4CC5A

Fragment-based discovery of 6 azaindazoles as inhibitors of bacterial dna ligase
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
308
structure length
308
Chain Sequence
ADLSSRVNELHDLLNQYSYEYYVEDNPSVPDSEYDKLLHELIKIEEEHPEYKTVDSPTVRVGGEAQASFNKVNHDTPMLSLGNAFNEDDLRKFDQRIREQIGNVEYMCELKIDGLAVSLKYVDGYFVQGLTRGDGTTGEDITENLKTIHAIPLKMKEPLNVEVRGEAYMPRRSFLRLNEEKEKNDEQLFANPRNAAAGSLRQLDSKLTAKRKLSVFIYSVNDFTDFNARSQSEALDELDKLGFTTNKNRARVNNIDGVLEYIEKWTSQRESLPYDIDGIVIKVNDLDQQDEMGFTQKSPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-Based Discovery of 6-Azaindazoles as Inhibitors of Bacterial DNA Ligase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 109
structure length 308
sequence length 308
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2013-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4cc5A01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4cc5A03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4cc5A02
3NC0B 4PZ6A 4UCOA 3QWUA 4PZ8A 4B3TB 2Q2UA 3RTXA 4DV1B 2UUAB 3S24A 3W1GA 4JV5B 5D1OB 1IBLB 4LFBB 1FJGB 1VS0A 5FPOA 1CKNB 4UCUA 3T1YB 5D1PA 4EQ5A 3GB8B 4DUYB 3BA9A 4LH6A 3UQ8A 4CC6A 1V9PA 2HVRA 4JI4B 4AQYB 3TY5A 4K0KB 1IBMB 4JI8B 4PZ7A 4EFBA 5LMUB 1TAEA 4JI0B 3JSNA 4B3MB 2OWOA 4UFZA 3RR5A 1TA8A 4JI6B 3BAAA 4JI5B 3PN1A 4X66B 4DUZB 4DR6B 4YY3B 3W1BA 4NXNB 3TY9A 4LF8B 1N33B 3NBYB 1N36B 4LF7B 5FPRA 1A0IA 2UXDB 2VQEB 4JI7B 3TY8A 1B04A 2UXCB 2UU9B 4GKJB 3L2PA 1DGSA 1I94B 5LMNB 2ZM6B 2VUGA 3GJXB 4DR4B 1XNQB 4DV2B 1XNRB 4X64B 3BABA 4YHHB 4DV0B 4DR2B 4GLXA 3T1HB 1N34B 4B3SB 1HNWB 4UCSA 4EEQA 4EFEA 4DR5B 1J5EB 4DR1B 4LF6B 1N32B 2HVSA 4DV4B 3GDEA 4DV6B 1XK5A 4LF9B 1CKNA 4DRFA 4DR7B 2CFMA 4LF5B 2Q2TA 4B3RB 4UCRA 5D1OA 3VNNA 5BR8B 4CC5A 4LF4B 1CKOA 3BA8A 3SGIA 4LFCB 1S68A 4JI3B 1HNXB 2HHHB 1XMQB 4JI2B 4DV7B 1HNZB 3KYHC 4UCVA 3NBZB 4X62B 4TOIA 4DV3B 4UCTA 3W5OA 4X65B 3JSLA 1P8LA 4LFAB 2UUBB 1CKMA 1XDNA 2F4VB 1IBKB 2VQFB 1HR0B 2UUCB 5IWAB 1P16A 1ZAUA 1XMOB 2HIVA 4JI1B 2E5LB 4LH7A 4E6NA 4KHPB 2UXBB 4NXMB 2HIXA 4DR3B 5DISC 1X9NA 4JYAB 4GKKB 1FVIA 3OTOB 4DV5B 4OX9B 2HVQA
chains in the Genus database with same CATH superfamily
2KG7A 4Q20A 3QWUA 5KT4A 2V5AA 1JCHA 2NU9B 3JALA 3JARA 3KXYT 4X89A 4DL5A 1XHZA 3VQWA 5FLXW 2EILB 4YY3O 4RU9A 3PZPA 3ORRA 4JI6O 5EBWC 1KUTA 3HKEA 2GDSA 1ROPA 2LGWA 2KSDA 4EFBA 4O7YA 1TAEA 1E1RG 3JSNA 2EIMB 4O7NA 1D5NA 4UFZA 5DECA 1NKDA 1TA8A 1YVWA 1BQ0A 4X66B 2R7MA 4C5AA 1GSAA 1SQVH 2J6SA 3TY9A 4JI2O 3BVOA 5KFRA 4DV7H 2J9GA 4ED3A 3DXRA 1RJQA 3FKIG 2ZM6H 1YSCA 3P32A 1JFFA 4CS3A 5JWPA 1I7LA 2VPSA 1M0TA 2K1EA 2QF7A 4B3SH 1IBKH 5IJ0B 3CMEV 4N21A 2ZR2A 1B06A 1IBMO 2Q7GA 3SI8A 4ABMA 3MFIA 2W6JG 3ABMC 4QE9A 4DL2A 5KKNB 3DC6A 3ABMB 4O3PA 2OH2A 4OGQB 4I4TF 1EKVA 1K73W 5B1OA 4DV6B 4QPJA 3G6EV 1PPJH 2R92A 1GM8A 1M90W 2NNUA 5L1LA 4GX5A 4ASUG 3QVNA 4FLZA 5K3WA 4YR0A 3D36A 1OCCC 2A06H 2YS6A 2WLLB 3CCRV 2W0FC 3CRQA 3MR3A 4RQEA 4O4HF 1R3IC 3GTLA 4LF4H 3JYCA 2HGXA 4NXNH 4LFCO 3WB1A 5L1KA 5BWUA 1D2DA 3T1YH 2COGA 3VMMA 5KFAA 1GN6A 4Q6GA 1VQKV 2PYLA 3T54A 4FFKA 3LMLA 1PK8A 3W5OA 3KAKA 1IYEA 1VQOV 1DIKA 3RF2A 4ECQA 2PN1A 3VPBA 1M9NA 2QKSA 4JYBA 3RB6A 2UUCB 4LF6H 2JEIA 2C35B 3L73H 2RDJA 3U0ZA 4X64H 3QO5A 1A3GA 3SYCA 2XHBA 2V58A 1TWAA 5KFWA 1OCOB 2W8KA 5I60A 1F23A 2BTOA 4P9OA 3ASOB 1JIHA 5L3DA 2JA8G 4A3GG 4U3JA 4YJ3A 2XGPA 2QTOA 1S5JA 4XX0B 1NS1A 2DIKA 2A79B 2JIZG 1B3QA 2MW2B 2XASA 4RQFA 4Q4CA 3WG7C 2QWOB 5CR5A 4EBDA 1VS0A 3EFFK 1CKNB 2VOBA 2ZE5A 4FPPA 2P4KA 3F7YC 3OUUA 4RUCA 2BSKB 2HVRA 1J5EH 4B3MH 4DR2O 1L8DA 1MZEA 4YHHO 5LGUA 4CMFA 4K0KB 2EIKB 4LSXA 1R3LC 4O2BA 2KKWA 2RN9A 3MWDA 2XGQA 2FJZA 1I0HA 3RUPA 2H3OA 4DUZH 1BL8A 4R7CA 1W96A 2GUZB 3H40A 2B5UA 4UVBA 2UXDO 3SJCC 2VQEB 4DR4H 1FD9A 1YXBA 1VQ8V 3T9AA 4LF4O 1ENVA 3T5LA 4IYHA 4LFCH 4O4HB 4FFLA 3SJAC 1ULZA 2EINB 1MNGA 3D36C 1RSOB 4ECTA 4DV2B 4A3LG 3GQCA 4YJ3B 1GSHA 2QK4A 5KHHA 3RVYA 4BW5A 5JJNB 2PVPA 3J80N 2ASJA 4H33A 5I5YA 5DGIA 1A9XA 4OX9H 4AYBE 1V51A 2AXTZ 1BE3H 4KFMA 4X65H 2DPJA 2DYSB 1FKAH 4TV9F 1YTFB 4ZI7A 5KFOA 4LF5B 3J80W 4LNUA 4YJ2B 4UV9A 5BR8H 3ZS8C 1S0VA 4CH6A 3DTGA 3Q4HB 1MZFA 3TETA 3C0FB 4ED8A 1XNQH 2FMAA 4MA0A 5E1AC 4FM2A 2CTWA 1OCZB 3KYHC 4JYCA 1K33A 2ARHA 3MR6A 5BYAA 1I6UA 1L0LH 3LNMB 1XDNA 3CJHA 4PELA 3BACA 2ZXWB 2HVJC 3AG7A 3UZOA 3VPDA 3H4DA 4W4KA 3T9EA 5GW7A 2M05A 4DR5O 1N34H 1HR0O 2ZD9A 5H6QA 2W7OA 4HYOA 3WNZA 4A3EG 4IR9A 2GBOA 2EIMC 3MFHA 1SA0B 2EZPA 1N36H 2WSSG 1N48A 4I50B 2ZDQA 2DN9A 5J2UA 1X9NA 5KHGA 1FYJA 1Q43A 2ZDIC 2CH7B 2N04A 1GO3F 4RNNA 2EULA 2IMWP 1JJOA 3Q8QB 3RFRA 4PV1B 4IL6Z 4JI7H 2Z0AA 2W9CA 3KHLA 2OIEA 1THZA 3AG3C 4I55B 1N8RW 4BBRG 2A3QA 2JK5C 2R86A 5LP6F 1I50A 1M57B 3RYFB 1Q7YW 2R7NA 3KG2A 3N2KB 2W9BA 1K3EA 4QGPA 1XMQH 4UVCA 2V4QA 3FYIB 2YDEA 4ECUA 1T3NA 3JASB 2CKZB 5IT9W 4ECWA 1FFXA 5H2FZ 4JAAA 4CS4A 4ED2A 3AG1C 5KFKA 3RBZA 4YY3B 2FL4A 2UU9H 4GKJH 3QZ7A 3T1HH 3CVZA 2E2IA 1BZKA 2Z02A 3R23A 1N36B 2UXDB 3Q8PB 4FK5C 1VF5B 3HXLA 4J9LA 3CEIA 5KG1A 5C44G 1KTAA 3K3WA 1GTOA 4OPAA 5LMNO 1F4NA 2WLIB 2Q68A 3S3WA 4LBEC 4DO2A 2JGDB 3OUFA 4MAMA 2ODTX 2JGUA 2XT9A 1Q90D 4K0KO 5EK0A 2W0XA 5LOVB 3AG2C 5FLXN 2UXBO 3FDSA 3RB3A 2MCTA 2Y0SA 4JI5O 2FLNA 4K35A 4QNHB 3ZRSA 2AHZA 5GONB 1A48A 2M7WA 3RN4A 2J6TA 1EZJA 2BQRA 2GSMB 5KFJA 3X2QB 3AG3B 2YZGA 2R92G 2NN4A 5EIBC 4UCRA 2W9BB 1EN4A 4MTEA 5BR8B 3QQMA 1M57C 1EM1A 4OPHA 5B66Z 4FLUA 1CKOA 3OMAB 3HB9A 2ZDGA 1G8MA 4LSAA 4O4IA 2ABJA 1JXLA 1GN2A 1AR1B 3JRXA 3CCEV 2Q7EA 1WCMA 3I4NG 2QTSA 1NVPD 1QVFU 5C1PA 3H1IH 1IBKO 1HR0H 3G8DA 1N0JA 2W6PA 3CE2A 2W6IG 4X65O 2KSWA 5B1AC 3SR2C 2WLHA 2UUBB 3VA7A 3ETDA 3JD3A 1EUCB 3SPJA 4TWKA 1XDCA 3UT5B 3HKBA 3VOTA 2P0AA 1Q6HA 2CTPA 2Z3YA 1P4RA 3P30A 3D3QA 3B8NA 1BCCH 2HEPA 5JH7F 2FB5A 4Z2WA 3ZN0A 3K03A 3FB5C 5KS8A 2C28A 5BWVA 2YI8A 2YU9A 3ZCCA 4ZQIA 2XAGA 2FTKA 2MK3A 4MVUA 4Q0YA 1CXZB 2R6FA 3T4DA 4KP4A 1B6QA 1I1MA 3N2GA 1XHXA 4MT8A 3ZMTA 1CS0A 5D8DA 4B3TB 3V4SA 3G6VA 2B9ZA 2R7LA 1IBLB 5LA6F 2V4DA 3H01A 4U3FH 4UCUA 4KUMA 3MWMA 1I3QA 4MV3A 3G8CA 4F4WA 3GIQA 5IYDO 5CB4B 5KFQA 3FB6C 5DN6G 3ZN1A 1FPOA 3GIKA 5CA0A 2ZE7A 1IBMB 1AJPA 3SYPA 4DRXB 1RYSA 1NZ6A 2R72A 4MV8A 3CCUV 4ZOLF 2LW1A 2BR0A 5A2QW 3HOWG 4PI2A 5IYZB 2P6JA 5BZBA 2P7TC 4L8JA 1ZETA 4WFEA 4FMTA 4PA9A 4LF8O 4DV4H 4EBCA 4FZ0A 4H44B 2YW2A 1VKZA 4PD4F 1DGSA 1AI5A 1GMGA 1AROP 5KFEA 3RVZA 1FXVA 3N8DA 2AZ0A 4DR2H 2QA4V 2BQUA 4RWUA 3L74H 3APOA 5KA5A 1KECA 4KHPH 3SYAA 3T1HB 4D7SA 2YL2A 4O2BF 3M4IA 2QKAA 3T9CA 2HVSA 3BCCH 4K3AA 5IYCG 3DF7A 5B1NA 2LFSA 2IW5A 2LFRA 1XK5A 3AW8A 4A3BG 5C8YA 4DV0H 4G2KA 2CNUA 2D3OW 3RV3A 1AB3A 1AP6A 1PNLA 3ICXA 5B1BB 2JS3A 5KFVA 5HNEA 1VQPV 2AZ2A 4MTOA 5LHGA 3QG5A 2YIDA 4EGJA 2IJIA 1HNXH 1IBLO 2NR5A 4DR3H 3R5FA 4R50A 2IP4A 2YS7A 3HKZE 4B08A 1T36A 1PX2A 4JUZA 1X4TA 3WFVA 1GO3E 1K1QA 5L1IA 4WBNB 4QWCA 5JQGB 4PBCA 2C2AA 3UO3A 2QWRB 4JI0H 2AHYA 3JAWA 2QJ1A 4J9YB 4ZI7F 1DF5A 4JI3H 4TQRA 1WSCA 1IBKB 5J2TB 3N44B 3KREA 5KG4A 3P3PA 3D8CA 3K06A 3J7AU 2VS0A 3LNNA 1NU1H 3SJQC 4M0JA 3ABKC 5DG7A 5BR8O 4JGSA 1YTFD 4QSHA 4EYIB 1QVGU 4X20B 3CCVV 3BQ0A 3RIZA 3WWIA 5IP7G 3GB8B 2HJDA 3BA9A 3CCJV 4IIJA 2YS8A 4DR5H 5J2TF 3K08A 4FLYA 4GX0A 3MJFA 5B5EZ 5KUMA 2E75B 3U11A 4IWYA 2ATKC 2QGNA 4I55F 2OTJV 2X6AA 5H5NA 1EKPA 3KTMA 4I4TA 4JI4O 2XCPA 3RT3C 3IJ4A 1I08A 4DR6B 3W1BA 2JDIG 4LFBO 2ODMA 5FPRA 4NVPA 2RDIA 1SFOA 2Y0IA 5CBHA 1GK9A 2F66C 3JCZA 3WU2Z 3WB0A 3RAXA 3T5HA 4ECXA 4Q43A 3SNOA 3F5WC 3BEHA 1I1KA 2JJ2G 4DR4B 3BHPA 2IJJA 3TW6A 2VQEH 4J7KA 1AR4A 5IY5C 4QJFA 3BABA 1W93A 2DABA 3OE7G 5IY5B 4YBZB 3HOZG 1KB9F 4YAJB 1R3KC 1Y74B 4TV8B 4PI0A 2GV9A 2DQ3A 3MR2A 2XNDG 3T1HO 4MV7A 4FGRA 3U9SA 2JA6G 3OGIB 5BWRA 1M4UA 4L1KA 1Y6XA 2RJZA 4F6RA 1CKNA 2VA3A 3ZJZA 4K0KH 1F51A 1EZVH 2F93B 4DW0A 1R9TA 4MTDA 2NLJC 4IRCA 3HOVG 5A2QN 4BXXG 1PNMA 5KHIA 3CC7V 3W7UA 2VQFH 4APMA 1AJQA 5KT2A 5CA1A 1S72V 2WB1E 4D7TA 1KMIZ 4CS2A 4JI1O 3DSQA 2ZGIA 2WLJA 3TIIA 4CH5A 3W7XA 4TV8F 4YQWA 1AR5A 2WDTA 3OW2U 