4CC5A

Fragment-based discovery of 6 azaindazoles as inhibitors of bacterial dna ligase
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
308
structure length
308
Chain Sequence
ADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-Based Discovery of 6-Azaindazoles as Inhibitors of Bacterial DNA Ligase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 109
structure length 308
sequence length 308
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4cc5A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4cc5A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4cc5A02
4PZ6A 1HNXB 4LF9B 3QWUA 2UUBB 4X66B 1VS0A 4JI6B 1X9NA 4DRFA 4NXNB 1A0IA 4UCOA 4YY3B 1N36B 4DR2B 4LF4B 3T1YB 3TY9A 4JI5B 4PZ8A 3TY8A 1FJGB 3S24A 1TAEA 3OTOB 4UFZA 3KYHC 4UCRA 3TY5A 2ZM6B 4JI8B 4B3MB 1ZAUA 4LF8B 3BA8A 1CKNB 1XMOB 4UCTA 3BABA 4DUYB 4DR6B 4X65B 4DV3B 4AQYB 2E5LB 4LF6B 3VNNA 3L2PA 4UCUA 2VQFB 4DR1B 4KHPB 4LF5B 3JSNA 2UUCB 3W1BA 1DGSA 2VUGA 2Q2TA 4JI7B 4DV5B 4JI2B 3UQ8A 1P16A 5D1OA 1HNZB 2UU9B 4EEQA 4E6NA 4DR7B 1HNWB 4JI1B 1B04A 4LH7A 5BR8B 3GB8B 3GJXB 4CC6A 2F4VB 4DV4B 2VQEB 5DISC 2CFMA 4JYAB 2HIXA 4B3RB 5D1OB 4UCVA 2UXBB 2UXDB 5LMNB 1P8LA 2HHHB 4DV1B 3SGIA 5D1PA 4K0KB 4GKJB 4DR5B 5IWAB 4X64B 1XK5A 4JI3B 1XNQB 4GLXA 4EQ5A 1V9PA 1TA8A 1IBLB 2HIVA 3BAAA 2HVQA 4DR3B 3RTXA 3W1GA 4PZ7A 4JI4B 4DV6B 4LF7B 1FVIA 4EFEA 5FPRA 4JI0B 5FPOA 3PN1A 2UUAB 1IBMB 4DV2B 1XNRB 4DV7B 4X62B 5LMUB 3RR5A 3NC0B 4YHHB 1XMQB 1N33B 4TOIA 4NXMB 1CKNA 1CKMA 4LFAB 3BA9A 4JV5B 4GKKB 1N34B 4UCSA 3NBZB 2HVSA 4LH6A 3JSLA 1J5EB 3T1HB 4B3SB 4DV0B 2OWOA 3GDEA 2UXCB 4CC5A 4B3TB 1I94B 4LFCB 1CKOA 1XDNA 4EFBA 4OX9B 4LFBB 1N32B 1S68A 2Q2UA 3W5OA 2HVRA 1HR0B 4DR4B 4DUZB 1IBKB 3NBYB
chains in the Genus database with same CATH superfamily
1SQVH 2EINC 1ORQC 4YJ2F 5H5NA 5I5UA 3ICXA 4WFBV 4B3TO 1V51A 5HBRB 1N56A 3HKZA 3FYEB 3U0ZA 2HJDA 1KC7A 1M56B 2XAHA 5C1OA 2D2CB 4TQDA 1YIJV 4X62O 4GX0A 4LP8A 4DV5O 4B3SO 1VQNV 3TY8A 2YI8A 3Q8SB 1SETA 4N21A 3GV7B 4XYLB 4RAZA 3NXSA 1MSWD 3A0RA 4QJFB 4J9YB 3JZ6A 1EYZA 3QO5A 1CKNB 4DV4O 2DWCA 1T94A 3PW5A 3JD1A 3K9AA 2KG7B 2EJ3A 3H9VA 2NN4A 3BY6A 4WHXA 5TISZ 5LXTA 5JVDB 3ZHTA 2V58A 1QCEA 5L3CA 3TQTA 5LP6F 1Y14B 5KFCA 3L70H 4JV5O 4WD3A 4I7ZB 2HP8A 1DV1A 1W59A 1PL4A 4TSFG 5LA6F 3RYIB 2A3QA 5BR8B 5KT3A 1H8EG 1EZJA 2YDEA 1YJWV 1VEWA 3JATA 1RFYA 4TV9A 5KMGA 3G6BA 3JAKB 5K2MA 4JASA 1P8LA 3QQMA 2UVWA 2DPIA 3RYHB 3BG5A 1P84F 4FK5C 4DR5B 1JPXA 2QR4A 2GHYA 3BJYA 4DL2A 3B09A 5C8YA 4YIPA 1IXBA 4MV6A 2EZOA 2VQFH 4JI4B 3KHRA 2ILMA 5IYCG 1H2KA 1P7GA 3LULA 4XDKA 4F4ZA 2ITCC 1VQ5V 4C5AA 5BR8H 2VQDA 4DV2B 5DN6G 5DG9A 2JGDA 2BSKA 2CH7A 3RBEA 3ABMC 4MSWC 3Q2OA 1VKZA 1PNLA 3CVZA 4E4EA 4NTXA 2W70A 2HHHH 3K5LA 3BACA 5DQGA 1NR7A 2JA5G 2DN9A 2X6CA 4G3IA 2X6BA 2W9AA 4O83A 3RJ0A 4LFCB 3ABMB 1JLLB 3RUPA 4DV3H 5BWUA 3N2KA 3OE7G 3E8HA 5CA1F 2OTJV 5LA6B 3AYHB 5KFZA 1RP3B 2DYRC 4LNUA 3F7VC 4OXSA 1SA0B 4RB0A 4EKWA 4GKJH 3ZRVA 1Y1VG 2GDSA 2YIBA 3PFFA 4DV4H 5CA1A 2GTAA 4LF5H 4FLZA 5KS8A 1S0OA 3N27A 2KB1A 3R5HA 3H40A 1N36B 5C8YB 3K58A 4CS2A 3ASNB 4MTGA 4X62H 1JJ2U 2UVUA 1OCZC 3N43B 1B06A 4O86A 4FZ1A 4MV7A 4I50F 3CEBA 4ZOLB 2QM7A 3SJQC 1XI1A 4H37A 2OIEA 3WB2A 2JA7G 2QSAA 3GB7C 3K5OA 2AGPA 4J41A 4Q44A 2Y4RA 1JQ0A 5CAEB 3SPIA 3FMAA 2Q8VA 5L3BA 3HKCB 4DV1O 3SPCA 4J7JA 5KKNB 1XL4A 3BQ2A 1JX4A 3BCCH 2VUGA 1IXMA 1ZWIC 4WFEA 2XCPA 2VS0A 3ZS8C 5EWFA 1TWCA 2Q7EA 2ARHA 1MNGA 5LOVA 5BMVA 2UU9B 4O7ZA 1I0HA 4R50A 1NZ6A 3T4ZA 4FLTA 3PR4A 2FMAA 2Q5ZA 5JQGB 4DL7A 2YRXA 1Z5WA 4J42A 5B66Z 4MVRA 5D5QA 5D1OB 4I50A 3H1LH 1CEZA 2DABA 2RGRA 4B3MO 4RCNA 3FB7C 3SYPA 1CP9A 5FJ8G 3W7WA 4GKJB 5JVDF 3ZHVA 4F4XA 2DYSB 4JI1O 1G1XB 2A1HA 1K4DC 3UCSC 1WH2A 3DTGA 3FX7A 5IYDG 2ZDHA 1YCIA 4MT8A 4MS2A 5KT2A 2R93G 2BR0A 2HFEC 2YEVA 2V5AA 1TUBB 3BQ0A 2Y48A 3MR6A 2CGNA 3P32A 2YZLA 4MTXA 3FKSG 2D3OW 1GSOA 3G4SV 1L2ZA 3T4DA 1WCMA 3MHHC 3L4JA 3JSLA 3PO2G 4CKEA 4O4JF 3GDEA 1YI2V 2VPQA 1MABG 4MVUA 1XDNA 3JCUZ 4I4TB 1UC8A 2YIBD 2B63G 4A3MG 1AI5A 1CQIB 3G6XA 3Q8RB 3CRRA 2GPWA 2KKWA 5EIBC 1VQ9V 3JZIA 3PO3G 3K9SA 1J5EO 2VQEH 2IH1C 1Z2NX 3Q8QB 4A3BG 5EC2C 5KFTA 4JV2A 2A7WA 4R7CA 1A48A 4RQEA 4LFBO 1SCUB 3JAMN 4LMYA 5KT5A 4ZHQB 1AR4A 1FS0G 5JJEB 5LMUH 5C44G 2GPSA 5CN0A 1N33H 1S72V 1I1LA 4HYOA 2XAQA 3G8DA 3SI8A 2R93A 3GLKA 2BTQA 3GIQA 1XMQH 2EIMB 3UKMA 1AN7A 2UXCH 1EHIA 5LP6A 1BQZA 4GUNA 1PL0A 4JUZA 4RU9A 4QWBA 3QZ7A 2JS5A 4FLWA 3MR2A 5LHHA 1FXKC 1H2GA 3BPZA 2Q2TA 2AGAA 3K79A 3CEIA 3ZMZA 4GLWA 2R8GA 1SQGA 4DR4O 1RM1C 1IBLO 1R3KC 2GQRA 2HKOA 3K5MA 4O3OA 2QWPB 5EC1C 2JEFA 2M7WA 2B63A 4NTYA 1S97A 2WE6A 4I0XA 4KFMA 1SKVA 1L1FA 4NXMH 2HVKC 4U3FH 4DO2A 2ETNA 1JCHA 4ETSA 3RT3C 4DV1B 3JZFA 2JS3A 3DC5A 2R70A 4G2KA 3CCMV 5LYJF 1YJ9V 1EN5A 1XK5A 4L1KA 1QVGU 1OZ0A 1E79G 1TVKB 3C3TA 4I4TF 4EQ5A 2QE7G 2BTQB 1SEIA 1QLEB 3JD4A 4O7LA 2QTSA 4X89A 3KXYT 1GLVA 5LP6B 1MZEA 2BQUA 2UVRA 1ET0A 2WB1A 2F23A 4I55B 2RNBA 3CRAA 2W6ZA 4FFKA 3RGXA 5FR9A 1IBMB 1HWYA 5BXZA 4DV7B 3RR5A 2E2HA 4X64H 1WCMG 1CKNA 2EIKC 3HXLA 5A9GA 1FFXA 2MK3A 1RJRA 1SQQH 4FZ0A 5IJ9A 2W71A 3HOXG 4F4YA 2HVSA 4L87A 1KECA 3U54A 4HAMA 5CBFA 2Q73A 3SNOA 5L3FA 3H0GG 4D7SA 1I94B 4FIPC 3M8AA 2LW7A 5IJ0B 3KALA 3OHAA 4HNVA 4CH6A 4QWDA 5LBQA 2COJA 4IWYA 2FB5A 4A2AA 4X1YA 1VQKV 3NBYB 3T9DA 1S10A 1PPJH 2YICA 1AJPA 3M4IA 5LMNH 1AROP 4PHZA 1NS1A 4O2BB 2EBOA 4I9QA 4WFFA 3D8CA 4YY3B 1N32H 4PI2A 3U10A 3R5FA 2AQ4A 2HHFB 3T1HO 3I4NG 3TY9A 4YJ2B 4LCUC 2EILC 3N44B 3RBZA 5KUMA 2YIDA 4YJ3B 1S76D 1XREA 3ETEA 1N48A 2A9HA 3OUSA 2PUSA 4MAMA 3TXSA 4ZHQF 3OW2U 4O3PA 5K1PA 4DV6H 3O9OA 4UCTA 1P4RA 3CP1A 1Q8IA 1IDSA 2EILB 2GBOA 4O7RA 4O4HB 1KKCA 4EGJA 3SE7A 1FJGH 4RB2C 4HQ6A 1DV2A 2PF4E 2J6TA 3VQXA 4UUJC 1DGSA 3OGCC 3T1CA 5FD5A 3GIKA 3JAWA 2CNUA 3E89A 4DL3A 1GK9A 1JJOA 3N2GA 3DXRB 1HNZB 4EEQA 4JI4H 5LOVF 4ECWA 4JI3H 3CD6V 2R82A 3KG2A 1V54B 2HG5C 2CNQA 5EBLC 2R85A 2P67A 2DAAA 1I94H 1Q82W 1PKXA 1FFTB 2UXBB 2P0AA 2ZM6H 4MTDA 1OHHG 4IRCA 4O2AA 5ITZA 4PA7A 4ZKIA 4ICGA 1WJZA 3HKBB 5IWAB 4TQSA 5IYZA 4BW9A 1I1MA 4X64B 2LFRA 4O3QA 3K04A 3RYIA 4W4KA 5J2UF 2HIVA 4DR3B 4B3RH 3VQVA 4PI0A 2VRZA 4WBNF 1DF5A 5KFIA 4JAVA 2XAFA 3GIDA 4UVCA 4DQNA 1TVKA 2W0FC 2R7KA 4X62B 4O2BF 5DLFA 1WP8A 4Y8VB 1LNQA 3B40A 3K06A 4LF4H 3N42B 4MV9A 4HYKA 4DR6O 2AHZA 2W8LA 2C2AA 3NBZB 4GX2A 3CHXA 3K5IA 4HNTA 3AG4C 4XDJA 3TGUH 4FBTA 4DV0B 2IMWP 1Q3EA 3BEHA 2WLHA 2R9AA 4NLGA 1CKOA 1NU1H 2ZM6O 4DR4B 1XBLA 1SQXH 4RUAA 3PZPA 2OLSA 4FFOA 4U7CA 3ML0A 1FPOA 5B1NA 4NZOA 3M9NB 1QR8A 4RNOA 4F50A 3ASNC 3P3PA 5KG0A 4TV8B 4PZ6A 3JD0A 3HKEB 3J81W 3B8MA 2QA4V 1SFOA 4JI4O 4DK0A 1FXKB 1W0JG 2WAMA 2X0LA 1AVMA 2UUAO 5KFJA 1S0MA 3JRWA 3T1YB 3FKIA 2C2RA 2F4VH 3HB3B 4DV2H 3ETJA 1A3GA 3TY5A 4FMTA 1Q90D 4UV9A 2RDIA 3TXQA 5B3SB 3GIMA 3ZHRA 3J81N 2ZE8A 4U7OA 2P22C 5IYBG 2JJ2G 4MTFA 3OFNG 4DV6O 4J9MA 3CRQA 3G80A 4IT5A 3K3WA 3OMAB 1MZFA 4GZRB 5DGHA 1SS3A 1VIBA 1ZETA 4YJ3A 1XNQH 4ZOLF 5HFLA 3JARA 2ZNJA 5F2VO 4LF9H 2UUBO 1SZTA 1BHAA 4ED2A 4E2LA 3GIJA 4DAAA 2YS8A 3GTJA 4KHPB 4A3CG 2VWJA 2L35A 2AZ2A 3RYHA 4LF8H 1K3EA 3N6RA 2WLMA 5FL7G 3JARB 5JJJB 4BBRG 1BS3A 5KFXA 1R3LC 2ODMA 4YJ3F 1KUQA 3DAAA 4MVMA 1ZL8B 3OHBA 2HIXA 1JFFA 3Q8PB 3OEEG 2PZSA 4YJ2A 1MOFA 3E2EA 1PD3A 3OAAG 3R65A 5B1AB 1WB8A 2V59A 3FB8C 1RJPA 4FU0A 1M57C 2JVDA 1GMGA 3K3PA 4QSHA 1Y74A 2W6IG 3I4MG 3W1GA 1OCOC 5E79Z 1KJIA 1NH2B 4HNAA 4UB6Z 1KP3A 1OJHA 3RB0A 3TJTA 5DG8A 1H2SB 4P30A 2VOBA 3CS5A 3RVYA 1B6SA 1XNRH 3F5TA 2RF4A 4YR3A 5FD6A 2V7QG 5L1IA 3T1YH 2BOBC 4ECVA 5KFWA 4LF6O 4PDBA 2Q0AA 5GTHZ 5JH7B 2OWOA 1BQ0A 4BXXG 3PVXA 3HOZG 4QWCA 3H1HH 4CBCA 3K0DA 5ITZB 2CDYA 2Q2UA 4YR0A 3V6JA 4OPAA 3O65A 1HR0B 4NXMO 3CCJV 2YRWA 2UU9H 4W4LA 2PMZA 1K97A 3ASOB 2XC9A 2JA5A 2YI9A 1M0TA 4X66H 3GWOA 4EB6A 2UUBH 1VS0A 4I55F 5CBGA 3CX5F 3JD3A 4NXNB 4ASUG 2UXBO 3KHLA 4IIJB 4JYCA 4X65O 1E4EB 5KX5F 2YXHA 2OT5A 1X4TA 1VARA 4Q43A 1BXRA 3WG7C 2ZM6B 4O4IF 4QIWA 3OMNB 