4CC5A

Fragment-based discovery of 6 azaindazoles as inhibitors of bacterial dna ligase
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
308
structure length
308
Chain Sequence
b'ADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title Fragment-Based Discovery of 6-Azaindazoles as Inhibitors of Bacterial DNA Ligase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 109
structure length 308
sequence length 308
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4cc5A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4cc5A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4cc5A02
2VQEB 3S24A 1XMQB 3GB8B 1XNQB 4LH7A 3BA9A 3RTXA 2VUGA 1CKMA 3W5OA 2HVSA 5D1PA 4CC5A 2HIVA 4B3MB 4UCSA 4DR2B 4K0KB 1ZAUA 3T1HB 1XMOB 4DRFA 3L2PA 1DGSA 4LF9B 3TY5A 4EQ5A 4JV5B 4PZ6A 2HHHB 4YHHB 3PN1A 3BA8A 4JI1B 4DUZB 4DV3B 5IWAB 4DR4B 2UU9B 4DR1B 4JI3B 1B04A 3TY8A 3NBZB 1HNWB 4EFBA 3W1GA 1N33B 1HNZB 3RR5A 3BAAA 5D1OA 2Q2TA 4EEQA 2OWOA 4DR3B 4LFAB 5D1OB 2VQFB 4X66B 4TOIA 2HIXA 5BR8B 1I94B 3SGIA 4JI6B 2HVRA 2UXBB 1A0IA 1J5EB 4DV4B 3JSNA 2UUCB 4JI0B 4NXMB 4UCTA 1CKNA 1P8LA 2UUBB 1CKNB 4GLXA 1VS0A 4GKKB 5LMUB 4UCOA 5FPOA 2UUAB 1HR0B 3GDEA 1HNXB 1N32B 1XDNA 5FPRA 3VNNA 3T1YB 4DR7B 3OTOB 4LH6A 4PZ7A 1IBKB 4JI8B 4UCRA 2UXCB 1TAEA 4OX9B 4DR5B 4UCVA 1N36B 1S68A 2HVQA 3NC0B 3NBYB 1V9PA 4X65B 4X62B 1FVIA 2E5LB 1IBMB 4LF4B 4JI7B 4CC6A 3GJXB 4DR6B 3BABA 4DV2B 4EFEA 4YY3B 4E6NA 4JI4B 5LMNB 4X64B 4LF6B 3UQ8A 4KHPB 4NXNB 4JYAB 4DV5B 4UCUA 4LF7B 1X9NA 3W1BA 1N34B 3TY9A 2UXDB 1P16A 1XNRB 1XK5A 2ZM6B 2F4VB 4DV0B 4GKJB 4B3SB 4DV7B 5DISC 4B3TB 4UFZA 4JI2B 2CFMA 4LF8B 1FJGB 1CKOA 1IBLB 4DV6B 4JI5B 3KYHC 4PZ8A 4DV1B 4B3RB 4DUYB 2Q2UA 3JSLA 4LFCB 1TA8A 3QWUA 4LF5B 4LFBB 4AQYB
chains in the Genus database with same CATH superfamily
4DR6O 5LP6F 3JD2A 1XHZA 3M8AA 2CH7B 2WAQE 1Y1WA 3CXCU 1DV1A 4EBEA 3CCRV 2YWVA 2EINC 2MCTA 2UUAO 1KUQA 1WB8A 4UCSA 1EKFA 4MV3A 1ZAUA 3T1HB 1XMOB 2RDIA 2BCCH 3CRCA 3N40P 1HNXO 4F50A 4TV9A 1A48A 1JKJB 3CCJV 5KMGA 3GIJA 4JI4H 4A3JG 4FPPA 4A3IG 2GTAA 3N44B 3E35A 4KHPH 3T2MA 5IYCO 3MDSA 1A32A 2ZDQA 3GILA 1LR1A 5LA6A 1OWTA 4RU9A 2W6IG 5GW7A 3FKIG 3G6BA 3W7WA 3CCLV 3D3IA 3OR6C 5LOVB 4JI4O 2A0LA 3SPJA 2QTOA 3EFFK 1K73W 1VAJA 1Q8IA 4KHPO 1EZVH 3H1LH 4YBZB 3K0GA 4MTGA 2ITDC 3CX5F 1EN6A 2YRXA 5IYDG 4TV9B 4HN2A 1EN4A 3MHHC 4O4HF 1KJJA 2UVVA 4DK0A 4U7OA 1HNZH 1K97A 2GUZA 1T3NA 2BTQA 2W6MA 4FM9A 4O7TA 1P49A 5FL7G 4IGGA 2IBKA 4BIOA 1UC8A 3ABMB 2YW2A 5IY5B 3TINA 1K5SA 3STZC 4O4IA 3GIPA 3FYEB 2O57A 2Z0AA 4XBFA 3EXAA 2XHBA 1HNZO 2E3CA 4FLTA 1G1XB 3ASNC 3A0HZ 1TAEA 3Q8QB 1R6KA 2LGQA 2V1DA 4TQFA 2FKLA 1B6RA 3NC0B 4A93G 1K34A 2QEXV 1S0NA 3D36C 2JEXA 5J9PC 3PW0A 4JI7B 3BEHA 3GJXB 1TUBA 1D5AA 4DR6B 2C2RA 1WAZA 1NJIW 5DQIA 4I5SA 1RM1B 3JCUZ 4YIPA 1I2LA 1PL4A 1BQZA 3S3WA 3H9VA 2B1IA 3MR5A 2JA5G 3CCQV 2BTQB 5C4XG 4I55A 3C3SA 4B08A 1M7JA 4UXNA 5CB4F 3GB7C 5KFBA 2UVUA 3N2KA 4ZI7B 3VPCA 4JYCA 4M7EA 3K03A 4Q20A 2JS5A 3QO5A 1KP3A 1I50A 1IBMH 1H2NA 1GSHA 5D5QA 3U55A 5EC2C 4JZGA 2WLLA 4FK5C 1QQCA 3TQTA 1ZTEA 4JI8O 1WN7A 4OX9O 2MW2B 3VMMA 1FKAO 4LSAA 4F6RA 3TIIA 2IM9A 5LXTA 1XL6A 1N32H 3GWOA 1IBMO 2ZJTA 1PL0A 1BJTA 2C2DA 4TUYF 4DV2O 3S24A 1HP8A 3GB8B 3BY6A 3SPIA 4DV7H 3SE7A 3WU2Z 2HVSA 3PJSK 3N2KB 3JAMN 1N36H 3DTUB 1IBLH 5IYZA 1L0NH 4H44B 3TY5A 4Q8FA 2SCUB 2JA6G 1N32O 3HT5A 1UNNC 1SQGA 1VQKV 1R3JC 1JJ2U 2W0XA 4DV7O 4O82A 2QTSA 2EIMB 2WLLB 1N36O 1VQ9V 2ABJA 1HNZB 1IBLO 3Q1KA 3RR5A 1K4DC 1ET0A 5D1OA 3L73H 2ZDIC 4FVMA 4MW3A 4GCZA 1QVGU 1O9GA 5KHGA 1B33N 1MABG 3CC7V 4FFBA 3CD6V 2JJ2G 4W4LA 3B77A 3JAWB 4PD4F 2YIBA 1QLEC 3LQSA 1XQ8A 3CS5A 5KG7A 1QLNA 3H1IH 4BR6A 3T9CA 3L74H 3OE7G 4ZIBA 5LL6Y 3CCSV 4X9QA 3K3WA 2R7NA 4IR9A 5LOVF 1AJPA 4FIPC 1S0MA 5TISZ 1QBZA 4UCTA 1BS3A 4RZRA 1QCEA 2R7ZG 5EWGA 4G3IA 4YAJB 4DL5A 3ABKC 3E83A 1CKNB 1VS0A 2UVRA 2CNVA 1XREA 1EFRG 1D5NA 5BZBA 4TV9F 3E22A 3AK3A 1NTMH 5BWXA 4UUGA 2YICA 1N48A 4KL1A 4K0KH 4FLUA 3UFXB 1SRYA 4FFBB 4JI8B 5DGBA 5IYBG 4OXSA 4QE7A 4RQFA 4OX9B 5L1KA 1L8DA 3K9AA 5KG5A 3AG3C 3J7AU 2GSMB 5KT3A 1FVIA 1IBMB 1M0WA 4WFFA 2BSKA 4EG0A 3RYHB 3HO8A 2VPSA 1OCRB 1DF5A 2ZE5A 4DV2B 2JEFA 3ICXA 3APQA 2R9RB 3OUFA 4MVQA 2YU9A 4EGQA 2P5OA 5A2QW 4X89A 1ZQ7A 4FBUA 4LFAH 3HKDB 5KFAA 2LFRA 3J7AK 4RZQA 2P4KA 2W6PA 4IIJB 1M0TA 1AUXA 1MOFA 4RAYA 1ZUQA 3UO2A 2HHFA 2FLLA 3E22B 2LQTA 3W7TA 2AU0A 2Q7GA 4N21A 4DV7B 3RVYA 4PDLA 4LFAO 5EBWC 4DO2A 4YY3H 4UB6Z 3T54A 2W9AA 1IBLB 3B40A 4ZI7F 1S0VA 1KEEA 1I5XA 3PVXA 2Q8VA 3MAQA 1VQ7V 5KFEA 4DUYB 3MWEA 2BSKB 4ZQIA 3TIGA 1LUWA 2B63G 3GTPA 1BGYH 5L3CA 1WCMG 2Y48A 2EZPA 2VQEB 3JYCA 4YY3O 1MZFA 2HJFC 1KP2A 2P4VA 2ZR3A 3BA9A 3FB8C 4Q6GA 2CK3G 1TWGA 1I0HA 4R8UA 2FJZA 4JI2H 2HIVA 3AG4C 1M6VA 1Q90D 1YTFB 4PHZA 2V9WA 4X62H 1S5LZ 2DYSB 3PZPA 4O3RA 4JI1B 2BR0A 3OR7C 1HNWB 4JI2O 5JCOC 5JVDA 1HW7A 1M9NA 1ZL8B 5B1BB 2Q2TA 4DW1A 4X62O 4APMA 4DR3B 3B8MA 4NYEA 1Q5OA 2DLNA 2V4RA 4U6PA 2N04A 5DLFA 4F6EA 1BGWA 4O4JA 2GTSA 2ZDHA 2W7OA 3PW7A 2NU7B 1NVPB 2R70A 4GZRB 2H3OA 3N42B 2AXTZ 2KSDA 3ZBHA 1KKCA 2BOBC 2JEUA 2YUAA 4EB6A 1SQBH 4MV1A 3GTLA 2R8HA 5KHJA 5EOYA 1KJ9A 3SPCA 2GV9A 5JVDB 5B3SC 4PA7A 2XAJA 2PF4E 5B1NA 1OCZB 2IA6A 5JQWA 4DR2H 1R3KC 3WG7B 2ZCEA 4DUZH 1N8RW 4DK1A 3CMEV 1I08A 1TWFA 4A3FG 1AROP 1XHXA 2HKOA 3JD4A 5L1LA 5CA1A 3H3VH 2R85A 2WLIB 4NKGB 4X20A 5KFCA 4YY3B 1CE8A 1URFA 2JA5A 3DXRB 4CZZA 4DUZO 3TXQA 2Y0IA 2XD4A 4QSHA 2ZXWC 2XT9A 3W1BA 1P84F 3BQ2A 4J9MA 2JEJA 5BYBA 3T4DA 4IWYA 4BIZA 5H80A 4U7CA 1QVFU 3UO3A 5BWTA 4JI2B 4Q8EA 4IIJF 4WBNB 3CRMA 4FFMA 4NVPA 4RAIA 5HFLA 1M90W 1Y1VA 4X20B 2ODTX 4TQDA 2NU9B 4J9ZB 1OCOB 2Q0OC 2NUAB 3I5DA 4DR7H 3RB4A 1Z2NX 4NB5A 2N74A 1VQ5V 4MAMA 1IBKH 3CJHA 5LP6C 4ED2A 2R93G 3RAXA 3IG0A 1Q3EA 2Q5ZA 2JA6A 2XCPA 5FNVA 2FPPB 2Y4TA 3OHAA 4DR7O 5I5WA 2VA2A 2C35B 3GIDA 1IBKO 3GTJA 1G6UA 1Z5WA 2WDTA 5D8DA 2NVXA 4J7JA 5EYPA 1CQJB 1MG1A 1JDBB 2W7PA 4AQYH 4JUZA 1JX9A 2H94A 3RB0A 1GN4A 1JA8A 1KMIZ 1S97A 1SS3A 5KHKA 5C1OA 4X66B 3JARA 3UCSC 3SYOA 1ULZA 3T5LA 2JVDA 4JI6B 2ASJA 2UXBB 1M56B 1OJHA 4AQYO 5BWUA 2W71A 3TW6A 1BQ0A 4O7SA 5L1JA 4JI5H 3AG1B 4QWCA 5B1OA 3AG2C 2Y0SA 3Q4HA 3RFCA 2FKXA 1M1KW 2JDIG 5KT4A 4P9OA 1BT8A 4YR0A 3IC9A 1IVSA 1SQXH 4RB0A 3ETGA 2AGPA 3E8HA 3I55V 2O03A 1IX9A 2DPJA 3OT7A 1H8EG 4I4TA 2P7TC 4YAKB 1L1FA 5L3BA 1CPYA 2BE3A 4JI5O 2EULA 4ECQA 4A3EG 1NH2D 4M9UA 3MWDA 1O75A 2PI4A 2WA3A 2UXNA 3JARB 1J5EH 2IBZH 3CE2A 3ZRSA 3ZHSA 4YHHH 1GM8A 1Y74A 1Q6IA 5JVDF 2A3QA 3J81N 1T5EA 2WSSG 3HBLA 3KAKA 4E6NA 4W4KA 1M4UA 4OGQB 1VF6A 3ZCCA 4KUMA 3CCEV 4PDMA 5DMXA 1J5EO 3CYOA 1NZ6A 5L3EA 2CTRA 2EIYA 4LWSA 3T1YH 4NXMO 4R8CA 1PNMA 4FZ0A 2DJVA 2X0LA 2LGWA 1AVMA 1EKVA 2ZDGA 1AI6A 4RB2C 1EUDB 1YVWA 4F4ZA 1RYRA 5DISC 1WR2A 3RUPA 2YXHA 1B06A 3T1YO 2GHYA 3VQVA 4RCNA 5IT9W 4FFKA 4FZ1A 4DR5O 3OFNG 1KECA 3W7XA 1WCMA 3RGXA 3C90A 3PO3G 4AQYB 2ZINA 4WBNF 1AI4A 1R6TA 4IZOA 4PA4A 2W9BA 4LWSB 3RTXA 2FE3A 4R7RA 1YXBA 1SERA 5DEDA 3W5OA 4FFPA 4ASUG 4RUFA 4DL4A 1JOYA 2Y69C 4Q4DA 5KFPA 1PX2A 1DGSA 3K0DA 3RBEA 1W93A 1DAAA 1F7YA 3CEBA 1Y14B 2P0AA 2R7KA 2Y0SE 3OMAB 1EBOA 1V54B 2I80A 4ED0A 4RWUA 4Y8VB 3VBBA 2ILMA 1BXRA 3SJQC 1R9TA 1OHHG 5DLGA 3R66A 2ZM6H 1BSMA 3U0GA 4O4HA 2HIXA 3P3NA 3ETHA 3K06A 2P90A 2ASDA 2YI8A 4X1KA 2EIJB 2XCAA 1F4NA 5EBMC 3MJFA 1ZX3A 3T9FA 4DL6A 1J5EB 5LGUA 2ZM6O 3M9NB 4NXMB 4FFOA 5FR9A 4HNTA 4NZOA 5KFOA 4UVBA 2CDYA 3P3PA 4H0LB 2Q6AA 2OCCB 3DTGA 1RJPA 3CC4V 3RBDA 4FE2A 1U97A 1YI2V 2YS6A 2PMZA 4ECYA 4JI3O 5CA0B 2QWNB 3T1YB 1XI1A 3P30A 2RMKB 5KFJA 3T1HH 1XMOH 2Z02A 1I6UA 4Q45A 3TK1A 3OEEG 2XC9A 4DV4H 4DR5B 4X1KB 5LBQA 1S68A 2J9GA 4X1IA 2QDOA 4ECSA 4CC6A 5IY5C 1US6A 3T9BA 3T1HO 2F23A 4PI2A 3SYAA 5KFMA 2JGDA 1W0JG 4MVSA 4DV4O 5HFMA 4G28B 4FU0A 3JATA 4FGRA 3GIQA 4DV5B 2XGQA 1SFOA 1V51A 2W6NA 1PP9H 2V4QA 4CH6A 4CMFA 4EGJA 2JEGA 3S3XA 4G27B 1YITV 3CSWA 5JVLA 2A79B 3JD0A 5KFNA 4TUYA 3GV5B 2QM7A 2HG8A 3N2GB 1BNCA 5AG2A 