4CDAA

Spectroscopically-validated structure of ferric cytochrome c prime from alcaligenes xylosoxidans
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
127
structure length
127
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Fingerprinting Redox and Ligand States in Haemprotein Crystal Structures Using Resonance Raman Spectroscopy.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 49
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cdaA00
3VRCA 3FOOA 4JKVA 1EKYA 2YLIA 2CCYA 4EIYA 2XLHA 3ZTMA 1JAFA 1RCPA 2YLGA 1CGOA 3IQ5A 2XLWA 3HNKA 1E84A 4NC3A 4CJOA 1YYJA 4CDYA 5B3IA 2XM0A 1YZCA 3NMIA 1LM3B 3HNIA 3HNJA 3NMKA 3M4CA 2YL0A 1S05A 5JP7A 5JVEA 4JEBA 4CDAA 3DE8A 5JLIA 2J9BA 1NBBA 3HNLA 3M79A 1BBHA 1M6TA 2QLAA 3QW1A 4WGZA 4ER9A 2XL6A 1GQAA 1YZAA 3U8PA 4U9DA 3TOLA 4ULVA 3C62A 2J8WA 3ZWIA 3L1MA 3IQ6A 256BA 4IAQA 4JE9A 4D4NA 1YYXA 2BC5A 2YLDA 4D4XA 2XLMA 2XM4A 2XLEA 4CX9A 3QVYA 1CPQA 3QW0A 5JRAA 2YKZA 2YL1A 1E83A 1QQ3A 2XLVA 1QPUA 4WGYA 4CDVA 4IB4A 1E85A 1MQVA 3ZQVA 4CIPA 1CGNA 3QVZA 2YL3A 3DE9A 1A7VA 3TOMA 3NMJA 1CPRA 3ZQYA 1E86A 5JS5A 4CJGA 5JT4A 4JEAA 4U9EA 3C63A 2XLDA 5JSLA 4IARA 1APCA 3M15A 3FOPA 3M4BA 4N6HA 2YL7A 5JUAA 4N4WA 5AGFA 2XL8A 2XLOA 4L6RA 3ZTZA
chains in the Genus database with same CATH superfamily
1AVOB 4OIOF 3C18A 2QTVA 3DAFA 3V5YA 2G62A 1AEPA 5L0FA 3AGUA 1KTMA 4JKVA 1HMDA 1V55C 4KC9A 4PJMA 1OCRC 1BZ4A 1MMAA 3KH2A 3MYFA 4LDKA 5COGA 3ATPA 4BJ1A 4DJ9A 3SEOA 1ORSC 4JJFA 2KW3C 3EGDA 2BE5F 5D91A 1D1CA 1FMVA 2GFHA 4NTAA 4P9FA 3LAYA 1NSGB 1JAFA 1RCPA 2KK1A 1B68A 1QSPA 1D1BA 4HEAJ 3L34A 4C7OA 3S29A 3WG7C 3IQ5A 4I1MA 1RMVA 1TFKB 4NTBA 2LFDA 1YYJA 3LUTB 3GWNA 1W2WA 3B71A 2LQGA 3GANA 3M1CB 2VCCA 2WZLA 1BDJB 3DAGA 2HKVA 3NMKA 1OW7A 3LEVA 3FXHA 2R7WA 3E9VA 4WABA 3DMDA 5KYWB 4BJTA 1S05A 