3RYFA 4JI8B 3I12A 3K5HA 4DV2O 3J80W 2J6UA 1X59A 3SJBC 2UXCO 5H2FZ 2YL2A 1NVPD 1EM1A 3A0HZ 3RB3A 1VF6C 3B8NA 4DLKA 4PDVA 4EYHB 4ZIBA 4LF7H 3L73H 4RB3C 3LNNA 3JSNA 2IW5A 3ABKC 3OR7C 4LF5B 2P7TC 2IJIA 1E1QG 4Q8EA 4FLYA 4BBSG 3M99B 3DF7A 3WWJA 3CWBH 3J80N 3H0GA 4UVBA 1VMGA 2F93B 2E76B 1RK5A 2DW4A 1GN2A 4PELA 5FNVB 3R66A 2CFMA 1VF5B 3KCYA 4CH4A 4LF4O 3ETHA 1AI7A 2CW7A 4OX9O 2WAQE 4GX5A 3PW0A 3HOVG 1I1KA 5BWXA 3TEKA 5GONF 3KCXA 1M7JA 2CGOA 4TV9B 2Y0SA 1D5NA 2NVYA 2X0SA 5KFOA 2H94A 1BT8A 2EJRA 3WB0A 3L74H 3OGIB 3T5KA 4GYCB 5KUKA 2VR1A 1KBLA 1R3IC 1AILA 3N2KB 1R6KA 2FP4B 2QJ1A 5KFSA 1NBMG 5DM6V 3B4SA 4A3JG 1D2DA 4MVQA 3TIIA 2IA6A 4YHHB 1UPGA 4B08A 1N34B 3Q1KA 2ASLA 5DQHA 3N8DA 4QPKA 2ASJA 3IN5A 3VPCA 2DQ3A 4JI3O 2JEJA 4KHPO 3N6XA 3JAMW 4YY3O 4A3FG 3D36A 3E22B 3U11A 2HVRA 2YEVB 2Y0IA 2FB9A 5KFAA 2JEIA 2ODTX 4NR1A 3P30A 1AUVA 4X1IB 3T5HA 4WBNB 4LF9B 1N0JA 2UUBB 4K0KO 2EIKB 3AG3B 1VQ4V 2HG8A 4MV8A 5EWGA 4J9SA 1A0IA 4H44B 5EDWA 1AI6A 2FLLA 4KHPH 1OCRC 1WP7A 4X1IA 1NH2D 5A2QW 4XZ3B 3OTOB 3UT5A 2B9ZA 4QIWF 5EWEA 4EEYA 2WLJA 1K92A 4RZQA 2Q7GA 2WA4A 2CQYA 4IIJA 4Q0YA 1SRYA 3T1HH 2SCUB 2RJZA 4PA4A 5CB4B 3CMEV 4DV3B 4OPHA 1T36A 2ZGIA 4K0KH 3QZ8A 2OCHA 1YJNV 5KFMA 2I8CA 4HNAB 5CBHA 4YBZB 3E22A 3P3NA 4PA9A 5KG2A 1GYFA 1V55C 3CCUV 1FYJA 1OCCB 2XT9A 2ADQB 4Z1MG 3OTOH 1RJQA 1Z2GA 1B04A 1NR1A 1YTFD 3GJXB 4O4HA 3T9FA 2WLIA 4DR1O 5H6RA 2ATKC 4GX1A 4J9ZB 3R5XA 4GT1A 2MW2B 4CKBA 2P90A 1BSMA 1KJJA 2R9RB 3CSWA 3RYCA 3APQA 3JASB 4O4JA 4DR5H 3RAXA 1FXHA 3JALB 2NU7B 4HN2A 3X2QB 1XNQB 2YS6A 4JI8O 4QNHB 3OUUA 3WWHA 1H2MA 2HVQA 5KHIA 3H1KH 1I50A 1S3JA 4YAJB 3PW4A 4CH5A 2HVJC 2Q4PA 2RDCA 2UXNA 4I0XB 5CA3A 3KHHA 5JUMA 4DK1A 1PNMA 1ZTEA 3HO8A 2HLDG 4QW9A 3ABLC 2V1DA 5KA6A 5BWVA 3LSSA 5DQIA 4U3JB 3RGBA 3UFXB 1HNZH 1MMMA 4O7VA 2YZGA 1VF7A 2XOKG 4BIOA 2LO1A 4R7RA 4X20A 4FLXA 1TWFA 4EBDA 5K3WA 4U3JA 1Q6IA 3CPWU 1G4YB 4NTWA 2DYRB 4FE2A 4FM2A 4O2BA 4IAJA 4B3SH 4DR4H 1YXBA 1SQBH 3QF7A 4NB5A 2VA3A 5H6QA 2XIGA 4QIWE 5KG4A 4C2MA 4X20B 3HB9A 4YP3A 2CTRA 2COIA 4JGSA 5DAAA 1XDCA 4MW8A 3ZMTA 4FLVA 4WFHA 2CUGA 1VQ6V 1ZL8A 1CE8A 1Y67A 2ZE5A 2NR5A 3R9RA 4C5BA 4LF4B 3JAKA 5B1OA 5IYBO 1GN6A 4PZ8A 4YQWA 4TM5A 5I5SA 4UFZA 1COWG 3U55A 1KBHA 1K1SA 5E1AC 2PGGA 1B6QA 2R87A 4JI8H 3OMIB 3BA8A 1K73W 4MV4A 4FPPA 5KA5A 4TT3G 2W6QA 4FFBA 2NLJC 2F43G 2E5LB 1SYXB 1S5LZ 1TGOA 4DR3O 4ECZA 1O9GA 4JI6H 5IJ0A 4JYAO 2V4RA 3GTMA 4JI7B 4C7UA 4JI2B 2FL4A 3ZBHA 5KFFA 2M05A 2ZKOA 1HNWB 5KT4A 3AW8A 3OM3B 1Z2OX 2W57A 4DV7H 3MD0A 2VQEB 5D5PA 3RB4A 3ABUA 3HPLC 3K0GA 2W9BB 4IYHA 2YZMA 2UUCO 2H8PC 3OR6C 1GSHA 1NJIW 2IM9A 4YAKB 2FK2A 1SA0A 2HR3A 5KLVH 1N34O 2AGQA 2GSMB 4FFLA 5KHGA 2ZINA 5B1BC 2R86A 4XYMB 2ZIMA 2R7NA 4M9UA 4O84A 5KX5B 4FM9A 4N23A 4JV0A 1FAFA 3BAAA 5I5WA 4U7NA 2PVPA 3VA7A 4PZ7A 4WBNA 1QLEC 1RSOA 1MSDA 2JA7A 4APMA 2X6AA 2FE3A 4JI0B 3PN1A 1LUVA 2UUAB 3ZIAG 5KX5A 4U6PA 3CXHF 4KL1A 1C3OA 2DOSA 2XHBA 3GIIA 5LOVB 2PYLA 1NTZH 2COGA 4FJCC 4NXMB 3ZN1A 3RFCA 5LMNO 5FLXW 3V6KA 4ZOLA 1CPYA 2QWQB 3FB6C 1WB7A 1R6TA 5BZBA 5CA0F 3TK1A 2MCTA 1N32B 4YY3H 2QM8A 2VPSA 4MW3A 1I08A 1SESA 2QKSA 3CC2V 5EZYB 1RYSA 1NQTA 3HR0A 1BMFG 1M0WA 3QWUA 2CTPA 1JOYA 3FAVA 2XASA 3HKZE 2X7RB 1XNQO 3BRCA 4X1YB 2YUAA 2W7OA 3HKDA 1MA1A 5LGTA 2HGSA 1IX9A 2DWEC 2XNDG 2NU6B 2EJ7A 1IZ3A 4B3MB 2HEPA 3ETGA 1CQJB 2QF7A 2HHFA 3L71H 4H13B 3V4SA 2BCCH 2LFSA 3BABA 1WRVA 1KQSU 2C2DA 1PV0A 1YF2A 4X65B 4IRDA 1AI4A 5L3DA 4WCEV 2ABJA 2YU9A 4QPJA 5BMVB 4M0JA 1S0NA 1N33O 1E4FT 1WPBA 1EZ1A 4ZBMA 5HFMA 5AG2A 4H33A 5LXTB 3T54A 4JI6O 3UQ8A 4MTEA 4R8CA 4JAUA 2CTWA 2Y0SE 3RFRA 2I80A 5KFEA 4KP4A 2W6MA 1J5EH 1ENVA 4NKGB 2BOCC 1GO3E 1OBGA 3G8CA 1K9MW 4JXUA 5IYZF 2ZT9B 1I7NA 2OYQA 5KT7A 3SYCA 5IY5C 1YEWA 1NKDA 1VQ7V 2WB1E 5EOYA 3RGZA 5KFUA 4J9QA 5GTIZ 5H9CA 5CR5A 4OGQB 3RB6A 1KTAA 1XMQO 5E25A 2AHYA 5CA0B 2R92G 3ABKB 2V9WA 3CYOA 1YVWA 2CZGA 1Q6HA 5J2TA 1WR2A 2W6PA 3BQ1A 1FJGO 4FFBB 1EN4A 2Y4UA 1K33A 5FPRA 2C2EA 4PDMA 2DYSC 5FPOA 4X65H 2QM4A 4O4HF 3J7AU 5LMUB 4LSXA 3ABLB 3HBLA 1XMQB 2F66C 3TW6A 3HOWG 4FGRA 3H1IH 1KEEA 4O7SA 1TWGA 2GV9A 2W8KA 4Q20A 3A2FA 3LWBA 5CA0A 3T99A 4QGPA 4DUYH 1K83A 4P9PA 2XTAA 3WG7B 1ZSPA 4R8UB 1W96A 5LXTF 2XAJA 4PJ0Z 5CB4A 1KKDA 2W9BA 1O9HA 2H3OA 4UXNA 3K59A 3ZHSA 1R73A 4CS3A 4JI0O 1SERA 2JGDB 3LDCA 4LSAA 4XBFA 2Z04A 3K57A 5KAFZ 1WLEA 2QK4A 4JI2H 3HKBA 4JV1A 3CC7V 5LA6A 1X9NA 4JF3A 1EN6A 2DJVA 1KP2A 3AG7A 4D7TA 2BE3A 3S3XA 4JI5B 5F9NA 4BIUA 3E5NA 3MDSA 1XHXA 2CAZC 5L3GA 1XOUA 3JASA 4O4JB 1QU7A 4DR5O 1GKFA 2FPGB 4Q45A 3GILA 2UXDH 2HDKA 1KC8W 2Q69A 4PD4F 3THOA 1OBDA 5I5VA 2C28A 4ED7A 1QHTA 1R6NA 3HKDB 3EVKA 3QTCA 5LYJA 2ZXWC 5J9PC 1VQMV 2PN1A 1AP5A 2WDTA 4DR1H 4ED8A 5GONB 2NNUA 2JRIA 3I5DA 4AQYB 4MV3A 4LF6B 2ZD9A 2Q67A 1JVMA 3FB5C 2W6NA 2JIZG 4IYIA 3VQYA 3OTOO 3KAJA 4DR1B 1IOWA 1GAXA 4DRXA 3GTLA 1ZX3A 2IU0A 3E8BA 1F51A 1HR0O 1AB3A 4IL6Z 1RK6A 4LR3A 1K8AW 3SJCC 4O81A 2UVVA 4UV8A 2LW1A 1IOVA 2OTLV 3GB8B 3LQSA 2GUZA 3ZHQA 3OUZA 1XEQA 3GVMA 1Q6UA 4CS4A 1I7FA 5IJ9B 1XNRO 1OV9A 3Q4HA 4P9OA 5IP7G 3CSXA 4IHJA 1H2NA 3E35A 5LMNB 1IBLH 2ZNIA 5D1PA 3RW0A 5JCOA 1Z5VA 5KFGA 4AILC 2W9CA 4RUEA 4HBNA 5KFYA 4TV8A 4TV8F 2R8HA 2AGOA 1FVIA 3APOA 4EFEA 4TUYB 3H20A 2CNVA 2F4VO 3ZMVA 4RZRA 1UFIA 3U9TA 3ETQA 2Q0OC 1VBHA 4CZZA 3NC0B 5KFDA 1OCZB 1HP8A 5BWRA 1N36H 3H01A 4UCSA 4EB6B 3T5LA 3PR5B 4LH6A 2WLLB 4ECYA 1E4GT 4GKJO 2Y0PA 4DIMA 4QJFA 1FKAH 1H8HG 4NZNA 1W0KG 1NTMH 2R7ZG 4QWAA 2K1EA 4ECXA 1VQ8V 4DV3O 3MHSC 2XCAA 4ZI7A 5A2QN 1UJWB 2A79B 3MR3A 3M9MB 2HGXA 2WLLA 4Q4CA 4RAIA 4LFCH 4EBEA 5KFLA 3TCUA 4MVZA 2LP7A 4IR1A 5HV6A 2FJZA 1EKVA 1S77D 4D6TH 1QNMA 2XAGA 3T9AA 4O7WA 5JVLA 3T9EA 4A3EG 2W6JG 5IYCO 3EXAA 1BL8A 1T5EA 3ZRSA 4DRFA 2WPDG 1T3NA 3MWEA 4UCOA 4MVSA 4ECTA 3RAQA 3ABTA 4JV5H 2P4KA 2PI4A 4BWSC 1BGWA 1V55B 2YCHA 1H2LA 3C0FB 1TAEA 2GQSA 3PW2A 1CXZB 2OCCC 4UCRA 1GM9A 1XQ8A 4O7TA 3LDDA 3B2EE 3SR2C 2Z02A 3UYYA 1S5JA 1JA8A 3EHBB 3VQWA 3AG2C 2L6LA 3J7AK 4A3GG 3A8TA 5KG7A 1I6UA 5BWWA 3T7AA 3IAYA 5BWTA 1MZBA 4DL4A 3R23A 4M7EA 2FLNA 1BNCA 3L2PA 3Q4HB 1NTKH 1NI8A 2WWWA 2VQFB 2EZPA 2E3CA 4UVAA 1AR1B 3E86A 2R7LA 3KAKA 5JH7F 2UUCB 4JI1H 1BGYH 1K5SA 2IP4A 2DMXA 5DGAA 4X1KB 2XD4A 4B3TH 4FLUA 4DR6H 4LF7O 2DZDA 4F4LA 3KHGA 4RAYA 3E83A 1JXLA 4DRXB 3I55V 1AJNA 2XCLA 3T5JA 5B1BB 1DF4A 1US6A 2EULA 5DISC 4JYAB 1L8DA 5IWAH 1BE3H 5JH7A 4X1KA 4UB8Z 2P5OA 4F6EA 4HR7A 4PA3A 2ALZA 5BPHA 1FXKA 2AZ0A 3TW7A 2QB5A 1D5AA 2JA8G 1IBLB 3RTXA 3AG1C 1Q5OA 3N41B 2W0XA 3TIGA 2R8JA 3E8FA 1XMOH 4J11A 3CRCA 1BHBA 3KREA 3AX6A 3IGAC 4I4TA 2FMLA 1EBOA 1E1RG 2A0LA 1Y66A 4DW0A 1XNRB 5I5TA 1SC5B 3QO8A 4JYBA 3RF2A 2HJFC 2UU9O 1CKMA 1YSCA 5BYAA 2YXYA 4X9QA 5B5EZ 4CE5A 3SYQA 3JATB 5B3SC 3T1HB 2EIJC 2OIGA 3IJ4A 1XMOO 4J9PA 2N04A 3N40P 2ADPA 2DIKA 4EFBA 3OSNA 3MWDA 3OTFA 3CRMA 3W5OA 3G6VA 4LWSB 2C22A 2BQ3A 2FLPA 4RO2A 2Q7HA 1IBMO 5KG3A 2UXXA 3TINA 3GTOA 1GM7A 4AQYH 2O03A 4P2ZA 4WF9V 5LGNA 4GC6A 3EPGA 3W7UA 4O3NA 5EYPA 4K6NA 5LGUA 3CCVV 1PK8A 4DR2H 4JI5H 4QW8A 5JCOC 3BVOA 4MA5A 1IBKO 3F5WC 4TWKA 3RWRD 3ZJZA 4TUYA 1G8MA 4LWSA 1UC9A 5C4XG 3LSQA 4JTCB 3GTGA 2PMZE 1N34H 3WB1A 3BFRA 4R6ZA 3WFVA 1L0NH 2XGPA 1JR9A 1KT8A 4YHHH 2IJJA 2ZDIC 4DUYB 3H1JH 4DR6B 4O4IA 4J7KA 4A93G 3LMLA 3LNMB 2WSSG 2E75B 3MFIA 2W9CB 4A3DG 5LP6C 2VA2A 4NYKA 4PBCA 4O2AB 4DV5B 5KFQA 4ZI7F 4K3AA 2Y4TA 1WAZA 5LL6b 4A2BA 3PW7A 3WO1A 1VAJA 4FVMA 2CW8A 4BIZA 4LFAO 1I3QA 2HJWA 4FS1A 4JI1B 3ZN0A 4LH7A 4QE9A 1I5XA 1GN3A 3RIZA 2QEXV 2R8IA 2YZNA 1GRJA 3DXRA 3RV4A 3EFFK 5EZYA 3ZEDA 2HHHB 3JAWB 5GONA 1RPRA 5BY1A 2DLNA 3U0GA 4LFAH 2FK1A 5FLXN 4GLXA 1KB9F 1V9PA 2B1GA 2A06H 4NZMA 3OSPA 3VOUA 4HZ3A 5EZYF 4CMDA 4IRKA 1AUXA 1JDBB 2JEXA 2PTMA 4DV6B 4LF7B 1B33N 4WFAV 4TVIA 1W2BU 3NGDA 1K4CC 5CMUA 4FFPA 1ZHSA 1JX9A 2ITDC 3QG5A 3ORRA 4TOIA 1DK1A 5KFRA 1OCOB 2JK5C 3FD9A 4IHJF 3BA9A 1F4MA 4J0MA 2YIAA 1I2KA 1KYOF 1VP7A 1J5EB 1BCCH 2YSUB 1HNXO 2ZQMA 3CCLV 1XHZA 1IURA 2R6FA 