2DAA A;  3TY8 A;  1H2N A;  1Q82 W;  4UCU A;  3FKI A;  2V1D A;  2PGG A;  2WWW A;  4HNA A;  5EIB C;  3SPI A;  1HNW H;  2YZN A;  4I5S A;  4H44 B;  4LF5 O;  3CRA A;  1FVI A;  5J2T B;  4OX9 B;  4QPK A;  3IFX A;  4U7O A;  1IXB A;  2C28 A;  3GTG A;  5EBW C;  4AIL C;  4IYH A;  3RJ0 A;  5KFF A;  4ED0 A;  1M57 B;  1QCE A;  3F8N A;  5H5N A;  2WLM A;  4DV6 B;  2R7M A;  1I6U A;  3WFV A;  4IGG A;  4YR0 A;  4NB5 A;  1AR1 B;  4WFG A;  4QJF B;  1IYE A;  2FJZ A;  5KX5 B;  4B3R H;  2FTK A;  4DRF A;  3CXC U;  1EUD B;  4EGQ A;  2YXL A;  2NN4 A;  3JD4 A;  4R7C A;  2HP8 A;  5L1J A;  4C5B A;  4TUY B;  2EBO A;  4CKC A;  4R6Z A;  1K73 W;  2Q67 A;  4YHH O;  2B5U A;  2BTQ B;  3P32 A;  1CKO A;  1VKZ A;  2V7Q G;  1CKN B;  1NKD A;  3LSQ A;  2ATK C;  1D5A A;  3H4B A;  4I4T A;  5CN0 A;  3K03 A;  5KFS A;  3BFR A;  1AIL A;  4AYB A;  4X1K B;  4PZ7 A;  1HR0 O;  4FFB A;  5L1I A;  3HB3 B;  5KS8 A;  4LF6 H;  5FLX W;  4MV3 A;  1ENV A;  4M7E A;  5LMN H;  1S9F A;  2R7N A;  4HNA B;  2R86 A;  4FLX A;  3SYC A;  1GN6 A;  1RK5 A;  4ECZ A;  3V6H A;  2ZM6 H;  2UXN A;  2AZ0 A;  2CAZ C;  3GB8 B;  1GGO A;  1WN7 A;  4DUY H;  4H13 B;  2JEJ A;  4MA5 A;  2CW8 A;  1NTK H;  1KUQ A;  2J6S A;  5EK0 A;  5JQW A;  1OZ0 A;  5LOV F;  4IHJ A;  5C8Y A;  1R9T A;  1N33 B;  3CCQ V;  1XOU A;  2E5L H;  2G38 A;  5I5V A;  4LFC H;  1GN4 A;  2OTJ V;  4O86 A;  4DR3 O;  5JVD A;  1M7J A;  2KKW A;  4TOI A;  2FB5 A;  4I4T B;  3EXA A;  3X2Q C;  2ZDG A;  3RBE A;  1I5X A;  3GIM A;  1VF5 B;  1K34 A;  2Z5U A;  3ML0 A;  3RIZ A;  5KT4 A;  1JCH A;  5GON F;  4ECX A;  3LQS A;  2FPG B;  4EBD A;  4M0J A;  3BPZ A;  2JJ1 G;  3ZRW A;  4NZO A;  2HEP A;  2VQF O;  4LF5 B;  4LFA H;  1KUT A;  4O7S A;  4BIU A;  3K3W A;  2QWQ B;  4MVO A;  4O2B F;  1AVM A;  2OH2 A;  3ZBH A;  2CW7 A;  5KT2 A;  3JAS B;  3F5W C;  2DQ3 A;  3K5L A;  5BMV A;  1GO3 E;  3FMA A;  5KFB A;  4RZR A;  4UXN A;  2Z02 A;  1L2Z A;  4YAK B;  4PD4 F;  3ETH A;  4IHJ B;  1XNR H;  3J7A K;  3IC9 A;  4CS3 A;  1RJR A;  5C8Y B;  4JTA B;  3X2Q B;  4FBT A;  2KQX A;  1TWA A;  4BY7 G;  5KA6 A;  4J9Z B;  4FZ1 A;  5EC2 C;  3M4I A;  2QF7 A;  3W1B A;  2XIG A;  2M05 A;  4DO2 A;  1HR0 B;  1FAF A;  5CBG A;  1S0O A;  3UZO A;  2W8L A;  4JI1 O;  3M99 B;  3ZRW B;  1BT8 A;  3CCU V;  3AX6 A;  2IJK A;  3P3N A;  3SYA A;  4O4L A;  3A8T A;  