5IY5C 1OCCC 2EPOA 3W4YA 2ICWG 4CS8A 2OEXA 4YL0A 2PF4E 1OCZC 4PFPA 1LIHA 3W8HA 3EGXB 3U2LA 2J7PA 3U5SA 3MX3A 2A6HF 4RDAA 2OG2A 1QLEC 2VCAA 1YVIA 3C8GA 4MQ9F 2R7VA 3TK0A 5B3SC 3ECSA 3HNLA 1YDIA 2PNOA 1Z7Qc 5L3QA 1OQCA 3DJNB 1L7CA 5DQTA 1U0BB 3QTHA 1NFOA 1N1CA 1O87A 4RBNA 1F1MA 3LLKA 3U8PA 2J7PD 4BEJA 5A69A 2ZXPA 3ASOC 1D0ZA 4W8PA 3K1IA 4XPYA 3C8GD 3SZRA 3MBGA 4K1OA 3POVA 2JX0A 256BA 4IAQA 4DVZA 2Q4FA 3O55A 2EPKX 1YYXA 2BC5A 2YLDA 2Q9AA 5COMA 4D4XA 2XLMA 5HV9A 4WJ0A 3AQCA 3JYYA 1JOGA 2DI3A 3PMRA 4XLNF 4CX9A 2XXAA 4BJ5A 4ZLDA 3L0IA 3G4ZA 1H9GA 3GEIA 2UUHA 2Z15A 1IW7F 4BPMA 4U5CE 4QI0A 1HE1A 2XLVA 3VYWA 4ANJA 4OIQF 4CDVA 1JRAA 1PD0A 2J45A 2P0NA 5L0JA 1CGNA 4AL0A 3FDQA 2YL3A 1TWCA 3G50A 1WGWA 5EK0A 1CPRA 1G4US 3AG2C 1FNTc 2LD6A 1H7IA 3O39A 1TFOB 2CW0F 1LI7A 1YA9A 1E86A 2ZXWC 3RKOF 4I3MA 4C3DA 1K40A 5BQHA 4PJLA 1Q0KA 1VYKA 2HMZA 3ASNC 3DZAA 1Q0DA 2W4BA 3JRMO 1Q0FA 3M15A 3Q7GA 4NY3A 4PR9A 3US6A 3VF0A 1U6HA 2HS5A 2X51A 4N6HA 2YL7A 3RYLA 5DS6A 2L6FA 3TQOA 1CGME 1HY5A 4Q4ZF 1A41A 2EPLX 4OIPF 1OXBA 2WVNA 3FHDA 1A7EA 2PFDA 1OXKA 1LI5A 4J7YA 4L6RA 4G7ZF 3BRJA 3LESA 4FWVA 4FAPB 3EHMA 3DXJF 3LS0A 2W45A 4K7BA 1SF8A 2GA0A 2HZ8A 2V26A 5A6JA 3L8IA 3R2PA 3QZCA 2M64A 1V4AA 2CCYA 4EBJA 5BQIA 4LDRA 3DM5A 3RF3A 1I4YA 2CGEA 2Y3DA 5F5HA 4EIYA 5A6BA 5KYYA 4U5FE 1R5ID 3B9QA 2DYSC 3CAXA 3DD7A 4JRZA 1WOLA 5CIVA 2IBFA 1H9TA 2ZD9A 1OCOC 4O6YA 4E7SA 3JT1A 1LS1A 3U9MA 2P61A 2OEVA 4MVRA 4JURI 4YT5A 4JW1A 3HJCA 3EZHA 3W2VA 1AUEA 4NTFA 4NC3A 3LLIA 4CJOA 1VTMP 2ZXOA 4GYTA 5F5FA 2XM0A 4IGGA 4MVQA 2HJMA 3NMIA 1WTYA 4JCHA 5B1AC 1VB5A 2OKUA 2W4MA 5COFA 1YJGA 1WASA 4F4BA 1GGQA 1YA7O 3EG9B 3HNJA 4XLPF 2L6GA 1Y6DA 1GS9A 4LDQA 4BEMJ 2R02A 3RQGA 3CEXA 4PACA 3JYHA 5JP7A 1LE4A 4O7GA 5JVEA 4AK9A 4J7TA 4IJJA 2KNHA 4Z9HA 3GM1A 1M56C 4YK5A 3N24A 2VC9A 4KI2A 