2VUMA 2ZR2A 2R7ZA 1WNSA 1N0NA 4BAYA 2UXCB 4J9LA 1S03G 5LYJB 3HKEA 2X5RA 2NU9B 1KMIZ 4OX9B 5DGBA 1S68A 4CKCA 3V6HA 5CB4F 1WA8A 5I60A 1OCRB 1Y6XA 2E74B 3TETA 3CXCU 4DR7O 2FKXA 1M6VA 1Q86W 3AK2A 4J80A 1HNXB 4PWQA 1Y4MA 3M9OB 2WA3A 4X66B 2B1IA 4BY1G 4MV1A 1URFA 3KKYA 4RWUA 3FKIG 4TQFA 5EBMC 2FPPB 5JQWA 3PJSK 4DR2B 5C5JA 2QWRB 2EIJB 3DC6A 4J10A 1FFXB 5JQGA 3HT5A 1Y1VA 4I55A 1Q81W 3CCEV 1EUCB 5I5YA 3HOYG 2UXBH 2YYAA 5J2UB 2PYJA 5L1KA 3M7MX 4A5UB 3ZRWB 4RNNA 2Q6AA 5C8YF 5IE9A 4X66O 2YC0A 4Z1VA 2IBZH 3GTKA 3JCZA 1L0LH 2R7MA 1LUWA 1M93A 1Q43A 1I2LA 5KT6A 4ED3A 3VNNA 5KMGB 1QLNA 3EPIA 3T2MA 1GSAA 3SDLA 2AW9A 5JWPA 2VUMG 3LDEA 4LBEC 2HGWA 2P4VA 1IBKH 2E2IA 5BYBA 3IG0A 2Z3YA 1Y1WA 4IIJF 3G67A 2DQ0A 1B3QA 5FNVF 5DG7A 2JEUA 3G6EV 3I56V 2QTOA 3A0BZ 2IBKA 2O57A 1M56C 1O75A 2AXTZ 4Q4DA 1F23A 2P6JA 4ZI7B 3HKCA 1N4CA 3N2GB 2J9GA 2ZIOA 4UCVA 5BPFA 2N74A 4Q8FA 4DYLA 4MTOA 1DLBA 4IGGA 2YXLA 1G2WA 5JQGF 1SQFA 1JMKC 2RQ6A 5CA1B 2LGWA 4DV7O 1K7DA 1UNNC 1SQPH 2CTQA 2F1MA 4FFNA 3QVNA 1R1BA 3WO0A 3QFFA 2ATLA 4RQFA 1THZA 1N32O 2GUZB 3AG1B 4HNUA 3FFQA 1KJ9A 2LGQA 3D3IA 1K34A 1JFFB 1WA8B 4JI7H 3MJFA 4DR3H 2WLKA 2R84A 4ZHQA 4FFMA 5K1XA 4A3LG 1N33B 2YS7A 1FD9A 5EIBD 4LF5O 4PV1B 4DUZO 2W6OA 3W7SA 4ABMA 4YR2A 3LUTB 4GKKB 2JA6G 3RVZA 5KHJA 4O4LB 1WN7A 4DW1A 2KSWA 2N05A 1A32A 2NVXA 4BY7G 5FLMG 1ROPA 2CKZB 4CH3A 4JTAB 4DV1H 3JALA 2ZE7A 5KFHA 2EJ0A 4DUZB 5L1JA 5C3EG 4X64O 5D8DA 3UZOA 4IWXA 5KFPA 4DR7H 1N8RW 2G38A 5EBWC 4OX9H 1A0GA 3WWIA 3GIPA 1Q7YW 2HHHO 1S0VA 4R8UA 2W7PA 2CK3G 2E5LH 4F6RB 1EUDB 4PDRA 3KZIZ 3OT7A 3ZRXA 2FKLA 3D3QA 3GTQA 4IHJB 1C30A 1P49A 1V54C 1AP6A 1FJGB 5H80A 2OCCB 5KFNA 3CJHA 4F6RA 1ULZA 3ZX6A 5KG1A 2IJKA 1GM8A 4CHIA 2Y69C 3AG3C 1K1QA 2DE0X 3SPJA 4J9OA 1QBZA 5IDJA 5JJNB 1ZAUA 3U9SA 4RUFA 2C00A 3RBDA 1Y76B 1YZBA 1HDJA 2RGVA 4PDLA 1HNZO 2FK3A 5IY5B 1J95A 1M9NA 5L1LA 4UCUA 3AK1A 4DV0H 5DLGA 1PNKA 5LHGA 5DMXA 4BWAA 3DSQA 1GGOA 2KG7A 2ASDA 1SZXA 2WLIB 4PA6A 5LL6Y 3G71V 4C5CA 1KJ8A 1VQLV 3ORQA 4ED0A 1P16A 5D1OA 2NU8B 3QO7A 3H4DA 2KSDA 4DR7B 1IYEA 4E6NA 1WSCA 2E5LO 4AYBE 1VQOV 4AYBA 5J2TB 1HNWH 2GLTA 3K3VA 1NVPB 3L75H 1XILA 2XGQA 1HNXH 1A9XA 4DV0O 4B3RB 3OEHG 1YITV 1EKPA 1Y1WG 5DGIA 5C93A 4JAAA 4O4LF 3OD4A 1GH6A 1HW7A 1ZLZA 5IYDO 3UM7A 2NUAB 1FKAO 2M6YA 4XX0B 4NVPA 3C3SA 4JI3B 1I7LA 3RYFB 1S5HC 2V4DA 2R92A 3OUFA 4K8XA 5CM0A 4IR9A 4LFBH 1TWHA 4RUCA 3GV8B 5EK0A 2I87A 5KHKA 4O7NA 1KD1W 3UT5B 4RNMA 4JZ2A 4JI7O 3V4ZA 3MR5A 3SPHA 3STZC 3T1YO 1NT2B 3ZCCA 2WTFA 4GCZA 1Z2PX 5BMVF 3IC7A 4O3RA 1F4NA 2IH3C 1RYRA 5J2UA 2YWVA 4ECUA 3E8GA 3CC4V 5I5XA 4JI5O 2JA6A 2QKCA 2JGUA 4O82A 2VWKA 3MFHA 1U97A 2IU3A 5F9LA 1S9FA 2BSKB 2CH7B 1E4EA 3G6YA 4LF6H 3L9DA 2ZCEA 3GQCA 4X88A 3RV3A 3MWMA 2BQRA 5EYPB 4EG0A 2EIMC 4ZQIA 1R3JC 1IBKB 2EINB 4BW5A 4FBUA 1M4UA 3SPGA 4XDLA 3T9BA 2EX3A 4JI2O 5KG6A 4DUZH 4TUYF 5KAIZ 5L3EA 1YHQV 3DTUB 4Z2WA 1W93A 3K5NA 4DXWA 4GKKH 2RN9A 4NYEA 5IP9G 4JI0H 2ZE6A 4ECQA 2Q9LA 2EIYA 3H3VH 2FYUH 2QGNA 2EJ2A 5C1PA 4DV5H 1RM1B 5KHHA 3S24A 4JYYA 3KYHC 3C90A 3K08A 1DAAA 2IJHA 2J6SA 1TUBA 4GC7A 4B3MH 3GWKC 4LF8B 4O3SA 4JYAH 1U96A 1XMOB 1GTOA 3ZHUA 3DTFA 4Q6GA 1RSOB 2K9PA 1YTFB 4FFRA 4E4TA 4GKKO 2FTKA 3NR7A 4O4LA 4LF9O 2QYZA 2UXDO 5FNVA 2XUMA 2QWOB 1M90W 3JRXA 4QE7A 4EYIB 1Y76A 4H0LB 4LF8O 3UO2A 1VF6A 3FAVB 1ZUQA 3ZMUA 3STLC 1V4YA 4UUGA 4NXNO 2OH2A 4YIOA 3DGEA 4CC6A 2F4VB 4O4IB 4DV4B 3UO3A 4EGQA 4L8JA 3JYCA 2WAQA 5KFBA 4KUMA 3X2QC 3VMMA 2RCVA 3AG2B 3F8NA 4FM0A 4G28B 4F4WA 1XUQA 4J9KA 2PY5A 5J2TF 4B7EA 3TQ1A 3IFXA 2LJ2A 4K0KB 2QWNB 3ZMSA 4DUYO 2QDOA 3LSUA 3ASOC 5B1AC 3B77A 4I50B 2UUAH 3CCQV 1BJTA 5KFKA 1RPOA 3SJAC 1VBGA 4FM1A 1DIKA 3CCSV 3D36C 3CCRV 4O7YA 3L72H 1BZKA 4LC1A 4I5SA 3AK3A 1PX2A 4K35A 3SYAA 5HNEA 4LFAB 1QQCA 1M1KW 3VOTA 2ZR3A 4JV5B 2F95B 1EZVH 2LQTA 3RN4A 3BHPA 4B3SB 1TWAA 4EBCA 2Z0AA 4A3KG 3FDSA 1HNWO 1R9TA 1M5IA 2QKAA 1EFRG 3F7YC 4LFBB 1XL6A 2ZDIA 2JEGA 2DPJA 4JZGA 4MVOA 4IZOA 1VQPV 2WYOA 3EYYA 1JIHA 1ZQ7A 2PBZA 3ETDA 2Q68A 5I47A 4DL6A 5BR8O 4QWEA 1JKJB 4RB1A 1MG1A 4ED6A 4O2AF 5LHIA 4JPRA 1YDXA 4JI6B 1TUEB 2VQFO 3MAQA 4B3RO 1WPXA 3VBBA 4CMFA 4KXRA 5CE8A 3LP8A 3WU2Z 5LMUO 4TQRA 3JD2A 2PI5A 1KU9A 2ZDQA 1AR5A 4DL5A 3CMAV 1OWTA 2R8KA 3KTMA 1F7YA 4JTDB 2RMKB 4WFGA 4YXWG 5L9XA 4G27B 1Y74B 2VQEO 1GN4A 3L4KA 2JJ1G 1I94O 1IYDA 2RDJA 1I5YA 1LR1A 2AU0A 3WNZA 1G6UA 2GTSA 3SYOA 2Y69B 1OCCC 4LNUB 3GV5B 1AJQA 4YB8B 2C35B 4J9RA 4X8AA 3W1BA 4LFCO 5KG5A 3RYCB 3ZRWA 5IYZB 4BR6A 2R9IA 3W7TA 4J7ZA 3FYIB 5T14A 2B5UA 3GTPA 4AQYO 1ZHQA 2R72A 3UZBA 3CJHB 2JDIG 1P7BA 3AG4B 1JDEA 1M57B 5DEDA 1H38A 3HOUG 1N36O 4ED1A 3NUAA 3VPDA 4K8ZA 2YW2A 2UXDB 4ECRA 4MA0A 3SGIA 4ME6A 1FXVA 2ZXWB 4YHHO 3VPBA 4I9WA 4J9NA 4ECSA 4I7HA 1TA8A 3AEIA 3QNEA 2Z5UA 1GO3F 1IVSA 1SF9A 4FS2A 2KQXA 5DECA 3CQZA 1QVFU 2ZJTA 2V4QA 4DR2O 1EKFA 2DWDC 3CE2A 5IT9W 5GW7A 1QR9A 2Q7DA 3K03A 1CS0A 2FPIB 3S3WA 3W7XA 2WLNA 4NXNH 2CE4A 1IBMH 4AI8A 2BTOA 1KJQA 1PM9A 1K5QA 5JVDA 1B6RA 4CC5A 4B3TB 3H4BA 3T9CA 3CB2A 4B7KA 3IC9A 4AHCA 5KFVA 2P06A 5IT9N 2ZDGA 1PP9H 4TV9F 1HR0H 5IWAO 1KUTA 4A3IG 2UUCH 1DTOA
chains in the Genus database with same CATH topology
5EZYB 1M0WA 4TV8B 4PZ6A 3J81W 3HKEB 1HNXB 3QWUA 3ICXA 4X66B 4DK0A 4TQFA 3BRCA 4X1YB 3U0ZA 4DR2B 3HKDA 3T1YB 2F4VH 4TQDA 2HGSA 3TY8A 2YI8A 4DV2H 5JQGA 1FFXB 4I55A 2UXBH 4RAZA 5J2UB 2PYJA 3M7MX 3TY5A 4B3MB 2HEPA 1CKNB 2P22C 3BABA 1XNQH 1M93A 1Q43A 4YJ3A 4X65B 4LF9H 3JARA 2ZNJA 5LXTA 3VNNA 5KMGB 5JVDB 5BMVB 1IBKH 4KHPB 2VWJA 1E4FT 3IG0A 1WPBA 3RYHA 4LF8H 3JARB 5LXTB 3UQ8A 5JJJB 4MTEA 3RYIB 3RFRA 5BR8B 1J5EH 1O75A 3JATA 4TV9A 4ZI7B 3HKCA 2HIXA 5KMGA 1JFFA 3N2GB 3JAKB 2OYQA 2ZIOA 4UCVA 1YEWA 2PZSA 1P8LA 5EOYA 4YJ2A 3RGZA 3RYHB 2YXLA 1SQFA 1JMKC 2RQ6A 5CA1B 4DR5B 2F1MA 5CA0B 2JVDA 5C8YA 5J2TA 3W1GA 4FFBB 2VQFH 4JI4B 3FFQA 4HNAA 5FPRA 1JFFB 5FPOA 4X65H 1H2SB 2VOBA 5BR8H 4JI7H 2QM4A 1XNRH 4DR3H 4DV2B 5LMUB 4ZHQA 4LSXA 5K1XA 1XMQB 2F66C 1N33B 5FD6A 5EIBD 2GV9A 3A2FA 4GKKB 5CA0A 3CVZA 3T1YH 2HHHH 3K5LA 5KHJA 4PDBA 2Q0AA 4O4LB 1WN7A 5JH7B 2OWOA 4DUYH 2KSWA 3RJ0A 4LFCB 4DV3H 5ITZB 3N2KA 2Q2UA 5CB4A 4CH3A 4DV1H 5LA6B 1HR0B 1O9HA 3JALA 3K59A 4LNUA 4DUZB 4RB0A 1SA0B 2UU9H 4CS3A 4LSAA 4DR7H 4GKJH 3K57A 4OX9H 2YIBA 2YI9A 1M0TA 4DV4H 2E5LH 5CA1A 4JI2H 3HKBA 4F6RB 4X66H 4EB6A 2UUBH 1VS0A 4LF5H 5LA6A 1X9NA 4FLZA 4NXNB 1N36B 5C8YB 3K58A 4IHJB 4IIJB 1P49A 4CS2A 4D7TA 4JI5B 1FJGB 1X4TA 4X62H 1XHXA 2CAZC 3N43B 4F6RA 3JASA 4O4JB 4MV7A 4ZOLB 2UXDH 2ZM6B 3THOA 1XI1A 3RYFA 4JI8B 5JJNB 1ZAUA 1QHTA 3WB2A 3J80W 3HKDB 3QTCA 3SJBC 5LYJA 2WDTA 2RGVA 3K5OA 4DR1H 5GONB 4AQYB 4LF6B 3FMAA 3HKCB 3VQYA 4ZIBA 4LF7H 4UCUA 3KAJA 4DV0H 4DR1B 4RB3C 3LNNA 3JSNA 4LF5B 4DRXA 4BWAA 3DSQA 2VUGA 4FLYA 3DF7A 3ZS8C 2Q7EA 1P16A 4LR3A 5D1OA 3SJCC 5LOVA 5BMVA 2UU9B 4E6NA 4DR7B 4FLTA 3GB8B 1HNWH 2F93B 5J2TB 3K3VA 4CS4A 5JQGB 1I7FA 5IJ9B 1HNXH 1Z5WA 5FNVB 5D5QA 2CFMA 4B3RB 3CSXA 5D1OB 4IHJA 4I50A 4CH4A 2RGRA 5LMNB 2CW7A 1IBLH 1HW7A 2ZNIA 5D1PA 4GKJB 5JCOA 1Z5VA 4NVPA 4TV9B 4AILC 4JI3B 3RYFB 2V4DA 3WB0A 4K8XA 4HBNA 1WH2A 4GYCB 4LFBH 4TV8A 1FVIA 4EFEA 3N2KB 5KHKA 4TUYB 3H20A 3UT5B 2QJ1A 1TUBB 1NT2B 3ETQA 3NC0B 4YHHB 1Z2PX 1L2ZA 1N36H 4B08A 1N34B 5J2UA 4UCSA 4EB6B 3L4JA 4LH6A 3JSLA 1E4GT 1FKAH 2JGUA 3GDEA 2VWKA 3N6XA 3JAMW 4LF6H 2ZCEA 1XDNA 4I4TB 2YIBD 3MWMA 3E22B 3U11A 4ZI7A 2HVRA 5EYPB 1IBKB 2KKWA 1M4UA 5EIBC 4LFCH 4X1IB 4WBNB 2VQEH 4LF9B 1Z2NX 2UUBB 2EX3A 4DUZH 3K5NA 1T5EA 4DRFA 4GKKH 1A0IA 4KHPH 4UCOA 4LMYA 4JI0H 4ZHQB 4JV5H 4BWSC 4X1IA 1BGWA 4DV5H 5JJEB 2YCHA 5A2QW 5KHHA 5LMUH 3S24A 3C0FB 1TAEA 1N33H 3OTOB 3UT5A 3KYHC 4UCRA 1XQ8A 1TUBA 3B2EE 4B3MH 4RZQA 3SR2C 2Q7GA 4LF8B 4IIJA 2BTQA 1S5JA 4Q0YA 4JYAH 1XMOB 3VQWA 3T1HH 1XMQH 1AN7A 3J7AK 2UXCH 4Q6GA 5LP6A 2RJZA 5CB4B 1I6UA 1MZBA 3IAYA 4DV3B 4O4LA 4M7EA 3L2PA 5FNVA 4K0KH 2JS5A 2VQFB 4FLWA 2E3CA 3KAKA 2UUCB 3BPZA 4HNAB 4JI1H 2Q2TA 3E22A 1GYFA 1SQGA 4X1KB 4B3TH 4FLUA 4DR6H 3OTOH 