1UNNC 4TUYA 4LFAB 5K1XA 1M56B 2HGWA 5LMUH 1JMKC 1FS0G 4XBFA 1SA0A 2HGSA 3RB0A 2GHYA 4DK1A 4A3CG 1MSWD 1GAXA 1E4FT 2KB1A 4X9QA 4QJFB 4JV5O 3K3PA 5KG6A 4JF3A 5KFDA 3M9NB 3H0GG 2Q5ZA 3UCSC 3ZIAG 1K1SA 3GILA 4HQ6A 3CCSV 3K04A 4UB8Z 4NZOA 1I2LA 3KHHA 1L0NH 1PL0A 2HVQA 5FD6A 3UFXB 3L4KA 1SF9A 1V55B 3N6XA 2N05A 3TIGA 3STZC 4NR1A 4LF9H 1P49A 5IYZF 5LYJA 1VIBA 4O2AA 1B33N 2G38A 4EQ5A 2JS5A 5KAFZ 5LMNH 2WAQE 3WWHA 1N32H 1CQIB 1Z5WA 4PWQA 4XZ3B 1K8AW 3ASOC 5FNVB 2UUBO 1NR7A 1AJNA 4WFBV 2Q7DA 4PHZA 5DLFA 4JI8B 3IC7A 4ZHQA 3K5IA 4C5BA 1Y1VA 4HYKA 4LF7H 5KHKA 1JLLB 4DQNA 2Y69B 4JI6B 1Q5OA 4X88A 3LDDA 5KT7A 1ZL8A 1QBZA 1CQJB 5KG7A 3G6XA 2F4VH 1HWYA 4O2BB 2AW9A 1R6NA 2Q0OC 2X6BA 3MAQA 2QDOA 1A0IA 2COJA 3K0DA 5CB4F 3CSWA 3TEKA 2EBOA 4IHJF 1Q86W 3JZFA 2W8LA 4A3FG 2PF4E 3L2PA 1KT8A 5AG2A 2D2CB 3KAJA 2I8CA 3KALA 2ZM6B 4ZOLB 4BIOA 4LP8A 2HJFC 5J2UB 1WJZA 1MA1A 4B7EA 3PO2G 5GONA 4DR2B 3VBBA 3H9VA 1RK6A 2W6MA 3MHSC 4DR1B 2E5LO 3H1HH 4DV4B 2P22C 2YZLA 4P9PA 1VF7A 4O4JA 3FB7C 5BWWA 4MTXA 2XIGA 3E22A 4X62O 3KCXA 1I7FA 3SGIA 1YI2V 4ZI7B 2DMXA 1SRYA 1BJTA 1TUBB 3G6BA 1GSOA 3HB3B 2P90A 1KC8W 4YIOA 1KYOF 2FPIB 4MV6A 3TJTA 3JAKA 3JD1A 3HKBB 5HFLA 4O7ZA 5LOVF 5DM6V 2V7QG 1NVPB 1BS3A 3RYHA 4U6PA 3CQZA 1NQTA 3DGEA 5LXTF 1VQ9V 2IA6A 5K2MA 2Y4TA 4TV9B 3TXSA 1Y76B 5KFXA 5DGAA 4YP3A 5CM0A 3B40A 3E2EA 4O82A 4BW9A 3M8AA 4WBNF 4C7UA 3CD6V 2F23A 1V54C 3CRCA 3FB8C 4YAKB 2IU3A 1KEEA 4DL4A 4O3QA 1AVMA 1M5IA 5J9PC 1VARA 5KFPA 3GTOA 3PW4A 3RGBA 3KZIZ 4MW8A 5CB4A 3HKCB 3PW7A 4E2LA 4JI3O 5GTIZ 4DR6H 4FFMA 5I5XA 4JTDB 1N0NA 3TGUH 4EGQA 4DUYB 2V59A 4O86A 3E8GA 5F2VO 2JRIA 2XAFA 3CEBA 1H8HG 1N34O 1M6VA 1S5HC 4XYMB 2JA6A 5LMUB 4LFAH 3GV5B 2ZM6O 3ABUA 2UXBH 3L4JA 2AGOA 3RAQA 3RV4A 4O84A 4I50F 4ECRA 3BAAA 2HJWA 4E4TA 4CHIA 1O9GA 1WPXA 4U7CA 3Q8RB 5IJ9B 1N33O 1RPOA 3HOUG 1JQ0A 4IYIA 1TWFA 2GLTA 1I94H 4PA3A 4IIJF 5EZYA 1S97A 4RAYA 3SE7A 5KFCA 4TQSA 1XL6A 2PTMA 5KFUA 4X1YA 1NTZH 4JZGA 2QEXV 1R3JC 2P4VA 2FKLA 1DTOA 5LHIA 3PJSK 3H20A 4EYHB 4LWSA 4FU0A 3RGZA 3R5XA 1BQZA 5DGHA 4LFBH 3CHXA 1HW7A 1AN7A 4DK0A 2Z04A 3VQYA 2R8KA 2R7KA 2R70A 2C2DA 3JARB 5LGTA 1Y1WG 1K9MW 4I9QA 2R93A 3HKEB 4OXSA 3O65A 4R8CA 1HNXB 1XMQB 4ED7A 4DV1O 4B3TO 4DR6O 2RMKB 1Q6UA 3TXQA 2PI4A 3DC5A 4I0XB 4B3MO 4GC6A 3QF7A 2QM7A 5EIBD 5LBQA 5JVDF 3DXRB 2XAHA 1FKAO 1F4MA 4WFHA 1WA8A 4JAVA 2IJKA 5LA6A 1UC9A 3K3VA 3OSPA 2XOKG 4IAJA 5KG2A 3N6RA 4JI1B 5L9XA 1Q6IA 4MS2A 4X1YB 2Y4RA 5CAEB 4KHPB 4O3NA 4YR2A 4NXMB 2UXXA 5IJ0A 2HHHH 1EUDB 1WNSA 4CBCA 3STLC 3W7TA 3ZMSA 2ADPA 3T2MA 2Q69A 4DV5O 3OMIB 3B4SA 5C8YB 4RAIA 1R6KA 3CCLV 4DR1H 4JV1A 5LGNA 4IRKA 4O3SA 2YWVA 1JDEA 1AUVA 3LWBA 5KMGB 2LW7A 1XQ8A 3F5TA 2QM8A 4IRDA 1GN4A 5FPOA 3ZHQA 2B63G 3JAMN 3TW7A 4JTAB 4DUZO 1BXRA 4GZRB 2CW8A 5JQGF 1V9PA 4DLKA 2EIJC 3ASNB 1XNRO 1XBLA 1IBMH 2H8PC 3TY5A 4PZ7A 2WAMA 5JH7B 1I1LA 4TQFA 3CMAV 4JI0B 4O7WA 4WFFA 5L1JA 2R7ZG 4HR7A 1H2GA 5KHJA 1IOWA 4MVSA 1N32O 2EIKC 1UC8A 1Z2OX 4YJ3F 1WA8B 3JAWB 1WLEA 5EYPA 4DV0O 5C8YF 4LF7B 3AEIA 2VUMA 4QIWF 1RK5A 3MWEA 4HNAA 4J80A 1IVSA 1BGWA 3CRAA 2WPDG 1JX9A 5LMNB 4FBTA 2YICA 4NKGB 3T4ZA 2F95B 3HKDB 3CCMV 1H38A 4RB1A 2YZNA 1EHIA 1WP8A 1XNRB 4DV0B 1AI7A 2NU8B 4QWAA 3CSXA 1VBHA 3VQVA 3ZBHA 4TQDA 4FLXA 4X20A 4B3SO 4LR3A 4MVRA 2YEVA 5KMGA 3FKIA 2UUBH 3EPGA 3T7AA 4H37A 4QW8A 3H1KH 5I5TA 4UB6Z 3WO1A 2BOCC 3HR0A 3FAVB 1CP9A 3U54A 2UXNA 1ZLZA 4A3DG 3AG4C 5D1OA 1T94A 3SYOA 1URFA 3JD0A 1W0KG 4NB5A 1A0GA 2RGVA 5EBMC 3BA8A 3GTMA 1OCRB 2QB5A 1S68A 1FJGH 2R7ZA 2LP7A 4MV4A 1SQGA 1MG1A 2ASDA 4JZ2A 2UUAH 1JVMA 3ZRVA 1WP7A 3AK2A 4RB0A 4WF9V 3PO3G 4MV9A 3FMAA 2LO1A 2WE6A 1YJNV 2DWCA 5C5JA 3K5NA 2K9PA 3TCUA 1XOUA 3FD9A 4X62B 3CS5A 4QWEA 2GTSA 3DAAA 4TT3G 2ILMA 2RQ6A 1SEIA 3V6KA 3RYCB 3ETEA 1WB8A 1DF4A 2IH3C 1H2MA 3QTCA 2VQFB 4X62H 1P16A 5BMVA 5L3GA 1K7DA 2YRWA 4BIUA 3HKDA 4ECYA 2HG5C 5D5PA 1HNXO 2WLNA 1NTKH 2QE7G 4J42A 1YITV 2HIXA 3KHRA 2CTQA 3ZMVA 1BNCA 4B3TH 4I55A 3E8FA 1FVIA 3K5HA 3N40P 5KLVH 4JI4H 5LXTB 2L6LA 1DK1A 3VPCA 2HHFA 3I4MG 3OT7A 2C2EA 2UXDH 1NJIW 2Q2UA 1VQ6V 2JEUA 4DV1B 3K9AA 4FJCC 2GPWA 4IZOA 4XYLB 4Q44A 1S0NA 4Q8EA 1XILA 2M6YA 3T1YB 4FZ1A 2FK1A 4QIWA 4BR6A 3TK1A 3PR4A 1UJWB 1SQPH 3PR5B 3SPIA 1RM1C 3HO8A 1IXMA 3OM3B 3F7VC 3E35A 2X5RA 3BJYA 2R85A 1H8EG 2BSKA 4CZZA 2PMZE 4MW3A 3GLKA 1MSDA 4J9MA 4DV5H 1RJPA 3RYCA 1EN5A 2WLIA 4ICGA 1VQLV 3NBYB 5KFIA 1AP5A 1W0JG 3C3SA 2E74B 4P2ZA 2YYAA 2E76B 4J9QA 4GC7A 2GTAA 4JI7B 2ZINA 3GWKC 1OJHA 5IYCO 3AK1A 2W70A 1VF6A 3B8MA 3TQTA 5EC2C 3DTFA 1NT2B 1O75A 1G6UA 2VRZA 3OAAG 3GJXB 3Q2OA 1WPBA 4LC1A 1YJ9V 1COWG 2E2HA 4RZRA 1N34B 4GLXA 4HNTA 4O4HA 1XI1A 1LUWA 2BOBC 2Q9LA 4B3SB 1TWGA 2W57A 1SKVA 3H3VH 3BPZA 4TSFG 1ZTEA 5FL7G 4FLTA 1WR2A 3A0RA 4PA6A 3BG5A 3OR6C 5KFTA 4A5UB 4DXWA 2OIGA 4CMDA 1VQMV 4ZIBA 3EVKA 2Q4PA 5DQIA 4MV1A 2CTRA 5JVDB 3X2QC 4F6RB 4J9RA 1G2WA 3IG0A 5KFFA 3JAKB 4JI3B 3JZIA 1IX9A 2HHHB 2JA7A 4FS1A 2WWWA 4O7VA 1OBGA 4LCUC 3EHBB 2VQDA 5HV6A 2PBZA 5TISZ 4YY3H 2ZDIA 4R8UA 5EC1C 4I7ZB 4YIPA 1VQNV 2FB9A 1JOYA 2YRXA 4LF5O 3RFCA 4X65B 4DL3A 4Q8FA 5ITZB 3NXSA 4HNUA 3PVXA 3ZHTA 1JR9A 4GLWA 3T5JA 4WHXA 4JAUA 4EB6B 3BQ2A 1KBLA 4FLVA 2DOSA 2JVDA 2UUCO 1Y66A 2HFEC 3N41B 5IYBG 3T99A 4J11A 2PUSA 3IAYA 3RB4A 4MTGA 4ZHQF 3OGCC 4Q4DA 2QM4A 2J6UA 3CX5F 4DV3H 1P84F 1KKDA 4I7HA 3ZHUA 3OTOO 1EZ1A 1HNZH 1VEWA 4O4JB 4UCOA 4DR7O 3GWOA 4D6TH 4DV1H 4KHPO 1F7YA 1S03G 2P5OA 3R5HA 4LFBB 3U10A 3K79A 4P30A 4CC6A 2AGAA 4QIWE 4RUAA 4JI4B 1BHBA 4B3RH 4A3MG 1EN6A 1NI8A 1B6SA 1OCOC 4O2AB 4J41A 2W6OA 1BMFG 3G80A 3TINA 2Q67A 1VMGA 3LSQA 2P67A 4B3MB 2PI5A 2OWOA 1KC7A 5F9NA 1V4YA 3BY6A 4X1KA 2UXCO 2CE4A 2YIBA 1VBGA 4GYCB 2Z5UA 5EZYB 2Q8VA 3UT5A 5HFMA 4XDKA 3H1JH 1AUXA 2X0LA 1B04A 4ETSA 3GVMA 2PYJA 2O57A 2WAQA 5GTHZ 5LHHA 3LULA 2DW4A 4LF5H 3VQXA 3S3XA 1GM7A 4F4YA 4X64B 4FE2A 1E1QG 2Y0PA 3JAMW 4QWDA 4F4ZA 1HNWB 2JGDA 5H9CA 1SQBH 4LF6B 4O3RA 5IWAO 4C2MA 5DG8A 3TQ1A 3FKSG 2R9IA 3I12A 1QLEB 3ZHRA 3U55A 2ZIOA 4AQYO 4EBEA 3I5DA 4IHJB 4CC5A 2FYUH 4LF4B 3OR7C 4FM9A 4LFCB 4AYBA 2YXHA 4HZ3A 2VQEO 3QFFA 4LMYA 4DR7H 2SCUB 4I0XA 2NVYA 4BY7G 2OCHA 1H2SB 4JXUA 5FLMG 3H1LH 2HVKC 2Q73A 1VQ7V 1Q82W 5J2UF 1CEZA 3OTFA 4ECSA 4UCVA 1BGYH 4M9UA 2EJ2A 4DL7A 4O7LA 1QCEA 3ZRXA 3E5NA 3BRCA 4DV6H 3L71H 1PP9H 4DV3O 1Y67A 4O2AF 1SQFA 1ZAUA 2HIVA 1QLNA 4GKKH 4JYAH 3OUZA 2VQFO 3ETHA 2UUAO 1YZBA 4U3JB 2RGRA 4PDRA 3SDLA 5KX5F 1L2ZA 1L1FA 4UUGA 3OTOB 1N56A 3NGDA 2BTQA 4I9WA 3GIIA 3ZHSA 4B3RO 3IFXA 1IOVA 3P3NA 2AGPA 2OCCC 2I87A 1S5LZ 2R8JA 4FBUA 2CQYA 2AU0A 4IHJA 4X66H 2KG7B 4NZMA 4ZKIA 2ETNA 3ZMUA 5KFLA 1M7JA 1K5SA 4RUFA 2R93G 3V6JA 2YUAA 1N4CA 3T1CA 5EWFA 1U96A 4RCNA 1K83A 4FLWA 2DWEC 2I80A 1TWCA 3OTOH 2EJ7A 5L3BA 2DJVA 1E4EA 4NXNB 2A1HA 2JA5A 4DRXA 4GX1A 1XNQO 5LYJF 1SERA 5LP6A 2EILC 1TVKB 3RWRD 2EIYA 2UXCB 4DIMA 3LSSA 3QO7A 2Y0SE 5J2TA 4OX9O 4PJ0Z 2UVWA 3L9DA 5B1AB 4WFAV 1JFFB 2YEVB 3JZ6A 3L72H 4JI8H 2WYOA 1CPYA 4LF8H 1LUVA 3G67A 4EEQA 2XTAA 4EFEA 4BWSC 2IM9A 1N32B 4FIPC 4JTCB 2QKCA 1SYXB 5IP9G 5EBLC 4LF9B 1KU9A 2PGGA 1VAJA 4JI0O 4DRFA 3F8NA 2YI9A 5IYBO 4DR7B 2HR3A 3UYYA 2B1IA 1SCUB 2FE3A 2Q2TA 5KFYA 1GYFA 4UV8A 2ZXWC 2YIBD 3HBLA 3T5KA 5CA1B 3N27A 1S9FA 3ZRWB 5JH7A 3PFFA 4JI7O 5FJ8G 4IIJB 5I5VA 4QW9A 2QSAA 1FXHA 4JI2B 4I4TB 4DV7B 3GIPA 1S0MA 4L87A 5DEDA 5JQWA 3JRWA 3HOXG 2PZSA 3HKZA 1GRJA 1RFYA 1BHAA 1HNWH 2YXLA 4K8ZA 2ADQB 4UCTA 1G1XB 2DE0X 3OHBA 4FFNA 2WA4A 4BWAA 1DLBA 3R66A 2GUZA 3QZ8A 2WLMA 3J81N 5C3EG 2QR4A 5IE9A 2QWPB 5I5WA 4O7SA 1JDBB 5BWTA 2CAZC 1JPXA 1QHTA 3M7MX 2UXBB 2ZJTA 2F4VO 3PW2A 4X1IB 5FNVF 4K6NA 3OUSA 5DISC 1H2KA 1D5AA 4PA7A 4OX9B 3AG1B 4DUYH 1B6RA 3NC0B 3RJ0A 4MVQA 3LSUA 4TV8A 2JA7G 3NR7A 4JI2H 3THOA 2BE3A 3N2KA 4TUYF 1BT8A 4C5CA 4DV2H 4JV5B 5H6RA 1S3JA 1DAAA 4ED6A 2BQ3A 4PDBA 3JASA 5I47A 2IJHA 4I5SA 4ZHQB 3M9MB 5LP6C 1KP3A 1Z5VA 3CXHF 5I5SA 2ITDC 4GUNA 4NYKA 3RW0A 1M93A 5EZYF 1RYRA 3V6HA 4ED0A 1FAFA 1ZL8B 5DGBA 1FXKC 3G6YA 3LUTB 2ALZA 1KUQA 2V1DA 4CE5A 3Q4HA 5LL6b 3QO8A 