3VQXA 4X1IB 2DWDC 1K9MW 4LF6H 5IP9G 2FK2A 4O3QA 1QR9A 2PYLA 2W9CA 4F4LA 4X65O 2OYQA 5KFIA 1UC9A 2L35A 3ZHRA 1XMQB 2F93B 2JGDB 2ZQMA 4RB3C 1E79G 2WLNA 4JGSA 2R93A 2FLPA 4LF6O 1CKMA 3UZOA 5D1PA 3IAYA 2PI5A 4NXNO 2ZGIA 1GSAA 4Z1VA 1VIBA 1SETA 5CM0A 3U9TA 2Z04A 3GIIA 4JI7H 1ZHSA 4XDJA 3F5WC 1SZXA 5BPFA 3GVMA 4ECZA 4J9PA 4MVOA 2GDSA 2CNQA 3TY8A 4JI3B 2YYAA 1HWYA 4JYYA 4ME6A 1KJ8A 4RNOA 1VP7A 2KG7A 1N33B 2BQRA 4IRCA 1S5JA 3OMIB 4FM2A 1BCCH 2W9CB 1OBGA 3K5LA 1PNKA 2HVJC 2PMZE 3KREA 3JRWA 3T5JA 2B9ZA 2R72A 3RIZA 2EIMC 1JDEA 2JA7A 1G4YB 2WWWA 3A0RA 3GIMA 4DV4B 3OGIB 1RK5A 3R5XA 3GTMA 3AK2A 2QWQB 1GLVA 3GTKA 3OGCC 3X2QB 3KG2A 3GDEA 3H20A 3VQWA 1DK1A 3OEHG 2KG7B 2IU3A 2W6JG 3R9RA 4JTDB 2R87A 4PJ0Z 3E8GA 2CGOA 3U10A 5BYAA 2FB5A 3G6EV 3RV4A 3H40A 4MVZA 2HVQA 4A3DG 5CA0F 4X65B 5GONA 4XX0B 1Q81W 4MV9A 2RCVA 2JK5C 1PV0A 4LC1A 1NS1A 3OD4A 4ED3A 2WLJA 4O3OA 4J9YB 4IAJA 4LF6B 3K5HA 3KCXA 4N23A 2R7LA 4NXNB 2ARHA 1PKXA 4CHIA 2YIDA 3RBZA 4Z2WA 4ZI7A 1N34B 2DYRB 2UXDB 4RAZA 5KFUA 1OCRC 2F4VB 1SC5B 2QR4A 1VMGA 4XYLB 1IYEA 2A7WA 2CAZC 3WO1A 1I2KA 4HNAB 1K3EA 3E5NA 3KHRA 1H8HG 1DTOA 3KYHC 4QPKA 2I87A 5GONB 3JSLA 5K1PA 3ZMTA 2DOSA 3HOVG 5EIBC 1VKZA 1P7GA 4GKJH 2BTOA 4JI8H 2IJJA 3DC5A 4OX9H 2QWPB 5DM6V 4OPAA 1FKAH 4U3JB 2ODMA 4KXRA 2QK4A 2ATLA 3T9AA 2XTAA 4FFNA 4PZ6A 3TGUH 3CC2V 2Q7EA 3J80W 4DV2H 3G6YA 3HOYG 1Q86W 4GKJO 1S10A 2Q9LA 2FPGB 1MNGA 3FDSA 3PFFA 4NLGA 3O9OA 5BMVA 2VR1A 2RF4A 3FKSG 4EEQA 2DYSC 3JAWA 2OWOA 2CZGA 2DIKA 2G38A 2JEIA 2IJHA 3SGIA 4DYLA 3FD9A 3HOWG 1GAXA 3K5OA 4HBNA 2E76B 3QZ7A 2W8LA 1W0KG 2YSUB 4DL3A 3V4ZA 4ZKIA 2Q7HA 5H9CA 4DUYH 4J0MA 4JI0B 2ADPA 5B1AB 1MSWD 1CKNA 5KFXA 1AP5A 3UT5B 1MA1A 5DECA 2W57A 3GQCA 2IMWP 4BWAA 2QM4A 4GKKB 4O83A 3EPGA 1K83A 2VQEH 1S03G 3G8CA 4AHCA 4O86A 5BMVB 2EJ3A 3P32A 2A1HA 4DUYO 1NT2B 3ZX6A 1H38A 2ZE8A 1F23A 3G6VA 4MA0A 3E8FA 1C3OA 4JI1H 2VQEO 1QHTA 1XILA 2QF7A 4O3SA 4PELA 3RYHA 1HNWH 4J42A 5BXZA 1Y6XA 1Y4MA 1Z2PX 5KUKA 3HKDA 3RGBA 1AI5A 4QWAA 2BQ3A 4PWQA 3WG7C 3CCMV 4JI1O 4DR3H 2UUCO 5HNEA 4IIJA 2P67A 2FLNA 4YP3A 2HFEC 3MWMA 1WA8A 3ABLB 1HNWO 1XK5A 4GKJB 3T4ZA 4DL7A 4MVUA 1TGOA 2KQXA 5EZYB 3T1CA 2ADQB 3SJCC 2IW5A 4B3TB 4E4EA 4DR3O 1VARA 3OMNB 3SPHA 1DV2A 1KUTA 3BVOA 4DV6B 5CBGA 4CMDA 3NXSA 1LNQA 3U54A 4PZ8A 2AGOA 5FLMG 1RSOB 4XDLA 3UYYA 1KC7A 2HJDA 1B6QA 1THZA 4QIWF 3KCYA 4JPRA 3K58A 4J9QA 4C7UA 1S3JA 3TEKA 2R6FA 4J7ZA 4TM5A 3TW7A 4HYKA 3GLKA 5KA6A 3FFQA 4DV0H 5GONF 3O65A 1EZ1A 3UM7A 1WPXA 5LGNA 2P06A 4JASA 1WA8B 4E4TA 3FYIB 5KT7A 5KX5A 3T9DA 4JV5B 2DPIA 2EJRA 3N6RA 1OCOC 5L9XA 2WLMA 1KC8W 2YIBD 1XNRO 1UFIA 3PO2G 2P22C 4DV0O 4TV8F 2X5RA 2CUGA 3ASNB 5LYJA 3K04A 2E74B 1ZL8A 1IURA 1GKFA 5LHHA 2HGSA 2FK1A 1RPOA 2X7RB 1S77D 1FPOA 3WWIA 5EK0A 5IYDO 2FB9A 3CB2A 4R7CA 2YXLA 4NZNA 1V55C 4D6TH 1BHAA 2YZMA 5CAEB 5LHIA 2JS3A 4DR1H 1A0IA 1AJQA 4CS3A 2OCHA 4EBCA 3IFXA 4X8AA 1XNQO 2DE0X 5IJ0A 5KX5B 5EIBD 2RQ6A 4XDKA 2UUCB 1NI8A 3BCCH 2OIEA 4LMYA 5CE8A 2PBZA 5ITZB 1WJZA 1A0GA 5LYJB 3KXYT 4UV9A 4U7NA 2X6BA 3FKIA 1XBLA 1Q7YW 3V6JA 4GC6A 4PZ7A 4QWEA 2E2HA 3IJ4A 4OPHA 2PY5A 5KT5A 1FAFA 3H1KH 1JFFA 4P30A 3MHSC 2WYOA 1GK9A 1YTFD 4C5AA 1WRVA 5BMVF 2WLIA 5KUMA 2E5LB 3QG5A 4L8JA 3E8BA 2B1GA 5JJNB 5H5NA 4B7EA 5IJ0B 1XL4A 2YS7A 3DXRA 4MW8A 4ECXA 5B66Z 4FFRA 3I4NG 4JF3A 4PBCA 1GN3A 1Q6UA 4H13B 4X66H 1K92A 4XZ3B 4P2ZA 5FLXW 4JI6H 3N27A 4BIUA 2UXBH 4K8XA 1XNRB 4D7SA 4DV0B 5C8YA 2OTLV 4B3SB 1Z5VA 5I60A 5LHGA 2NU8B 2DMXA 2M7WA 2YC0A 4WBNA 1UJWB 4X66O 1S0OA 1JFFB 1CKOA 5DGHA 5LMNH 1JVMA 1QLEB 3D3QA 4JI6O 1F51A 2JRIA 2UXBO 2QWOB 5KKNB 3QO8A 5EZYF 1L0LH 3BRCA 5JJJB 5BWRA 1WNSA 3NGDA 1C30A 3E2EA 3L4JA 3ABKB 5F9LA 1P7BA 5LMNO 1XNQB 4CE5A 3B09A 3F5TA 3R65A 4O2AB 2CKZB 3GIKA 1IXMA 1X4TA 1WP7A 4MTXA 1G2WA 4O7NA 3H0GG 2NR5A 5C8YB 1VF6C 1YF2A 2LO1A 5EWEA 3EVKA 1TVKB 2WPDG 1XDCA 3HKBA 4MV7A 4H37A 4UB8Z 1B04A 3JD3A 5KFKA 1RYSA 3MFIA 3MR2A 4EBDA 3W1GA 3AG3B 3RB3A 2XCLA 2VUMG 2CTQA 4J9NA 2CTPA 3HKZA 1RP3B 4Q44A 1EKPA 4QE9A 4RUCA 5CA3A 2R92G 4L87A 1F4MA 5L3DA 1NU1H 3R5HA 3M9OB 2WTFA 4TWKA 3B2EE 3STLC 3JSNA 2ZNIA 3N8DA 3KALA 2CTWA 1SA0A 1SCUB 3T7AA 2HP8A 5D5PA 5T14A 2DAAA 3LUTB 2NLJC 4LNUA 2V59A 5IYBO 2EIJC 2EIKC 2K1EA 3H1JH 4RO2A 1RK6A 3OSNA 3HKBB 4B7KA 4I50A 5KX5F 1WPBA 2RJZA 2CW7A 2CGNA 2VWKA 1U96A 3T99A 4MTOA 3K3PA 2LP7A 3HOXG 4PDVA 4G2KA 5LYJF 4FJCC 1K33A 4Q4CA 1KQSU 1I1KA 2OCCC 3T5HA 4LBEC 4DAAA 3ZHTA 2R8GA 2YEVA 2R7ZA 3LSUA 5I5VA 3IN5A 5H6QA 2HG5C 5LMNB 1OZ0A 1SA0B 3H4DA 2OTJV 2J6TA 2YDEA 1NH2B 3TQ1A 4LNUB 1SKVA 3TCUA 4ZBMA 3GTQA 1S9FA 2HJWA 4QW9A 2Y0PA 3KHLA 3U0ZA 3WFVA 2EBOA 4I50B 1K1QA 1Y1WG 2C28A 2P6JA 1W96A 3V4SA 4M0JA 2GPSA 4BXXG 3BG5A 4YQWA 4I0XA 4NXMH 3HOUG 3AG7A 1N0NA 4X64H 1KJIA 1KT8A 4YJ2A 4Q43A 3HB9A 4BBRG 3K5NA 3JAMW 2Q67A 2YEVB 3V6HA 2ZIOA 1JR9A 3OUSA 5L1IA 4I7HA 4PI0A 4F4YA 3RW0A 4YIOA 3B8NA 2XIGA 3ZMUA 4AILC 2ALZA 2Q0AA 2Y4RA 2LW7A 4LH7A 5KAIZ 4IT5A 4X64O 1YCIA 3PW4A 4DR5H 4GX2A 3HKZE 1GN6A 5C93A 2FMAA 5B3SB 4EQ5A 2F66C 3BA8A 4C5BA 5IP7G 4IRKA 5KFTA 4DV3B 3CRQA 1OCCC 5EBLC 4I0XB 1S76D 4O2AF 4YR2A 4LF5H 4ECVA 2I8CA 4A2BA 1T36A 5FJ8G 5C3EG 1VQMV 3E86A 4YJ2B 5C8YF 4DV5H 4BW5A 4O81A 2B63A 1KTAA 4Z1MG 4NZMA 2DWCA 4TOIA 4XYMB 4FFLA 1RJQA 1BE3H 4LF5O 5GTIZ 3G67A 1GGOA 3BHPA 5IYCG 2CQYA 4TVIA 4DV5O 1NQTA 3K57A 1GYFA 2R86A 2ZNJA 2W6QA 2IJIA 3AEIA 3ORRA 4ZHQA 1PK8A 1P8LA 3M4IA 3AK1A 2HR3A 2UUBB 2PGGA 3ABTA 4NYKA 4HR7A 1A9XA 5LMUB 4UCOA 4WFGA 5FPOA 1HR0B 3DTFA 3SYQA 1R3LC 4UVAA 3H4BA 2WE6A 1XMQH 2LW1A 2XAFA 5CA0A 4DR4O 1XDNA 3VNNA 1GRJA 3PR4A 4K35A 4WFHA 1R6NA 1MSDA 3OW2U 5DQHA 4JV2A 2ITCC 1GMGA 4HNUA 3IC7A 4K8ZA 3X2QC 1XMQO 1FXKA 1M93A 3ZJZA 1KBLA 2PYJA 2J6SA 2QSAA 4JI3H 4DLKA 1L2ZA 1ZWIC 5KG3A 3SDLA 1N33H 2RNBA 4ZHQB 3KHHA 4X64B 4A3GG 3SR2C 1N0JA 2DWEC 3CP1A 4UCUA 1IZ3A 1X9NA 2QGNA 4ED8A 1SF9A 4KFMA 4MV4A 3IGAC 3CMAV 4J9SA 4F4WA 1N33O 5F9NA 1WP8A 2NNUA 2VWJA 1CP9A 5J2TA 3R5FA 4LF4H 2Z5UA 4GX5A 5A2QN 4UFZA 2OLSA 3N2GA 4IYHA 1PM9A 3K08A 2D3OW 4LF8B 2VQDA 4I50F 1M57B 4IYIA 3ABMC 1SYXB 3CWBH 3KTMA 2E75B 4CKEA 1FXKB 5K2MA 5KHIA 1DF4A 3ABUA 1YDXA 3W7UA 2VS0A 4LF5B 2EILB 4LF4O 3K5MA 4HYOA 3I4MG 4RUEA 4FLZA 1AR4A 1ZSPA 5E79Z 2PN1A 1GN2A 3VQYA 4B3MB 2QB5A 5KFZA 1RM1C 3H0GA 2HGWA 5KG2A 1RPRA 4X65H 1O9HA 4J9RA 1VQLV 4IRDA 4B3RH 1I7FA 5J2TB 3VPDA 2F1MA 3TXSA 3M7MX 5DG9A 4CH4A 5IWAB 4DR4B 1GSOA 1BZKA 2DQ0A 5JQGA 2W6OA 1XEQA 4PV1B 4NXNH 3PW2A 5KG1A 1AJNA 4QJFA 1N34H 1NKDA 4DV1O 1N56A 1JXLA 2UXDH 2Q69A 4B3RO 4BW9A 3OUZA 4A3MG 3SYCA 2F4VH 2CE4A 4LF9H 3CEIA 3LP8A 3RF2A 5I5XA 3CCUV 1P4RA 4YJ2F 4FS2A 4WD3A 2FK3A 4O7LA 3DSQA 1N34O 5KS8A 1UPGA 2UXDO 2MK3A 4DQNA 4J7KA 2F4VO 4I7ZB 4PA3A 4LF9O 1RFYA 1D2DA 3JD1A 5JQGB 4O84A 2QM8A 2V5AA 3BQ0A 3FMAA 2OIGA 3CHXA 1GO3E 4GC7A 2LFSA 4QJFB 1VQ6V 2UU9O 2CNUA 3JRXA 4EEYA 1PPJH 5B1AC 3W7SA 4ZOLA 2DZDA 1K1SA 1Q82W 5KT6A 2ZE6A 5JH7B 3ZRXA 4NTXA 2COIA 5K1XA 3MR6A 4ECTA 3HKCA 2VQFO 4UCVA 2M6YA 1VQ4V 3A8TA 4HZ3A 2R82A 4LF4B 3JASA 2HGXA 4MS2A 1NTKH 1E1RG 2ZT9B 4FBTA 4FM1A 4O4LA 3C0FB 5KFWA 2XUMA 4CS2A 5DGIA 4ED6A 3LULA 4HQ6A 4JYAB 3OTOH 2GQRA 4LF7B 2NN4A 4JAUA 3JZIA 3ASOB 1JCHA 1H2GA 2UXCH 4RUAA 4ZHQF 2HDKA 2QE7G 5BPHA 1Y76A 5FD6A 2KKWA 5KFRA 4HNAA 4QIWA 5LL6b 1H2KA 1NTZH 4ZOLB 2YL2A 2R9AA 4JI0H 1FJGB 3OTOO 4BWSC 1FYJA 4JTAB 4TQSA 3HKCB 3EYYA 4DV1B 4ECWA 2GBOA 4HAMA 2UXCO 3TJTA 4B3RB 4GKKH 2C2AA 3ABLC 1TWHA 3JASB 3BFRA 5KFGA 1K5QA 4O4LB 3HPLC 3VA7A 4JI0O 3I56V 3K5IA 3N41B 3A2FA 5A9GA 4TV8A 5CMUA 1NR7A 3ZMZA 4U3JA 4PDBA 3ETQA 4GKKO 3ZN1A 2ETNA 3WB2A 3L2PA 4X88A 4DRFA 4LF9B 1GO3F 2HHHB 1Y76B 2DABA 4JZ2A 1GM9A 3JCZA 3L71H 4LR3A 3ETJA 3FAVA 5KMGB 3LWBA 2UU9B 2V7QG 3NBZB 4PA6A 4WFEA 1IOWA 2DW4A 3BAAA 1DLBA 4IHJA 4E2LA 4U3FH 3HR0A 5J2TF 3M9MB 5H6RA 3KKYA 1I3QA 5LA6B 4O7YA 2VQFB 1AR5A 4P9PA 2OT5A 1H2MA 4EKWA 5BR8B 1AN7A 2CW8A 2A06H 4TV8B 4B3TH 3SJBC 5KFSA 5H2FZ 2C00A 4DV6H 5E1AC 3DGEA 3UKMA 2XNDG 2ZR2A 3OTFA 4O7RA 4YXWG 3UT5A 1EZJA 