4CC5A

Fragment-based discovery of 6 azaindazoles as inhibitors of bacterial dna ligase
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
308
structure length
308
Chain Sequence
ADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title Fragment-Based Discovery of 6-Azaindazoles as Inhibitors of Bacterial DNA Ligase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 109
structure length 308
sequence length 308
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4cc5A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4cc5A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4cc5A02
4NXNB 4UFZA 1FJGB 3NBYB 3RR5A 1X9NA 1CKNB 5FPOA 4E6NA 1XMOB 1TAEA 2UUCB 4X66B 4EEQA 4DV3B 4DV0B 3UQ8A 1HR0B 4X64B 1J5EB 4JI7B 4DR1B 1CKNA 4PZ6A 2VUGA 3KYHC 4DRFA 1N34B 4LF4B 4DR6B 3BABA 4EFBA 1IBKB 3T1HB 4LFBB 4YHHB 3S24A 5LMNB 3BA9A 4LF6B 2UU9B 4B3RB 3JSNA 2UXBB 1P16A 1S68A 4GKJB 2VQEB 2HIVA 1N36B 4UCVA 4JI8B 3TY9A 1A0IA 1IBLB 4DV4B 1CKMA 2ZM6B 1XNQB 4LF7B 1XDNA 4CC6A 1IBMB 3PN1A 4DV5B 3NC0B 3L2PA 4DV7B 2UXDB 4DR7B 1CKOA 4PZ8A 4B3TB 4DUYB 3QWUA 4X65B 4NXMB 3GB8B 4B3MB 4LFCB 4UCRA 4GKKB 4DV2B 2F4VB 1FVIA 4LH7A 4UCSA 4JI5B 4LFAB 4DR3B 1V9PA 5BR8B 1DGSA 4DV1B 3JSLA 4DV6B 4K0KB 3SGIA 3W1BA 3NBZB 4UCTA 2HVQA 5D1OB 4LF5B 4UCUA 4OX9B 4LF8B 1I94B 2E5LB 1P8LA 3OTOB 3BA8A 3BAAA 4EFEA 4EQ5A 2HVRA 5IWAB 4JI2B 5D1OA 1N33B 1HNZB 4JI0B 4TOIA 2UUBB 5LMUB 3T1YB 3RTXA 4JI4B 4X62B 3GJXB 4CC5A 1XNRB 4JV5B 1N32B 3TY8A 4UCOA 4DUZB 2UUAB 4DR2B 3VNNA 2HHHB 2OWOA 3TY5A 1HNXB 5DISC 1B04A 1XMQB 3W1GA 4DR5B 1ZAUA 4JI1B 4JYAB 5FPRA 1XK5A 1TA8A 4YY3B 3W5OA 4LH6A 1VS0A 1HNWB 4DR4B 2Q2UA 2UXCB 4PZ7A 4LF9B 2CFMA 2Q2TA 5D1PA 3GDEA 4B3SB 4KHPB 2HIXA 4JI6B 4GLXA 4AQYB 4JI3B 2HVSA 2VQFB
chains in the Genus database with same CATH superfamily
3FX7A 2R82A 3ZJZA 2JEUA 2RN9A 2R7NA 3GIMA 1KUTA 3SYQA 4L1KA 4X88A 5H5NA 3V4ZA 2Y4UA 3KCYA 3E22A 2DQ3A 4DV0B 5BWTA 3DTUB 3QVNA 5LP6F 4BY7G 5JQGF 3HKDA 2IM9A 5KLVH 3UFXB 5FNVB 4R7RA 3FYEB 4LFBB 3H1HH 2RNBA 5IYDO 1PL0A 5FLXW 1QU7A 3IJ4A 3W7UA 4LF6B 4JI7H 3I5DA 3U0ZA 4GKJB 2Z04A 4MVQA 2CUGA 2LW1A 4X1IA 4C5BA 2HIVA 2FMLA 3S3WA 5JH7F 4J7KA 3PW2A 3C90A 2Q67A 3TW6A 2RQ6A 3J80N 3SJQC 2Z0AA 4DR7B 2QB5A 3W7XA 1Q5OA 3DAAA 5KFCA 1IYEA 3CE2A 1FS0G 2NU8B 4DV5H 3UCSC 5GTIZ 4KFMA 3J7AU 5JQWA 4QWBA 2RF4A 3KCXA 4R8CA 4UXNA 4ZOLF 4ED2A 1N34O 2R9AA 4IHJB 2P06A 3ZRSA 4DV2B 4CHIA 4B3MH 1EUDB 5K3WA 4DIMA 3AG3B 4HNVA 1XQ8A 5LA6F 1Y14B 2HVKC 2Y69B 1Z2OX 2D3OW 1KJ8A 3KAJA 3ZN0A 2Q0AA 4MV9A 2ZE5A 3RFRA 4DV1H 5D1OB 4UCUA 2HGXA 4A3MG 2UXDO 4FPPA 2CDYA 4PHZA 4I55F 3K3WA 4DO2A 4Q20A 1S76D 2YZGA 4FM9A 4GX0A 4WFGA 1Q90D 2RDCA 3ABKC 2L35A 2KSDA 3AG1C 1MZEA 2JRIA 3ZHTA 4O7WA 5GW7A 5IYCO 3T1YB 4RB0A 4FS2A 1I2KA 5EIBD 4WFEA 2J9GA 4O4LF 5FLMG 5KHHA 2NU6B 3N2GB 1GYFA 1TVKA 3CB2A 1HNXB 3RB0A 1W59A 1YVWA 1Z2PX 3TCUA 2LQTA 4JI1O 2YS8A 4TQFA 5JUMA 1RJRA 5KFPA 2RDJA 1SQBH 2LFRA 3E89A 2Q7HA 2H8PC 2EJ3A 3HKCA 2HIXA 4K6NA 1GN6A 1OCCB 4AQYB 4DR4H 2BOCC 1N33O 1VAJA 4ECVA 4F4XA 4YHHH 2AU0A 3G6YA 1S77D 2IP4A 3BHPA 1EN5A 4UFZA 5CR5A 4YJ2A 1PNMA 3PW7A 1WJZA 2UUAO 4J0MA 1UFIA 2YWVA 2R9IA 3N2KA 4NXNH 1TAEA 4NZOA 3OSPA 3J81W 3CMAV 4EEQA 1UNNC 3RYCA 2CTPA 5IYZA 4A3DG 4DR5O 3MR6A 4DK0A 1K92A 1RYRA 2WA3A 4FZ1A 3E35A 4RNNA 4RNMA 4DV3H 1OCZB 3ABTA 1WA8B 2ADPA 2P4VA 4RB3C 3RUPA 2ZINA 3V6JA 4W4KA 5J9PC 3OUUA 5KG3A 5KT3A 2YYAA 5LMNH 4ZI7B 2HJDA 5KHJA 1AILA 4A3BG 5EIBC 1K5QA 2YL2A 1R3KC 3PW4A 3MJFA 2ODMA 4TUYB 2YXLA 3RJ0A 2F43G 2G38A 2JA8G 4O7ZA 1NTKH 2M05A 2IJIA 1M6VA 4GUNA 4LFCB 2CNUA 1I2LA 5AG2A 2XC9A 5LL6Y 2RGRA 2W6IG 2YEVA 3JATA 1CPYA 3T1HO 3IFXA 2AGOA 1XREA 3ZN1A 3JZ6A 3PJSK 4O2AB 4WBNA 2DLNA 3V6HA 4OGQB 5KFFA 2DWEC 4DL6A 4B3RO 3AG3C 5IYDG 4I9QA 1UC9A 5C1OA 2W6JG 2QKCA 2Y0SE 4J11A 4F4LA 1BL8A 4TM5A 1EZVH 4J9OA 1PX2A 5ITZA 4I50A 3R65A 3TETA 2HJFC 4XX0B 4R8UB 1IXMA 2P4KA 4DV6H 2NNUA 2W70A 5BZBA 1VQ6V 4MV4A 1G4YB 3VQYA 2PYLA 2FE3A 4A3CG 3ETGA 3GWOA 3KKYA 2HGSA 3LWBA 5CB4F 1NH2B 4LF5H 4OX9H 1KJ9A 3OTFA 1K8AW 4ZQIA 2ZE6A 3K3VA 1IX9A 2EJ2A 1Q6UA 3H1LH 5FD6A 4JI0H 2OWOA 2VOBA 2YZMA 3OE7G 5BR8O 1XNRH 4KL1A 1UJWB 1I0HA 3M7MX 3W1GA 3G6XA 4K0KO 1JFFA 2EJRA 1AR5A 3Q4HB 4PDVA 2OLSA 3I12A 4J80A 2Y0IA 3EPGA 1VQ9V 2ZXWB 4JYAH 3OUSA 5D1PA 3VPCA 2VRZA 2GDSA 1SQGA 4GLWA 4PA6A 1OCCC 5BPFA 3A0HZ 2V59A 5JVDA 1Q6IA 3N6RA 5EOYA 5LL6b 5LHGA 1FPOA 4R50A 4YR2A 2XTAA 4PA7A 2V4QA 1WB8A 2A7WA 2Z5UA 3BY6A 4TV8A 1JLLB 4JV5O 5IYCG 3E22B 5J2UF 5FPOA 4QWCA 5KFQA 2DYSB 2QM7A 4M0JA 1NH2D 4DRFA 2CAZC 2ZDGA 1N34B 1BNCA 1Y76A 4YP3A 2QWRB 4X1IB 3MAQA 4TV9F 1XMOH 2IBKA 4FBTA 1Z2GA 1JJOA 1IBKO 4HZ3A 1OCZC 3B8MA 4IYHA 2VPQA 3GILA 1JVMA 1EYZA 1J5EH 2L6LA 1DV1A 3VMMA 1WH2A 2YXYA 2IH3C 1OCOB 1A0IA 1EUCB 1ZL8B 5KFZA 1H8HG 3JD3A 4F4WA 2UXDB 3EHBB 1OV9A 4IGGA 2QGNA 4P2ZA 5IJ0A 5A2QN 1SERA 2FPGB 2WYOA 3T2MA 2UUCO 2WLIA 4HYKA 1RM1B 2IW5A 1P84F 4UCRA 4IIJA 5B66Z 2PMZE 2V9WA 1ULZA 2EJ0A 4RUEA 1XBLA 1EKVA 2WLMA 5FNVF 3SYPA 4DL5A 3LMLA 3J80W 4EEYA 2X0LA 3JSLA 1ZTEA 3K58A 3GV7B 2R8JA 3BFRA 5KFKA 4Q4DA 1NKDA 3G6BA 3JCZA 3SE7A 2W9CA 1F7YA 3ORQA 3K79A 3TXQA 3UZBA 4C7UA 3G6EV 4BWSC 4IRCA 3TINA 1HWYA 3DXRB 4E2LA 1K83A 1N33B 2MK3A 4MAMA 3LDDA 2VUMA 1TVKB 2P90A 1AI5A 5IY5B 1S9FA 1MZBA 2F1MA 2UUAB 2FPPB 4IHJF 3PZPA 2Y48A 1US6A 2CTWA 4Q0YA 2ASDA 4DR5B 2CK3G 4MA0A 4I4TA 3HKCB 4BY1G 3E8BA 4EGQA 1SA0A 2QJ1A 3W7TA 4ECRA 3JD0A 2ZXWC 2W6ZA 1V4YA 1VF5B 4CH4A 4RO2A 3VQWA 2AGAA 4YAKB 2ITDC 5KFYA 4J9NA 4YJ2B 2XCPA 2BSKB 5CBHA 3T4ZA 3G8CA 1VQ8V 4QIWE 4MV3A 5IYZB 3HOUG 4PA3A 4P9OA 5CA1F 2DYSC 2JVDA 2LFSA 3JAKA 4W4LA 4P30A 2LP7A 4O4JA 4JTDB 3AK2A 3LDEA 3T1HB 4ETSA 1QBZA 1TUEB 2B63A 4DR1H 3M99B 3STZC 4B3RB 1WP7A 4DQNA 2ZE8A 3OEEG 4JI3O 5D8DA 4A3IG 3WG7C 3EYYA 3T9FA 1FXHA 4J10A 4JZGA 3OT7A 4QPJA 3NC0B 2IMWP 1Y67A 3CRMA 3T5HA 2ZM6H 4TT3G 2XCAA 4B3TO 3QWUA 3VPDA 4PI0A 2CGNA 2YEVB 3OM3B 5KFNA 1E4EA 3WB0A 1NT2B 2DAAA 1RM1C 4LF4O 2IJHA 1K1QA 3APOA 3OTOH 1WPXA 2W6OA 1O9GA 1S72V 1HW7A 1R6KA 1VQKV 5ITZB 5BR8B 3K0GA 1G6UA 5J2TA 5CA0A 2FMAA 4EBCA 4GKKH 4K0KB 2COJA 1Q3EA 1WRVA 1XNQO 4ZI7F 4UCTA 3MWDA 2XOKG 1H2NA 1SQPH 3FD9A 2Q69A 1P8LA 3TEKA 2IJJA 3K5MA 2GQSA 4G28B 5C8YA 4PDRA 3TW7A 5KFSA 1F4MA 4X65O 5KMGA 4LF8H 1RP3B 1K9MW 2QWNB 3CPWU 2JDIG 5IY5C 4JV5B 4JI2H 5I60A 1R9TA 2IA6A 2UUBH 1JFFB 1TWFA 4X62H 4O2AF 4DR3O 2GLTA 2JA6A 3F7YC 1C3OA 1AI6A 1N32H 5DM6V 3IAYA 1WR2A 1SEIA 4A3JG 4Y8VB 3KHLA 2ZKOA 4YJ3F 4OPHA 5JVDB 3KZIZ 2Q5ZA 2YCHA 4MVZA 2HKOA 3V4SA 5KFDA 4NYKA 1KBLA 4TV8B 4WD3A 1B3QA 4ICGA 4LF9H 4RUCA 4JAUA 5LMUO 5KFVA 4B3SH 1THZA 2E3CA 2QR4A 3RIZA 1KJIA 4GX2A 1PPJH 1IBLH 1Y76B 2UUCB 1KMIZ 3CS5A 4KXRA 1K97A 4PJ0Z 3PW5A 2W6PA 1M1KW 3K04A 1KJJA 4PZ6A 3M9OB 5B5EZ 2VUGA 3EXAA 3J81N 1LNQA 4ECSA 1C30A 3S24A 1SQQH 1YEWA 2DPIA 2ATKC 4FE2A 4UB8Z 4X64H 1D5AA 1GTOA 1DAAA 1P16A 2ZNIA 3OW2U 1S68A 4HNAA 4DR6H 2PGGA 1BT8A 4UCVA 3RYFA 1I7LA 1CKMA 5EBWC 2QWPB 1KT8A 4CC6A 3Q2OA 2Q73A 3KREA 4I0XA 3A2FA 4L87A 4CH5A 1VQOV 2XCLA 1GN4A 2M7WA 3T1CA 1TWCA 3Q8PB 4IIJB 3SPHA 4K35A 4TSFG 5BMVA 5B3SB 4O4IF 4JI7O 1NBMG 3PFFA 4JZ2A 2JJ1G 3Q8QB 3L71H 4ECXA 1OCRB 4LH7A 1KB9F 2A1HA 5CN0A 4DAAA 1N0NA 4U3JA 2ODTX 2W9CB 3ASNB 4FLZA 4TQDA 2ZDHA 4J9KA 2BR0A 1GO3F 2W6MA 2EINB 4BBRG 5LGUA 5IJ9A 5L3CA 5BPHA 2JJ2G 5A2QW 4DV5O 3CSWA 2QM4A 3WU2Z 5KHIA 4O4HA 4XZ3B 4DUYO 4PA9A 3U0GA 4GC6A 4X9QA 2JK5C 4J9RA 3ABMB 1AJPA 4J41A 3UO3A 4B3MO 2CE4A 3BQ1A 3GJXB 4EKWA 4GCZA 2BQRA 2B63G 1DIKA 3VNNA 4ED1A 4K8XA 4I4TB 4JI4H 3RB3A 4LFAO 3GIPA 2ILMA 1FYJA 4YAJB 4H13B 3A0RA 4DV1O 1SA0B 2C22A 1RPOA 2VPSA 5HNEA 1GLVA 1M9NA 1A0GA 4UV8A 4CKCA 2Q2UA 3W7SA 5DGIA 5CA3A 1B6SA 3LSSA 2OTJV 4PZ7A 2F23A 2W6QA 2H3OA 1AP6A 1BJTA 1HNWH 4JI3B 1M7JA 1EHIA 1W96A 2HVSA 1OBDA 4TQSA 1E1QG 1XUQA 4LFBH 4LCUC 2VWJA 5KFWA 2J6SA 3CCQV 3LNNA 4MVUA 1M93A 2XAQA 3JAKB 2FL4A 3T9BA 3NUAA 1X9NA 2HHHO 3CD6V 4FFRA 4O4JB 3U9TA 2ZDQA 1N8RW 1VEWA 4BIZA 3ETHA 5KFTA 4X1KB 5KAIZ 3HOXG 