2WB7A 3K7DA 4CDAA 2H7BA 3Q7LA 1MNEA 2KC3A 3OA1A 1L3PA 3CSKA 2J9BA 2MWQA 4QI2A 2NUTB 3AOUA 3I4UA 1M6TA 3S28A 2Y3HA 2Y39A 4YT2A 4KNVA 3QW1A 1K04A 2A69F 2AWYA 1NG1A 3G4XA 3UMKA 1T6UA 5KYNA 3E70C 4WGZA 4X0RA 2HV6A 1XZQA 2XL6A 3GEEA 3N0TA 5KYXB 1GQAA 1M2VB 2A6EF 3K66A 2XS1A 3ZVRA 3DKAA 4ULVA 2W9YA 2GAQA 1T6QA 1MNDA 2QNLA 2J8WA 2Y3BA 2NUPA 5KYWA 3L1MA 3EJNA 3IQ6A 2L7AA 4HE8D 4XWJA 3S84A 1FFHA 4Z9JA 1VMAA 1G5ZA 5GPGB 4OINF 2AWCA 5EHHA 5L3VA 1TQGA 3GM3A 4N06A 3UNGC 3EGXA 2XLEA 2MYSA 4HFKB 5EGYA 4Z9IA 4E0HA 1G8XA 1ZYRF 3DJUB 4MTOA 3RQEA 1NU7D 3FAPB 5JRAA 3AG1C 2YKZA 2YL1A 3U0CA 4ULWA 3F47A 1E83A 1T5OA 1EI7A 1O3UA 1OR3A 1T01A 2MHRA 1ZHTA 3WODF 1ZW2A 2UUIA 2IM8A 1T9KA 4H54A 5CI9A 5T3WA 4G7OF 2R03A 4XEVA 1QVXA 1OKKA 4E0IA 4EBKA 1O5HA 1D0YA 4BJ6A 3ABKC 2IXOA 1A7VA 1I4ZA 1Y4CA 1Q0GA 3EZIA 1J8YF 2YZSA 3NMJA 3TOMA 3SXYA 4JTCB 3RW0A 1FTSA 2LIGA 3NG1A 2HV7A 5BUOA 4CSAC 3GWLA 3LJBA 5JT4A 3JZ0A 3B0VC 3IQCA 3S90A 1RKEB 2A68F 4A4AA 3RQFA 3ZIBA 5L0GA 3PHF2 1OKKD 4FX5A 3JCUQ 1ORYA 2QY9A 2WZFA 2X0CA 3R7CA 4AE4B 3IEEA 1OW6A 3WHNA 2OOCA 5E3AA 1BR1A 4JVSA 4IRUA 1SMYF 2L6HA 1RJ9A 4I1OB 4YT8A 2ETSA 3HTKC 4MVOA 3ZTZA 2PP4A 4LACB 3K33A 3W2WA 2L81A 4O79A 1VLSA 4PJNA 1D0XA 1ZVZA 3EFOB 4M63A 1A7DA 2WZGA 4U5HA 1EKYA 4DVYP 4G0HA 2YLIA 4U5BE 1QKRA 1YARO 2J46A 2HSBA 2P7VA 4PJJA 1SYQA 3K6BA 2OU6A 4O6NA 4XEFA 3NRHA 1FMWA 2G3KA 2H8AA 5T3TA 1PD1A 1QZXA 4MTGA 4ZLCA 3B29A 1XZPA 1YLMA 1J8MF 4JZAA 4NQFA 1VOMA 3IQTA 2C04A 3AG3C 3S0XA 1SZIA 1TWAA 2YLGA 3SYNA 1CGOA 1Z23A 3EPVA 3C8ZA 1YAUO 3H2VA 3AGTA 3HNKA 3OWTA 3JSEO 3GM2A 1U89A 4CDYA 3SXZA 2J9UA 4LERA 3C7JA 2KJGA 3LNMB 1DOVA 2DYRC 4MVUA 3HNIA 3K1HA 2G3VA 3H65A 4H4KC 4DRJB 3RVYA 3M4CA 5DLJA 4DRIB 1JPNA 2A1DD 4JEBA 4J32B 3V5ZA 2BL2A 1EA8A 4EUKB 5JLIA 3ZDLA 3NYMA 1WN0A 2OJED 4JC7A 1NBBA 2P1AA 1WWPA 