3PN1A 4DUZB 4CKEA 1GGOA 1V54B 4LF8B 2EX3A 1OCCB 2OLSA 1NBMG 1SZXA 1NH2B 3Q8SB 3RGXA 4O7RA 1OZ0A 4CH3A 2ZDHA 4TUYB 4X66O 3CJHB 3K57A 4A2AA 4TVIA 3MDSA 3H4BA 1QNMA 4R6ZA 5BXZA 1Y1WA 5JCOA 4Y8VB 3LDEA 5I5UA 2R82A 5KFNA 3ETGA 4AHCA 4RO2A 2NUAB 2EJ0A 4DR5B 3AG2B 5KFBA 1NH2D 1GKFA 5DAAA 1JA8A 4EKWA 5JVDA 2HDKA 4J9KA 1N33H 1K5QA 3GIDA 4YB8B 5BWXA 4O4IB 1XEQA 3IGAC 2HG8A 4KL1A 2XCAA 5BMVF 4J7JA 4F4XA 1SZTA 1R1BA 2UUCH 1YJWV 1H2NA 5CE8A 3FAVA 1EKFA 4IWXA 4BBSG 1KQSU 3T9DA 2ASLA 3L75H 3JATA 5FR9A 5EDWA 3PW0A 2NU6B 1U97A 1FXKB 3RYHB 3SPCA 1KD1W 2C22A 3CWBH 2IBZH 3O9OA 4FFBA 4TOIA 1C30A 2DZDA 3OHAA 3UZBA 3G4SV 1W59A 1LR1A 2L35A 4BIZA 1CKMA 5CBGA 2VR1A 2F4VB 1Q8IA 3CP1A 1K92A 2CK3G 3MR5A 5IWAB 5B3SC 1IYDA 3ABLB 2P06A 4JI6H 4LH7A 2N74A 2ZT9B 4E6NA 1O9HA 5DG9A 4PDMA 3E86A 2W6NA 4J0MA 3GTPA 2AGQA 4YXWG 4DR3B 2ZQMA 3GTJA 1JJ2U 1YCIA 2OTLV 2LJ2A 3I56V 2COIA 4DV5B 1ZQ7A 3RBEA 2IU0A 4NTXA 3B77A 5KFSA 2A7WA 2UVVA 5IDJA 2OYQA 4RZQA 5JJJB 2C00A 4DV7O 1OBDA 3S24A 4MVMA 1E79G 3PW5A 5LXTA 2CW7A 2EJ3A 4RNMA 1P7BA 4UUJC 1EYZA 2CZGA 3RBDA 3JATB 4IT5A 4NYEA 1JKJB 2W71A 5JCOC 1PM9A 5LMUO 2ATLA 1M1KW 4LF9O 2A0LA 5EWGA 1IXBA 3E89A 2FMLA 3GB7C 2X0SA 4FFBB 3RR5A 1ZSPA 5DQGA 5IJ9A 4JI5B 3OD4A 1XUQA 5D5QA 3Q1KA 3KKYA 2JA5G 4DR1O 4DUYO 3HOYG 3K9SA 3BFRA 1FFXB 1N36O 3ML0A 4MVOA 4TV9A 4QWBA 1IZ3A 4B7KA 4EB6A 1KJJA 2EZOA 2ZE8A 4H0LB 4M7EA 2R9RB 2JEXA 2UU9O 4GKJO 1OCZC 4BAYA 2QWQB 3A0HZ 2W6QA 4ECZA 4A2BA 1YIJV 5CA1F 3WWJA 2R8IA 1TUEB 1I5YA 3E8HA 3T9FA 4MSWC 2JJ1G 1ZHSA 1RJRA 1IBLH 1VQ4V 2X7RB 5F9LA 3K58A 5KFZA 1Q3EA 1MOFA 2WLLA 4JI8O 3JALB 1P7GA 4RNOA 4UVAA 2IBKA 4B3RB 2CDYA 3W7WA 1KJ9A 1WB7A 3VNNA 3GIJA 3JD4A 3K5MA 4GKKO 4JYAO 2XCLA 1OWTA 2FKXA 3N43B 3BQ1A 5A9GA 4WBNA 1R73A 4O4LB 4J9NA 3B09A 4X1KB 2QYZA 5IYDG 1HNZB 2O03A 2LQTA 3IN5A 4DV3B 3CCQV 5L3CA 3T9BA 1Q81W 4CKCA 2FK3A 2RF4A 1HR0B 3D3IA 4HNVA 2JEFA 1DV1A 3EYYA 1XMOB 1ZUQA 1VP7A 1XMOO 2E5LB 3U9TA 1FJGO 5DQHA 4YHHH 3CXCU 5CA0F 3ABKB 1NTMH 3A0BZ 1HP8A 2Y48A 1Z2PX 3OMNB 2F43G 3A8TA 2ZE6A 2W7PA 4AILC 3I55V 2ZKOA 3EPIA 3K0GA 4MA5A 5KT5A 4PZ6A 1AI6A 2CNVA 3HT5A 4LWSB 5JVLA 1EFRG 2FK2A 3R9RA 1OCRC 4NTWA 4GCZA 1YHQV 3MD0A 3AX6A 4O3OA 2FLLA 3N2GB 2NVXA 2HKOA 3UQ8A 1HNWO 1K4DC 1CE8A 4HN2A 4AQYB 4X64O 3LQSA 1SQQH 1XREA 2OT5A 4O83A 1H2LA 1WAZA 1ORQC 1Z2NX 2X6CA 4F50A 2DYRB 3A2FA 4Q45A 2DYRC 2EINC 2XAJA 4N23A 1WRVA 2CUGA 3W7SA 1N33B 5BYBA 3OEHG 3CRRA 2VUMG 1Z2GA 4DV2O 4NXMH 2FPPB 2V9WA 2UU9B 4GKJB 4JI1H 2OCCB 1LNQA 3U0GA 5CMUA 1OV9A 4A3KG 4IR1A 2VUGA 4NTYA 1QU7A 2Q0AA 1RPRA 4O4IF 1Y4MA 2ZNJA 4YHHB 4DV4O 3QNEA 5H80A 2ZCEA 5C1OA 5T14A 4RB2C 5JJEB 1S10A 3LDCA 4G27B 3EXAA 4LFAO 3E8BA 2PMZA 2XC9A 3VOUA 3WO0A 1AILA 3CC4V 4FVMA 4JASA 3GTKA 4RUEA 3ORQA 1HDJA 4J9PA 2FPGB 4DYLA 5KT3A 2C2RA 3SPHA 2GPSA 3AK3A 4Z1VA 5IT9N 4DAAA 3GTGA 3ETJA 4A3JG 4YR3A 3SYQA 3H0GA 5KT6A 2A9HA 1VF6C 5JUMA 2RNBA 4U7OA 3NBZB 2YXYA 3ASNC 1YDXA 1ZHQA 4GT1A 4JV5H 5BMVB 1SQXH 4JPRA 5LP6B 3J81W 2JEGA 3JSLA 1KJIA 4GX2A 1TWHA 4AI8A 2R8HA 4AQYH 4A3IG 5JQGA 5C93A 4J9SA 4J10A 5DLGA 2DAAA 3CC2V 5L3FA 2HHFB 3R65A 3JCUZ 1Y74A 4F6EA 4FM1A 2GQRA 1RSOA 1I2KA 1K34A 4CKBA 1I7NA 3CB2A 2PY5A 1GLVA 3RTXA 2UUAB 5D1OB 2HHHO 4LF7O 4DV6O 3B2EE 2EIJB 1FJGB 4HBNA 4WFGA 4IGGA 5D1PA 3ZRWA 1DV2A 2YC0A 1KJ8A 5E25A 4O7TA 3NUAA 1XMOH 2HLDG 4A93G 2XUMA 4EEYA 1BSMA 4BY1G 3C3TA 2ZIMA 1J95A 2LGQA 5E79Z 2R87A 5K1PA 2B1GA 3ZMZA 3GTQA 2BCCH 3KCYA 2RDCA 3WB2A 2DQ0A 5KX5B 3SPGA 5KG3A 1RP3B 2DLNA 5BY1A 3UO2A 2VA2A 4WD3A 1PNKA 2EJRA 4FM0A 1EBOA 1W2BU 4RAZA 5L3EA 1XNRH 4MTFA 5CBFA 2B63A 1GM9A 1KJQA 3J7AK 2Y4UA 3TY8A 1QR9A 4ED1A 1E4EB 2YIAA 3GIMA 5EYPB 5C4XG 4G28B 4XDJA 4X1IA 1ZWIC 2KQXA 1SESA 4FFPA 4FFRA 1TVKA 4DR3O 4DW1A 4EG0A 1S0OA 2F1MA 2RCVA 2DWDC 4HNAB 4UCSA 1RM1B 4LF6O 2UVUA 4I50A 1J5EB 1E4GT 5HBRB 2VPQA 3T1YO 3K5LA 4JYYA 3GDEA 5KG5A 2WA3A 4MVZA 2E3CA 3ABLC 4ME6A 1X59A 2CFMA 2W9CB 4ECVA 3M99B 2R9AA 3K5OA 5LYJB 4K8XA 4U7NA 3RYFA 2ITCC 3ZEDA 2NU7B 3DTUB 1TGOA 4RB3C 2H94A 5FNVA 4LNUB 2WLKA 5KX5A 4YJ2A 1QQCA 3ABTA 3JD2A 2IH1C 5ITZA 4J9OA 3ETQA 2XD4A 3V4ZA 4JI5H 4CH4A 1A32A 1ZX3A 4O81A 2VWJA 2R84A 4O4JF 5BPFA 2HP8A 2Q6AA 1IDSA 1G4YB 3APQA 5B1BC 3AG4B 4NLGA 5KAIZ 5B3SB 5EWEA 4G3IA 4O4LF 2FLPA 1S77D 4J7ZA 1HNZO 1J5EO 1FFTB 4R7RA 4JV0A 2YSUB 2Y69C 4F4LA 4XDLA 2JEJA 2CNQA 2WB1A 4JYAB 4GKKB 1UFIA 3AYHB 1WH2A 2CGNA 1S76D 1SS3A 1MZBA 2V4RA 1R6TA 4PZ8A 3UKMA 3W1GA 2CH7A 3IC9A 3OFNG 3MHHC 4WCEV 5CA0B 1PD3A 1K4CC 4LH6A 3K59A 5BPHA 3E22B 5KFGA 5KG0A 5IWAH 4TM5A 3RYIB 4UXNA 4DR4O 2XAQA 3LP8A 5GONF 1K97A 4Z1MG 1I5XA 2QWNB 1TUBA 5CN0A 1YF2A 4R8UB 1I94O 1UPGA 2CGOA 3ZX6A 3G71V 3OSNA 2W6ZA 2ZR3A 2UVRA 3FX7A 4ZBMA 4X8AA 1NR1A 1QLEC 4KXRA 5CA3A 3CPWU 1I94B 3WG7B 1VQ5V 3FYEB 1XNQB 1JX4A 4NZNA 4YJ2F 1Y14B 1QR8A 1GN3A 1SETA 4NXNO 2GQSA 5LL6Y 5DMXA 4ZOLA 5KFMA 1WCMG 3FFQA 5LOVA 3CRMA 1Y1VG 1SC5B 1T5EA 4H13B 3C90A 5KA6A 3GV8B 3OEEG 2R8GA 1V55C 2YZMA 1PV0A 3HKCA 4O4LA 1YEWA 4PA4A 2E5LH 3RYIA 5KUKA 1KP2A 3L70H 3M9OB 1AI4A 4E4EA 4NXMO 1MABG 3HPLC 4HAMA 4DL6A 2WTFA 1PKXA 1US6A 5LA6B 2DPIA 4W4LA 2FP4B 1PL4A 2Q7HA 4QPKA 1KBHA 2YCHA 1FXKA 1ET0A 5KFHA 1P8LA 5IYZA 3SJBC 3E83A 3ZHVA 5FD5A 2DYSC 4JV2A 1KKCA 4PDLA 3KHGA 2W9AA 1M56C 2BTQB 3CYOA 1XL4A 1GH6A 3UM7A 1XMQO 4FFOA 2AQ4A 1M0WA 1OHHG 1WN7A 4PDVA 3GV7B 1IURA 4FS2A 3N42B 1MMMA 5EOYA 2VWKA 1C3OA 1Y76A 2ZNIA 4J9ZB 4QE7A 2UXCH
chains in the Genus database with same CATH topology
3QWUA 3JALA 2UXDH 4X20B 2OYQA 3JARA 2Q2UA 5JJJB 3KXYT 4DV1B 3S24A 4RZQA 3RIZA 1XHZA 5LXTA 2CW7A 3VQWA 3T1YB 5FLXW 3GB8B 3BA9A 4IIJA 4DR5H 4FLYA 3HKEA 3JATB 5JCOC 4EFBA 3U11A 1TAEA 3JSNA 4UFZA 4FFBB 3RR5A 1TA8A 4I4TA 5IJ9A 4JI5B 5D5QA 4DV5H 4X66B 4DR6B 3W1BA 3RYCA 3TY9A 3NBYB 1FFXB 5FPRA 4NVPA 4DV7H 4JI7B 4TV9A 2ZINA 4EB6A 2ZM6H 2F66C 1JFFA 4CS3A 2VPSA 3WB0A 1M0TA 4B3SH 4M7EA 1IBKH 1NT2B 5IJ0B 1O75A 1G6UA 3GJXB 4DR4B 3BHPA 2VQEH 1WPBA 2Q7GA 1N34B 3BABA 4GLXA 4A2BA 4O4HA 1XI1A 4B3SB 2W57A 1SKVA 3BPZA 4TV8B 4FLTA 4PI0A 2GV9A 4MV7A 4DV6B 1ZHSA 1IBLH 1M4UA 2RJZA 3K58A 4F6RA 1Q3EA 1CKNA 4K0KH 3JALB 4ZIBA 2F93B 4MTDA 4B3RB 3VNNA 5JVDB 4FLZA 3K5MA 4F6RB 5KHIA 2VQFH 3N43B 3IG0A 3JAKB 4JI3B 4WBNA 2HHHB 4APMA 4O4LB 5CA1A 4X1KB 4D7TA 1KMIZ 4CS2A 1HNZB 4LF4H 2O03A 3DSQA 4NXNH 3WB1A 4YY3H 3T1YH 4DV3B 4Q6GA 4CH5A 2PYLA 3LMLA 3W5OA 2WDTA 4X65B 3KAKA 4TUYA 4LFAB 5ITZB 5K1XA 3RF2A 5LMUH 1JMKC 1SA0A 2HGSA 2UUCB 1HR0B 4LF6H 4DK1A 4EB6B 3EYYA 1XMOB 3U0ZA 2E5LB 4FLVA 1E4FT 2JVDA 4X64H 4YHHH 3N41B 2XHBA 2PUSA 3IAYA 1Z2PX 2QM4A 4DV3H 4AILC 4I7HA 2BTOA 2HVQA 5FD6A 4U3JA 3L4KA 1HNZH 4YJ3A 4O4JB 4UCOA 4PZ6A 1S5JA 3N6XA 4DV1H 4LF9H 1P49A 1S03G 5LYJA 2P5OA 4LFBB 1VS0A 4O2AA 1CKNB 2VOBA 4EQ5A 2JS5A 3U10A 5LMNH 1N32H 3N2GB 1Z5WA 3UQ8A 4CC6A 1J5EH 2HVRA 4B3MH 4B3RH 4JI4B 1L8DA 5FNVB 4AQYB 4K0KB 4O2AB 4PHZA 4JI8B 4ZHQA 1Z2NX 4LSXA 4LF7H 4O2BA 5KHKA 3A2FA 4B3MB 2KKWA 2OWOA 4JI6B 1Q5OA 4DUZH 4X1KA 2YIBA 1N33B 4GYCB 2F4VH 4O2BB 5EZYB 3SJCC 3MAQA 1A0IA 3UT5A 4NXMH 2VQEB 4DR4H 1B04A 4ETSA 2UU9B 2PYJA 4GKJB 3L2PA 4JI1H 4LFCH 4O4HB 3KAJA 3SJAC 3KALA 2ZM6B 2VUGA 4ZOLB 2Q0AA 4LF5H 3VQXA 5J2UB 2ZNJA 4DV2B 4X64B 4YHHB 3JAMW 5GONA 4DR2B 1HNWB 4YJ3B 2ZCEA 4DR1B 5KHHA 5JJNB 4LF6B 4DV4B 2P22C 4RB2C 4OX9H 5JJEB 1VF7A 4X65H 4O4JA 1FKAH 2ZIOA 4ZI7A 3J80W 4LF5B 2XIGA 4LNUA 4YJ2B 3E22A 4FVMA 5BR8H 4IHJB 4CC5A 1I7FA 4LF4B 3SGIA 4FM9A 4LFCB 3ZS8C 4DR7H 4LMYA 4CH6A 4ZI7B 1BJTA 1TUBB 3C0FB 1H2SB 1XNQH 4FM2A 3KYHC 3OTFA 4UCVA 3NBZB 3JAKA 3HKBB 1ZHQA 4JV5H 5BMVB 1I6UA 5LP6B 3J81W 3RYHA 3JSLA 4DV6H 3BRCA 1XDNA 1SQFA 4TV9B 4AQYH 1ZAUA 2HIVA 4GKKH 4JYAH 5JQGA 1N34H 4U3JB 2RGRA 1SA0B 4BW9A 1N36H 4I50B 1L2ZA 4FM1A 5J2UA 1X9NA 5KHGA 1RSOA 1Q43A 3OTOB 2UXCH 2BTQA 1JJOA 3RFRA 1M5IA 4JI7H 3CB2A 2PY5A 3RGBA 3RTXA 4I55B 2UUAB 5CB4A 3HKCB 5D1OB 3B2EE 4IHJA 4DR6H 1FJGB 4HBNA 4X66H 5D1PA 4DUYB 3RYFB 1XMOH 3N2KB 1XMQH 2ZIMA 5IT9W 3JASB 5K1PA 5LMUB 4LFAH 2UXBH 1FFXA 3L4JA 4CS4A 3WB2A 5KX5B 3BAAA 4FLWA 3OTOH 4YY3B 2UU9H 4GKJH 