3DC6A 4LF4B 2KG7A 4H37A 3FB8C 4QGPA 1VQ4V 1QVFU 1BQZA 2CZGA 4DR4O 5F9LA 4IT5A 3L75H 3RAQA 1MSDA 1P7BA 1YZBA 1SQXH 3UT5B 4CMFA 2CW8A 3LSQA 5KS8A 2RGVA 3OMAB 3PW0A 5DGHA 2D2CB 1BCCH 2ALZA 1GK9A 2ZR3A 3I4MG 1XNQB 4O7LA 4NXNO 2JEFA 3PN1A 1E4EB 5JWPA 3H0GA 2ZQMA 4JAAA 3GQCA 4O83A 4O2BF 2IU0A 1RYSA 1IBMH 4JGSA 3N6XA 2AHYA 2CKZB 2OH2A 2JA6G 4X65B 2R8HA 5LYJA 5B3SC 1H2KA 4DV3O 3O65A 5KX5F 3ICXA 2YI8A 1NVPB 4EYIB 5J2TB 5CA0B 1N0JA 5KFEA 1NR7A 3K06A 1GH6A 1ET0A 5LMNO 3E5NA 3KHHA 4O3NA 1JX4A 4NR1A 1QR9A 4DR3B 3FB7C 3ASNC 1AB3A 1KECA 1TWGA 1ZUQA 2EZOA 4MTEA 3QO5A 3K5LA 1QLNA 3Q8RB 5GONF 1BS3A 4HYOA 1KC8W 5H9CA 2V7QG 4CKEA 3A0BZ 1EN4A 3SPIA 4EFEA 4A3EG 2HVRA 2NLJC 2YRWA 4RCNA 3ABMC 2R9RB 5LMUB 5I5XA 4FGRA 1L2ZA 4XDKA 1XHXA 4UCOA 1HNZH 1CP9A 1SZTA 1YHQV 2QSAA 1KBHA 2FK3A 5KG1A 4JAVA 3H9VA 4ZHQF 4BAYA 3MR2A 3GLKA 4DV6O 4FU0A 5FPRA 2YZLA 4A2BA 1W0KG 1NR1A 1VS0A 3CJHA 1NVPD 3H20A 4HR7A 4LF5O 4OX9O 3CC2V 2CQYA 1XMQH 3SJCC 4O86A 4QPKA 4RNOA 2AZ0A 4AYBA 2OYQA 1VQMV 3OHBA 2ABJA 2C2DA 4O3RA 2FLLA 1VF7A 4JI0O 2W0XA 1SCUB 5E1AC 1KUQA 1XNRO 4FS1A 3HT5A 3TQ1A 1XHZA 2V58A 2X6BA 3JAWA 2NVXA 2JA5A 5KFUA 4QW8A 3NGDA 3IC7A 2B1IA 3OGCC 3CXCU 3H01A 4F4YA 1FJGH 4JI7B 3JZIA 4JYAO 2GTSA 3CSXA 1XOUA 2C35B 3K5IA 5EWGA 4YIPA 4O7TA 1S0VA 4X66H 3OGIB 5HV6A 4FVMA 3AEIA 4G3IA 4J9ZB 5EBLC 2ZD9A 1B33N 4LFCH 2CNVA 4I0XB 4DL3A 3ZHRA 1HDJA 5LGTA 1NQTA 2E2IA 1P49A 2HP8A 4LSAA 2BCCH 4DV5B 1RFYA 2VQEH 4ECUA 5BMVB 2SCUB 3KALA 1OWTA 4CE5A 4Q8FA 3IGAC 4DUYB 3T4DA 3DC5A 3T9CA 4DV4H 3FAVB 1IDSA 3WFVA 3I55V 1XMOO 3ZBHA 4DXWA 4B3MB 1D5NA 1J5EO 2Q4PA 2RMKB 5BWRA 4U3JB 1I50A 2FYUH 1FVIA 1J95A 1Y6XA 5IJ9B 4LFAB 4YIOA 4DV1B 4C5CA 3RGZA 1L1FA 2Y4RA 3LDCA 4JI8O 1XEQA 3CCJV 1Q6HA 4JI5H 4QNHB 4JYBA 2O57A 3VQVA 2OIGA 5BY1A 5LP6A 1YJ9V 5JQGA 4N23A 3N41B 5KT6A 2IBZH 3UKMA 3K57A 2ASLA 5K1XA 1DF5A 3L73H 4LBEC 2GPSA 2I80A 4IIJF 4EBDA 1YF2A 2AQ4A 1JIHA 2BTQA 1BHBA 2HHFA 3ORRA 1K5SA 4LNUA 2R85A 5EC2C 3T54A 5DGAA 2HHHB 3CXHF 1CEZA 1GRJA 5LHHA 4Q44A 1S5HC 2Y69C 3RYHB 2I87A 1WCMA 4QWEA 3JASA 4Q43A 5KHKA 3RF2A 4K3AA 1TA8A 2ARHA 3W5OA 5DG8A 4I7ZB 4DR4B 3N8DA 4MV1A 3H0GG 2PVPA 1WAZA 2CFMA 5CMUA 3FB6C 1TUBB 1IYDA 4YY3H 4JYYA 2FTKA 2M6YA 3QNEA 5KFHA 4JTCB 4NXNB 4KHPH 5LA6A 4AI8A 4JXUA 1UPGA 1O9HA 3L74H 4XYLB 3GIIA 3HKEA 2DJVA 4FIPC 2O03A 2R87A 2UVUA 1K4DC 4JV1A 3RFCA 4RQEA 2KG7B 3HKBA 3HB3B 4C2MA 1AR1B 4IRKA 4I4TF 4DL2A 3HBLA 4DV3B 4I55A 5DQIA 2R93A 1Y1VG 5B1AB 5KFXA 4WHXA 1AN7A 1BGYH 1U96A 1A9XA 5LMNB 5L1KA 3RT3C 4QW9A 2LO1A 3HB9A 1RSOA 2C2EA 3MD0A 4Z1VA 4LP8A 1JOYA 3SYAA 2NVYA 2N74A 3WO1A 1BE3H 3VPBA 3EPIA 1WNSA 2ZE7A 2ZNJA 5KFIA 3SYOA 4MVSA 5JJNB 5LYJB 3U9SA 3HKDB 3GV8B 3FDSA 4G2KA 3JALA 2XD4A 3TIGA 5KG0A 3IN5A 4LF7H 1I5XA 1VBGA 2QA4V 2A79B 4UV9A 1SYXB 2HG5C 1R73A 2J6TA 3MHSC 4DR1O 1IOWA 2DPJA 4NXMH 2ZIMA 1B6QA 3TXSA 5FD5A 1WP8A 1QNMA 3L4KA 3GTJA 2RCVA 2UXBO 2NU9B 2RDIA 1CS0A 1YDXA 2F4VH 4DV6B 2ZM6O 2UUAH 3BEHA 3NBZB 3OR7C 4DYLA 4LF5B 4OX9B 1AJNA 2JA5G 2HFEC 2P7TC 4B08A 5FR9A 1TWAA 4EBEA 1GM8A 1UC8A 2DQ0A 1VBHA 1M0TA 5DN6G 4QE9A 4JI0B 2BTOA 2GTAA 3CC4V 5IDJA 4RQFA 1I94H 3T5KA 1ORQC 1BHAA 4IZOA 1XNRB 1KC7A 3HPLC 4DW1A 4PD4F 4GKKO 4UUGA 5J2TF 2KQXA 4ZIBA 3O9OA 3ETJA 5CBGA 2BOBC 1M57B 3QO8A 3R5FA 1KP2A 3K5NA 5L1LA 2R7ZA 4JI1B 4JYAB 4DR2H 1H2LA 3HXLA 3K0DA 5KG5A 2R8KA 3QF7A 3V6KA 4LF8O 3Q1KA 3U54A 2PF4E 1VKZA 1DF4A 3OSNA 1SF9A 1XI1A 4GLXA 1AUXA 5CAEB 4JI2O 1QQCA 2YIDA 2UUBO 1T36A 4X62O 1N32O 1ZETA 5BWWA 2XAJA 3UYYA 1S5JA 3SDLA 4E6NA 2UXXA 3ZHVA 4QIWF 1XMOB 2EILB 5KT7A 4AHCA 3OUFA 5BWUA 1J5EB 4ZKIA 2W71A 1K3EA 2R7MA 5B1AC 4LC1A 2HDKA 2XUMA 4FLYA 4EFBA 4ASUG 5CB4A 1EZJA 2XAFA 5BYAA 3HO8A 4LF9O 1HR0H 2PN1A 3CEBA 2QE7G 3OAAG 4B3SO 3SYCA 2BE3A 3ZRWA 1I5YA 4JI6O 4JI8B 5JJJB 5KA5A 1GGOA 1AR4A 3N2KB 4U7OA 2Q6AA 2EIKB 2IH1C 3RYCB 1YXBA 1GKFA 2Q7GA 1KD1W 4MS2A 3RGBA 2N04A 4K0KH 1WCMG 5KFJA 2GBOA 4MTFA 1G1XB 1MG1A 4DW0A 4FLVA 3AW8A 4HNTA 2R86A 3CMEV 4X64O 3AYHB 4U6PA 1R3JC 4DR6O 1VQPV 4FFKA 1WPBA 4Q6GA 4CBCA 2NN4A 3N44B 4PWQA 3LQSA 2QM8A 5H2FZ 3WB1A 2UU9O 5K2MA 3ASOB 1L8DA 4I7HA 1OCOC 5EWFA 2JEGA 1JX9A 5J2UA 4MTGA 3MR3A 3H40A 2B5UA 2COGA 4FFBA 4ECQA 2E76B 2LGWA 3G80A 4J42A 1Q81W 3DTFA 1H38A 3BAAA 3JATB 4TV9A 4QSHA 1RK5A 4WBNB 4BIUA 2HHFB 3CCRV 2R93G 2E5LH 4TOIA 1COWG 3RTXA 1FD9A 3EFFK 1VF6A 4ABMA 4RAYA 1AVMA 5IWAH 3WWJA 2C28A 3JASB 5H80A 3MR5A 4MA5A 2AHZA 4I50B 4FLXA 3BCCH 5C44G 4JYCA 2DOSA 1M57C 3JD4A 2NU7B 5DLFA 4DUZH 5FL7G 4JUZA 1FXKA 5KFBA 2P0AA 1RPRA 4O7VA 3R5HA 2B9ZA 2WAQA 2UUCH 3NR7A 2Q2TA 4PDBA 3UZOA 5LA6B 4TUYF 3B40A 3HKEB 3L72H 2A0LA 2X6CA 5L1JA 1FKAH 1JMKC 1FFTB 1MABG 4JV2A 4MTXA 4PV1B 5DEDA 1MA1A 4JI4O 4K8ZA 1AI7A 3GIDA 4LSXA 1KYOF 3HKBB 4O7NA 3WO0A 1ENVA 3T9EA 4I55B 4A2AA 3B4SA 4FZ0A 2VQFH 2W9BA 4OXSA 2EILC 4GX1A 1S0OA 4JF3A 3FKIA 1OBGA 4ECZA 4DR1B 4FLUA 3L9DA 1A48A 1M56B 1IXBA 1MOFA 1IBKB 1HNWO 3MWMA 3OMNB 3PVXA 5L3DA 3RGXA 5KUMA 1ROPA 2UXBB 1JDBB 5DQGA 4FMTA 3SPGA 1JXLA 4GX5A 5EYPA 5I5SA 4FBUA 2ZM6B 2A3QA 3JALB 1XDNA 3PR5B 5KG2A 2EIKC 4RUAA 1LUVA 3GWKC 1N36H 3U55A 3DGEA 1QCEA 3H4BA 1N4CA 2P22C 3OUZA 3CHXA 3BQ2A 4FLWA 3GB8B 4Z2WA 4YQWA 4DV7H 2R7ZG 2COIA 1M0WA 3ETQA 3ML0A 1EZ1A 4GKKB 2BQUA 1GN3A 2FKLA 3G4SV 3ASOC 4NYEA 4DRXA 2Y0PA 3K59A 4O3PA 3J7AK 5IJ0B 3B2EE 4F6RA 5CA1A 1BQ0A 4UVAA 1IBMO 1HP8A 2R7LA 3KAKA 2WLIB 2X6AA 4G27B 5C93A 4RB1A 4NTYA 4LF8B 3AG2B 3OFNG 3X2QB 5CBFA 1NI8A 4JI2B 3CQZA 5FJ8G 2YW2A 1PV0A 2XT9A 1V51A 1AUVA 2YS7A 2UUBB 3C3SA 3K08A 4WFAV 2W8LA 1K33A 4X62B 4CS4A 1N32B 1PKXA 3LUTB 2Q0OC 1ZWIC 3H1IH 2W6NA 3QG5A 3PO2G 1Y74A 3CRCA 2WAMA 4FJCC 1PNKA 2GQRA 2LGQA 2YZNA 2QK4A 1VMGA 4A93G 4HN2A 2QYZA 2EJ7A 4LF9B 1WN7A 2EX3A 5CM0A 3T5JA 4EB6A 2CW7A 1FXVA 5KHGA 2QTSA 4XDJA 4B3SB 4Z1MG 3LP8A 4BBSG 4BW5A 4JI6B 1BZKA 2LJ2A 5H6QA 1Q82W 4LF4H 2UXCH 2PYJA 1HNZO 4J9SA 2WLHA 2P67A 4IRDA 4IR9A 1LUWA 1NS1A 2MCTA 5KG4A 2R8GA 1DLBA 4L8JA 1AP5A 3DF7A 2GUZA 1H2SB 5CB4B 3HOVG 4PDMA 4J9YB 3GIKA 2DMXA 1XMQO 4X64B 3U10A 2HEPA 1AI4A 1Y66A 1M56C 2YDEA 4DR6B 3VOUA 2KKWA 3ZRWB 3UO2A 3JYCA 2FPIB 1MNGA 3BPZA 4GZRB 4X65H 1R3LC 4DV0H 4LWSA 3I56V 2UU9B 2YIBD 2DYRB 1B6RA 1NTZH 1YJNV 5DMXA 3FMAA 1M90W 3EVKA 4LF6H 4O2AA 2FK1A 1QHTA 4GKJH 2ZGIA 4MV7A 2QF7A 3HKZE 4J9MA 4ED6A 3T5LA 1FJGO 3G8DA 4B3TB 5EBMC 3P30A 5L9XA 2ETNA 4X8AA 3R23A 4YJ3A 4GC7A 4CMDA 3QO7A 4AYBE 4X66O 3JAMW 4DR7H 4CH6A 3A8TA 5LOVA 2FLNA 1Y4MA 4YHHO 5J2UB 3AG7A 3LNMB 4X89A 3SJAC 5B1NA 4FFBB 1V9PA 2JS5A 1DGSA 4X1YA 2VQEO 2UVRA 2EZPA 3QZ8A 4DV2H 4QWDA 4YJ2F 1R3IC 5GTHZ 4DV4O 4O7SA 5BYBA 3CRRA 4IR1A 3S3XA 4TV9B 2DE0X 5BWVA 2OCHA 5IYZF 4TQRA 3AG2C 4EQ5A 3X2QC 4MV6A 4H44B 2JS3A 4PELA 3Q8SB 2PY5A 3FKIG 1D2DA 3F7VC 2WWWA 4JI4B 5I5WA 5EZYA 4CZZA 2WLLA 5I5YA 1OCRC 3CCEV 5C3EG 3T1YH 2C00A 1E4GT 4JI5O 4CKBA 3WB2A 1FXKB 2W57A 4YXWG 2QWOB 2HJWA 3GTGA 1B04A 2QWQB 1E4FT 2UXNA 2EINC 3FKSG 4N21A 3RAXA 3RBDA 5C8YB 1Y1VA 3CCUV 5JVLA 5KFRA 2CGOA 4LH6A 1HNWB 1HNXH 2LW7A 3H1KH 5KMGB 4O4IA 1KTAA 2V5AA 2ATLA 1BSMA 2YC0A 3D8CA 2QEXV 2XGPA 4TWKA 3TGUH 1I08A 2PI4A 2Q7DA 4WBNF 4A3LG 1GN2A 2DWDC 2I8CA 1K1SA 3B09A 2W9BB 2R70A 4AQYH 1GMGA 4QE7A 2JGDA 1SS3A 5I5VA 3KTMA 4RWUA 1SQVH 3T9AA 1MZFA 1ZL8A 4O3QA 4I50F 2JEJA 4IYIA 1X59A 4DK1A 3ZIAG 2WLNA 1AROP 1CKNA 3HKZA 4APMA 3D3QA 4MTDA 4YY3O 3H4DA 4DUYH 3VOTA 4IAJA 2R72A 5EYPB 2W7PA 2EBOA 2XHBA 3C0FB 4KHPO 4YR0A 2DYRC 4WFHA 1Q86W 4O7YA 3ZMSA 1I1MA 4B7EA 1PL4A 2FB9A 2GHYA 2W8KA 1IBMB 4PDLA 3L2PA 4LFAH 1DV2A 3CP1A 4PZ8A 4QWAA 3RYIA 3LULA 1BMFG 3FYIB 2V1DA 3ABLB 3ETDA 1OHHG 4EG0A 2HGWA 4HNAB 2P6JA 4MVOA 4DRXB 3RYFB 2X5RA 1JCHA 2YUAA 3DXRA 5JVDF 4A5UB 1PNLA 1T3NA 2A06H 4F6RB 5CA1B 4FM1A 4U7NA 2AW9A 1Q8IA 3OR6C 3GV5B 4XYMB 4TV8F 1L0NH 2GSMB 4O82A 4BXXG 4LF7O 1X4TA 2E2HA 2HHHH 3W1BA 1Z5VA 4NTWA 3ABUA 1GM9A 1QVGU 2OT5A 1W2BU 3OEHG 2WTFA 1I6UA 1VF6C 1EKFA 3JCUZ 5DECA 2NUAB 4NXMO 4ED7A 4FK5C 4HBNA 1HNZB 3GTKA 2JA7A 1YI2V 5LXTA 3CCVV 3FB5C 2DABA 4NZNA 