4CC5A

Fragment-based discovery of 6 azaindazoles as inhibitors of bacterial dna ligase
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
308
structure length
308
Chain Sequence
ADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-Based Discovery of 6-Azaindazoles as Inhibitors of Bacterial DNA Ligase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 109
structure length 308
sequence length 308
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4cc5A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4cc5A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4cc5A02
1IBLB 5IWAB 3S24A 2CFMA 1N34B 4LF5B 4PZ7A 4JI7B 3UQ8A 4JI0B 4K0KB 4B3SB 4JI5B 4EFBA 4DR2B 2VUGA 2UXBB 5LMUB 1N32B 5D1OB 4EEQA 4B3MB 4JI6B 4DUZB 2F4VB 3VNNA 4JYAB 3NC0B 4EFEA 3W1BA 3BAAA 2UUAB 1XMOB 1CKMA 1FJGB 4DR1B 4NXNB 1X9NA 4LF8B 4YHHB 3BABA 3GDEA 3W1GA 2HVQA 4DR3B 3RR5A 4UCTA 2E5LB 5LMNB 4DV1B 4JI8B 1XMQB 4UCUA 4LF9B 4LFAB 1XDNA 4DRFA 3L2PA 4X64B 1XNRB 4DV4B 4JI4B 4AQYB 2UUCB 2UXCB 3W5OA 4DV2B 4X65B 1HR0B 4LF4B 4PZ6A 2ZM6B 4LH7A 4JI2B 1P8LA 3NBZB 4UCSA 4KHPB 4YY3B 4GLXA 1J5EB 1IBMB 3NBYB 1CKOA 2VQFB 4GKKB 1XNQB 4B3RB 1FVIA 4EQ5A 1CKNA 4CC6A 4JI1B 3GB8B 3TY9A 2HVRA 2Q2UA 4DR4B 1P16A 2VQEB 1IBKB 3OTOB 4B3TB 1I94B 3SGIA 3TY5A 4X66B 5D1PA 4PZ8A 4UFZA 4NXMB 1N33B 2HIXA 1S68A 4JI3B 2HVSA 3QWUA 2Q2TA 1A0IA 3TY8A 1HNXB 4CC5A 4GKJB 5FPRA 2HIVA 4E6NA 4UCRA 1TAEA 3BA9A 4LFBB 4OX9B 5DISC 2UU9B 4LFCB 1ZAUA 4DR7B 1N36B 1DGSA 1VS0A 1TA8A 4DV5B 2HHHB 2UUBB 3T1HB 3RTXA 2OWOA 3JSNA 5BR8B 1V9PA 5D1OA 4DR6B 4DV6B 4TOIA 5FPOA 4UCVA 3PN1A 4X62B 4DUYB 2UXDB 1HNZB 3JSLA 4JV5B 3KYHC 4DV3B 4DV7B 4DR5B 1CKNB 4LH6A 3BA8A 1B04A 4DV0B 4UCOA 1XK5A 1HNWB 3T1YB 4LF7B 4LF6B 3GJXB
chains in the Genus database with same CATH superfamily
4TQDA 1IBLH 4QWAA 2A3QA 1R3KC 4LFBH 5FLXW 1PNMA 4DR4H 5F9NA 3WWJA 4JI0B 1WA8A 1K4DC 2H3OA 3AG1B 1MMMA 4CH4A 1NS1A 1IXMA 4I9WA 4GC7A 4CS3A 1FFXA 1I1KA 3VQWA 2VUGA 2W9BB 3L75H 4ZIBA 4CZZA 3FKIG 2IJJA 5KHIA 4CS4A 3GVMA 4U7OA 1CE8A 1R6TA 3FKIA 2OCHA 1BCCH 1SZXA 2UUAB 2HR3A 2BTQB 3W7XA 5KKNB 2ZINA 2NLJC 2V4RA 4ZHQB 3H1LH 4TQRA 3CWBH 5BMVB 2L6LA 5I5SA 3E8GA 1JJOA 1PV0A 5KFGA 5DG8A 2C35B 3T1HH 3N2GB 3BFRA 3HKEB 5AG2A 2WAQA 4PDBA 4IZOA 2UUCB 1IYDA 4M0JA 2HKOA 2W6OA 1R1BA 5JVLA 5LOVB 3CJHB 2UUBH 5CA0F 4J9MA 4O4JA 3FB7C 5KUMA 3FMAA 4QIWE 1PNLA 2ZDIC 4IRKA 5BWTA 1S0NA 4AYBE 4JTAB 2Y69B 2WPDG 4N23A 1G1XB 4JI2H 2HJFC 2ODMA 5E25A 4WFGA 4DV6O 4NXMH 2R7ZA 5IYZB 1A0GA 3D36C 4KFMA 3AG4B 1HNZO 3THOA 4JI1O 4GZRB 3RJ0A 1Q86W 4NXMB 1S68A 4IAJA 1OCCB 3M9MB 3GTPA 5L3CA 3KHRA 4RQFA 1SCUB 4J9ZB 4RNOA 4LFCB 1K97A 2Y0IA 4I55A 1VS0A 1GO3F 4MVMA 4NZNA 2BQRA 4XX0B 4YR0A 1XDCA 1GYFA 4RB2C 1VQPV 4O4LA 2IBZH 5E79Z 3ABLC 4RUCA 3HT5A 4MVOA 1HW7A 4DV6B 3DAAA 2C00A 4NXNO 4FPPA 4JI1H 1EKPA 3B2EE 4ICGA 4YY3H 4UXNA 2F43G 2VQEO 4JV5B 2P90A 3JD3A 3K3WA 3GWOA 2C2DA 2JEUA 1O9HA 1WB8A 2CTRA 4O2AF 4OGQB 3JAKA 1EN5A 2FMAA 4DO2A 2XC9A 1IZ3A 3JAKB 3GJXB 4TV8A 1DAAA 2GTSA 4DW1A 1H2KA 2R7LA 2ZXWB 2Q8VA 2HLDG 3CJHA 3SJBC 1YHQV 5JQWA 2KB1A 4O2BB 4I7HA 4HZ3A 2NR5A 4JI3H 5JH7A 1KU9A 3GTOA 4UVBA 3WWHA 4EFBA 4EGJA 1US6A 3E83A 3HKBA 5BWXA 4HAMA 1R6NA 3TQTA 2CTWA 4O4LB 2COJA 1KC8W 2PF4E 3MD0A 4UVCA 4O7TA 3HKCA 4ETSA 4DRXA 4AQYH 4MTGA 4DR3B 3QZ8A 3KAKA 4DR1H 1AI7A 2F66C 3L2PA 4O86A 4Q6GA 4QJFB 4LFAB 1Z2OX 5LA6F 4AQYB 4JZ2A 1UPGA 2LP7A 4KXRA 3EVKA 2UU9O 1QQCA 1P8LA 5IT9N 1E1RG 2PYJA 3CXHF 4I4TA 2JRIA 1RFYA 4YY3B 1NI8A 4R7RA 4P9PA 2R70A 1V55C 3TK1A 5F9LA 2UVVA 1T5EA 1XNQB 1OBDA 3ABKC 2Q2UA 2W6IG 1GAXA 4O4LF 2OIGA 4J9NA 3H1IH 2COIA 2D2CB 4QIWF 3UM7A 3SGIA 3HOWG 2CNVA 4Q0YA 4O4JB 4B3RO 4FLUA 3CRRA 4RWUA 1MNGA 1RSOA 2R93G 4JTCB 1GO3E 4JZGA 2E3CA 4CC5A 3SPCA 4NLGA 3HKEA 5KHHA 4X1YA 4YJ2B 4R8UA 2W7OA 1N32H 4O7SA 3KCXA 4PA9A 1JX4A 3RUPA 1L0LH 4H33A 5FL7G 4PBCA 4YR2A 2IH1C 3H4DA 1QU7A 3VBBA 3K5HA 2B1GA 3CCMV 3ETGA 5KFUA 4PA7A 1QHTA 3HB3B 3JSNA 1WP7A 1M9NA 3KALA 1SETA 1CPYA 1FFXB 3CCSV 4JI8H 4TUYA 2QKAA 3GV7B 5KG3A 2FE3A 5KHKA 4PDMA 4OPAA 4UV8A 2GQSA 4KHPO 4DV3B 3FAVB 1W96A 1Y4MA 1EZ1A 2GDSA 4DL4A 5HV6A 1MOFA 3T1YO 3ABKB 1DIKA 2FB5A 2EZPA 3R23A 3CQZA 1KTAA 3OSPA 3HOYG 3U0GA 4ZI7B 1HNWO 4NVPA 4YIOA 3JRXA 3B09A 5KX5F 2Q7DA 4JI0H 4DV0O 1N0NA 4IYIA 3E5NA 3V4ZA 5GONA 4FBUA 1FXKC 4JI8O 4YXWG 3ZRWA 4DR6O 2BE3A 4CKBA 1L0NH 5DQGA 1H2NA 2IJKA 3GIPA 2WLMA 1XMOB 5KLVH 3PW2A 1XUQA 3PFFA 3ORRA 1VQOV 4JI6H 3K04A 3ETJA 2UUCH 4K8ZA 4O4IF 3KHHA 2V4DA 2FP4B 1N32O 1WCMA 5KFCA 1AILA 1GH6A 2QWRB 3DXRB 4JI3O 4DV2B 2DZDA 5KFJA 1WNSA 4ECSA 1OCRB 3GV8B 5B3SB 4J9RA 4ZBMA 3NBYB 4FVMA 4PD4F 4DR5H 4F6RA 1RJPA 5C8YA 5IYDO 3RBDA 2IM9A 2R93A 1A9XA 4ABMA 2FYUH 3NR7A 3BRCA 2PVPA 2JGUA 5LXTA 1Q90D 1IBKB 4OPHA 1I94H 4PI0A 2EJRA 3ZHVA 3IGAC 5LL6Y 3QO5A 4A3IG 4J7ZA 4RAZA 3ZCCA 3T9EA 2ODTX 3VPCA 2HIVA 4HYKA 5HNEA 3OMNB 1DF4A 3P32A 1WB7A 1SQGA 1MSDA 2UU9B 3FB5C 2HVJC 1JXLA 2CK3G 2ETNA 5DN6G 3PVXA 3DTUB 1K73W 2EIKB 2FPIB 1T36A 1KMIZ 3ZS8C 4FJCC 2W9CB 3UKMA 3D3QA 5JH7F 2YS8A 2DYRC 2R6FA 3QTCA 4XDJA 3C0FB 1TVKA 4AYBA 2R9RB 2Q7HA 1RM1B 4DUYB 1HNZH 5ITZA 2OYQA 5J2UF 2YEVA 4JV5H 1DLBA 2ALZA 3RVZA 4HNTA 3U55A 1I08A 1N33H 4QWEA 2ZE6A 1EN6A 2QGNA 4LF7B 4K0KH 1WR2A 3T1YH 2C2EA 3ETEA 3PO2G 3DF7A 1WSCA 1EN4A 1F4NA 3G80A 3RBEA 3HPLC 2KG7B 3MDSA 3CCJV 4PZ7A 1QVFU 3LP8A 2JA7G 2WWWA 4FLWA 2ZE8A 2GBOA 3CPWU 3TGUH 3BG5A 1FYJA 5L1KA 3K06A 3CE2A 5LMUB 3H0GA 3JALA 4DR3O 4GT1A 4DRXB 2F4VB 4DUZB 3OT7A 4DW0A 1A48A 3TEKA 1ZHQA 1IBKH 2NU9B 4YQWA 4H13B 4NXNB 3LQSA 5C8YF 3O65A 3Q1KA 4JAAA 1XMQH 1P7BA 2O57A 4LNUB 2R72A 5B1AC 3BABA 4RB0A 3E89A 4RB1A 3GIDA 5H80A 2V7QG 2DJVA 3JZIA 1XDNA 4LF9B 3J7AU 4BWAA 4X64H 3N6XA 1H8HG 3LDCA 1BL8A 1KC7A 2UXCB 2AW9A 4O2BA 1V4YA 4MSWC 3RYIA 2HGSA 3H1KH 2HJWA 4F4YA 3K5NA 2V9WA 1P49A 4WFBV 1Z2NX 1XNQO 2XAFA 2A9HA 2W6JG 3GB8B 3ZMSA 4MVZA 5KFLA 2XGQA 3E35A 5DAAA 4PA6A 3SDLA 5ITZB 1GLVA 5LYJF 2VQEH 4JI7H 3RYIB 3TCUA 1TWFA 4DV7H 3K0DA 1R73A 3HKDB 5HFLA 5LOVA 3SPHA 3K5LA 2QWOB 4DV5O 3CXCU 3LUTB 1I2LA 3A0HZ 1NBMG 3SPGA 4IHJF 4GKJB 5FPRA 2ILMA 2V58A 5KT2A 4XDKA 5FNVA 3UFXB 3UZOA 4A3KG 3N43B 2WLIA 4I55B 1OCZC 1BJTA 2VPQA 4BWSC 1N36B 5BZBA 1I1LA 4RUFA 1JQ0A 3QZ7A 2E5LH 3V6KA 1DK1A 5LMUH 1AB3A 1E1QG 1TWGA 3FD9A 5KFBA 2N05A 1VQKV 4A3BG 3GTMA 5BPHA 1GRJA 3CB2A 2NU7B 4PELA 2ZDQA 3M7MX 3E2EA 3CX5F 2XD4A 5BXZA 5IYZA 1M7JA 2KG7A 5BYBA 2F1MA 2PBZA 1NVPD 1YJ9V 1IBLO 5FLMG 4O2AA 3I5DA 3KG2A 3T9AA 1XNRO 5EC2C 2WLHA 4MV3A 4JASA 2H8PC 4LF5H 1SYXB 1NU1H 2ZDGA 3J80W 3VMMA 2ZDIA 4I50B 5LA6B 2WA3A 4FLYA 1KT8A 4YBZB 5KT7A 1JFFA 3CMAV 4RCNA 2JEJA 2NVYA 1FXKB 1L2ZA 4EFEA 5IE9A 5B1OA 3JARB 4XBFA 4YJ3A 2W9CA 1XOUA 2PUSA 2WTFA 2UUAO 4YJ2F 4LBEC 3W1GA 4CMDA 3KKYA 1VBGA 5JJNB 4RZRA 3EPIA 3N2KB 5LMNB 1FS0G 4K6NA 1YI2V 5LOVF 5DQHA 1YTFD 5IYCG 4CKEA 2CE4A 3LMLA 3MR5A 5B3SC 2X6BA 2J6TA 3U54A 2P06A 5J2TF 5F2VO 4GLWA 1T94A 4MV4A 3A2FA 1RPOA 1Z5VA 2GTAA 4CC6A 1COWG 4R6ZA 2P6JA 2QK4A 2W9AA 3OTFA 1Y1WG 1DV1A 2QM7A 4IRDA 3I12A 4QW9A 3OTOH 5D8DA 4Q4DA 1BQ0A 3MR3A 3K5OA 2JJ1G 2P0AA 4ECRA 1FKAO 2GV9A 5CB4A 1K9MW 1JX9A 5CA1F 1M0TA 5J2UA 4QNHB 4J7KA 2Q4PA 5LGTA 4XYLB 4LC1A 3TQ1A 2QKCA 2W71A 4RNNA 5DGAA 3AG4C 2HHHO 5DISC 2RNBA 4C2MA 3LNMB 1N36O 2R7KA 1EUDB 3BQ2A 4GKJH 4D7TA 3GTKA 2QEXV 3QFFA 5H2FZ 2YS7A 4EBDA 2HHFB 2YXHA 4MA5A 5IY5B 4B3TO 1SZTA 4O7LA 3M8AA 1I7NA 1AP5A 2ASLA 2DIKA 1PKXA 4MV6A 1VQ6V 5CB4B 2VQFH 3HKZE 5LA6A 4PJ0Z 3SR2C 4N21A 5DMXA 4FFKA 3WG7B 3JATB 1W0JG 2XHBA 1K5QA 3OR7C 2ADPA 1BMFG 3WO0A 4DR5B 3JCUZ 1JDBB 2GHYA 2GQRA 3T2MA 5KFQA 3LSQA 4O2AB 3ZHQA 2QM4A 5D5QA 3ZMZA 3Q8RB 3SJQC 2V4QA 4LF7O 4I5SA 5E1AC 4LP8A 4WFEA 5L3DA 3S3XA 2A0LA 4MVQA 5KG0A 2W7PA 2RCVA 1WN7A 5KX5A 4LF9O 2JGDA 3JD0A 4QWBA 4A3EG 2JA6G 1Q82W 1N8RW 2YDEA 3KXYT 2EIKC 5GTIZ 4FS2A 1XMOH 3GIIA 4AI8A 3STLC 3JARA 1JDEA 1QR9A 1C30A 3U9SA 1K34A 5LYJA 2IA6A 4EYIB 3IFXA 2HVQA 3JAMW 1YXBA 3RR5A 3VPBA 2W6MA 4DRFA 2AU0A 2B63G 4O4HF 4LF6O 