3K5MA 1B04A 4RAYA 4DRXB 3GJXB 4CC6A 2F4VB 4O4HA 4O4IB 4DV4B 5DISC 4L8JA 2WE6A 1SKVA 3F8NA 4JYAB 4FM0A 1L8DA 5IWAH 5JH7A 4NXMH 4X1KA 2P5OA 4ETSA 2PY5A 3RYCA 4DV1B 2R70A 3JASB 4O4JA 4K0KB 4DR5H 3JALB 1XK5A 1TVKB 1XNQB 4EQ5A 4I50B 1D5AA 2BTQB 1SEIA 2UUAH 1IBLB 2HVQA 3RTXA 1Q5OA 5KHIA 1BJTA 3N41B 3KXYT 3SJAC 5LP6B 4CH5A 4FM1A 1XMOH 4I4TA 4I55B 4DK1A 3RGXA 1IBMB 1XNRB 4DV7B 3RR5A 3RF2A 4X64H 1CKNA 4U3JB 3RGBA 1QQCA 4LFAB 1CKMA 3HXLA 1FFXA 1HNZH 4JV5B 2F95B 5IJ9A 3JATB 2HVSA 3T1HB 1VF7A 3BHPA 4B3SB 4R7RA 4X20A 4D7SA 1I94B 4FLXA 3N40P 1M5IA 4U3JA 5IJ0B 4EFBA 4LFBB 3OTFA 3KALA 3W5OA 4FM2A 4O2BA 4IAJA 4CH6A 4B3SH 4DR4H 2WYOA 3QF7A 3EYYA 4A2AA 4X1YA 2XIGA 3NBYB 4X20B 2Q7HA 3M4IA 4RB1A 5LMNH 4AQYH 2O03A 4PHZA 4FLVA 4JI6B 4O2BB 4I9QA 5EYPA 3MAQA 4YY3B 1N32H 4PI2A 3U10A 3JAKA 4LF4B 4DR2H 3TY9A 4JI5H 4PZ8A 5JCOC 4YJ2B 3N44B 3RWRD 4TUYA 1KU9A 4UFZA 4YJ3B 2PGGA 2PUSA 1N34H 3WB1A 4JI8H 3BA8A 5K1PA 4DV6H 3L4KA 4UCTA 4YHHH 1Q8IA 4FFBA 4DUYB 4DR6B 4O4IA 4O4HB 1G6UA 2E5LB 3LMLA 1SYXB 1FJGH 4RB2C 4LNUB 1TGOA 5LP6C 1O9GA 4JI6H 5IJ0A 3W1BA 3VQXA 1DGSA 5FD5A 3RYCB 3JAWA 4O2AB 4JI7B 4DV5B 4JI2B 5IYZB 5LL6b 1JJOA 3N2GA 4A2BA 4FVMA 2CW8A 1HNZB 4EEQA 4JI4H 1HNWB 4JI1B 4LH7A 1ZHQA 4JI3H 2R72A 1Z2OX 2W57A 4DV7H 2VQEB 5D5PA 3RIZA 1I94H 2IM9A 1SA0A 2UXBB 2ZM6H 4K8ZA 2UXDB 5EZYA 3ZEDA 4MTDA 2HHHB 3JAWB 5ITZA 4O2AA 3SGIA 5KHGA 2ZINA 3HKBB 5IWAB 5GONA 5IYZA 4BW9A 2ZIMA 4X64B 4LFAH 5KX5B 4GLXA 3RYIA 4FM9A 1V9PA 4I7HA 1TA8A 2HIVA 3BAAA 4DR3B 4PZ7A 4WBNA 4B3RH 3VQVA 1RSOA 4PI0A 4DV6B 2PTMA 4LF7B 4APMA 2FE3A 4JI0B 2ZJTA 3PN1A 2UUAB 1TVKA 5KX5A 1ZHSA 4KL1A 5IT9W 4X62B 2XHBA 5LOVB 2PYLA 3QG5A 4TOIA 4NXMB 4LF4H 3N42B 3BA9A 4MV9A 4J0MA 2YIAA 4NXNH 5FLXW 4ZOLA 3NBZB 1IBMH 3CHXA 1J5EB 2BTOA 1XHZA 4DV0B 1WNSA 1Q3EA 4CC5A 5JVDA 2UXCB 4B3TB 1S03G 2R9AA 5LYJB 3CB2A 3HKEA 1CKOA 1KMIZ 4OX9B 2MCTA 1N32B 1S68A 4YY3H 4AHCA 4DR4B 1HR0H 2VPSA 2UUCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZ6 A;  1HNX B;  4LF9 B;  3QWU A;  2UUB B;  4X66 B;  1VS0 A;  4JI6 B;  1X9N A;  4DRF A;  4NXN B;  1A0I A;  4UCO A;  4YY3 B;  1N36 B;  4DR2 B;  4LF4 B;  3T1Y B;  3TY9 A;  4JI5 B;  4PZ8 A;  3TY8 A;  1FJG B;  3S24 A;  1TAE A;  3OTO B;  4UFZ A;  3KYH C;  4UCR A;  3TY5 A;  2ZM6 B;  4JI8 B;  4B3M B;  1ZAU A;  4LF8 B;  3BA8 A;  1CKN B;  1XMO B;  4UCT A;  3BAB A;  4DUY B;  4DR6 B;  4X65 B;  4DV3 B;  4AQY B;  2E5L B;  4LF6 B;  3VNN A;  3L2P A;  4UCU A;  2VQF B;  4DR1 B;  4KHP B;  4LF5 B;  3JSN A;  2UUC B;  3W1B A;  1DGS A;  2VUG A;  2Q2T A;  4JI7 B;  4DV5 B;  4JI2 B;  3UQ8 A;  1P16 A;  5D1O A;  1HNZ B;  2UU9 B;  4EEQ A;  4E6N A;  4DR7 B;  1HNW B;  4JI1 B;  1B04 A;  4LH7 A;  5BR8 B;  3GB8 B;  3GJX B;  4CC6 A;  2F4V B;  4DV4 B;  2VQE B;  5DIS C;  2CFM A;  4JYA B;  2HIX A;  4B3R B;  5D1O B;  4UCV A;  2UXB B;  2UXD B;  5LMN B;  1P8L A;  2HHH B;  4DV1 B;  3SGI A;  5D1P A;  4K0K B;  4GKJ B;  4DR5 B;  5IWA B;  4X64 B;  1XK5 A;  4JI3 B;  1XNQ B;  4GLX A;  4EQ5 A;  1V9P A;  1TA8 A;  1IBL B;  2HIV A;  3BAA A;  2HVQ A;  4DR3 B;  3RTX A;  3W1G A;  4PZ7 A;  4JI4 B;  4DV6 B;  4LF7 B;  1FVI A;  4EFE A;  5FPR A;  4JI0 B;  5FPO A;  3PN1 A;  2UUA B;  1IBM B;  4DV2 B;  1XNR B;  4DV7 B;  4X62 B;  5LMU B;  3RR5 A;  3NC0 B;  4YHH B;  1XMQ B;  1N33 B;  4TOI A;  4NXM B;  1CKN A;  1CKM A;  4LFA B;  3BA9 A;  4JV5 B;  4GKK B;  1N34 B;  4UCS A;  3NBZ B;  2HVS A;  4LH6 A;  3JSL A;  1J5E B;  3T1H B;  4B3S B;  4DV0 B;  2OWO A;  3GDE A;  2UXC B;  4CC5 A;  4B3T B;  1I94 B;  4LFC B;  1CKO A;  1XDN A;  4EFB A;  4OX9 B;  4LFB B;  1N32 B;  1S68 A;  2Q2U A;  3W5O A;  2HVR A;  1HR0 B;  4DR4 B;  4DUZ B;  1IBK B;  3NBY B; 
#chains in the Genus database with same CATH topology
 1SQV H;  2EIN C;  1ORQ C;  4YJ2 F;  5H5N A;  5I5U A;  3ICX A;  4WFB V;  4B3T O;  1V51 A;  5HBR B;  1N56 A;  3HKZ A;  3FYE B;  3U0Z A;  2HJD A;  1KC7 A;  1M56 B;  2XAH A;  5C1O A;  2D2C B;  4TQD A;  1YIJ V;  4X62 O;  4GX0 A;  4LP8 A;  4DV5 O;  4B3S O;  1VQN V;  3TY8 A;  2YI8 A;  3Q8S B;  1SET A;  4N21 A;  3GV7 B;  4XYL B;  4RAZ A;  3NXS A;  1MSW D;  3A0R A;  4QJF B;  4J9Y B;  3JZ6 A;  1EYZ A;  3QO5 A;  1CKN B;  4DV4 O;  2DWC A;  1T94 A;  3PW5 A;  3JD1 A;  3K9A A;  2KG7 B;  2EJ3 A;  3H9V A;  2NN4 A;  3BY6 A;  4WHX A;  5TIS Z;  5LXT A;  5JVD B;  3ZHT A;  2V58 A;  1QCE A;  5L3C A;  3TQT A;  5LP6 F;  1Y14 B;  5KFC A;  3L70 H;  4JV5 O;  4WD3 A;  4I7Z B;  2HP8 A;  1DV1 A;  1W59 A;  1PL4 A;  4TSF G;  5LA6 F;  3RYI B;  2A3Q A;  5BR8 B;  5KT3 A;  1H8E G;  1EZJ A;  2YDE A;  1YJW V;  1VEW A;  3JAT A;  1RFY A;  4TV9 A;  5KMG A;  3G6B A;  3JAK B;  5K2M A;  4JAS A;  1P8L A;  3QQM A;  2UVW A;  2DPI A;  3RYH B;  3BG5 A;  1P84 F;  4FK5 C;  4DR5 B;  1JPX A;  2QR4 A;  2GHY A;  3BJY A;  4DL2 A;  3B09 A;  5C8Y A;  4YIP A;  1IXB A;  4MV6 A;  2EZO A;  2VQF H;  4JI4 B;  3KHR A;  2ILM A;  5IYC G;  1H2K A;  1P7G A;  3LUL A;  4XDK A;  4F4Z A;  2ITC C;  1VQ5 V;  4C5A A;  5BR8 H;  2VQD A;  4DV2 B;  5DN6 G;  5DG9 A;  2JGD A;  2BSK A;  2CH7 A;  3RBE A;  3ABM C;  4MSW C;  3Q2O A;  1VKZ A;  1PNL A;  3CVZ A;  4E4E A;  4NTX A;  2W70 A;  2HHH H;  3K5L A;  3BAC A;  5DQG A;  1NR7 A;  2JA5 G;  2DN9 A;  2X6C A;  4G3I A;  2X6B A;  2W9A A;  4O83 A;  3RJ0 A;  4LFC B;  3ABM B;  1JLL B;  3RUP A;  4DV3 H;  5BWU A;  3N2K A;  3OE7 G;  3E8H A;  5CA1 F;  2OTJ V;  5LA6 B;  3AYH B;  5KFZ A;  1RP3 B;  2DYR C;  4LNU A;  3F7V C;  4OXS A;  1SA0 B;  4RB0 A;  4EKW A;  4GKJ H;  3ZRV A;  1Y1V G;  2GDS A;  2YIB A;  3PFF A;  4DV4 H;  5CA1 A;  2GTA A;  4LF5 H;  4FLZ A;  5KS8 A;  1S0O A;  3N27 A;  2KB1 A;  3R5H A;  3H40 A;  1N36 B;  5C8Y B;  3K58 A;  4CS2 A;  3ASN B;  4MTG A;  4X62 H;  1JJ2 U;  2UVU A;  1OCZ C;  3N43 B;  1B06 A;  4O86 A;  4FZ1 A;  4MV7 A;  4I50 F;  3CEB A;  4ZOL B;  2QM7 A;  3SJQ C;  1XI1 A;  4H37 A;  2OIE A;  3WB2 A;  2JA7 G;  2QSA A;  3GB7 C;  3K5O A;  2AGP A;  4J41 A;  4Q44 A;  2Y4R A;  1JQ0 A;  5CAE B;  3SPI A;  3FMA A;  2Q8V A;  5L3B A;  3HKC B;  4DV1 O;  3SPC A;  4J7J A;  5KKN B;  1XL4 A;  3BQ2 A;  1JX4 A;  3BCC H;  2VUG A;  1IXM A;  1ZWI C;  4WFE A;  2XCP A;  2VS0 A;  3ZS8 C;  5EWF A;  1TWC A;  2Q7E A;  2ARH A;  1MNG A;  5LOV A;  5BMV A;  2UU9 B;  4O7Z A;  1I0H A;  4R50 A;  1NZ6 A;  3T4Z A;  4FLT A;  3PR4 A;  2FMA A;  2Q5Z A;  5JQG B;  4DL7 A;  2YRX A;  1Z5W A;  4J42 A;  5B66 Z;  4MVR A;  5D5Q A;  5D1O B;  4I50 A;  3H1L H;  1CEZ A;  2DAB A;  2RGR A;  4B3M O;  4RCN A;  3FB7 C;  3SYP A;  1CP9 A;  5FJ8 G;  3W7W A;  4GKJ B;  5JVD F;  3ZHV A;  4F4X A;  2DYS B;  4JI1 O;  1G1X B;  2A1H A;  1K4D C;  3UCS C;  1WH2 A;  3DTG A;  3FX7 A;  5IYD G;  2ZDH A;  1YCI A;  4MT8 A;  4MS2 A;  5KT2 A;  2R93 G;  2BR0 A;  2HFE C;  2YEV A;  2V5A A;  1TUB B;  3BQ0 A;  2Y48 A;  3MR6 A;  2CGN A;  3P32 A;  2YZL A;  4MTX A;  3FKS G;  2D3O W;  1GSO A;  3G4S V;  1L2Z A;  3T4D A;  1WCM A;  3MHH C;  3L4J A;  3JSL A;  3PO2 G;  4CKE A;  4O4J F;  3GDE A;  1YI2 V;  2VPQ A;  1MAB G;  4MVU A;  1XDN A;  3JCU Z;  4I4T B;  1UC8 A;  2YIB D;  2B63 G;  4A3M G;  1AI5 A;  1CQI B;  3G6X A;  3Q8R B;  3CRR A;  2GPW A;  2KKW A;  5EIB C;  1VQ9 V;  3JZI A;  3PO3 G;  3K9S A;  1J5E O;  2VQE H;  2IH1 C;  1Z2N X;  3Q8Q B;  4A3B G;  5EC2 C;  5KFT A;  4JV2 A;  2A7W A;  4R7C A;  1A48 A;  4RQE A;  4LFB O;  1SCU B;  3JAM N;  4LMY A;  5KT5 A;  4ZHQ B;  1AR4 A;  1FS0 G;  5JJE B;  5LMU H;  5C44 G;  2GPS A;  5CN0 A;  1N33 H;  1S72 V;  1I1L A;  4HYO A;  2XAQ A;  3G8D A;  3SI8 A;  2R93 A;  3GLK A;  2BTQ A;  3GIQ A;  1XMQ H;  2EIM B;  3UKM A;  1AN7 A;  2UXC H;  1EHI A;  5LP6 A;  1BQZ A;  4GUN A;  1PL0 A;  4JUZ A;  4RU9 A;  4QWB A;  3QZ7 A;  2JS5 A;  4FLW A;  3MR2 A;  5LHH A;  1FXK C;  1H2G A;  3BPZ A;  2Q2T A;  2AGA A;  3K79 A;  3CEI A;  3ZMZ A;  4GLW A;  2R8G A;  1SQG A;  4DR4 O;  1RM1 C;  1IBL O;  1R3K C;  2GQR A;  2HKO A;  3K5M A;  4O3O A;  2QWP B;  5EC1 C;  2JEF