1ORJA 1A0BA 2NPUA 3KYIA 3HLZA 3LS1A 1ZHZA 4R32A 2QLAA 3RVZA 3T9OA 2XXAB 2EINC 3UMHA 2H7OA 4LLEA 1NLXA 2F22A 5DS5A 2R9RB 3EH1A 2R7UA 1YZAA 4UDVA 5E33A 3EG9A 4YL3A 3TJ5A 3LNRA 2AVKA 3VM6A 3C62A 4NCQA 3U3FA 3DI5A 3GEHA 1M2OA 2M4EA 4XTKA 3ZWIA 3FVYA 1SR2A 2KSFA 1VK5A 2PX0A 3Q6MA 4CS9C 4D4NA 2DB4A 3ABLC 4HFFB 4U5EE 2RD9A 2ZPAA 1KU2A 4CS7A 4RD9A 3HKKA 3NKDA 2CNWA 1D1AA 3CZ6A 4MW3A 3TULA 3B0PA 4OD4A 1ZU5A 5L0IA 2V3CC 1ZU4A 3EH2A 2NUTA 4YWQA 3A9CA 5KYUB 2I8BA 1ZHWA 4P9TA 3EQLF 4P6IC 3S27A 4KNWA 3H2UA 2QE9A 2GWWA 4C3BA 1FR0A 1JR8A 5KYXA 1LVKA 1TR2A 1TWHA 4IB4A 2EILC 3ZQVA 3T6BA 1M2VA 2JPUA 4CIPA 2YHSA 3QVZA 2LFFA 2CNWD 2DGJA 2E87A 2HFIA 2J0WA 4U5GA 3ZQYA 1WATA 5A6BD 1KNYA 3SNHA 2PBEA 4E18A 1TWGA 2EIMC 2R7OA 4XPXA 1LKXA 2YVKA 4XPWA 2Y69C 2VCBA 1Z5ZA 2LK4A 4Q7CA 4AX2A 4CJGA 4DOZA 4W8KA 1HE9A 4U9EA 3DWWA 3C63A 2XLDA 3ITFA 5JSLA 3LEOA 4IARA 2NSFA 1HW2A 1APCA 1LE2A 2IXNA 3EGDB 2Q9CA 3FMSA 2R05A 2RSEB 3FOPA 3NKEA 4EKWA 3M4BA 4MTFA 2D5RB 3Q6NA 5JUAA 2VH3A 3SXKA 1PV3A 1V74B 3VAYA 2P6VA 1VYIA 1C03A 4XQ1A 1C02A 5E3CA 3V5XA 4CS8C 4C7OB 1UFBA 4MNDA 5D92A 1NZEA 2HJ3A 2L9JA 2LP4A 4JCZA 1Z6AA 5HSWA 2R7SA 1MMDA 2Q3TA 2R25A 2XLOA 3JSZA 5AC4A 2HSQA 3T6JA 3FAJA 3VRCA 4IWBA 4EHPA 4JTAB 3FOOA 2NUPB 1IZMA 1OR2A 1ZHXA 4EBBA 3O6XA 2R7TA 2VB6A 5FZTA 2KGOA 1ZZPA 2NG1A 3KL4A 3I5PA 2PX3A 2J0XA 2ASRA 5TJ5E 1RKEA 2AU5A 4MVZA 3RH3A 2H7VC 4BJ6C 1Z63A 2A0UA 3IPMO 3J06A 2Q9BA 4I44A 4YT4A 4DBRA 3C8GB 3K1IC 2XLHA 3L8JA 3T6GB 1ZW3A 2Q00A 3KMIA 3ZTMA 2YWAA 4AL1A 4E7ZA 4AE4A 2VASA 2EIKC 3UGOA 1ZHYA 2EPMX 4CIHA 2WVOA 3UR3C 1G4WR 2R7RA 3GODA 3SXMA 2XLWA 2AP3A 3SP1A 3W8IA 1C17M 1E84A 3ZC4A 4CSAA 3QMKA 3AJMA 3NYLA 5B3IA 1JPJA 2B0JA 4BG0A 4BJ5C 2FFHA 1YZCA 4IAOA 2IXPA 2QUPA 3MFNA 3N2ZB 3O10A 1LPEA 1T6IA 1LM3B 3S9OA 1JMWA 2JD3A 1I5NA 3BEHA 3EFOA 3WAQA 2XRHA 