1WB7A 2ZE7A 5BY1A 1J95A 3LMLA 3FAVB 4GYCB 4B3TO 1DIKA 2GUZB 2YXYA 3SYPA 3LDDA 2UUAB 3J81W 4A3KG 5KG6A 3SJAC 4DV6O 3FB6C 4J41A 3WB0A 1HNXB 3N43B 1KU9A 2WAMA 4IHJB 4J11A 3L9DA 1FFTB 3OTOB 4TQRA 5DG7A 2QA4V 2J6UA 1ORQC 4O4IB 5JQGF 4JV5H 3CPWU 2UXCB 4MT8A 2VPQA 4CKCA 4KP4A 3NBYB 1EHIA 4QIWE 5HV6A 5B1BC 2EJ7A 5JH7F 4JI4B 5C5JA 4FLWA 1TUBB 1IOVA 4GT1A 3L75H 3RYCA 4DXWA 4JV5O 1Y1VG 3G71V 3SI8A 4KHPB 1AR1B 1JPXA 2Y4UA 3Q8PB 4QNHB 1R73A 2FYUH 2QKCA 4PDRA 5E25A 4QW8A 1GH6A 3TY9A 3PR5B 4I55B 4TSFG 2PTMA 4ECRA 5EZYA 1K7DA 4J9KA 2WA4A 4WFAV 2AQ4A 4JV1A 1R3IC 2CFMA 1I7NA 2UUCH 1CS0A 3G4SV 3RB6A 1RSOA 4GX0A 4O7ZA 4ABMA 3BACA 3K3VA 2EINB 3H01A 1OCZC 1TA8A 4ZOLF 5JWPA 2Q73A 4DW0A 1MZBA 3RWRD 1W59A 1M5IA 4F6RB 3RYCB 5LXTB 3OM3B 2GLTA 3FB5C 1Z2OX 3ZIAG 3ETEA 4LCUC 5IT9N 4O4LF 2HLDG 3ZHQA 2R8KA 2E5LH 1AUVA 1NBMG 5IYZB 1FXHA 5EWFA 5DGAA 4MTFA 3RYIA 2Q4PA 5LGTA 3D36A 1RJRA 3JAKA 1BL8A 3Q8RB 3LSSA 4ECUA 4CH3A 3Q2OA 2E5LO 2YRWA 3WB1A 5KG0A 4LSXA 4DIMA 1XNRH 5D1OB 4JXUA 3LSQA 4B3SH 4A5UB 2WLHA 5I5YA 3G8DA 2JGUA 4C2MA 4RB1A 2VOBA 2W6ZA 5LA6F 5DAAA 2N05A 2EJ2A 2R8IA 2COGA 3A0BZ 1VF5B 4RNNA 5KLVH 3RT3C 4K0KO 4B3SO 5ITZA 1YSCA 3G80A 3ZHUA 4GLXA 3RYIB 3L70H 4ETSA 2LJ2A 3N6XA 2XGPA 4O7VA 2QKAA 4IWXA 1I94H 2H8PC 3JAKB 1E4FT 1XNQH 3FX7A 1N32B 4DR1O 3OSPA 2Q68A 3KAJA 3APOA 1CEZA 5IE9A 1E4EA 3H1HH 4UCRA 4MA5A 3VOTA 4CH5A 3LDEA 1N36B 5EDWA 3RAQA 4IHJF 1V9PA 1I94O 1XOUA 3CRAA 3Q8SB 4K3AA 1JLLB 1TWAA 1VQOV 3ETDA 4O4IF 4EFEA 4DL2A 1IXBA 4FLXA 1YJWV 4J10A 5KFFA 2GPWA 1M56C 5KFHA 2AW9A 1WLEA 4DRXA 3AX6A 3CCVV 3AG1C 2QYZA 1P16A 3F8NA 2HEPA 3E89A 2ZDIA 2NVYA 5DN6G 2HHFB 5J2UA 1E4EB 3RJ0A 1CQIB 5F2VO 5KA5A 4CBCA 2DN9A 3ZHVA 2ASLA 4QGPA 3SNOA 3T5KA 4I55F 2RN9A 2ZIMA 1SQPH 1JX4A 2AZ0A 4RQEA 2E2IA 4UUJC 4D7TA 3C3TA 4O7WA 1OV9A 3LDCA 1YEWA 3TETA 1I5YA 3L4KA 4O2AA 4DRXB 3RGZA 1WH2A 4GX1A 1NR1A 5CR5A 4K0KB 4R8UB 5LXTF 4MV8A 4JTCB 1TVKA 4GUNA 5I5UA 2V4DA 2YZGA 2FPIB 4R6ZA 5J2UB 1NVPD 2W8KA 1FD9A 1S72V 4RNMA 2XAHA 1IDSA 5DG8A 3KZIZ 1X59A 4DR1B 4A3LG 1AILA 5JJEB 4K6NA 5IYZF 2RGRA 1Z2GA 2FP4B 4LFAB 2BQUA 1CXZB 2IH3C 1AP6A 2K9PA 3THOA 4FLYA 1I94B 4EYHB 2HVRA 1ENVA 2YZNA 3NUAA 1ZHQA 1E4GT 4H33A 4O4JB 3ZRWA 1VEWA 1SQQH 1KB9F 3F7VC 4MVRA 4YB8B 4DR2O 2ZD9A 3QF7A 3ZMVA 1ZLZA 2FMLA 4JAVA 4EB6B 3HXLA 3LNMB 5CBHA 2XOKG 1GTOA 2HVKC 2JIZG 2COJA 3WNZA 5I47A 3HKEA 1TUEB 5JUMA 4LP8A 3PW5A 4X1YA 5L3GA 3ZMSA 2V58A 4J9LA 3ZS8C 1VQPV 1Q6HA 1E1QG 4FMTA 3ML0A 1V54C 5L3FA 4DV3H 1LUVA 2AGAA 4X62B 3NR7A 3QVNA 3ZRWB 2R7MA 4A3BG 1FS0G 5CA1B 1GM7A 2QWRB 3HOZG 1H2LA 2EZOA 3UQ8A 1QU7A 3BJYA 2YS8A 2UXXA 4DV3O 4I9QA 2IP4A 3CQZA 5JCOA 2Q7DA 4O2BA 3HKEB 4MTEA 3G6XA 3GTGA 4X1YB 2X6AA 2PVPA 3UZBA 2WLKA 4J9OA 1MMMA 1V55B 2UUBH 1Y67A 1V4YA 2AHZA 5LMUH 4NTYA 2ATKC 3AG4B 5K3WA 4UV8A 1I7LA 2Q2UA 1HR0H 3FB7C 2VRZA 4FM0A 5GTHZ 3GV8B 2R9IA 2YIAA 3RFRA 2WB1A 1KKDA 3DF7A 5KHHA 2F95B 5IJ9A 1SESA 1M57C 5B5EZ 2UUBO 5I5SA 2VUGA 4O3PA 5LMUO 3GV7B 4CC5A 3CJHB 1FXKC 4O2BB 4TT3G 4DR2B 1HR0O 2ZKOA 5BWWA 3MFHA 4FS1A 3MR3A 3QO7A 1MZEA 1TWCA 2JA7G 2EILC 4UVCA 1KD1W 4DUZB 1H2SB 5FNVB 1SQFA 2R84A 5KFQA 2R8JA 5KAFZ 2D2CB 1SZTA 3K59A 1VBHA 3M99B 3ZN0A 1EN5A 2DQ3A 2AGQA 2IH1C 1AB3A 2XASA 4F4XA 1FFXA 5EYPB 5J2UF 4ED7A 1B3QA 4BBSG 4QWBA 1G8MA 1EUCB 3BQ1A 3J80N 2GQSA 3ZRVA 5KT2A 2YZLA 4WHXA 3VOUA 4PA9A 5IJ9B 1YIJV 2M05A 4C5CA 2PZSA 3MD0A 4LF8H 2EX3A 1VQ8V 1K8AW 1PD3A 2Z3YA 5KG4A 5C44G 1K4CC 3JZ6A 1OBDA 2RGVA 3Q4HB 3CRRA 3QFFA 4A3CG 4O4JF 4O3NA 3SPGA 1Y66A 4YHHO 1B6SA 3LNNA 3OHBA 4EYIB 4LF8O 2XAQA 3KHGA 1FFXB 4I4TB 4L1KA 5FPRA 5KFYA 4DR7B 4B3MH 1IBKB 3DC6A 4QWDA 1YJ9V 1JMKC 4YJ3A 1EM1A 1YZBA 5LP6A 1ZETA 2ZXWB 1ROPA 2YCHA 2C2EA 1Y74B 5IWAH 4DR4H 5KFVA 3OAAG 2NU6B 3QZ8A 4B3MO 3K9SA 3T9EA 5C1PA 1JJOA 2UVWA 4IR1A 2AZ2A 1VF7A 5IWAO 4BY1G 2WB1E 5CA1F 4NR1A 3QTCA 3F7YC 1KYOF 1I1MA 4MSWC 4YR3A 1W2BU 2IU0A 2EJ0A 5KFDA 2QKSA 4YJ3B 4QPJA 4JI5B 3JALA 1N4CA 5LP6B 2X0SA 3ASOC 5EC1C 4NTWA 1QNMA 1SQVH 4I9WA 3EPIA 3JZFA 4J80A 1BHBA 4JI7O 3I12A 4R50A 5BWVA 1WSCA 4WFBV 4CS4A 2RDCA 3K79A 2W9BB 2EIKB 1PNLA 2JJ1G 4ED1A 1VQNV 1HDJA 2A9HA 3D8CA 2W0FC 3OUUA 3AYHB 1JIHA 5IDJA 4YHHB 3PN1A 4CKBA 4GLWA 3RV3A 3RN4A 4LFCH 2L6LA 4AYBA 2RDJA 3WWHA 4O2BF 1S5HC 4LFBH 3JALB 3VPBA 2DYRC 4EFBA 4FLVA 3ZEDA 4JYAH 2AHYA 1XUQA 2WAQA 3U9SA 2FTKA 4ICGA 4LF7H 1AI7A 2VA3A 5FNVF 4BY7G 1QR8A 3AG2B 2IJKA 4JAAA 1KBHA 1A3GA 4LFCO 3CSXA 4O4HB 3WWJA 4LFBO 1YJNV 4JYAO 1FJGH 4LF7O 2F43G 5CB4A 4DV1H 1COWG 3QNEA 3DAAA 1XMOO 4BAYA 4HNVA 1I1LA 4Q0YA 3RVZA 4JV0A 1KJQA 1SEIA 2B5UA 4A2AA 1FJGO 2VUMA 1R1BA 2YI9A 3GTOA 2XAGA 3RYFA 3BPZA 2QJ1A 2X6CA 3WO0A 5KFLA 3EHBB 4LH6A 5JH7A 2R92A 2HHHH 3QQMA 3L72H 4I4TF 4MVMA 3HB3B 3CXHF 2UU9H 1IYDA 2C22A 1T94A 3BABA 5CB4B 1EYZA 5I5TA 1Q43A 4AI8A 4MV6A 3CVZA 2HHHO 2CH7A 2VQFH 1JQ0A 5DQGA 4MTDA 1OCCB 5BR8H 3JATB 3R23A 4JYBA 3V6KA 1YHQV 3ORQA 2ZM6B 3RYFB 2W70A 4IL6Z 1BMFG 3U11A 5HBRB 4DR6H 2KB1A 2PUSA 2KSWA 5CBFA 5BR8O 4TUYB 2FL4A 5FLXN 5FD5A 2Y69B 2OH2A 2BOCC 4WCEV 2UUAH 4LFCB 1VBGA 5CN0A 4AYBE 3AW8A 3QWUA 3B4SA 4WF9V 1HNXH 4LFBB 3GWKC 2JA8G 4YJ3F 5LOVA 1FXVA
chains in the Genus database with same CATH topology
5LXTB 1XHZA 3L4JA 1XNQB 1Z2OX 3RTXA 2FE3A 4R7RA 3W5OA 2MCTA 4O2AB 4UCSA 1X4TA 1ZAUA 3T1HB 1XMOB 1DGSA 3N40P 4TV9A 2E5LH 5C8YB 5IYZB 1TVKB 5KMGA 4JI4H 3RYIA 3HKBA 4MV7A 3N44B 1B04A 4KHPH 3JAKA 3W1GA 5LA6A 4CH3A 4LSXA 3WB1A 1XNRH 5D1OB 2ZM6H 4O4HA 5LOVB 2HIXA 4B3SH 2YI8A 4X1KA 1Q8IA 2JGUA 4RB1A 2VOBA 1J5EB 3B2EE 3JSNA 4TV9B 2ZNIA 3KALA 4NXMB 4DK0A 1SA0A 1HNZH 5D5PA 5ITZA 4LNUA 2BTQA 4GLXA 3RYIB 4FM9A 1P49A 3HKBB 4ETSA 4I50A 3N6XA 1WPBA 2RJZA 2CW7A 2VWKA 1I94H 3JAKB 1XNQH 1E4FT 1N32B 5CA0B 3T1YB 4O4IA 1XI1A 3KAJA 3T1HH 1XMOH 2XHBA 2E3CA 4FLTA 4UCRA 1I6UA 1TAEA 4DV4H 4DR5B 4TQFA 4X1KB 4CH5A 1S68A 1N36B 3NC0B 4X1IA 1V9PA 4JI7B 4CC6A 3GJXB 1TUBA 1D5AA 4DR6B 4EFEA 5LMNB 4FLXA 4PI2A 1SA0B 4LNUB 2BTQB 1SKVA 3JATA 4DV5B 4DRXA 4I55A 4B08A 3U0ZA 4I50B 3N2KA 4ZI7B 1P16A 3F8NA 2HEPA 4F6RB 4M7EA 2JS5A 4CH6A 5J2UA 3RJ0A 1IBMH 5D5QA 4TUYA 4NXMH 3N2GB 1QQCA 3VQXA 4X64H 4X1IB 4LF6H 1WN7A 4YJ2A 2ZIMA 3K5NA 3JAMW 4LSAA 2ZIOA 4F6RA 2IM9A 5LXTA 2PYLA 4D7TA 2OYQA 4I7HA 1N32H 2ZJTA 4PI0A 1BJTA 3S24A 2XIGA 1YEWA 1XMQB 2F93B 4RB3C 4AILC 3GB8B 2Q0AA 3L4KA 4DV7H 4LH7A 4O2AA 4DRXB 3RGZA 1CKMA 2HVSA 1WH2A 5D1PA 4DR5H 3IAYA 3N2KB 4K0KB 1N36H 1IBLH 5IYZA 3TY5A 4EQ5A 1TVKA 2V4DA 4JI7H 2F66C 3BA8A 1ZHSA 5J2UB 1SQGA 4DV3B 4LF5H 3TY8A 4DR1B 4JI3B 5JJEB 4A2BA 4DV5H 4YJ2B 1N33B 1HNZB 3RR5A 5D1OA 1S5JA 2RGRA 4FVMA 1O9GA 5KHGA 4FM2A 4LFAB 4FFBA 4TOIA 3K5LA 3THOA 3JAWB 1MZBA 4FLYA 1I94B 2YIBA 2HVRA 1XQ8A 1ZHQA 2R72A 1E4GT 3RIZA 3BHPA 4ZIBA 4O4JB 3K57A 1GYFA 2ZNJA 4DV4B 4ZHQA 4UCTA 1P8LA 3M4IA 2UUBB 3QF7A 2PGGA 1CKNB 4EB6B 1VS0A 5LMUB 3HXLA 4UCOA 5FPOA 1HR0B 1XMQH 3GDEA 2WE6A 3VQWA 3H20A 5CA0A 3E22A 3HKEA 1XDNA 3VNNA 4KL1A 4K0KH 4X1YA 4FLUA 4FFBB 3U10A 3ZS8C 4JI8B 4OX9B 4K8ZA 1L8DA 2HVQA 4DV3H 4X65B 1M93A 4X62B 5GONA 1FVIA 1IBMB 2PYJA 1M0WA 4MV9A 4DR1H 4JI3H 3RYHB 2VPSA 4DV2B 1L2ZA 3ICXA 5CA1B 1N33H 4ZHQB 2P5OA 4X64B 4IAJA 4LF6B 5A2QW 3SR2C 3UQ8A 4LFAH 4NXNB 3HKDB 3J7AK 4RZQA 4UCUA 4ZI7A 4I9QA 1X9NA 5JCOA 1N34B 4IIJB 4O2BA 1M0TA 2UXDB 4RAZA 4RAYA 3E22B 3HKEB 4MTEA 2F4VB 2Q7GA 4DV7B 2VWJA 5J2TA 2CAZC 4X1YB 4LF4H 4UFZA 3N2GA 4HNAB 4LF8B 4YY3H 1IBLB 2UUBH 3KYHC 3MAQA 1SYXB 5LMUH 4DUYB 2Q2UA 5GONB 3JSLA 5KHIA 5K1PA 1HR0H 4FM0A 4LF5B 3RFRA 2YIAA 3K5MA 5EIBC 2VQEB 3DF7A 5KHHA 2F95B 5IJ9A 4FLZA 4GKJH 2BTOA 4JI8H 3BA9A 4Q6GA 2VUGA 4OX9H 4JI2H 1FKAH 3VQYA 4CC5A 4O2BB 4U3JB 4B3MB 4DR2B 2HIVA 4PHZA 4X65H 4X62H 1O9HA 4PZ6A 4JI1B 4B3RH 2Q7EA 1I7FA 1H2SB 5FNVB 1SQFA 5J2TB 4DUZB 2F1MA 3J80W 4DV2H 3M7MX 4CH4A 5IWAB 4DR4B 3K59A 5JQGA 1HNWB 4NXNH 1FFXA 5JCOC 5EYPB 5JVDA 5BMVA 1HW7A 2Q2TA 1N34H 4APMA 4EEQA 3JAWA 2UXDH 2OWOA 4DR3B 4BW9A 1Q5OA 2F4VH 4LF9H 3SGIA 1BGWA 3RF2A 5IJ9B 4O4JA 2PZSA 2R70A 3K5OA 4HBNA 4LF8H 2EX3A 