A;  2M7W A;  2B63 A;  4NTY A;  1S97 A;  2WE6 A;  4I0X A;  4KFM A;  1SKV A;  1L1F A;  4NXM H;  2HVK C;  4U3F H;  4DO2 A;  2ETN A;  1JCH A;  4ETS A;  3RT3 C;  4DV1 B;  3JZF A;  2JS3 A;  3DC5 A;  2R70 A;  4G2K A;  3CCM V;  5LYJ F;  1YJ9 V;  1EN5 A;  1XK5 A;  4L1K A;  1QVG U;  1OZ0 A;  1E79 G;  1TVK B;  3C3T A;  4I4T F;  4EQ5 A;  2QE7 G;  2BTQ B;  1SEI A;  1QLE B;  3JD4 A;  4O7L A;  2QTS A;  4X89 A;  3KXY T;  1GLV A;  5LP6 B;  1MZE A;  2BQU A;  2UVR A;  1ET0 A;  2WB1 A;  2F23 A;  4I55 B;  2RNB A;  3CRA A;  2W6Z A;  4FFK A;  3RGX A;  5FR9 A;  1IBM B;  1HWY A;  5BXZ A;  4DV7 B;  3RR5 A;  2E2H A;  4X64 H;  1WCM G;  1CKN A;  2EIK C;  3HXL A;  5A9G A;  1FFX A;  2MK3 A;  1RJR A;  1SQQ H;  4FZ0 A;  5IJ9 A;  2W71 A;  3HOX G;  4F4Y A;  2HVS A;  4L87 A;  1KEC A;  3U54 A;  4HAM A;  5CBF A;  2Q73 A;  3SNO A;  5L3F A;  3H0G G;  4D7S A;  1I94 B;  4FIP C;  3M8A A;  2LW7 A;  5IJ0 B;  3KAL A;  3OHA A;  4HNV A;  4CH6 A;  4QWD A;  5LBQ A;  2COJ A;  4IWY A;  2FB5 A;  4A2A A;  4X1Y A;  1VQK V;  3NBY B;  3T9D A;  1S10 A;  1PPJ H;  2YIC A;  1AJP A;  3M4I A;  5LMN H;  1ARO P;  4PHZ A;  1NS1 A;  4O2B B;  2EBO A;  4I9Q A;  4WFF A;  3D8C A;  4YY3 B;  1N32 H;  4PI2 A;  3U10 A;  3R5F A;  2AQ4 A;  2HHF B;  3T1H O;  3I4N G;  3TY9 A;  4YJ2 B;  4LCU C;  2EIL C;  3N44 B;  3RBZ A;  5KUM A;  2YID A;  4YJ3 B;  1S76 D;  1XRE A;  3ETE A;  1N48 A;  2A9H A;  3OUS A;  2PUS A;  4MAM A;  3TXS A;  4ZHQ F;  3OW2 U;  4O3P A;  5K1P A;  4DV6 H;  3O9O A;  4UCT A;  1P4R A;  3CP1 A;  1Q8I A;  1IDS A;  2EIL B;  2GBO A;  4O7R A;  4O4H B;  1KKC A;  4EGJ A;  3SE7 A;  1FJG H;  4RB2 C;  4HQ6 A;  1DV2 A;  2PF4 E;  2J6T A;  3VQX A;  4UUJ C;  1DGS A;  3OGC C;  3T1C A;  5FD5 A;  3GIK A;  3JAW A;  2CNU A;  3E89 A;  4DL3 A;  1GK9 A;  1JJO A;  3N2G A;  3DXR B;  1HNZ B;  4EEQ A;  4JI4 H;  5LOV F;  4ECW A;  4JI3 H;  3CD6 V;  2R82 A;  3KG2 A;  1V54 B;  2HG5 C;  2CNQ A;  5EBL C;  2R85 A;  2P67 A;  2DAA A;  1I94 H;  1Q82 W;  1PKX A;  1FFT B;  2UXB B;  2P0A A;  2ZM6 H;  4MTD A;  1OHH G;  4IRC A;  4O2A A;  5ITZ A;  4PA7 A;  4ZKI A;  4ICG A;  1WJZ A;  3HKB B;  5IWA B;  4TQS A;  5IYZ A;  4BW9 A;  1I1M A;  4X64 B;  2LFR A;  4O3Q A;  3K04 A;  3RYI A;  4W4K A;  5J2U F;  2HIV A;  4DR3 B;  4B3R H;  3VQV A;  4PI0 A;  2VRZ A;  4WBN F;  1DF5 A;  5KFI A;  4JAV A;  2XAF A;  3GID A;  4UVC A;  4DQN A;  1TVK A;  2W0F C;  2R7K A;  4X62 B;  4O2B F;  5DLF A;  1WP8 A;  4Y8V B;  1LNQ A;  3B40 A;  3K06 A;  4LF4 H;  3N42 B;  4MV9 A;  4HYK A;  4DR6 O;  2AHZ A;  2W8L A;  2C2A A;  3NBZ B;  4GX2 A;  3CHX A;  3K5I A;  4HNT A;  3AG4 C;  4XDJ A;  3TGU H;  4FBT A;  4DV0 B;  2IMW P;  1Q3E A;  3BEH A;  2WLH A;  2R9A A;  4NLG A;  1CKO A;  1NU1 H;  2ZM6 O;  4DR4 B;  1XBL A;  1SQX H;  4RUA A;  3PZP A;  2OLS A;  4FFO A;  4U7C A;  3ML0 A;  1FPO A;  5B1N A;  4NZO A;  3M9N B;  1QR8 A;  4RNO A;  4F50 A;  3ASN C;  3P3P A;  5KG0 A;  4TV8 B;  4PZ6 A;  3JD0 A;  3HKE B;  3J81 W;  3B8M A;  2QA4 V;  1SFO A;  4JI4 O;  4DK0 A;  1FXK B;  1W0J G;  2WAM A;  2X0L A;  1AVM A;  2UUA O;  5KFJ A;  1S0M A;  3JRW A;  3T1Y B;  3FKI A;  2C2R A;  2F4V H;  3HB3 B;  4DV2 H;  3ETJ A;  1A3G A;  3TY5 A;  4FMT A;  1Q90 D;  4UV9 A;  2RDI A;  3TXQ A;  5B3S B;  3GIM A;  3ZHR A;  3J81 N;  2ZE8 A;  4U7O A;  2P22 C;  5IYB G;  2JJ2 G;  4MTF A;  3OFN G;  4DV6 O;  4J9M A;  3CRQ A;  3G80 A;  4IT5 A;  3K3W A;  3OMA B;  1MZF A;  4GZR B;  5DGH A;  1SS3 A;  1VIB A;  1ZET A;  4YJ3 A;  1XNQ H;  4ZOL F;  5HFL A;  3JAR A;  2ZNJ A;  5F2V O;  4LF9 H;  2UUB O;  1SZT A;  1BHA A;  4ED2 A;  4E2L A;  3GIJ A;  4DAA A;  2YS8 A;  3GTJ A;  4KHP B;  4A3C G;  2VWJ A;  2L35 A;  2AZ2 A;  3RYH A;  4LF8 H;  1K3E A;  3N6R A;  2WLM A;  5FL7 G;  3JAR B;  5JJJ B;  4BBR G;  1BS3 A;  5KFX A;  1R3L C;  2ODM A;  4YJ3 F;  1KUQ A;  3DAA A;  4MVM A;  1ZL8 B;  3OHB A;  2HIX A;  1JFF A;  3Q8P B;  3OEE G;  2PZS A;  4YJ2 A;  1MOF A;  3E2E A;  1PD3 A;  3OAA G;  3R65 A;  5B1A B;  1WB8 A;  2V59 A;  3FB8 C;  1RJP A;  4FU0 A;  1M57 C;  2JVD A;  1GMG A;  3K3P A;  4QSH A;  1Y74 A;  2W6I G;  3I4M G;  3W1G A;  1OCO C;  5E79 Z;  1KJI A;  1NH2 B;  4HNA A;  4UB6 Z;  1KP3 A;  1OJH A;  3RB0 A;  3TJT A;  5DG8 A;  1H2S B;  4P30 A;  2VOB A;  3CS5 A;  3RVY A;  1B6S A;  1XNR H;  3F5T A;  2RF4 A;  4YR3 A;  5FD6 A;  2V7Q G;  5L1I A;  3T1Y H;  2BOB C;  4ECV A;  5KFW A;  4LF6 O;  4PDB A;  2Q0A A;  5GTH Z;  5JH7 B;  2OWO A;  1BQ0 A;  4BXX G;  3PVX A;  3HOZ G;  4QWC A;  3H1H H;  4CBC A;  3K0D A;  5ITZ B;  2CDY A;  2Q2U A;  4YR0 A;  3V6J A;  4OPA A;  3O65 A;  1HR0 B;  4NXM O;  3CCJ V;  2YRW A;  2UU9 H;  4W4L A;  2PMZ A;  1K97 A;  3ASO B;  2XC9 A;  2JA5 A;  2YI9 A;  1M0T A;  4X66 H;  3GWO A;  4EB6 A;  2UUB H;  1VS0 A;  4I55 F;  5CBG A;  3CX5 F;  3JD3 A;  4NXN B;  4ASU G;  2UXB O;  3KHL A;  4IIJ B;  4JYC A;  4X65 O;  1E4E B;  5KX5 F;  2YXH A;  2OT5 A;  1X4T A;  1VAR A;  4Q43 A;  1BXR A;  3WG7 C;  2ZM6 B;  4O4I F;  4QIW A;  3OMN B;  3RYF A;  4JI8 B;  3I12 A;  3K5H A;  4DV2 O;  3J80 W;  2J6U A;  1X59 A;  3SJB C;  2UXC O;  5H2F Z;  2YL2 A;  1NVP D;  1EM1 A;  3A0H Z;  3RB3 A;  1VF6 C;  3B8N A;  4DLK A;  4PDV A;  4EYH B;  4ZIB A;  4LF7 H;  3L73 H;  4RB3 C;  3LNN A;  3JSN A;  2IW5 A;  3ABK C;  3OR7 C;  4LF5 B;  2P7T C;  2IJI A;  1E1Q G;  4Q8E A;  4FLY A;  4BBS G;  3M99 B;  3DF7 A;  3WWJ A;  3CWB H;  3J80 N;  3H0G A;  4UVB A;  1VMG A;  2F93 B;  2E76 B;  1RK5 A;  2DW4 A;  1GN2 A;  4PEL A;  5FNV B;  3R66 A;  2CFM A;  1VF5 B;  3KCY A;  4CH4 A;  4LF4 O;  3ETH A;  1AI7 A;  2CW7 A;  4OX9 O;  2WAQ E;  4GX5 A;  3PW0 A;  3HOV G;  1I1K A;  5BWX A;  3TEK A;  5GON F;  3KCX A;  1M7J A;  2CGO A;  4TV9 B;  2Y0S A;  1D5N A;  2NVY A;  2X0S A;  5KFO A;  2H94 A;  1BT8 A;  2EJR A;  3WB0 A;  3L74 H;  3OGI B;  3T5K A;  4GYC B;  5KUK A;  2VR1 A;  1KBL A;  1R3I C;  1AIL A;  3N2K B;  1R6K A;  2FP4 B;  2QJ1 A;  5KFS A;  1NBM G;  5DM6 V;  3B4S A;  4A3J G;  1D2D A;  4MVQ A;  3TII A;  2IA6 A;  4YHH B;  1UPG A;  4B08 A;  1N34 B;  3Q1K A;  2ASL A;  5DQH A;  3N8D A;  4QPK A;  2ASJ A;  3IN5 A;  3VPC A;  2DQ3 A;  4JI3 O;  2JEJ A;  4KHP O;  3N6X A;  3JAM W;  4YY3 O;  4A3F G;  3D36 A;  3E22 B;  3U11 A;  2HVR A;  2YEV B;  2Y0I A;  2FB9 A;  5KFA A;  2JEI A;  2ODT X;  4NR1 A;  3P30 A;  1AUV A;  4X1I B;  3T5H A;  4WBN B;  4LF9 B;  1N0J A;  2UUB B;  4K0K O;  2EIK B;  3AG3 B;  1VQ4 V;  2HG8 A;  4MV8 A;  5EWG A;  4J9S A;  1A0I A;  4H44 B;  5EDW A;  1AI6 A;  2FLL A;  4KHP H;  1OCR C;  1WP7 A;  4X1I A;  1NH2 D;  5A2Q W;  4XZ3 B;  3OTO B;  3UT5 A;  2B9Z A;  4QIW F;  5EWE A;  4EEY A;  2WLJ A;  1K92 A;  4RZQ A;  2Q7G A;  2WA4 A;  2CQY A;  4IIJ A;  4Q0Y A;  1SRY A;  3T1H H;  2SCU B;  2RJZ A;  4PA4 A;  5CB4 B;  3CME V;  4DV3 B;  4OPH A;  1T36 A;  2ZGI A;  4K0K H;  3QZ8 A;  2OCH A;  1YJN V;  5KFM A;  2I8C A;  4HNA B;  5CBH A;  4YBZ B;  3E22 A;  3P3N A;  4PA9 A;  5KG2 A;  1GYF A;  1V55 C;  3CCU V;  1FYJ A;  1OCC B;  2XT9 A;  2ADQ B;  4Z1M G;  3OTO H;  1RJQ A;  1Z2G A;  1B04 A;  1NR1 A;  1YTF D;  3GJX B;  4O4H A;  3T9F A;  2WLI A;  4DR1 O;  5H6R A;  2ATK C;  4GX1 A;  4J9Z B;  3R5X A;  4GT1 A;  2MW2 B;  4CKB A;  2P90 A;  1BSM A;  1KJJ A;  2R9R B;  3CSW A;  3RYC A;  3APQ A;  3JAS B;  4O4J A;  4DR5 H;  3RAX A;  1FXH A;  3JAL B;  2NU7 B;  4HN2 A;  3X2Q B;  1XNQ B;  2YS6 A;  4JI8 O;  4QNH B;  3OUU A;  3WWH A;  1H2M A;  2HVQ A;  5KHI A;  3H1K H;  1I50 A;  1S3J A;  4YAJ B;  3PW4 A;  4CH5 A;  2HVJ C;  2Q4P A;  2RDC A;  2UXN A;  4I0X B;  5CA3 A;  3KHH A;  5JUM A;  4DK1 A;  1PNM A;  1ZTE A;  3HO8 A;  2HLD G;  4QW9 A;  3ABL C;  2V1D A;  5KA6 A;  5BWV A;  3LSS A;  5DQI A;  4U3J B;  3RGB A;  3UFX B;  1HNZ H;  1MMM A;  4O7V A;  2YZG A;  1VF7 A;  2XOK G;  4BIO A;  2LO1 A;  4R7R A;  4X20 A;  4FLX A;  1TWF A;  4EBD A;  5K3W A;  4U3J A;  1Q6I A;  3CPW U;  1G4Y B;  4NTW A;  2DYR B;  4FE2 A;  4FM2 A;  4O2B A;  4IAJ A;  4B3S H;  4DR4 H;  1YXB A;  1SQB H;  3QF7 A;  4NB5 A;  2VA3 A;  5H6Q A;  2XIG A;  4QIW E;  5KG4 A;  4C2M A;  4X20 B;  3HB9 A;  4YP3 A;  2CTR A;  2COI A;  4JGS A;  5DAA A;  1XDC A;  4MW8 A;  3ZMT A;  4FLV A;  4WFH A;  2CUG A;  1VQ6 V;  1ZL8 A;  1CE8 A;  1Y67 A;  2ZE5 A;  2NR5 A;  3R9R A;  4C5B A;  4LF4 B;  3JAK A;  5B1O A;  5IYB O;  1GN6 A;  4PZ8 A;  4YQW A;  4TM5 A;  5I5S A;  4UFZ A;  1COW G;  3U55 A;  1KBH A;  1K1S A;  5E1A C;  2PGG A;  1B6Q A;  2R87 A;  4JI8 H;  3OMI B;  3BA8 A;  1K73 W;  4MV4 A;  4FPP A;  5KA5 A;  4TT3 G;  2W6Q A;  4FFB A;  2NLJ C;  2F43 G;  2E5L B;  1SYX B;  1S5L Z;  1TGO A;  4DR3 O;  4ECZ A;  1O9G A;  4JI6 H;  5IJ0 A;  4JYA O;  2V4R A;  3GTM A;  4JI7 B;  4C7U A;  4JI2 B;  2FL4 A;  3ZBH A;  5KFF A;  2M05 A;  2ZKO A;  1HNW B;  5KT4 A;  3AW8 A;  3OM3 B;  1Z2O X;  2W57 A;  4DV7 H;  3MD0 A;  2VQE B;  5D5P A;  3RB4 A;  3ABU A;  3HPL C;  3K0G A;  2W9B B;  4IYH A;  2YZM A;  2UUC O;  2H8P C;  3OR6 C;  1GSH A;  1NJI W;  2IM9 A;  4YAK B;  2FK2 A;  1SA0 A;  2HR3 A;  5KLV H;  1N34 O;  2AGQ A;  2GSM B;  4FFL A;  5KHG A;  2ZIN A;  5B1B C;  2R86 A;  4XYM B;  2ZIM A;  2R7N A;  4M9U A;  4O84 A;  5KX5 B;  4FM9 A;  4N23 A;  4JV0 A;  1FAF A;  3BAA A;  5I5W A;  4U7N A;  2PVP A;  3VA7 A;  4PZ7 A;  4WBN A;  1QLE C;  1RSO A;  1MSD A;  2JA7 A;  4APM A;  2X6A A;  2FE3 A;  4JI0 B;  3PN1 A;  1LUV A;  2UUA B;  3ZIA G;  5KX5 A;  4U6P A;  3CXH F;  4KL1 A;  1C3O A;  2DOS A;  2XHB A;  3GII A;  5LOV B;  2PYL A;  1NTZ H;  2COG A;  4FJC C;  4NXM B;  3ZN1 A;  3RFC A;  5LMN O;  5FLX W;  3V6K A;  4ZOL A;  1CPY A;  2QWQ B;  3FB6 C;  1WB7 A;  1R6T A;  5BZB A;  5CA0 F;  3TK1 A;  2MCT A;  1N32 B;  4YY3 H;  2QM8 A;  2VPS A;  4MW3 A;  1I08 A;  1SES A;  2QKS A;  3CC2 V;  5EZY B;  1RYS A;  1NQT A;  3HR0 A;  1BMF G;  1M0W A;  3QWU A;  2CTP A;  1JOY A;  3FAV A;  2XAS A;  3HKZ E;  2X7R B;  1XNQ O;  3BRC A;  4X1Y B;  2YUA A;  2W7O A;  3HKD A;  1MA1 A;  5LGT A;  2HGS A;  1IX9 A;  2DWE C;  2XND G;  2NU6 B;  2EJ7 A;  1IZ3 A;  4B3M B;  2HEP A;  3ETG A;  1CQJ B;  2QF7 A;  2HHF A;  3L71 H;  4H13 B;  3V4S A;  2BCC H;  2LFS A;  3BAB A;  1WRV A;  1KQS U;  2C2D A;  1PV0 A;  1YF2 A;  4X65 B;  4IRD A;  1AI4 A;  5L3D A;  4WCE V;  2ABJ A;  2YU9 A;  4QPJ A;  5BMV B;  4M0J A;  1S0N A;  1N33 O;  1E4F T;  1WPB A;  1EZ1 A;  4ZBM A;  5HFM A;  5AG2 A;  4H33 A;  5LXT B;  3T54 A;  4JI6 O;  3UQ8 A;  4MTE A;  4R8C A;  4JAU A;  2CTW A;  2Y0S E;  3RFR A;  2I80 A;  5KFE A;  4KP4 A;  2W6M A;  1J5E H;  1ENV A;  4NKG B;  2BOC C;  1GO3 E;  1OBG A;  3G8C A;  1K9M W;  4JXU A;  5IYZ F;  2ZT9 B;  1I7N A;  2OYQ A;  5KT7 A;  3SYC A;  5IY5 C;  1YEW A;  1NKD A;  1VQ7 V;  2WB1 E;  5EOY A;  3RGZ A;  5KFU A;  4J9Q A;  5GTI Z;  5H9C A;  5CR5 A;  4OGQ B;  3RB6 A;  1KTA A;  1XMQ O;  5E25 A;  2AHY A;  5CA0 B;  2R92 G;  3ABK B;  2V9W A;  3CYO A;  1YVW A;  2CZG A;  1Q6H A;  5J2T A;  1WR2 A;  2W6P A;  3BQ1 A;  1FJG O;  4FFB B;  1EN4 A;  2Y4U A;  1K33 A;  5FPR A;  2C2E A;  4PDM A;  2DYS C;  5FPO A;  4X65 H;  2QM4 A;  4O4H F;  3J7A U;  5LMU B;  4LSX A;  3ABL B;  3HBL A;  1XMQ B;  2F66 C;  3TW6 A;  3HOW G;  4FGR A;  3H1I H;  1KEE A;  4O7S A;  1TWG A;  2GV9 A;  2W8K A;  4Q20 A;  3A2F A;  3LWB A;  5CA0 A;  3T99 A;  4QGP A;  4DUY H;  1K83 A;  4P9P A;  2XTA A;  3WG7 B;  1ZSP A;  4R8U B;  1W96 A;  5LXT F;  2XAJ A;  4PJ0 Z;  5CB4 A;  1KKD A;  2W9B A;  1O9H A;  2H3O A;  4UXN A;  3K59 A;  3ZHS A;  1R73 A;  4CS3 A;  4JI0 O;  1SER A;  2JGD B;  3LDC A;  4LSA A;  4XBF A;  2Z04 A;  3K57 A;  5KAF Z;  1WLE A;  2QK4 A;  4JI2 H;  3HKB A;  4JV1 A;  3CC7 V;  5LA6 A;  1X9N A;  4JF3 A;  1EN6 A;  2DJV A;  1KP2 A;  3AG7 A;  4D7T A;  2BE3 A;  3S3X A;  4JI5 B;  5F9N A;  4BIU A;  3E5N A;  3MDS A;  1XHX A;  2CAZ C;  5L3G A;  1XOU A;  3JAS A;  4O4J B;  1QU7 A;  4DR5 O;  1GKF A;  2FPG B;  4Q45 A;  3GIL A;  2UXD H;  2HDK A;  1KC8 W;  2Q69 A;  4PD4 F;  3THO A;  1OBD A;  5I5V A;  2C28 A;  4ED7 A;  1QHT A;  1R6N A;  3HKD B;  3EVK A;  3QTC A;  5LYJ A;  2ZXW C;  5J9P C;  1VQM V;  2PN1 A;  1AP5 A;  2WDT A;  4DR1 H;  4ED8 A;  5GON B;  2NNU A;  2JRI A;  3I5D A;  4AQY B;  4MV3 A;  4LF6 B;  2ZD9 A;  2Q67 A;  1JVM A;  3FB5 C;  2W6N A;  2JIZ G;  4IYI A;  3VQY A;  3OTO O;  3KAJ A;  4DR1 B;  1IOW A;  1GAX A;  4DRX A;  3GTL A;  1ZX3 A;  2IU0 A;  3E8B A;  1F51 A;  1HR0 O;  1AB3 A;  4IL6 Z;  1RK6 A;  4LR3 A;  1K8A W;  3SJC C;  4O81 A;  2UVV A;  4UV8 A;  2LW1 A;  1IOV A;  2OTL V;  3GB8 B;  3LQS A;  2GUZ A;  3ZHQ A;  3OUZ A;  1XEQ A;  3GVM A;  1Q6U A;  4CS4 A;  1I7F A;  5IJ9 B;  1XNR O;  1OV9 A;  3Q4H A;  4P9O A;  5IP7 G;  3CSX A;  4IHJ A;  1H2N A;  3E35 A;  5LMN B;  1IBL H;  2ZNI A;  5D1P A;  3RW0 A;  5JCO A;  1Z5V A;  5KFG A;  4AIL C;  2W9C A;  4RUE A;  4HBN A;  5KFY A;  4TV8 A;  4TV8 F;  2R8H A;  2AGO A;  1FVI A;  3APO A;  4EFE A;  4TUY B;  3H20 A;  2CNV A;  2F4V O;  3ZMV A;  4RZR A;  1UFI A;  3U9T A;  3ETQ A;  2Q0O C;  1VBH A;  4CZZ A;  3NC0 B;  5KFD A;  1OCZ B;  1HP8 A;  5BWR A;  1N36 H;  3H01 A;  4UCS A;  4EB6 B;  3T5L A;  3PR5 B;  4LH6 A;  2WLL B;  4ECY A;  1E4G T;  4GKJ O;  2Y0P A;  4DIM A;  4QJF A;  1FKA H;  1H8H G;  4NZN A;  1W0K G;  1NTM H;  2R7Z G;  4QWA A;  2K1E A;  4ECX A;  1VQ8 V;  4DV3 O;  3MHS C;  2XCA A;  4ZI7 A;  5A2Q N;  1UJW B;  2A79 B;  3MR3 A;  3M9M B;  2HGX A;  2WLL A;  4Q4C A;  4RAI A;  4LFC H;  4EBE A;  5KFL A;  3TCU A;  4MVZ A;  2LP7 A;  4IR1 A;  5HV6 A;  2FJZ A;  1EKV A;  1S77 D;  4D6T H;  1QNM A;  2XAG A;  3T9A A;  4O7W A;  5JVL A;  3T9E A;  4A3E G;  2W6J G;  5IYC O;  3EXA A;  1BL8 A;  1T5E A;  3ZRS A;  4DRF A;  2WPD G;  1T3N A;  3MWE A;  4UCO A;  4MVS A;  4ECT A;  3RAQ A;  3ABT A;  4JV5 H;  2P4K A;  2PI4 A;  4BWS C;  1BGW A;  1V55 B;  2YCH A;  1H2L A;  3C0F B;  1TAE A;  2GQS A;  3PW2 A;  1CXZ B;  2OCC C;  4UCR A;  1GM9 A;  1XQ8 A;  4O7T A;  3LDD A;  3B2E E;  3SR2 C;  2Z02 A;  3UYY A;  1S5J A;  1JA8 A;  3EHB B;  3VQW A;  3AG2 C;  2L6L A;  3J7A K;  4A3G G;  3A8T A;  5KG7 A;  1I6U A;  5BWW A;  3T7A A;  3IAY A;  5BWT A;  1MZB A;  4DL4 A;  3R23 A;  4M7E A;  2FLN A;  1BNC A;  3L2P A;  3Q4H B;  1NTK H;  1NI8 A;  2WWW A;  2VQF B;  2EZP A;  2E3C A;  4UVA A;  1AR1 B;  3E86 A;  2R7L A;  3KAK A;  5JH7 F;  2UUC B;  4JI1 H;  1BGY H;  1K5S A;  2IP4 A;  2DMX A;  5DGA A;  4X1K B;  2XD4 A;  4B3T H;  4FLU A;  4DR6 H;  4LF7 O;  2DZD A;  4F4L A;  3KHG A;  4RAY A;  3E83 A;  1JXL A;  4DRX B;  3I55 V;  1AJN A;  2XCL A;  3T5J A;  5B1B B;  1DF4 A;  1US6 A;  2EUL A;  5DIS C;  4JYA B;  1L8D A;  5IWA H;  1BE3 H;  5JH7 A;  4X1K A;  4UB8 Z;  2P5O A;  4F6E A;  4HR7 A;  4PA3 A;  2ALZ A;  5BPH A;  1FXK A;  2AZ0 A;  3TW7 A;  2QB5 A;  1D5A A;  2JA8 G;  1IBL B;  3RTX A;  3AG1 C;  1Q5O A;  3N41 B;  2W0X A;  3TIG A;  2R8J A;  3E8F A;  1XMO H;  4J11 A;  3CRC A;  1BHB A;  3KRE A;  3AX6 A;  3IGA C;  4I4T A;  2FML A;  1EBO A;  1E1R G;  2A0L A;  1Y66 A;  4DW0 A;  1XNR B;  5I5T A;  1SC5 B;  3QO8 A;  4JYB A;  3RF2 A;  2HJF C;  2UU9 O;  1CKM A;  1YSC A;  5BYA A;  2YXY A;  4X9Q A;  5B5E Z;  4CE5 A;  3SYQ A;  3JAT B;  5B3S C;  3T1H B;  2EIJ C;  2OIG A;  3IJ4 A;  1XMO O;  4J9P A;  2N04 A;  3N40 P;  2ADP A;  2DIK A;  4EFB A;  3OSN A;  3MWD A;  3OTF A;  3CRM A;  3W5O A;  3G6V A;  4LWS B;  2C22 A;  2BQ3 A;  2FLP A;  4RO2 A;  2Q7H A;  1IBM O;  5KG3 A;  2UXX A;  3TIN A;  3GTO A;  1GM7 A;  4AQY H;  2O03 A;  4P2Z A;  4WF9 V;  5LGN A;  4GC6 A;  3EPG A;  3W7U A;  4O3N A;  5EYP A;  4K6N A;  5LGU A;  3CCV V;  1PK8 A;  4DR2 H;  4JI5 H;  4QW8 A;  5JCO C;  3BVO A;  4MA5 A;  1IBK O;  3F5W C;  4TWK A;  3RWR D;  3ZJZ A;  4TUY A;  1G8M A;  4LWS A;  1UC9 A;  5C4X G;  3LSQ A;  4JTC B;  3GTG A;  2PMZ E;  1N34 H;  3WB1 A;  3BFR A;  4R6Z A;  3WFV A;  1L0N H;  2XGP A;  1JR9 A;  1KT8 A;  4YHH H;  2IJJ A;  2ZDI C;  4DUY B;  3H1J H;  4DR6 B;  4O4I A;  4J7K A;  4A93 G;  3LML A;  3LNM B;  2WSS