2NSGA 3PDMP 2YL0A 2B0HA 3CQZA 5BQGA 3U8VA 1MMNA 4FESA 2OCCC 3I5QA 4XEKA 3MYIA 3RIPA 4G7HF 2R7XA 4MW8A 4YN0B 3GORA 2HMQA 2IYLD 5B1BC 1OW8A 2YRFA 1M57C 3ABMC 3TD7A 3KPHA 3DE8A 4MVSA 2HUJA 2J9VA 2GDCA 3UMIA 1BR2A 4YJWA 3U3BA 3X1OA 3AQBA 2OQMA 2TMVP 1K05A 2EPNA 2I15A 3M79A 1FFTC 1BBHA 1RJ9B 2OJQA 1ST6A 3A11A 4G78A 2XSEA 1NU9C 2IXMA 4GEHA 2KYHA 2XS8A 3OEOA 3U9JA 5DQZA 4ER9A 5A6KA 3JRTA 5T1DB 2LCHA 3NYJA 3T4RA 4U9DA 2R7QA 1BR4A 3TOLA 1R4TA 2A0BA 2CDQA 1XWJA 3AG4C 1MMGA 3F46A 4U5DE 4JIOA 1LS4A 3DM9B 2O9XA 4JE9A 3RFYA 2Q7RA 5K0IA 3V7OA 2EIJC 1RKCA 5L0DA 1Q0MA 2ZXRA 4ONSA 2XM4A 4C3EA 1Z3IX 3U2MA 5FCLA 2XL4A 3QVYA 4MS2A 3KYJA 3ZSUA 1FAPB 4J30B 1CPQA 3KKBA 3QW0A 2WVQA 4LLCA 3JTLO 4OD5A 1EQ1A 3NDBB 1HMOA 1V54C 2IOQA 1PCXA 1QQ3A 4CBEA 1VLTA 2CYDA 5AC5A 2FGYA 4YL1A 1QPUA 4DXWA 3ZG1A 4O6MA 4WGYA 4KBLA 5CI8A 1E85A 3MLGA 1MQVA 1HW1A 3TJ6A 2YQYA 4N6CA 5E2QA 1RXQA 3PCVA 4OIRF 3DE9A 5L0CA 1E2XA 1GM5A 3B0UX 4PK4A 4GQHA 4DBQA 3EHNA 1DOWA 3IHUA 2Y3GA 5JS5A 2FAPB 2J9WA 4JJGA 2WL8A 4E17A 5KYYB 4JEAA 2C03A 4B6IA 2LSEA 4JTDB 1TKNA 4A2NB 3UGPA 5DS4A 1H6GA 5DVWA 3X2QC 4MVMA 5KYUA 1NFNA 1UG7A 1S7ZA 2KQ9A 4EWCA 4Q5SF 4CS9A 4N4WA 5AGFA 2YEVA 2D4UA 5A6AA 2XL8A 4K0DA 5L0HA 4DRHB 5F28E 4QDLA 4PFOA
chains in the Genus database with same CATH topology
3VRCA 3FOOA 4JKVA 1EKYA 2YLIA 2CCYA 4EIYA 2XLHA 3ZTMA 1JAFA 1RCPA 2YLGA 1CGOA 3IQ5A 2XLWA 3HNKA 1E84A 4NC3A 4CJOA 1YYJA 4CDYA 5B3IA 2XM0A 1YZCA 3NMIA 1LM3B 3HNIA 3HNJA 3NMKA 3M4CA 2YL0A 1S05A 5JP7A 5JVEA 4JEBA 4CDAA 3DE8A 5JLIA 2J9BA 1NBBA 3HNLA 3M79A 1BBHA 1M6TA 2QLAA 3QW1A 4WGZA 4ER9A 2XL6A 1GQAA 1YZAA 3U8PA 4U9DA 3TOLA 4ULVA 3C62A 2J8WA 3ZWIA 3L1MA 3IQ6A 256BA 4IAQA 4JE9A 4D4NA 1YYXA 2BC5A 2YLDA 4D4XA 2XLMA 2XM4A 2XLEA 4CX9A 3QVYA 1CPQA 3QW0A 5JRAA 2YKZA 2YL1A 1E83A 1QQ3A 2XLVA 1QPUA 