4BIUA 5B1BB 4IHJA 3W7WA 3OHBA 5KFFA 4LF7H 1KUQA 4DQNA 4LF4H 5C1OA 1Y67A 4HYOA 4JI2B 4LH7A 3NBZB 2XUMA 3ETQA 1OHHG 3K59A 3SYOA 5KFSA 1Y76B 5K1XA 3PW5A 3L4KA 1PPJH 2VQDA 3JD2A 2WE6A 2EX3A 5LP6B 2X0SA 5BY1A 3H3VH 1QVGU 3OMAB 2YIBD 1AI4A 5FD5A 3HB9A 5CR5A 3CSWA 2Q0AA 4DLKA 1SQFA 4JYAH 1M56B 2Q67A 2NUAB 5IT9W 2EINC 3CCEV 1D2DA 4FBTA 4O4HA 5LGUA 4LFCH 1V54B 2RN9A 1XQ8A 4LWSA 4H44B 2X6AA 1U97A 4FU0A 2NU6B 4ZKIA 4A3GG 4LFBB 5FR9A 3LSUA 4GKJO 2UXXA 3G6VA 3M9NB 2WLIB 2A7WA 4IYHA 2XAGA 4BIZA 4K8XA 4DV5B 5D5PA 3RV3A 5KFTA 1CP9A 2ASJA 2JA5A 1ET0A 1R6KA 1FXKA 4PA4A 1Z2PX 1CXZB 1AR1B 4ED8A 2CDYA 2UXBO 3RN4A 4DR2O 5HBRB 3K58A 2JIZG 1VF6C 4DV0H 1VEWA 3OTOO 5CA1A 4CH6A 3STZC 1FAFA 2VUMG 3GWKC 3JSLA 2ZIOA 4HNAA 1KQSU 3SE7A 2C2AA 2DMXA 1NZ6A 1H2GA 4TV8B 3ZMTA 4DV0B 2A1HA 1OJHA 3R5XA 3FFQA 1GM9A 3V4SA 2W6ZA 1MG1A 3IC7A 5IWAB 4JYYA 4O3PA 3QO8A 3TETA 2YEVB 3CRMA 4UUJC 4FS1A 5CM0A 1UNNC 1OV9A 2VRZA 4ECYA 2RDJA 4IIJB 1WAZA 5JCOC 4F4ZA 3AW8A 4DR1O 1FJGO 1N32B 2WLLB 3H4BA 1KJ8A 3OGIB 4CKCA 1V51A 4QWDA 4B3SH 3BAAA 1KKDA 5GTHZ 1CKMA 1W59A 2JVDA 3MR2A 4LF8H 4LF8B 2BTQA 1WPXA 2ZNJA 2XCLA 1NR7A 2Y0PA 1H2MA 1SA0A 4U7CA 2Q73A 5IYBO 3MAQA 1GMGA 1MZFA 4QE7A 2PTMA 1N36H 2YW2A 3JAWB 1SQVH 2AGAA 2EIMB 2Q69A 5H9CA 2HDKA 2R87A 3K5IA 1VQ8V 1G6UA 2VWKA 4DV4H 1K8AW 3UT5B 4X20B 4X65H 2E76B 1SQXH 1M57B 2AXTZ 5KAFZ 5EOYA 3L70H 3ZX6A 5K3WA 1XNRH 3K3VA 5LXTB 1URFA 1M56C 3AK1A 3QG5A 3Q4HB 1TUBA 1B6SA 4IWXA 1TWAA 5KFWA 4GKKB 4EQ5A 4FLXA 2W70A 1SS3A 2IBKA 1SKVA 4MVUA 1P16A 3F7YC 5BR8O 3BCCH 3R5FA 5I5XA 3K57A 1KJIA 4ECUA 4EB6A 1N33B 3GIKA 4DK0A 4NTWA 3ETHA 2EZOA 3RB4A 4Z1MG 2XIGA 1F4MA 3TINA 5B1BC 2AGQA 3UYYA 3K08A 1YJWV 3FYEB 5EK0A 3RYCB 5KAIZ 1Y14B 1R3JC 2DAAA 3BHPA 4AQYO 4CH5A 4UVAA 3T54A 1KECA 4JI4O 2L35A 2MW2B 4E2LA 1AJQA 1I5XA 2ZDHA 2COGA 3TJTA 2ZE5A 3OUZA 3ZRVA 3J7AK 5EZYA 2R8JA 1VMGA 5BR8B 3MR6A 1WRVA 4DIMA 1Q5OA 1YITV 4DV1H 5EBLC 2GPWA 2P4KA 3CCRV 4GKKO 4YAKB 2DOSA 3IC9A 4Z1VA 4MTOA 3UO3A 3HBLA 3NUAA 2ABJA 3DC5A 2ARHA 1X59A 2WAMA 4XZ3B 2QWNB 1B04A 2XAQA 4UCOA 3K9SA 4MV1A 3ETDA 1EBOA 2KSDA 1HWYA 3HOXG 3E86A 1EZJA 1NH2B 4YAJB 5BWUA 2ZT9B 2CFMA 1P7GA 5IJ0B 3HKZA 4C5AA 1FXHA 3ASNC 4QW8A 2CGNA 3FB8C 4FMTA 4GKKH 4LFAO 3N2KA 4DV1O 4DR2B 1SERA 1HP8A 4PV1B 5K1PA 1NTMH 3HR0A 1W2BU 1YDXA 4J9KA 4B3MH 4A3DG 1Y1WA 5JVDF 4YB8B 3N44B 2M6YA 3CCUV 4TSFG 1IYEA 4B3SO 4IRCA 1I0HA 5IJ9A 1PD3A 3F7VC 3ZRWB 1EKVA 2E5LB 4GCZA 2RQ6A 2XTAA 5LHIA 3ZHSA 2CQYA 3U10A 3RB0A 1M1KW 2UXDH 1PM9A 5JCOA 1AVMA 2Y4UA 4M7EA 4NZOA 4ED1A 3G71V 2PYLA 4B08A 2QF7A 1P4RA 3JRWA 1J95A 5C93A 1XREA 1IURA 4X62O 3LDEA 4NXMO 1O9GA 4DV6H 1F51A 4APMA 1FVIA 4X66O 4JI1B 5C8YB 4B7KA 3MWMA 3A0BZ 3Q8SB 2XNDG 2R92A 3WWIA 4MVRA 4I4TB 3JAMN 2R7ZG 3N6RA 3BVOA 2Y4RA 2YWVA 4ED0A 2WSSG 1KBHA 2G38A 4X65O 2YRXA 4O3OA 5IYBG 3RIZA 2Q0OC 2QYZA 1VQ5V 3VPDA 4DV4O 1S5JA 1B6RA 2ZJTA 4YP3A 4A3LG 3RB3A 4X8AA 5LHGA 4ECXA 4TWKA 4H0LB 2EJ7A 3FDSA 2HEPA 4YHHO 3TW7A 3H01A 1I3QA 1D5AA 1SFOA 3VQXA 2FJZA 1S03G 5J2UB 3AYHB 5IYCO 1TGOA 4FM9A 5KFIA 4EB6B 4ECZA 3ZEDA 5CB4F 3L72H 1ROPA 4FK5C 4JYAO 1ULZA 2YC0A 4MV7A 5C4XG 2Z02A 2N74A 4ECWA 5IJ0A 2CUGA 5IDJA 1ZL8B 3JD4A 1AI6A 3GIQA 4JI5O 4LH6A 1HDJA 1KYOF 4K0KO 4E4EA 1TUBB 1ZETA 4WBNA 3SYPA 1A32A 1N34O 4IR1A 4ZOLF 4DL7A 2HGXA 4O7NA 3HXLA 1NTZH 4OX9H 1FXVA 4IL6Z 4JV5O 4ZQIA 5KFNA 1Q81W 3T5LA 4FFNA 3VOTA 3SPIA 3GTQA 4DL5A 4JI5B 1PX2A 5DGHA 2I87A 1A3GA 1JJ2U 1BXRA 5LMNO 2C22A 5KG5A 1Y6XA 4PDRA 5LP6C 3JCZA 2YIAA 4LR3A 3AG3C 3T4DA 5J2TA 3VNNA 4O7VA 5KFKA 4ME6A 1S5HC 5TISZ 4JV1A 3RBZA 3K9AA 2O03A 4EEYA 3LNNA 1CQJB 4JI4H 2RGRA 5LXTF 3G4SV 3U0ZA 3UCSC 4YR3A 1IOWA 4R8UB 2DQ0A 3APQA 2R8HA 4LSXA 2XCPA 3AG3B 4ECQA 3I4NG 2ZNIA 3U11A 2W6NA 1HR0B 2FK1A 5CE8A 1VIBA 1AJPA 3AG2C 2B9ZA 4I9QA 2OH2A 4A3CG 1H38A 1RM1C 2ZCEA 3PW0A 1S0MA 4J0MA 2V59A 5CAEB 1IBMO 3Q4HA 4XYMB 4B3TB 4DV3H 1F23A 3OFNG 2HG8A 2R8IA 1TVKB 2OT5A 4X20A 4O3NA 1QR8A 2ZD9A 1I1MA 3CRQA 2Q9LA 3UZBA 3IAYA 4BY1G 4L87A 5I5WA 2C28A 2DWEC 3RFRA 3N2GA 4PDLA 4OXSA 3RGZA 4ZOLB 4J7JA 5HFMA 4J11A 4FFBB 3ZHUA 3BQ0A 2UXCO 5JWPA 1S3JA 1ZAUA 4DR7B 4NYEA 3ZHRA 3DTGA 4BBRG 4HBNA 1I7FA 1SC5B 2ZXWC 4B7EA 4ED6A 2PN1A 2P7TC 3LDDA 1M6VA 3HKDA 2CH7B 2XGPA 1AR4A 4C5CA 5KFZA 4WFAV 1WA8B 2D3OW 5B66Z 2R9IA 2R8KA 5KG4A 1DTOA 2LO1A 4O82A 4GUNA 2R92G 3I56V 4NTXA 3PZPA 5L3EA 2BOBC 2LFSA 2Z5UA 3CC4V 4RUAA 2R7MA 5IWAH 4HR7A 4LF5B 4QIWA 5K2MA 2XCAA 4IHJB 4WCEV 2Y0SE 3N27A 3KTMA 1SEIA 2JS3A 2RJZA 4J42A 4JTDB 1M93A 2QR4A 3SJAC 5BMVA 1JMKC 3VQVA 2UXBH 2NVXA 1SQPH 4EEQA 1HNXH 5EYPA 1MABG 2JA6A 2YXLA 4B3TH 4LNUA 2A06H 4U3JA 2HG5C 2YS6A 1M4UA 3G8CA 1Y1VA 4NKGB 3LWBA 3B8MA 2F4VH 5C5JA 4G3IA 3OD4A 3CS5A 4P2ZA 4UCTA 4ZOLA 1GSHA 4CHIA 4DV1B 4O4IA 2ATKC 5GONB 1Z2GA 4DV4B 1S77D 4JI4B 1GM7A 4I50F 4JYCA 2Y69C 1EZVH 3Q8PB 3SI8A 4F6EA 2JEXA 1VQ7V 4X65B 3QO7A 1H2LA 3RAQA 4O4HB 4ZI7F 1ZWIC 3E8HA 1DF5A 2EULA 4D7SA 4JI5H 1V54C 1H8EG 3OE7G 1CKNA 3TY9A 4P9OA 3JATA 4JXUA 1XEQA 2FLLA 5B1AB 4TUYB 2RMKB 3P30A 4UFZA 1JR9A 3B77A 4MTFA 1EHIA 2E74B 2QM8A 2W57A 3MJFA 4J9LA 4LF6H 3T9CA 4BBSG 1N56A 1VARA 4K3AA 2E5LO 2DQ3A 4P30A 5KS8A 4YIPA 2XAHA 4UUGA 1Q43A 4A93G 1DGSA 2EBOA 1TA8A 3VA7A 4O84A 3D8CA 4I0XA 3OHAA 4FFOA 1YVWA 1OCZB 1EM1A 4BIOA 4B3MO 4DUZH 5KMGA 1Q3EA 2OLSA 3CVZA 1CEZA 1OBGA 2W9BA 4WD3A 5KX5B 1KB9F 5LL6b 5EC1C 3PN1A 3R66A 2YSUB 2PI5A 4X62B 1ZTEA 2UXDB 2EJ3A 4I4TF 2EILB 1I2KA 1CKNB 2JJ2G 1LNQA 1EUCB 3CRAA 2ZQMA 1M0WA 4JUZA 1SQQH 2W8KA 1HNWB 2RF4A 1TWCA 2FK2A 4NR1A 5LHHA 1ZL8A 3RB6A 2W0XA 2WLJA 2BTOA 3A8TA 3T5HA 3RFCA 3H1JH 2MCTA 1BS3A 4F50A 5FD6A 3JASA 1M90W 4IR9A 4FZ1A 4X64O 5A2QN 3T7AA 3T1CA 2QDOA 2C2RA 2UXNA 1KEEA 2EILC 4PA3A 4LCUC 4JI6B 5EZYB 3CCLV 2DWDC 3OM3B 4JYBA 5LMUO 1GSAA 4U6PA 1GN6A 4JV2A 3CSXA 3GLKA 4I0XB 2DYSC 4BW9A 3DTFA 4BR6A 1YJNV 4BAYA 1G4YB 1OCOB 5CA3A 5KG2A 5DG7A 3D3IA 5B5EZ 3RYCA 1Q6HA 1TUEB 2DWCA 4U7NA 5BYAA 2KSWA 5CA0B 4Q43A 4ECTA 1JOYA 1NJIW 3K03A 3JASB 1GN4A 4PHZA 2E2HA 4LF4B 4LFBO 3L73H 2VR1A 2YU9A 4UCSA 4FFPA 5BR8H 2BQUA 4PWQA 4MTDA 3VQYA 4B3RB 1VKZA 1FPOA 1PNKA 3CEIA 3M9OB 1JPXA 2KKWA 4MW3A 4Q4CA 1WH2A 1I94B 3RGXA 3H9VA 3TY5A 2P67A 2YZGA 5D1PA 1ORQC 3I55V 1LUVA 2CH7A 3M99B 3CCVV 2ZKOA 1QLEC 1G8MA 4IIJF 5JQGA 1SRYA 3AK2A 3WB0A 2Q6AA 1BSMA 4BY7G 4ED2A 3R5HA 3PW7A 3MHHC 4QJFA 1K1SA 1TAEA 2DYRB 2QWPB 4GX1A 1FFTB 1BT8A 2V1DA 3E8BA 3T5JA 5GW7A 2K9PA 3JYCA 2UUAH 3X2QB 3TXQA 3T1HB 4TM5A 2YICA 2X5RA 1M5IA 5KFEA 1LR1A 5KT6A 2F23A 2PZSA 3AEIA 4JV0A 3HKBB 3ABMC 4MT8A 3H1HH 2LGWA 4D6TH 3FX7A 4O83A 2R8GA 3ZMUA 5EWFA 5KA5A 5T14A 3ZMVA 1AP6A 2B5UA 1R3IC 2F95B 3RW0A 4DR4O 2EIYA 1J5EH 3TXSA 4DV7B 5IWAO 5EDWA 2OTJV 2VWJA 3H40A 2ASDA 1UC9A 5BPFA 1YCIA 1GM8A 3BEHA 4J41A 3PW4A 3T1YB 3E22B 2IH3C 3J80N 2J6SA 1SF9A 5CBHA 3J81N 4WBNF 4A2AA 3S24A 3ZHTA 3N8DA 2GSMB 4KUMA 1K3EA 1AI5A 3UQ8A 1F7YA 2QTOA 2BQ3A 2FLNA 1KKCA 1IVSA 2NNUA 3WFVA 1BGWA 1MZBA 1YF2A 1IX9A 4X1KA 4MAMA 3JAWA 5D1OB 1UJWB 3H0GG 3AK3A 2IJIA 2YZNA 3HKCB 3J81W 2HVKC 3JD1A 5A9GA 4DR1B 2AGOA 3F8NA 2JS5A 3ORQA 5EBWC 4QSHA 3BQ1A 5EYPB 2UXCH 2SCUB 3PR5B 3RV4A 2QKSA 3JALB 1I5YA 3ZRSA 5H6RA 1H2SB 3ZIAG 4LF9H 5FNVB 1Y66A 4JAUA 4UCUA 4FLZA 5KFAA 1NQTA 5H6QA 3SJCC 4DV5H 1HR0H 2P5OA 2IMWP 3GTJA 4ASUG 3CD6V 5I60A 4R8CA 3AG7A 4DV3O 4KHPB 3W7SA 4QE9A 4O7RA 3T5KA 1OZ0A 1EKFA 4CBCA 2Q68A 4Q8EA 3CMEV 2Y0SA 1XNQH 3AX6A 2HVRA 4DR5O 1S0OA 1BHBA 5LP6A 2VQEB 4DK1A 2JA5G 5CBGA 2AHYA 4PZ8A 1KP2A 1VQNV 4RUEA 3KREA 1YSCA 4I7ZB 2HIXA 3GILA 2HVSA 3UT5A 1PL4A 2YYAA 5EIBC 4E6NA 2FMLA 1Y74A 2DE0X 4FLTA 4OX9B 3LULA 1Y1VG 1N0JA 4X89A 1K5SA 4AHCA 5BWVA 3K0GA 2CNUA 1XMQO 2QA4V 4FFLA 3T9FA 3FYIB 2GPSA 2VA3A 3NXSA 1V9PA 3N42B 2CTPA 2ZR3A 1XHXA 4WF9V 4X1KB 2Z04A 2CTQA 4MTXA 2W8LA 4B3RH 2W6PA 4QWCA 4Q8FA 2AGPA 5FLXN 2EIJC 3CC2V 3CYOA 1IBMH 3ABLB 2FLPA 5IP9G 4X66H 4MW8A 5JUMA 5KG7A 3GIJA 3RF2A 1RK6A 4F4LA 3UO2A 4A2BA 3KAJA 2I8CA 3R65A 2VA2A 4LF6B 1Y76A 4J9PA 3L71H 4R7CA 1LUWA 2CNQA 1WCMG 