2F4VO 3TY8A 1Y74B 2BSKA 1FXKC 1A32A 3L70H 2QKAA 3E8HA 5DISC 4O4HB 2JEIA 1XMQB 4ECYA 3GTOA 3C3TA 4O2BA 4EB6B 1JPXA 1XK5A 4RU9A 4RAIA 1S03G 4O84A 4D7TA 2ITCC 4FFMA 5E79Z 5I47A 1I94O 5KX5A 3ZHSA 3M9MB 1R6TA 4J9LA 3JRWA 3G67A 4FFPA 3W7WA 3CCSV 2GUZB 3ZCCA 1YITV 1KP3A 4KUMA 1RJQA 2AGQA 5JH7A 3TIIA 2YU9A 1KQSU 1FJGB 4F6EA 2E74B 4DR2O 1OJHA 1KKCA 1VQNV 1DK1A 4MT8A 4RAZA 5EC1C 5GONA 1K7DA 3RVZA 4X66B 4YBZB 4J7ZA 1JDEA 2YRXA 3UQ8A 2MW2B 2ZIOA 2BQ3A 4LWSB 3JZFA 3KYHC 1MMMA 4ME6A 2FK2A 2GV9A 3BABA 4Q4CA 5B1OA 4ZOLA 4YHHB 4R7CA 2FB5A 3AG4B 1SESA 1M5IA 5JCOA 1N34H 2VQEB 5IT9N 1E79G 3ZHUA 3TY9A 4A3GG 4DV4B 2ZCEA 2VA2A 1Y1WA 3CC7V 3RV4A 4ZHQA 1V54B 4YJ3B 4HQ6A 4H0LB 1CKOA 1XILA 2JEXA 2WLKA 2V4RA 4TVIA 3ZRXA 2DW4A 3ABLC 5L3EA 1KKDA 5LOVB 5DGBA 2UXDH 2Y4TA 3CWBH 1I7FA 3M9NB 2K9PA 1HR0O 4WCEV 4EYHB 1NTMH 2XAHA 3K9AA 5TISZ 2DZDA 4X20A 1VARA 2X7RB 4NLGA 4X1YB 2V4DA 3ZMUA 1VQLV 3TK1A 5F2VO 3JARA 5B1BB 4JI5B 3P3NA 4O4LA 2ASJA 5IYBO 4ED8A 3CVZA 2R92A 2ZR2A 2HVJC 1GSOA 3KHGA 4I9WA 5KUKA 1S0NA 3GTQA 3QFFA 2WA4A 1ZX3A 2Q8VA 1N56A 1EBOA 1OZ0A 3LSUA 3BA8A 4F50A 4MSWC 4JI1H 4O4JF 3ZMVA 1FFXA 5EZYB 2WLLB 1A3GA 4LR3A 2ADQB 2CH7A 3IC9A 3UM7A 1PD3A 1G8MA 1H8EG 3K9SA 5KT5A 4CC5A 2KSWA 1XDCA 2Z3YA 1N33H 3CRQA 4NB5A 5EWEA 4FFNA 3CCLV 3M8AA 5JJEB 4J9PA 4HNUA 3KXYT 1CQIB 4O4IB 3RBZA 2PZSA 5HBRB 3D36A 4YY3B 2ZDIA 1S97A 4Q8EA 2PBZA 1P4RA 4E4EA 3JD2A 5L1IA 1K4CC 3ZS8C 2E5LO 4DR5H 1H2GA 3OTOO 4KHPB 1U97A 2OCCB 5IWAO 2AZ2A 3QZ7A 4RB2C 2JGDB 2FKXA 3E86A 2Q7EA 3BG5A 3APQA 3H1JH 3MWEA 5T14A 2FLPA 2J6UA 3WG7B 2UVVA 4CH3A 3MFIA 1S5LZ 4BW9A 3WWIA 5K1PA 1WSCA 5CA0F 3BJYA 1JR9A 3NBYB 4FLTA 2VQDA 4DUZO 1CKNB 2VS0A 3FFQA 5BXZA 4JI8H 3GTPA 3CJHB 2Y0SA 1S10A 2YIBA 1K34A 2OTLV 2AXTZ 5C8YF 3OD4A 3CRAA 5D5QA 1FKAO 4U7CA 4AILC 3AG4C 3KG2A 4RZQA 3ZHQA 4YR3A 1W0JG 1VIBA 3ZEDA 4O3SA 5L3BA 3L4JA 3CX5F 4MVRA 3T1HH 3JAWB 2JA7G 4YB8B 3RYIB 2VQFO 4UVCA 3AK3A 4LF7B 2XNDG 4B3RH 2KB1A 1V54C 3CYOA 2YS6A 4CS3A 4ECTA 4P9PA 1ZSPA 3GIJA 2E75B 2WAQE 3WWHA 4IL6Z 3GTLA 4PA4A 5KFMA 4NXMB 3BVOA 1Q7YW 3DTGA 3G71V 1I7NA 4B7KA 4D6TH 1Z2NX 1KJQA 1EN6A 4JV0A 1S3JA 3GTMA 1YTFB 3AK1A 3JAMN 2F4VB 5B1BC 2ZJTA 5C4XG 2B1GA 3TJTA 4LMYA 1QLEB 3JD1A 2AGPA 3F5TA 3K5OA 3RBEA 1N36O 1IBLO 1VQ5V 4UVBA 3RV3A 2R8IA 1TGOA 2W7OA 5BR8H 3ZRVA 3PO3G 3CCMV 1E1RG 1JJ2U 4DV7O 2R6FA 2WB1E 1GM7A 1I94B 2R7KA 3T7AA 1BGWA 5LXTB 4MW8A 4J9QA 2JIZG 5EK0A 3JRXA 5LHIA 2HLDG 5D5PA 2PUSA 3DSQA 4BIOA 1LR1A 1V55B 1P7GA 4O2BB 4DR2B 1JA8A 3TY5A 4E4TA 2CTRA 1XL6A 5LP6B 5DAAA 4BWAA 1QR8A 5JQGB 4FM0A 4JV5H 1CQJB 1TWHA 1ZAUA 1RK6A 1Y1WG 3HOYG 5KX5B 5H6RA 5IYBG 1YTFD 2UVWA 1IURA 5DG7A 4GT1A 2XIGA 1B06A 1SQFA 2BTQB 5BMVF 3K5HA 1Q43A 3GDEA 2X0SA 4X1KA 3BRCA 4O81A 4QJFA 3ZX6A 4LNUB 5JH7B 3G6VA 2OCCC 1VP7A 4XBFA 4M7EA 5FLXN 1IBKH 3OHAA 2PMZA 3K3PA 1T94A 3UT5A 5KFLA 1MSWD 2EULA 5GONB 2HR3A 2UXBH 3BQ0A 2EIYA 3B77A 1RJPA 3SI8A 2PTMA 5HFLA 1I3QA 4GYCB 2R92G 1T5EA 4ZOLB 5HFMA 2PI5A 1SRYA 4WFBV 1HR0B 4O4HF 2C2AA 4IWXA 1F51A 4FFLA 3I4NG 1WLEA 2UXCO 4D7SA 3BA9A 2QKSA 1PK8A 3RN4A 4CS2A 2K1EA 2EIJB 4MV8A 3JSNA 3U11A 4ZHQB 5FNVA 3ZMTA 2XAGA 1CE8A 5KG7A 1VQ7V 3ETEA 1SC5B 5C5JA 4R6ZA 5LGNA 1KU9A 2WDTA 2C2RA 3B8NA 2GPWA 1SETA 2CTQA 4X20B 4A3FG 5L3GA 3VBBA 4JPRA 4ECWA 4HAMA 4MVMA 3THOA 4DV0O 3JARB 4U3FH 2WB1A 4NKGB 1RSOB 2XASA 4O4LB 4UUJC 3D3IA 1NJIW 3N40P 4FM2A 5IT9W 4LFBO 1IZ3A 5IP7G 1IVSA 4NVPA 1M4UA 4LF6O 2IU3A 4UCSA 1Z5WA 1DTOA 1QLEC 2QTOA 4IHJA 4GKJO 3T99A 2YIAA 1ZLZA 2CNQA 4F4ZA 5KA6A 1YJWV 3MFHA 4A3KG 5DQHA 5C1PA 2F95B 2YSUB 2VR1A 4QIWA 1L0LH 1FFXB 2E5LB 4DR7O 3SJBC 1I1KA 2CH7B 3OTOB 4PI2A 5IWAB 2RJZA 2XGQA 3RB6A 5D1OA 5I5TA 3P3PA 4MTOA 3P32A 3N42B 5LOVF 2EIMB 2WLJA 4IWYA 4DV2O 5KG6A 3QQMA 5IP9G 4DUZB 4JI6H 3H3VH 1V55C 3R9RA 4RZRA 4ED0A 4MW3A 4RUFA 2P5OA 2YI9A 5LP6C 3E83A 3R5XA 2NR5A 4KP4A 3WNZA 5KT4A 3N2GA 4FFOA 5IE9A 3STLC 2DWCA 3SPCA 5LYJF 1BXRA 1W93A 3HOWG 1JKJB 2A9HA 3AX6A 3T9DA 3TQTA 1PM9A 4I5SA 4Q45A 5EZYF 2VQFB 1SKVA 3T1YO 5DLGA 2VUMG 1S0MA 4UB6Z 3KHRA 2UU9H 3HOZG 1G2WA 4JI3H 5L3FA 1FAFA 2N05A 4NTXA 3RR5A 5KT2A 4BR6A 2DIKA 5KFAA 2R84A 1HNXO 4NZMA 3N43B 1R6NA 2FJZA 4ED3A 5LBQA 3R66A 4OPAA 1SFOA 3IG0A 1GSAA 4B3TH 2QDOA 5JCOC 2F66C 3FAVA 2VA3A 2Q9LA 2WE6A 4M9UA 1ZHQA 4J7JA 1ZQ7A 2H94A 2EIJC 5KAFZ 4PBCA 1URFA 4O7RA 4DL7A 3GIQA 3PR4A 4AQYO 2F93B 1N36B 4WFFA 1YCIA 4XDLA 1WA8A 1IBLB 4O3OA 1EFRG 3SPJA 3RW0A 5KFGA 3QTCA 2WPDG 4DV7B 1WB7A 1GSHA 4H33A 2VWKA 4ZI7A 4JASA 1XNQH 1N48A 3RWRD 2YICA 3BACA 5BWXA 3HR0A 1PP9H 2YXHA 1KEEA 1YIJV 1AJQA 1K73W 4TUYA 1EKPA 3SR2C 5E25A 1NZ6A 5KFOA 3E8GA 1GO3E 4C5AA 5KKNB 3GVMA 3MDSA 1H2MA 1CXZB 5EDWA 3SGIA 3K03A 2OIEA 4DR3H 1F4NA 2HVQA 5F9NA 1XL4A 3M4IA 3RYHA 4EGJA 1ZHSA 5A9GA 1O75A 1GAXA 1IOVA 3SNOA 4R8UA 1YSCA 2IJKA 4DL4A 3GB7C 3ABKB 3AG1B 1R1BA 3E8FA 1F23A 4LFCO 2EIMC 2W0FC 2ZT9B 2HG8A 1TUBA 3N27A 2JGUA 4ZBMA 3MHHC 5CE8A 3D36C 5LMUH 1I1LA 2ZDIC 1NU1H 3F8NA 2Q68A 3RVYA 1JQ0A 2W9AA 3RB4A 3NXSA 3E2EA 3VQXA 4JTAB 4QJFB 4WF9V 3VA7A 5DG9A 2Z02A 1SZXA 2UXCB 2DN9A 4DLKA 3Q4HA 3F5WC 3ZMZA 1EM1A 5I5UA 2FP4B 5LXTF 2WSSG 3OMIB 3CEIA
chains in the Genus database with same CATH topology
4B3SH 5JH7A 2E3CA 1FJGB 3RIZA 1S5JA 4E6NA 1IBLH 4RAZA 1XMOB 5GONA 2UUCB 1KMIZ 4AHCA 4X66B 3E22A 4DV0B 3UQ8A 2ZIOA 1J5EB 4PZ6A 3HKDA 2VUGA 3KYHC 2IM9A 2GV9A 3BABA 5FNVB 4EFBA 5CB4A 4FLYA 4R7RA 4LFBB 4ZOLA 4YHHB 1YEWA 3S24A 5FLXW 4LF6B 1HR0H 4X64H 4JI7H 1D5AA 1M5IA 1P16A 3U0ZA 2ZNIA 5JCOA 4GKJB 4HNAA 2VQEB 4X1IA 1S68A 2PGGA 2HIVA 1N34H 4DR6H 4UCVA 5JJJB 4JI8B 3TY9A 3RYFA 3N2KB 4DV4B 2ZCEA 1CKMA 4CC6A 2RQ6A 4ZHQA 4YJ3B 3RYCB 2Q7GA 3A2FA 4DR7B 1CKOA 4CH5A 1Q5OA 3RGBA 4K0KH 4IIJB 4DV5H 5LOVB 5BMVA 4FLVA 2UXDH 1I7FA 4X20A 2R9AA 4IHJB 2V4DA 4X1YB 1WPBA 4Q6GA 4DV2B 4B3MH 3N44B 4LH7A 3JARA 4JI5B 3WB1A 1L8DA 1XQ8A 4O4LA 4U3JA 4I7HA 4FLZA 4TQDA 5J2UA 3CVZA 1Z2OX 3KAJA 4FFBA 5IJ9A 2Q0AA 4MV9A 5A2QW 3RFRA 4DV1H 5D1OB 2QM4A 4UCUA 5KHIA 4O4HA 4PHZA 3BA8A 3BAAA 3JATB 4JI1H 4TV9A 1FFXA 4FM9A 5EZYB 4WBNB 4LR3A 4RB0A 4TOIA 2E5LH 3T1YB 3RTXA 3GJXB 4RAYA 4CC5A 2KSWA 5IWAH 5EIBD 3JASB 1N33H 3VNNA 4K8XA 5KHHA 4I50B 4FLXA 4I4TB 4JI4H 3N2GB 1GYFA 1TVKA 3CB2A 1HNXB 5JJEB 1SA0B 3KXYT 4O4IB 2VPSA 2PZSA 4DUZH 1Z2PX 4YY3B 4TQFA 2Q2UA 4PZ7A 3ZS8C 4DR5H 2UUCH 2Q7HA 2Q2TA 3HKCA 4KHPB 4PDBA 2HIXA 5LA6B 1BJTA 3HKEB 4AQYB 1HNWH 4JI3B 4DR4H 4RB2C 1FKAH 1JMKC 2HVSA 2Q7EA 4LFBH 4YHHH 2VWJA 4K8ZA 4LSXA 4CH3A 3HKBB 4BW9A 3BHPA 3LNNA 5K1PA 1M93A 4UFZA 4YJ2A 4FLTA 4I55B 3NBYB 3JAKB 4A2AA 4J0MA 1X9NA 1CKNB 2VQFH 3FFQA 4JI8H 4O4JB 4NXNH 3N2KA 1TAEA 3J81W 2YIBA 4EEQA 3RYCA 5IYZA 4X1KB 4DK0A 4DR1B 4FLUA 4LF4B 1IBKB 3MWMA 5D5QA 4DV3H 4AILC 3RGXA 3UT5B 2CW8A 4RZQA 4RB3C 3ZEDA 2UXBB 2ZINA 2RGVA 3L4JA 3T1HH 3JAWB 5EYPA 3RYIB 5LMNH 4ZI7B 2ZM6B 1XNQB 5KHJA 3JALB 4LF7B 1XDNA 4B3RH 3PN1A 5EIBC 4CS3A 1N36H 2P22C 4TUYB 2YXLA 3CHXA 3RJ0A 3N6XA 1IBMH 4FLWA 4X65B 5LYJA 4NXMB 3GB8B 4DV7H 1M0WA 1Z2NX 4LFCB 3ETQA 2RGRA 3ICXA 2YI8A 5J2TB 5CA0B 3JATA 4GKKB 2F4VB 4O2AB 4WBNA 2ZJTA 4LMYA 4DR3B 4DRXA 4I9QA 3K5OA 3K59A 3J7AK 5IJ0B 3B2EE 4F6RA 5CA1A 5ITZA 4MTEA 1TGOA 4I50A 5BR8H 3KAKA 3K5LA 4RB1A 4LF8B 4DV6H 1I94B 1BGWA 5LXTB 3VQYA 2PYLA 4EFEA 2FE3A 2HVRA 4JI2B 2HGSA 4LF5H 4OX9H 2UUBB 5LMUB 3OTFA 4X62B 1L2ZA 4CS4A 1XHXA 5D5PA 2PUSA 3K3VA 3DSQA 1N32B 4UCOA 1HNZH 5FD6A 4O2BB 4DR2B 4JI0H 2OWOA 3TY5A 2VOBA 5LP6B 1XNRH 3QG5A 4KL1A 4BWAA 5JQGB 4FM0A 4JV5H 3W1GA 3M7MX 1ZAUA 5FPRA 5KX5B 1JFFA 4A2BA 1VS0A 3H20A 2XIGA 4LF9B 1SQFA 1WN7A 2BTQB 2EX3A 1XMQH 3SJCC 4EB6A 4JYAH 1Q43A 2CW7A 5D1PA 5KHGA 3GDEA 4B3SB 4X1KA 3BRCA 1SQGA 5JH7B 4LNUB 2OYQA 4JI6B 4LF4H 4M7EA 5JVDA 2UXCH 2PYJA 1VF7A 1IBKH 5EOYA 5LL6b 3UT5A 2MCTA 5GONB 4TV8A 2UXBH 4L8JA 3E22B 1XHZA 3DF7A 3JAWA 1H2SB 5FPOA 2PTMA 4GYCB 5CB4B 1T5EA 4ZOLB 1FJGH 4JI7B 1HR0B 4X64B 3U10A 2HEPA 4DRFA 2CAZC 3CSXA 1N34B 4DR6B 2KKWA 4X1IB 3MAQA 1XMOH 4X66H 4FVMA 1JJOA 3BPZA 4D7SA 4X65H 3BA9A 4DV0H 