G;  2E75 B;  3MFI A;  2W9C B;  4A3D G;  5LP6 C;  2VA2 A;  4NYK A;  4PBC A;  4O2A B;  4DV5 B;  5KFQ A;  4ZI7 F;  4K3A A;  2Y4T A;  1WAZ A;  5LL6 b;  4A2B A;  3PW7 A;  3WO1 A;  1VAJ A;  4FVM A;  2CW8 A;  4BIZ A;  4LFA O;  1I3Q A;  2HJW A;  4FS1 A;  4JI1 B;  3ZN0 A;  4LH7 A;  4QE9 A;  1I5X A;  1GN3 A;  3RIZ A;  2QEX V;  2R8I A;  2YZN A;  1GRJ A;  3DXR A;  3RV4 A;  3EFF K;  5EZY A;  3ZED A;  2HHH B;  3JAW B;  5GON A;  1RPR A;  5BY1 A;  2DLN A;  3U0G A;  4LFA H;  2FK1 A;  5FLX N;  4GLX A;  1KB9 F;  1V9P A;  2B1G A;  2A06 H;  4NZM A;  3OSP A;  3VOU A;  4HZ3 A;  5EZY F;  4CMD A;  4IRK A;  1AUX A;  1JDB B;  2JEX A;  2PTM A;  4DV6 B;  4LF7 B;  1B33 N;  4WFA V;  4TVI A;  1W2B U;  3NGD A;  1K4C C;  5CMU A;  4FFP A;  1ZHS A;  1JX9 A;  2ITD C;  3QG5 A;  3ORR A;  4TOI A;  1DK1 A;  5KFR A;  1OCO B;  2JK5 C;  3FD9 A;  4IHJ F;  3BA9 A;  1F4M A;  4J0M A;  2YIA A;  1I2K A;  1KYO F;  1VP7 A;  1J5E B;  1BCC H;  2YSU B;  1HNX O;  2ZQM A;  3CCL V;  1XHZ A;  1IUR A;  2R6F A;  2VUM A;  2ZR2 A;  2R7Z A;  1WNS A;  1N0N A;  4BAY A;  2UXC B;  4J9L A;  1S03 G;  5LYJ B;  3HKE A;  2X5R A;  2NU9 B;  1KMI Z;  4OX9 B;  5DGB A;  1S68 A;  4CKC A;  3V6H A;  5CB4 F;  1WA8 A;  5I60 A;  1OCR B;  1Y6X A;  2E74 B;  3TET A;  3CXC U;  4DR7 O;  2FKX A;  1M6V A;  1Q86 W;  3AK2 A;  4J80 A;  1HNX B;  4PWQ A;  1Y4M A;  3M9O B;  2WA3 A;  4X66 B;  2B1I A;  4BY1 G;  4MV1 A;  1URF A;  3KKY A;  4RWU A;  3FKI G;  4TQF A;  5EBM C;  2FPP B;  5JQW A;  3PJS K;  4DR2 B;  5C5J A;  2QWR B;  2EIJ B;  3DC6 A;  4J10 A;  1FFX B;  5JQG A;  3HT5 A;  1Y1V A;  4I55 A;  1Q81 W;  3CCE V;  1EUC B;  5I5Y A;  3HOY G;  2UXB H;  2YYA A;  5J2U B;  2PYJ A;  5L1K A;  3M7M X;  4A5U B;  3ZRW B;  4RNN A;  2Q6A A;  5C8Y F;  5IE9 A;  4X66 O;  2YC0 A;  4Z1V A;  2IBZ H;  3GTK A;  3JCZ A;  1L0L H;  2R7M A;  1LUW A;  1M93 A;  1Q43 A;  1I2L A;  5KT6 A;  4ED3 A;  3VNN A;  5KMG B;  1QLN A;  3EPI A;  3T2M A;  1GSA A;  3SDL A;  2AW9 A;  5JWP A;  2VUM G;  3LDE A;  4LBE C;  2HGW A;  2P4V A;  1IBK H;  2E2I A;  5BYB A;  3IG0 A;  2Z3Y A;  1Y1W A;  4IIJ F;  3G67 A;  2DQ0 A;  1B3Q A;  5FNV F;  5DG7 A;  2JEU A;  3G6E V;  3I56 V;  2QTO A;  3A0B Z;  2IBK A;  2O57 A;  1M56 C;  1O75 A;  2AXT Z;  4Q4D A;  1F23 A;  2P6J A;  4ZI7 B;  3HKC A;  1N4C A;  3N2G B;  2J9G A;  2ZIO A;  4UCV A;  5BPF A;  2N74 A;  4Q8F A;  4DYL A;  4MTO A;  1DLB A;  4IGG A;  2YXL A;  1G2W A;  5JQG F;  1SQF A;  1JMK C;  2RQ6 A;  5CA1 B;  2LGW A;  4DV7 O;  1K7D A;  1UNN C;  1SQP H;  2CTQ A;  2F1M A;  4FFN A;  3QVN A;  1R1B A;  3WO0 A;  3QFF A;  2ATL A;  4RQF A;  1THZ A;  1N32 O;  2GUZ B;  3AG1 B;  4HNU A;  3FFQ A;  1KJ9 A;  2LGQ A;  3D3I A;  1K34 A;  1JFF B;  1WA8 B;  4JI7 H;  3MJF A;  4DR3 H;  2WLK A;  2R84 A;  4ZHQ A;  4FFM A;  5K1X A;  4A3L G;  1N33 B;  2YS7 A;  1FD9 A;  5EIB D;  4LF5 O;  4PV1 B;  4DUZ O;  2W6O A;  3W7S A;  4ABM A;  4YR2 A;  3LUT B;  4GKK B;  2JA6 G;  3RVZ A;  5KHJ A;  4O4L B;  1WN7 A;  4DW1 A;  2KSW A;  2N05 A;  1A32 A;  2NVX A;  4BY7 G;  5FLM G;  1ROP A;  2CKZ B;  4CH3 A;  4JTA B;  4DV1 H;  3JAL A;  2ZE7 A;  5KFH A;  2EJ0 A;  4DUZ B;  5L1J A;  5C3E G;  4X64 O;  5D8D A;  3UZO A;  4IWX A;  5KFP A;  4DR7 H;  1N8R W;  2G38 A;  5EBW C;  4OX9 H;  1A0G A;  3WWI A;  3GIP A;  1Q7Y W;  2HHH O;  1S0V A;  4R8U A;  2W7P A;  2CK3 G;  2E5L H;  4F6R B;  1EUD B;  4PDR A;  3KZI Z;  3OT7 A;  3ZRX A;  2FKL A;  3D3Q A;  3GTQ A;  4IHJ B;  1C30 A;  1P49 A;  1V54 C;  1AP6 A;  1FJG B;  5H80 A;  2OCC B;  5KFN A;  3CJH A;  4F6R A;  1ULZ A;  3ZX6 A;  5KG1 A;  2IJK A;  1GM8 A;  4CHI A;  2Y69 C;  3AG3 C;  1K1Q A;  2DE0 X;  3SPJ A;  4J9O A;  1QBZ A;  5IDJ A;  5JJN B;  1ZAU A;  3U9S A;  4RUF A;  2C00 A;  3RBD A;  1Y76 B;  1YZB A;  1HDJ A;  2RGV A;  4PDL A;  1HNZ O;  2FK3 A;  5IY5 B;  1J95 A;  1M9N A;  5L1L A;  4UCU A;  3AK1 A;  4DV0 H;  5DLG A;  1PNK A;  5LHG A;  5DMX A;  4BWA A;  3DSQ A;  1GGO A;  2KG7 A;  2ASD A;  1SZX A;  2WLI B;  4PA6 A;  5LL6 Y;  3G71 V;  4C5C A;  1KJ8 A;  1VQL V;  3ORQ A;  4ED0 A;  1P16 A;  5D1O A;  2NU8 B;  3QO7 A;  3H4D A;  2KSD A;  4DR7 B;  1IYE A;  4E6N A;  1WSC A;  2E5L O;  4AYB E;  1VQO V;  4AYB A;  5J2T B;  1HNW H;  2GLT A;  3K3V A;  1NVP B;  3L75 H;  1XIL A;  2XGQ A;  1HNX H;  1A9X A;  4DV0 O;  4B3R B;  3OEH G;  1YIT V;  1EKP A;  1Y1W G;  5DGI A;  5C93 A;  4JAA A;  4O4L F;  3OD4 A;  1GH6 A;  1HW7 A;  1ZLZ A;  5IYD O;  3UM7 A;  2NUA B;  1FKA O;  2M6Y A;  4XX0 B;  4NVP A;  3C3S A;  4JI3 B;  1I7L A;  3RYF B;  1S5H C;  2V4D A;  2R92 A;  3OUF A;  4K8X A;  5CM0 A;  4IR9 A;  4LFB H;  1TWH A;  4RUC A;  3GV8 B;  5EK0 A;  2I87 A;  5KHK A;  4O7N A;  1KD1 W;  3UT5 B;  4RNM A;  4JZ2 A;  4JI7 O;  3V4Z A;  3MR5 A;  3SPH A;  3STZ C;  3T1Y O;  1NT2 B;  3ZCC A;  2WTF A;  4GCZ A;  1Z2P X;  5BMV F;  3IC7 A;  4O3R A;  1F4N A;  2IH3 C;  1RYR A;  5J2U A;  2YWV A;  4ECU A;  3E8G A;  3CC4 V;  5I5X A;  4JI5 O;  2JA6 A;  2QKC A;  2JGU A;  4O82 A;  2VWK A;  3MFH A;  1U97 A;  2IU3 A;  5F9L A;  1S9F A;  2BSK B;  2CH7 B;  1E4E A;  3G6Y A;  4LF6 H;  3L9D A;  2ZCE A;  3GQC A;  4X88 A;  3RV3 A;  3MWM A;  2BQR A;  5EYP B;  4EG0 A;  2EIM C;  4ZQI A;  1R3J C;  1IBK B;  2EIN B;  4BW5 A;  4FBU A;  1M4U A;  3SPG A;  4XDL A;  3T9B A;  2EX3 A;  4JI2 O;  5KG6 A;  4DUZ H;  4TUY F;  5KAI Z;  5L3E A;  1YHQ V;  3DTU B;  4Z2W A;  1W93 A;  3K5N A;  4DXW A;  4GKK H;  2RN9 A;  4NYE A;  5IP9 G;  4JI0 H;  2ZE6 A;  4ECQ A;  2Q9L A;  2EIY A;  3H3V H;  2FYU H;  2QGN A;  2EJ2 A;  5C1P A;  4DV5 H;  1RM1 B;  5KHH A;  3S24 A;  4JYY A;  3KYH C;  3C90 A;  3K08 A;  1DAA A;  2IJH A;  2J6S A;  1TUB A;  4GC7 A;  4B3M H;  3GWK C;  4LF8 B;  4O3S A;  4JYA H;  1U96 A;  1XMO B;  1GTO A;  3ZHU A;  3DTF A;  4Q6G A;  1RSO B;  2K9P A;  1YTF B;  4FFR A;  4E4T A;  4GKK O;  2FTK A;  3NR7 A;  4O4L A;  4LF9 O;  2QYZ A;  2UXD O;  5FNV A;  2XUM A;  2QWO B;  1M90 W;  3JRX A;  4QE7 A;  4EYI B;  1Y76 A;  4H0L B;  4LF8 O;  3UO2 A;  1VF6 A;  3FAV B;  1ZUQ A;  3ZMU A;  3STL C;  1V4Y A;  4UUG A;  4NXN O;  2OH2 A;  4YIO A;  3DGE A;  4CC6 A;  2F4V B;  4O4I B;  4DV4 B;  3UO3 A;  4EGQ A;  4L8J A;  3JYC A;  2WAQ A;  5KFB A;  4KUM A;  3X2Q C;  3VMM A;  2RCV A;  3AG2 B;  3F8N A;  4FM0 A;  4G28 B;  4F4W A;  1XUQ A;  4J9K A;  2PY5 A;  5J2T F;  4B7E A;  3TQ1 A;  3IFX A;  2LJ2 A;  4K0K B;  2QWN B;  3ZMS A;  4DUY O;  2QDO A;  3LSU A;  3ASO C;  5B1A C;  3B77 A;  4I50 B;  2UUA H;  3CCQ V;  1BJT A;  5KFK A;  1RPO A;  3SJA C;  1VBG A;  4FM1 A;  1DIK A;  3CCS V;  3D36 C;  3CCR V;  4O7Y A;  3L72 H;  1BZK A;  4LC1 A;  4I5S A;  3AK3 A;  1PX2 A;  4K35 A;  3SYA A;  5HNE A;  4LFA B;  1QQC A;  1M1K W;  3VOT A;  2ZR3 A;  4JV5 B;  2F95 B;  1EZV H;  2LQT A;  3RN4 A;  3BHP A;  4B3S B;  1TWA A;  4EBC A;  2Z0A A;  4A3K G;  3FDS A;  1HNW O;  1R9T A;  1M5I A;  2QKA A;  1EFR G;  3F7Y C;  4LFB B;  1XL6 A;  2ZDI A;  2JEG A;  2DPJ A;  4JZG A;  4MVO A;  4IZO A;  1VQP V;  2WYO A;  3EYY A;  1JIH A;  1ZQ7 A;  2PBZ A;  3ETD A;  2Q68 A;  5I47 A;  4DL6 A;  5BR8 O;  4QWE A;  1JKJ B;  4RB1 A;  1MG1 A;  4ED6 A;  4O2A F;  5LHI A;  4JPR A;  1YDX A;  4JI6 B;  1TUE B;  2VQF O;  3MAQ A;  4B3R O;  1WPX A;  3VBB A;  4CMF A;  4KXR A;  5CE8 A;  3LP8 A;  3WU2 Z;  5LMU O;  4TQR A;  3JD2 A;  2PI5 A;  1KU9 A;  2ZDQ A;  1AR5 A;  4DL5 A;  3CMA V;  1OWT A;  2R8K A;  3KTM A;  1F7Y A;  4JTD B;  2RMK B;  4WFG A;  4YXW G;  5L9X A;  4G27 B;  1Y74 B;  2VQE O;  1GN4 A;  3L4K A;  2JJ1 G;  1I94 O;  1IYD A;  2RDJ A;  1I5Y A;  1LR1 A;  2AU0 A;  3WNZ A;  1G6U A;  2GTS A;  3SYO A;  2Y69 B;  1OCC C;  4LNU B;  3GV5 B;  1AJQ A;  4YB8 B;  2C35 B;  4J9R A;  4X8A A;  3W1B A;  4LFC O;  5KG5 A;  3RYC B;  3ZRW A;  5IYZ B;  4BR6 A;  2R9I A;  3W7T A;  4J7Z A;  3FYI B;  5T14 A;  2B5U A;  3GTP A;  4AQY O;  1ZHQ A;  2R72 A;  3UZB A;  3CJH B;  2JDI G;  1P7B A;  3AG4 B;  1JDE A;  1M57 B;  5DED A;  1H38 A;  3HOU G;  1N36 O;  4ED1 A;  3NUA A;  3VPD A;  4K8Z A;  2YW2 A;  2UXD B;  4ECR A;  4MA0 A;  3SGI A;  4ME6 A;  1FXV A;  2ZXW B;  4YHH O;  3VPB A;  4I9W A;  4J9N A;  4ECS A;  4I7H A;  1TA8 A;  3AEI A;  3QNE A;  2Z5U A;  1GO3 F;  1IVS A;  1SF9 A;  4FS2 A;  2KQX A;  5DEC A;  3CQZ A;  1QVF U;  2ZJT A;  2V4Q A;  4DR2 O;  1EKF A;  2DWD C;  3CE2 A;  5IT9 W;  5GW7 A;  1QR9 A;  2Q7D A;  3K03 A;  1CS0 A;  2FPI B;  3S3W A;  3W7X A;  2WLN A;  4NXN H;  2CE4 A;  1IBM H;  4AI8 A;  2BTO A;  1KJQ A;  1PM9 A;  1K5Q A;  5JVD A;  1B6R A;  4CC5 A;  4B3T B;  3H4B A;  3T9C A;  3CB2 A;  4B7K A;  3IC9 A;  4AHC A;  5KFV A;  2P06 A;  5IT9 N;  2ZDG A;  1PP9 H;  4TV9 F;  1HR0 H;  5IWA O;  1KUT A;  4A3I G;  2UUC H;  1DTO A; 