5KG6A 3V6JA 2BCCH 4GYCB 1N34B 3A0RA 4HNAB 3FKSG 2QB5A 2UVRA 3P3NA 4K0KB 5EBMC 2LJ2A 2W0FC 4TV9F 4FM1A 2ITCC 4WFFA 1UC8A 5KFHA 5DG9A 5IYDG 1JLLB 1V55B 2P4VA 2XOKG 5FNVF 2F93B 4R50A 5KFPA 3L74H 4JYAB 3WU2Z 3MWEA 1XL4A 4FZ0A 1DV2A 3L9DA 4O3RA 3B8NA 4JPRA 4RAIA 3V6HA 3T9DA 4ED3A 3QQMA 4MA0A 1N48A 1EFRG 2KQXA 4JAVA 2Z3YA 2PGGA 4IWYA 2OTLV 1S72V 5L3FA 1L1FA 1XMQB 1Q8IA 1IDSA 1WJZA 3G67A 1I6UA 2QSAA 1I7LA 4J9SA 4OX9O 1YTFB 3QVNA 3RYHA 1MSWD 2ITDC 3U9TA 4CE5A 2ATLA 4PI2A 2ZM6B 5KFDA 2JA8G 4WFHA 1AR5A 3TIIA 3APOA 3ML0A 5I5UA 2WB1E 5KUKA 3IJ4A 1IBMB 2R85A 1CKOA 2PMZE 2CZGA 1K33A 4LMYA 3CRCA 5EZYF 1NTKH 3M4IA 1GSOA 2VPSA 5EWGA 1BZKA 3NGDA 4X66B 1B33N 1OCOC 2LFRA 4QPJA 2J6UA 1HR0O 4HNVA 1S97A 3AG1C 3OMIB 5KFYA 5KMGB 1A0IA 3OUUA 1ZSPA 4H37A 4A3JG 3ASNB 3QNEA 4KP4A 2WLKA 3QF7A 4GX0A 4RB3C 4UCRA 2XAJA 4C7UA 2LGQA 2PI4A 4NB5A 5DLFA 1XILA 3ICXA 5IJ9B 1GTOA 4IT5A 5L1JA 3C3TA 4X1YB 4YJ2A 2HHHH 3KZIZ 1CS0A 5JVDB 4F4XA 5I5YA 1S5LZ 2EIJB 3CEBA 4W4LA 3DC6A 4J9QA 4NYKA 5KFRA 4TOIA 2HFEC 2AHZA 3EHBB 1G2WA 2JGDB 2QJ1A 4TV9A 3OUSA 2VOBA 4LFAH 3G8DA 4A3MG 4JI0O 1RPRA 3SNOA 4E4TA 2ZIMA 3L4JA 3EYYA 3RWRD 1RP3B 2YUAA 2NN4A 1RJQA 2ZM6O 1QNMA 3LSSA 4TVIA 4UB6Z 2V5AA 4I55F 4G2KA 4EGQA 1IXBA 1MZEA 1K1QA 1IBLB 2RDIA 3O9OA 4TT3G 2LQTA 2A79B 4EKWA 2IW5A 3FAVA 2QE7G 3F5WC 1GK9A 4CMFA 4FM2A 2FL4A 4ED7A 3CP1A 1YEWA 1M57C 2ADQB 2P22C 4X9QA 3D36A 2PY5A 5DM6V 5EWEA 2R84A 2R82A 3X2QC 1NT2B 3W1BA 3KHGA 1GGOA 3BY6A 4UB8Z 4YHHB 5JVDA 3HOZG 2QWQB 3ZN0A 1O75A 4Z2WA 3RGBA 3ABTA 1VQLV 2FTKA 5DLGA 3ZRXA 4WHXA 3N40P 4IIJA 3PO3G 3JZFA 1XNRB 1S76D 4MS2A 1EYZA 5KT5A 3GIMA 4U3FH 1S9FA 1E79G 4FE2A 2I80A 2JA7A 2MK3A 1S10A 2WDTA 1P84F 4M9UA 3TW6A 4GLXA 1J5EB 1N33O 2VQFB 4GX2A 2ZM6H 1RYSA 2OCCB 3DSQA 3K5MA 2N04A 5L1IA 4DR4B 3T99A 1VAJA 4RU9A 1JA8A 2RDCA 1AROP 3RYFA 3ZBHA 1VQ4V 4EBEA 2UUBO 3SYAA 4X1IA 3T9BA 5L3BA 2YI8A 1ZUQA 1E4FT 4CH3A 4EBCA 4RO2A 4DYLA 4Q45A 1VP7A 3TY8A 1HNXB 2BSKB 3G6XA 2JEGA 1JVMA 1OWTA 2FB9A 3FB6C 4O2BF 4O4IB 3G6BA 1GN3A 2M7WA 4PDVA 3T1HO 2DPJA 1AUVA 3EFFK 4L8JA 5CBFA 3EPGA 4FFRA 5I5VA 2HJDA 5KFVA 4FFBA 2OCCC 1PK8A 1Y74B 3S3WA 4YJ3B 2WLNA 2OWOA 4LSAA 5KT4A 4Y8VB 4RZQA 1JFFB 2DW4A 2IU3A 2CW8A 2CAZC 4X1IB 3G6EV 1IOVA 4C5BA 2BR0A 1FJGH 5KHGA 3G6YA 3HOVG 2AZ0A 2JK5C 4J10A 4JI7O 5JH7B 1UFIA 3GB7C 5EIBD 3DGEA 4K35A 2PMZA 1THZA 5LGNA 3BA8A 5L9XA 2WB1A 2JDIG 3E22A 1GKFA 1B3QA 2DN9A 1ZX3A 3WB1A 1N4CA 4TV8F 1AN7A 2JEFA 5DGIA 2YZMA 2YRWA 1VF7A 3OGCC 2R7NA 3WB2A 4F4WA 2IJHA 4LF4O 3MWDA 1Q6IA 3OR6C 3T4ZA 4DUYO 2WA4A 2Z0AA 5CA1B 4TQSA 3GV5B 3EXAA 2DYSB 4B3SB 2Q7EA 2JEIA 5CN0A 1RK5A 5LBQA 4AILC 5KG1A 1BQZA 5DGBA 1ZHSA 4ZHQA 4DUZO 2F4VO 4YJ3F 1K92A 3NC0B 1SQBH 1SA0B 5IYZF 1OCCC 2LW1A 3WNZA 2VUMA 4CS2A 1X9NA 2YIBA 4LF8O 2E2IA 3BPZA 4A5UB 5J2TB 3I4MG 4J9YB 4DR3H 5BWWA 4Q44A 2WLLA 1Q7YW 4DR6H 1NH2D 4X88A 4JI8B 1AUXA 3K3PA 4HN2A 3OSNA 4X64B 4DXWA 1SESA 1QBZA 4NTYA 1E4GT 5JQGF 5JQGB 3W5OA 4DL3A 2ZGIA 5KFMA 3ABUA 2IU0A 3HO8A 4PZ6A 1ZQ7A 1BGYH 3RYFB 1YIJV 1I94O 2AZ2A 4DV7O 1N34H 4ZHQF 4WBNB 1VBHA 1D5NA 1K83A 2UVWA 2DLNA 4O3QA 1B6QA 3SYCA 3IN5A 2EIMC 3OTOB 2B1IA 4TV9B 2LW7A 1RJRA 4O81A 4JGSA 4DL2A 2VQFO 5A2QW 4DR2H 5CMUA 4JI3B 4DV2O 5L3GA 3DXRA 2DABA 2Q2TA 4J80A 3WO1A 3OAAG 1QLNA 1KJJA 1L8DA 3ASOC 1VQ9V 4GX5A 2YI9A 5IY5C 2Q7GA 5DEDA 1JCHA 5DQIA 1GN2A 4Q20A 1XMOO 3P3PA 4O7YA 4O3SA 1E4EA 2YL2A 1IBKO 2BSKA 1XL6A 4LWSB 1HNXO 4L1KA 1AJNA 5D1OA 1U96A 2VS0A 2XT9A 4DR6B 2M05A 2GUZA 5BWRA 1FKAH 5KT3A 5FPOA 1CQIB 2IP4A 1BE3H 1YZBA 3W7UA 1BNCA 3KHLA 3RAXA 1HNWH 1OCRC 3KYHC 3MFIA 5B1NA 3R9RA 3CHXA 4QGPA 2QTSA 4KL1A 1NVPB 5C3EG 1JKJB 3ZJZA 1WLEA 5DECA 2YCHA 2K1EA 1Q6UA 1X4TA 2FK3A 2CW7A 1FD9A 5J9PC 2YIDA 1KJ9A 3CCQV 5KFXA 3GTGA 3RYHB 4KHPH 1RYRA 1VF6A 1ENVA 2UXDO 4JI7B 1NR1A 3OW2U 2YXYA 3GTLA 5C1PA 2R9AA 1QLEB 5CA0A 1VQMV 4O4JF 2CGOA 3Q8QB 1W93A 3JZ6A 2UXBB 4TUYF 1KD1W 5FJ8G 3B40A 3C90A 4B3MB 1KJQA 4JI6O 5LYJB 1BHAA 3WG7C 1FJGB 1C3OA 3Q2OA 4NZMA 4MV9A 3BACA 2EINB 5IP7G 2W6QA 2DPIA 4FIPC 2YZLA 3GDEA 4O7WA 1Z5WA 5LP6F 4A3FG 4W4KA 4UV9A 2UVUA 1T3NA 4HQ6A 2X7RB 5H5NA 4BW5A 1R3LC 4JF3A 4DR7O 1KBLA 3ABMB 1NKDA 4LFCO 1JIHA 4FGRA 4DV2H 2RGVA 1TWHA 4GC6A 4ZI7A 4LF5O 2FKLA 1R9TA 3ZN1A 5GONF 1PP9H 4FFMA 3OEHG 2HP8A 2FKXA 4EG0A 1K4CC 2CKZB 3B4SA 3SYQA 3BJYA 4HNUA 3CC7V 3N41B 2FPPB 2E75B 4F6RB 1J5EO 3AG2B 3OEEG 4YY3O 1S0VA 3MFHA 2EJ2A 4ECVA 1XI1A 2WAQE 2R86A 2GUZB 2HGWA 4NXNH 1MA1A 4TQFA 4QPKA 2EJ0A 4MVSA 2OIEA 3QWUA 2UU9H 5I5TA 4O7ZA 4IGGA 3GQCA 3IG0A 2GLTA 1E4EB 5C44G 4RNMA 1WPBA 3PR4A 4DR7H 3MHSC 4BXXG 4EYHB 5BMVF 5KHJA 2ZE7A 2HHFA 4MV8A 3BA9A 2FPGB 4YHHH 4J9OA 4FLVA 4DAAA 4XDLA 3H20A 4RAYA 2XASA 1K7DA 1VF5B 2UUCO 1I50A 3VOUA 1ZLZA 2WYOA 1KP3A 2Y48A 3E8FA 2HHHB 2UUBB 3RTXA 2B63A 3W7TA 4G27B 4U3JB 5JJEB 4FM0A 5KFOA 1B06A 2AQ4A 1QCEA 2X6CA 1XBLA 3PJSK 3F5TA 1RSOB 2ZR2A 3K79A 2J9GA 3TIGA 5LMNH 3OUFA 4G28B 3SPJA 4I50A 4UCVA 1PL0A 2H94A 4DL6A 1HNZB 4DUYH 5JJJB 1WP8A 1KUTA 5I47A 2Q5ZA 2Y4TA 3KCYA 4JI2O 4MTEA 4RQEA 1W0KG 2NU8B 3C3SA 5L1LA 4X62H 5KA6A 1XK5A 3RVYA 1XHZA 3HOUG 3ASOB 2BOCC 2X0LA 3RT3C
chains in the Genus database with same CATH topology
4TQDA 1IBLH 3HXLA 4LFBH 4GYCB 4LF5H 1N34B 5FLXW 4HNAB 1SYXB 4OX9H 4DR4H 3J80W 4JI0B 4K0KB 4JI5B 4I50B 4CH4A 4FM1A 5LA6B 4CS3A 1FFXA 3VQWA 2VUGA 4FLYA 4ZIBA 5LP6C 5KHIA 4CS4A 2F93B 1JFFA 2YIAA 4LR3A 3VNNA 5J2TA 4JYAB 1L2ZA 4EFEA 2UUAB 3JARB 4YJ3A 2BTQB 2O03A 2PUSA 2ZINA 3LNNA 4JI4H 2RGRA 4ZHQB 3W1GA 3U0ZA 5BMVB 2PGGA 5JJNB 1JJOA 4LSXA 3T1HH 3N2KB 5LMNB 3N2GB 1XMQB 1Q8IA 3HKEB 4PDBA 1I6UA 2UUCB 3LMLA 2ZNIA 3U11A 1HR0B 3RYHA 5LOVB 4PI2A 2ZM6B 2UUBH 4O4JA 4I9QA 3FMAA 1IBMB 3A2FA 2ZCEA 1Z5VA 1CKOA 4JI2H 4LMYA 4J0MA 4CC6A 4NXMH 3OTFA 5IYZB 3M4IA 3OTOH 4B3TB 3THOA 2VPSA 4DV3H 3K5OA 4X66B 3RJ0A 2GV9A 5CB4A 1TVKB 4NXMB 4X20A 1S68A 4IAJA 1M0TA 5J2UA 5KMGB 1A0IA 3IAYA 4RB3C 3QF7A 4UCRA 3RFRA 3N2GA 3RGZA 4ZOLB 5DISC 4LFCB 4FFBB 3ICXA 4I55A 5IJ9B 1ZAUA 4DR7B 4GKJH 4D7TA 1VS0A 4X1YB 4YJ2A 2HHHH 5JVDB 4HBNA 1GYFA 4RB2C 1I7FA 4O4LA 1HW7A 4DV6B 4TOIA 3HKDA 2VQFH 5CB4B 2QJ1A 5LA6A 4TV9A 2VOBA 4LFAH 3SR2C 4JI1H 3B2EE 3JATB 4YY3H 2XHBA 4JV5B 2ZIMA 3L4JA 4DR5B 3EYYA 1O9HA 3RWRD 3JAKA 4O2AB 3JAKB 3GJXB 4TV8A 1IBLB 2QM4A 5D5QA 3SJBC 5IWAH 4O2BB 4LF5B 4I7HA 4JI3H 4FM2A 5JH7A 4IHJB 1YEWA 1KU9A 1SEIA 2P22C 1WN7A 2RJZA 4EFBA 5KX5A 1M93A 2PY5A 3HKBA 3SJAC 5BMVA 1JMKC 3VQVA 2UXBH 4EEQA 1HNXH 5EYPA 3KXYT 2YXLA 4B3TH 4LNUA 1NT2B 4U3JA 4O4LB 3W1BA 1XMOH 4YHHB 5JVDA 3JARA 1M4UA 3HKCA 5LYJA 4ETSA 2F4VH 4DRXA 4AQYH 2HVQA 1O75A 3JAMW 3RGBA 4DR3B 3RR5A 3KAKA 4DR1H 4UCTA 4ZOLA 2F66C 4DV1B 4DRFA 4O4IA 3L2PA 4Q6GA 3N40P 5GONB 4LFAB 4IIJA 1Z2OX 1XNRB 4DV4B 4JI4B 4IHJA 4AQYB 4LF7H 1QQCA 4X65B 4LF4H 4O4HB 4LH7A 4JI2B 1P8LA 3NBZB 3ETQA 2WDTA 3K59A 2PYJA 4I4TA 5K1XA 3L4KA 4YY3B 2WE6A 4R7RA 2R70A 2EX3A 5LP6B 4GLXA 1J5EB 4D7SA 2VQFB 2ZM6H 1T5EA 4JI5H 1XNQB 3DSQA 2Q2UA 1CKNA 3TY9A 2YIBD 3K5MA 5FD5A 4DR4B 2Q0AA 1SQFA 3JATA 4JYAH 3SGIA 5IT9W 3RYFA 4Q0YA 4O4JB 4TUYB 4FLUA 4O4HA 4X1IA 1RSOA 4UFZA 2YI8A 1E4FT 4CH3A 4LFCH 1XQ8A 3TY8A 1HNXB 2E3CA 2W57A 4CC5A 4LF6H 3HKEA 5KHHA 4O4IB 4LFBB 4L8JA 4X1YA 4YJ2B 1N32H 1Q43A 4FFBA 1DGSA 4K8XA 1TA8A 5D5PA 4DV5B 4YJ3B 2OWOA 4LSAA 1QHTA 3JSNA 1Z2PX 1JFFB 5KMGA 4RZQA 1Q3EA 4DUZH 3KALA 3CVZA 2CW8A 2CAZC 4X1IB 3K58A 1FJGH 1FFXB 4JI8H 5KX5B 4TUYA 5KHGA 5LL6b 3PN1A 4DV0H 5CA1A 4X62B 4CH6A 5JH7B 2UXDB 3JSLA 2FE3A 5KHKA 2ZIOA 4HNAA 4DV3B 5EIBD 1CKNB 3BA8A 4TV8B 4DV0B 3E22A 3FFQA 3WB1A 1AN7A 1M0WA 1HNWB 1VF7A 3WB2A 5IWAB 2BTOA 4ZI7B 2MCTA 5FD6A 3JASA 4NVPA 5CA1B 4JI0H 4B3SB 4IIJB 5GONA 2Q7EA 5JCOC 1N32B 4AILC 1ZHSA 4ZHQA 4JI6B 5EZYB 3NC0B 1SA0B 4B3SH 3BAAA 1XMOB 1CKMA 2JVDA 4CS2A 4LF8H 3CSXA 2YIBA 2BTQA 4LF8B 2ZNJA 1X9NA 4BW9A 3BPZA 1SA0A 5J2TB 3MAQA 4JI6H 2UUCH 4DR3H 2PTMA 4K8ZA 1N36H 3JAWB 3RYCA 2V4DA 4DR6H 1G6UA 4JI8B 2VWKA 2KSWA 5CA0B 4X64B 4DV4H 3JASB 4PHZA 1E4GT 5JQGB 4DV2B 3W5OA 3UT5B 1WNSA 4X20B 4LF4B 4X65H 4PZ6A 5EOYA 3RYFB 1XNRH 4UCSA 1N34H 3K3VA 5LXTB 3QG5A 4WBNB 5BR8H 1TUBA 3NBYB 4FVMA 4MTDA 3VQYA 4DR5H 4F6RA 5C8YA 4GKKB 4B3RB 2IM9A 4EQ5A 4FLXA 1SKVA 1P16A 2KKWA 3BRCA 2JGUA 5LXTA 1IBKB 3OTOB 1WH2A 1I94B 3RGXA 1I94H 3TY5A 4PI0A 5D1PA 4TV9B 3K57A 5A2QW 4EB6A 4DR2H 1N33B 4JI3B 4DK0A 5JQGA 2Q2TA 3WB0A 4RAZA 2XIGA 2HIVA 1TAEA 1L8DA 1SQGA 3RYCB 2UU9B 3BHPA 2YI9A 4CH5A 2UUAH 2Q7GA 1KMIZ 3ZS8C 3T1HB 1M5IA 3J7AK 5EZYA 2PZSA 5BR8B 5D1OA 1Q5OA 3QTCA 4DR6B 3C0FB 3HKBB 1TVKA 4DV1H 1FKAH 5FPOA 2Q7HA 4DUYB 1HNZH 5ITZA 2OYQA 2F95B 1HNWH 4JV5H 1J5EH 3KYHC 4DV7B 3CHXA 2VWJA 4KL1A 1B04A 1N33H 4UCOA 2YCHA 1X4TA 2CW7A 3T1YB 4LF7B 3E22B 3T1YH 4K0KH 3DF7A 4A2AA 3S24A 2CFMA 5IJ0B 3RYHB 4KHPH 4PZ7A 4JI7B 3UQ8A 4FLWA 2R9AA 5CA0A 4GKKH 1BGWA 1MZBA 3N2KA 4X1KA 4DR2B 2UXBB 5K1PA 5LMUB 3JAWA 3JALA 5D1OB 4B3MB 4DRXB 2F4VB 4DUZB 4B3MH 3HKCB 5LYJB 1ZHQA 3J81W 1IBKH 1FJGB 4DR1B 3N44B 4NXNB 3F8NA 2JS5A 1XMQH 4MV9A 4LNUB 2R72A 4RB0A 3BABA 3GDEA 5IJ9A 5EYPB 1Z5WA 2UXCH 4RB1A 3JALB 2E5LB 1H2SB 4LF9H 2RQ6A 5FNVB 4LF9B 4UCUA 1XDNA 4BWAA 4X64H 3N6XA 3U10A 4FLZA 2UXCB 2UXDH 5JCOA 4M7EA 4DV2H 4O2BA 2RGVA 3SJCC 4ZI7A 4DV5H 1HR0H 2P5OA 2PYLA 4B08A 4KHPB 3RYIA 2HGSA 3K5NA 4DV6H 1O9GA 1P49A 1Z2NX 3N41B 1FVIA 4APMA 3GB8B 4JI1B 5C8YB 4F6RB 2HVRA 3MWMA 1XNQH 5LP6A 5ITZB 2VQEH 2VQEB 4JI7H 4DK1A 3RYIB 4DV7H 4I4TB 1XI1A 4PZ8A 4NXNH 4TQFA 3HKDB 5LOVA 3K5LA 2HIXA 2HVSA 3RIZA 3UT5A 3QWUA 2UU9H 3IG0A 4GKJB 4DR7H 1S5JA 1WPBA 5EIBC 5FPRA 4E6NA 2ZJTA 5FNVA 5KHJA 3BA9A 4YHHH 4FLVA 4FLTA 4OX9B 3H20A 4RAYA 3N43B 4I55B 1BJTA 4BWSC 2HEPA 4AHCA 1N36B 2WYOA 2HHHB 2UUBB 3RTXA 2E5LH 5LMUH 4U3JB 5JJEB 1D5AA 3VQXA 4FM0A 1S03G 5J2UB 1V9PA 1TGOA 4FM9A 4EB6B 3CB2A 3N42B 3ZEDA 5LMNH 1XHXA 4X1KB 4B3RH 3M7MX 4I50A 4UCVA 4MV7A 1HNZB 5IYZA 4DUYH 5JJJB 1IBMH 2F1MA 5IJ0A 4X66H 4LH6A 4MTEA 3RF2A 4O2AA 4X62H 1TUBB 4A2BA 1XK5A 1XHZA 4WBNA 3KAJA 4LF6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL B;  5IWA B;  3S24 A;  2CFM A;  1N34 B;  4LF5 B;  4PZ7 A;  4JI7 B;  3UQ8 A;  4JI0 B;  4K0K B;  4B3S B;  4JI5 B;  4EFB A;  4DR2 B;  2VUG A;  2UXB B;  5LMU B;  1N32 B;  5D1O B;  4EEQ A;  4B3M B;  4JI6 B;  4DUZ B;  2F4V B;  3VNN A;  4JYA B;  3NC0 B;  4EFE A;  3W1B A;  3BAA A;  2UUA B;  1XMO B;  1CKM A;  1FJG B;  4DR1 B;  4NXN B;  1X9N A;  4LF8 B;  4YHH B;  3BAB A;  3GDE A;  3W1G A;  2HVQ A;  4DR3 B;  3RR5 A;  4UCT A;  2E5L B;  5LMN B;  4DV1 B;  4JI8 B;  1XMQ B;  4UCU A;  4LF9 B;  4LFA B;  1XDN A;  4DRF A;  3L2P A;  4X64 B;  1XNR B;  4DV4 B;  4JI4 B;  4AQY B;  2UUC B;  2UXC B;  3W5O A;  4DV2 B;  4X65 B;  1HR0 B;  4LF4 B;  4PZ6 A;  2ZM6 B;  4LH7 A;  4JI2 B;  1P8L A;  3NBZ B;  4UCS A;  4KHP B;  4YY3 B;  4GLX A;  1J5E B;  1IBM B;  3NBY B;  1CKO A;  2VQF B;  4GKK B;  1XNQ B;  4B3R B;  1FVI A;  4EQ5 A;  1CKN A;  4CC6 A;  4JI1 B;  3GB8 B;  3TY9 A;  2HVR A;  2Q2U A;  4DR4 B;  1P16 A;  2VQE B;  1IBK B;  3OTO B;  4B3T B;  1I94 B;  3SGI A;  3TY5 A;  4X66 B;  5D1P A;  4PZ8 A;  4UFZ A;  4NXM B;  1N33 B;  2HIX A;  1S68 A;  4JI3 B;  2HVS A;  3QWU A;  2Q2T A;  1A0I A;  3TY8 A;  1HNX B;  4CC5 A;  4GKJ B;  5FPR A;  2HIV A;  4E6N A;  4UCR A;  1TAE A;  3BA9 A;  4LFB B;  4OX9 B;  5DIS C;  2UU9 B;  4LFC B;  1ZAU A;  4DR7 B;  1N36 B;  1DGS A;  1VS0 A;  1TA8 A;  4DV5 B;  2HHH B;  2UUB B;  3T1H B;  3RTX A;  2OWO A;  3JSN A;  5BR8 B;  1V9P A;  5D1O A;  4DR6 B;  4DV6 B;  4TOI A;  5FPO A;  4UCV A;  3PN1 A;  4X62 B;  4DUY B;  2UXD B;  1HNZ B;  3JSL A;  4JV5 B;  3KYH C;  4DV3 B;  4DV7 B;  4DR5 B;  1CKN B;  4LH6 A;  3BA8 A;  1B04 A;  4DV0 B;  4UCO A;  1XK5 A;  1HNW B;  3T1Y B;  4LF7 B;  4LF6 B;  3GJX B; 
#chains in the Genus database with same CATH topology
 4TQD A;  1IBL H;  4QWA A;  2A3Q A;  1R3K C;  4LFB H;  5FLX W;  1PNM A;  4DR4 H;  5F9N A;  3WWJ A;  4JI0 B;  1WA8 A;  1K4D C;  2H3O A;  3AG1 B;  1MMM A;  4CH4 A;  1NS1 A;  1IXM A;  4I9W A;  4GC7 A;  4CS3 A;  1FFX A;  1I1K A;  3VQW A;  2VUG A;  2W9B B;  3L75 H;  4ZIB A;  4CZZ A;  3FKI G;  2IJJ A;  5KHI A;  4CS4 A;  3GVM A;  4U7O A;  1CE8 A;  1R6T A;  3FKI A;  2OCH A;  1BCC H;  1SZX A;  2UUA B;  2HR3 A;  2BTQ B;  3W7X A;  5KKN B;  2ZIN A;  2NLJ C;  2V4R A;  4ZHQ B;  3H1L H;  4TQR A;  3CWB H;  5BMV B;  2L6L A;  5I5S A;  3E8G A;  1JJO A;  1PV0 A;  5KFG A;  5DG8 A;  2C35 B;  3T1H H;  3N2G B;  3BFR A;  3HKE B;  5AG2 A;  2WAQ A;  4PDB A;  4IZO A;  2UUC B;  1IYD A;  4M0J A;  2HKO A;  2W6O A;  1R1B A;  5JVL A;  5LOV B;  3CJH B;  2UUB H;  5CA0 F;  4J9M A;  4O4J A;  3FB7 C;  5KUM A;  3FMA A;  4QIW E;  1PNL A;  2ZDI C;  4IRK A;  5BWT A;  1S0N A;  4AYB E;  4JTA B;  2Y69 B;  2WPD G;  4N23 A;  1G1X B;  4JI2 H;  2HJF C;  2ODM A;  5E25 A;  4WFG A;  4DV6 O;  4NXM H;  2R7Z A;  5IYZ B;  1A0G A;  3D36 C;  4KFM A;  3AG4 B;  1HNZ O;  3THO A;  4JI1 O;  4GZR B;  3RJ0 A;  1Q86 W;  4NXM B;  1S68 A;  4IAJ A;  1OCC B;  3M9M B;  3GTP A;  5L3C A;  3KHR A;  4RQF A;  1SCU B;  4J9Z B;  4RNO A;  4LFC B;  1K97 A;  2Y0I A;  4I55 A;  1VS0 A;  1GO3 F;  4MVM A;  4NZN A;  2BQR A;  4XX0 B;  4YR0 A;  1XDC A;  1GYF A;  4RB2 C;  1VQP V;  4O4L A;  2IBZ H;  5E79 Z;  3ABL C;  4RUC A;  3HT5 A;  4MVO A;  1HW7 A;  4DV6 B;  3DAA A;  2C00 A;  4NXN O;  4FPP A;  4JI1 H;  1EKP A;  3B2E E;  4ICG A;  4YY3 H;  4UXN A;  2F43 G;  2VQE O;  4JV5 B;  2P90 A;  3JD3 A;  3K3W A;  3GWO A;  2C2D A;  2JEU A;  1O9H A;  1WB8 A;  2CTR A;  4O2A F;  4OGQ B;  3JAK A;  1EN5 A;  2FMA A;  4DO2 A;  2XC9 A;  1IZ3 A;  3JAK B;  3GJX B;  4TV8 A;  1DAA A;  2GTS A;  4DW1 A;  1H2K A;  2R7L A;  2ZXW B;  2Q8V A;  2HLD G;  3CJH A;  3SJB C;  1YHQ V;  5JQW A;  2KB1 A;  4O2B B;  4I7H A;  4HZ3 A;  2NR5 A;  4JI3 H;  5JH7 A;  1KU9 A;  3GTO A;  4UVB A;  3WWH A;  4EFB A;  4EGJ A;  1US6 A;  3E83 A;  3HKB A;  5BWX A;  4HAM A;  1R6N A;  3TQT A;  2CTW A;  4O4L B;  2COJ A;  1KC8 W;  2PF4 E;  3MD0 A;  4UVC A;  4O7T A;  3HKC A;  4ETS A;  4DRX A;  4AQY H;  4MTG A;  4DR3 B;  3QZ8 A;  3KAK A;  4DR1 H;  1AI7 A;  2F66 C;  3L2P A;  4O86 A;  4Q6G A;  4QJF B;  4LFA B;  1Z2O X;  5LA6 F;  4AQY B;  4JZ2 A;  1UPG A;  2LP7 A;  4KXR A;  3EVK A;  2UU9 O;  1QQC A;  1P8L A;  5IT9 N;  1E1R G;  2PYJ A;  3CXH F;  4I4T A;  2JRI A;  1RFY A;  4YY3 B;  1NI8 A;  4R7R A;  4P9P A;  2R70 A;  1V55 C;  3TK1 A;  5F9L A;  2UVV A;  1T5E A;  1XNQ B;  1OBD A;  3ABK C;  2Q2U A;  2W6I G;  1GAX A;  4O4L F;  2OIG A;  4J9N A;  3H1I H;  2COI A;  2D2C B;  4QIW F;  3UM7 A;  3SGI A;  3HOW G;  2CNV A;  4Q0Y A;  4O4J B;  4B3R O;  4FLU A;  3CRR A;  4RWU A;  1MNG A;  1RSO A;  2R93 G;  4JTC B;  1GO3 E;  4JZG A;  2E3C A;  4CC5 A;  3SPC A;  4NLG A;  3HKE A;  5KHH A;  4X1Y A;  4YJ2 B;  4R8U A;  2W7O A;  1N32 H;  4O7S A;  3KCX A;  4PA9 A;  1JX4 A;  3RUP A;  1L0L H;  4H33 A;  5FL7 G;  4PBC A;  4YR2 A;  2IH1 C;  3H4D A;  1QU7 A;  3VBB A;  3K5H A;  2B1G A;  3CCM V;  3ETG A;  5KFU A;  4PA7 A;  1QHT A;  3HB3 B;  3JSN A;  1WP7 A;  1M9N A;  3KAL A;  1SET A;  1CPY A;  1FFX B;  3CCS V;  4JI8 H;  4TUY A;  2QKA A;  3GV7 B;  5KG3 A;  2FE3 A;  5KHK A;  4PDM A;  4OPA A;  4UV8 A;  2GQS A;  4KHP O;  4DV3 B;  3FAV B;  1W96 A;  1Y4M A;  1EZ1 A;  2GDS A;  4DL4 A;  5HV6 A;  1MOF A;  3T1Y O;  3ABK B;  1DIK A;  2FB5 A;  2EZP A;  3R23 A;  3CQZ A;  1KTA A;  3OSP A;  3HOY G;  3U0G A;  4ZI7 B;  1HNW O;  4NVP A;  4YIO A;  3JRX A;  3B09 A;  5KX5 F;  2Q7D A;  4JI0 H;  4DV0 O;  1N0N A;  4IYI A;  3E5N A;  3V4Z A;  5GON A;  4FBU A;  1FXK C;  4JI8 O;  4YXW G;  3ZRW A;  4DR6 O;  2BE3 A;  4CKB A;  1L0N H;  5DQG A;  1H2N A;  2IJK A;  3GIP A;  2WLM A;  1XMO B;  5KLV H;  3PW2 A;  1XUQ A;  3PFF A;  3ORR A;  1VQO V;  4JI6 H;  3K04 A;  3ETJ A;  2UUC H;  4K8Z A;  4O4I F;  3KHH A;  2V4D A;  2FP4 B;  1N32 O;  1WCM A;  5KFC A;  1AIL A;  1GH6 A;  2QWR B;  3DXR B;  4JI3 O;  4DV2 B;  2DZD A;  5KFJ A;  1WNS A;  4ECS A;  1OCR B;  3GV8 B;  5B3S B;  4J9R A;  4ZBM