1J5EH 4CS2A 2UU9B 2YIBD 3JSNA 3U11A 4ZHQB 5FNVA 4LFCH 3FMAA 1WH2A 1A0IA 4LF6H 1P49A 4O2AA 4LSAA 4DV5B 1QHTA 4GKJH 2VQEH 4MV7A 1KU9A 5BMVB 2UXDB 3KALA 2WDTA 4B3TB 4DUYB 4DV4H 5IJ0A 4X20B 2WYOA 4YJ3A 4B3MB 3JAMW 4DR7H 3THOA 3JARB 4CH6A 4UCRA 4O4LB 4IIJA 4U3JB 3N40P 4FM2A 5IT9W 5LOVA 5J2UB 4NVPA 1FVIA 3SJAC 1M4UA 4UCSA 3LMLA 4FFBB 5IJ9B 4LFAB 1Z5WA 1V9PA 2JS5A 3J80W 1DGSA 4IHJA 3JSLA 4X1YA 4DV1B 3K58A 3RGZA 4DV2H 2YIAA 4JI5H 2F95B 4TV9B 1FFXB 3VQVA 5LP6A 3N41B 2E5LB 5JQGA 3SJBC 4BWSC 3OTOB 4PI2A 4EQ5A 5IWAB 2RJZA 3K57A 5D1OA 2PY5A 1N33B 5K1XA 3N42B 4JI4B 2BTQA 1TVKB 5EZYA 4LNUA 1MZBA 2F1MA 4JI6H 4DUZB 2UUAB 2HHHB 3T1YH 1E4GT 2W57A 2P5OA 3WB2A 2YI9A 4Q0YA 5LP6C 3RYHB 1B04A 1E4FT 3JASA 5KHKA 4DR5B 3RF2A 5C8YB 4I4TA 1TA8A 3HKCB 3N2GA 4LH6A 3W5OA 1HNWB 1HNXH 4DR4B 5KMGB 1SA0A 2QJ1A 4O4IA 2CFMA 1TUBB 4CH4A 4YY3H 3VQWA 4YJ2B 2VQFB 1SKVA 4NXNB 4KHPH 5LA6A 1O9HA 3HKEA 2UU9H 2R70A 4AQYH 4JI3H 5IYZB 3RR5A 2O03A 3HKBA 3N43B 4DV3B 4DK1A 4I55A 2JVDA 3JAKA 1CKNA 3IG0A 4O4JA 4APMA 4MTDA 4B3TH 1AN7A 5JCOC 4DUYH 2F66C 3T1HB 4ETSA 4IAJA 2WE6A 2R72A 1ZHQA 5EYPB 5LMNB 2XHBA 3C0FB 4DR1H 4B3RB 1RSOA 2F93B 1N36B 1IBLB 3EYYA 1WNSA 1IBMB 3QTCA 2ZNJA 3NC0B 3L2PA 4DV7B 4LFAH 5JJNB 5LYJB 3HKDB 4PZ8A 3RYIA 2VWKA 4ZI7A 3JALA 2ZM6H 4LF7H 1XNQH 3RWRD 3QWUA 4PI0A 1SYXB 3WB0A 1NT2B 4HNAB 4TUYA 4DRXB 3SR2C 3OTOH 3RYFB 4NXMH 1O9GA 2ZIMA 1HW7A 5FD5A 4F6RB 5CA1B 4FM1A 5ITZB 3L4KA 5BR8B 1G6UA 5J2TA 1Q8IA 5CA0A 4GKKH 2F4VH 4DV6B 4K0KB 1Q3EA 3SGIA 2UUAH 1X4TA 4DR3H 3W1BA 2HHHH 1Z5VA 3NBZB 4UCTA 2HVQA 4LF5B 4OX9B 3M4IA 3RYHA 1P8LA 3K5MA 1ZHSA 4B08A 1O75A 1I6UA 5C8YA 1M0TA 4HBNA 1HNZB 5KMGA 4JI0B 2BTOA 1I94H 4LF8H 5LXTA 1XNRB 1TUBA 4JV5B 4JI2H 3TY8A 2JGUA 2UUBH 1JFFB 5LMUH 4ZIBA 4X62H 5DISC 4O4HB 3F8NA 1XMQB 3K5NA 1N32H 4O2BA 4JI1B 4EB6B 3IAYA 4JYAB 1XK5A 4DR2H 1SEIA 3VQXA 1S03G 3HXLA 4D7TA 2UXCB 3QF7A 5JVDB 2YCHA 5KX5A 1XI1A 4GLXA 4TV8B 1QQCA 4LF9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN B;  4UFZ A;  1FJG B;  3NBY B;  3RR5 A;  1X9N A;  1CKN B;  5FPO A;  4E6N A;  1XMO B;  1TAE A;  2UUC B;  4X66 B;  4EEQ A;  4DV3 B;  4DV0 B;  3UQ8 A;  1HR0 B;  4X64 B;  1J5E B;  4JI7 B;  4DR1 B;  1CKN A;  4PZ6 A;  2VUG A;  3KYH C;  4DRF A;  1N34 B;  4LF4 B;  4DR6 B;  3BAB A;  4EFB A;  1IBK B;  3T1H B;  4LFB B;  4YHH B;  3S24 A;  5LMN B;  3BA9 A;  4LF6 B;  2UU9 B;  4B3R B;  3JSN A;  2UXB B;  1P16 A;  1S68 A;  4GKJ B;  2VQE B;  2HIV A;  1N36 B;  4UCV A;  4JI8 B;  3TY9 A;  1A0I A;  1IBL B;  4DV4 B;  1CKM A;  2ZM6 B;  1XNQ B;  4LF7 B;  1XDN A;  4CC6 A;  1IBM B;  3PN1 A;  4DV5 B;  3NC0 B;  3L2P A;  4DV7 B;  2UXD B;  4DR7 B;  1CKO A;  4PZ8 A;  4B3T B;  4DUY B;  3QWU A;  4X65 B;  4NXM B;  3GB8 B;  4B3M B;  4LFC B;  4UCR A;  4GKK B;  4DV2 B;  2F4V B;  1FVI A;  4LH7 A;  4UCS A;  4JI5 B;  4LFA B;  4DR3 B;  1V9P A;  5BR8 B;  1DGS A;  4DV1 B;  3JSL A;  4DV6 B;  4K0K B;  3SGI A;  3W1B A;  3NBZ B;  4UCT A;  2HVQ A;  5D1O B;  4LF5 B;  4UCU A;  4OX9 B;  4LF8 B;  1I94 B;  2E5L B;  1P8L A;  3OTO B;  3BA8 A;  3BAA A;  4EFE A;  4EQ5 A;  2HVR A;  5IWA B;  4JI2 B;  5D1O A;  1N33 B;  1HNZ B;  4JI0 B;  4TOI A;  2UUB B;  5LMU B;  3T1Y B;  3RTX A;  4JI4 B;  4X62 B;  3GJX B;  4CC5 A;  1XNR B;  4JV5 B;  1N32 B;  3TY8 A;  4UCO A;  4DUZ B;  2UUA B;  4DR2 B;  3VNN A;  2HHH B;  2OWO A;  3TY5 A;  1HNX B;  5DIS C;  1B04 A;  1XMQ B;  3W1G A;  4DR5 B;  1ZAU A;  4JI1 B;  4JYA B;  5FPR A;  1XK5 A;  1TA8 A;  4YY3 B;  3W5O A;  4LH6 A;  1VS0 A;  1HNW B;  4DR4 B;  2Q2U A;  2UXC B;  4PZ7 A;  4LF9 B;  2CFM A;  2Q2T A;  5D1P A;  3GDE A;  4B3S B;  4KHP B;  2HIX A;  4JI6 B;  4GLX A;  4AQY B;  4JI3 B;  2HVS A;  2VQF B; 
#chains in the Genus database with same CATH topology
 3FX7 A;  2R82 A;  3ZJZ A;  2JEU A;  2RN9 A;  2R7N A;  3GIM A;  1KUT A;  3SYQ A;  4L1K A;  4X88 A;  5H5N A;  3V4Z A;  2Y4U A;  3KCY A;  3E22 A;  2DQ3 A;  4DV0 B;  5BWT A;  3DTU B;  3QVN A;  5LP6 F;  4BY7 G;  5JQG F;  3HKD A;  2IM9 A;  5KLV H;  3UFX B;  5FNV B;  4R7R A;  3FYE B;  4LFB B;  3H1H H;  2RNB A;  5IYD O;  1PL0 A;  5FLX W;  1QU7 A;  3IJ4 A;  3W7U A;  4LF6 B;  4JI7 H;  3I5D A;  3U0Z A;  4GKJ B;  2Z04 A;  4MVQ A;  2CUG A;  2LW1 A;  4X1I A;  4C5B A;  2HIV A;  2FML A;  3S3W A;  5JH7 F;  4J7K A;  3PW2 A;  3C90 A;  2Q67 A;  3TW6 A;  2RQ6 A;  3J80 N;  3SJQ C;  2Z0A A;  4DR7 B;  2QB5 A;  3W7X A;  1Q5O A;  3DAA A;  5KFC A;  1IYE A;  3CE2 A;  1FS0 G;  2NU8 B;  4DV5 H;  3UCS C;  5GTI Z;  4KFM A;  3J7A U;  5JQW A;  4QWB A;  2RF4 A;  3KCX A;  4R8C A;  4UXN A;  4ZOL F;  4ED2 A;  1N34 O;  2R9A A;  4IHJ B;  2P06 A;  3ZRS A;  4DV2 B;  4CHI A;  4B3M H;  1EUD B;  5K3W A;  4DIM A;  3AG3 B;  4HNV A;  1XQ8 A;  5LA6 F;  1Y14 B;  2HVK C;  2Y69 B;  1Z2O X;  2D3O W;  1KJ8 A;  3KAJ A;  3ZN0 A;  2Q0A A;  4MV9 A;  2ZE5 A;  3RFR A;  4DV1 H;  5D1O B;  4UCU A;  2HGX A;  4A3M G;  2UXD O;  4FPP A;  2CDY A;  4PHZ A;  4I55 F;  3K3W A;  4DO2 A;  4Q20 A;  1S76 D;  2YZG A;  4FM9 A;  4GX0 A;  4WFG A;  1Q90 D;  2RDC A;  3ABK C;  2L35 A;  2KSD A;  3AG1 C;  1MZE A;  2JRI A;  3ZHT A;  4O7W A;  5GW7 A;  5IYC O;  3T1Y B;  4RB0 A;  4FS2 A;  1I2K A;  5EIB D;  4WFE A;  2J9G A;  4O4L F;  5FLM G;  5KHH A;  2NU6 B;  3N2G B;  1GYF A;  1TVK A;  3CB2 A;  1HNX B;  3RB0 A;  1W59 A;  1YVW A;  1Z2P X;  3TCU A;  2LQT A;  4JI1 O;  2YS8 A;  4TQF A;  5JUM A;  1RJR A;  5KFP A;  2RDJ A;  1SQB H;  2LFR A;  3E89 A;  2Q7H A;  2H8P C;  2EJ3 A;  3HKC A;  2HIX A;  4K6N A;  1GN6 A;  1OCC B;  4AQY B;  4DR4 H;  2BOC C;  1N33 O;  1VAJ A;  4ECV A;  4F4X A;  4YHH H;  2AU0 A;  3G6Y A;  1S77 D;  2IP4 A;  3BHP A;  1EN5 A;  4UFZ A;  5CR5 A;  4YJ2 A;  1PNM A;  3PW7 A;  1WJZ A;  2UUA O;  4J0M A;  1UFI A;  2YWV A;  2R9I A;  3N2K A;  4NXN H;  1TAE A;  4NZO A;  3OSP A;  3J81 W;  3CMA V;  4EEQ A;  1UNN C;  3RYC A;  2CTP A;  5IYZ A;  4A3D G;  4DR5 O;  3MR6 A;  4DK0 A;  1K92 A;  1RYR A;  2WA3 A;  4FZ1 A;  3E35 A;  4RNN A;  4RNM A;  4DV3 H;  1OCZ B;  3ABT A;  1WA8 B;  2ADP A;  2P4V A;  4RB3 C;  3RUP A;  2ZIN A;  3V6J A;  4W4K A;  5J9P C;  3OUU A;  5KG3 A;  5KT3 A;  2YYA A;  5LMN H;  4ZI7 B;  2HJD A;  5KHJ A;  1AIL A;  4A3B G;  5EIB C;  1K5Q A;  2YL2 A;  1R3K C;  3PW4 A;  3MJF A;  2ODM A;  4TUY B;  2YXL A;  3RJ0 A;  2F43 G;  2G38 A;  2JA8 G;  4O7Z A;  1NTK H;  2M05 A;  2IJI A;  1M6V A;  4GUN A;  4LFC B;  2CNU A;  1I2L A;  5AG2 A;  2XC9 A;  5LL6 Y;  2RGR A;  2W6I G;  2YEV A;  3JAT A;  1CPY A;  3T1H O;  3IFX A;  2AGO A;  1XRE A;  3ZN1 A;  3JZ6 A;  3PJS K;  4O2A B;  4WBN A;  2DLN A;  3V6H A;  4OGQ B;  5KFF A;  2DWE C;  4DL6 A;  4B3R O;  3AG3 C;  5IYD G;  4I9Q A;  1UC9 A;  5C1O A;  2W6J G;  2QKC A;  2Y0S E;  4J11 A;  4F4L A;  1BL8 A;  4TM5 A;  1EZV H;  4J9O A;  1PX2 A;  5ITZ A;  4I50 A;  3R65 A;  3TET A;  2HJF C;  4XX0 B;  4R8U B;  1IXM A;  2P4K A;  4DV6 H;  2NNU A;  2W70 A;  5BZB A;  1VQ6 V;  4MV4 A;  1G4Y B;  3VQY A;  2PYL A;  2FE3 A;  4A3C G;  3ETG A;  3GWO A;  3KKY A;  2HGS A;  3LWB A;  5CB4 F;  1NH2 B;  4LF5 H;  4OX9 H;  1KJ9 A;  3OTF A;  1K8A W;  4ZQI A;  2ZE6 A;  3K3V A;  1IX9 A;  2EJ2 A;  1Q6U A;  3H1L H;  5FD6 A;  4JI0 H;  2OWO A;  2VOB A;  2YZM A;  3OE7 G;  5BR8 O;  1XNR H;  4KL1 A;  1UJW B;  1I0H A;  3M7M X;  3W1G A;  3G6X A;  4K0K O;  1JFF A;  2EJR A;  1AR5 A;  3Q4H B;  4PDV A;  2OLS A;  3I12 A;  4J80 A;  2Y0I A;  3EPG A;  1VQ9 V;  2ZXW B;  4JYA H;  3OUS A;  5D1P A;  3VPC A;  2VRZ A;  2GDS A;  1SQG A;  4GLW A;  4PA6 A;  1OCC C;  5BPF A;  3A0H Z;  2V59 A;  5JVD A;  1Q6I A;  3N6R A;  5EOY A;  5LL6 b;  5LHG A;  1FPO A;  4R50 A;  4YR2 A;  2XTA A;  4PA7 A;  2V4Q A;  1WB8 A;  2A7W A;  2Z5U A;  3BY6 A;  4TV8 A;  1JLL B;  4JV5 O;  5IYC G;  3E22 B;  5J2U F;  5FPO A;  4QWC A;  5KFQ A;  2DYS B;  2QM7 A;  4M0J A;  1NH2 D;  4DRF A;  2CAZ C;  2ZDG A;  1N34 B;  1BNC A;  1Y76 A;  4YP3 A;  2QWR B;  4X1I B;  3MAQ A;  4TV9 F;  1XMO H;  2IBK A;  