4NXNB 3T1HH 4FM0A 3CVZA 1XNRH 4DRXA 1O9GA 4RAZA 1N36B 2UXDB 3HXLA 5IJ9B 3J7AK 3TY8A 5LP6A 1TVKB 3RWRD 2UXCB 2YIAA 1I94H 5EYPB 5EZYA 5J2TA 4X1IA 4RAYA 2JGUA 1TVKA 1JFFB 2PTMA 4X1YA 4JI8H 5LOVB 2WYOA 2F1MA 4LF8H 4HNAB 4UCSA 4EEQA 4BWSC 4I50A 4EFEA 1J5EB 2IM9A 1E4GT 2MCTA 3H20A 1N32B 3K5LA 3GDEA 3RGZA 4LFBH 1SYXB 3CHXA 1HW7A 5GONB 1AN7A 4LF9B 1KU9A 2E3CA 2PGGA 4DK0A 3VQYA 2R70A 4DRFA 3F8NA 2YI9A 4DR7B 2CFMA 2R9AA 2FE3A 3JARB 2Q2TA 1GYFA 5EIBC 4UCRA 3K5OA 4I9QA 2YIBD 3HKEB 5LYJB 5BR8B 5CA1B 4FLUA 4MTEA 1CKOA 4LSAA 4K8XA 5JH7A 3RYFA 3ZEDA 4IIJB 4O4IA 1HNXB 1TGOA 4RB3C 1XMQB 5FNVA 4LNUB 4YJ2A 5KX5A 4I4TB 4DV7B 4JI2B 1QQCA 2Q7EA 5ITZA 2PZSA 3ETQA 1HNWH 4JI5H 1HR0H 3QF7A 2YXLA 5EIBD 4CH4A 4K8ZA 4UCTA 2VWJA 4BWAA 2KSWA 3SR2C 2UUBB 5LA6A 3K3VA 3UT5B 3HKBA 4IAJA 4JI1B 2HEPA 4R7RA 2CAZC 4X1YB 1QHTA 4KHPB 3M7MX 2UXBB 2ZJTA 4NXMB 5IJ0A 4X1IB 2HHHH 5DISC 1D5AA 1WNSA 2YI8A 4JYAB 4GKKB 4OX9B 1WH2A 1MZBA 4DUYH 5C8YB 3NC0B 4Q0YA 4DR1H 3RJ0A 4TV8A 4PZ8A 3N2GA 1XHXA 4JI2H 4B3TB 3THOA 3N2KA 3W1GA 5KMGB 4DV2H 1XQ8A 4JV5B 1IBLB 4PDBA 2V4DA 3JASA 5FPOA 5CA0B 4UCUA 4ZHQB 1Z5VA 5LP6C 4LH6A 3MWMA 2CW8A 3K59A 1M93A 1V9PA 3E22B 5IWAH 5CB4B 3RYIB 1IBMH 3TY5A 5CA0A 1IBMB 4PZ7A 5JH7B 4TQFA 4JI0B 4DRXB 1TUBA 2R72A 5LL6b 5KHJA 3PN1A 4DUZB 1Z2OX 5A2QW 4LF8B 4PI2A 5IYZB 3JAWB 2EX3A 5EYPA 4L8JA 4LF7B 3RGXA 4DV4H 4CH3A 4TUYB 1DGSA 1I94B 4HNAA 1BGWA 3K57A 4A2AA 4DR2H 5LMNB 5JCOA 1XNQB 2F95B 3HKDB 4RB1A 4KHPH 1XNRB 4AHCA 4DV0B 3T1HB 4D7SA 3CSXA 3VQVA 4DR5B 4TQDA 3M4IA 4ZOLA 4FLXA 4X20A 2HVSA 4LR3A 5KMGA 3FFQA 3DF7A 5LOVA 2UUBH 5JVDA 1XK5A 5C8YA 4DV0H 1T5EA 1N33H 4O4IB 4KL1A 3HKCA 3ICXA 5D1OA 4O4LA 1YEWA 2E5LH 3RYIA 2RGVA 3BA8A 1FJGH 1S68A 2UUCH 3QG5A 1SQGA 1HNXH 4DR3H 2UUAH 4RB0A 3FMAA 4MV9A 3JATA 2WE6A 3RYHB 4B08A 3K5NA 5LA6B 1X4TA 4WBNB 4FFBA 4TOIA 4X62B 2Q7HA 2YCHA 5JQGB 1SEIA 2RQ6A 3RYCB 1P8LA 4JI0H 1CKMA 3JAWA 2QJ1A 3SJBC 5IYZA 2F4VB 4JI3H 1Q8IA 3QTCA 5FD5A 1IBKB 5J2TB 2VQFB 4X62H 5IWAB 1P16A 3N44B 5BMVA 4JI6H 4LH7A 3HKDA 2BTQB 4E6NA 1O9HA 4J0MA 1M0WA 5D5PA 1WN7A 3N42B 2HIXA 4DR3B 3LNNA 2VWKA 5EOYA 4B3TH 4I55A 1FVIA 4DV5B 2ZNIA 3N40P 4JI4H 5LXTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NC0 B;  4PZ6 A;  4UCO A;  3QWU A;  4PZ8 A;  4B3T B;  2Q2U A;  3RTX A;  4DV1 B;  2UUA B;  3S24 A;  3W1G A;  4JV5 B;  5D1O B;  1IBL B;  4LFB B;  1FJG B;  1VS0 A;  5FPO A;  1CKN B;  4UCU A;  3T1Y B;  5D1P A;  4EQ5 A;  3GB8 B;  4DUY B;  3BA9 A;  4LH6 A;  3UQ8 A;  4CC6 A;  1V9P A;  2HVR A;  4JI4 B;  4AQY B;  3TY5 A;  4K0K B;  1IBM B;  4JI8 B;  4PZ7 A;  4EFB A;  5LMU B;  1TAE A;  4JI0 B;  3JSN A;  4B3M B;  2OWO A;  4UFZ A;  3RR5 A;  1TA8 A;  4JI6 B;  3BAA A;  4JI5 B;  3PN1 A;  4X66 B;  4DUZ B;  4DR6 B;  4YY3 B;  3W1B A;  4NXN B;  3TY9 A;  4LF8 B;  1N33 B;  3NBY B;  1N36 B;  4LF7 B;  5FPR A;  1A0I A;  2UXD B;  2VQE B;  4JI7 B;  3TY8 A;  1B04 A;  2UXC B;  2UU9 B;  4GKJ B;  3L2P A;  1DGS A;  1I94 B;  5LMN B;  2ZM6 B;  2VUG A;  3GJX B;  4DR4 B;  1XNQ B;  4DV2 B;  1XNR B;  4X64 B;  3BAB A;  4YHH B;  4DV0 B;  4DR2 B;  4GLX A;  3T1H B;  1N34 B;  4B3S B;  1HNW B;  4UCS A;  4EEQ A;  4EFE A;  4DR5 B;  1J5E B;  4DR1 B;  4LF6 B;  1N32 B;  2HVS A;  4DV4 B;  3GDE A;  4DV6 B;  1XK5 A;  4LF9 B;  1CKN A;  4DRF A;  4DR7 B;  2CFM A;  4LF5 B;  2Q2T A;  4B3R B;  4UCR A;  5D1O A;  3VNN A;  5BR8 B;  4CC5 A;  4LF4 B;  1CKO A;  3BA8 A;  3SGI A;  4LFC B;  1S68 A;  4JI3 B;  1HNX B;  2HHH B;  1XMQ B;  4JI2 B;  4DV7 B;  1HNZ B;  3KYH C;  4UCV A;  3NBZ B;  4X62 B;  4TOI A;  4DV3 B;  4UCT A;  3W5O A;  4X65 B;  3JSL A;  1P8L A;  4LFA B;  2UUB B;  1CKM A;  1XDN A;  2F4V B;  1IBK B;  2VQF B;  1HR0 B;  2UUC B;  5IWA B;  1P16 A;  1ZAU A;  1XMO B;  2HIV A;  4JI1 B;  2E5L B;  4LH7 A;  4E6N A;  4KHP B;  2UXB B;  4NXM B;  2HIX A;  4DR3 B;  5DIS C;  1X9N A;  4JYA B;  4GKK B;  1FVI A;  3OTO B;  4DV5 B;  4OX9 B;  2HVQ A; 
#chains in the Genus database with same CATH topology
 2KG7 A;  4Q20 A;  3QWU A;  5KT4 A;  2V5A A;  1JCH A;  2NU9 B;  3JAL A;  3JAR A;  3KXY T;  4X89 A;  4DL5 A;  1XHZ A;  3VQW A;  5FLX W;  2EIL B;  4YY3 O;  4RU9 A;  3PZP A;  3ORR A;  4JI6 O;  5EBW C;  1KUT A;  3HKE A;  2GDS A;  1ROP A;  2LGW A;  2KSD A;  4EFB A;  4O7Y A;  1TAE A;  1E1R G;  3JSN A;  2EIM B;  4O7N A;  1D5N A;  4UFZ A;  5DEC A;  1NKD A;  1TA8 A;  1YVW A;  1BQ0 A;  4X66 B;  2R7M A;  4C5A A;  1GSA A;  1SQV H;  2J6S A;  3TY9 A;  4JI2 O;  3BVO A;  5KFR A;  4DV7 H;  2J9G A;  4ED3 A;  3DXR A;  1RJQ A;  3FKI G;  2ZM6 H;  1YSC A;  3P32 A;  1JFF A;  4CS3 A;  5JWP A;  1I7L A;  2VPS A;  1M0T A;  2K1E A;  2QF7 A;  4B3S H;  1IBK H;  5IJ0 B;  3CME V;  4N21 A;  2ZR2 A;  1B06 A;  1IBM O;  2Q7G A;  3SI8 A;  4ABM A;  3MFI A;  2W6J G;  3ABM C;  4QE9 A;  4DL2 A;  5KKN B;  3DC6 A;  3ABM B;  4O3P A;  2OH2 A;  4OGQ B;  4I4T F;  1EKV A;  1K73 W;  5B1O A;  4DV6 B;  4QPJ A;  3G6E V;  1PPJ H;  2R92 A;  1GM8 A;  1M90 W;  2NNU A;  5L1L A;  4GX5 A;  4ASU G;  3QVN A;  4FLZ A;  5K3W A;  4YR0 A;  3D36 A;  1OCC C;  2A06 H;  2YS6 A;  2WLL B;  3CCR V;  2W0F C;  3CRQ A;  3MR3 A;  4RQE A;  4O4H F;  1R3I C;  3GTL A;  4LF4 H;  3JYC A;  2HGX A;  4NXN H;  4LFC O;  3WB1 A;  5L1K A;  5BWU A;  1D2D A;  3T1Y H;  2COG A;  3VMM A;  5KFA A;  1GN6 A;  4Q6G A;  1VQK V;  2PYL A;  3T54 A;  4FFK A;  3LML A;  1PK8 A;  3W5O A;  3KAK A;  1IYE A;  1VQO V;  1DIK A;  3RF2 A;  4ECQ A;  2PN1 A;  3VPB A;  1M9N A;  2QKS A;  4JYB A;  3RB6 A;  2UUC B;  4LF6 H;  2JEI A;  2C35 B;  3L73 H;  2RDJ A;  3U0Z A;  4X64 H;  3QO5 A;  1A3G A;  3SYC A;  2XHB A;  2V58 A;  1TWA A;  5KFW A;  1OCO B;  2W8K A;  5I60 A;  1F23 A;  2BTO A;  4P9O A;  3ASO B;  1JIH A;  5L3D A;  2JA8 G;  4A3G G;  4U3J A;  4YJ3 A;  2XGP A;  2QTO A;  1S5J A;  4XX0 B;  1NS1 A;  2DIK A;  2A79 B;  2JIZ G;  1B3Q A;  2MW2 B;  2XAS A;  4RQF A;  4Q4C A;  3WG7 C;  2QWO B;  5CR5 A;  4EBD A;  1VS0 A;  3EFF K;  1CKN B;  2VOB A;  2ZE5 A;  4FPP A;  2P4K A;  3F7Y C;  3OUU A;  4RUC A;  2BSK B;  2HVR A;  1J5E H;  4B3M H;  4DR2 O;  1L8D A;  1MZE A;  4YHH O;  5LGU A;  4CMF A;  4K0K B;  2EIK B;  4LSX A;  1R3L C;  4O2B A;  2KKW A;  2RN9 A;  3MWD A;  2XGQ A;  2FJZ A;  1I0H A;  3RUP A;  2H3O A;  4DUZ H;  1BL8 A;  4R7C A;  1W96 A;  2GUZ B;  3H40 A;  2B5U A;  4UVB A;  2UXD O;  3SJC C;  2VQE B;  4DR4 H;  1FD9 A;  1YXB A;  1VQ8 V;  3T9A A;  4LF4 O;  1ENV A;  3T5L A;  4IYH A;  4LFC H;  4O4H B;  4FFL A;  3SJA C;  1ULZ A;  2EIN B;  1MNG A;  3D36 C;  1RSO B;  4ECT A;  4DV2 B;  4A3L G;  3GQC A;  4YJ3 B;  1GSH A;  2QK4 A;  5KHH A;  3RVY A;  4BW5 A;  5JJN B;  2PVP A;  3J80 N;  2ASJ A;  4H33 A;  5I5Y A;  5DGI A;  1A9X A;  4OX9 H;  4AYB E;  1V51 A;  2AXT Z;  1BE3 H;  4KFM A;  4X65 H;  2DPJ A;  2DYS B;  1FKA H;  4TV9 F;  1YTF B;  4ZI7 A;  5KFO A;  4LF5 B;  3J80 W;  4LNU A;  4YJ2 B;  4UV9 A;  5BR8 H;  3ZS8 C;  1S0V A;  4CH6 A;  3DTG A;  3Q4H B;  1MZF A;  3TET A;  3C0F B;  4ED8 A;  1XNQ H;  2FMA A;  4MA0 A;  5E1A C;  4FM2 A;  2CTW A;  1OCZ B;  3KYH C;  4JYC A;  1K33 A;  2ARH A;  3MR6 A;  5BYA A;  1I6U A;  1L0L H;  3LNM B;  1XDN A;  3CJH A;  4PEL A;  3BAC A;  2ZXW B;  2HVJ C;  3AG7 A;  3UZO A;  3VPD A;  3H4D A;  4W4K A;  3T9E A;  5GW7 A;  2M05 A;  4DR5 O;  1N34 H;  1HR0 O;  2ZD9 A;  5H6Q A;  2W7O A;  4HYO A;  3WNZ A;  4A3E G;  4IR9 A;  2GBO A;  2EIM C;  3MFH A;  1SA0 B;  2EZP A;  1N36 H;  2WSS G;  1N48 A;  4I50 B;  2ZDQ A;  2DN9 A;  5J2U A;  1X9N A;  5KHG A;  1FYJ A;  1Q43 A;  2ZDI C;  2CH7 B;  2N04 A;  1GO3 F;  4RNN A;  2EUL A;  2IMW P;  1JJO A;  3Q8Q B;  3RFR A;  4PV1 B;  4IL6 Z;  4JI7 H;  2Z0A A;  2W9C A;  3KHL A;  2OIE A;  1THZ A;  3AG3 C;  4I55 B;  1N8R W;  4BBR G;  2A3Q A;  2JK5 C;  2R86 A;  5LP6 F;  1I50 A;  1M57 B;  3RYF B;  1Q7Y W;  2R7N A;  3KG2 A;  3N2K B;  2W9B A;  1K3E A;  4QGP A;  1XMQ H;  4UVC A;  2V4Q A;  3FYI B;  2YDE A;  4ECU A;  1T3N A;  3JAS B;  2CKZ B;  5IT9 W;  4ECW A;  1FFX A;  5H2F Z;  4JAA