A;  3NBY B;  4FVM A;  4PD4 F;  4DR5 H;  4F6R A;  1RJP A;  5C8Y A;  5IYD O;  3RBD A;  2IM9 A;  2R93 A;  1A9X A;  4ABM A;  2FYU H;  3NR7 A;  3BRC A;  2PVP A;  2JGU A;  5LXT A;  1Q90 D;  1IBK B;  4OPH A;  1I94 H;  4PI0 A;  2EJR A;  3ZHV A;  3IGA C;  5LL6 Y;  3QO5 A;  4A3I G;  4J7Z A;  4RAZ A;  3ZCC A;  3T9E A;  2ODT X;  3VPC A;  2HIV A;  4HYK A;  5HNE A;  3OMN B;  1DF4 A;  3P32 A;  1WB7 A;  1SQG A;  1MSD A;  2UU9 B;  3FB5 C;  2HVJ C;  1JXL A;  2CK3 G;  2ETN A;  5DN6 G;  3PVX A;  3DTU B;  1K73 W;  2EIK B;  2FPI B;  1T36 A;  1KMI Z;  3ZS8 C;  4FJC C;  2W9C B;  3UKM A;  3D3Q A;  5JH7 F;  2YS8 A;  2DYR C;  2R6F A;  3QTC A;  4XDJ A;  3C0F B;  1TVK A;  4AYB A;  2R9R B;  2Q7H A;  1RM1 B;  4DUY B;  1HNZ H;  5ITZ A;  2OYQ A;  5J2U F;  2YEV A;  4JV5 H;  1DLB A;  2ALZ A;  3RVZ A;  4HNT A;  3U55 A;  1I08 A;  1N33 H;  4QWE A;  2ZE6 A;  1EN6 A;  2QGN A;  4LF7 B;  4K0K H;  1WR2 A;  3T1Y H;  2C2E A;  3ETE A;  3PO2 G;  3DF7 A;  1WSC A;  1EN4 A;  1F4N A;  3G80 A;  3RBE A;  3HPL C;  2KG7 B;  3MDS A;  3CCJ V;  4PZ7 A;  1QVF U;  3LP8 A;  2JA7 G;  2WWW A;  4FLW A;  2ZE8 A;  2GBO A;  3CPW U;  3TGU H;  3BG5 A;  1FYJ A;  5L1K A;  3K06 A;  3CE2 A;  5LMU B;  3H0G A;  3JAL A;  4DR3 O;  4GT1 A;  4DRX B;  2F4V B;  4DUZ B;  3OT7 A;  4DW0 A;  1A48 A;  3TEK A;  1ZHQ A;  1IBK H;  2NU9 B;  4YQW A;  4H13 B;  4NXN B;  3LQS A;  5C8Y F;  3O65 A;  3Q1K A;  4JAA A;  1XMQ H;  1P7B A;  2O57 A;  4LNU B;  2R72 A;  5B1A C;  3BAB A;  4RB0 A;  3E89 A;  4RB1 A;  3GID A;  5H80 A;  2V7Q G;  2DJV A;  3JZI A;  1XDN A;  4LF9 B;  3J7A U;  4BWA A;  4X64 H;  3N6X A;  1H8H G;  3LDC A;  1BL8 A;  1KC7 A;  2UXC B;  2AW9 A;  4O2B A;  1V4Y A;  4MSW C;  3RYI A;  2HGS A;  3H1K H;  2HJW A;  4F4Y A;  3K5N A;  2V9W A;  1P49 A;  4WFB V;  1Z2N X;  1XNQ O;  2XAF A;  2A9H A;  2W6J G;  3GB8 B;  3ZMS A;  4MVZ A;  5KFL A;  2XGQ A;  3E35 A;  5DAA A;  4PA6 A;  3SDL A;  5ITZ B;  1GLV A;  5LYJ F;  2VQE H;  4JI7 H;  3RYI B;  3TCU A;  1TWF A;  4DV7 H;  3K0D A;  1R73 A;  3HKD B;  5HFL A;  5LOV A;  3SPH A;  3K5L A;  2QWO B;  4DV5 O;  3CXC U;  3LUT B;  1I2L A;  3A0H Z;  1NBM G;  3SPG A;  4IHJ F;  4GKJ B;  5FPR A;  2ILM A;  2V58 A;  5KT2 A;  4XDK A;  5FNV A;  3UFX B;  3UZO A;  4A3K G;  3N43 B;  2WLI A;  4I55 B;  1OCZ C;  1BJT A;  2VPQ A;  4BWS C;  1N36 B;  5BZB A;  1I1L A;  4RUF A;  1JQ0 A;  3QZ7 A;  2E5L H;  3V6K A;  1DK1 A;  5LMU H;  1AB3 A;  1E1Q G;  1TWG A;  3FD9 A;  5KFB A;  2N05 A;  1VQK V;  4A3B G;  3GTM A;  5BPH A;  1GRJ A;  3CB2 A;  2NU7 B;  4PEL A;  2ZDQ A;  3M7M X;  3E2E A;  3CX5 F;  2XD4 A;  5BXZ A;  5IYZ A;  1M7J A;  2KG7 A;  5BYB A;  2F1M A;  2PBZ A;  1NVP D;  1YJ9 V;  1IBL O;  5FLM G;  4O2A A;  3I5D A;  3KG2 A;  3T9A A;  1XNR O;  5EC2 C;  2WLH A;  4MV3 A;  4JAS A;  2H8P C;  4LF5 H;  1SYX B;  1NU1 H;  2ZDG A;  3J80 W;  3VMM A;  2ZDI A;  4I50 B;  5LA6 B;  2WA3 A;  4FLY A;  1KT8 A;  4YBZ B;  5KT7 A;  1JFF A;  3CMA V;  4RCN A;  2JEJ A;  2NVY A;  1FXK B;  1L2Z A;  4EFE A;  5IE9 A;  5B1O A;  3JAR B;  4XBF A;  4YJ3 A;  2W9C A;  1XOU A;  2PUS A;  2WTF A;  2UUA O;  4YJ2 F;  4LBE C;  3W1G A;  4CMD A;  3KKY A;  1VBG A;  5JJN B;  4RZR A;  3EPI A;  3N2K B;  5LMN B;  1FS0 G;  4K6N A;  1YI2 V;  5LOV F;  5DQH A;  1YTF D;  5IYC G;  4CKE A;  2CE4 A;  3LML A;  3MR5 A;  5B3S C;  2X6B A;  2J6T A;  3U54 A;  2P06 A;  5J2T F;  5F2V O;  4GLW A;  1T94 A;  4MV4 A;  3A2F A;  1RPO A;  1Z5V A;  2GTA A;  4CC6 A;  1COW G;  4R6Z A;  2P6J A;  2QK4 A;  2W9A A;  3OTF A;  1Y1W G;  1DV1 A;  2QM7 A;  4IRD A;  3I12 A;  4QW9 A;  3OTO H;  5D8D A;  4Q4D A;  1BQ0 A;  3MR3 A;  3K5O A;  2JJ1 G;  2P0A A;  4ECR A;  1FKA O;  2GV9 A;  5CB4 A;  1K9M W;  1JX9 A;  5CA1 F;  1M0T A;  5J2U A;  4QNH B;  4J7K A;  2Q4P A;  5LGT A;  4XYL B;  4LC1 A;  3TQ1 A;  2QKC A;  2W71 A;  4RNN A;  5DGA A;  3AG4 C;  2HHH O;  5DIS C;  2RNB A;  4C2M A;  3LNM B;  1N36 O;  2R7K A;  1EUD B;  3BQ2 A;  4GKJ H;  4D7T A;  3GTK A;  2QEX V;  3QFF A;  5H2F Z;  2YS7 A;  4EBD A;  2HHF B;  2YXH A;  4MA5 A;  5IY5 B;  4B3T O;  1SZT A;  4O7L A;  3M8A A;  1I7N A;  1AP5 A;  2ASL A;  2DIK A;  1PKX A;  4MV6 A;  1VQ6 V;  5CB4 B;  2VQF H;  3HKZ E;  5LA6 A;  4PJ0 Z;  3SR2 C;  4N21 A;  5DMX A;  4FFK A;  3WG7 B;  3JAT B;  1W0J G;  2XHB A;  1K5Q A;  3OR7 C;  2ADP A;  1BMF G;  3WO0 A;  4DR5 B;  3JCU Z;  1JDB B;  2GHY A;  2GQR A;  3T2M A;  5KFQ A;  3LSQ A;  4O2A B;  3ZHQ A;  2QM4 A;  5D5Q A;  3ZMZ A;  3Q8R B;  3SJQ C;  2V4Q A;  4LF7 O;  4I5S A;  5E1A C;  4LP8 A;  4WFE A;  5L3D A;  3S3X A;  2A0L A;  4MVQ A;  5KG0 A;  2W7P A;  2RCV A;  1WN7 A;  5KX5 A;  4LF9 O;  2JGD A;  3JD0 A;  4QWB A;  4A3E G;  2JA6 G;  1Q82 W;  1N8R W;  2YDE A;  3KXY T;  2EIK C;  5GTI Z;  4FS2 A;  1XMO H;  3GII A;  4AI8 A;  3STL C;  3JAR A;  1JDE A;  1QR9 A;  1C30 A;  3U9S A;  1K34 A;  5LYJ A;  2IA6 A;  4EYI B;  3IFX A;  2HVQ A;  3JAM W;  1YXB A;  3RR5 A;  3VPB A;  2W6M A;  4DRF A;  2AU0 A;  2B63 G;  4O4H F;  4LF6 O;  4BIU A;  5B1B B;  4IHJ A;  3W7W A;  3OHB A;  5KFF A;  4LF7 H;  1KUQ A;  4DQN A;  4LF4 H;  5C1O A;  1Y67 A;  4HYO A;  4JI2 B;  4LH7 A;  3NBZ B;  2XUM A;  3ETQ A;  1OHH G;  3K59 A;  3SYO A;  5KFS A;  1Y76 B;  5K1X A;  3PW5 A;  3L4K A;  1PPJ H;  2VQD A;  3JD2 A;  2WE6 A;  2EX3 A;  5LP6 B;  2X0S A;  5BY1 A;  3H3V H;  1QVG U;  3OMA B;  2YIB D;  1AI4 A;  5FD5 A;  3HB9 A;  5CR5 A;  3CSW A;  2Q0A A;  4DLK A;  1SQF A;  4JYA H;  1M56 B;  2Q67 A;  2NUA B;  5IT9 W;  2EIN C;  3CCE V;  1D2D A;  4FBT A;  4O4H A;  5LGU A;  4LFC H;  1V54 B;  2RN9 A;  1XQ8 A;  4LWS A;  4H44 B;  2X6A A;  1U97 A;  4FU0 A;  2NU6 B;  4ZKI A;  4A3G G;  4LFB B;  5FR9 A;  3LSU A;  4GKJ O;  2UXX A;  3G6V A;  3M9N B;  2WLI B;  2A7W A;  4IYH A;  2XAG A;  4BIZ A;  4K8X A;  4DV5 B;  5D5P A;  3RV3 A;  5KFT A;  1CP9 A;  2ASJ A;  2JA5 A;  1ET0 A;  1R6K A;  1FXK A;  4PA4 A;  1Z2P X;  1CXZ B;  1AR1 B;  4ED8 A;  2CDY A;  2UXB O;  3RN4 A;  4DR2 O;  5HBR B;  3K58 A;  2JIZ G;  1VF6 C;  4DV0 H;  1VEW A;  3OTO O;  5CA1 A;  4CH6 A;  3STZ C;  1FAF A;  2VUM G;  3GWK C;  3JSL A;  2ZIO A;  4HNA A;  1KQS U;  3SE7 A;  2C2A A;  2DMX A;  1NZ6 A;  1H2G A;  4TV8 B;  3ZMT A;  4DV0 B;  2A1H A;  1OJH A;  3R5X A;  3FFQ A;  1GM9 A;  3V4S A;  2W6Z A;  1MG1 A;  3IC7 A;  5IWA B;  4JYY A;  4O3P A;  3QO8 A;  3TET A;  2YEV B;  3CRM A;  4UUJ C;  4FS1 A;  5CM0 A;  1UNN C;  1OV9 A;  2VRZ A;  4ECY A;  2RDJ A;  4IIJ B;  1WAZ A;  5JCO C;  4F4Z A;  3AW8 A;  4DR1 O;  1FJG O;  1N32 B;  2WLL B;  3H4B A;  1KJ8 A;  3OGI B;  4CKC A;  1V51 A;  4QWD A;  4B3S H;  3BAA A;  1KKD A;  5GTH Z;  1CKM A;  1W59 A;  2JVD A;  3MR2 A;  4LF8 H;  4LF8 B;  2BTQ A;  1WPX A;  2ZNJ A;  2XCL A;  1NR7 A;  2Y0P A;  1H2M A;  1SA0 A;  4U7C A;  2Q73 A;  5IYB O;  3MAQ A;  1GMG A;  1MZF A;  4QE7 A;  2PTM A;  1N36 H;  2YW2 A;  3JAW B;  1SQV H;  2AGA A;  2EIM B;  2Q69 A;  5H9C A;  2HDK A;  2R87 A;  3K5I A;  1VQ8 V;  1G6U A;  2VWK A;  4DV4 H;  1K8A W;  3UT5 B;  4X20 B;  4X65 H;  2E76 B;  1SQX H;  1M57 B;  2AXT Z;  5KAF Z;  5EOY A;  3L70 H;  3ZX6 A;  5K3W A;  1XNR H;  3K3V A;  5LXT B;  1URF A;  1M56 C;  3AK1 A;  3QG5 A;  3Q4H B;  1TUB A;  1B6S A;  4IWX A;  1TWA A;  5KFW A;  4GKK B;  4EQ5 A;  4FLX A;  2W70 A;  1SS3 A;  2IBK A;  1SKV A;  4MVU A;  1P16 A;  3F7Y C;  5BR8 O;  3BCC H;  3R5F A;  5I5X A;  3K57 A;  1KJI A;  4ECU A;  4EB6 A;  1N33 B;  3GIK A;  4DK0 A;  4NTW A;  3ETH A;  2EZO A;  3RB4 A;  4Z1M G;  2XIG A;  1F4M A;  3TIN A;  5B1B C;  2AGQ A;  3UYY A;  3K08 A;  1YJW V;  3FYE B;  5EK0 A;  3RYC B;  5KAI Z;  1Y14 B;  1R3J C;  2DAA A;  3BHP A;  4AQY O;  4CH5 A;  4UVA A;  3T54 A;  1KEC A;  4JI4 O;  2L35 A;  2MW2 B;  4E2L A;  1AJQ A;  1I5X A;  2ZDH A;  2COG A;  3TJT A;  2ZE5 A;  3OUZ A;  3ZRV A;  3J7A K;  5EZY A;  2R8J A;  1VMG A;  5BR8 B;  3MR6 A;  1WRV A;  4DIM A;  1Q5O A;  1YIT V;  4DV1 H;  5EBL C;  2GPW A;  2P4K A;  3CCR V;  4GKK