5E1A C;  1XUQ A;  2ASL A;  3QVN A;  1H2K A;  3K5M A;  3KAJ A;  1E4F T;  4WF9 V;  3H1H H;  5H6Q A;  3OMN B;  1S0N A;  4CMF A;  1KC7 A;  4X1I A;  3KAK A;  1IZ3 A;  5BMV B;  1L0N H;  3FFQ A;  5IYD G;  3MR3 A;  4ECV A;  3B40 A;  1S03 G;  3QO5 A;  1DIK A;  3QTC A;  4QW9 A;  4OGQ B;  1I94 H;  2WLN A;  3RYC A;  4GC7 A;  4JI7 B;  3ZIA G;  3F7Y C;  3OM3 B;  3OMI B;  3T2M A;  4FVM A;  3OUF A;  4HYO A;  3GLK A;  4ED3 A;  2EUL A;  4J0M A;  2EJ3 A;  3KHR A;  3ZMU A;  4FM9 A;  1M0T A;  4E4T A;  4O4H A;  2UUC H;  2YWV A;  2VQF B;  3CXH F;  1BXR A;  3GV7 B;  3BJY A;  3AEI A;  1KT8 A;  1BL8 A;  3GIP A;  4DR7 H;  5I5U A;  4O4L B;  1CP9 A;  5FLM G;  5KG0 A;  4IYI A;  5B5E Z;  1GMG A;  2FML A;  3K79 A;  4IR9 A;  2ABJ A;  2CNV A;  1SCU B;  3BAC A;  2R85 A;  3CD6 V;  4D7S A;  3OFN G;  3G8D A;  4UCT A;  4X1I B;  1FFX B;  2RJZ A;  4PDB A;  5JVL A;  1H2G A;  2NLJ C;  3CEI A;  2Q0A A;  2R9A A;  1VQN V;  1N32 B;  3BHP A;  3RYC B;  4JI5 O;  3CS5 A;  1IBM H;  3T9A A;  2UVW A;  2BOB C;  2L35 A;  1IXM A;  3U0Z A;  1BS3 A;  4PDL A;  3UT5 A;  4Z1V A;  4AI8 A;  3TJT A;  2R7Z A;  1Z5V A;  4JI3 H;  3HB9 A;  1ORQ C;  3Q8R B;  4QSH A;  3HOW G;  1AUX A;  2JS3 A;  2OWO A;  2W6M A;  2O03 A;  4O4H B;  4JI1 B;  4IAJ A;  5KG4 A;  2E2H A;  2Z0A A;  1QHT A;  3QNE A;  5BPF A;  3J81 W;  3CCM V;  4B7E A;  5GW7 A;  2WA4 A;  1CXZ B;  3I55 V;  1VF6 C;  1W59 A;  3IGA C;  4JV5 O;  3H0G G;  3RF2 A;  1PD3 A;  4CS4 A;  3VPD A;  3HR0 A;  4DV2 O;  3K9S A;  4A5U B;  4GC6 A;  1FFT B;  1EZ1 A;  4J41 A;  1UC8 A;  4K3A A;  2HJD A;  2QM7 A;  3RFC A;  3T4D A;  2JA7 G;  2R72 A;  4LWS A;  2YC0 A;  4J9L A;  3PW2 A;  5LGN A;  2HGW A;  3T1H O;  1FXH A;  1AJQ A;  3ASO C;  1CQI B;  3HOV G;  5KG2 A;  2NU6 B;  4WFE A;  2DYR C;  2IU3 A;  4ZBM A;  2C2D A;  4O7V A;  2DPI A;  3ABM B;  2R9I A;  3UT5 B;  1YSC A;  5BWX A;  4X62 H;  3SJQ C;  4GT1 A;  1O75 A;  1SEI A;  1LR1 A;  4J80 A;  3VQW A;  3OTO O;  2BQU A;  4QE7 A;  3UO3 A;  5C93 A;  5D1O A;  4FFK A;  1XNQ H;  1Y14 B;  3W7X A;  4ME6 A;  1BHA A;  2QWP B;  2P06 A;  3PJS K;  3BQ0 A;  1DTO A;  1XMQ H;  1I0H A;  2CH7 A;  4BIZ A;  3JD2 A;  5LOV A;  3ASO B;  1KQS U;  2Y48 A;  1JIH A;  1T94 A;  3ASN C;  3CRQ A;  2Y0S E;  2RQ6 A;  2NNU A;  4LWS B;  4YJ3 A;  1F4M A;  4YJ2 F;  4DV3 O;  1L8D A;  2PBZ A;  2FK1 A;  1OCR