3N42B 3DSQA 2Q7HA 4DUYH 4J0MA 4JI0B 1CKNA 4EB6A 2RGVA 3UT5B 2W57A 5KHJA 4BWAA 2QM4A 4GKKB 3LNNA 5JQGB 2VQEH 1S03G 5EOYA 3FMAA 1FFXB 3CHXA 4I4TB 4AHCA 2GV9A 5JVDB 5BMVB 5FPRA 4DR7B 1NT2B 4B3MH 4DR2H 1IBKB 4ZOLA 5JH7B 1JMKC 2ZCEA 4YJ3A 5K1XA 4JI1H 4DUZH 3HKCA 1QHTA 4UCVA 4DK1A 5LP6A 2YCHA 3RYHA 5IWAH 1XHXA 4DR4H 4LF4B 5CA1A 3JASA 1HNWH 4X20A 4YY3B 4FM1A 4O4LA 3C0FB 1JJOA 1Z2PX 4CS2A 3HKDA 3RGBA 4DR3H 1VF7A 4JYAB 3OTOH 4IIJA 4LF7B 3W1BA 3MWMA 3QTCA 2UXCH 1XK5A 4GKJB 5FD6A 1TGOA 2KKWA 5EZYB 4HNAA 3SJCC 5LL6b 4ZOLB 4B3TB 2R9AA 4JI2B 4JI0H 1FJGB 4BWSC 4YJ3B 4DV6B 4JI5B 4WBNB 3JALA 3HKCB 5LP6B 3EYYA 4PZ8A 4DV1B 4NVPA 4GKKH 4B3RB 3JASB 4X20B 4TQDA 4O4LB 3K58A 4DR7H 3N41B 1Z2NX 3A2FA 3FFQA 4DV0H 4TV8A 1IBKH 4CS4A 5LP6C 4U3JA 4PDBA 3ETQA 3IG0A 1Q3EA 3WB2A 3L2PA 4DRFA 5KX5A 4LF9B 4JV5B 5FNVA 2HHHB 4YHHB 3PN1A 2YIBD 4LR3A 4LFCH 2P22C 1G6UA 1Z5WA 2WDTA 5KMGB 5LYJA 2UU9B 5EYPA 3JALB 4AQYH 4LFBH 3NBZB 4EFBA 4FLVA 3ZEDA 4JYAH 4LF7H 1KMIZ 3BAAA 4IHJA 2HGSA 5KHKA 5LA6B 2VQFB 4X66B 3JARA 3CB2A 2YXLA 1AN7A 3CSXA 5BR8B 2CW8A 2JVDA 4O4HB 4JI6B 2UXBB 4TV8B 4B3TH 3SJBC 1A0IA 1FJGH 4CS3A 4DV6H 4JI5H 5CB4A 3OTFA 4DV1H 5IJ0A 5KX5B 3UT5A 5EIBD 2RQ6A 2UUCB 4RB0A 3LMLA 4LMYA 4Q0YA 4GYCB 2O03A 1SEIA 5ITZB 4I4TA 2UUAB 5LYJB 3KXYT 4A2AA 3J81W 3SJAC 3WB0A 3N43B 2YI9A 1HNXB 3RYFA 1KU9A 2QJ1A 3BPZA 4IHJB 3OTOB 4LH6A 4PZ7A 5JH7A 1O75A 2PY5A 4O4IB 3JARB 1J5EH 4JV5H 2HHHH 4YHHH 2UXCB 1JFFA 2WYOA 3NBYB 1T5EA 2E5LB 3QG5A 2UU9H 4L8JA 5JJNB 3BABA 5CB4B 4E6NA 3KAKA 5IJ0B 1M4UA 4JI4B 4FLWA 1TUBB 1Q43A 3RYCA 3CVZA 4KHPB 3T1YH 2VQFH 4X66H 4MTDA 5BR8H 3TY9A 3JATB 5FLXW 4JI6H 2UXBH 4I55B 4K8XA 1XNRB 2PTMA 3RYFB 5EZYA 4D7SA 2ZM6B 4RB2C 4DV0B 5C8YA 3U11A 4B3SB 1Z5VA 5DISC 4WBNA 2CFMA 4DR6H 2UUCH 2PUSA 1JFFB 1CKOA 1RSOA 2KSWA 5LMNH 4TUYB 3VQVA 3K3VA 5FD5A 5IT9W 2UUAH 4LFCB 3BRCA 5JJJB 1TA8A 3QWUA 1HNXH 1WNSA 3RGXA 4LFBB 4AQYB 2ZINA 3RWRD 5LOVA 1M5IA 3RYCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE B;  3S24 A;  1XMQ B;  3GB8 B;  1XNQ B;  4LH7 A;  3BA9 A;  3RTX A;  2VUG A;  1CKM A;  3W5O A;  2HVS A;  5D1P A;  4CC5 A;  2HIV A;  4B3M B;  4UCS A;  4DR2 B;  4K0K B;  1ZAU A;  3T1H B;  1XMO B;  4DRF A;  3L2P A;  1DGS A;  4LF9 B;  3TY5 A;  4EQ5 A;  4JV5 B;  4PZ6 A;  2HHH B;  4YHH B;  3PN1 A;  3BA8 A;  4JI1 B;  4DUZ B;  4DV3 B;  5IWA B;  4DR4 B;  2UU9 B;  4DR1 B;  4JI3 B;  1B04 A;  3TY8 A;  3NBZ B;  1HNW B;  4EFB A;  3W1G A;  1N33 B;  1HNZ B;  3RR5 A;  3BAA A;  5D1O A;  2Q2T A;  4EEQ A;  2OWO A;  4DR3 B;  4LFA B;  5D1O B;  2VQF B;  4X66 B;  4TOI A;  2HIX A;  5BR8 B;  1I94 B;  3SGI A;  4JI6 B;  2HVR A;  2UXB B;  1A0I A;  1J5E B;  4DV4 B;  3JSN A;  2UUC B;  4JI0 B;  4NXM B;  4UCT A;  1CKN A;  1P8L A;  2UUB B;  1CKN B;  4GLX A;  1VS0 A;  4GKK B;  5LMU B;  4UCO A;  5FPO A;  2UUA B;  1HR0 B;  3GDE A;  1HNX B;  1N32 B;  1XDN A;  5FPR A;  3VNN A;  3T1Y B;  4DR7 B;  3OTO B;  4LH6 A;  4PZ7 A;  1IBK B;  4JI8 B;  4UCR A;  2UXC B;  1TAE A;  4OX9 B;  4DR5 B;  4UCV A;  1N36 B;  1S68 A;  2HVQ A;  3NC0 B;  3NBY B;  1V9P A;  4X65 B;  4X62 B;  1FVI A;  2E5L B;  1IBM B;  4LF4 B;  4JI7 B;  4CC6 A;  3GJX B;  4DR6 B;  3BAB A;  4DV2 B;  4EFE A;  4YY3 B;  4E6N A;  4JI4 B;  5LMN B;  4X64 B;  4LF6 B;  3UQ8 A;  4KHP B;  4NXN B;  4JYA B;  4DV5 B;  4UCU A;  4LF7 B;  1X9N A;  3W1B A;  1N34 B;  3TY9 A;  2UXD B;  1P16 A;  1XNR B;  1XK5 A;  2ZM6 B;  2F4V B;  4DV0 B;  4GKJ B;  4B3S B;  4DV7 B;  5DIS C;  4B3T B;  4UFZ A;  4JI2 B;  2CFM A;  4LF8 B;  1FJG B;  1CKO A;  1IBL B;  4DV6 B;  4JI5 B;  3KYH C;  4PZ8 A;  4DV1 B;  4B3R B;  4DUY B;  2Q2U A;  3JSL A;  4LFC B;  1TA8 A;  3QWU A;  4LF5 B;  4LFB B;  4AQY B; 
#chains in the Genus database with same CATH topology
 4DR6 O;  5LP6 F;  3JD2 A;  1XHZ A;  3M8A A;  2CH7 B;  2WAQ E;  1Y1W A;  3CXC U;  1DV1 A;  4EBE A;  3CCR V;  2YWV A;  2EIN C;  2MCT A;  2UUA O;  1KUQ A;  1WB8 A;  4UCS A;  1EKF A;  4MV3 A;  1ZAU A;  3T1H B;  1XMO B;  2RDI A;  2BCC H;  3CRC A;  3N40 P;  1HNX O;  4F50 A;  4TV9 A;  1A48 A;  1JKJ B;  3CCJ V;  5KMG A;  3GIJ A;  4JI4 H;  4A3J G;  4FPP A;  4A3I G;  2GTA A;  3N44 B;  3E35 A;  4KHP H;  3T2M A;  5IYC O;  3MDS A;  1A32 A;  2ZDQ A;  3GIL A;  1LR1 A;  5LA6 A;  1OWT A;  4RU9 A;  2W6I G;  5GW7 A;  3FKI G;  3G6B A;  3W7W A;  3CCL V;  3D3I A;  3OR6 C;  5LOV B;  4JI4 O;  2A0L A;  3SPJ A;  2QTO A;  3EFF K;  1K73 W;  1VAJ A;  1Q8I A;  4KHP O;  1EZV H;  3H1L H;  4YBZ B;  3K0G A;  4MTG A;  2ITD C;  3CX5 F;  1EN6 A;  2YRX A;  5IYD G;  4TV9 B;  4HN2 A;  1EN4 A;  3MHH C;  4O4H F;  1KJJ A;  2UVV A;  4DK0 A;  4U7O A;  1HNZ H;  1K97 A;  2GUZ A;  1T3N A;  2BTQ A;  2W6M A;  4FM9 A;  4O7T A;  1P49 A;  5FL7 G;  4IGG A;  2IBK A;  4BIO A;  1UC8 A;  3ABM B;  2YW2 A;  5IY5 B;  3TIN A;  1K5S A;  3STZ C;  4O4I A;  3GIP A;  3FYE B;  2O57 A;  2Z0A A;  4XBF A;  3EXA A;  2XHB A;  1HNZ O;  2E3C A;  4FLT A;  1G1X B;  3ASN C;  3A0H Z;  1TAE A;  3Q8Q B;  1R6K A;  2LGQ A;  2V1D A;  4TQF A;  2FKL A;  1B6R A;  3NC0 B;  4A93 G;  1K34 A;  2QEX V;  1S0N A;  3D36 C;  2JEX A;  5J9P C;  3PW0 A;  4JI7 B;  3BEH A;  3GJX B;  1TUB A;  1D5A A;  4DR6 B;  2C2R A;  1WAZ A;  1NJI W;  5DQI A;  4I5S A;  1RM1 B;  3JCU Z;  4YIP A;  1I2L A;  1PL4 A;  1BQZ A;  3S3W A;  3H9V A;  2B1I A;  3MR5 A;  2JA5 G;  3CCQ V;  2BTQ B;  5C4X G;  4I55 A;  3C3S A;  4B08 A;  1M7J A;  4UXN A;  5CB4 F;  3GB7 C;  5KFB A;  2UVU A;  3N2K A;  4ZI7 B;  3VPC A;  4JYC A;  4M7E A;  3K03 A;  4Q20 A;  2JS5 A;  3QO5 A;  1KP3 A;  1I50 A;  1IBM H;  1H2N A;  1GSH A;  5D5Q A;  3U55 A;  5EC2 C;  4JZG A;  2WLL A;  4FK5 C;  1QQC A;  3TQT A;  1ZTE A;  4JI8 O;  1WN7 A;  4OX9 O;  2MW2 B;  3VMM A;  1FKA O;  4LSA A;  4F6R A;  3TII A;  2IM9 A;  5LXT A;  1XL6 A;  1N32 H;  3GWO A;  1IBM O;  2ZJT A;  1PL0 A;  1BJT A;  2C2D A;  4TUY F;  4DV2 O;  3S24 A;  1HP8 A;  3GB8 B;  3BY6 A;  3SPI A;  4DV7 H;  3SE7 A;  3WU2 Z;  2HVS A;  3PJS K;  3N2K B;  3JAM N;  1N36 H;  3DTU B;  1IBL H;  5IYZ A;  1L0N H;  4H44 B;  3TY5 A;  4Q8F A;  2SCU B;  2JA6 G;  1N32 O;  3HT5 A;  1UNN C;  1SQG A;  1VQK V;  1R3J C;  1JJ2 U;  2W0X A;  4DV7 O;  4O82 A;  2QTS A;  2EIM B;  2WLL B;  1N36 O;  1VQ9 V;  2ABJ A;  1HNZ B;  1IBL O;  3Q1K A;  3RR5 A;  1K4D C;  1ET0 A;  5D1O A;  3L73 H;  2ZDI C;  4FVM A;  4MW3 A;  4GCZ A;  1QVG U;  1O9G A;  5KHG A;  1B33 N;  1MAB G;  3CC7 V;  4FFB A;  3CD6 V;  2JJ2 G;  4W4L A;  3B77 A;  3JAW B;  4PD4 F;  2YIB A;  1QLE C;  3LQS A;  1XQ8 A;  3CS5 A;  5KG7 A;  1QLN A;  3H1I H;  4BR6 A;  3T9C A;  3L74 H;  3OE7 G;  4ZIB A;  5LL6 Y;  3CCS V;  4X9Q A;  3K3W A;  2R7N A;  4IR9 A;  5LOV F;  1AJP A;  4FIP C;  1S0M A;  5TIS Z;  1QBZ A;  4UCT A;  1BS3 A;  4RZR A;  1QCE A;  2R7Z G;  5EWG A;  4G3I A;  4YAJ B;  4DL5 A;  3ABK C;  3E83 A;  1CKN B;  1VS0 A;  2UVR A;  2CNV A;  1XRE A;  1EFR G;  1D5N A;  5BZB A;  4TV9 F;  3E22 A;  3AK3 A;  1NTM H;  5BWX A;  4UUG A;  2YIC A;  1N48 A;  4KL1 A;  4K0K H;  4FLU A;  3UFX B;  1SRY A;  4FFB B;  4JI8 B;  5DGB A;  5IYB G;  4OXS A;  4QE7 A;  4RQF A;  4OX9 B;  5L1K A;  1L8D A;  3K9A A;  5KG5 A;  3AG3 C;  3J7A U;  2GSM B;  5KT3 A;  1FVI A;  1IBM B;  1M0W A;  4WFF A;  2BSK A;  4EG0 A;  3RYH B;  3HO8 A;  2VPS A;  1OCR B;  1DF5 A;  2ZE5 A;  4DV2 B;  2JEF A;  3ICX A;  3APQ A;  2R9R B;  3OUF A;  4MVQ A;  2YU9 A;  4EGQ A;  2P5O A;  5A2Q W;  4X89 A;  1ZQ7 A;  4FBU A;  4LFA H;  3HKD B;  5KFA A;  2LFR A;  3J7A K;  4RZQ A;  2P4K A;  2W6P A;  4IIJ B;  1M0T A;  1AUX A;  1MOF A;  4RAY A;  1ZUQ A;  3UO2 A;  2HHF A;  2FLL A;  3E22 B;  2LQT A;  3W7T A;  2AU0 A;  2Q7G A;  4N21 A;  4DV7 B;  3RVY A;  4PDL A;  4LFA O;  5EBW C;  4DO2 A;  4YY3 H;  4UB6 Z;  3T54 A;  2W9A A;  1IBL B;  3B40 A;  4ZI7 F;  1S0V A;  1KEE A;  1I5X A;  3PVX A;  2Q8V A;  3MAQ A;  1VQ7 V;  5KFE A;  4DUY B;  3MWE A;  2BSK B;  4ZQI A;  3TIG A;  1LUW A;  2B63 G;  3GTP A;  1BGY H;  5L3C A;  