O;  4YAK B;  2DOS A;  3IC9 A;  4Z1V A;  4MTO A;  3UO3 A;  3HBL A;  3NUA A;  2ABJ A;  3DC5 A;  2ARH A;  1X59 A;  2WAM A;  4XZ3 B;  2QWN B;  1B04 A;  2XAQ A;  4UCO A;  3K9S A;  4MV1 A;  3ETD A;  1EBO A;  2KSD A;  1HWY A;  3HOX G;  3E86 A;  1EZJ A;  1NH2 B;  4YAJ B;  5BWU A;  2ZT9 B;  2CFM A;  1P7G A;  5IJ0 B;  3HKZ A;  4C5A A;  1FXH A;  3ASN C;  4QW8 A;  2CGN A;  3FB8 C;  4FMT A;  4GKK H;  4LFA O;  3N2K A;  4DV1 O;  4DR2 B;  1SER A;  1HP8 A;  4PV1 B;  5K1P A;  1NTM H;  3HR0 A;  1W2B U;  1YDX A;  4J9K A;  4B3M H;  4A3D G;  1Y1W A;  5JVD F;  4YB8 B;  3N44 B;  2M6Y A;  3CCU V;  4TSF G;  1IYE A;  4B3S O;  4IRC A;  1I0H A;  5IJ9 A;  1PD3 A;  3F7V C;  3ZRW B;  1EKV A;  2E5L B;  4GCZ A;  2RQ6 A;  2XTA A;  5LHI A;  3ZHS A;  2CQY A;  3U10 A;  3RB0 A;  1M1K W;  2UXD H;  1PM9 A;  5JCO A;  1AVM A;  2Y4U A;  4M7E A;  4NZO A;  4ED1 A;  3G71 V;  2PYL A;  4B08 A;  2QF7 A;  1P4R A;  3JRW A;  1J95 A;  5C93 A;  1XRE A;  1IUR A;  4X62 O;  3LDE A;  4NXM O;  1O9G A;  4DV6 H;  1F51 A;  4APM A;  1FVI A;  4X66 O;  4JI1 B;  5C8Y B;  4B7K A;  3MWM A;  3A0B Z;  3Q8S B;  2XND G;  2R92 A;  3WWI A;  4MVR A;  4I4T B;  3JAM N;  2R7Z G;  3N6R A;  3BVO A;  2Y4R A;  2YWV A;  4ED0 A;  2WSS G;  1KBH A;  2G38 A;  4X65 O;  2YRX A;  4O3O A;  5IYB G;  3RIZ A;  2Q0O C;  2QYZ A;  1VQ5 V;  3VPD A;  4DV4 O;  1S5J A;  1B6R A;  2ZJT A;  4YP3 A;  4A3L G;  3RB3 A;  4X8A A;  5LHG A;  4ECX A;  4TWK A;  4H0L B;  2EJ7 A;  3FDS A;  2HEP A;  4YHH O;  3TW7 A;  3H01 A;  1I3Q A;  1D5A A;  1SFO A;  3VQX A;  2FJZ A;  1S03 G;  5J2U B;  3AYH B;  5IYC O;  1TGO A;  4FM9 A;  5KFI A;  4EB6 B;  4ECZ A;  3ZED A;  5CB4 F;  3L72 H;  1ROP A;  4FK5 C;  4JYA O;  1ULZ A;  2YC0 A;  4MV7 A;  5C4X G;  2Z02 A;  2N74 A;  4ECW A;  5IJ0 A;  2CUG A;  5IDJ A;  1ZL8 B;  3JD4 A;  1AI6 A;  3GIQ A;  4JI5 O;  4LH6 A;  1HDJ A;  1KYO F;  4K0K O;  4E4E A;  1TUB B;  1ZET A;  4WBN A;  3SYP A;  1A32 A;  1N34 O;  4IR1 A;  4ZOL F;  4DL7 A;  2HGX A;  4O7N A;  3HXL A;  1NTZ H;  4OX9 H;  1FXV A;  4IL6 Z;  4JV5 O;  4ZQI A;  5KFN A;  1Q81 W;  3T5L A;  4FFN A;  3VOT A;  3SPI A;  3GTQ A;  4DL5 A;  4JI5 B;  1PX2 A;  5DGH A;  2I87 A;  1A3G A;  1JJ2 U;  1BXR A;  5LMN O;  2C22 A;  5KG5 A;  1Y6X A;  4PDR A;  5LP6 C;  3JCZ A;  2YIA A;  4LR3 A;  3AG3 C;  3T4D A;  5J2T A;  3VNN A;  4O7V A;  5KFK A;  4ME6 A;  1S5H C;  5TIS Z;  4JV1 A;  3RBZ A;  3K9A A;  2O03 A;  4EEY A;  3LNN A;  1CQJ B;  4JI4 H;  2RGR A;  5LXT F;  3G4S V;  3U0Z A;  3UCS C;  4YR3 A;  1IOW A;  4R8U B;  2DQ0 A;  3APQ A;  2R8H A;  4LSX A;  2XCP A;  3AG3 B;  4ECQ A;  3I4N G;  2ZNI A;  3U11 A;  2W6N A;  1HR0 B;  2FK1 A;  5CE8 A;  1VIB A;  1AJP A;  3AG2 C;  2B9Z A;  4I9Q A;  2OH2 A;  4A3C G;  1H38 A;  1RM1 C;  2ZCE A;  3PW0 A;  1S0M A;  4J0M A;  2V59 A;  5CAE B;  1IBM O;  3Q4H A;  4XYM B;  4B3T B;  4DV3 H;  1F23 A;  3OFN G;  2HG8 A;  2R8I A;  1TVK B;  2OT5 A;  4X20 A;  4O3N A;  1QR8 A;  2ZD9 A;  1I1M A;  3CRQ A;  2Q9L A;  3UZB A;  3IAY A;  4BY1 G;  4L87 A;  5I5W A;  2C28 A;  2DWE C;  3RFR A;  3N2G A;  4PDL A;  4OXS A;  3RGZ A;  4ZOL B;  4J7J A;  5HFM A;  4J11 A;  4FFB B;  3ZHU A;  3BQ0 A;  2UXC O;  5JWP A;  1S3J A;  1ZAU A;  4DR7 B;  4NYE A;  3ZHR A;  3DTG A;  4BBR G;  4HBN A;  1I7F A;  1SC5 B;  2ZXW C;  4B7E A;  4ED6 A;  2PN1 A;  2P7T C;  3LDD A;  1M6V A;  3HKD A;  2CH7 B;  2XGP A;  1AR4 A;  4C5C A;  5KFZ A;  4WFA V;  1WA8 B;  2D3O W;  5B66 Z;  2R9I A;  2R8K A;  5KG4 A;  1DTO A;  2LO1 A;  4O82 A;  4GUN A;  2R92 G;  3I56 V;  4NTX A;  3PZP A;  5L3E A;  2BOB C;  2LFS A;  2Z5U A;  3CC4 V;  4RUA A;  2R7M A;  5IWA H;  4HR7 A;  4LF5 B;  4QIW A;  5K2M A;  2XCA A;  4IHJ B;  4WCE V;  2Y0S E;  3N27 A;  3KTM A;  1SEI A;  2JS3 A;  2RJZ A;  4J42 A;  4JTD B;  1M93 A;  2QR4 A;  3SJA C;  5BMV A;  1JMK C;  3VQV A;  2UXB H;  2NVX A;  1SQP H;  4EEQ A;  1HNX H;  5EYP A;  1MAB G;  2JA6 A;  2YXL A;  4B3T H;  4LNU A;  2A06 H;  4U3J A;  2HG5 C;  2YS6 A;  1M4U A;  3G8C A;  1Y1V A;  4NKG B;  3LWB A;  3B8M A;  2F4V H;  5C5J A;  4G3I A;  3OD4 A;  3CS5 A;  4P2Z A;  4UCT A;  4ZOL A;  1GSH A;  4CHI A;  4DV1 B;  4O4I A;  2ATK C;  5GON B;  1Z2G A;  4DV4 B;  1S77 D;  4JI4 B;  1GM7 A;  4I50 F;  4JYC A;  2Y69 C;  1EZV H;  3Q8P B;  3SI8 A;  4F6E A;  2JEX A;  1VQ7 V;  4X65 B;  3QO7 A;  1H2L A;  3RAQ A;  4O4H B;  4ZI7 F;  1ZWI C;  3E8H A;  1DF5 A;  2EUL A;  4D7S A;  4JI5 H;  1V54 C;  1H8E G;  3OE7 G;  1CKN A;  3TY9 A;  4P9O A;  3JAT A;  4JXU A;  1XEQ A;  2FLL A;  5B1A B;  4TUY B;  2RMK B;  3P30 A;  4UFZ A;  1JR9 A;  3B77 A;  4MTF A;  1EHI A;  2E74 B;  2QM8 A;  2W57 A;  3MJF A;  4J9L A;  4LF6 H;  3T9C A;  4BBS G;  1N56 A;  1VAR A;  4K3A A;  2E5L O;  2DQ3 A;  4P30 A;  5KS8 A;  4YIP A;  2XAH A;  4UUG A;  1Q43 A;  4A93 G;  1DGS A;  2EBO A;  1TA8 A;  3VA7 A;  4O84 A;  3D8C A;  4I0X A;  3OHA A;  4FFO A;  1YVW A;  1OCZ B;  1EM1 A;  4BIO A;  4B3M O;  4DUZ H;  5KMG A;  1Q3E A;  2OLS A;  3CVZ A;  1CEZ A;  1OBG A;  2W9B A;  4WD3 A;  5KX5 B;  1KB9 F;  5LL6 b;  5EC1 C;  3PN1 A;  3R66 A;  2YSU B;  2PI5 A;  4X62 B;  1ZTE A;  2UXD B;  2EJ3 A;  4I4T F;  2EIL B;  1I2K A;  1CKN B;  2JJ2 G;  1LNQ A;  1EUC B;  3CRA A;  2ZQM A;  1M0W A;  4JUZ A;  1SQQ H;  2W8K A;  1HNW B;  2RF4 A;  1TWC A;  2FK2 A;  4NR1 A;  5LHH A;  1ZL8 A;  3RB6 A;  2W0X A;  2WLJ A;  2BTO A;  3A8T A;  3T5H A;  3RFC A;  3H1J H;  2MCT A;  1BS3 A;  4F50 A;  5FD6 A;  3JAS A;  1M90 W;  4IR9 A;  4FZ1 A;  4X64 O;  5A2Q N;  3T7A A;  3T1C A;  2QDO A;  2C2R A;  2UXN A;  1KEE A;  2EIL C;  4PA3 A;  4LCU C;  4JI6 B;  5EZY B;  3CCL V;  2DWD C;  3OM3 B;  4JYB A;  5LMU O;  1GSA A;  4U6P A;  1GN6 A;  4JV2 A;  3CSX A;  3GLK A;  4I0X B;  2DYS C;  4BW9 A;  3DTF A;  4BR6 A;  1YJN V;  4BAY A;  1G4Y B;  1OCO B;  5CA3 A;  5KG2 A;  5DG7 A;  3D3I A;  5B5E Z;  3RYC A;  1Q6H A;  1TUE B;  2DWC A;  4U7N A;  5BYA A;  2KSW A;  5CA0 B;  4Q43 A;  4ECT A;  1JOY A;  1NJI W;  3K03 A;  3JAS B;  1GN4 A;  4PHZ A;  2E2H A;  4LF4 B;  4LFB O;  3L73 H;  2VR1 A;  2YU9 A;  4UCS A;  4FFP A;  5BR8 H;  2BQU A;  4PWQ A;  4MTD A;  3VQY A;  4B3R B;  1VKZ A;  1FPO A;  1PNK A;  3CEI A;  3M9O B;  1JPX A;  2KKW A;  4MW3 A;  4Q4C A;  1WH2 A;  1I94 B;  3RGX A;  3H9V A;  3TY5 A;  2P67 A;  2YZG A;  5D1P A;  1ORQ C;  3I55 V;  1LUV A;  2CH7 A;  3M99 B;  3CCV V;  2ZKO A;  1QLE C;  1G8M A;  4IIJ F;  5JQG A;  1SRY A;  3AK2 A;  3WB0 A;  2Q6A A;  1BSM A;  4BY7 G;  4ED2 A;  3R5H A;  3PW7 A;  3MHH C;  4QJF A;  1K1S A;  1TAE A;  2DYR B;  2QWP B;  4GX1 A;  1FFT B;  1BT8 A;  2V1D A;  3E8B A;  3T5J A;  5GW7 A;  2K9P A;  3JYC A;  2UUA H;  3X2Q B;  3TXQ A;  3T1H B;  4TM5 A;  2YIC A;  2X5R A;  1M5I A;  5KFE A;  1LR1 A;  5KT6 A;  2F23 A;  2PZS A;  3AEI A;  4JV0 A;  3HKB B;  3ABM C;  4MT8 A;  3H1H H;  2LGW A;  4D6T H;  3FX7 A;  4O83 A;  2R8G A;  3ZMU A;  5EWF A;  5KA5 A;  5T14 A;  3ZMV A;  1AP6 A;  2B5U A;  1R3I C;  2F95 B;  3RW0 A;  4DR4 O;  2EIY A;  1J5E H;  3TXS A;  4DV7 B;  5IWA O;  5EDW A;  2OTJ V;  2VWJ A;  3H40 A;  2ASD A;  1UC9 A;  5BPF A;  1YCI A;  1GM8 A;  3BEH A;  4J41 A;  3PW4 A;  3T1Y B;  3E22 B;  2IH3 C;  3J80 N;  2J6S A;  1SF9 A;  5CBH A;  3J81 N;  4WBN F;  4A2A A;  3S24 A;  3ZHT A;  3N8D A;  2GSM B;  4KUM A;  1K3E A;  1AI5 A;  3UQ8 A;  1F7Y A;  2QTO A;  2BQ3 A;  2FLN A;  1KKC A;  1IVS A;  2NNU A;  3WFV A;  1BGW A;  1MZB A;  1YF2 A;  1IX9 A;  4X1K A;  4MAM A;  3JAW A;  5D1O B;  1UJW B;  3H0G G;  3AK3 A;  2IJI A;  2YZN A;  3HKC B;  3J81 W;  2HVK C;  3JD1 A;  5A9G A;  4DR1 B;  2AGO A;  3F8N A;  2JS5 A;  3ORQ A;  5EBW C;  4QSH A;  3BQ1 A;  5EYP B;  2UXC H;  2SCU B;  3PR5 B;  3RV4 A;  2QKS A;  3JAL B;  1I5Y A;  3ZRS A;  5H6R A;  1H2S B;  3ZIA G;  4LF9 H;  5FNV B;  1Y66 A;  4JAU A;  4UCU A;  4FLZ A;  5KFA A;  1NQT A;  5H6Q A;  3SJC C;  4DV5 H;  1HR0 H;  2P5O A;  2IMW P;  3GTJ A;  4ASU G;  3CD6 V;  5I60 A;  4R8C A;  3AG7 A;  4DV3 