C;  1S10 A;  4W4L A;  4JI5 B;  4F4Z A;  1JJO A;  2C00 A;  5L3G A;  3HOY G;  4YBZ B;  4F6E A;  3PW4 A;  2V59 A;  4MVQ A;  4GKJ H;  2Z3Y A;  1ZLZ A;  3OMA B;  1ULZ A;  4O84 A;  4NXN H;  3OUS A;  1G1X B;  3SYP A;  2XAH A;  5KHH A;  1ET0 A;  4P9P A;  4O3N A;  3CCV V;  4JI4 O;  1IOV A;  5KFD A;  1DAA A;  2PMZ A;  2P5O A;  4O2B A;  1Y1W A;  1GKF A;  2WLK A;  4JV5 B;  4O83 A;  5D1O B;  2YZL A;  3WWH A;  3HKB A;  4I0X B;  3K0G A;  4DV2 B;  1WP8 A;  2JA6 G;  1XIL A;  5DM6 V;  1H2L A;  3ASN B;  4B3M O;  1YTF B;  2CH7 B;  1SQV H;  1G2W A;  2BQ3 A;  2P22 C;  4O3Q A;  2RDJ A;  1OCR B;  1KMI Z;  3BRC A;  5LOV B;  4NXM H;  2Q6A A;  4JYC A;  1B6Q A;  4F4W A;  1X9N A;  4LFB H;  1TWC A;  2ZXW C;  3T1H B;  4WBN A;  4TV8 A;  2ODT X;  4YJ3 B;  4FZ0 A;  2HLD G;  3CYO A;  3VQX A;  5KKN B;  5KFT A;  1NZ6 A;  2UXB H;  2ZE5 A;  2KG7 A;  1RM1 C;  4DR5 H;  1EZJ A;  3K08 A;  5KAI Z;  4A3M G;  1TWH A;  1MZB A;  3R65 A;  1TVK A;  1PL0 A;  2PY5 A;  4EQ5 A;  2FLL A;  1N34 O;  1M9N A;  4RUF A;  4DQN A;  3BA8 A;  5KFQ A;  1TWG A;  5HNE A;  3VMM A;  1PPJ H;  4GX1 A;  5JQG F;  4HBN A;  3LSS A;  3OTO B;  2QE7 G;  4X20 A;  2VS0 A;  1A9X A;  2YU9 A;  1S5H C;  4O2B B;  3CME V;  1MSW D;  2BTO A;  3UKM A;  2GUZ B;  3L72 H;  4CH5 A;  2A06 H;  3HKB B;  4FLV A;  4DV7 O;  5JCO A;  2ZXW B;  1SFO A;  1XK5 A;  1Q81 W;  4FFL A;  4JZ2 A;  3AG7 A;  4NKG B;  3H4D A;  4NYK A;  4MV4 A;  1H8E G;  5IP7 G;  1PK8 A;  4WFB V;  3K3V A;  1J5E O;  1RM1 B;  4JYY A;  1P8L A;  5JCO C;  4DV3 B;  3BQ1 A;  1LUV A;  1IVS A;  1OCC C;  5L1K A;  4WBN B;  4ECR A;  2ZNJ A;  2Y4U A;  5LP6 F;  3SJB C;  4JI0 H;  2E76 B;  4A3I G;  3ZMS A;  3TET A;  2KG7 B;  2Q7G A;  2QM4 A;  3CCJ V;  4ASU G;  1TVK B;  3BQ2 A;  1OCO C;  3IN5 A;  4XBF A;  2W6Q A;  4PA7 A;  1HP8 A;  2NU8 B;  1X59 A;  3V6J A;  2D2C B;  3T1Y H;  3ZMT A;  3N42 B;  4XZ3 B;  2PTM A;  5H6R A;  4A93 G;  4JI4 B;  2ZDI A;  4FGR A;  4EB6 A;  2EX3 A;  3KKY A;  4DV1 H;  1VIB A;  4X20 B;  1XMO O;  1K5S A;  3LNN A;  3VOU A;  2QEX V;  2CGN A;  3NBY B;  1JA8 A;  1HNZ H;  2FL4 A;  3Q2O A;  4FJC C;  2ZDI C;  3ZED A;  4B3M B;  1KEC A;  5F9N A;  3V4Z A;  1OCC B;  4DV0 B;  2Q69 A;  3ZHV A;  2PYJ A;  2YRW A;  2PF4 E;  5KT7 A;  1WCM G;  3IC7 A;  3JCZ A;  2HHH O;  2ZR2 A;  5EYP A;  5IY5 C;  2AU0 A;  5KFH A;  1KJ8 