1WCM G;  2Y48 A;  2EZP A;  2VQE B;  3JYC A;  4YY3 O;  1MZF A;  2HJF C;  1KP2 A;  2P4V A;  2ZR3 A;  3BA9 A;  3FB8 C;  4Q6G A;  2CK3 G;  1TWG A;  1I0H A;  4R8U A;  2FJZ A;  4JI2 H;  2HIV A;  3AG4 C;  1M6V A;  1Q90 D;  1YTF B;  4PHZ A;  2V9W A;  4X62 H;  1S5L Z;  2DYS B;  3PZP A;  4O3R A;  4JI1 B;  2BR0 A;  3OR7 C;  1HNW B;  4JI2 O;  5JCO C;  5JVD A;  1HW7 A;  1M9N A;  1ZL8 B;  5B1B B;  2Q2T A;  4DW1 A;  4X62 O;  4APM A;  4DR3 B;  3B8M A;  4NYE A;  1Q5O A;  2DLN A;  2V4R A;  4U6P A;  2N04 A;  5DLF A;  4F6E A;  1BGW A;  4O4J A;  2GTS A;  2ZDH A;  2W7O A;  3PW7 A;  2NU7 B;  1NVP B;  2R70 A;  4GZR B;  2H3O A;  3N42 B;  2AXT Z;  2KSD A;  3ZBH A;  1KKC A;  2BOB C;  2JEU A;  2YUA A;  4EB6 A;  1SQB H;  4MV1 A;  3GTL A;  2R8H A;  5KHJ A;  5EOY A;  1KJ9 A;  3SPC A;  2GV9 A;  5JVD B;  5B3S C;  4PA7 A;  2XAJ A;  2PF4 E;  5B1N A;  1OCZ B;  2IA6 A;  5JQW A;  4DR2 H;  1R3K C;  3WG7 B;  2ZCE A;  4DUZ H;  1N8R W;  4DK1 A;  3CME V;  1I08 A;  1TWF A;  4A3F G;  1ARO P;  1XHX A;  2HKO A;  3JD4 A;  5L1L A;  5CA1 A;  3H3V H;  2R85 A;  2WLI B;  4NKG B;  4X20 A;  5KFC A;  4YY3 B;  1CE8 A;  1URF A;  2JA5 A;  3DXR B;  4CZZ A;  4DUZ O;  3TXQ A;  2Y0I A;  2XD4 A;  4QSH A;  2ZXW C;  2XT9 A;  3W1B A;  1P84 F;  3BQ2 A;  4J9M A;  2JEJ A;  5BYB A;  3T4D A;  4IWY A;  4BIZ A;  5H80 A;  4U7C A;  1QVF U;  3UO3 A;  5BWT A;  4JI2 B;  4Q8E A;  4IIJ F;  4WBN B;  3CRM A;  4FFM A;  4NVP A;  4RAI A;  5HFL A;  1M90 W;  1Y1V A;  4X20 B;  2ODT X;  4TQD A;  2NU9 B;  4J9Z B;  1OCO B;  2Q0O C;  2NUA B;  3I5D A;  4DR7 H;  3RB4 A;  1Z2N X;  4NB5 A;  2N74 A;  1VQ5 V;  4MAM A;  1IBK H;  3CJH A;  5LP6 C;  4ED2 A;  2R93 G;  3RAX A;  3IG0 A;  1Q3E A;  2Q5Z A;  2JA6 A;  2XCP A;  5FNV A;  2FPP B;  2Y4T A;  3OHA A;  4DR7 O;  5I5W A;  2VA2 A;  2C35 B;  3GID A;  1IBK O;  3GTJ A;  1G6U A;  1Z5W A;  2WDT A;  5D8D A;  2NVX A;  4J7J A;  5EYP A;  1CQJ B;  1MG1 A;  1JDB B;  2W7P A;  4AQY H;  4JUZ A;  1JX9 A;  2H94 A;  3RB0 A;  1GN4 A;  1JA8 A;  1KMI Z;  1S97 A;  1SS3 A;  5KHK A;  5C1O A;  4X66 B;  3JAR A;  3UCS C;  3SYO A;  1ULZ A;  3T5L A;  2JVD A;  4JI6 B;  2ASJ A;  2UXB B;  1M56 B;  1OJH A;  4AQY O;  5BWU A;  2W71 A;  3TW6 A;  1BQ0 A;  4O7S A;  5L1J A;  4JI5 H;  3AG1 B;  4QWC A;  5B1O A;  3AG2 C;  2Y0S A;  3Q4H A;  3RFC A;  2FKX A;  1M1K W;  2JDI G;  5KT4 A;  4P9O A;  1BT8 A;  4YR0 A;  3IC9 A;  1IVS A;  1SQX H;  4RB0 A;  3ETG A;  2AGP A;  3E8H A;  3I55 V;  2O03 A;  1IX9 A;  2DPJ A;  3OT7 A;  1H8E G;  4I4T A;  2P7T C;  4YAK B;  1L1F A;  5L3B A;  1CPY A;  2BE3 A;  4JI5 O;  2EUL A;  4ECQ A;  4A3E G;  1NH2 D;  4M9U A;  3MWD A;  1O75 A;  2PI4 A;  2WA3 A;  2UXN A;  3JAR B;  1J5E H;  2IBZ H;  3CE2 A;  3ZRS A;  3ZHS A;  4YHH H;  1GM8 A;  1Y74 A;  1Q6I A;  5JVD F;  2A3Q A;  3J81 N;  1T5E A;  2WSS G;  3HBL A;  3KAK A;  4E6N A;  4W4K A;  1M4U A;  4OGQ B;  1VF6 A;  3ZCC A;  4KUM A;  3CCE V;  4PDM A;  5DMX A;  1J5E O;  3CYO A;  1NZ6 A;  5L3E A;  2CTR A;  2EIY A;  4LWS A;  3T1Y H;  4NXM O;  4R8C A;  1PNM A;  4FZ0 A;  2DJV A;  2X0L A;  2LGW A;  1AVM A;  1EKV A;  2ZDG A;  1AI6 A;  4RB2 C;  1EUD B;  1YVW A;  4F4Z A;  1RYR A;  5DIS C;  1WR2 A;  3RUP A;  2YXH A;  1B06 A;  3T1Y O;  2GHY A;  3VQV A;  4RCN A;  5IT9 W;  4FFK A;  4FZ1 A;  4DR5 O;  3OFN G;  1KEC A;  3W7X A;  1WCM A;  3RGX A;  3C90 A;  3PO3 G;  4AQY B;  2ZIN A;  4WBN F;  1AI4 A;  1R6T A;  4IZO A;  4PA4 A;  2W9B A;  4LWS B;  3RTX A;  2FE3 A;  4R7R A;  1YXB A;  1SER A;  5DED A;  3W5O A;  4FFP A;  4ASU G;  4RUF A;  4DL4 A;  1JOY A;  2Y69 C;  4Q4D A;  5KFP A;  1PX2 A;  1DGS A;  3K0D A;  3RBE A;  1W93 A;  1DAA A;  1F7Y A;  3CEB A;  1Y14 B;  2P0A A;  2R7K A;  2Y0S E;  3OMA B;  1EBO A;  1V54 B;  2I80 A;  4ED0 A;  4RWU A;  4Y8V B;  3VBB A;  2ILM A;  1BXR A;  3SJQ C;  1R9T A;  1OHH G;  5DLG A;  3R66 A;  2ZM6 H;  1BSM A;  3U0G A;  4O4H A;  2HIX A;  3P3N A;  3ETH A;  3K06 A;  2P90 A;  2ASD A;  2YI8 A;  4X1K A;  2EIJ B;  2XCA A;  1F4N A;  5EBM C;  3MJF A;  1ZX3 A;  3T9F A;  4DL6 A;  1J5E B;  5LGU A;  2ZM6 O;  3M9N B;  4NXM B;  4FFO A;  5FR9 A;  4HNT A;  4NZO A;  5KFO A;  4UVB A;  2CDY A;  3P3P A;  4H0L B;  2Q6A A;  2OCC B;  3DTG A;  1RJP A;  3CC4 V;  3RBD A;  4FE2 A;  1U97 A;  1YI2 V;  2YS6 A;  2PMZ A;  4ECY A;  4JI3 O;  5CA0 B;  2QWN B;  3T1Y B;  1XI1 A;  3P30 A;  2RMK B;  5KFJ A;  3T1H H;  1XMO H;  2Z02 A;  1I6U A;  4Q45 A;  3TK1 A;  3OEE G;  2XC9 A;  4DV4 H;  4DR5 B;  4X1K B;  5LBQ A;  1S68 A;  2J9G A;  4X1I A;  2QDO A;  4ECS A;  4CC6 A;  5IY5 C;  1US6 A;  3T9B A;  3T1H O;  2F23 A;  4PI2 A;  3SYA A;  5KFM A;  2JGD A;  1W0J G;  4MVS A;  4DV4 O;  5HFM A;  4G28 B;  4FU0 A;  3JAT A;  4FGR A;  3GIQ A;  4DV5 B;  2XGQ A;  1SFO A;  1V51 A;  2W6N A;  1PP9 H;  2V4Q A;  4CH6 A;  4CMF A;  4EGJ A;  2JEG A;  3S3X A;  4G27 B;  1YIT V;  3CSW A;  5JVL A;  2A79 B;  3JD0 A;  5KFN A;  4TUY A;  3GV5 B;  2QM7 A;  2HG8 A;  3N2G B;  1BNC A;  5AG2 A;  3VQX A;  4X1I B;  2DWD C;  1K9M W;  4LF6 H;  5IP9 G;  2FK2 A;  4O3Q A;  1QR9 A;  2PYL A;  2W9C A;  4F4L A;  4X65 O;  2OYQ A;  5KFI A;  1UC9 A;  2L35 A;  3ZHR A;  1XMQ B;  2F93 B;  2JGD B;  2ZQM A;  4RB3 C;  1E79 G;  2WLN A;  4JGS A;  2R93 A;  2FLP A;  4LF6 O;  1CKM A;  3UZO A;  5D1P A;  3IAY A;  2PI5 A;  4NXN O;  2ZGI A;  1GSA A;  4Z1V A;  1VIB A;  1SET A;  5CM0 A;  3U9T A;  2Z04 A;  3GII A;  4JI7 H;  1ZHS A;  4XDJ A;  3F5W C;  1SZX A;  5BPF A;  3GVM A;  4ECZ A;  4J9P A;  4MVO A;  2GDS A;  2CNQ A;  3TY8 A;  4JI3 B;  2YYA A;  1HWY A;  4JYY A;  4ME6 A;  1KJ8 A;  4RNO A;  1VP7 A;  2KG7 A;  1N33 B;  2BQR A;  4IRC A;  1S5J A;  3OMI B;  4FM2 A;  1BCC H;  2W9C B;  1OBG A;  3K5L A;  1PNK A;  2HVJ C;  2PMZ E;  3KRE A;  3JRW A;  3T5J A;  2B9Z A;  2R72 A;  3RIZ A;  2EIM C;  1JDE A;  2JA7 A;  1G4Y B;  2WWW A;  3A0R A;  3GIM A;  4DV4 B;  3OGI B;  1RK5 A;  3R5X A;  3GTM A;  3AK2 A;  2QWQ B;  1GLV A;  3GTK A;  3OGC C;  3X2Q B;  3KG2 A;  3GDE A;  3H20 A;  3VQW A;  1DK1 A;  3OEH G;  2KG7 B;  2IU3 A;  2W6J G;  3R9R A;  4JTD B;  2R87 A;  4PJ0 Z;  3E8G A;  2CGO A;  3U10 A;  5BYA A;  2FB5 A;  3G6E V;  3RV4 A;  3H40 A;  4MVZ A;  2HVQ A;  4A3D G;  5CA0 F;  4X65 B;  5GON A;  4XX0 B;  1Q81 W;  4MV9 A;  2RCV A;  2JK5 C;  1PV0 A;  4LC1 A;  1NS1 A;  3OD4 A;  4ED3 A;  2WLJ A;  4O3O A;  4J9Y B;  4IAJ A;  4LF6 B;  3K5H A;  3KCX A;  4N23 A;  2R7L A;  4NXN B;  2ARH A;  1PKX A;  4CHI A;  2YID A;  3RBZ A;  4Z2W A;  4ZI7 A;  1N34 B;  2DYR B;  2UXD B;  4RAZ A;  5KFU A;  1OCR C;  2F4V B;  1SC5 B;  2QR4 A;  1VMG A;  4XYL B;  1IYE A;  2A7W A;  2CAZ C;  3WO1 A;  1I2K A;  4HNA B;  1K3E A;  3E5N A;  3KHR A;  1H8H G;  1DTO A;  3KYH C;  4QPK A;  2I87 A;  5GON B;  3JSL A;  5K1P A;  3ZMT A;  2DOS A;  3HOV G;  5EIB C;  1VKZ A;  1P7G A;  4GKJ H;  2BTO A;  4JI8 H;  2IJJ A;  3DC5 A;  4OX9 H;  2QWP B;  5DM6 V;  4OPA A;  1FKA H;  4U3J B;  2ODM A;  4KXR A;  2QK4 A;  2ATL A;  3T9A A;  2XTA A;  4FFN A;  4PZ6 A;  3TGU H;  3CC2 V;  2Q7E A;  3J80 W;  4DV2 H;  3G6Y A;  3HOY G;  1Q86 W;  4GKJ O;  1S10 A;  2Q9L A;  2FPG B;  1MNG A;  3FDS A;  3PFF A;  4NLG A;  3O9O A;  5BMV A;  2VR1 A;  2RF4 A;  3FKS G;  4EEQ A;  2DYS C;  3JAW A;  2OWO A;  2CZG A;  2DIK A;  2G38 A;  2JEI A;  2IJH A;  3SGI A;  4DYL A;  3FD9 A;  3HOW G;  1GAX A;  3K5O A;  4HBN A;  2E76 B;  3QZ7 A;  2W8L A;  1W0K G;  2YSU B;  4DL3 A;  3V4Z A;  4ZKI A;  2Q7H A;  5H9C A;  4DUY H;  4J0M A;  4JI0 B;  2ADP A;  5B1A B;  1MSW D;  1CKN A;  5KFX A;  1AP5 A;  3UT5 B;  1MA1 A;  5DEC A;  2W57 A;  3GQC A;  2IMW P;  4BWA A;  2QM4 A;  4GKK B;  4O83 A;  3EPG A;  1K83 A;  2VQE H;  1S03 G;  3G8C A;  4AHC A;  4O86 A;  5BMV B;  2EJ3 A;  3P32 A;  2A1H A;  4DUY O;  1NT2 B;  3ZX6 A;  1H38 A;  2ZE8 A;  1F23 A;  3G6V A;  4MA0 A;  3E8F A;  1C3O A;  4JI1 H;  2VQE O;  1QHT A;  1XIL A;  2QF7 A;  4O3S A;  4PEL A;  3RYH A;  1HNW H;  4J42 A;  5BXZ A;  1Y6X A;  