A;  4CS4 A;  4ED2 A;  3AG1 C;  5KFK A;  3RBZ A;  4YY3 B;  2FL4 A;  2UU9 H;  4GKJ H;  3QZ7 A;  3T1H H;  3CVZ A;  2E2I A;  1BZK A;  2Z02 A;  3R23 A;  1N36 B;  2UXD B;  3Q8P B;  4FK5 C;  1VF5 B;  3HXL A;  4J9L A;  3CEI A;  5KG1 A;  5C44 G;  1KTA A;  3K3W A;  1GTO A;  4OPA A;  5LMN O;  1F4N A;  2WLI B;  2Q68 A;  3S3W A;  4LBE C;  4DO2 A;  2JGD B;  3OUF A;  4MAM A;  2ODT X;  2JGU A;  2XT9 A;  1Q90 D;  4K0K O;  5EK0 A;  2W0X A;  5LOV B;  3AG2 C;  5FLX N;  2UXB O;  3FDS A;  3RB3 A;  2MCT A;  2Y0S A;  4JI5 O;  2FLN A;  4K35 A;  4QNH B;  3ZRS A;  2AHZ A;  5GON B;  1A48 A;  2M7W A;  3RN4 A;  2J6T A;  1EZJ A;  2BQR A;  2GSM B;  5KFJ A;  3X2Q B;  3AG3 B;  2YZG A;  2R92 G;  2NN4 A;  5EIB C;  4UCR A;  2W9B B;  1EN4 A;  4MTE A;  5BR8 B;  3QQM A;  1M57 C;  1EM1 A;  4OPH A;  5B66 Z;  4FLU A;  1CKO A;  3OMA B;  3HB9 A;  2ZDG A;  1G8M A;  4LSA A;  4O4I A;  2ABJ A;  1JXL A;  1GN2 A;  1AR1 B;  3JRX A;  3CCE V;  2Q7E A;  1WCM A;  3I4N G;  2QTS A;  1NVP D;  1QVF U;  5C1P A;  3H1I H;  1IBK O;  1HR0 H;  3G8D A;  1N0J A;  2W6P A;  3CE2 A;  2W6I G;  4X65 O;  2KSW A;  5B1A C;  3SR2 C;  2WLH A;  2UUB B;  3VA7 A;  3ETD A;  3JD3 A;  1EUC B;  3SPJ A;  4TWK A;  1XDC A;  3UT5 B;  3HKB A;  3VOT A;  2P0A A;  1Q6H A;  2CTP A;  2Z3Y A;  1P4R A;  3P30 A;  3D3Q A;  3B8N A;  1BCC H;  2HEP A;  5JH7 F;  2FB5 A;  4Z2W A;  3ZN0 A;  3K03 A;  3FB5 C;  5KS8 A;  2C28 A;  5BWV A;  2YI8 A;  2YU9 A;  3ZCC A;  4ZQI A;  2XAG A;  2FTK A;  2MK3 A;  4MVU A;  4Q0Y A;  1CXZ B;  2R6F A;  3T4D A;  4KP4 A;  1B6Q A;  1I1M A;  3N2G A;  1XHX A;  4MT8 A;  3ZMT A;  1CS0 A;  5D8D A;  4B3T B;  3V4S A;  3G6V A;  2B9Z A;  2R7L A;  1IBL B;  5LA6 F;  2V4D A;  3H01 A;  4U3F H;  4UCU A;  4KUM A;  3MWM A;  1I3Q A;  4MV3 A;  3G8C A;  4F4W A;  3GIQ A;  5IYD O;  5CB4 B;  5KFQ A;  3FB6 C;  5DN6 G;  3ZN1 A;  1FPO A;  3GIK A;  5CA0 A;  2ZE7 A;  1IBM B;  1AJP A;  3SYP A;  4DRX B;  1RYS A;  1NZ6 A;  2R72 A;  4MV8 A;  3CCU V;  4ZOL F;  2LW1 A;  2BR0 A;  5A2Q W;  3HOW G;  4PI2 A;  5IYZ B;  2P6J A;  5BZB A;  2P7T C;  4L8J A;  1ZET A;  4WFE A;  4FMT A;  4PA9 A;  4LF8 O;  4DV4 H;  4EBC A;  4FZ0 A;  4H44 B;  2YW2 A;  1VKZ A;  4PD4 F;  1DGS A;  1AI5 A;  1GMG A;  1ARO P;  5KFE A;  3RVZ A;  1FXV A;  3N8D A;  2AZ0 A;  4DR2 H;  2QA4 V;  2BQU A;  4RWU A;  3L74 H;  3APO A;  5KA5 A;  1KEC A;  4KHP H;  3SYA A;  3T1H B;  4D7S A;  2YL2 A;  4O2B F;  3M4I A;  2QKA A;  3T9C A;  2HVS A;  3BCC H;  4K3A A;  5IYC G;  3DF7 A;  5B1N A;  2LFS A;  2IW5 A;  2LFR A;  1XK5 A;  3AW8 A;  4A3B G;  5C8Y A;  4DV0 H;  4G2K A;  2CNU A;  2D3O W;  3RV3 A;  1AB3 A;  1AP6 A;  1PNL A;  3ICX A;  5B1B B;  2JS3 A;  5KFV A;  5HNE A;  1VQP V;  2AZ2 A;  4MTO A;  5LHG A;  3QG5 A;  2YID A;  4EGJ A;  2IJI A;  1HNX H;  1IBL O;  2NR5 A;  4DR3 H;  3R5F A;  4R50 A;  2IP4 A;  2YS7 A;  3HKZ E;  4B08 A;  1T36 A;  1PX2 A;  4JUZ A;  1X4T A;  3WFV A;  1GO3 E;  1K1Q A;  5L1I A;  4WBN B;  4QWC A;  5JQG B;  4PBC A;  2C2A A;  3UO3 A;  2QWR B;  4JI0 H;  2AHY A;  3JAW A;  2QJ1 A;  4J9Y B;  4ZI7 F;  1DF5 A;  4JI3 H;  4TQR A;  1WSC A;  1IBK B;  5J2T B;  3N44 B;  3KRE A;  5KG4 A;  3P3P A;  3D8C A;  3K06 A;  3J7A U;  2VS0 A;  3LNN A;  1NU1 H;  3SJQ C;  4M0J A;  3ABK C;  5DG7 A;  5BR8 O;  4JGS A;  1YTF D;  4QSH A;  4EYI B;  1QVG U;  4X20 B;  3CCV V;  3BQ0 A;  3RIZ A;  3WWI A;  5IP7 G;  3GB8 B;  2HJD A;  3BA9 A;  3CCJ V;  4IIJ A;  2YS8 A;  4DR5 H;  5J2T F;  3K08 A;  4FLY A;  4GX0 A;  3MJF A;  5B5E Z;  5KUM A;  2E75 B;  3U11 A;  4IWY A;  2ATK C;  2QGN A;  4I55 F;  2OTJ V;  2X6A A;  5H5N A;  1EKP A;  3KTM A;  4I4T A;  4JI4 O;  2XCP A;  3RT3 C;  3IJ4 A;  1I08 A;  4DR6 B;  3W1B A;  2JDI G;  4LFB O;  2ODM A;  5FPR A;  4NVP A;  2RDI A;  1SFO A;  2Y0I A;  5CBH A;  1GK9 A;  2F66 C;  3JCZ A;  3WU2 Z;  3WB0 A;  3RAX A;  3T5H A;  4ECX A;  4Q43 A;  3SNO A;  3F5W C;  3BEH A;  1I1K A;  2JJ2 G;  4DR4 B;  3BHP A;  2IJJ A;  3TW6 A;  2VQE H;  4J7K A;  1AR4 A;  5IY5 C;  4QJF A;  3BAB A;  1W93 A;  2DAB A;  3OE7 G;  5IY5 B;  4YBZ B;  3HOZ G;  1KB9 F;  4YAJ B;  1R3K C;  1Y74 B;  4TV8 B;  4PI0 A;  2GV9 A;  2DQ3 A;  3MR2 A;  2XND G;  3T1H O;  4MV7 A;  4FGR A;  3U9S A;  2JA6 G;  3OGI B;  5BWR A;  1M4U A;  4L1K A;  1Y6X A;  2RJZ A;  4F6R A;  1CKN A;  2VA3 A;  3ZJZ A;  4K0K H;  1F51 A;  1EZV H;  2F93 B;  4DW0 A;  1R9T A;  4MTD A;  2NLJ C;  4IRC A;  3HOV G;  5A2Q N;  4BXX G;  1PNM A;  5KHI A;  3CC7 V;  3W7U A;  2VQF H;  4APM A;  1AJQ A;  5KT2 A;  5CA1 A;  1S72 V;  2WB1 E;  4D7T A;  1KMI Z;  4CS2 A;  4JI1 O;  3DSQ A;  2ZGI A;  2WLJ A;  3TII A;  4CH5 A;  3W7X A;  4TV8 F;  4YQW A;  1AR5 A;  2WDT A;  3OW2 U;  1UNN C;  4TUY A;  4LFA B;  5K1X A;  1M56 B;  2HGW A;  5LMU H;  1JMK C;  1FS0 G;  4XBF A;  1SA0 A;  2HGS A;  3RB0 A;  2GHY A;  4DK1 A;  4A3C G;  1MSW D;  1GAX A;  1E4F T;  2KB1 A;  4X9Q A;  4QJF B;  4JV5 O;  3K3P A;  5KG6 A;  4JF3 A;  5KFD A;  3M9N B;  3H0G G;  2Q5Z A;  3UCS C;  3ZIA G;  1K1S A;  3GIL A;  4HQ6 A;  3CCS V;  3K04 A;  4UB8 Z;  4NZO A;  1I2L A;  3KHH A;  1L0N H;  1PL0 A;  2HVQ A;  5FD6 A;  3UFX B;  3L4K A;  1SF9 A;  1V55 B;  3N6X A;  2N05 A;  3TIG A;  3STZ C;  4NR1 A;  4LF9 H;  1P49 A;  5IYZ F;  5LYJ A;  1VIB A;  4O2A A;  1B33 N;  2G38 A;  4EQ5 A;  2JS5 A;  5KAF Z;  5LMN H;  2WAQ E;  3WWH A;  1N32 H;  1CQI B;  1Z5W A;  4PWQ A;  4XZ3 B;  1K8A W;  3ASO C;  5FNV B;  2UUB O;  1NR7 A;  1AJN A;  4WFB V;  2Q7D A;  4PHZ A;  5DLF A;  4JI8 B;  3IC7 A;  4ZHQ A;  3K5I A;  4C5B A;  1Y1V A;  4HYK A;  4LF7 H;  5KHK A;  1JLL B;  4DQN A;  2Y69 B;  4JI6 B;  1Q5O A;  4X88 A;  3LDD A;  5KT7 A;  1ZL8 A;  1QBZ A;  1CQJ B;  5KG7 A;  3G6X A;  2F4V H;  1HWY A;  4O2B B;  2AW9 A;  1R6N A;  2Q0O C;  2X6B A;  3MAQ A;  2QDO A;  1A0I A;  2COJ A;  3K0D A;  5CB4 F;  3CSW A;  3TEK A;  2EBO A;  4IHJ F;  1Q86 W;  3JZF A;  2W8L A;  4A3F G;  2PF4 E;  3L2P A;  1KT8 A;  5AG2 A;  2D2C B;  3KAJ A;  2I8C A;  3KAL A;  2ZM6 B;  4ZOL B;  4BIO A;  4LP8 A;  2HJF C;  5J2U B;  1WJZ A;  1MA1 A;  4B7E A;  3PO2 G;  5GON A;  4DR2 B;  3VBB A;  3H9V A;  1RK6 A;  2W6M A;  3MHS C;  4DR1 B;  2E5L O;  3H1H H;  4DV4 B;  2P22 C;  2YZL A;  4P9P A;  1VF7 A;  4O4J A;  3FB7 C;  5BWW A;  4MTX A;  2XIG A;  3E22 A;  4X62 O;  3KCX A;  1I7F A;  3SGI A;  1YI2 V;  4ZI7 B;  2DMX A;  1SRY A;  1BJT A;  1TUB B;  3G6B A;  1GSO A;  3HB3 B;  2P90 A;  1KC8 W;  4YIO A;  1KYO F;  2FPI B;  4MV6 A;  3TJT A;  3JAK A;  3JD1 A;  3HKB B;  5HFL A;  4O7Z A;  5LOV F;  5DM6 V;  2V7Q G;  1NVP B;  1BS3 A;  3RYH A;  4U6P A;  3CQZ A;  1NQT A;  3DGE A;  5LXT F;  1VQ9 V;  2IA6 A;  5K2M A;  2Y4T A;  4TV9 B;  3TXS A;  1Y76 B;  5KFX A;  5DGA A;  4YP3 A;  5CM0 A;  3B40 A;  3E2E A;  4O82 A;  4BW9 A;  3M8A A;  4WBN F;  4C7U A;  3CD6 V;  2F23 A;  1V54 C;  3CRC A;  3FB8 C;  4YAK B;  2IU3 A;  1KEE A;  4DL4 A;  4O3Q A;  1AVM A;  1M5I A;  5J9P C;  1VAR A;  5KFP A;  3GTO A;  3PW4 A;  3RGB A;  3KZI Z;  4MW8 A;  5CB4 A;  3HKC B;  3PW7 A;  4E2L A;  4JI3 O;  5GTI Z;  4DR6 H;  4FFM A;  5I5X A;  4JTD B;  1N0N A;  3TGU H;  4EGQ A;  4DUY B;  2V59 A;  4O86 A;  3E8G A;  5F2V O;  2JRI A;  2XAF A;  3CEB A;  1H8H G;  1N34 O;  1M6V A;  1S5H C;  4XYM B;  2JA6 A;  5LMU B;  4LFA H;  3GV5 B;  2ZM6 O;  3ABU A;  2UXB H;  3L4J A;  2AGO A;  3RAQ A;  3RV4 A;  4O84 A;  4I50 F;  4ECR A;  3BAA A;  2HJW A;  4E4T A;  4CHI A;  1O9G A;  1WPX A;  4U7C A;  3Q8R B;  5IJ9 B;  1N33 O;  1RPO A;  3HOU G;  1JQ0 A;  4IYI A;  1TWF A;  2GLT A;  1I94 H;  4PA3 A;  4IIJ F;  5EZY A;  1S97 A;  4RAY A;  3SE7 A;  5KFC A;  4TQS A;  1XL6 A;  2PTM A;  5KFU A;  4X1Y A;  1NTZ H;  4JZG A;  2QEX V;  1R3J C;  2P4V A;  2FKL A;  1DTO A;  5LHI A;  3PJS K;  3H20 A;  4EYH B;  4LWS A;  4FU0 A;  3RGZ A;  3R5X A;  1BQZ A;  5DGH A;  4LFB H;  3CHX A;  1HW7 A;  1AN7 A;  4DK0 A;  2Z04 A;  3VQY A;  2R8K A;  2R7K A;  2R70 A;  2C2D A;  3JAR B;  5LGT A;  1Y1W G;  1K9M W;  4I9Q A;  2R93 A;  3HKE B;  4OXS A;  3O65 