A;  1JMK C;  5EWF A;  3RB3 A;  1OCO B;  2EIM C;  2R70 A;  4U6P A;  4EEY A;  5D5Q A;  2ZJT A;  2HG5 C;  3O65 A;  1N34 B;  2ADP A;  4YIO A;  3MJF A;  3AG3 C;  2VUG A;  2FKL A;  4MW3 A;  1EZV H;  2UXX A;  5CBF A;  2WB1 A;  2X6C A;  3EPG A;  3GV5 B;  2QDO A;  4I9W A;  2VQE O;  3RWR D;  4O3S A;  3G6X A;  4EB6 B;  1ZQ7 A;  5HFL A;  1RP3 B;  1THZ A;  5B3S B;  2UXC O;  1RK6 A;  3TK1 A;  4E6N A;  4K0K H;  4DV7 B;  5LXT F;  1M56 B;  5JH7 F;  3KHL A;  4Q43 A;  5EZY F;  3SPG A;  5IY5 B;  5FD6 A;  1CKM A;  4F4L A;  2DN9 A;  2EIM B;  5KHJ A;  1EN5 A;  4DUZ O;  1J5E B;  4LBE C;  4UB8 Z;  2UVV A;  4LSA A;  2M7W A;  1VBH A;  4EG0 A;  3AG3 B;  5EYP B;  3UCS C;  2BSK B;  4JYB A;  2DPJ A;  2IH1 C;  1OWT A;  1HNX H;  4DL7 A;  3B8N A;  2ZDH A;  3LUL A;  3ETE A;  1IYD A;  2WLL B;  5IT9 N;  2QWO B;  3W5O A;  2KSD A;  4DUY O;  3FYI B;  3AG4 C;  3CP1 A;  1BE3 H;  4LF4 H;  5L9X A;  3ZRV A;  4FM1 A;  1KP3 A;  1MMM A;  4O4I F;  4NZN A;  4K8Z A;  3OTF A;  1VQ6 V;  5E79 Z;  4UUG A;  3FKI G;  1SZX A;  1XMO B;  3JZI A;  4E4E A;  1VAR A;  2E75 B;  2WLI A;  1N36 O;  4MV7 A;  2XAG A;  1AUV A;  3HOZ G;  3G6E V;  2QB5 A;  1AR5 A;  2OTL V;  2FP4 B;  2D3O W;  1ZHS A;  2IJH A;  3C90 A;  1Z2G A;  1R6N A;  4JAU A;  1SS3 A;  5H9C A;  4YJ2 A;  2HHH B;  2GTA A;  2AGP A;  3SE7 A;  5KG7 A;  2JA5 G;  3ZN0 A;  5IDJ A;  3AG4 B;  1BZK A;  2EZP A;  2FK3 A;  2K9P A;  1B06 A;  4NVP A;  1SQB H;  2QK4 A;  3KRE A;  1XEQ A;  4EKW A;  1GSA A;  2RGR A;  3ZRX A;  2YSU B;  2HIX A;  2R82 A;  4EGJ A;  4KXR A;  3SPJ A;  2J6U A;  4BAY A;  5J2T A;  4B3R B;  4BBS G;  3UQ8 A;  4OXS A;  2LFS A;  1ZHQ A;  4MTO A;  1OCZ C;  4QWE A;  1NR1 A;  1S0M A;  3J7A U;  4IL6 Z;  2ZE6 A;  2UXC B;  2JGU A;  3CC2 V;  4QIW F;  5KT3 A;  2WLI B;  2LP7 A;  2QR4 A;  4IIJ F;  1IBK H;  4TVI A;  3G71 V;  3AG1 C;  4JPR A;  3GIK A;  3RYI A;  4DUZ B;  4EFE A;  5EDW A;  3HO8 A;  2A79 B;  4X64 H;  2AXT Z;  4YJ2 B;  5LMN B;  3E8F A;  1DF4 A;  2OIG A;  1JFF A;  3U9S A;  2O57 A;  1BGW A;  1XQ8 A;  2QTO A;  2C2R A;  3GDE A;  3W1G A;  1LUW A;  1OCZ B;  1S76 D;  4DUY B;  5KFX A;  4BWA A;  2R87 A;  3RV4 A;  4JI2 O;  5HBR B;  3A0B Z;  3H9V A;  2XAF A;  1J95 A;  1QU7 A;  3APO A;  3TY9 A;  4Q4C A;  4HNV A;  3T5J A;  3KCX A;  5KHK A;  1NTZ H;  1PV0 A;  3H1L H;  1DV1 A;  3OR7 C;  3NUA A;  