#chains in the Genus database with same CATH homology
 5EZY B;  1M0W A;  4TV8 B;  4PZ6 A;  3J81 W;  3HKE B;  1HNX B;  3QWU A;  3ICX A;  4X66 B;  4DK0 A;  4TQF A;  3BRC A;  4X1Y B;  3U0Z A;  4DR2 B;  3HKD A;  3T1Y B;  2F4V H;  4TQD A;  2HGS A;  3TY8 A;  2YI8 A;  4DV2 H;  5JQG A;  1FFX B;  4I55 A;  2UXB H;  4RAZ A;  5J2U B;  2PYJ A;  3M7M X;  3TY5 A;  4B3M B;  2HEP A;  1CKN B;  2P22 C;  3BAB A;  1XNQ H;  1M93 A;  1Q43 A;  4YJ3 A;  4X65 B;  4LF9 H;  3JAR A;  2ZNJ A;  5LXT A;  3VNN A;  5KMG B;  5JVD B;  5BMV B;  1IBK H;  4KHP B;  2VWJ A;  1E4F T;  3IG0 A;  1WPB A;  3RYH A;  4LF8 H;  3JAR B;  5LXT B;  3UQ8 A;  5JJJ B;  4MTE A;  3RYI B;  3RFR A;  5BR8 B;  1J5E H;  1O75 A;  3JAT A;  4TV9 A;  4ZI7 B;  3HKC A;  2HIX A;  5KMG A;  1JFF A;  3N2G B;  3JAK B;  2OYQ A;  2ZIO A;  4UCV A;  1YEW A;  2PZS A;  1P8L A;  5EOY A;  4YJ2 A;  3RGZ A;  3RYH B;  2YXL A;  1SQF A;  1JMK C;  2RQ6 A;  5CA1 B;  4DR5 B;  2F1M A;  5CA0 B;  2JVD A;  5C8Y A;  5J2T A;  3W1G A;  4FFB B;  2VQF H;  4JI4 B;  3FFQ A;  4HNA A;  5FPR A;  1JFF B;  5FPO A;  4X65 H;  1H2S B;  2VOB A;  5BR8 H;  4JI7 H;  2QM4 A;  1XNR H;  4DR3 H;  4DV2 B;  5LMU B;  4ZHQ A;  4LSX A;  5K1X A;  1XMQ B;  2F66 C;  1N33 B;  5FD6 A;  5EIB D;  2GV9 A;  3A2F A;  4GKK B;  5CA0 A;  3CVZ A;  3T1Y H;  2HHH H;  3K5L A;  5KHJ A;  4PDB A;  2Q0A A;  4O4L B;  1WN7 A;  5JH7 B;  2OWO A;  4DUY H;  2KSW A;  3RJ0 A;  4LFC B;  4DV3 H;  5ITZ B;  3N2K A;  2Q2U A;  5CB4 A;  4CH3 A;  4DV1 H;  5LA6 B;  1HR0 B;  1O9H A;  3JAL A;  3K59 A;  4LNU A;  4DUZ B;  4RB0 A;  1SA0 B;  2UU9 H;  4CS3 A;  4LSA A;  4DR7 H;  4GKJ H;  3K57 A;  4OX9 H;  2YIB A;  2YI9 A;  1M0T A;  4DV4 H;  2E5L H;  5CA1 A;  4JI2 H;  3HKB A;  4F6R B;  4X66 H;  4EB6 A;  2UUB H;  1VS0 A;  4LF5 H;  5LA6 A;  1X9N A;  4FLZ A;  4NXN B;  1N36 B;  5C8Y B;  3K58 A;  4IHJ B;  4IIJ B;  1P49 A;  4CS2 A;  4D7T A;  4JI5 B;  1FJG B;  1X4T A;  4X62 H;  1XHX A;  2CAZ C;  3N43 B;  4F6R A;  3JAS A;  4O4J B;  4MV7 A;  4ZOL B;  2UXD H;  2ZM6 B;  3THO A;  1XI1 A;  3RYF A;  4JI8 B;  5JJN B;  1ZAU A;  1QHT A;  3WB2 A;  3J80 W;  3HKD B;  3QTC A;  3SJB C;  5LYJ A;  2WDT A;  2RGV A;  3K5O A;  4DR1 H;  5GON B;  4AQY B;  4LF6 B;  3FMA A;  3HKC B;  3VQY A;  4ZIB A;  4LF7 H;  4UCU A;  3KAJ A;  4DV0 H;  4DR1 B;  4RB3 C;  3LNN A;  3JSN A;  4LF5 B;  4DRX A;  4BWA A;  3DSQ A;  2VUG A;  4FLY A;  3DF7 A;  3ZS8 C;  2Q7E A;  1P16 A;  4LR3 A;  5D1O A;  3SJC C;  5LOV A;  5BMV A;  2UU9 B;  4E6N A;  4DR7 B;  4FLT A;  3GB8 B;  1HNW H;  2F93 B;  5J2T B;  3K3V A;  4CS4 A;  5JQG B;  1I7F A;  5IJ9 B;  1HNX H;  1Z5W A;  5FNV B;  5D5Q A;  2CFM A;  4B3R B;  3CSX A;  5D1O B;  4IHJ A;  4I50 A;  4CH4 A;  2RGR A;  5LMN B;  2CW7 A;  1IBL H;  1HW7 A;  2ZNI A;  5D1P A;  4GKJ B;  5JCO A;  1Z5V A;  4NVP A;  4TV9 B;  4AIL C;  4JI3 B;  3RYF B;  2V4D A;  3WB0 A;  4K8X A;  4HBN A;  1WH2 A;  4GYC B;  4LFB H;  4TV8 A;  1FVI A;  4EFE A;  3N2K B;  5KHK A;  4TUY B;  3H20 A;  3UT5 B;  2QJ1 A;  1TUB B;  1NT2 B;  3ETQ A;  3NC0 B;  4YHH B;  1Z2P X;  1L2Z A;  1N36 H;  4B08 A;  1N34 B;  5J2U A;  4UCS A;  4EB6 B;  3L4J A;  4LH6 A;  3JSL A;  1E4G T;  1FKA H;  2JGU A;  3GDE A;  2VWK A;  3N6X A;  3JAM W;  4LF6 H;  2ZCE A;  1XDN A;  4I4T B;  2YIB D;  3MWM A;  3E22 B;  3U11 A;  4ZI7 A;  2HVR A;  5EYP B;  1IBK B;  2KKW A;  1M4U A;  5EIB C;  4LFC H;  4X1I B;  4WBN B;  2VQE H;  4LF9 B;  1Z2N X;  2UUB B;  2EX3 A;  4DUZ H;  3K5N A;  1T5E A;  4DRF A;  4GKK H;  1A0I A;  4KHP H;  4UCO A;  4LMY A;  4JI0 H;  4ZHQ B;  4JV5 H;  4BWS C;  4X1I A;  1BGW A;  4DV5 H;  5JJE B;  2YCH A;  5A2Q W;  5KHH A;  5LMU H;  3S24 A;  3C0F B;  1TAE A;  1N33 H;  3OTO B;  3UT5 A;  3KYH C;  4UCR A;  1XQ8 A;  1TUB A;  3B2E E;  4B3M H;  4RZQ A;  3SR2 C;  2Q7G A;  4LF8 B;  4IIJ A;  2BTQ A;  1S5J A;  4Q0Y A;  4JYA H;  1XMO B;  3VQW A;  3T1H H;  1XMQ H;  1AN7 A;  3J7A K;  2UXC H;  4Q6G A;  5LP6 A;  2RJZ A;  5CB4 B;  1I6U A;  1MZB A;  3IAY A;  4DV3 B;  4O4L A;  4M7E A;  3L2P A;  5FNV A;  4K0K H;  2JS5 A;  2VQF B;  4FLW A;  2E3C A;  3KAK A;  2UUC B;  3BPZ A;  4HNA B;  4JI1 H;  2Q2T A;  3E22 A;  1GYF A;  1SQG A;  4X1K B;  4B3T H;  4FLU A;  4DR6 H;  3OTO H;  3K5M A;  1B04 A;  4RAY A;  4DRX B;  3GJX B;  4CC6 A;  2F4V B;  4O4H A;  4O4I B;  4DV4 B;  5DIS C;  4L8J A;  2WE6 A;  1SKV A;  3F8N A;  4JYA B;  4FM0 A;  1L8D A;  5IWA H;  5JH7 A;  4NXM H;  4X1K A;  2P5O A;  4ETS A;  2PY5 A;  3RYC A;  4DV1 B;  2R70 A;  3JAS B;  4O4J A;  4K0K B;  4DR5 H;  3JAL B;  1XK5 A;  1TVK B;  1XNQ B;  4EQ5 A;  4I50 B;  1D5A A;  2BTQ B;  1SEI A;  2UUA H;  1IBL B;  2HVQ A;  3RTX A;  1Q5O A;  5KHI A;  1BJT A;  3N41 B;  3KXY T;  3SJA C;  5LP6 B;  4CH5 A;  4FM1 A;  1XMO H;  4I4T A;  4I55 B;  4DK1 A;  3RGX A;  1IBM B;  1XNR B;  4DV7 B;  3RR5 A;  3RF2 A;  4X64 H;  1CKN A;  4U3J B;  3RGB A;  1QQC A;  4LFA B;  1CKM A;  3HXL A;  1FFX A;  1HNZ H;  4JV5 B;  2F95 B;  5IJ9 A;  3JAT B;  2HVS A;  3T1H B;  1VF7 A;  3BHP A;  4B3S B;  4R7R A;  4X20 A;  4D7S A;  1I94 B;  4FLX A;  3N40 P;  1M5I A;  4U3J A;  5IJ0 B;  4EFB A;  4LFB B;  3OTF A;  3KAL A;  3W5O A;  4FM2 A;  4O2B A;  4IAJ A;  4CH6 A;  4B3S H;  4DR4 H;  2WYO A;  3QF7 A;  3EYY A;  4A2A A;  4X1Y A;  2XIG A;  3NBY B;  4X20 B;  2Q7H A;  3M4I A;  4RB1 A;  5LMN H;  4AQY H;  2O03 A;  4PHZ A;  4FLV A;  4JI6 B;  4O2B B;  4I9Q A;  5EYP A;  3MAQ A;  4YY3 B;  1N32 H;  4PI2 A;  3U10 A;  3JAK A;  4LF4 B;  4DR2 H;  3TY9 A;  4JI5 H;  4PZ8 A;  5JCO C;  4YJ2 B;  3N44 B;  3RWR D;  4TUY A;  1KU9 A;  4UFZ A;  4YJ3 B;  2PGG A;  2PUS A;  1N34 H;  3WB1 A;  4JI8 H;  3BA8 A;  5K1P A;  4DV6 H;  3L4K A;  4UCT A;  4YHH H;  1Q8I A;  4FFB A;  4DUY B;  4DR6 B;  4O4I A;  4O4H B;  1G6U A;  2E5L B;  3LML A;  1SYX B;  1FJG H;  4RB2 C;  4LNU B;  1TGO A;  5LP6 C;  1O9G A;  4JI6 H;  5IJ0 A;  3W1B A;  3VQX A;  1DGS A;  5FD5 A;  3RYC B;  3JAW A;  4O2A B;  4JI7 B;  4DV5 B;  4JI2 B;  5IYZ B;  5LL6 b;  1JJO A;  3N2G A;  4A2B A;  4FVM A;  2CW8 A;  1HNZ B;  4EEQ A;  4JI4 H;  1HNW B;  4JI1 B;  4LH7 A;  1ZHQ A;  4JI3 H;  2R72 A;  1Z2O X;  2W57 A;  4DV7 H;  2VQE B;  5D5P A;  3RIZ A;  1I94 H;  2IM9 A;  1SA0 A;  2UXB B;  2ZM6 H;  4K8Z A;  2UXD B;  5EZY A;  3ZED A;  4MTD A;  2HHH B;  3JAW B;  5ITZ A;  4O2A A;  3SGI A;  5KHG A;  2ZIN A;  3HKB B;  5IWA B;  5GON A;  5IYZ A;  4BW9 A;  2ZIM A;  4X64 B;  4LFA H;  5KX5 B;  4GLX A;  3RYI A;  4FM9 A;  1V9P A;  4I7H A;  1TA8 A;  2HIV A;  3BAA A;  4DR3 B;  4PZ7 A;  4WBN A;  4B3R H;  3VQV A;  1RSO A;  4PI0 A;  4DV6 B;  2PTM A;  4LF7 B;  4APM A;  2FE3 A;  4JI0 B;  2ZJT A;  3PN1 A;  2UUA B;  1TVK A;  5KX5 A;  1ZHS A;  4KL1 A;  5IT9 W;  4X62 B;  2XHB A;  5LOV B;  2PYL A;  3QG5 A;  4TOI A;  4NXM B;  4LF4 H;  3N42 B;  3BA9 A;  4MV9 A;  4J0M A;  2YIA A;  4NXN H;  5FLX W;  4ZOL A;  3NBZ B;  1IBM H;  3CHX A;  1J5E B;  2BTO A;  1XHZ A;  4DV0 B;  1WNS A;  1Q3E A;  4CC5 A;  5JVD A;  2UXC B;  4B3T B;  1S03 G;  2R9A A;  5LYJ B;  3CB2 A;  3HKE A;  1CKO A;  1KMI Z;  4OX9 B;  2MCT A;  1N32 B;  1S68 A;  4YY3 H;  4AHC A;  4DR4 B;  1HR0 H;  2VPS A;  2UUC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...