4FBT A;  1Z2G A;  1JJO A;  1IBK O;  4HZ3 A;  1OCZ C;  3B8M A;  4IYH A;  2VPQ A;  3GIL A;  1JVM A;  1EYZ A;  1J5E H;  2L6L A;  1DV1 A;  3VMM A;  1WH2 A;  2YXY A;  2IH3 C;  1OCO B;  1A0I A;  1EUC B;  1ZL8 B;  5KFZ A;  1H8H G;  3JD3 A;  4F4W A;  2UXD B;  3EHB B;  1OV9 A;  4IGG A;  2QGN A;  4P2Z A;  5IJ0 A;  5A2Q N;  1SER A;  2FPG B;  2WYO A;  3T2M A;  2UUC O;  2WLI A;  4HYK A;  1RM1 B;  2IW5 A;  1P84 F;  4UCR A;  4IIJ A;  5B66 Z;  2PMZ E;  2V9W A;  1ULZ A;  2EJ0 A;  4RUE A;  1XBL A;  1EKV A;  2WLM A;  5FNV F;  3SYP A;  4DL5 A;  3LML A;  3J80 W;  4EEY A;  2X0L A;  3JSL A;  1ZTE A;  3K58 A;  3GV7 B;  2R8J A;  3BFR A;  5KFK A;  4Q4D A;  1NKD A;  3G6B A;  3JCZ A;  3SE7 A;  2W9C A;  1F7Y A;  3ORQ A;  3K79 A;  3TXQ A;  3UZB A;  4C7U A;  3G6E V;  4BWS C;  4IRC A;  3TIN A;  1HWY A;  3DXR B;  4E2L A;  1K83 A;  1N33 B;  2MK3 A;  4MAM A;  3LDD A;  2VUM A;  1TVK B;  2P90 A;  1AI5 A;  5IY5 B;  1S9F A;  1MZB A;  2F1M A;  2UUA B;  2FPP B;  4IHJ F;  3PZP A;  2Y48 A;  1US6 A;  2CTW A;  4Q0Y A;  2ASD A;  4DR5 B;  2CK3 G;  4MA0 A;  4I4T A;  3HKC B;  4BY1 G;  3E8B A;  4EGQ A;  1SA0 A;  2QJ1 A;  3W7T A;  4ECR A;  3JD0 A;  2ZXW C;  2W6Z A;  1V4Y A;  1VF5 B;  4CH4 A;  4RO2 A;  3VQW A;  2AGA A;  4YAK B;  2ITD C;  5KFY A;  4J9N A;  4YJ2 B;  2XCP A;  2BSK B;  5CBH A;  3T4Z A;  3G8C A;  1VQ8 V;  4QIW E;  4MV3 A;  5IYZ B;  3HOU G;  4PA3 A;  4P9O A;  5CA1 F;  2DYS C;  2JVD A;  2LFS A;  3JAK A;  4W4L A;  4P30 A;  2LP7 A;  4O4J A;  4JTD B;  3AK2 A;  3LDE A;  3T1H B;  4ETS A;  1QBZ A;  1TUE B;  2B63 A;  4DR1 H;  3M99 B;  3STZ C;  4B3R B;  1WP7 A;  4DQN A;  2ZE8 A;  3OEE G;  4JI3 O;  5D8D A;  4A3I G;  3WG7 C;  3EYY A;  3T9F A;  1FXH A;  4J10 A;  4JZG A;  3OT7 A;  4QPJ A;  3NC0 B;  2IMW P;  1Y67 A;  3CRM A;  3T5H A;  2ZM6 H;  4TT3 G;  2XCA A;  4B3T O;  3QWU A;  3VPD A;  4PI0 A;  2CGN A;  2YEV B;  3OM3 B;  5KFN A;  1E4E A;  3WB0 A;  1NT2 B;  2DAA A;  1RM1 C;  4LF4 O;  2IJH A;  1K1Q A;  3APO A;  3OTO H;  1WPX A;  2W6O A;  1O9G A;  1S72 V;  1HW7 A;  1R6K A;  1VQK V;  5ITZ B;  5BR8 B;  3K0G A;  1G6U A;  5J2T A;  5CA0 A;  2FMA A;  4EBC A;  4GKK H;  4K0K B;  2COJ A;  1Q3E A;  1WRV A;  1XNQ O;  4ZI7 F;  4UCT A;  3MWD A;  2XOK G;  1H2N A;  1SQP H;  3FD9 A;  2Q69 A;  1P8L A;  3TEK A;  2IJJ A;  3K5M A;  2GQS A;  4G28 B;  5C8Y A;  4PDR A;  3TW7 A;  5KFS A;  1F4M A;  4X65 O;  5KMG A;  4LF8 H;  1RP3 B;  1K9M W;  2QWN B;  3CPW U;  2JDI G;  5IY5 C;  4JV5 B;  4JI2 H;  5I60 A;  1R9T A;  2IA6 A;  2UUB H;  1JFF B;  1TWF A;  4X62 H;  4O2A F;  4DR3 O;  2GLT A;  2JA6 A;  3F7Y C;  1C3O A;  1AI6 A;  1N32 H;  5DM6 V;  3IAY A;  1WR2 A;  1SEI A;  4A3J G;  4Y8V B;  3KHL A;  2ZKO A;  4YJ3 F;  4OPH A;  5JVD B;  3KZI Z;  2Q5Z A;  2YCH A;  4MVZ A;  2HKO A;  3V4S A;  5KFD A;  4NYK A;  1KBL A;  4TV8 B;  4WD3 A;  1B3Q A;  4ICG A;  4LF9 H;  4RUC A;  4JAU A;  5LMU O;  5KFV A;  4B3S H;  1THZ A;  2E3C A;  2QR4 A;  3RIZ A;  1KJI A;  4GX2 A;  1PPJ H;  1IBL H;  1Y76 B;  2UUC B;  1KMI Z;  3CS5 A;  4KXR A;  1K97 A;  4PJ0 Z;  3PW5 A;  2W6P A;  1M1K W;  3K04 A;  1KJJ A;  4PZ6 A;  3M9O B;  5B5E Z;  2VUG A;  3EXA A;  3J81 N;  1LNQ A;  4ECS A;  1C30 A;  3S24 A;  1SQQ H;  1YEW A;  2DPI A;  2ATK C;  4FE2 A;  4UB8 Z;  4X64 H;  1D5A A;  1GTO A;  1DAA A;  1P16 A;  2ZNI A;  3OW2 U;  1S68 A;  4HNA A;  4DR6 H;  2PGG A;  1BT8 A;  4UCV A;  3RYF A;  1I7L A;  1CKM A;  5EBW C;  2QWP B;  1KT8 A;  4CC6 A;  3Q2O A;  2Q73 A;  3KRE A;  4I0X A;  3A2F A;  4L87 A;  4CH5 A;  1VQO V;  2XCL A;  1GN4 A;  2M7W A;  3T1C A;  1TWC A;  3Q8P B;  4IIJ B;  3SPH A;  4K35 A;  4TSF G;  5BMV A;  5B3S B;  4O4I F;  4JI7 O;  1NBM G;  3PFF A;  4JZ2 A;  2JJ1 G;  3Q8Q B;  3L71 H;  4ECX A;  1OCR B;  4LH7 A;  1KB9 F;  2A1H A;  5CN0 A;  4DAA A;  1N0N A;  4U3J A;  2ODT X;  2W9C B;  3ASN B;  4FLZ A;  4TQD A;  2ZDH A;  4J9K A;  2BR0 A;  1GO3 F;  2W6M A;  2EIN B;  4BBR G;  5LGU A;  5IJ9 A;  5L3C A;  5BPH A;  2JJ2 G;  5A2Q W;  4DV5 O;  3CSW A;  2QM4 A;  3WU2 Z;  5KHI A;  4O4H A;  4XZ3 B;  4DUY O;  4PA9 A;  3U0G A;  4GC6 A;  4X9Q A;  2JK5 C;  4J9R A;  3ABM B;  1AJP A;  4J41 A;  3UO3 A;  4B3M O;  2CE4 A;  3BQ1 A;  3GJX B;  4EKW A;  4GCZ A;  2BQR A;  2B63 G;  1DIK A;  3VNN A;  4ED1 A;  4K8X A;  4I4T B;  4JI4 H;  3RB3 A;  4LFA O;  3GIP A;  2ILM A;  1FYJ A;  4YAJ B;  4H13 B;  3A0R A;  4DV1 O;  1SA0 B;  2C22 A;  1RPO A;  2VPS A;  5HNE A;  1GLV A;  1M9N A;  1A0G A;  4UV8 A;  4CKC A;  2Q2U A;  3W7S A;  5DGI A;  5CA3 A;  1B6S A;  3LSS A;  2OTJ V;  4PZ7 A;  2F23 A;  2W6Q A;  2H3O A;  1AP6 A;  1BJT A;  1HNW H;  4JI3 B;  1M7J A;  1EHI A;  1W96 A;  2HVS A;  1OBD A;  4TQS A;  1E1Q G;  1XUQ A;  4LFB H;  4LCU C;  2VWJ A;  5KFW A;  2J6S A;  3CCQ V;  3LNN A;  4MVU A;  1M93 A;  2XAQ A;  3JAK B;  2FL4 A;  3T9B A;  3NUA A;  1X9N A;  2HHH O;  3CD6 V;  4FFR A;  4O4J B;  3U9T A;  2ZDQ A;  1N8R W;  1VEW A;  4BIZ A;  3ETH A;  5KFT A;  4X1K B;  5KAI Z;  3HOX G;  3DC6 A;  4LF4 B;  2KG7 A;  4H37 A;  3FB8 C;  4QGP A;  1VQ4 V;  1QVF U;  1BQZ A;  2CZG A;  4DR4 O;  5F9L A;  4IT5 A;  3L75 H;  3RAQ A;  1MSD A;  1P7B A;  1YZB A;  1SQX H;  3UT5 B;  4CMF A;  2CW8 A;  3LSQ A;  5KS8 A;  2RGV A;  3OMA B;  3PW0 A;  5DGH A;  2D2C B;  1BCC H;  2ALZ A;  1GK9 A;  2ZR3 A;  3I4M G;  1XNQ B;  4O7L A;  4NXN O;  2JEF A;  3PN1 A;  1E4E B;  5JWP A;  3H0G A;  2ZQM A;  4JAA A;  3GQC A;  4O83 A;  4O2B F;  2IU0 A;  1RYS A;  1IBM H;  4JGS A;  3N6X A;  2AHY A;  2CKZ B;  2OH2 A;  2JA6 G;  4X65 B;  2R8H A;  5LYJ A;  5B3S C;  1H2K A;  4DV3 O;  3O65 A;  5KX5 F;  3ICX A;  2YI8 A;  1NVP B;  4EYI B;  5J2T B;  5CA0 B;  1N0J A;  5KFE A;  1NR7 A;  3K06 A;  1GH6 A;  1ET0 A;  5LMN O;  3E5N A;  3KHH A;  4O3N A;  1JX4 A;  4NR1 A;  1QR9 A;  4DR3 B;  3FB7 C;  3ASN C;  1AB3 A;  1KEC A;  1TWG A;  1ZUQ A;  2EZO A;  4MTE A;  3QO5 A;  3K5L A;  1QLN A;  3Q8R B;  5GON F;  1BS3 A;  4HYO A;  1KC8 W;  5H9C A;  2V7Q G;  4CKE A;  3A0B Z;  1EN4 A;  3SPI A;  4EFE A;  4A3E G;  2HVR A;  2NLJ C;  2YRW A;  4RCN A;  3ABM C;  2R9R B;  5LMU B;  5I5X A;  4FGR A;  1L2Z A;  4XDK A;  1XHX A;  4UCO A;  1HNZ H;  1CP9 A;  1SZT A;  1YHQ V;  2QSA A;  1KBH A;  2FK3 A;  5KG1 A;  4JAV A;  3H9V A;  4ZHQ F;  4BAY A;  3MR2 A;  3GLK A;  4DV6 O;  4FU0 A;  5FPR A;  2YZL A;  4A2B A;  1W0K G;  1NR1 A;  1VS0 A;  3CJH A;  1NVP D;  3H20 A;  4HR7 A;  4LF5 O;  4OX9 O;  3CC2 V;  2CQY A;  1XMQ H;  3SJC C;  4O86 A;  4QPK A;  4RNO A;  2AZ0 A;  4AYB A;  2OYQ A;  1VQM V;  3OHB A;  2ABJ A;  2C2D A;  4O3R A;  2FLL A;  1VF7 A;  4JI0 O;  2W0X A;  1SCU B;  5E1A C;  1KUQ A;  1XNR O;  4FS1 A;  3HT5 A;  3TQ1 A;  1XHZ A;  2V58 A;  2X6B A;  3JAW A;  2NVX A;  2JA5 A;  5KFU A;  4QW8 A;  3NGD A;  3IC7 A;  2B1I A;  3OGC C;  3CXC U;  3H01 A;  4F4Y A;  1FJG H;  4JI7 B;  3JZI A;  4JYA O;  2GTS A;  3CSX A;  1XOU A;  2C35 B;  3K5I A;  5EWG A;  4YIP A;  4O7T A;  1S0V A;  4X66 H;  3OGI B;  5HV6 A;  4FVM A;  3AEI A;  4G3I A;  4J9Z B;  5EBL C;  2ZD9 A;  1B33 N;  4LFC H;  2CNV A;  4I0X B;  4DL3 A;  3ZHR A;  1HDJ A;  5LGT A;  1NQT A;  2E2I A;  1P49 A;  2HP8 A;  4LSA A;  2BCC H;  4DV5 B;  1RFY A;  2VQE H;  4ECU A;  5BMV B;  2SCU B;  3KAL A;  1OWT A;  4CE5 A;  4Q8F A;  3IGA C;  4DUY B;  3T4D A;  3DC5 A;  3T9C A;  4DV4 H;  3FAV B;  1IDS A;  3WFV A;  3I55 V;  1XMO O;  3ZBH A;  4DXW A;  4B3M B;  1D5N A;  1J5E O;  2Q4P A;  2RMK B;  5BWR A;  4U3J B;  1I50 A;  2FYU H;  1FVI A;  1J95 A;  1Y6X A;  5IJ9 B;  4LFA B;  4YIO A;  4DV1 B;  4C5C A;  3RGZ A;  1L1F A;  2Y4R A;  3LDC A;  4JI8 O;  1XEQ A;  3CCJ V;  1Q6H A;  4JI5 H;  4QNH B;  4JYB A;  2O57 A;  3VQV A;  2OIG A;  5BY1 A;  5LP6 A;  1YJ9 V;  5JQG A;  4N23 A;  3N41 B;  5KT6 A;  2IBZ H;  3UKM A;  3K57 A;  2ASL A;  5K1X A;  1DF5 A;  3L73 H;  4LBE C;  2GPS A;  2I80 A;  4IIJ F;  4EBD A;  1YF2 A;  2AQ4 A;  1JIH A;  2BTQ A;  1BHB A;  2HHF A;  3ORR A;  1K5S A;  4LNU A;  