3BAA A;  4IRK A;  2B63 A;  1YCI A;  4TV9 F;  2HVR A;  3AG1 B;  3C3T A;  5LMU H;  1N36 B;  2GV9 A;  3DF7 A;  3N6X A;  3OT7 A;  1FD9 A;  5C1P A;  2EIN C;  3WO0 A;  3CPW U;  5BY1 A;  3CJH B;  3B77 A;  1EN6 A;  1NVP B;  4Q45 A;  1JX9 A;  4ABM A;  4DAA A;  4F4X A;  3D36 A;  4U3F H;  2ZDQ A;  2W6I G;  2QJ1 A;  1TA8 A;  3RYI B;  4OPH A;  3D3I A;  3OSP A;  3L9D A;  4UB6 Z;  2UUC O;  3I5D A;  4UVB A;  2R7K A;  1P7G A;  4CH6 A;  4KFM A;  1Q6U A;  4YY3 O;  3D36 C;  5B66 Z;  3E8B A;  5LP6 A;  2ZQM A;  1I7F A;  2HFE C;  4CKE A;  4K8X A;  5KFO A;  1JFF B;  3MR6 A;  1SKV A;  2ZR3 A;  2ILM A;  1GM8 A;  1VMG A;  1S5L Z;  4JXU A;  2CK3 G;  1I5Y A;  4IT5 A;  1S0V A;  3MDS A;  1E79 G;  3BG5 A;  1H38 A;  5LP6 C;  2V5A A;  4YIP A;  1NJI W;  2KB1 A;  5DN6 G;  2P90 A;  2EIN B;  3HKZ E;  1UJW B;  4TQS A;  2ETN A;  1A0G A;  5LBQ A;  2WAM A;  2EJ2 A;  3JAS A;  5TIS Z;  2HGS A;  2OCC C;  4O3O A;  4AQY H;  1YF2 A;  2LFR A;  2E2I A;  3G67 A;  4DV4 H;  1Y1V A;  5KFG A;  4MVM A;  1I3Q A;  1E4G T;  1R3L C;  3LNM B;  2ASJ A;  1FJG H;  5IYC O;  4Z1M G;  2GBO A;  4FLU A;  1FXV A;  3S24 A;  1ZET A;  2N05 A;  1IX9 A;  5EBL C;  4PDV A;  4FFN A;  4LCU C;  4L8J A;  1RYS A;  5JJN B;  2HJF C;  2VRZ A;  1M6V A;  4YP3 A;  4BWS C;  4K35 A;  5CA3 A;  3WWJ A;  3GJX B;  5LA6 A;  1GSH A;  1MOF A;  2QKC A;  4TSF G;  2OT5 A;  4JI7 O;  2IA6 A;  3HOX G;  5LP6 B;  2AGO A;  3EFF K;  3H40 A;  5DGH A;  2COI A;  5C44 G;  3B4S A;  2F4V O;  3OHB A;  3ZN1 A;  2ATL A;  1JXL A;  2W0F C;  5BR8 O;  4JI2 B;  3FB7 C;  1KJ9 A;  2EIK C;  1WJZ A;  2PI4 A;  5E25 A;  4RB3 C;  4LNU B;  2OCC B;  4ETS A;  4OX9 H;  3RBD A;  1QVF U;  1SA0 A;  4X66 O;  1Y74 A;  3OR6 C;  2ZGI A;  1KD1 W;  4J10 A;  4MTE A;  3M9N B;  4FU0 A;  4ZHQ F;  1Q7Y W;  2CE4 A;  1M0W A;  1SQQ H;  4HZ3 A;  5DEC A;  4DK0 A;  4LF9 H;  4LP8 A;  2DZD A;  5LXT A;  5JH7 A;  1PL4 A;  2X0S A;  2UUA H;  3N6R A;  2DWD C;  3OW2 U;  2GQS A;  3K5I A;  3PW7 A;  4PI2 A;  3I4M G;  3DC5 A;  1BGY H;  2PZS A;  2UUC B;  3SDL A;  4YY3 B;  2RN9 A;  3JRX A;  3PW5 A;  2Q0O C;  1N32 O;  3Q1K A;  4R7R A;  3STZ C;  3CRR A;  4O2A F;  2JIZ G;  5KFN A;  5LA6 B;  2EIK B;  2QKS A;  5BWT A;  4DR7 B; 
#chains in the Genus database with same CATH homology