A;  4R8C A;  1HNX B;  1XMQ B;  4ED7 A;  4DV1 O;  4B3T O;  4DR6 O;  2RMK B;  1Q6U A;  3TXQ A;  2PI4 A;  3DC5 A;  4I0X B;  4B3M O;  4GC6 A;  3QF7 A;  2QM7 A;  5EIB D;  5LBQ A;  5JVD F;  3DXR B;  2XAH A;  1FKA O;  1F4M A;  4WFH A;  1WA8 A;  4JAV A;  2IJK A;  5LA6 A;  1UC9 A;  3K3V A;  3OSP A;  2XOK G;  4IAJ A;  5KG2 A;  3N6R A;  4JI1 B;  5L9X A;  1Q6I A;  4MS2 A;  4X1Y B;  2Y4R A;  5CAE B;  4KHP B;  4O3N A;  4YR2 A;  4NXM B;  2UXX A;  5IJ0 A;  2HHH H;  1EUD B;  1WNS A;  4CBC A;  3STL C;  3W7T A;  3ZMS A;  2ADP A;  3T2M A;  2Q69 A;  4DV5 O;  3OMI B;  3B4S A;  5C8Y B;  4RAI A;  1R6K A;  3CCL V;  4DR1 H;  4JV1 A;  5LGN A;  4IRK A;  4O3S A;  2YWV A;  1JDE A;  1AUV A;  3LWB A;  5KMG B;  2LW7 A;  1XQ8 A;  3F5T A;  2QM8 A;  4IRD A;  1GN4 A;  5FPO A;  3ZHQ A;  2B63 G;  3JAM N;  3TW7 A;  4JTA B;  4DUZ O;  1BXR A;  4GZR B;  2CW8 A;  5JQG F;  1V9P A;  4DLK A;  2EIJ C;  3ASN B;  1XNR O;  1XBL A;  1IBM H;  2H8P C;  3TY5 A;  4PZ7 A;  2WAM A;  5JH7 B;  1I1L A;  4TQF A;  3CMA V;  4JI0 B;  4O7W A;  4WFF A;  5L1J A;  2R7Z G;  4HR7 A;  1H2G A;  5KHJ A;  1IOW A;  4MVS A;  1N32 O;  2EIK C;  1UC8 A;  1Z2O X;  4YJ3 F;  1WA8 B;  3JAW B;  1WLE A;  5EYP A;  4DV0 O;  5C8Y F;  4LF7 B;  3AEI A;  2VUM A;  4QIW F;  1RK5 A;  3MWE A;  4HNA A;  4J80 A;  1IVS A;  1BGW A;  3CRA A;  2WPD G;  1JX9 A;  5LMN B;  4FBT A;  2YIC A;  4NKG B;  3T4Z A;  2F95 B;  3HKD B;  3CCM V;  1H38 A;  4RB1 A;  2YZN A;  1EHI A;  1WP8 A;  1XNR B;  4DV0 B;  1AI7 A;  2NU8 B;  4QWA A;  3CSX A;  1VBH A;  3VQV A;  3ZBH A;  4TQD A;  4FLX A;  4X20 A;  4B3S O;  4LR3 A;  4MVR A;  2YEV A;  5KMG A;  3FKI A;  2UUB H;  3EPG A;  3T7A A;  4H37 A;  4QW8 A;  3H1K H;  5I5T A;  4UB6 Z;  3WO1 A;  2BOC C;  3HR0 A;  3FAV B;  1CP9 A;  3U54 A;  2UXN A;  1ZLZ A;  4A3D G;  3AG4 C;  5D1O A;  1T94 A;  3SYO A;  1URF A;  3JD0 A;  1W0K G;  4NB5 A;  1A0G A;  2RGV A;  5EBM C;  3BA8 A;  3GTM A;  1OCR B;  2QB5 A;  1S68 A;  1FJG H;  2R7Z A;  2LP7 A;  4MV4 A;  1SQG A;  1MG1 A;  2ASD A;  4JZ2 A;  2UUA H;  1JVM A;  3ZRV A;  1WP7 A;  3AK2 A;  4RB0 A;  4WF9 V;  3PO3 G;  4MV9 A;  3FMA A;  2LO1 A;  2WE6 A;  1YJN V;  2DWC A;  5C5J A;  3K5N A;  2K9P A;  3TCU A;  1XOU A;  3FD9 A;  4X62 B;  3CS5 A;  4QWE A;  2GTS A;  3DAA A;  4TT3 G;  2ILM A;  2RQ6 A;  1SEI A;  3V6K A;  3RYC B;  3ETE A;  1WB8 A;  1DF4 A;  2IH3 C;  1H2M A;  3QTC A;  2VQF B;  4X62 H;  1P16 A;  5BMV A;  5L3G A;  1K7D A;  2YRW A;  4BIU A;  3HKD A;  4ECY A;  2HG5 C;  5D5P A;  1HNX O;  2WLN A;  1NTK H;  2QE7 G;  4J42 A;  1YIT V;  2HIX A;  3KHR A;  2CTQ A;  3ZMV A;  1BNC A;  4B3T H;  4I55 A;  3E8F A;  1FVI A;  3K5H A;  3N40 P;  5KLV H;  4JI4 H;  5LXT B;  2L6L A;  1DK1 A;  3VPC A;  2HHF A;  3I4M G;  3OT7 A;  2C2E A;  2UXD H;  1NJI W;  2Q2U A;  1VQ6 V;  2JEU A;  4DV1 B;  3K9A A;  4FJC C;  2GPW A;  4IZO A;  4XYL B;  4Q44 A;  1S0N A;  4Q8E A;  1XIL A;  2M6Y A;  3T1Y B;  4FZ1 A;  2FK1 A;  4QIW A;  4BR6 A;  3TK1 A;  3PR4 A;  1UJW B;  1SQP H;  3PR5 B;  3SPI A;  1RM1 C;  3HO8 A;  1IXM A;  3OM3 B;  3F7V C;  3E35 A;  2X5R A;  3BJY A;  2R85 A;  1H8E G;  2BSK A;  4CZZ A;  2PMZ E;  4MW3 A;  3GLK A;  1MSD A;  4J9M A;  4DV5 H;  1RJP A;  3RYC A;  1EN5 A;  2WLI A;  4ICG A;  1VQL V;  3NBY B;  5KFI A;  1AP5 A;  1W0J G;  3C3S A;  2E74 B;  4P2Z A;  2YYA A;  2E76 B;  4J9Q A;  4GC7 A;  2GTA A;  4JI7 B;  2ZIN A;  3GWK C;  1OJH A;  5IYC O;  3AK1 A;  2W70 A;  1VF6 A;  3B8M A;  3TQT A;  5EC2 C;  3DTF A;  1NT2 B;  1O75 A;  1G6U A;  2VRZ A;  3OAA G;  3GJX B;  3Q2O A;  1WPB A;  4LC1 A;  1YJ9 V;  1COW G;  2E2H A;  4RZR A;  1N34 B;  4GLX A;  4HNT A;  4O4H A;  1XI1 A;  1LUW A;  2BOB C;  2Q9L A;  4B3S B;  1TWG A;  2W57 A;  1SKV A;  3H3V H;  3BPZ A;  4TSF G;  1ZTE A;  5FL7 G;  4FLT A;  1WR2 A;  3A0R A;  4PA6 A;  3BG5 A;  3OR6 C;  5KFT A;  4A5U B;  4DXW A;  2OIG A;  4CMD A;  1VQM V;  4ZIB A;  3EVK A;  2Q4P A;  5DQI A;  4MV1 A;  2CTR A;  5JVD B;  3X2Q C;  4F6R B;  4J9R A;  1G2W A;  3IG0 A;  5KFF A;  3JAK B;  4JI3 B;  3JZI A;  1IX9 A;  2HHH B;  2JA7 A;  4FS1 A;  2WWW A;  4O7V A;  1OBG A;  4LCU C;  3EHB B;  2VQD A;  5HV6 A;  2PBZ A;  5TIS Z;  4YY3 H;  2ZDI A;  4R8U A;  5EC1 C;  4I7Z B;  4YIP A;  1VQN V;  2FB9 A;  1JOY A;  2YRX A;  4LF5 O;  3RFC A;  4X65 B;  4DL3 A;  4Q8F A;  5ITZ B;  3NXS A;  4HNU A;  3PVX A;  3ZHT A;  1JR9 A;  4GLW A;  3T5J A;  4WHX A;  4JAU A;  4EB6 B;  3BQ2 A;  1KBL A;  4FLV A;  2DOS A;  2JVD A;  2UUC O;  1Y66 A;  2HFE C;  3N41 B;  5IYB G;  3T99 A;  4J11 A;  2PUS A;  3IAY A;  3RB4 A;  4MTG A;  4ZHQ F;  3OGC C;  4Q4D A;  2QM4 A;  2J6U A;  3CX5 F;  4DV3 H;  1P84 F;  1KKD A;  4I7H A;  3ZHU A;  3OTO O;  1EZ1 A;  1HNZ H;  1VEW A;  4O4J B;  4UCO A;  4DR7 O;  3GWO A;  4D6T H;  4DV1 H;  4KHP O;  1F7Y A;  1S03 G;  2P5O A;  3R5H A;  4LFB B;  3U10 A;  3K79 A;  4P30 A;  4CC6 A;  2AGA A;  4QIW E;  4RUA A;  4JI4 B;  1BHB A;  4B3R H;  4A3M G;  1EN6 A;  1NI8 A;  1B6S A;  1OCO C;  4O2A B;  4J41 A;  2W6O A;  1BMF G;  3G80 A;  3TIN A;  2Q67 A;  1VMG A;  3LSQ A;  2P67 A;  4B3M B;  2PI5 A;  2OWO A;  1KC7 A;  5F9N A;  1V4Y A;  3BY6 A;  4X1K A;  2UXC O;  2CE4 A;  2YIB A;  1VBG A;  4GYC B;  2Z5U A;  5EZY B;  2Q8V A;  3UT5 A;  5HFM A;  4XDK A;  3H1J H;  1AUX A;  2X0L A;  1B04 A;  4ETS A;  3GVM A;  2PYJ A;  2O57 A;  2WAQ A;  5GTH Z;  5LHH A;  3LUL A;  2DW4 A;  4LF5 H;  3VQX A;  3S3X A;  1GM7 A;  4F4Y A;  4X64 B;  4FE2 A;  1E1Q G;  2Y0P A;  3JAM W;  4QWD A;  4F4Z A;  1HNW B;  2JGD A;  5H9C A;  1SQB H;  4LF6 B;  4O3R A;  5IWA O;  4C2M A;  5DG8 A;  3TQ1 A;  3FKS G;  2R9I A;  3I12 A;  1QLE B;  3ZHR A;  3U55 A;  2ZIO A;  4AQY O;  4EBE A;  3I5D A;  4IHJ B;  4CC5 A;  2FYU H;  4LF4 B;  3OR7 C;  4FM9 A;  4LFC B;  4AYB A;  2YXH A;  4HZ3 A;  2VQE O;  3QFF A;  4LMY A;  4DR7 H;  2SCU B;  4I0X A;  2NVY A;  4BY7 G;  2OCH A;  1H2S B;  4JXU A;  5FLM G;  3H1L H;  2HVK C;  2Q73 A;  1VQ7 V;  1Q82 W;  5J2U F;  1CEZ A;  3OTF A;  4ECS A;  4UCV A;  1BGY H;  4M9U A;  2EJ2 A;  4DL7 A;  4O7L A;  1QCE A;  3ZRX A;  3E5N A;  3BRC A;  4DV6 H;  3L71 H;  1PP9 H;  4DV3 O;  1Y67 A;  4O2A F;  1SQF A;  1ZAU A;  2HIV A;  1QLN A;  4GKK H;  4JYA H;  3OUZ A;  2VQF O;  3ETH A;  2UUA O;  1YZB A;  4U3J B;  2RGR A;  4PDR A;  3SDL A;  5KX5 F;  1L2Z A;  1L1F A;  4UUG A;  3OTO B;  1N56 A;  3NGD A;  2BTQ A;  4I9W A;  3GII A;  3ZHS A;  4B3R O;  3IFX A;  1IOV A;  3P3N A;  2AGP A;  2OCC C;  2I87 A;  1S5L Z;  2R8J A;  4FBU A;  2CQY A;  2AU0 A;  4IHJ A;  4X66 H;  2KG7 B;  4NZM A;  4ZKI A;  2ETN A;  3ZMU A;  5KFL A;  1M7J A;  1K5S A;  4RUF A;  2R93 G;  3V6J A;  2YUA A;  1N4C A;  3T1C A;  5EWF A;  1U96 A;  4RCN A;  1K83 A;  4FLW A;  2DWE C;  2I80 A;  1TWC A;  3OTO H;  2EJ7 A;  5L3B A;  2DJV A;  1E4E A;  4NXN B;  2A1H A;  2JA5 A;  4DRX A;  4GX1 A;  1XNQ O;  5LYJ F;  1SER A;  5LP6 A;  2EIL C;  1TVK B;  3RWR D;  2EIY A;  2UXC B;  4DIM A;  3LSS A;  3QO7 A;  2Y0S E;  5J2T A;  4OX9 O;  4PJ0 Z;  2UVW A;  3L9D A;  5B1A B;  4WFA V;  1JFF B;  2YEV B;  3JZ6 A;  3L72 H;  4JI8 H;  2WYO A;  1CPY A;  4LF8 H;  1LUV A;  3G67 A;  4EEQ A;  2XTA A;  4EFE A;  4BWS C;  2IM9 A;  1N32 B;  4FIP C;  4JTC B;  2QKC A;  1SYX B;  5IP9 G;  5EBL C;  4LF9 B;  1KU9 A;  2PGG A;  1VAJ A;  4JI0 O;  4DRF A;  3F8N A;  2YI9 A;  5IYB O;  4DR7 B;  2HR3 A;  3UYY A;  2B1I A;  1SCU B;  2FE3 A;  2Q2T A;  5KFY A;  1GYF A;  4UV8 A;  2ZXW C;  2YIB D;  3HBL A;  3T5K A;  5CA1 B;  3N27 A;  1S9F A;  3ZRW B;  5JH7 A;  3PFF A;  4JI7 O;  5FJ8 G;  4IIJ B;  5I5V A;  4QW9 A;  2QSA A;  1FXH A;  4JI2 B;  4I4T B;  4DV7 B;  3GIP A;  1S0M A;  4L87 A;  5DED A;  5JQW A;  3JRW A;  3HOX G;  2PZS A;  3HKZ A;  1GRJ A;  1RFY A;  1BHA A;  1HNW H;  2YXL A;  4K8Z A;  2ADQ B;  4UCT A;  1G1X B;  2DE0 X;  3OHB A;  4FFN A;  2WA4 A;  4BWA A;  1DLB A;  3R66 A;  2GUZ A;  3QZ8 A;  2WLM A;  3J81 N;  5C3E G;  2QR4 A;  5IE9 A;  2QWP B;  5I5W A;  4O7S A;  1JDB B;  5BWT A;  2CAZ C;  1JPX A;  1QHT