2R85 A;  5EC2 C;  3T54 A;  5DGA A;  2HHH B;  3CXH F;  1CEZ A;  1GRJ A;  5LHH A;  4Q44 A;  1S5H C;  2Y69 C;  3RYH B;  2I87 A;  1WCM A;  4QWE A;  3JAS A;  4Q43 A;  5KHK A;  3RF2 A;  4K3A A;  1TA8 A;  2ARH A;  3W5O A;  5DG8 A;  4I7Z B;  4DR4 B;  3N8D A;  4MV1 A;  3H0G G;  2PVP A;  1WAZ A;  2CFM A;  5CMU A;  3FB6 C;  1TUB B;  1IYD A;  4YY3 H;  4JYY A;  2FTK A;  2M6Y A;  3QNE A;  5KFH A;  4JTC B;  4NXN B;  4KHP H;  5LA6 A;  4AI8 A;  4JXU A;  1UPG A;  1O9H A;  3L74 H;  4XYL B;  3GII A;  3HKE A;  2DJV A;  4FIP C;  2O03 A;  2R87 A;  2UVU A;  1K4D C;  4JV1 A;  3RFC A;  4RQE A;  2KG7 B;  3HKB A;  3HB3 B;  4C2M A;  1AR1 B;  4IRK A;  4I4T F;  4DL2 A;  3HBL A;  4DV3 B;  4I55 A;  5DQI A;  2R93 A;  1Y1V G;  5B1A B;  5KFX A;  4WHX A;  1AN7 A;  1BGY H;  1U96 A;  1A9X A;  5LMN B;  5L1K A;  3RT3 C;  4QW9 A;  2LO1 A;  3HB9 A;  1RSO A;  2C2E A;  3MD0 A;  4Z1V A;  4LP8 A;  1JOY A;  3SYA A;  2NVY A;  2N74 A;  3WO1 A;  1BE3 H;  3VPB A;  3EPI A;  1WNS A;  2ZE7 A;  2ZNJ A;  5KFI A;  3SYO A;  4MVS A;  5JJN B;  5LYJ B;  3U9S A;  3HKD B;  3GV8 B;  3FDS A;  4G2K A;  3JAL A;  2XD4 A;  3TIG A;  5KG0 A;  3IN5 A;  4LF7 H;  1I5X A;  1VBG A;  2QA4 V;  2A79 B;  4UV9 A;  1SYX B;  2HG5 C;  1R73 A;  2J6T A;  3MHS C;  4DR1 O;  1IOW A;  2DPJ A;  4NXM H;  2ZIM A;  1B6Q A;  3TXS A;  5FD5 A;  1WP8 A;  1QNM A;  3L4K A;  3GTJ A;  2RCV A;  2UXB O;  2NU9 B;  2RDI A;  1CS0 A;  1YDX A;  2F4V H;  4DV6 B;  2ZM6 O;  2UUA H;  3BEH A;  3NBZ B;  3OR7 C;  4DYL A;  4LF5 B;  4OX9 B;  1AJN A;  2JA5 G;  2HFE C;  2P7T C;  4B08 A;  5FR9 A;  1TWA A;  4EBE A;  1GM8 A;  1UC8 A;  2DQ0 A;  1VBH A;  1M0T A;  5DN6 G;  4QE9 A;  4JI0 B;  2BTO A;  2GTA A;  3CC4 V;  5IDJ A;  4RQF A;  1I94 H;  3T5K A;  1ORQ C;  1BHA A;  4IZO A;  1XNR B;  1KC7 A;  3HPL C;  4DW1 A;  4PD4 F;  4GKK O;  4UUG A;  5J2T F;  2KQX A;  4ZIB A;  3O9O A;  3ETJ A;  5CBG A;  2BOB C;  1M57 B;  3QO8 A;  3R5F A;  1KP2 A;  3K5N A;  5L1L A;  2R7Z A;  4JI1 B;  4JYA B;  4DR2 H;  1H2L A;  3HXL A;  3K0D A;  5KG5 A;  2R8K A;  3QF7 A;  3V6K A;  4LF8 O;  3Q1K A;  3U54 A;  2PF4 E;  1VKZ A;  1DF4 A;  3OSN A;  1SF9 A;  1XI1 A;  4GLX A;  1AUX A;  5CAE B;  4JI2 O;  1QQC A;  2YID A;  2UUB O;  1T36 A;  4X62 O;  1N32 O;  1ZET A;  5BWW A;  2XAJ A;  3UYY A;  1S5J A;  3SDL A;  4E6N A;  2UXX A;  3ZHV A;  4QIW F;  1XMO B;  2EIL B;  5KT7 A;  4AHC A;  3OUF A;  5BWU A;  1J5E B;  4ZKI A;  2W71 A;  1K3E A;  2R7M A;  5B1A C;  4LC1 A;  2HDK A;  2XUM A;  4FLY A;  4EFB A;  4ASU G;  5CB4 A;  1EZJ A;  2XAF A;  5BYA A;  3HO8 A;  4LF9 O;  1HR0 H;  2PN1 A;  3CEB A;  2QE7 G;  3OAA G;  4B3S O;  3SYC A;  2BE3 A;  3ZRW A;  1I5Y A;  4JI6 O;  4JI8 B;  5JJJ B;  5KA5 A;  1GGO A;  1AR4 A;  3N2K B;  4U7O A;  2Q6A A;  2EIK B;  2IH1 C;  3RYC B;  1YXB A;  1GKF A;  2Q7G A;  1KD1 W;  4MS2 A;  3RGB A;  2N04 A;  4K0K H;  1WCM G;  5KFJ A;  2GBO A;  4MTF A;  1G1X B;  1MG1 A;  4DW0 A;  4FLV A;  3AW8 A;  4HNT A;  2R86 A;  3CME V;  4X64 O;  3AYH B;  4U6P A;  1R3J C;  4DR6 O;  1VQP V;  4FFK A;  1WPB A;  4Q6G A;  4CBC A;  2NN4 A;  3N44 B;  4PWQ A;  3LQS A;  2QM8 A;  5H2F Z;  3WB1 A;  2UU9 O;  5K2M A;  3ASO B;  1L8D A;  4I7H A;  1OCO C;  5EWF A;  2JEG A;  1JX9 A;  5J2U A;  4MTG A;  3MR3 A;  3H40 A;  2B5U A;  2COG A;  4FFB A;  4ECQ A;  2E76 B;  2LGW A;  3G80 A;  4J42 A;  1Q81 W;  3DTF A;  1H38 A;  3BAA A;  3JAT B;  4TV9 A;  4QSH A;  1RK5 A;  4WBN B;  4BIU A;  2HHF B;  3CCR V;  2R93 G;  2E5L H;  4TOI A;  1COW G;  3RTX A;  1FD9 A;  3EFF K;  1VF6 A;  4ABM A;  4RAY A;  1AVM A;  5IWA H;  3WWJ A;  2C28 A;  3JAS B;  5H80 A;  3MR5 A;  4MA5 A;  2AHZ A;  4I50 B;  4FLX A;  3BCC H;  5C44 G;  4JYC A;  2DOS A;  1M57 C;  3JD4 A;  2NU7 B;  5DLF A;  4DUZ H;  5FL7 G;  4JUZ A;  1FXK A;  5KFB A;  2P0A A;  1RPR A;  4O7V A;  3R5H A;  2B9Z A;  2WAQ A;  2UUC H;  3NR7 A;  2Q2T A;  4PDB A;  3UZO A;  5LA6 B;  4TUY F;  3B40 A;  3HKE B;  3L72 H;  2A0L A;  2X6C A;  5L1J A;  1FKA H;  1JMK C;  1FFT B;  1MAB G;  4JV2 A;  4MTX A;  4PV1 B;  5DED A;  1MA1 A;  4JI4 O;  4K8Z A;  1AI7 A;  3GID A;  4LSX A;  1KYO F;  3HKB B;  4O7N A;  3WO0 A;  1ENV A;  3T9E A;  4I55 B;  4A2A A;  3B4S A;  4FZ0 A;  2VQF H;  2W9B A;  4OXS A;  2EIL C;  4GX1 A;  1S0O A;  4JF3 A;  3FKI A;  1OBG A;  4ECZ A;  4DR1 B;  4FLU A;  3L9D A;  1A48 A;  1M56 B;  1IXB A;  1MOF A;  1IBK B;  1HNW O;  3MWM A;  3OMN B;  3PVX A;  5L3D A;  3RGX A;  5KUM A;  1ROP A;  2UXB B;  1JDB B;  5DQG A;  4FMT A;  3SPG A;  1JXL A;  4GX5 A;  5EYP A;  5I5S A;  4FBU A;  2ZM6 B;  2A3Q A;  3JAL B;  1XDN A;  3PR5 B;  5KG2 A;  2EIK C;  4RUA A;  1LUV A;  3GWK C;  1N36 H;  3U55 A;  3DGE A;  1QCE A;  3H4B A;  1N4C A;  2P22 C;  3OUZ A;  3CHX A;  3BQ2 A;  4FLW A;  3GB8 B;  4Z2W A;  4YQW A;  4DV7 H;  2R7Z G;  2COI A;  1M0W A;  3ETQ A;  3ML0 A;  1EZ1 A;  4GKK B;  2BQU A;  1GN3 A;  2FKL A;  3G4S V;  3ASO C;  4NYE A;  4DRX A;  2Y0P A;  3K59 A;  4O3P A;  3J7A K;  5IJ0 B;  3B2E E;  4F6R A;  5CA1 A;  1BQ0 A;  4UVA A;  1IBM O;  1HP8 A;  2R7L A;  3KAK A;  2WLI B;  2X6A A;  4G27 B;  5C93 A;  4RB1 A;  4NTY A;  4LF8 B;  3AG2 B;  3OFN G;  3X2Q B;  5CBF A;  1NI8 A;  4JI2 B;  3CQZ A;  5FJ8 G;  2YW2 A;  1PV0 A;  2XT9 A;  1V51 A;  1AUV A;  2YS7 A;  2UUB B;  3C3S A;  3K08 A;  4WFA V;  2W8L A;  1K33 A;  4X62 B;  4CS4 A;  1N32 B;  1PKX A;  3LUT B;  2Q0O C;  1ZWI C;  3H1I H;  2W6N A;  3QG5 A;  3PO2 G;  1Y74 A;  3CRC A;  2WAM A;  4FJC C;  1PNK A;  2GQR A;  2LGQ A;  2YZN A;  2QK4 A;  1VMG A;  4A93 G;  4HN2 A;  2QYZ A;  2EJ7 A;  4LF9 B;  1WN7 A;  2EX3 A;  5CM0 A;  3T5J A;  4EB6 A;  2CW7 A;  1FXV A;  5KHG A;  2QTS A;  4XDJ A;  4B3S B;  4Z1M G;  3LP8 A;  4BBS G;  4BW5 A;  4JI6 B;  1BZK A;  2LJ2 A;  5H6Q A;  1Q82 W;  4LF4 H;  2UXC H;  2PYJ A;  1HNZ O;  4J9S A;  2WLH A;  2P67 A;  4IRD A;  4IR9 A;  1LUW A;  1NS1 A;  2MCT A;  5KG4 A;  2R8G A;  1DLB A;  4L8J A;  1AP5 A;  3DF7 A;  2GUZ A;  1H2S B;  5CB4 B;  3HOV G;  4PDM A;  4J9Y B;  3GIK A;  2DMX A;  1XMQ O;  4X64 B;  3U10 A;  2HEP A;  1AI4 A;  1Y66 A;  1M56 C;  2YDE A;  4DR6 B;  3VOU A;  2KKW A;  3ZRW B;  3UO2 A;  3JYC A;  2FPI B;  1MNG A;  3BPZ A;  4GZR B;  4X65 H;  1R3L C;  4DV0 H;  4LWS A;  3I56 V;  2UU9 B;  2YIB D;  2DYR B;  1B6R A;  1NTZ H;  1YJN V;  5DMX A;  3FMA A;  1M90 W;  3EVK A;  4LF6 H;  4O2A A;  2FK1 A;  1QHT A;  4GKJ H;  2ZGI A;  4MV7 A;  2QF7 A;  3HKZ E;  4J9M A;  4ED6 A;  3T5L A;  1FJG O;  3G8D A;  4B3T B;  5EBM C;  3P30 A;  5L9X A;  2ETN A;  4X8A A;  3R23 A;  4YJ3 A;  4GC7 A;  4CMD A;  3QO7 A;  4AYB E;  4X66 O;  3JAM W;  4DR7 H;  4CH6 A;  3A8T A;  5LOV A;  2FLN A;  1Y4M A;  4YHH O;  5J2U B;  3AG7 A;  3LNM B;  4X89 A;  3SJA C;  5B1N A;  4FFB B;  1V9P A;  2JS5 A;  1DGS A;  4X1Y A;  2VQE O;  2UVR A;  2EZP A;  3QZ8 A;  4DV2 H;  4QWD A;  4YJ2 F;  1R3I C;  5GTH Z;  4DV4 O;  4O7S A;  5BYB A;  3CRR A;  4IR1 A;  3S3X A;  4TV9 B;  2DE0 X;  5BWV A;  2OCH A;  5IYZ F;  4TQR A;  3AG2 C;  4EQ5 A;  3X2Q C;  4MV6 A;  4H44 B;  2JS3 A;  4PEL A;  3Q8S B;  2PY5 A;  3FKI G;  1D2D A;  3F7V C;  2WWW A;  4JI4 B;  5I5W A;  5EZY A;  4CZZ A;  2WLL A;  5I5Y A;  1OCR C;  3CCE V;  5C3E G;  3T1Y H;  2C00 A;  1E4G T;  4JI5 O;  4CKB A;  3WB2 A;  1FXK B;  2W57 A;  4YXW G;  2QWO B;  2HJW A;  3GTG A;  1B04 A;  2QWQ B;  1E4F T;  2UXN A;  2EIN C;  3FKS G;  4N21 A;  3RAX A;  3RBD A;  5C8Y B;  1Y1V A;  3CCU V;  5JVL A;  5KFR A;  2CGO A;  4LH6 A;  1HNW B;  1HNX H;  2LW7 A;  3H1K H;  5KMG B;  4O4I A;  1KTA A;  2V5A A;  2ATL A;  1BSM A;  2YC0 A;  3D8C A;  2QEX V;  2XGP A;  4TWK A;  3TGU H;  1I08 A;  2PI4 A;  2Q7D A;  4WBN F;  4A3L G;  1GN2 A;  2DWD C;  2I8C A;  1K1S A;  3B09 A;  2W9B B;  2R70 A;  4AQY H;  1GMG A;  4QE7 A;  2JGD A;  1SS3 A;  5I5V A;  3KTM A;  4RWU A;  1SQV H;  3T9A A;  1MZF A;  1ZL8 A;  4O3Q A;  4I50 F;  2JEJ A;  4IYI A;  1X59 A;  4DK1 A;  3ZIA G;  2WLN A;  1ARO P;  1CKN A;  3HKZ A;  4APM