 4X62 H;  1O75 A;  2F95 B;  5D1P A;  3CHX A;  2ZM6 B;  1SEI A;  5ITZ B;  4RAY A;  3VQW A;  5D5P A;  1SYX B;  4AQY B;  2ZNI A;  3N2K B;  4O4I A;  5D1O A;  3L4K A;  4DV4 B;  2VWK A;  4I9Q A;  1XNQ H;  5JQG A;  1SA0 B;  2YIA A;  3SGI A;  5A2Q W;  1XMO H;  2VOB A;  4FM2 A;  3OTO H;  1XMQ H;  4DRX A;  4A2A A;  3KYH C;  3JSL A;  5LOV A;  5KHG A;  5CB4 A;  5LXT B;  4ZI7 B;  4LFC B;  5JH7 B;  2E5L B;  2YIB A;  1S68 A;  5EZY B;  2RQ6 A;  1FFX A;  4YJ3 A;  3HKC A;  1N33 H;  2Q7H A;  3C0F B;  1L8D A;  5FD5 A;  5IT9 W;  1Z2O X;  1Q8I A;  4JI5 B;  1YEW A;  1JJO A;  2HHH H;  2F1M A;  4O4J B;  3JAK A;  4D7T A;  4LH7 A;  1HW7 A;  4GKJ H;  2YIB D;  1TUB A;  4LFA B;  4NXN H;  4UCS A;  2F4V B;  2FE3 A;  5KHH A;  5BR8 B;  3THO A;  2HVS A;  3L2P A;  4LF5 H;  4LF9 B;  3RGX A;  2P5O A;  4O2B A;  2VQE H;  1A0I A;  4DR1 H;  3K5O A;  4JV5 B;  2IM9 A;  4O4I B;  4X66 B;  4LNU A;  3K57 A;  5D1O B;  5KMG A;  3HKB A;  5LYJ B;  2UUA B;  4I55 A;  3N43 B;  4DV2 B;  3NC0 B;  3JAL A;  4UCV A;  5JQG B;  4JI4 H;  2UXC H;  1XNR B;  3CVZ A;  2MCT A;  4DRX B;  1B04 A;  5EOY A;  1ZAU A;  2P22 C;  1KMI Z;  3BRC A;  5LOV B;  4NXM H;  3U10 A;  5CB4 B;  1X9N A;  4JI6 H;  2UXD H;  4LFB H;  3T1H B;  4EEQ A;  4WBN A;  4TV8 A;  4LMY A;  4YJ3 B;  4YHH H;  4DUZ H;  3HKC B;  5CA0 A;  4B3T B;  3QWU A;  3VQX A;  4DV0 H;  3SJA C;  3VQV A;  5LL6 b;  2UXB H;  1IBL H;  3JSN A;  1VS0 A;  5JJE B;  4DR5 H;  3JAK B;  2ZIN A;  4UFZ A;  1MZB A;  1TVK A;  3LML A;  1M5I A;  2PY5 A;  4EQ5 A;  1Z2P X;  1X4T A;  3ICX A;  5K1X A;  1HR0 H;  1XNQ B;  3BA8 A;  4ZIB A;  1TUB B;  3RGB A;  2F66 C;  4DR2 B;  4CC6 A;  4HBN A;  3PN1 A;  3OTO B;  3K58 A;  4X20 A;  5LMU B;  4O2B B;  2BTO A;  4B08 A;  4CH5 A;  5KMG B;  3HKB B;  4MTD A;  1M4U A;  4GKK H;  4I55 B;  4FLV A;  3JAL B;  5JCO A;  1XHZ A;  4X1Y A;  1N36 H;  4MV9 A;  4DV6 H;  1XK5 A;  3VNN A;  5IJ0 A;  1I94 B;  3RGZ A;  3JAR A;  1G6U A;  3K3V A;  1VF7 A;  5EZY A;  1P8L A;  5JCO C;  4DV3 B;  5FPR A;  3WB2 A;  1RSO A;  2RGV A;  4WBN B;  4NXN B;  5CA0 B;  4DR3 H;  2ZNJ A;  2ZIM A;  4FFB B;  3SJB C;  4JI0 H;  2Q2T A;  1WPB A;  2Q7G A;  2QM4 A;  2WYO A;  2UU9 H;  2VQE B;  1TVK B;  3T1Y H;  3N42 B;  3HKE A;  3H20 A;  3B2E E;  2PTM A;  4JI4 B;  2VQF H;  3N40 P;  4EB6 A;  4UCR A;  4X65 H;  2EX3 A;  4DV1 H;  4X20 B;  5KX5 A;  3LNN A;  1XDN A;  3NBY B;  1HNZ H;  4JI6 B;  