1Y4M A;  1Z2P X;  5KUK A;  3HKD A;  3RGB A;  1AI5 A;  4QWA A;  2BQ3 A;  4PWQ A;  3WG7 C;  3CCM V;  4JI1 O;  4DR3 H;  2UUC O;  5HNE A;  4IIJ A;  2P67 A;  2FLN A;  4YP3 A;  2HFE C;  3MWM A;  1WA8 A;  3ABL B;  1HNW O;  1XK5 A;  4GKJ B;  3T4Z A;  4DL7 A;  4MVU A;  1TGO A;  2KQX A;  5EZY B;  3T1C A;  2ADQ B;  3SJC C;  2IW5 A;  4B3T B;  4E4E A;  4DR3 O;  1VAR A;  3OMN B;  3SPH A;  1DV2 A;  1KUT A;  3BVO A;  4DV6 B;  5CBG A;  4CMD A;  3NXS A;  1LNQ A;  3U54 A;  4PZ8 A;  2AGO A;  5FLM G;  1RSO B;  4XDL A;  3UYY A;  1KC7 A;  2HJD A;  1B6Q A;  1THZ A;  4QIW F;  3KCY A;  4JPR A;  3K58 A;  4J9Q A;  4C7U A;  1S3J A;  3TEK A;  2R6F A;  4J7Z A;  4TM5 A;  3TW7 A;  4HYK A;  3GLK A;  5KA6 A;  3FFQ A;  4DV0 H;  5GON F;  3O65 A;  1EZ1 A;  3UM7 A;  1WPX A;  5LGN A;  2P06 A;  4JAS A;  1WA8 B;  4E4T A;  3FYI B;  5KT7 A;  5KX5 A;  3T9D A;  4JV5 B;  2DPI A;  2EJR A;  3N6R A;  1OCO C;  5L9X A;  2WLM A;  1KC8 W;  2YIB D;  1XNR O;  1UFI A;  3PO2 G;  2P22 C;  4DV0 O;  4TV8 F;  2X5R A;  2CUG A;  3ASN B;  5LYJ A;  3K04 A;  2E74 B;  1ZL8 A;  1IUR A;  1GKF A;  5LHH A;  2HGS A;  2FK1 A;  1RPO A;  2X7R B;  1S77 D;  1FPO A;  3WWI A;  5EK0 A;  5IYD O;  2FB9 A;  3CB2 A;  4R7C A;  2YXL A;  4NZN A;  1V55 C;  4D6T H;  1BHA A;  2YZM A;  5CAE B;  5LHI A;  2JS3 A;  4DR1 H;  1A0I A;  1AJQ A;  4CS3 A;  2OCH A;  4EBC A;  3IFX A;  4X8A A;  1XNQ O;  2DE0 X;  5IJ0 A;  5KX5 B;  5EIB D;  2RQ6 A;  4XDK A;  2UUC B;  1NI8 A;  3BCC H;  2OIE A;  4LMY A;  5CE8 A;  2PBZ A;  5ITZ B;  1WJZ A;  1A0G A;  5LYJ B;  3KXY T;  4UV9 A;  4U7N A;  2X6B A;  3FKI A;  1XBL A;  1Q7Y W;  3V6J A;  4GC6 A;  4PZ7 A;  4QWE A;  2E2H A;  3IJ4 A;  4OPH A;  2PY5 A;  5KT5 A;  1FAF A;  3H1K H;  1JFF A;  4P30 A;  3MHS C;  2WYO A;  1GK9 A;  1YTF D;  4C5A A;  1WRV A;  5BMV F;  2WLI A;  5KUM A;  2E5L B;  3QG5 A;  4L8J A;  3E8B A;  2B1G A;  5JJN B;  5H5N A;  4B7E A;  5IJ0 B;  1XL4 A;  2YS7 A;  3DXR A;  4MW8 A;  4ECX A;  5B66 Z;  4FFR A;  3I4N G;  4JF3 A;  4PBC A;  1GN3 A;  1Q6U A;  4H13 B;  4X66 H;  1K92 A;  4XZ3 B;  4P2Z A;  5FLX W;  4JI6 H;  3N27 A;  4BIU A;  2UXB H;  4K8X A;  1XNR B;  4D7S A;  4DV0 B;  5C8Y A;  2OTL V;  4B3S B;  1Z5V A;  5I60 A;  5LHG A;  2NU8 B;  2DMX A;  2M7W A;  2YC0 A;  4WBN A;  1UJW B;  4X66 O;  1S0O A;  1JFF B;  1CKO A;  5DGH A;  5LMN H;  1JVM A;  1QLE B;  3D3Q A;  4JI6 O;  1F51 A;  2JRI A;  2UXB O;  2QWO B;  5KKN B;  3QO8 A;  5EZY F;  1L0L H;  3BRC A;  5JJJ B;  5BWR A;  1WNS A;  3NGD A;  1C30 A;  3E2E A;  3L4J A;  3ABK B;  5F9L A;  1P7B A;  5LMN O;  1XNQ B;  4CE5 A;  3B09 A;  3F5T A;  3R65 A;  4O2A B;  2CKZ B;  3GIK A;  1IXM A;  1X4T A;  1WP7 A;  4MTX A;  1G2W A;  4O7N A;  3H0G G;  2NR5 A;  5C8Y B;  1VF6 C;  1YF2 A;  2LO1 A;  5EWE A;  3EVK A;  1TVK B;  2WPD G;  1XDC A;  3HKB A;  4MV7 A;  4H37 A;  4UB8 Z;  1B04 A;  3JD3 A;  5KFK A;  1RYS A;  3MFI A;  3MR2 A;  4EBD A;  3W1G A;  3AG3 B;  3RB3 A;  2XCL A;  2VUM G;  2CTQ A;  4J9N A;  2CTP A;  3HKZ A;  1RP3 B;  4Q44 A;  1EKP A;  4QE9 A;  4RUC A;  5CA3 A;  2R92 G;  4L87 A;  1F4M A;  5L3D A;  1NU1 H;  3R5H A;  3M9O B;  2WTF A;  4TWK A;  3B2E E;  3STL C;  3JSN A;  2ZNI A;  3N8D A;  3KAL A;  2CTW A;  1SA0 A;  1SCU B;  3T7A A;  2HP8 A;  5D5P A;  5T14 A;  2DAA A;  3LUT B;  2NLJ C;  4LNU A;  2V59 A;  5IYB O;  2EIJ C;  2EIK C;  2K1E A;  3H1J H;  4RO2 A;  1RK6 A;  3OSN A;  3HKB B;  4B7K A;  4I50 A;  5KX5 F;  1WPB A;  2RJZ A;  2CW7 A;  2CGN A;  2VWK A;  1U96 A;  3T99 A;  4MTO A;  3K3P A;  2LP7 A;  3HOX G;  4PDV A;  4G2K A;  5LYJ F;  4FJC C;  1K33 A;  4Q4C A;  1KQS U;  1I1K A;  2OCC C;  3T5H A;  4LBE C;  4DAA A;  3ZHT A;  2R8G A;  2YEV A;  2R7Z A;  3LSU A;  5I5V A;  3IN5 A;  5H6Q A;  2HG5 C;  5LMN B;  1OZ0 A;  1SA0 B;  3H4D A;  2OTJ V;  2J6T A;  2YDE A;  1NH2 B;  3TQ1 A;  4LNU B;  1SKV A;  3TCU A;  4ZBM A;  3GTQ A;  1S9F A;  2HJW A;  4QW9 A;  2Y0P A;  3KHL A;  3U0Z A;  3WFV A;  2EBO A;  4I50 B;  1K1Q A;  1Y1W G;  2C28 A;  2P6J A;  1W96 A;  3V4S A;  4M0J A;  2GPS A;  4BXX G;  3BG5 A;  4YQW A;  4I0X A;  4NXM H;  3HOU G;  3AG7 A;  1N0N A;  4X64 H;  1KJI A;  1KT8 A;  4YJ2 A;  4Q43 A;  3HB9 A;  4BBR G;  3K5N A;  3JAM W;  2Q67 A;  2YEV B;  3V6H A;  2ZIO A;  1JR9 A;  3OUS A;  5L1I A;  4I7H A;  4PI0 A;  4F4Y A;  3RW0 A;  4YIO A;  3B8N A;  2XIG A;  3ZMU A;  4AIL C;  2ALZ A;  2Q0A A;  2Y4R A;  2LW7 A;  4LH7 A;  5KAI Z;  4IT5 A;  4X64 O;  1YCI A;  3PW4 A;  4DR5 H;  4GX2 A;  3HKZ E;  1GN6 A;  5C93 A;  2FMA A;  5B3S B;  4EQ5 A;  2F66 C;  3BA8 A;  4C5B A;  5IP7 G;  4IRK A;  5KFT A;  4DV3 B;  3CRQ A;  1OCC C;  5EBL C;  4I0X B;  1S76 D;  4O2A F;  4YR2 A;  4LF5 H;  4ECV A;  2I8C A;  4A2B A;  1T36 A;  5FJ8 G;  5C3E G;  1VQM V;  3E86 A;  4YJ2 B;  5C8Y F;  4DV5 H;  4BW5 A;  4O81 A;  2B63 A;  1KTA A;  4Z1M G;  4NZM A;  2DWC A;  4TOI A;  4XYM B;  4FFL A;  1RJQ A;  1BE3 H;  4LF5 O;  5GTI Z;  3G67 A;  1GGO A;  3BHP A;  5IYC G;  2CQY A;  4TVI A;  4DV5 O;  1NQT A;  3K57 A;  1GYF A;  2R86 A;  2ZNJ A;  2W6Q A;  2IJI A;  3AEI A;  3ORR A;  4ZHQ A;  1PK8 A;  1P8L A;  3M4I A;  3AK1 A;  2HR3 A;  2UUB B;  2PGG A;  3ABT A;  4NYK A;  4HR7 A;  1A9X A;  5LMU B;  4UCO A;  4WFG A;  5FPO A;  1HR0 B;  3DTF A;  3SYQ A;  1R3L C;  4UVA A;  3H4B A;  2WE6 A;  1XMQ H;  2LW1 A;  2XAF A;  5CA0 A;  4DR4 O;  1XDN A;  3VNN A;  1GRJ A;  3PR4 A;  4K35 A;  4WFH A;  1R6N A;  1MSD A;  3OW2 U;  5DQH A;  4JV2 A;  2ITC C;  1GMG A;  4HNU A;  3IC7 A;  4K8Z A;  3X2Q C;  1XMQ O;  1FXK A;  1M93 A;  3ZJZ A;  1KBL A;  2PYJ A;  2J6S A;  2QSA A;  4JI3 H;  4DLK A;  1L2Z A;  1ZWI C;  5KG3 A;  3SDL A;  1N33 H;  2RNB A;  4ZHQ B;  3KHH A;  4X64 B;  4A3G G;  3SR2 C;  1N0J A;  2DWE C;  3CP1 A;  4UCU A;  1IZ3 A;  1X9N A;  2QGN A;  4ED8 A;  1SF9 A;  4KFM A;  4MV4 A;  3IGA C;  3CMA V;  4J9S A;  4F4W A;  1N33 O;  5F9N A;  1WP8 A;  2NNU A;  2VWJ A;  1CP9 A;  5J2T A;  3R5F A;  4LF4 H;  2Z5U A;  4GX5 A;  5A2Q N;  4UFZ A;  2OLS A;  3N2G A;  4IYH A;  1PM9 A;  3K08 A;  2D3O W;  4LF8 B;  2VQD A;  4I50 F;  1M57 B;  4IYI A;  3ABM C;  1SYX B;  3CWB H;  3KTM A;  2E75 B;  4CKE A;  1FXK B;  5K2M A;  5KHI A;  1DF4 A;  3ABU A;  1YDX A;  3W7U A;  2VS0 A;  4LF5 B;  2EIL B;  4LF4 O;  3K5M A;  4HYO A;  3I4M G;  4RUE A;  4FLZ A;  1AR4 A;  1ZSP A;  5E79 Z;  2PN1 A;  1GN2 A;  3VQY A;  4B3M B;  2QB5 A;  5KFZ A;  1RM1 C;  3H0G A;  2HGW A;  5KG2 A;  1RPR A;  4X65 H;  1O9H A;  4J9R A;  1VQL V;  4IRD A;  4B3R H;  1I7F A;  5J2T B;  3VPD A;  2F1M A;  3TXS A;  3M7M X;  5DG9 A;  4CH4 A;  5IWA B;  4DR4 B;  1GSO A;  1BZK A;  2DQ0 A;  5JQG A;  2W6O A;  1XEQ A;  4PV1 B;  4NXN H;  3PW2 A;  5KG1 A;  1AJN A;  4QJF A;  1N34 H;  1NKD A;  4DV1 O;  1N56 A;  1JXL A;  2UXD H;  2Q69 A;  4B3R O;  4BW9 A;  3OUZ A;  4A3M G;  3SYC A;  2F4V H;  2CE4 A;  4LF9 H;  3CEI A;  3LP8 A;  3RF2 A;  5I5X A;  3CCU V;  1P4R A;  4YJ2 F;  4FS2 A;  4WD3 A;  2FK3 A;  4O7L A;  3DSQ A;  1N34 O;  5KS8 A;  1UPG A;  2UXD O;  2MK3 A;  4DQN A;  4J7K A;  2F4V O;  4I7Z B;  4PA3 A;  4LF9 O;  1RFY A;  1D2D A;  3JD1 A;  5JQG B;  4O84 A;  2QM8 A;  2V5A A;  3BQ0 A;  3FMA A;  2OIG A;  3CHX A;  1GO3 E;  4GC7 A;  2LFS A;  4QJF B;  1VQ6 V;  2UU9 O;  2CNU A;  3JRX A;  4EEY A;  1PPJ H;  5B1A C;  3W7S A;  4ZOL A;  2DZD A;  1K1S A;  1Q82 W;  5KT6 A;  2ZE6 A;  5JH7 B;  3ZRX A;  4NTX A;  2COI A;  5K1X A;  3MR6 A;  4ECT A;  3HKC A;  2VQF O;  4UCV A;  2M6Y A;  1VQ4 V;  3A8T A;  4HZ3 A;  2R82 A;  4LF4 B;  3JAS A;  2HGX A;  4MS2 A;  1NTK H;  1E1R G;  2ZT9 B;  4FBT A;  4FM1 A;  4O4L A;  3C0F B;  5KFW A;  2XUM A;  4CS2 A;  5DGI A;  4ED6 A;  3LUL A;  4HQ6 A;  4JYA B;  3OTO H;  2GQR A;  4LF7 B;  2NN4 A;  4JAU A;  3JZI A;  3ASO B;  1JCH A;  1H2G A;  2UXC H;  4RUA A;  4ZHQ F;  2HDK A;  2QE7 G;  5BPH A;  1Y76 A;  5FD6 A;  2KKW A;  5KFR A;  4HNA A;  4QIW A;  5LL6 b;  1H2K A;  1NTZ H;  4ZOL B;  2YL2 A;  2R9A A;  4JI0 H;  1FJG B;  3OTO