A;  3M7M X;  2UXB B;  2ZJT A;  2F4V O;  3PW2 A;  4X1I B;  5FNV F;  4K6N A;  3OUS A;  5DIS C;  1H2K A;  1D5A A;  4PA7 A;  4OX9 B;  3AG1 B;  4DUY H;  1B6R A;  3NC0 B;  3RJ0 A;  4MVQ A;  3LSU A;  4TV8 A;  2JA7 G;  3NR7 A;  4JI2 H;  3THO A;  2BE3 A;  3N2K A;  4TUY F;  1BT8 A;  4C5C A;  4DV2 H;  4JV5 B;  5H6R A;  1S3J A;  1DAA A;  4ED6 A;  2BQ3 A;  4PDB A;  3JAS A;  5I47 A;  2IJH A;  4I5S A;  4ZHQ B;  3M9M B;  5LP6 C;  1KP3 A;  1Z5V A;  3CXH F;  5I5S A;  2ITD C;  4GUN A;  4NYK A;  3RW0 A;  1M93 A;  5EZY F;  1RYR A;  3V6H A;  4ED0 A;  1FAF A;  1ZL8 B;  5DGB A;  1FXK C;  3G6Y A;  3LUT B;  2ALZ A;  1KUQ A;  2V1D A;  4CE5 A;  3Q4H A;  5LL6 b;  3QO8 A;  3PN1 A;  4DUZ B;  4CKE A;  1GGO A;  1V54 B;  4LF8 B;  2EX3 A;  1OCC B;  2OLS A;  1NBM G;  1SZX A;  1NH2 B;  3Q8S B;  3RGX A;  4O7R A;  1OZ0 A;  4CH3 A;  2ZDH A;  4TUY B;  4X66 O;  3CJH B;  3K57 A;  4A2A A;  4TVI A;  3MDS A;  3H4B A;  1QNM A;  4R6Z A;  5BXZ A;  1Y1W A;  5JCO A;  4Y8V B;  3LDE A;  5I5U A;  2R82 A;  5KFN A;  3ETG A;  4AHC A;  4RO2 A;  2NUA B;  2EJ0 A;  4DR5 B;  3AG2 B;  5KFB A;  1NH2 D;  1GKF A;  5DAA A;  1JA8 A;  4EKW A;  5JVD A;  2HDK A;  4J9K A;  1N33 H;  1K5Q A;  3GID A;  4YB8 B;  5BWX A;  4O4I B;  1XEQ A;  3IGA C;  2HG8 A;  4KL1 A;  2XCA A;  5BMV F;  4J7J A;  4F4X A;  1SZT A;  1R1B A;  2UUC H;  1YJW V;  1H2N A;  5CE8 A;  3FAV A;  1EKF A;  4IWX A;  4BBS G;  1KQS U;  3T9D A;  2ASL A;  3L75 H;  3JAT A;  5FR9 A;  5EDW A;  3PW0 A;  2NU6 B;  1U97 A;  1FXK B;  3RYH B;  3SPC A;  1KD1 W;  2C22 A;  3CWB H;  2IBZ H;  3O9O A;  4FFB A;  4TOI A;  1C30 A;  2DZD A;  3OHA A;  3UZB A;  3G4S V;  1W59 A;  1LR1 A;  2L35 A;  4BIZ A;  1CKM A;  5CBG A;  2VR1 A;  2F4V B;  1Q8I A;  3CP1 A;  1K92 A;  2CK3 G;  3MR5 A;  5IWA B;  5B3S C;  1IYD A;  3ABL B;  2P06 A;  4JI6 H;  4LH7 A;  2N74 A;  2ZT9 B;  4E6N A;  1O9H A;  5DG9 A;  4PDM A;  3E86 A;  2W6N A;  4J0M A;  3GTP A;  2AGQ A;  4YXW G;  4DR3 B;  2ZQM A;  3GTJ A;  1JJ2 U;  1YCI A;  2OTL V;  2LJ2 A;  3I56 V;  2COI A;  4DV5 B;  1ZQ7 A;  3RBE A;  2IU0 A;  4NTX A;  3B77 A;  5KFS A;  2A7W A;  2UVV A;  5IDJ A;  2OYQ A;  4RZQ A;  5JJJ B;  2C00 A;  4DV7 O;  1OBD A;  3S24 A;  4MVM A;  1E79 G;  3PW5 A;  5LXT A;  2CW7 A;  2EJ3 A;  4RNM A;  1P7B A;  4UUJ C;  1EYZ A;  2CZG A;  3RBD A;  3JAT B;  4IT5 A;  4NYE A;  1JKJ B;  2W71 A;  5JCO C;  1PM9 A;  5LMU O;  2ATL A;  1M1K W;  4LF9 O;  2A0L A;  5EWG A;  1IXB A;  3E89 A;  2FML A;  3GB7 C;  2X0S A;  4FFB B;  3RR5 A;  1ZSP A;  5DQG A;  5IJ9 A;  4JI5 B;  3OD4 A;  1XUQ A;  5D5Q A;  3Q1K A;  3KKY A;  2JA5 G;  4DR1 O;  4DUY O;  3HOY G;  3K9S A;  3BFR A;  1FFX B;  1N36 O;  3ML0 A;  4MVO A;  4TV9 A;  4QWB A;  1IZ3 A;  4B7K A;  4EB6 A;  1KJJ A;  2EZO A;  2ZE8 A;  4H0L B;  4M7E A;  2R9R B;  2JEX A;  2UU9 O;  4GKJ O;  1OCZ C;  4BAY A;  2QWQ B;  3A0H Z;  2W6Q A;  4ECZ A;  4A2B A;  1YIJ V;  5CA1 F;  3WWJ A;  2R8I A;  1TUE B;  1I5Y A;  3E8H A;  3T9F A;  4MSW C;  2JJ1 G;  1ZHS A;  1RJR A;  1IBL H;  1VQ4 V;  2X7R B;  5F9L A;  3K58 A;  5KFZ A;  1Q3E A;  1MOF A;  2WLL A;  4JI8 O;  3JAL B;  1P7G A;  4RNO A;  4UVA A;  2IBK A;  4B3R B;  2CDY A;  3W7W A;  1KJ9 A;  1WB7 A;  3VNN A;  3GIJ A;  3JD4 A;  3K5M A;  4GKK O;  4JYA O;  2XCL A;  1OWT A;  2FKX A;  3N43 B;  3BQ1 A;  5A9G A;  4WBN A;  1R73 A;  4O4L B;  4J9N A;  3B09 A;  4X1K B;  2QYZ A;  5IYD G;  1HNZ B;  2O03 A;  2LQT A;  3IN5 A;  4DV3 B;  3CCQ V;  5L3C A;  3T9B A;  1Q81 W;  4CKC A;  2FK3 A;  2RF4 A;  1HR0 B;  3D3I A;  4HNV A;  2JEF A;  1DV1 A;  3EYY A;  1XMO B;  1ZUQ A;  1VP7 A;  1XMO O;  2E5L B;  3U9T A;  1FJG O;  5DQH A;  4YHH H;  3CXC U;  5CA0 F;  3ABK B;  1NTM H;  3A0B Z;  1HP8 A;  2Y48 A;  1Z2P X;  3OMN B;  2F43 G;  3A8T A;  2ZE6 A;  2W7P A;  4AIL C;  3I55 V;  2ZKO A;  3EPI A;  3K0G A;  4MA5 A;  5KT5 A;  4PZ6 A;  1AI6 A;  2CNV A;  3HT5 A;  4LWS B;  5JVL A;  1EFR G;  2FK2 A;  3R9R A;  1OCR C;  4NTW A;  4GCZ A;  1YHQ V;  3MD0 A;  3AX6 A;  4O3O A;  2FLL A;  3N2G B;  2NVX A;  2HKO A;  3UQ8 A;  1HNW O;  1K4D C;  1CE8 A;  4HN2 A;  4AQY B;  4X64 O;  3LQS A;  1SQQ H;  1XRE A;  2OT5 A;  4O83 A;  1H2L A;  1WAZ A;  1ORQ C;  1Z2N X;  2X6C A;  4F50 A;  2DYR B;  3A2F A;  4Q45 A;  2DYR C;  2EIN C;  2XAJ A;  4N23 A;  1WRV A;  2CUG A;  3W7S A;  1N33 B;  5BYB A;  3OEH G;  3CRR A;  2VUM G;  1Z2G A;  4DV2 O;  4NXM H;  2FPP B;  2V9W A;  2UU9 B;  4GKJ B;  4JI1 H;  2OCC B;  1LNQ A;  3U0G A;  5CMU A;  1OV9 A;  4A3K G;  4IR1 A;  2VUG A;  4NTY A;  1QU7 A;  2Q0A A;  1RPR A;  4O4I F;  1Y4M A;  2ZNJ A;  4YHH B;  4DV4 O;  3QNE A;  5H80 A;  2ZCE A;  5C1O A;  5T14 A;  4RB2 C;  5JJE B;  1S10 A;  3LDC A;  4G27 B;  3EXA A;  4LFA O;  3E8B A;  2PMZ A;  2XC9 A;  3VOU A;  3WO0 A;  1AIL A;  3CC4 V;  4FVM A;  4JAS A;  3GTK A;  4RUE A;  3ORQ A;  1HDJ A;  4J9P A;  2FPG B;  4DYL A;  5KT3 A;  2C2R A;  3SPH A;  2GPS A;  3AK3 A;  4Z1V A;  5IT9 N;  4DAA A;  3GTG A;  3ETJ A;  4A3J G;  4YR3 A;  3SYQ A;  3H0G A;  5KT6 A;  2A9H A;  1VF6 C;  5JUM A;  2RNB A;  4U7O A;  3NBZ B;  2YXY A;  3ASN C;  1YDX A;  1ZHQ A;  4GT1 A;  4JV5 H;  5BMV B;  1SQX H;  4JPR A;  5LP6 B;  3J81 W;  2JEG A;  3JSL A;  1KJI A;  4GX2 A;  1TWH A;  4AI8 A;  2R8H A;  4AQY H;  4A3I G;  5JQG A;  5C93 A;  4J9S A;  4J10 A;  5DLG A;  2DAA A;  3CC2 V;  5L3F A;  2HHF B;  3R65 A;  3JCU Z;  1Y74 A;  4F6E A;  4FM1 A;  2GQR A;  1RSO A;  1I2K A;  1K34 A;  4CKB A;  1I7N A;  3CB2 A;  2PY5 A;  1GLV A;  3RTX A;  2UUA B;  5D1O B;  2HHH O;  4LF7 O;  4DV6 O;  3B2E E;  2EIJ B;  1FJG B;  4HBN A;  4WFG A;  4IGG A;  5D1P A;  3ZRW A;  1DV2 A;  2YC0 A;  1KJ8 A;  5E25 A;  4O7T A;  3NUA A;  1XMO H;  2HLD G;  4A93 G;  2XUM A;  4EEY A;  1BSM A;  4BY1 G;  3C3T A;  2ZIM A;  1J95 A;  2LGQ A;  5E79 Z;  2R87 A;  5K1P A;  2B1G A;  3ZMZ A;  3GTQ A;  2BCC H;  3KCY A;  2RDC A;  3WB2 A;  2DQ0 A;  5KX5 B;  3SPG A;  5KG3 A;  1RP3 B;  2DLN A;  5BY1 A;  3UO2 A;  2VA2 A;  4WD3 A;  1PNK A;  2EJR A;  4FM0 A;  1EBO A;  1W2B U;  4RAZ A;  5L3E A;  1XNR H;  4MTF A;  5CBF A;  2B63 A;  1GM9 A;  1KJQ A;  3J7A K;  2Y4U A;  3TY8 A;  1QR9 A;  4ED1 A;  1E4E B;  2YIA A;  3GIM A;  5EYP B;  5C4X G;  4G28 B;  4XDJ A;  4X1I A;  1ZWI C;  2KQX A;  1SES A;  4FFP A;  4FFR A;  1TVK A;  4DR3 O;  4DW1 A;  4EG0 A;  1S0O A;  2F1M A;  2RCV A;  2DWD C;  4HNA B;  4UCS A;  1RM1 B;  4LF6 O;  2UVU A;  4I50 A;  1J5E B;  1E4G T;  5HBR B;  2VPQ A;  3T1Y O;  3K5L A;  4JYY A;  3GDE A;  5KG5 A;  2WA3 A;  4MVZ A;  2E3C A;  3ABL C;  4ME6 A;  1X59 A;  2CFM A;  2W9C B;  4ECV A;  3M99 B;  2R9A A;  3K5O A;  5LYJ B;  4K8X A;  4U7N A;  3RYF A;  2ITC C;  3ZED A;  2NU7 B;  3DTU B;  1TGO A;  4RB3 C;  2H94 A;  5FNV A;  4LNU B;  2WLK A;  5KX5 A;  4YJ2 A;  1QQC A;  3ABT A;  3JD2 A;  2IH1 C;  5ITZ A;  4J9O A;  3ETQ A;  2XD4 A;  3V4Z A;  4JI5 H;  4CH4 A;  1A32 A;  1ZX3 A;  4O81 A;  2VWJ A;  2R84 A;  4O4J F;  5BPF A;  2HP8 A;  2Q6A A;  1IDS A;  1G4Y B;  3APQ A;  5B1B C;  3AG4 B;  4NLG A;  5KAI Z;  5B3S B;  5EWE A;  4G3I A;  4O4L F;  2FLP A;  1S77 D;  4J7Z A;  1HNZ O;  1J5E O;  1FFT B;  4R7R A;  4JV0 A;  2YSU B;  2Y69 C;  4F4L A;  4XDL A;  2JEJ A;  2CNQ A;  2WB1 A;  4JYA B;  4GKK B;  1UFI A;  3AYH B;  1WH2 A;  2CGN A;  1S76 D;  1SS3 A;  1MZB A;  2V4R A;  1R6T A;  4PZ8 A;  3UKM A;  3W1G A;  2CH7 A;  3IC9 A;  3OFN G;  3MHH C;  4WCE V;  5CA0 B;  1PD3 A;  1K4C C;  4LH6 A;  3K59 A;  5BPH A;  3E22 B;  5KFG A;  5KG0 A;  5IWA H;  4TM5 A;  3RYI B;  4UXN A;  4DR4 O;  2XAQ A;  3LP8 A;  5GON F;  1K97 A;  4Z1M G;  1I5X A;  2QWN B;  1TUB A;  5CN0 A;  1YF2 A;  4R8U B;  1I94 O;  1UPG A;  2CGO A;  3ZX6 A;  3G71 V;  3OSN A;  2W6Z A;  2ZR3 A;  2UVR A;  3FX7 A;  4ZBM A;  4X8A A;  1NR1 A;  1QLE C;  4KXR A;  5CA3 A;  3CPW U;  1I94 B;  3WG7 B;  1VQ5 V;  3FYE B;  1XNQ B;  1JX4 A;  4NZN A;  4YJ2 F;  1Y14 B;  1QR8 A;  1GN3 A;  1SET A;  4NXN O;  2GQS A;  5LL6 Y;  5DMX A;  4ZOL A;  5KFM A;  1WCM G;  3FFQ A;  5LOV A;  3CRM A;  1Y1V G;  1SC5 B;  1T5E A;  4H13 B;  3C90 A;  5KA6 A;  3GV8 B;  3OEE G;  2R8G A;  1V55 C;  2YZM A;  1PV0 A;  3HKC A;  4O4L A;  1YEW A;  4PA4 A;  2E5L H;  3RYI A;  5KUK A;  1KP2 A;  3L70 H;  3M9O B;  1AI4 A;  4E4E A;  4NXM O;  1MAB G;  3HPL C;  4HAM A;  4DL6 A;  2WTF A;  1PKX A;  1US6 A;  5LA6 B;  2DPI A;  4W4L A;  2FP4 B;  1PL4 A;  2Q7H A;  4QPK A;  1KBH A;  2YCH A;  1FXK A;  1ET0 A;  5KFH A;  1P8L A;  5IYZ A;  3SJB C;  3E83 A;  3ZHV A;  5FD5 A;  2DYS C;  4JV2 A;  1KKC A;  4PDL A;  3KHG A;  2W9A A;  1M56 C;  2BTQ B;  3CYO A;  1XL4 A;  1GH6 A;  3UM7 A;  1XMQ O;  4FFO A;  2AQ4 A;  1M0W A;  1OHH G;  1WN7 A;  4PDV A;  3GV7 B;  1IUR A;  4FS2 A;  3N42 B;  1MMM A;  5EOY A;  2VWK A;  1C3O A;  1Y76 A;  2ZNI A;  4J9Z B;  4QE7 A;  2UXC H; 