A;  3D3Q A;  4MTD A;  4YY3 O;  3H4D A;  4DUY H;  3VOT A;  4IAJ A;  2R72 A;  5EYP B;  2W7P A;  2EBO A;  2XHB A;  3C0F B;  4KHP O;  4YR0 A;  2DYR C;  4WFH A;  1Q86 W;  4O7Y A;  3ZMS A;  1I1M A;  4B7E A;  1PL4 A;  2FB9 A;  2GHY A;  2W8K A;  1IBM B;  4PDL A;  3L2P A;  4LFA H;  1DV2 A;  3CP1 A;  4PZ8 A;  4QWA A;  3RYI A;  3LUL A;  1BMF G;  3FYI B;  2V1D A;  3ABL B;  3ETD A;  1OHH G;  4EG0 A;  2HGW A;  4HNA B;  2P6J A;  4MVO A;  4DRX B;  3RYF B;  2X5R A;  1JCH A;  2YUA A;  3DXR A;  5JVD F;  4A5U B;  1PNL A;  1T3N A;  2A06 H;  4F6R B;  5CA1 B;  4FM1 A;  4U7N A;  2AW9 A;  1Q8I A;  3OR6 C;  3GV5 B;  4XYM B;  4TV8 F;  1L0N H;  2GSM B;  4O82 A;  4BXX G;  4LF7 O;  1X4T A;  2E2H A;  2HHH H;  3W1B A;  1Z5V A;  4NTW A;  3ABU A;  1GM9 A;  1QVG U;  2OT5 A;  1W2B U;  3OEH G;  2WTF A;  1I6U A;  1VF6 C;  1EKF A;  3JCU Z;  5DEC A;  2NUA B;  4NXM O;  4ED7 A;  4FK5 C;  4HBN A;  1HNZ B;  3GTK A;  2JA7 A;  1YI2 V;  5LXT A;  3CCV V;  3FB5 C;  2DAB A;  4NZN A;  2F4V O;  3TY8 A;  1Y74 B;  2BSK A;  1FXK C;  1A32 A;  3L70 H;  2QKA A;  3E8H A;  5DIS C;  4O4H B;  2JEI A;  1XMQ B;  4ECY A;  3GTO A;  3C3T A;  4O2B A;  4EB6 B;  1JPX A;  1XK5 A;  4RU9 A;  4RAI A;  1S03 G;  4O84 A;  4D7T A;  2ITC C;  4FFM A;  5E79 Z;  5I47 A;  1I94 O;  5KX5 A;  3ZHS A;  3M9M B;  1R6T A;  4J9L A;  3JRW A;  3G67 A;  4FFP A;  3W7W A;  3CCS V;  2GUZ B;  3ZCC A;  1YIT V;  1KP3 A;  4KUM A;  1RJQ A;  2AGQ A;  5JH7 A;  3TII A;  2YU9 A;  1KQS U;  1FJG B;  4F6E A;  2E74 B;  4DR2 O;  1OJH A;  1KKC A;  1VQN V;  1DK1 A;  4MT8 A;  4RAZ A;  5EC1 C;  5GON A;  1K7D A;  3RVZ A;  4X66 B;  4YBZ B;  4J7Z A;  1JDE A;  2YRX A;  3UQ8 A;  2MW2 B;  2ZIO A;  2BQ3 A;  4LWS B;  3JZF A;  3KYH C;  1MMM A;  4ME6 A;  2FK2 A;  2GV9 A;  3BAB A;  4Q4C A;  5B1O A;  4ZOL A;  4YHH B;  4R7C A;  2FB5 A;  3AG4 B;  1SES A;  1M5I A;  5JCO A;  1N34 H;  2VQE B;  5IT9 N;  1E79 G;  3ZHU A;  3TY9 A;  4A3G G;  4DV4 B;  2ZCE A;  2VA2 A;  1Y1W A;  3CC7 V;  3RV4 A;  4ZHQ A;  1V54 B;  4YJ3 B;  4HQ6 A;  4H0L B;  1CKO A;  1XIL A;  2JEX A;  2WLK A;  2V4R A;  4TVI A;  3ZRX A;  2DW4 A;  3ABL C;  5L3E A;  1KKD A;  5LOV B;  5DGB A;  2UXD H;  2Y4T A;  3CWB H;  1I7F A;  3M9N B;  2K9P A;  1HR0 O;  4WCE V;  4EYH B;  1NTM H;  2XAH A;  3K9A A;  5TIS Z;  2DZD A;  4X20 A;  1VAR A;  2X7R B;  4NLG A;  4X1Y B;  2V4D A;  3ZMU A;  1VQL V;  3TK1 A;  5F2V O;  3JAR A;  5B1B B;  4JI5 B;  3P3N A;  4O4L A;  2ASJ A;  5IYB O;  4ED8 A;  3CVZ A;  2R92 A;  2ZR2 A;  2HVJ C;  1GSO A;  3KHG A;  4I9W A;  5KUK A;  1S0N A;  3GTQ A;  3QFF A;  2WA4 A;  1ZX3 A;  2Q8V A;  1N56 A;  1EBO A;  1OZ0 A;  3LSU A;  3BA8 A;  4F50 A;  4MSW C;  4JI1 H;  4O4J F;  3ZMV A;  1FFX A;  5EZY B;  2WLL B;  1A3G A;  4LR3 A;  2ADQ B;  2CH7 A;  3IC9 A;  3UM7 A;  1PD3 A;  1G8M A;  1H8E G;  3K9S A;  5KT5 A;  4CC5 A;  2KSW A;  1XDC A;  2Z3Y A;  1N33 H;  3CRQ A;  4NB5 A;  5EWE A;  4FFN A;  3CCL V;  3M8A A;  5JJE B;  4J9P A;  4HNU A;  3KXY T;  1CQI B;  4O4I B;  3RBZ A;  2PZS A;  5HBR B;  3D36 A;  4YY3 B;  2ZDI A;  1S97 A;  4Q8E A;  2PBZ A;  1P4R A;  4E4E A;  3JD2 A;  5L1I A;  1K4C C;  3ZS8 C;  2E5L O;  4DR5 H;  1H2G A;  3OTO O;  4KHP B;  1U97 A;  2OCC B;  5IWA O;  2AZ2 A;  3QZ7 A;  4RB2 C;  2JGD B;  2FKX A;  3E86 A;  2Q7E A;  3BG5 A;  3APQ A;  3H1J H;  3MWE A;  5T14 A;  2FLP A;  2J6U A;  3WG7 B;  2UVV A;  4CH3 A;  3MFI A;  1S5L Z;  4BW9 A;  3WWI A;  5K1P A;  1WSC A;  5CA0 F;  3BJY A;  1JR9 A;  3NBY B;  4FLT A;  2VQD A;  4DUZ O;  1CKN B;  2VS0 A;  3FFQ A;  5BXZ A;  4JI8 H;  3GTP A;  3CJH B;  2Y0S A;  1S10 A;  2YIB A;  1K34 A;  2OTL V;  2AXT Z;  5C8Y F;  3OD4 A;  3CRA A;  5D5Q A;  1FKA O;  4U7C A;  4AIL C;  3AG4 C;  3KG2 A;  4RZQ A;  3ZHQ A;  4YR3 A;  1W0J G;  1VIB A;  3ZED A;  4O3S A;  5L3B A;  3L4J A;  3CX5 F;  4MVR A;  3T1H H;  3JAW B;  2JA7 G;  4YB8 B;  3RYI B;  2VQF O;  4UVC A;  3AK3 A;  4LF7 B;  2XND G;  4B3R H;  2KB1 A;  1V54 C;  3CYO A;  2YS6 A;  4CS3 A;  4ECT A;  4P9P A;  1ZSP A;  3GIJ A;  2E75 B;  2WAQ E;  3WWH A;  4IL6 Z;  3GTL A;  4PA4 A;  5KFM A;  4NXM B;  3BVO A;  1Q7Y W;  3DTG A;  3G71 V;  1I7N A;  4B7K A;  4D6T H;  1Z2N X;  1KJQ A;  1EN6 A;  4JV0 A;  1S3J A;  3GTM A;  1YTF B;  3AK1 A;  3JAM N;  2F4V B;  5B1B C;  2ZJT A;  5C4X G;  2B1G A;  3TJT A;  4LMY A;  1QLE B;  3JD1 A;  2AGP A;  3F5T A;  3K5O A;  3RBE A;  1N36 O;  1IBL O;  1VQ5 V;  4UVB A;  3RV3 A;  2R8I A;  1TGO A;  2W7O A;  5BR8 H;  3ZRV A;  3PO3 G;  3CCM V;  1E1R G;  1JJ2 U;  4DV7 O;  2R6F A;  2WB1 E;  1GM7 A;  1I94 B;  2R7K A;  3T7A A;  1BGW A;  5LXT B;  4MW8 A;  4J9Q A;  2JIZ G;  5EK0 A;  3JRX A;  5LHI A;  2HLD G;  5D5P A;  2PUS A;  3DSQ A;  4BIO A;  1LR1 A;  1V55 B;  1P7G A;  4O2B B;  4DR2 B;  1JA8 A;  3TY5 A;  4E4T A;  2CTR A;  1XL6 A;  5LP6 B;  5DAA A;  4BWA A;  1QR8 A;  5JQG B;  4FM0 A;  4JV5 H;  1CQJ B;  1TWH A;  1ZAU A;  1RK6 A;  1Y1W G;  3HOY G;  5KX5 B;  5H6R A;  5IYB G;  1YTF D;  2UVW A;  1IUR A;  5DG7 A;  4GT1 A;  2XIG A;  1B06 A;  1SQF A;  2BTQ B;  5BMV F;  3K5H A;  1Q43 A;  3GDE A;  2X0S A;  4X1K A;  3BRC A;  4O81 A;  4QJF A;  3ZX6 A;  4LNU B;  5JH7 B;  3G6V A;  2OCC C;  1VP7 A;  4XBF A;  4M7E A;  5FLX N;  1IBK H;  3OHA A;  2PMZ A;  3K3P A;  1T94 A;  3UT5 A;  5KFL A;  1MSW D;  2EUL A;  5GON B;  2HR3 A;  2UXB H;  3BQ0 A;  2EIY A;  3B77 A;  1RJP A;  3SI8 A;  2PTM A;  5HFL A;  1I3Q A;  4GYC B;  2R92 G;  1T5E A;  4ZOL B;  5HFM A;  2PI5 A;  1SRY A;  4WFB V;  1HR0 B;  4O4H F;  2C2A A;  4IWX A;  1F51 A;  4FFL A;  3I4N G;  1WLE A;  2UXC O;  4D7S A;  3BA9 A;  2QKS A;  1PK8 A;  3RN4 A;  4CS2 A;  2K1E A;  2EIJ B;  4MV8 A;  3JSN A;  3U11 A;  4ZHQ B;  5FNV A;  3ZMT A;  2XAG A;  1CE8 A;  5KG7 A;  1VQ7 V;  3ETE A;  1SC5 B;  5C5J A;  4R6Z A;  5LGN A;  1KU9 A;  2WDT A;  2C2R A;  3B8N A;  2GPW A;  1SET A;  2CTQ A;  4X20 B;  4A3F G;  5L3G A;  3VBB A;  4JPR A;  4ECW A;  4HAM A;  4MVM A;  3THO A;  4DV0 O;  3JAR B;  4U3F H;  2WB1 A;  4NKG B;  1RSO B;  2XAS A;  4O4L B;  4UUJ C;  3D3I A;  1NJI W;  3N40 P;  4FM2 A;  5IT9 W;  4LFB O;  1IZ3 A;  5IP7 G;  1IVS A;  4NVP A;  1M4U A;  4LF6 O;  2IU3 A;  4UCS A;  1Z5W A;  1DTO A;  1QLE C;  2QTO A;  4IHJ A;  4GKJ O;  3T99 A;  2YIA A;  1ZLZ A;  2CNQ A;  4F4Z A;  5KA6 A;  1YJW V;  3MFH A;  4A3K G;  5DQH A;  5C1P A;  2F95 B;  2YSU B;  2VR1 A;  4QIW A;  1L0L H;  1FFX B;  2E5L B;  4DR7 O;  3SJB C;  1I1K A;  2CH7 B;  3OTO B;  4PI2 A;  5IWA B;  2RJZ A;  2XGQ A;  3RB6 A;  5D1O A;  5I5T A;  3P3P A;  4MTO A;  3P32 A;  3N42 B;  5LOV F;  2EIM B;  2WLJ A;  4IWY A;  4DV2 O;  5KG6 A;  3QQM A;  5IP9 G;  4DUZ B;  4JI6 H;  3H3V H;  1V55 C;  3R9R A;  4RZR A;  4ED0 A;  4MW3 A;  4RUF A;  2P5O A;  2YI9 A;  5LP6 C;  3E83 A;  3R5X A;  2NR5 A;  4KP4 A;  3WNZ A;  5KT4 A;  3N2G A;  4FFO A;  5IE9 A;  3STL C;  2DWC A;  3SPC A;  5LYJ F;  1BXR A;  1W93 A;  3HOW G;  1JKJ B;  2A9H A;  3AX6 A;  3T9D A;  3TQT A;  1PM9 A;  4I5S A;  4Q45 A;  5EZY F;  2VQF B;  1SKV A;  3T1Y O;  5DLG A;  2VUM G;  1S0M A;  4UB6 Z;  3KHR A;  2UU9 H;  3HOZ G;  1G2W A;  4JI3 H;  5L3F A;  1FAF A;  2N05 A;  4NTX A;  3RR5 A;  5KT2 A;  4BR6 A;  2DIK A;  5KFA A;  2R84 A;  1HNX O;  4NZM A;  3N43 B;  1R6N A;  2FJZ A;  4ED3 A;  5LBQ A;  3R66 A;  4OPA A;  1SFO A;  3IG0 A;  1GSA A;  4B3T H;  2QDO A;  5JCO C;  2F66 C;  3FAV A;  2VA3 A;  2Q9L A;  2WE6 A;  4M9U A;  1ZHQ A;  4J7J A;  1ZQ7 A;  2H94 A;  2EIJ C;  5KAF Z;  4PBC A;  1URF A;  4O7R A;  4DL7 A;  3GIQ A;  3PR4 A;  4AQY O;  2F93 B;  1N36 B;  4WFF A;  1YCI A;  4XDL A;  1WA8 A;  1IBL B;  4O3O A;  1EFR G;  3SPJ A;  3RW0 A;  5KFG A;  3QTC A;  2WPD G;  4DV7 B;  1WB7 A;  1GSH A;  4H33 A;  2VWK A;  4ZI7 A;  4JAS A;  1XNQ H;  1N48 A;  3RWR D;  2YIC A;  3BAC A;  5BWX A;  3HR0 A;  1PP9 H;  2YXH A;  1KEE A;  1YIJ V;  1AJQ A;  1K73 W;  4TUY A;  1EKP A;  3SR2 C;  5E25 A;  1NZ6 A;  5KFO A;  3E8G A;  1GO3 E;  4C5A A;  5KKN B;  3GVM A;  3MDS A;  1H2M A;  1CXZ B;  5EDW A;  3SGI A;  3K03 A;  2OIE A;  4DR3 H;  1F4N A;  2HVQ A;  5F9N A;  1XL4 A;  3M4I A;  3RYH A;  4EGJ A;  1ZHS A;  5A9G A;  1O75 A;  1GAX A;  1IOV A;  3SNO A;  4R8U A;  1YSC A;  2IJK A;  4DL4 A;  3GB7 C;  3ABK B;  3AG1 B;  1R1B A;  3E8F A;  1F23 A;  4LFC O;  2EIM C;  2W0F C;  2ZT9 B;  2HG8 A;  1TUB A;  3N27 A;  2JGU A;  4ZBM A;  3MHH C;  5CE8 A;  3D36 C;  5LMU H;  1I1L A;  2ZDI C;  1NU1 H;  3F8N A;  2Q68 A;  3RVY A;  1JQ0 A;  2W9A A;  3RB4 A;  3NXS A;  3E2E A;  3VQX A;  4JTA B;  4QJF B;  4WF9 V;  3VA7 A;  5DG9 A;  2Z02 A;  1SZX A;  2UXC B;  2DN9 A;  4DLK A;  3Q4H A;  3F5W C;  3ZMZ A;  1EM1 A;  5I5U A;  2FP4 B;  5LXT F;  2WSS G;  3OMI B;  3CEI A; 