O;  4BWS C;  1FYJ A;  4JTA B;  4TQS A;  3HKC B;  3EYY A;  4DV1 B;  4ECW A;  2GBO A;  4HAM A;  2UXC O;  3TJT A;  4B3R B;  4GKK H;  2C2A A;  3ABL C;  1TWH A;  3JAS B;  3BFR A;  5KFG A;  1K5Q A;  4O4L B;  3HPL C;  3VA7 A;  4JI0 O;  3I56 V;  3K5I A;  3N41 B;  3A2F A;  5A9G A;  4TV8 A;  5CMU A;  1NR7 A;  3ZMZ A;  4U3J A;  4PDB A;  3ETQ A;  4GKK O;  3ZN1 A;  2ETN A;  3WB2 A;  3L2P A;  4X88 A;  4DRF A;  4LF9 B;  1GO3 F;  2HHH B;  1Y76 B;  2DAB A;  4JZ2 A;  1GM9 A;  3JCZ A;  3L71 H;  4LR3 A;  3ETJ A;  3FAV A;  5KMG B;  3LWB A;  2UU9 B;  2V7Q G;  3NBZ B;  4PA6 A;  4WFE A;  1IOW A;  2DW4 A;  3BAA A;  1DLB A;  4IHJ A;  4E2L A;  4U3F H;  3HR0 A;  5J2T F;  3M9M B;  5H6R A;  3KKY A;  1I3Q A;  5LA6 B;  4O7Y A;  2VQF B;  1AR5 A;  4P9P A;  2OT5 A;  1H2M A;  4EKW A;  5BR8 B;  1AN7 A;  2CW8 A;  2A06 H;  4TV8 B;  4B3T H;  3SJB C;  5KFS A;  5H2F Z;  2C00 A;  4DV6 H;  5E1A C;  3DGE A;  3UKM A;  2XND G;  2ZR2 A;  3OTF A;  4O7R A;  4YXW G;  3UT5 A;  1EZJ A;  1WB7 A;  2ZE7 A;  5BY1 A;  1J95 A;  3LML A;  3FAV B;  4GYC B;  4B3T O;  1DIK A;  2GUZ B;  2YXY A;  3SYP A;  3LDD A;  2UUA B;  3J81 W;  4A3K G;  5KG6 A;  3SJA C;  4DV6 O;  3FB6 C;  4J41 A;  3WB0 A;  1HNX B;  3N43 B;  1KU9 A;  2WAM A;  4IHJ B;  4J11 A;  3L9D A;  1FFT B;  3OTO B;  4TQR A;  5DG7 A;  2QA4 V;  2J6U A;  1ORQ C;  4O4I B;  5JQG F;  4JV5 H;  3CPW U;  2UXC B;  4MT8 A;  2VPQ A;  4CKC A;  4KP4 A;  3NBY B;  1EHI A;  4QIW E;  5HV6 A;  5B1B C;  2EJ7 A;  5JH7 F;  4JI4 B;  5C5J A;  4FLW A;  1TUB B;  1IOV A;  4GT1 A;  3L75 H;  3RYC A;  4DXW A;  4JV5 O;  1Y1V G;  3G71 V;  3SI8 A;  4KHP B;  1AR1 B;  1JPX A;  2Y4U A;  3Q8P B;  4QNH B;  1R73 A;  2FYU H;  2QKC A;  4PDR A;  5E25 A;  4QW8 A;  1GH6 A;  3TY9 A;  3PR5 B;  4I55 B;  4TSF G;  2PTM A;  4ECR A;  5EZY A;  1K7D A;  4J9K A;  2WA4 A;  4WFA V;  2AQ4 A;  4JV1 A;  1R3I C;  2CFM A;  1I7N A;  2UUC H;  1CS0 A;  3G4S V;  3RB6 A;  1RSO A;  4GX0 A;  4O7Z A;  4ABM A;  3BAC A;  3K3V A;  2EIN B;  3H01 A;  1OCZ C;  1TA8 A;  4ZOL F;  5JWP A;  2Q73 A;  4DW0 A;  1MZB A;  3RWR D;  1W59 A;  1M5I A;  4F6R B;  3RYC B;  5LXT B;  3OM3 B;  2GLT A;  3FB5 C;  1Z2O X;  3ZIA G;  3ETE A;  4LCU C;  5IT9 N;  4O4L F;  2HLD G;  3ZHQ A;  2R8K A;  2E5L H;  1AUV A;  1NBM G;  5IYZ B;  1FXH A;  5EWF A;  5DGA A;  4MTF A;  3RYI A;  2Q4P A;  5LGT A;  3D36 A;  1RJR A;  3JAK A;  1BL8 A;  3Q8R B;  3LSS A;  4ECU A;  4CH3 A;  3Q2O A;  2E5L O;  2YRW A;  3WB1 A;  5KG0 A;  4LSX A;  4DIM A;  1XNR H;  5D1O B;  4JXU A;  3LSQ A;  4B3S H;  4A5U B;  2WLH A;  5I5Y A;  3G8D A;  2JGU A;  4C2M A;  4RB1 A;  2VOB A;  2W6Z A;  5LA6 F;  5DAA A;  2N05 A;  2EJ2 A;  2R8I A;  2COG A;  3A0B Z;  1VF5 B;  4RNN A;  5KLV H;  3RT3 C;  4K0K O;  4B3S O;  5ITZ A;  1YSC A;  3G80 A;  3ZHU A;  4GLX A;  3RYI B;  3L70 H;  4ETS A;  2LJ2 A;  3N6X A;  2XGP A;  4O7V A;  2QKA A;  4IWX A;  1I94 H;  2H8P C;  3JAK B;  1E4F T;  1XNQ H;  3FX7 A;  1N32 B;  4DR1 O;  3OSP A;  2Q68 A;  3KAJ A;  3APO A;  1CEZ A;  5IE9 A;  1E4E A;  3H1H H;  4UCR A;  4MA5 A;  3VOT A;  4CH5 A;  3LDE A;  1N36 B;  5EDW A;  3RAQ A;  4IHJ F;  1V9P A;  1I94 O;  1XOU A;  3CRA A;  3Q8S B;  4K3A A;  1JLL B;  1TWA A;  1VQO V;  3ETD A;  4O4I F;  4EFE A;  4DL2 A;  1IXB A;  4FLX A;  1YJW V;  4J10 A;  5KFF A;  2GPW A;  1M56 C;  5KFH A;  2AW9 A;  1WLE A;  4DRX A;  3AX6 A;  3CCV V;  3AG1 C;  2QYZ A;  1P16 A;  3F8N A;  2HEP A;  3E89 A;  2ZDI A;  2NVY A;  5DN6 G;  2HHF B;  5J2U A;  1E4E B;  3RJ0 A;  1CQI B;  5F2V O;  5KA5 A;  4CBC A;  2DN9 A;  3ZHV A;  2ASL A;  4QGP A;  3SNO A;  3T5K A;  4I55 F;  2RN9 A;  2ZIM A;  1SQP H;  1JX4 A;  2AZ0 A;  4RQE A;  2E2I A;  4UUJ C;  4D7T A;  3C3T A;  4O7W A;  1OV9 A;  3LDC A;  1YEW A;  3TET A;  1I5Y A;  3L4K A;  4O2A A;  4DRX B;  3RGZ A;  1WH2 A;  4GX1 A;  1NR1 A;  5CR5 A;  4K0K B;  4R8U B;  5LXT F;  4MV8 A;  4JTC B;  1TVK A;  4GUN A;  5I5U A;  2V4D A;  2YZG A;  2FPI B;  4R6Z A;  5J2U B;  1NVP D;  2W8K A;  1FD9 A;  1S72 V;  4RNM A;  2XAH A;  1IDS A;  5DG8 A;  3KZI Z;  1X59 A;  4DR1 B;  4A3L G;  1AIL A;  5JJE B;  4K6N A;  5IYZ F;  2RGR A;  1Z2G A;  2FP4 B;  4LFA B;  2BQU A;  1CXZ B;  2IH3 C;  1AP6 A;  2K9P A;  3THO A;  4FLY A;  1I94 B;  4EYH B;  2HVR A;  1ENV A;  2YZN A;  3NUA A;  1ZHQ A;  1E4G T;  4H33 A;  4O4J B;  3ZRW A;  1VEW A;  1SQQ H;  1KB9 F;  3F7V C;  4MVR A;  4YB8 B;  4DR2 O;  2ZD9 A;  3QF7 A;  3ZMV A;  1ZLZ A;  2FML A;  4JAV A;  4EB6 B;  3HXL A;  3LNM B;  5CBH A;  2XOK G;  1GTO A;  2HVK C;  2JIZ G;  2COJ A;  3WNZ A;  5I47 A;  3HKE A;  1TUE B;  5JUM A;  4LP8 A;  3PW5 A;  4X1Y A;  5L3G A;  3ZMS A;  2V58 A;  4J9L A;  3ZS8 C;  1VQP V;  1Q6H A;  1E1Q G;  4FMT A;  3ML0 A;  1V54 C;  5L3F A;  4DV3 H;  1LUV A;  2AGA A;  4X62 B;  3NR7 A;  3QVN A;  3ZRW B;  2R7M A;  4A3B G;  1FS0 G;  5CA1 B;  1GM7 A;  2QWR B;  3HOZ G;  1H2L A;  2EZO A;  3UQ8 A;  1QU7 A;  3BJY A;  2YS8 A;  2UXX A;  4DV3 O;  4I9Q A;  2IP4 A;  3CQZ A;  5JCO A;  2Q7D A;  4O2B A;  3HKE B;  4MTE A;  3G6X A;  3GTG A;  4X1Y B;  2X6A A;  2PVP A;  3UZB A;  2WLK A;  4J9O A;  1MMM A;  1V55 B;  2UUB H;  1Y67 A;  1V4Y A;  2AHZ A;  5LMU H;  4NTY A;  2ATK C;  3AG4 B;  5K3W A;  4UV8 A;  1I7L A;  2Q2U A;  1HR0 H;  3FB7 C;  2VRZ A;  4FM0 A;  5GTH Z;  3GV8 B;  2R9I A;  2YIA A;  3RFR A;  2WB1 A;  1KKD A;  3DF7 A;  5KHH A;  2F95 B;  5IJ9 A;  1SES A;  1M57 C;  5B5E Z;  2UUB O;  5I5S A;  2VUG A;  4O3P A;  5LMU O;  3GV7 B;  4CC5 A;  3CJH B;  1FXK C;  4O2B B;  4TT3 G;  4DR2 B;  1HR0 O;  2ZKO A;  5BWW A;  3MFH A;  4FS1 A;  3MR3 A;  3QO7 A;  1MZE A;  1TWC A;  2JA7 G;  2EIL C;  4UVC A;  1KD1 W;  4DUZ B;  1H2S B;  5FNV B;  1SQF A;  2R84 A;  5KFQ A;  2R8J A;  5KAF Z;  2D2C B;  1SZT A;  3K59 A;  1VBH A;  3M99 B;  3ZN0 A;  1EN5 A;  2DQ3 A;  2AGQ A;  2IH1 C;  1AB3 A;  2XAS A;  4F4X A;  1FFX A;  5EYP B;  5J2U F;  4ED7 A;  1B3Q A;  4BBS G;  4QWB A;  1G8M A;  1EUC B;  3BQ1 A;  3J80 N;  2GQS A;  3ZRV A;  5KT2 A;  2YZL A;  4WHX A;  3VOU A;  4PA9 A;  5IJ9 B;  1YIJ V;  2M05 A;  4C5C A;  2PZS A;  3MD0 A;  4LF8 H;  2EX3 A;  1VQ8 V;  1K8A W;  1PD3 A;  2Z3Y A;  5KG4 A;  5C44 G;  1K4C C;  3JZ6 A;  1OBD A;  2RGV A;  3Q4H B;  3CRR A;  3QFF A;  4A3C G;  4O4J F;  4O3N A;  3SPG A;  1Y66 A;  4YHH O;  1B6S A;  3LNN A;  3OHB A;  4EYI B;  4LF8 O;  2XAQ A;  3KHG A;  1FFX B;  4I4T B;  4L1K A;  5FPR A;  5KFY A;  4DR7 B;  4B3M H;  1IBK B;  3DC6 A;  4QWD A;  1YJ9 V;  1JMK C;  4YJ3 A;  1EM1 A;  1YZB A;  5LP6 A;  1ZET A;  2ZXW B;  1ROP A;  2YCH A;  2C2E A;  1Y74 B;  5IWA H;  4DR4 H;  5KFV A;  3OAA G;  2NU6 B;  3QZ8 A;  4B3M O;  3K9S A;  3T9E A;  5C1P A;  1JJO A;  2UVW A;  4IR1 A;  2AZ2 A;  1VF7 A;  5IWA O;  4BY1 G;  2WB1 E;  5CA1 F;  4NR1 A;  3QTC A;  3F7Y C;  1KYO F;  1I1M A;  4MSW C;  4YR3 A;  1W2B U;  2IU0 A;  2EJ0 A;  5KFD A;  2QKS A;  4YJ3 B;  4QPJ A;  4JI5 B;  3JAL A;  1N4C A;  5LP6 B;  2X0S A;  3ASO C;  5EC1 C;  4NTW A;  1QNM A;  1SQV H;  4I9W A;  3EPI A;  3JZF A;  4J80 A;  1BHB A;  4JI7 O;  3I12 A;  4R50 A;  5BWV A;  1WSC A;  4WFB V;  4CS4 A;  2RDC A;  3K79 A;  2W9B B;  2EIK B;  1PNL A;  2JJ1 G;  4ED1 A;  1VQN V;  1HDJ A;  2A9H A;  3D8C A;  2W0F C;  3OUU A;  3AYH B;  1JIH A;  5IDJ A;  4YHH B;  3PN1 A;  4CKB A;  4GLW A;  3RV3 A;  3RN4 A;  4LFC H;  2L6L A;  4AYB A;  2RDJ A;  3WWH A;  4O2B F;  1S5H C;  4LFB H;  3JAL B;  3VPB A;  2DYR C;  4EFB A;  4FLV A;  3ZED A;  4JYA H;  2AHY A;  1XUQ A;  2WAQ A;  3U9S A;  2FTK A;  4ICG A;  4LF7 H;  1AI7 A;  2VA3 A;  5FNV F;  4BY7 G;  1QR8 A;  3AG2 B;  2IJK A;  4JAA A;  1KBH A;  1A3G A;  4LFC O;  3CSX A;  4O4H B;  3WWJ A;  4LFB O;  1YJN V;  4JYA O;  1FJG H;  4LF7 O;  2F43 G;  5CB4 A;  4DV1 H;  1COW G;  3QNE A;  3DAA A;  1XMO O;  4BAY A;  4HNV A;  1I1L A;  4Q0Y A;  3RVZ A;  4JV0 A;  1KJQ A;  1SEI A;  2B5U A;  4A2A A;  1FJG O;  2VUM A;  1R1B A;  2YI9 A;  3GTO A;  2XAG A;  3RYF A;  3BPZ A;  2QJ1 A;  2X6C A;  3WO0 A;  5KFL A;  3EHB B;  4LH6 A;  5JH7 A;  2R92 A;  2HHH H;  3QQM A;  3L72 H;  4I4T F;  4MVM A;  3HB3 B;  3CXH F;  2UU9 H;  1IYD A;  2C22 A;  1T94 A;  3BAB A;  5CB4 B;  1EYZ A;  5I5T A;  1Q43 A;  4AI8 A;  4MV6 A;  3CVZ A;  2HHH O;  2CH7 A;  2VQF H;  1JQ0 A;  5DQG A;  4MTD A;  1OCC B;  5BR8 H;  3JAT B;  3R23 A;  4JYB A;  3V6K A;  1YHQ V;  3ORQ A;  2ZM6 B;  3RYF B;  2W70 A;  4IL6 Z;  1BMF G;  3U11 A;  5HBR B;  4DR6 H;  2KB1 A;  2PUS A;  2KSW A;  5CBF A;  5BR8 O;  4TUY B;  2FL4 A;  5FLX N;  5FD5 A;  2Y69 B;  2OH2 A;  2BOC C;  4WCE V;  2UUA H;  4LFC B;  1VBG A;  5CN0 A;  4AYB E;  3AW8 A;  3QWU A;  3B4S A;  4WF9 V;  1HNX H;  4LFB B;  3GWK C;  2JA8 G;  4YJ3 F;  5LOV A;  1FXV A; 