#chains in the Genus database with same CATH homology
 3QWU A;  3JAL A;  2UXD H;  4X20 B;  2OYQ A;  3JAR A;  2Q2U A;  5JJJ B;  3KXY T;  4DV1 B;  3S24 A;  4RZQ A;  3RIZ A;  1XHZ A;  5LXT A;  2CW7 A;  3VQW A;  3T1Y B;  5FLX W;  3GB8 B;  3BA9 A;  4IIJ A;  4DR5 H;  4FLY A;  3HKE A;  3JAT B;  5JCO C;  4EFB A;  3U11 A;  1TAE A;  3JSN A;  4UFZ A;  4FFB B;  3RR5 A;  1TA8 A;  4I4T A;  5IJ9 A;  4JI5 B;  5D5Q A;  4DV5 H;  4X66 B;  4DR6 B;  3W1B A;  3RYC A;  3TY9 A;  3NBY B;  1FFX B;  5FPR A;  4NVP A;  4DV7 H;  4JI7 B;  4TV9 A;  2ZIN A;  4EB6 A;  2ZM6 H;  2F66 C;  1JFF A;  4CS3 A;  2VPS A;  3WB0 A;  1M0T A;  4B3S H;  4M7E A;  1IBK H;  1NT2 B;  5IJ0 B;  1O75 A;  1G6U A;  3GJX B;  4DR4 B;  3BHP A;  2VQE H;  1WPB A;  2Q7G A;  1N34 B;  3BAB A;  4GLX A;  4A2B A;  4O4H A;  1XI1 A;  4B3S B;  2W57 A;  1SKV A;  3BPZ A;  4TV8 B;  4FLT A;  4PI0 A;  2GV9 A;  4MV7 A;  4DV6 B;  1ZHS A;  1IBL H;  1M4U A;  2RJZ A;  3K58 A;  4F6R A;  1Q3E A;  1CKN A;  4K0K H;  3JAL B;  4ZIB A;  2F93 B;  4MTD A;  4B3R B;  3VNN A;  5JVD B;  4FLZ A;  3K5M A;  4F6R B;  5KHI A;  2VQF H;  3N43 B;  3IG0 A;  3JAK B;  4JI3 B;  4WBN A;  2HHH B;  4APM A;  4O4L B;  5CA1 A;  4X1K B;  4D7T A;  1KMI Z;  4CS2 A;  1HNZ B;  4LF4 H;  2O03 A;  3DSQ A;  4NXN H;  3WB1 A;  4YY3 H;  3T1Y H;  4DV3 B;  4Q6G A;  4CH5 A;  2PYL A;  3LML A;  3W5O A;  2WDT A;  4X65 B;  3KAK A;  4TUY A;  4LFA B;  5ITZ B;  5K1X A;  3RF2 A;  5LMU H;  1JMK C;  1SA0 A;  2HGS A;  2UUC B;  1HR0 B;  4LF6 H;  4DK1 A;  4EB6 B;  3EYY A;  1XMO B;  3U0Z A;  2E5L B;  4FLV A;  1E4F T;  2JVD A;  4X64 H;  4YHH H;  3N41 B;  2XHB A;  2PUS A;  3IAY A;  1Z2P X;  2QM4 A;  4DV3 H;  4AIL C;  4I7H A;  2BTO A;  2HVQ A;  5FD6 A;  4U3J A;  3L4K A;  1HNZ H;  4YJ3 A;  4O4J B;  4UCO A;  4PZ6 A;  1S5J A;  3N6X A;  4DV1 H;  4LF9 H;  1P49 A;  1S03 G;  5LYJ A;  2P5O A;  4LFB B;  1VS0 A;  4O2A A;  1CKN B;  2VOB A;  4EQ5 A;  2JS5 A;  3U10 A;  5LMN H;  1N32 H;  3N2G B;  1Z5W A;  3UQ8 A;  4CC6 A;  1J5E H;  2HVR A;  4B3M H;  4B3R H;  4JI4 B;  1L8D A;  5FNV B;  4AQY B;  4K0K B;  4O2A B;  4PHZ A;  4JI8 B;  4ZHQ A;  1Z2N X;  4LSX A;  4LF7 H;  4O2B A;  5KHK A;  3A2F A;  4B3M B;  2KKW A;  2OWO A;  4JI6 B;  1Q5O A;  4DUZ H;  4X1K A;  2YIB A;  1N33 B;  4GYC B;  2F4V H;  4O2B B;  5EZY B;  3SJC C;  3MAQ A;  1A0I A;  3UT5 A;  4NXM H;  2VQE B;  4DR4 H;  1B04 A;  4ETS A;  2UU9 B;  2PYJ A;  4GKJ B;  3L2P A;  4JI1 H;  4LFC H;  4O4H B;  3KAJ A;  3SJA C;  3KAL A;  2ZM6 B;  2VUG A;  4ZOL B;  2Q0A A;  4LF5 H;  3VQX A;  5J2U B;  2ZNJ A;  4DV2 B;  4X64 B;  4YHH B;  3JAM W;  5GON A;  4DR2 B;  1HNW B;  4YJ3 B;  2ZCE A;  4DR1 B;  5KHH A;  5JJN B;  4LF6 B;  4DV4 B;  2P22 C;  4RB2 C;  4OX9 H;  5JJE B;  1VF7 A;  4X65 H;  4O4J A;  1FKA H;  2ZIO A;  4ZI7 A;  3J80 W;  4LF5 B;  2XIG A;  4LNU A;  4YJ2 B;  3E22 A;  4FVM A;  5BR8 H;  4IHJ B;  4CC5 A;  1I7F A;  4LF4 B;  3SGI A;  4FM9 A;  4LFC B;  3ZS8 C;  4DR7 H;  4LMY A;  4CH6 A;  4ZI7 B;  1BJT A;  1TUB B;  3C0F B;  1H2S B;  1XNQ H;  4FM2 A;  3KYH C;  3OTF A;  4UCV A;  3NBZ B;  3JAK A;  3HKB B;  1ZHQ A;  4JV5 H;  5BMV B;  1I6U A;  5LP6 B;  3J81 W;  3RYH A;  3JSL A;  4DV6 H;  3BRC A;  1XDN A;  1SQF A;  4TV9 B;  4AQY H;  1ZAU A;  2HIV A;  4GKK H;  4JYA H;  5JQG A;  1N34 H;  4U3J B;  2RGR A;  1SA0 B;  4BW9 A;  1N36 H;  4I50 B;  1L2Z A;  4FM1 A;  5J2U A;  1X9N A;  5KHG A;  1RSO A;  1Q43 A;  3OTO B;  2UXC H;  2BTQ A;  1JJO A;  3RFR A;  1M5I A;  4JI7 H;  3CB2 A;  2PY5 A;  3RGB A;  3RTX A;  4I55 B;  2UUA B;  5CB4 A;  3HKC B;  5D1O B;  3B2E E;  4IHJ A;  4DR6 H;  1FJG B;  4HBN A;  4X66 H;  5D1P A;  4DUY B;  3RYF B;  1XMO H;  3N2K B;  1XMQ H;  2ZIM A;  5IT9 W;  3JAS B;  5K1P A;  5LMU B;  4LFA H;  2UXB H;  1FFX A;  3L4J A;  4CS4 A;  3WB2 A;  5KX5 B;  3BAA A;  4FLW A;  3OTO H;  4YY3 B;  2UU9 H;  4GKJ H;  4NXN B;  3T1H H;  4FM0 A;  3CVZ A;  1XNR H;  4DRX A;  1O9G A;  4RAZ A;  1N36 B;  2UXD B;  3HXL A;  5IJ9 B;  3J7A K;  3TY8 A;  5LP6 A;  1TVK B;  3RWR D;  2UXC B;  2YIA A;  1I94 H;  5EYP B;  5EZY A;  5J2T A;  4X1I A;  4RAY A;  2JGU A;  1TVK A;  1JFF B;  2PTM A;  4X1Y A;  4JI8 H;  5LOV B;  2WYO A;  2F1M A;  4LF8 H;  4HNA B;  4UCS A;  4EEQ A;  4BWS C;  4I50 A;  4EFE A;  1J5E B;  2IM9 A;  1E4G T;  2MCT A;  3H20 A;  1N32 B;  3K5L A;  3GDE A;  3RGZ A;  4LFB H;  1SYX B;  3CHX A;  1HW7 A;  5GON B;  1AN7 A;  4LF9 B;  1KU9 A;  2E3C A;  2PGG A;  4DK0 A;  3VQY A;  2R70 A;  4DRF A;  3F8N A;  2YI9 A;  4DR7 B;  2CFM A;  2R9A A;  2FE3 A;  3JAR B;  2Q2T A;  1GYF A;  5EIB C;  4UCR A;  3K5O A;  4I9Q A;  2YIB D;  3HKE B;  5LYJ B;  5BR8 B;  5CA1 B;  4FLU A;  4MTE A;  1CKO A;  4LSA A;  4K8X A;  5JH7 A;  3RYF A;  3ZED A;  4IIJ B;  4O4I A;  1HNX B;  1TGO A;  4RB3 C;  1XMQ B;  5FNV A;  4LNU B;  4YJ2 A;  5KX5 A;  4I4T B;  4DV7 B;  4JI2 B;  1QQC A;  2Q7E A;  5ITZ A;  2PZS A;  3ETQ A;  1HNW H;  4JI5 H;  1HR0 H;  3QF7 A;  2YXL A;  5EIB D;  4CH4 A;  4K8Z A;  4UCT A;  2VWJ A;  4BWA A;  2KSW A;  3SR2 C;  2UUB B;  5LA6 A;  3K3V A;  3UT5 B;  3HKB A;  4IAJ A;  4JI1 B;  2HEP A;  4R7R A;  2CAZ C;  4X1Y B;  1QHT A;  4KHP B;  3M7M X;  2UXB B;  2ZJT A;  4NXM B;  5IJ0 A;  4X1I B;  2HHH H;  5DIS C;  1D5A A;  1WNS A;  2YI8 A;  4JYA B;  4GKK B;  4OX9 B;  1WH2 A;  1MZB A;  4DUY H;  5C8Y B;  3NC0 B;  4Q0Y A;  4DR1 H;  3RJ0 A;  4TV8 A;  4PZ8 A;  3N2G A;  1XHX A;  4JI2 H;  4B3T B;  3THO A;  3N2K A;  3W1G A;  5KMG B;  4DV2 H;  1XQ8 A;  4JV5 B;  1IBL B;  4PDB A;  2V4D A;  3JAS A;  5FPO A;  5CA0 B;  4UCU A;  4ZHQ B;  1Z5V A;  5LP6 C;  4LH6 A;  3MWM A;  2CW8 A;  3K59 A;  1M93 A;  1V9P A;  3E22 B;  5IWA H;  5CB4 B;  3RYI B;  1IBM H;  3TY5 A;  5CA0 A;  1IBM B;  4PZ7 A;  5JH7 B;  4TQF A;  4JI0 B;  4DRX B;  1TUB A;  2R72 A;  5LL6 b;  5KHJ A;  3PN1 A;  4DUZ B;  1Z2O X;  5A2Q W;  4LF8 B;  4PI2 A;  5IYZ B;  3JAW B;  2EX3 A;  5EYP A;  4L8J A;  4LF7 B;  3RGX A;  4DV4 H;  4CH3 A;  4TUY B;  1DGS A;  1I94 B;  4HNA A;  1BGW A;  3K57 A;  4A2A A;  4DR2 H;  5LMN B;  5JCO A;  1XNQ B;  2F95 B;  3HKD B;  4RB1 A;  4KHP H;  1XNR B;  4AHC A;  4DV0 B;  3T1H B;  4D7S A;  3CSX A;  3VQV A;  4DR5 B;  4TQD A;  3M4I A;  4ZOL A;  4FLX A;  4X20 A;  2HVS A;  4LR3 A;  5KMG A;  3FFQ A;  3DF7 A;  5LOV A;  2UUB H;  5JVD A;  1XK5 A;  5C8Y A;  4DV0 H;  1T5E A;  1N33 H;  4O4I B;  4KL1 A;  3HKC A;  3ICX A;  5D1O A;  4O4L A;  1YEW A;  2E5L H;  3RYI A;  2RGV A;  3BA8 A;  1FJG H;  1S68 A;  2UUC H;  3QG5 A;  1SQG A;  1HNX H;  4DR3 H;  2UUA H;  4RB0 A;  3FMA A;  4MV9 A;  3JAT A;  2WE6 A;  3RYH B;  4B08 A;  3K5N A;  5LA6 B;  1X4T A;  4WBN B;  4FFB A;  4TOI A;  4X62 B;  2Q7H A;  2YCH A;  5JQG B;  1SEI A;  2RQ6 A;  3RYC B;  1P8L A;  4JI0 H;  1CKM A;  3JAW A;  2QJ1 A;  3SJB C;  5IYZ A;  2F4V B;  4JI3 H;  1Q8I A;  3QTC A;  5FD5 A;  1IBK B;  5J2T B;  2VQF B;  4X62 H;  5IWA B;  1P16 A;  3N44 B;  5BMV A;  4JI6 H;  4LH7 A;  3HKD A;  2BTQ B;  4E6N A;  1O9H A;  4J0M A;  1M0W A;  5D5P A;  1WN7 A;  3N42 B;  2HIX A;  4DR3 B;  3LNN A;  2VWK A;  5EOY A;  4B3T H;  4I55 A;  1FVI A;  4DV5 B;  2ZNI A;  3N40 P;  4JI4 H;  5LXT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...