O;  4KHP B;  3W7S A;  4QE9 A;  4O7R A;  3T5K A;  1OZ0 A;  1EKF A;  4CBC A;  2Q68 A;  4Q8E A;  3CME V;  2Y0S A;  1XNQ H;  3AX6 A;  2HVR A;  4DR5 O;  1S0O A;  1BHB A;  5LP6 A;  2VQE B;  4DK1 A;  2JA5 G;  5CBG A;  2AHY A;  4PZ8 A;  1KP2 A;  1VQN V;  4RUE A;  3KRE A;  1YSC A;  4I7Z B;  2HIX A;  3GIL A;  2HVS A;  3UT5 A;  1PL4 A;  2YYA A;  5EIB C;  4E6N A;  2FML A;  1Y74 A;  2DE0 X;  4FLT A;  4OX9 B;  3LUL A;  1Y1V G;  1N0J A;  4X89 A;  1K5S A;  4AHC A;  5BWV A;  3K0G A;  2CNU A;  1XMQ O;  2QA4 V;  4FFL A;  3T9F A;  3FYI B;  2GPS A;  2VA3 A;  3NXS A;  1V9P A;  3N42 B;  2CTP A;  2ZR3 A;  1XHX A;  4WF9 V;  4X1K B;  2Z04 A;  2CTQ A;  4MTX A;  2W8L A;  4B3R H;  2W6P A;  4QWC A;  4Q8F A;  2AGP A;  5FLX N;  2EIJ C;  3CC2 V;  3CYO A;  1IBM H;  3ABL B;  2FLP A;  5IP9 G;  4X66 H;  4MW8 A;  5JUM A;  5KG7 A;  3GIJ A;  3RF2 A;  1RK6 A;  4F4L A;  3UO2 A;  4A2B A;  3KAJ A;  2I8C A;  3R65 A;  2VA2 A;  4LF6 B;  1Y76 A;  4J9P A;  3L71 H;  4R7C A;  1LUW A;  2CNQ A;  1WCM G;  5KG6 A;  3V6J A;  2BCC H;  4GYC B;  1N34 B;  3A0R A;  4HNA B;  3FKS G;  2QB5 A;  2UVR A;  3P3N A;  4K0K B;  5EBM C;  2LJ2 A;  2W0F C;  4TV9 F;  4FM1 A;  2ITC C;  4WFF A;  1UC8 A;  5KFH A;  5DG9 A;  5IYD G;  1JLL B;  1V55 B;  2P4V A;  2XOK G;  5FNV F;  2F93 B;  4R50 A;  5KFP A;  3L74 H;  4JYA B;  3WU2 Z;  3MWE A;  1XL4 A;  4FZ0 A;  1DV2 A;  3L9D A;  4O3R A;  3B8N A;  4JPR A;  4RAI A;  3V6H A;  3T9D A;  4ED3 A;  3QQM A;  4MA0 A;  1N48 A;  1EFR G;  2KQX A;  4JAV A;  2Z3Y A;  2PGG A;  4IWY A;  2OTL V;  1S72 V;  5L3F A;  1L1F A;  1XMQ B;  1Q8I A;  1IDS A;  1WJZ A;  3G67 A;  1I6U A;  2QSA A;  1I7L A;  4J9S A;  4OX9 O;  1YTF B;  3QVN A;  3RYH A;  1MSW D;  2ITD C;  3U9T A;  4CE5 A;  2ATL A;  4PI2 A;  2ZM6 B;  5KFD A;  2JA8 G;  4WFH A;  1AR5 A;  3TII A;  3APO A;  3ML0 A;  5I5U A;  2WB1 E;  5KUK A;  3IJ4 A;  1IBM B;  2R85 A;  1CKO A;  2PMZ E;  2CZG A;  1K33 A;  4LMY A;  3CRC A;  5EZY F;  1NTK H;  3M4I A;  1GSO A;  2VPS A;  5EWG A;  1BZK A;  3NGD A;  4X66 B;  1B33 N;  1OCO C;  2LFR A;  4QPJ A;  2J6U A;  1HR0 O;  4HNV A;  1S97 A;  3AG1 C;  3OMI B;  5KFY A;  5KMG B;  1A0I A;  3OUU A;  1ZSP A;  4H37 A;  4A3J G;  3ASN B;  3QNE A;  4KP4 A;  2WLK A;  3QF7 A;  4GX0 A;  4RB3 C;  4UCR A;  2XAJ A;  4C7U A;  2LGQ A;  2PI4 A;  4NB5 A;  5DLF A;  1XIL A;  3ICX A;  5IJ9 B;  1GTO A;  4IT5 A;  5L1J A;  3C3T A;  4X1Y B;  4YJ2 A;  2HHH H;  3KZI Z;  1CS0 A;  5JVD B;  4F4X A;  5I5Y A;  1S5L Z;  2EIJ B;  3CEB A;  4W4L A;  3DC6 A;  4J9Q A;  4NYK A;  5KFR A;  4TOI A;  2HFE C;  2AHZ A;  3EHB B;  1G2W A;  2JGD B;  2QJ1 A;  4TV9 A;  3OUS A;  2VOB A;  4LFA H;  3G8D A;  4A3M G;  4JI0 O;  1RPR A;  3SNO A;  4E4T A;  2ZIM A;  3L4J A;  3EYY A;  3RWR D;  1RP3 B;  2YUA A;  2NN4 A;  1RJQ A;  2ZM6 O;  1QNM A;  3LSS A;  4TVI A;  4UB6 Z;  2V5A A;  4I55 F;  4G2K A;  4EGQ A;  1IXB A;  1MZE A;  1K1Q A;  1IBL B;  2RDI A;  3O9O A;  4TT3 G;  2LQT A;  2A79 B;  4EKW A;  2IW5 A;  3FAV A;  2QE7 G;  3F5W C;  1GK9 A;  4CMF A;  4FM2 A;  2FL4 A;  4ED7 A;  3CP1 A;  1YEW A;  1M57 C;  2ADQ B;  2P22 C;  4X9Q A;  3D36 A;  2PY5 A;  5DM6 V;  5EWE A;  2R84 A;  2R82 A;  3X2Q C;  1NT2 B;  3W1B A;  3KHG A;  1GGO A;  3BY6 A;  4UB8 Z;  4YHH B;  5JVD A;  3HOZ G;  2QWQ B;  3ZN0 A;  1O75 A;  4Z2W A;  3RGB A;  3ABT A;  1VQL V;  2FTK A;  5DLG A;  3ZRX A;  4WHX A;  3N40 P;  4IIJ A;  3PO3 G;  3JZF A;  1XNR B;  1S76 D;  4MS2 A;  1EYZ A;  5KT5 A;  3GIM A;  4U3F H;  1S9F A;  1E79 G;  4FE2 A;  2I80 A;  2JA7 A;  2MK3 A;  1S10 A;  2WDT A;  1P84 F;  4M9U A;  3TW6 A;  4GLX A;  1J5E B;  1N33 O;  2VQF B;  4GX2 A;  2ZM6 H;  1RYS A;  2OCC B;  3DSQ A;  3K5M A;  2N04 A;  5L1I A;  4DR4 B;  3T99 A;  1VAJ A;  4RU9 A;  1JA8 A;  2RDC A;  1ARO P;  3RYF A;  3ZBH A;  1VQ4 V;  4EBE A;  2UUB O;  3SYA A;  4X1I A;  3T9B A;  5L3B A;  2YI8 A;  1ZUQ A;  1E4F T;  4CH3 A;  4EBC A;  4RO2 A;  4DYL A;  4Q45 A;  1VP7 A;  3TY8 A;  1HNX B;  2BSK B;  3G6X A;  2JEG A;  1JVM A;  1OWT A;  2FB9 A;  3FB6 C;  4O2B F;  4O4I B;  3G6B A;  1GN3 A;  2M7W A;  4PDV A;  3T1H O;  2DPJ A;  1AUV A;  3EFF K;  4L8J A;  5CBF A;  3EPG A;  4FFR A;  5I5V A;  2HJD A;  5KFV A;  4FFB A;  2OCC C;  1PK8 A;  1Y74 B;  3S3W A;  4YJ3 B;  2WLN A;  2OWO A;  4LSA A;  5KT4 A;  4Y8V B;  4RZQ A;  1JFF B;  2DW4 A;  2IU3 A;  2CW8 A;  2CAZ C;  4X1I B;  3G6E V;  1IOV A;  4C5B A;  2BR0 A;  1FJG H;  5KHG A;  3G6Y A;  3HOV G;  2AZ0 A;  2JK5 C;  4J10 A;  4JI7 O;  5JH7 B;  1UFI A;  3GB7 C;  5EIB D;  3DGE A;  4K35 A;  2PMZ A;  1THZ A;  5LGN A;  3BA8 A;  5L9X A;  2WB1 A;  2JDI G;  3E22 A;  1GKF A;  1B3Q A;  2DN9 A;  1ZX3 A;  3WB1 A;  1N4C A;  4TV8 F;  1AN7 A;  2JEF A;  5DGI A;  2YZM A;  2YRW A;  1VF7 A;  3OGC C;  2R7N A;  3WB2 A;  4F4W A;  2IJH A;  4LF4 O;  3MWD A;  1Q6I A;  3OR6 C;  3T4Z A;  4DUY O;  2WA4 A;  2Z0A A;  5CA1 B;  4TQS A;  3GV5 B;  3EXA A;  2DYS B;  4B3S B;  2Q7E A;  2JEI A;  5CN0 A;  1RK5 A;  5LBQ A;  4AIL C;  5KG1 A;  1BQZ A;  5DGB A;  1ZHS A;  4ZHQ A;  4DUZ O;  2F4V O;  4YJ3 F;  1K92 A;  3NC0 B;  1SQB H;  1SA0 B;  5IYZ F;  1OCC C;  2LW1 A;  3WNZ A;  2VUM A;  4CS2 A;  1X9N A;  2YIB A;  4LF8 O;  2E2I A;  3BPZ A;  4A5U B;  5J2T B;  3I4M G;  4J9Y B;  4DR3 H;  5BWW A;  4Q44 A;  2WLL A;  1Q7Y W;  4DR6 H;  1NH2 D;  4X88 A;  4JI8 B;  1AUX A;  3K3P A;  4HN2 A;  3OSN A;  4X64 B;  4DXW A;  1SES A;  1QBZ A;  4NTY A;  1E4G T;  5JQG F;  5JQG B;  3W5O A;  4DL3 A;  2ZGI A;  5KFM A;  3ABU A;  2IU0 A;  3HO8 A;  4PZ6 A;  1ZQ7 A;  1BGY H;  3RYF B;  1YIJ V;  1I94 O;  2AZ2 A;  4DV7 O;  1N34 H;  4ZHQ F;  4WBN B;  1VBH A;  1D5N A;  1K83 A;  2UVW A;  2DLN A;  4O3Q A;  1B6Q A;  3SYC A;  3IN5 A;  2EIM C;  3OTO B;  2B1I A;  4TV9 B;  2LW7 A;  1RJR A;  4O81 A;  4JGS A;  4DL2 A;  2VQF O;  5A2Q W;  4DR2 H;  5CMU A;  4JI3 B;  4DV2 O;  5L3G A;  3DXR A;  2DAB A;  2Q2T A;  4J80 A;  3WO1 A;  3OAA G;  1QLN A;  1KJJ A;  1L8D A;  3ASO C;  1VQ9 V;  4GX5 A;  2YI9 A;  5IY5 C;  2Q7G A;  5DED A;  1JCH A;  5DQI A;  1GN2 A;  4Q20 A;  1XMO O;  3P3P A;  4O7Y A;  4O3S A;  1E4E A;  2YL2 A;  1IBK O;  2BSK A;  1XL6 A;  4LWS B;  1HNX O;  4L1K A;  1AJN A;  5D1O A;  1U96 A;  2VS0 A;  2XT9 A;  4DR6 B;  2M05 A;  2GUZ A;  5BWR A;  1FKA H;  5KT3 A;  5FPO A;  1CQI B;  2IP4 A;  1BE3 H;  1YZB A;  3W7U A;  1BNC A;  3KHL A;  3RAX A;  1HNW H;  1OCR C;  3KYH C;  3MFI A;  5B1N A;  3R9R A;  3CHX A;  4QGP A;  2QTS A;  4KL1 A;  1NVP B;  5C3E G;  1JKJ B;  3ZJZ A;  1WLE A;  5DEC A;  2YCH A;  2K1E A;  1Q6U A;  1X4T A;  2FK3 A;  2CW7 A;  1FD9 A;  5J9P C;  2YID A;  1KJ9 A;  3CCQ V;  5KFX A;  3GTG A;  3RYH B;  4KHP H;  1RYR A;  1VF6 A;  1ENV A;  2UXD O;  4JI7 B;  1NR1 A;  3OW2 U;  2YXY A;  3GTL A;  5C1P A;  2R9A A;  1QLE B;  5CA0 A;  1VQM V;  4O4J F;  2CGO A;  3Q8Q B;  1W93 A;  3JZ6 A;  2UXB B;  4TUY F;  1KD1 W;  5FJ8 G;  3B40 A;  3C90 A;  4B3M B;  1KJQ A;  4JI6 O;  5LYJ B;  1BHA A;  3WG7 C;  1FJG B;  1C3O A;  3Q2O A;  4NZM A;  4MV9 A;  3BAC A;  2EIN B;  5IP7 G;  2W6Q A;  2DPI A;  4FIP C;  2YZL A;  3GDE A;  4O7W A;  1Z5W A;  5LP6 F;  4A3F G;  4W4K A;  4UV9 A;  2UVU A;  1T3N A;  4HQ6 A;  2X7R B;  5H5N A;  4BW5 A;  1R3L C;  4JF3 A;  4DR7 O;  1KBL A;  3ABM B;  1NKD A;  4LFC O;  1JIH A;  4FGR A;  4DV2 H;  2RGV A;  1TWH A;  4GC6 A;  4ZI7 A;  4LF5 O;  2FKL A;  1R9T A;  3ZN1 A;  5GON F;  1PP9 H;  4FFM A;  3OEH G;  2HP8 A;  2FKX A;  4EG0 A;  1K4C C;  2CKZ B;  3B4S A;  3SYQ A;  3BJY A;  4HNU A;  3CC7 V;  3N41 B;  2FPP B;  2E75 B;  4F6R B;  1J5E O;  3AG2 B;  3OEE G;  4YY3 O;  1S0V A;  3MFH A;  2EJ2 A;  4ECV A;  1XI1 A;  2WAQ E;  2R86 A;  2GUZ B;  2HGW A;  4NXN H;  1MA1 A;  4TQF A;  4QPK A;  2EJ0 A;  4MVS A;  2OIE A;  3QWU A;  2UU9 H;  5I5T A;  4O7Z A;  4IGG A;  3GQC A;  3IG0 A;  2GLT A;  1E4E B;  5C44 G;  4RNM A;  1WPB A;  3PR4 A;  4DR7 H;  3MHS C;  4BXX G;  4EYH B;  5BMV F;  5KHJ A;  2ZE7 A;  2HHF A;  4MV8 A;  3BA9 A;  2FPG B;  4YHH H;  4J9O A;  4FLV A;  4DAA A;  4XDL A;  3H20 A;  4RAY A;  2XAS A;  1K7D A;  1VF5 B;  2UUC O;  1I50 A;  3VOU A;  1ZLZ A;  2WYO A;  1KP3 A;  2Y48 A;  3E8F A;  2HHH B;  2UUB B;  3RTX A;  2B63 A;  3W7T A;  4G27 B;  4U3J B;  5JJE B;  4FM0 A;  5KFO A;  1B06 A;  2AQ4 A;  1QCE A;  2X6C A;  1XBL A;  3PJS K;  3F5T A;  1RSO B;  2ZR2 A;  3K79 A;  2J9G A;  3TIG A;  5LMN H;  3OUF A;  4G28 B;  3SPJ A;  4I50 A;  4UCV A;  1PL0 A;  2H94 A;  4DL6 A;  1HNZ B;  4DUY H;  5JJJ B;  1WP8 A;  1KUT A;  5I47 A;  2Q5Z A;  2Y4T A;  3KCY A;  4JI2 O;  4MTE A;  4RQE A;  1W0K G;  2NU8 B;  3C3S A;  5L1L A;  4X62 H;  5KA6 A;  1XK5 A;  3RVY A;  1XHZ A;  3HOU G;  3ASO B;  2BOC C;  2X0L A;  3RT3 C; 