#chains in the Genus database with same CATH homology
 5LXT B;  1XHZ A;  3L4J A;  1XNQ B;  1Z2O X;  3RTX A;  2FE3 A;  4R7R A;  3W5O A;  2MCT A;  4O2A B;  4UCS A;  1X4T A;  1ZAU A;  3T1H B;  1XMO B;  1DGS A;  3N40 P;  4TV9 A;  2E5L H;  5C8Y B;  5IYZ B;  1TVK B;  5KMG A;  4JI4 H;  3RYI A;  3HKB A;  4MV7 A;  3N44 B;  1B04 A;  4KHP H;  3JAK A;  3W1G A;  5LA6 A;  4CH3 A;  4LSX A;  3WB1 A;  1XNR H;  5D1O B;  2ZM6 H;  4O4H A;  5LOV B;  2HIX A;  4B3S H;  2YI8 A;  4X1K A;  1Q8I A;  2JGU A;  4RB1 A;  2VOB A;  1J5E B;  3B2E E;  3JSN A;  4TV9 B;  2ZNI A;  3KAL A;  4NXM B;  4DK0 A;  1SA0 A;  1HNZ H;  5D5P A;  5ITZ A;  4LNU A;  2BTQ A;  4GLX A;  3RYI B;  4FM9 A;  1P49 A;  3HKB B;  4ETS A;  4I50 A;  3N6X A;  1WPB A;  2RJZ A;  2CW7 A;  2VWK A;  1I94 H;  3JAK B;  1XNQ H;  1E4F T;  1N32 B;  5CA0 B;  3T1Y B;  4O4I A;  1XI1 A;  3KAJ A;  3T1H H;  1XMO H;  2XHB A;  2E3C A;  4FLT A;  4UCR A;  1I6U A;  1TAE A;  4DV4 H;  4DR5 B;  4TQF A;  4X1K B;  4CH5 A;  1S68 A;  1N36 B;  3NC0 B;  4X1I A;  1V9P A;  4JI7 B;  4CC6 A;  3GJX B;  1TUB A;  1D5A A;  4DR6 B;  4EFE A;  5LMN B;  4FLX A;  4PI2 A;  1SA0 B;  4LNU B;  2BTQ B;  1SKV A;  3JAT A;  4DV5 B;  4DRX A;  4I55 A;  4B08 A;  3U0Z A;  4I50 B;  3N2K A;  4ZI7 B;  1P16 A;  3F8N A;  2HEP A;  4F6R B;  4M7E A;  2JS5 A;  4CH6 A;  5J2U A;  3RJ0 A;  1IBM H;  5D5Q A;  4TUY A;  4NXM H;  3N2G B;  1QQC A;  3VQX A;  4X64 H;  4X1I B;  4LF6 H;  1WN7 A;  4YJ2 A;  2ZIM A;  3K5N A;  3JAM W;  4LSA A;  2ZIO A;  4F6R A;  2IM9 A;  5LXT A;  2PYL A;  4D7T A;  2OYQ A;  4I7H A;  1N32 H;  2ZJT A;  4PI0 A;  1BJT A;  3S24 A;  2XIG A;  1YEW A;  1XMQ B;  2F93 B;  4RB3 C;  4AIL C;  3GB8 B;  2Q0A A;  3L4K A;  4DV7 H;  4LH7 A;  4O2A A;  4DRX B;  3RGZ A;  1CKM A;  2HVS A;  1WH2 A;  5D1P A;  4DR5 H;  3IAY A;  3N2K B;  4K0K B;  1N36 H;  1IBL H;  5IYZ A;  3TY5 A;  4EQ5 A;  1TVK A;  2V4D A;  4JI7 H;  2F66 C;  3BA8 A;  1ZHS A;  5J2U B;  1SQG A;  4DV3 B;  4LF5 H;  3TY8 A;  4DR1 B;  4JI3 B;  5JJE B;  4A2B A;  4DV5 H;  4YJ2 B;  1N33 B;  1HNZ B;  3RR5 A;  5D1O A;  1S5J A;  2RGR A;  4FVM A;  1O9G A;  5KHG A;  4FM2 A;  4LFA B;  4FFB A;  4TOI A;  3K5L A;  3THO A;  3JAW B;  1MZB A;  4FLY A;  1I94 B;  2YIB A;  2HVR A;  1XQ8 A;  1ZHQ A;  2R72 A;  1E4G T;  3RIZ A;  3BHP A;  4ZIB A;  4O4J B;  3K57 A;  1GYF A;  2ZNJ A;  4DV4 B;  4ZHQ A;  4UCT A;  1P8L A;  3M4I A;  2UUB B;  3QF7 A;  2PGG A;  1CKN B;  4EB6 B;  1VS0 A;  5LMU B;  3HXL A;  4UCO A;  5FPO A;  1HR0 B;  1XMQ H;  3GDE A;  2WE6 A;  3VQW A;  3H20 A;  5CA0 A;  3E22 A;  3HKE A;  1XDN A;  3VNN A;  4KL1 A;  4K0K H;  4X1Y A;  4FLU A;  4FFB B;  3U10 A;  3ZS8 C;  4JI8 B;  4OX9 B;  4K8Z A;  1L8D A;  2HVQ A;  4DV3 H;  4X65 B;  1M93 A;  4X62 B;  5GON A;  1FVI A;  1IBM B;  2PYJ A;  1M0W A;  4MV9 A;  4DR1 H;  4JI3 H;  3RYH B;  2VPS A;  4DV2 B;  1L2Z A;  3ICX A;  5CA1 B;  1N33 H;  4ZHQ B;  2P5O A;  4X64 B;  4IAJ A;  4LF6 B;  5A2Q W;  3SR2 C;  3UQ8 A;  4LFA H;  4NXN B;  3HKD B;  3J7A K;  4RZQ A;  4UCU A;  4ZI7 A;  4I9Q A;  1X9N A;  5JCO A;  1N34 B;  4IIJ B;  4O2B A;  1M0T A;  2UXD B;  4RAZ A;  4RAY A;  3E22 B;  3HKE B;  4MTE A;  2F4V B;  2Q7G A;  4DV7 B;  2VWJ A;  5J2T A;  2CAZ C;  4X1Y B;  4LF4 H;  4UFZ A;  3N2G A;  4HNA B;  4LF8 B;  4YY3 H;  1IBL B;  2UUB H;  3KYH C;  3MAQ A;  1SYX B;  5LMU H;  4DUY B;  2Q2U A;  5GON B;  3JSL A;  5KHI A;  5K1P A;  1HR0 H;  4FM0 A;  4LF5 B;  3RFR A;  2YIA A;  3K5M A;  5EIB C;  2VQE B;  3DF7 A;  5KHH A;  2F95 B;  5IJ9 A;  4FLZ A;  4GKJ H;  2BTO A;  4JI8 H;  3BA9 A;  4Q6G A;  2VUG A;  4OX9 H;  4JI2 H;  1FKA H;  3VQY A;  4CC5 A;  4O2B B;  4U3J B;  4B3M B;  4DR2 B;  2HIV A;  4PHZ A;  4X65 H;  4X62 H;  1O9H A;  4PZ6 A;  4JI1 B;  4B3R H;  2Q7E A;  1I7F A;  1H2S B;  5FNV B;  1SQF A;  5J2T B;  4DUZ B;  2F1M A;  3J80 W;  4DV2 H;  3M7M X;  4CH4 A;  5IWA B;  4DR4 B;  3K59 A;  5JQG A;  1HNW B;  4NXN H;  1FFX A;  5JCO C;  5EYP B;  5JVD A;  5BMV A;  1HW7 A;  2Q2T A;  1N34 H;  4APM A;  4EEQ A;  3JAW A;  2UXD H;  2OWO A;  4DR3 B;  4BW9 A;  1Q5O A;  2F4V H;  4LF9 H;  3SGI A;  1BGW A;  3RF2 A;  5IJ9 B;  4O4J A;  2PZS A;  2R70 A;  3K5O A;  4HBN A;  4LF8 H;  2EX3 A;  3N42 B;  3DSQ A;  2Q7H A;  4DUY H;  4J0M A;  4JI0 B;  1CKN A;  4EB6 A;  2RGV A;  3UT5 B;  2W57 A;  5KHJ A;  4BWA A;  2QM4 A;  4GKK B;  3LNN A;  5JQG B;  2VQE H;  1S03 G;  5EOY A;  3FMA A;  1FFX B;  3CHX A;  4I4T B;  4AHC A;  2GV9 A;  5JVD B;  5BMV B;  5FPR A;  4DR7 B;  1NT2 B;  4B3M H;  4DR2 H;  1IBK B;  4ZOL A;  5JH7 B;  1JMK C;  2ZCE A;  4YJ3 A;  5K1X A;  4JI1 H;  4DUZ H;  3HKC A;  1QHT A;  4UCV A;  4DK1 A;  5LP6 A;  2YCH A;  3RYH A;  5IWA H;  1XHX A;  4DR4 H;  4LF4 B;  5CA1 A;  3JAS A;  1HNW H;  4X20 A;  4YY3 B;  4FM1 A;  4O4L A;  3C0F B;  1JJO A;  1Z2P X;  4CS2 A;  3HKD A;  3RGB A;  4DR3 H;  1VF7 A;  4JYA B;  3OTO H;  4IIJ A;  4LF7 B;  3W1B A;  3MWM A;  3QTC A;  2UXC H;  1XK5 A;  4GKJ B;  5FD6 A;  1TGO A;  2KKW A;  5EZY B;  4HNA A;  3SJC C;  5LL6 b;  4ZOL B;  4B3T B;  2R9A A;  4JI2 B;  4JI0 H;  1FJG B;  4BWS C;  4YJ3 B;  4DV6 B;  4JI5 B;  4WBN B;  3JAL A;  3HKC B;  5LP6 B;  3EYY A;  4PZ8 A;  4DV1 B;  4NVP A;  4GKK H;  4B3R B;  3JAS B;  4X20 B;  4TQD A;  4O4L B;  3K58 A;  4DR7 H;  3N41 B;  1Z2N X;  3A2F A;  3FFQ A;  4DV0 H;  4TV8 A;  1IBK H;  4CS4 A;  5LP6 C;  4U3J A;  4PDB A;  3ETQ A;  3IG0 A;  1Q3E A;  3WB2 A;  3L2P A;  4DRF A;  5KX5 A;  4LF9 B;  4JV5 B;  5FNV A;  2HHH B;  4YHH B;  3PN1 A;  2YIB D;  4LR3 A;  4LFC H;  2P22 C;  1G6U A;  1Z5W A;  2WDT A;  5KMG B;  5LYJ A;  2UU9 B;  5EYP A;  3JAL B;  4AQY H;  4LFB H;  3NBZ B;  4EFB A;  4FLV A;  3ZED A;  4JYA H;  4LF7 H;  1KMI Z;  3BAA A;  4IHJ A;  2HGS A;  5KHK A;  5LA6 B;  2VQF B;  4X66 B;  3JAR A;  3CB2 A;  2YXL A;  1AN7 A;  3CSX A;  5BR8 B;  2CW8 A;  2JVD A;  4O4H B;  4JI6 B;  2UXB B;  4TV8 B;  4B3T H;  3SJB C;  1A0I A;  1FJG H;  4CS3 A;  4DV6 H;  4JI5 H;  5CB4 A;  3OTF A;  4DV1 H;  5IJ0 A;  5KX5 B;  3UT5 A;  5EIB D;  2RQ6 A;  2UUC B;  4RB0 A;  3LML A;  4LMY A;  4Q0Y A;  4GYC B;  2O03 A;  1SEI A;  5ITZ B;  4I4T A;  2UUA B;  5LYJ B;  3KXY T;  4A2A A;  3J81 W;  3SJA C;  3WB0 A;  3N43 B;  2YI9 A;  1HNX B;  3RYF A;  1KU9 A;  2QJ1 A;  3BPZ A;  4IHJ B;  3OTO B;  4LH6 A;  4PZ7 A;  5JH7 A;  1O75 A;  2PY5 A;  4O4I B;  3JAR B;  1J5E H;  4JV5 H;  2HHH H;  4YHH H;  2UXC B;  1JFF A;  2WYO A;  3NBY B;  1T5E A;  2E5L B;  3QG5 A;  2UU9 H;  4L8J A;  5JJN B;  3BAB A;  5CB4 B;  4E6N A;  3KAK A;  5IJ0 B;  1M4U A;  4JI4 B;  4FLW A;  1TUB B;  1Q43 A;  3RYC A;  3CVZ A;  4KHP B;  3T1Y H;  2VQF H;  4X66 H;  4MTD A;  5BR8 H;  3TY9 A;  3JAT B;  5FLX W;  4JI6 H;  2UXB H;  4I55 B;  4K8X A;  1XNR B;  2PTM A;  3RYF B;  5EZY A;  4D7S A;  2ZM6 B;  4RB2 C;  4DV0 B;  5C8Y A;  3U11 A;  4B3S B;  1Z5V A;  5DIS C;  4WBN A;  2CFM A;  4DR6 H;  2UUC H;  2PUS A;  1JFF B;  1CKO A;  1RSO A;  2KSW A;  5LMN H;  4TUY B;  3VQV A;  3K3V A;  5FD5 A;  5IT9 W;  2UUA H;  4LFC B;  3BRC A;  5JJJ B;  1TA8 A;  3QWU A;  1HNX H;  1WNS A;  3RGX A;  4LFB B;  4AQY B;  2ZIN A;  3RWR D;  5LOV A;  1M5I A;  3RYC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...