5LYJ A;  4PZ6 A;  4LFB B;  3ZED A;  4RZQ A;  4YHH B;  4B3M B;  4DK1 A;  4TUY A;  1FJG B;  1H2S B;  4X1Y B;  1Q43 A;  4DV0 B;  2BTQ A;  1CKN A;  2PYJ A;  4CC5 A;  5JVD B;  5IJ0 B;  4DR5 B;  4RAZ A;  4KL1 A;  3JAR B;  1IBM B;  3SR2 C;  3RYF A;  4LF7 B;  4LR3 A;  2YI8 A;  5EYP A;  4B3S B;  4FLW A;  2Q2U A;  1JMK C;  2UUB H;  4X1K A;  3TY8 A;  1P49 A;  2R70 A;  4JI3 B;  4PI0 A;  4FLZ A;  4UCU A;  5D5Q A;  2ZJT A;  2PGG A;  3HXL A;  1N34 B;  4HNA A;  5EIB C;  2VUG A;  1HNW H;  4DR6 B;  1FVI A;  5J2T B;  5DIS C;  5EIB D;  5GON A;  4OX9 B;  3BA9 A;  3RWR D;  3HKE B;  4AIL C;  3RJ0 A;  4Q6G A;  4JI2 H;  3F8N A;  4DV6 B;  4EB6 B;  4JI8 H;  1I6U A;  4LH6 A;  1XI1 A;  2KSW A;  5CA1 A;  4E6N A;  5KX5 B;  4B3R H;  4K0K H;  4DV7 B;  3K59 A;  4DRF A;  4KHP B;  4I7H A;  1SQF A;  3QF7 A;  2PUS A;  2YXL A;  5FD6 A;  3E22 A;  4TUY B;  1CKM A;  4DR4 H;  4DR3 B;  2BTQ B;  1CKO A;  5KHJ A;  4IIJ A;  1AN7 A;  1J5E B;  1CKN B;  1D5A A;  4LSA A;  4I4T A;  3RYF B;  5EYP B;  4RB2 C;  4RB1 A;  4X1K B;  4FM0 A;  4PZ7 A;  3JAW A;  1HNX H;  4YY3 H;  4DV5 H;  4O2A A;  4FFB A;  4X62 B;  4TQF A;  3L4J A;  4LF6 H;  4DV1 B;  1M93 A;  4AHC A;  5FLX W;  3W5O A;  4M7E A;  5LMN H;  4HNA B;  3RTX A;  4FLX A;  2V4D A;  4TQD A;  1Q3E A;  4CH3 A;  4LF4 H;  4ZOL A;  4FM1 A;  2ZM6 H;  5GON B;  2VWJ A;  4K8Z A;  2CAZ C;  3OTF A;  3GB8 B;  3CB2 A;  1XMO B;  1WN7 A;  4DUY H;  1XMQ B;  2CW8 A;  4U3J A;  3HKD A;  4MV7 A;  3RYH A;  5CA1 B;  2JS5 A;  4TV9 A;  4IHJ A;  3WB1 A;  4FLY A;  3IG0 A;  5C8Y A;  2UUB B;  1WH2 A;  1ZHS A;  1N33 B;  3E22 B;  2E5L H;  4LFC H;  3JAT A;  4IIJ B;  5JVD A;  4YJ2 A;  2HHH B;  4APM A;  2KKW A;  4TOI A;  4LSX A;  1T5E A;  3JAM W;  3IAY A;  4I4T B;  4JI5 H;  4GKJ B;  3RIZ A;  5J2U A;  4NVP A;  3JAW B;  3BPZ A;  4JI8 B;  4JI7 H;  2JVD A;  4O2A B;  2HEP A;  2RGR A;  4LF5 B;  5JJJ B;  2HIX A;  4LFA H;  3QG5 A;  4DR1 B;  2F4V H;  5J2T A;  4B3R B;  1Z2N X;  3UQ8 A;  1ZHQ A;  5BR8 H;  4ZOL B;  2CW7 A;  5IYZ B;  3JAS B;  4DR4 B;  4JV5 H;  2UXC B;  2JGU A;  2Q7E A;  4X66 H;  4I50 A;  3K5L A;  4U3J B;  5BMV A;  3HKD B;  4DV2 H;  3FMA A;  3RYH B;  1IBK H;  1QQC A;  1SQG A;  4NXM B;  2W57 A;  1L2Z A;  1XNR H;  4TV9 B;  4IHJ B;  5FPO A;  3J7A K;  2UXD B;  3RYI A;  4CS3 A;  5C8Y B;  1XHX A;  4BW9 A;  4DUZ B;  4EFE