#chains in the Genus database with same CATH homology
 4TQD A;  1IBL H;  3HXL A;  4LFB H;  4GYC B;  4LF5 H;  1N34 B;  5FLX W;  4HNA B;  1SYX B;  4OX9 H;  4DR4 H;  3J80 W;  4JI0 B;  4K0K B;  4JI5 B;  4I50 B;  4CH4 A;  4FM1 A;  5LA6 B;  4CS3 A;  1FFX A;  3VQW A;  2VUG A;  4FLY A;  4ZIB A;  5LP6 C;  5KHI A;  4CS4 A;  2F93 B;  1JFF A;  2YIA A;  4LR3 A;  3VNN A;  5J2T A;  4JYA B;  1L2Z A;  4EFE A;  2UUA B;  3JAR B;  4YJ3 A;  2BTQ B;  2O03 A;  2PUS A;  2ZIN A;  3LNN A;  4JI4 H;  2RGR A;  4ZHQ B;  3W1G A;  3U0Z A;  5BMV B;  2PGG A;  5JJN B;  1JJO A;  4LSX A;  3T1H H;  3N2K B;  5LMN B;  3N2G B;  1XMQ B;  1Q8I A;  3HKE B;  4PDB A;  1I6U A;  2UUC B;  3LML A;  2ZNI A;  3U11 A;  1HR0 B;  3RYH A;  5LOV B;  4PI2 A;  2ZM6 B;  2UUB H;  4O4J A;  4I9Q A;  3FMA A;  1IBM B;  3A2F A;  2ZCE A;  1Z5V A;  1CKO A;  4JI2 H;  4LMY A;  4J0M A;  4CC6 A;  4NXM H;  3OTF A;  5IYZ B;  3M4I A;  3OTO H;  4B3T B;  3THO A;  2VPS A;  4DV3 H;  3K5O A;  4X66 B;  3RJ0 A;  2GV9 A;  5CB4 A;  1TVK B;  4NXM B;  4X20 A;  1S68 A;  4IAJ A;  1M0T A;  5J2U A;  5KMG B;  1A0I A;  3IAY A;  4RB3 C;  3QF7 A;  4UCR A;  3RFR A;  3N2G A;  3RGZ A;  4ZOL B;  5DIS C;  4LFC B;  4FFB B;  3ICX A;  4I55 A;  5IJ9 B;  1ZAU A;  4DR7 B;  4GKJ H;  4D7T A;  1VS0 A;  4X1Y B;  4YJ2 A;  2HHH H;  5JVD B;  4HBN A;  1GYF A;  4RB2 C;  1I7F A;  4O4L A;  1HW7 A;  4DV6 B;  4TOI A;  3HKD A;  2VQF H;  5CB4 B;  2QJ1 A;  5LA6 A;  4TV9 A;  2VOB A;  4LFA H;  3SR2 C;  4JI1 H;  3B2E E;  3JAT B;  4YY3 H;  2XHB A;  4JV5 B;  2ZIM A;  3L4J A;  4DR5 B;  3EYY A;  1O9H A;  3RWR D;  3JAK A;  4O2A B;  3JAK B;  3GJX B;  4TV8 A;  1IBL B;  2QM4 A;  5D5Q A;  3SJB C;  5IWA H;  4O2B B;  4LF5 B;  4I7H A;  4JI3 H;  4FM2 A;  5JH7 A;  4IHJ B;  1YEW A;  1KU9 A;  1SEI A;  2P22 C;  1WN7 A;  2RJZ A;  4EFB A;  5KX5 A;  1M93 A;  2PY5 A;  3HKB A;  3SJA C;  5BMV A;  1JMK C;  3VQV A;  2UXB H;  4EEQ A;  1HNX H;  5EYP A;  3KXY T;  2YXL A;  4B3T H;  4LNU A;  1NT2 B;  4U3J A;  4O4L B;  3W1B A;  1XMO H;  4YHH B;  5JVD A;  3JAR A;  1M4U A;  3HKC A;  5LYJ A;  4ETS A;  2F4V H;  4DRX A;  4AQY H;  2HVQ A;  1O75 A;  3JAM W;  3RGB A;  4DR3 B;  3RR5 A;  3KAK A;  4DR1 H;  4UCT A;  4ZOL A;  2F66 C;  4DV1 B;  4DRF A;  4O4I A;  3L2P A;  4Q6G A;  3N40 P;  5GON B;  4LFA B;  4IIJ A;  1Z2O X;  1XNR B;  4DV4 B;  4JI4 B;  4IHJ A;  4AQY B;  4LF7 H;  1QQC A;  4X65 B;  4LF4 H;  4O4H B;  4LH7 A;  4JI2 B;  1P8L A;  3NBZ B;  3ETQ A;  2WDT A;  3K59 A;  2PYJ A;  4I4T A;  5K1X A;  3L4K A;  4YY3 B;  2WE6 A;  4R7R A;  2R70 A;  2EX3 A;  5LP6 B;  4GLX A;  1J5E B;  4D7S A;  2VQF B;  2ZM6 H;  1T5E A;  4JI5 H;  1XNQ B;  3DSQ A;  2Q2U A;  1CKN A;  3TY9 A;  2YIB D;  3K5M A;  5FD5 A;  4DR4 B;  2Q0A A;  1SQF A;  3JAT A;  4JYA H;  3SGI A;  5IT9 W;  3RYF A;  4Q0Y A;  4O4J B;  4TUY B;  4FLU A;  4O4H A;  4X1I A;  1RSO A;  4UFZ A;  2YI8 A;  1E4F T;  4CH3 A;  4LFC H;  1XQ8 A;  3TY8 A;  1HNX B;  2E3C A;  2W57 A;  4CC5 A;  4LF6 H;  3HKE A;  5KHH A;  4O4I B;  4LFB B;  4L8J A;  4X1Y A;  4YJ2 B;  1N32 H;  1Q43 A;  4FFB A;  1DGS A;  4K8X A;  1TA8 A;  5D5P A;  4DV5 B;  4YJ3 B;  2OWO A;  4LSA A;  1QHT A;  3JSN A;  1Z2P X;  1JFF B;  5KMG A;  4RZQ A;  1Q3E A;  4DUZ H;  3KAL A;  3CVZ A;  2CW8 A;  2CAZ C;  4X1I B;  3K58 A;  1FJG H;  1FFX B;  4JI8 H;  5KX5 B;  4TUY A;  5KHG A;  5LL6 b;  3PN1 A;  4DV0 H;  5CA1 A;  4X62 B;  4CH6 A;  5JH7 B;  2UXD B;  3JSL A;  2FE3 A;  5KHK A;  2ZIO A;  4HNA A;  4DV3 B;  5EIB D;  1CKN B;  3BA8 A;  4TV8 B;  4DV0 B;  3E22 A;  3FFQ A;  3WB1 A;  1AN7 A;  1M0W A;  1HNW B;  1VF7 A;  3WB2 A;  5IWA B;  2BTO A;  4ZI7 B;  2MCT A;  5FD6 A;  3JAS A;  4NVP A;  5CA1 B;  4JI0 H;  4B3S B;  4IIJ B;  5GON A;  2Q7E A;  5JCO C;  1N32 B;  4AIL C;  1ZHS A;  4ZHQ A;  4JI6 B;  5EZY B;  3NC0 B;  1SA0 B;  4B3S H;  3BAA A;  1XMO B;  1CKM A;  2JVD A;  4CS2 A;  4LF8 H;  3CSX A;  2YIB A;  2BTQ A;  4LF8 B;  2ZNJ A;  1X9N A;  4BW9 A;  3BPZ A;  1SA0 A;  5J2T B;  3MAQ A;  4JI6 H;  2UUC H;  4DR3 H;  2PTM A;  4K8Z A;  1N36 H;  3JAW B;  3RYC A;  2V4D A;  4DR6 H;  1G6U A;  4JI8 B;  2VWK A;  2KSW A;  5CA0 B;  4X64 B;  4DV4 H;  3JAS B;  4PHZ A;  1E4G T;  5JQG B;  4DV2 B;  3W5O A;  3UT5 B;  1WNS A;  4X20 B;  4LF4 B;  4X65 H;  4PZ6 A;  5EOY A;  3RYF B;  1XNR H;  4UCS A;  1N34 H;  3K3V A;  5LXT B;  3QG5 A;  4WBN B;  5BR8 H;  1TUB A;  3NBY B;  4FVM A;  4MTD A;  3VQY A;  4DR5 H;  4F6R A;  5C8Y A;  4GKK B;  4B3R B;  2IM9 A;  4EQ5 A;  4FLX A;  1SKV A;  1P16 A;  2KKW A;  3BRC A;  2JGU A;  5LXT A;  1IBK B;  3OTO B;  1WH2 A;  1I94 B;  3RGX A;  1I94 H;  3TY5 A;  4PI0 A;  5D1P A;  4TV9 B;  3K57 A;  5A2Q W;  4EB6 A;  4DR2 H;  1N33 B;  4JI3 B;  4DK0 A;  5JQG A;  2Q2T A;  3WB0 A;  4RAZ A;  2XIG A;  2HIV A;  1TAE A;  1L8D A;  1SQG A;  3RYC B;  2UU9 B;  3BHP A;  2YI9 A;  4CH5 A;  2UUA H;  2Q7G A;  1KMI Z;  3ZS8 C;  3T1H B;  1M5I A;  3J7A K;  5EZY A;  2PZS A;  5BR8 B;  5D1O A;  1Q5O A;  3QTC A;  4DR6 B;  3C0F B;  3HKB B;  1TVK A;  4DV1 H;  1FKA H;  5FPO A;  2Q7H A;  4DUY B;  1HNZ H;  5ITZ A;  2OYQ A;  2F95 B;  1HNW H;  4JV5 H;  1J5E H;  3KYH C;  4DV7 B;  3CHX A;  2VWJ A;  4KL1 A;  1B04 A;  1N33 H;  4UCO A;  2YCH A;  1X4T A;  2CW7 A;  3T1Y B;  4LF7 B;  3E22 B;  3T1Y H;  4K0K H;  3DF7 A;  4A2A A;  3S24 A;  2CFM A;  5IJ0 B;  3RYH B;  4KHP H;  4PZ7 A;  4JI7 B;  3UQ8 A;  4FLW A;  2R9A A;  5CA0 A;  4GKK H;  1BGW A;  1MZB A;  3N2K A;  4X1K A;  4DR2 B;  2UXB B;  5K1P A;  5LMU B;  3JAW A;  3JAL A;  5D1O B;  4B3M B;  4DRX B;  2F4V B;  4DUZ B;  4B3M H;  3HKC B;  5LYJ B;  1ZHQ A;  3J81 W;  1IBK H;  1FJG B;  4DR1 B;  3N44 B;  4NXN B;  3F8N A;  2JS5 A;  1XMQ H;  4MV9 A;  4LNU B;  2R72 A;  4RB0 A;  3BAB A;  3GDE A;  5IJ9 A;  5EYP B;  1Z5W A;  2UXC H;  4RB1 A;  3JAL B;  2E5L B;  1H2S B;  4LF9 H;  2RQ6 A;  5FNV B;  4LF9 B;  4UCU A;  1XDN A;  4BWA A;  4X64 H;  3N6X A;  3U10 A;  4FLZ A;  2UXC B;  2UXD H;  5JCO A;  4M7E A;  4DV2 H;  4O2B A;  2RGV A;  3SJC C;  4ZI7 A;  4DV5 H;  1HR0 H;  2P5O A;  2PYL A;  4B08 A;  4KHP B;  3RYI A;  2HGS A;  3K5N A;  4DV6 H;  1O9G A;  1P49 A;  1Z2N X;  3N41 B;  1FVI A;  4APM A;  3GB8 B;  4JI1 B;  5C8Y B;  4F6R B;  2HVR A;  3MWM A;  1XNQ H;  5LP6 A;  5ITZ B;  2VQE H;  2VQE B;  4JI7 H;  4DK1 A;  3RYI B;  4DV7 H;  4I4T B;  1XI1 A;  4PZ8 A;  4NXN H;  4TQF A;  3HKD B;  5LOV A;  3K5L A;  2HIX A;  2HVS A;  3RIZ A;  3UT5 A;  3QWU A;  2UU9 H;  3IG0 A;  4GKJ B;  4DR7 H;  1S5J A;  1WPB A;  5EIB C;  5FPR A;  4E6N A;  2ZJT A;  5FNV A;  5KHJ A;  3BA9 A;  4YHH H;  4FLV A;  4FLT A;  4OX9 B;  3H20 A;  4RAY A;  3N43 B;  4I55 B;  1BJT A;  4BWS C;  2HEP A;  4AHC A;  1N36 B;  2WYO A;  2HHH B;  2UUB B;  3RTX A;  2E5L H;  5LMU H;  4U3J B;  5JJE B;  1D5A A;  3VQX A;  4FM0 A;  1S03 G;  5J2U B;  1V9P A;  1TGO A;  4FM9 A;  4EB6 B;  3CB2 A;  3N42 B;  3ZED A;  5LMN H;  1XHX A;  4X1K B;  4B3R H;  3M7M X;  4I50 A;  4UCV A;  4MV7 A;  1HNZ B;  5IYZ A;  4DUY H;  5JJJ B;  1IBM H;  2F1M A;  5IJ0 A;  4X66 H;  4LH6 A;  4MTE A;  3RF2 A;  4O2A A;  4X62 H;  1TUB B;  4A2B A;  1XK5 A;  1XHZ A;  4WBN A;  3KAJ A;  4LF6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...