#chains in the Genus database with same CATH homology
 4B3S H;  5JH7 A;  2E3C A;  1FJG B;  3RIZ A;  1S5J A;  4E6N A;  1IBL H;  4RAZ A;  1XMO B;  5GON A;  2UUC B;  1KMI Z;  4AHC A;  4X66 B;  3E22 A;  4DV0 B;  3UQ8 A;  2ZIO A;  1J5E B;  4PZ6 A;  3HKD A;  2VUG A;  3KYH C;  2IM9 A;  2GV9 A;  3BAB A;  5FNV B;  4EFB A;  5CB4 A;  4FLY A;  4R7R A;  4LFB B;  4ZOL A;  4YHH B;  1YEW A;  3S24 A;  5FLX W;  4LF6 B;  1HR0 H;  4X64 H;  4JI7 H;  1D5A A;  1M5I A;  1P16 A;  3U0Z A;  2ZNI A;  5JCO A;  4GKJ B;  4HNA A;  2VQE B;  4X1I A;  1S68 A;  2PGG A;  2HIV A;  1N34 H;  4DR6 H;  4UCV A;  5JJJ B;  4JI8 B;  3TY9 A;  3RYF A;  3N2K B;  4DV4 B;  2ZCE A;  1CKM A;  4CC6 A;  2RQ6 A;  4ZHQ A;  4YJ3 B;  3RYC B;  2Q7G A;  3A2F A;  4DR7 B;  1CKO A;  4CH5 A;  1Q5O A;  3RGB A;  4K0K H;  4IIJ B;  4DV5 H;  5LOV B;  5BMV A;  4FLV A;  2UXD H;  1I7F A;  4X20 A;  2R9A A;  4IHJ B;  2V4D A;  4X1Y B;  1WPB A;  4Q6G A;  4DV2 B;  4B3M H;  3N44 B;  4LH7 A;  3JAR A;  4JI5 B;  3WB1 A;  1L8D A;  1XQ8 A;  4O4L A;  4U3J A;  4I7H A;  4FLZ A;  4TQD A;  5J2U A;  3CVZ A;  1Z2O X;  3KAJ A;  4FFB A;  5IJ9 A;  2Q0A A;  4MV9 A;  5A2Q W;  3RFR A;  4DV1 H;  5D1O B;  2QM4 A;  4UCU A;  5KHI A;  4O4H A;  4PHZ A;  3BA8 A;  3BAA A;  3JAT B;  4JI1 H;  4TV9 A;  1FFX A;  4FM9 A;  5EZY B;  4WBN B;  4LR3 A;  4RB0 A;  4TOI A;  2E5L H;  3T1Y B;  3RTX A;  3GJX B;  4RAY A;  4CC5 A;  2KSW A;  5IWA H;  5EIB D;  3JAS B;  1N33 H;  3VNN A;  4K8X A;  5KHH A;  4I50 B;  4FLX A;  4I4T B;  4JI4 H;  3N2G B;  1GYF A;  1TVK A;  3CB2 A;  1HNX B;  5JJE B;  1SA0 B;  3KXY T;  4O4I B;  2VPS A;  2PZS A;  4DUZ H;  1Z2P X;  4YY3 B;  4TQF A;  2Q2U A;  4PZ7 A;  3ZS8 C;  4DR5 H;  2UUC H;  2Q7H A;  2Q2T A;  3HKC A;  4KHP B;  4PDB A;  2HIX A;  5LA6 B;  1BJT A;  3HKE B;  4AQY B;  1HNW H;  4JI3 B;  4DR4 H;  4RB2 C;  1FKA H;  1JMK C;  2HVS A;  2Q7E A;  4LFB H;  4YHH H;  2VWJ A;  4K8Z A;  4LSX A;  4CH3 A;  3HKB B;  4BW9 A;  3BHP A;  3LNN A;  5K1P A;  1M93 A;  4UFZ A;  4YJ2 A;  4FLT A;  4I55 B;  3NBY B;  3JAK B;  4A2A A;  4J0M A;  1X9N A;  1CKN B;  2VQF H;  3FFQ A;  4JI8 H;  4O4J B;  4NXN H;  3N2K A;  1TAE A;  3J81 W;  2YIB A;  4EEQ A;  3RYC A;  5IYZ A;  4X1K B;  4DK0 A;  4DR1 B;  4FLU A;  4LF4 B;  1IBK B;  3MWM A;  5D5Q A;  4DV3 H;  4AIL C;  3RGX A;  3UT5 B;  2CW8 A;  4RZQ A;  4RB3 C;  3ZED A;  2UXB B;  2ZIN A;  2RGV A;  3L4J A;  3T1H H;  3JAW B;  5EYP A;  3RYI B;  5LMN H;  4ZI7 B;  2ZM6 B;  1XNQ B;  5KHJ A;  3JAL B;  4LF7 B;  1XDN A;  4B3R H;  3PN1 A;  5EIB C;  4CS3 A;  1N36 H;  2P22 C;  4TUY B;  2YXL A;  3CHX A;  3RJ0 A;  3N6X A;  1IBM H;  4FLW A;  4X65 B;  5LYJ A;  4NXM B;  3GB8 B;  4DV7 H;  1M0W A;  1Z2N X;  4LFC B;  3ETQ A;  2RGR A;  3ICX A;  2YI8 A;  5J2T B;  5CA0 B;  3JAT A;  4GKK B;  2F4V B;  4O2A B;  4WBN A;  2ZJT A;  4LMY A;  4DR3 B;  4DRX A;  4I9Q A;  3K5O A;  3K59 A;  3J7A K;  5IJ0 B;  3B2E E;  4F6R A;  5CA1 A;  5ITZ A;  4MTE A;  1TGO A;  4I50 A;  5BR8 H;  3KAK A;  3K5L A;  4RB1 A;  4LF8 B;  4DV6 H;  1I94 B;  1BGW A;  5LXT B;  3VQY A;  2PYL A;  4EFE A;  2FE3 A;  2HVR A;  4JI2 B;  2HGS A;  4LF5 H;  4OX9 H;  2UUB B;  5LMU B;  3OTF A;  4X62 B;  1L2Z A;  4CS4 A;  1XHX A;  5D5P A;  2PUS A;  3K3V A;  3DSQ A;  1N32 B;  4UCO A;  1HNZ H;  5FD6 A;  4O2B B;  4DR2 B;  4JI0 H;  2OWO A;  3TY5 A;  2VOB A;  5LP6 B;  1XNR H;  3QG5 A;  4KL1 A;  4BWA A;  5JQG B;  4FM0 A;  4JV5 H;  3W1G A;  3M7M X;  1ZAU A;  5FPR A;  5KX5 B;  1JFF A;  4A2B A;  1VS0 A;  3H20 A;  2XIG A;  4LF9 B;  1SQF A;  1WN7 A;  2BTQ B;  2EX3 A;  1XMQ H;  3SJC C;  4EB6 A;  4JYA H;  1Q43 A;  2CW7 A;  5D1P A;  5KHG A;  3GDE A;  4B3S B;  4X1K A;  3BRC A;  1SQG A;  5JH7 B;  4LNU B;  2OYQ A;  4JI6 B;  4LF4 H;  4M7E A;  5JVD A;  2UXC H;  2PYJ A;  1VF7 A;  1IBK H;  5EOY A;  5LL6 b;  3UT5 A;  2MCT A;  5GON B;  4TV8 A;  2UXB H;  4L8J A;  3E22 B;  1XHZ A;  3DF7 A;  3JAW A;  1H2S B;  5FPO A;  2PTM A;  4GYC B;  5CB4 B;  1T5E A;  4ZOL B;  1FJG H;  4JI7 B;  1HR0 B;  4X64 B;  3U10 A;  2HEP A;  4DRF A;  2CAZ C;  3CSX A;  1N34 B;  4DR6 B;  2KKW A;  4X1I B;  3MAQ A;  1XMO H;  4X66 H;  4FVM A;  1JJO A;  3BPZ A;  4D7S A;  4X65 H;  3BA9 A;  4DV0 H;  1J5E H;  4CS2 A;  2UU9 B;  2YIB D;  3JSN A;  3U11 A;  4ZHQ B;  5FNV A;  4LFC H;  3FMA A;  1WH2 A;  1A0I A;  4LF6 H;  1P49 A;  4O2A A;  4LSA A;  4DV5 B;  1QHT A;  4GKJ H;  2VQE H;  4MV7 A;  1KU9 A;  5BMV B;  2UXD B;  3KAL A;  2WDT A;  4B3T B;  4DUY B;  4DV4 H;  5IJ0 A;  4X20 B;  2WYO A;  4YJ3 A;  4B3M B;  3JAM W;  4DR7 H;  3THO A;  3JAR B;  4CH6 A;  4UCR A;  4O4L B;  4IIJ A;  4U3J B;  3N40 P;  4FM2 A;  5IT9 W;  5LOV A;  5J2U B;  4NVP A;  1FVI A;  3SJA C;  1M4U A;  4UCS A;  3LML A;  4FFB B;  5IJ9 B;  4LFA B;  1Z5W A;  1V9P A;  2JS5 A;  3J80 W;  1DGS A;  4IHJ A;  3JSL A;  4X1Y A;  4DV1 B;  3K58 A;  3RGZ A;  4DV2 H;  2YIA A;  4JI5 H;  2F95 B;  4TV9 B;  1FFX B;  3VQV A;  5LP6 A;  3N41 B;  2E5L B;  5JQG A;  3SJB C;  4BWS C;  3OTO B;  4PI2 A;  4EQ5 A;  5IWA B;  2RJZ A;  3K57 A;  5D1O A;  2PY5 A;  1N33 B;  5K1X A;  3N42 B;  4JI4 B;  2BTQ A;  1TVK B;  5EZY A;  4LNU A;  1MZB A;  2F1M A;  4JI6 H;  4DUZ B;  2UUA B;  2HHH B;  3T1Y H;  1E4G T;  2W57 A;  2P5O A;  3WB2 A;  2YI9 A;  4Q0Y A;  5LP6 C;  3RYH B;  1B04 A;  1E4F T;  3JAS A;  5KHK A;  4DR5 B;  3RF2 A;  5C8Y B;  4I4T A;  1TA8 A;  3HKC B;  3N2G A;  4LH6 A;  3W5O A;  1HNW B;  1HNX H;  4DR4 B;  5KMG B;  1SA0 A;  2QJ1 A;  4O4I A;  2CFM A;  1TUB B;  4CH4 A;  4YY3 H;  3VQW A;  4YJ2 B;  2VQF B;  1SKV A;  4NXN B;  4KHP H;  5LA6 A;  1O9H A;  3HKE A;  2UU9 H;  2R70 A;  4AQY H;  4JI3 H;  5IYZ B;  3RR5 A;  2O03 A;  3HKB A;  3N43 B;  4DV3 B;  4DK1 A;  4I55 A;  2JVD A;  3JAK A;  1CKN A;  3IG0 A;  4O4J A;  4APM A;  4MTD A;  4B3T H;  1AN7 A;  5JCO C;  4DUY H;  2F66 C;  3T1H B;  4ETS A;  4IAJ A;  2WE6 A;  2R72 A;  1ZHQ A;  5EYP B;  5LMN B;  2XHB A;  3C0F B;  4DR1 H;  4B3R B;  1RSO A;  2F93 B;  1N36 B;  1IBL B;  3EYY A;  1WNS A;  1IBM B;  3QTC A;  2ZNJ A;  3NC0 B;  3L2P A;  4DV7 B;  4LFA H;  5JJN B;  5LYJ B;  3HKD B;  4PZ8 A;  3RYI A;  2VWK A;  4ZI7 A;  3JAL A;  2ZM6 H;  4LF7 H;  1XNQ H;  3RWR D;  3QWU A;  4PI0 A;  1SYX B;  3WB0 A;  1NT2 B;  4HNA B;  4TUY A;  4DRX B;  3SR2 C;  3OTO H;  3RYF B;  4NXM H;  1O9G A;  2ZIM A;  1HW7 A;  5FD5 A;  4F6R B;  5CA1 B;  4FM1 A;  5ITZ B;  3L4K A;  5BR8 B;  1G6U A;  5J2T A;  1Q8I A;  5CA0 A;  4GKK H;  2F4V H;  4DV6 B;  4K0K B;  1Q3E A;  3SGI A;  2UUA H;  1X4T A;  4DR3 H;  3W1B A;  2HHH H;  1Z5V A;  3NBZ B;  4UCT A;  2HVQ A;  4LF5 B;  4OX9 B;  3M4I A;  3RYH A;  1P8L A;  3K5M A;  1ZHS A;  4B08 A;  1O75 A;  1I6U A;  5C8Y A;  1M0T A;  4HBN A;  1HNZ B;  5KMG A;  4JI0 B;  2BTO A;  1I94 H;  4LF8 H;  5LXT A;  1XNR B;  1TUB A;  4JV5 B;  4JI2 H;  3TY8 A;  2JGU A;  2UUB H;  1JFF B;  5LMU H;  4ZIB A;  4X62 H;  5DIS C;  4O4H B;  3F8N A;  1XMQ B;  3K5N A;  1N32 H;  4O2B A;  4JI1 B;  4EB6 B;  3IAY A;  4JYA B;  1XK5 A;  4DR2 H;  1SEI A;  3VQX A;  1S03 G;  3HXL A;  4D7T A;  2UXC B;  3QF7 A;  5JVD B;  2YCH A;  5KX5 A;  1XI1 A;  4GLX A;  4TV8 B;  1QQC A;  4LF9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...