A;  4DV5 B;  2OYQ A;  3JAT B;  2UXB B;  4X64 H;  1IBL B;  3T1H H;  4YJ2 B;  1NT2 B;  5IJ9 A;  5LMN B;  1JFF A;  3N2G A;  1BGW A;  4Q0Y A;  1XQ8 A;  4LF4 B;  3M4I A;  2YCH A;  3MWM A;  3W1B A;  2XIG A;  2YI9 A;  5FNV A;  1HR0 B;  1N32 H;  5J2U B;  3GDE A;  3MAQ A;  3W1G A;  5IWA H;  4CS2 A;  1GYF A;  4DUY B;  4BWA A;  4JYA H;  4LF8 H;  1V9P A;  3TY9 A;  4DR2 H;  5KHK A;  4O4L A;  3BAA A;  4GKK B;  2HVR A;  4JI1 H;  4PZ8 A;  3K5M A;  2F93 B;  1E4F T;  3KAJ A;  5LMU H;  1N36 B;  2GV9 A;  3DF7 A;  3N6X A;  4RB0 A;  2WE6 A;  1WNS A;  4I50 B;  4X1I A;  1O9G A;  3KAK A;  5BMV B;  3A2F A;  3FFQ A;  4ZHQ A;  1S03 G;  2E3C A;  2QJ1 A;  3QTC A;  1I94 H;  1TA8 A;  3ETQ A;  3RYI B;  3RYC A;  2PYL A;  1DGS A;  4JI7 B;  4JI0 B;  4DV3 H;  2WDT A;  1Q5O A;  4CH6 A;  4FVM A;  5IJ9 B;  2UU9 B;  5LP6 A;  1I7F A;  4PHZ A;  3U11 A;  4K8X A;  2HIV A;  1JFF B;  2ZIO A;  3N2G B;  4A2B A;  4J0M A;  1SKV A;  3T1Y B;  4FM9 A;  5FNV B;  1M0T A;  4O4H A;  2CFM A;  2UUC H;  2VQF B;  1FKA H;  4X65 B;  5LP6 C;  5K1P A;  4FLT A;  4DR7 H;  1IBK B;  4EFB A;  4O4L B;  1HNZ B;  3SJC C;  3N44 B;  5IYZ A;  3JAS A;  3EYY A;  2HGS A;  4CH4 A;  4AQY H;  4D7S A;  4DV4 H;  4X64 B;  4B3M H;  4UCT A;  4X1I B;  1FFX B;  2RJZ A;  1E4G T;  1FJG H;  4PDB A;  4ZHQ B;  4FLU A;  3NBZ B;  3S24 A;  2Q0A A;  2R9A A;  1N32 B;  3BHP A;  3DSQ A;  4GLX A;  2XHB A;  3RYC B;  5IWA B;  1IBM H;  4L8J A;  3BAB A;  4LF7 H;  5JJN B;  3KAL A;  3WB0 A;  3U0Z A;  4BWS C;  4JYA B;  1Z5W A;  4B3S H;  4F6R A;  3UT5 A;  3GJX B;  5LA6 A;  4LF8 B;  1Z5V A;  1HNW B;  5LP6 B;  3N41 B;  4JI3 H;  1TGO A;  5ITZ A;  2VPS A;  2OWO A;  1N34 H;  2O03 A;  4O4H B;  4JI1 B;  4IAJ A;  3CSX A;  4UCO A;  1QHT A;  4JI2 B;  4DR6 H;  3J81 W;  3N2K A;  3J80 W;  4RB3 C;  4LNU B;  4OX9 H;  1TAE A;  1KU9 A;  3K5N A;  3M7M X;  4ETS A;  3KXY T;  1SA0 A;  3RF2 A;  4CS4 A;  4GYC B;  4K0K B;  2ZCE A;  4MTE A;  1P16 A;  1M0W A;  4LF9 H;  4DK0 A;  3ZS8 C;  3TY5 A;  5LXT A;  4ZI7 A;  1S5J A;  5JH7 A;  1BJT A;  4DV7 H;  4KHP H;  2UUA H;  2R72 A;  3RFR A;  3VQY A;  4TV8 B;  4PI2 A;  1J5E H;  4O4J A;  2PZS A;  2UUC B;  5KHI A;  3RR5 A;  1HNX B;  4YY3 B;  1O9H A;  2HVQ A;  4R7R A;  4LF6 B;  4F6R B;  3UT5 B;  5LA6 B;  4B3T H;  4DR7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...