4WGYA 4CDVA 4IB4A 1E85A 1MQVA 3ZQVA 4CIPA 1CGNA 3QVZA 2YL3A 3DE9A 1A7VA 3TOMA 3NMJA 1CPRA 3ZQYA 1E86A 5JS5A 4CJGA 5JT4A 4JEAA 4U9EA 3C63A 2XLDA 5JSLA 4IARA 1APCA 3M15A 3FOPA 3M4BA 4N6HA 2YL7A 5JUAA 4N4WA 5AGFA 2XL8A 2XLOA 4L6RA 3ZTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRC A;  3FOO A;  4JKV A;  1EKY A;  2YLI A;  2CCY A;  4EIY A;  2XLH A;  3ZTM A;  1JAF A;  1RCP A;  2YLG A;  1CGO A;  3IQ5 A;  2XLW A;  3HNK A;  1E84 A;  4NC3 A;  4CJO A;  1YYJ A;  4CDY A;  5B3I A;  2XM0 A;  1YZC A;  3NMI A;  1LM3 B;  3HNI A;  3HNJ A;  3NMK A;  3M4C A;  2YL0 A;  1S05 A;  5JP7 A;  5JVE A;  4JEB A;  4CDA A;  3DE8 A;  5JLI A;  2J9B A;  1NBB A;  3HNL A;  3M79 A;  1BBH A;  1M6T A;  2QLA A;  3QW1 A;  4WGZ A;  4ER9 A;  2XL6 A;  1GQA A;  1YZA A;  3U8P A;  4U9D A;  3TOL A;  4ULV A;  3C62 A;  2J8W A;  3ZWI A;  3L1M A;  3IQ6 A;  256B A;  4IAQ A;  4JE9 A;  4D4N A;  1YYX A;  2BC5 A;  2YLD A;  4D4X A;  2XLM A;  2XM4 A;  2XLE A;  4CX9 A;  3QVY A;  1CPQ A;  3QW0 A;  5JRA A;  2YKZ A;  2YL1 A;  1E83 A;  1QQ3 A;  2XLV A;  1QPU A;  4WGY A;  4CDV A;  4IB4 A;  1E85 A;  1MQV A;  3ZQV A;  4CIP A;  1CGN A;  3QVZ A;  2YL3 A;  3DE9 A;  1A7V A;  3TOM A;  3NMJ A;  1CPR A;  3ZQY A;  1E86 A;  5JS5 A;  4CJG A;  5JT4 A;  4JEA A;  4U9E A;  3C63 A;  2XLD A;  5JSL A;  4IAR A;  1APC A;  3M15 A;  3FOP A;  3M4B A;  4N6H A;  2YL7 A;  5JUA A;  4N4W A;  5AGF A;  2XL8 A;  2XLO A;  4L6R A;  3ZTZ A; 
#chains in the Genus database with same CATH topology
 1AVO B;  4OIO F;  3C18 A;  2QTV A;  3DAF A;  3V5Y A;  2G62 A;  1AEP A;  5L0F A;  3AGU A;  1KTM A;  4JKV A;  1HMD A;  1V55 C;  4KC9 A;  4PJM A;  1OCR C;  1BZ4 A;  1MMA A;  3KH2 A;  3MYF A;  4LDK A;  5COG A;  3ATP A;  4BJ1 A;  4DJ9 A;  3SEO A;  1ORS C;  4JJF A;  2KW3 C;  3EGD A;  2BE5 F;  5D91 A;  1D1C A;  1FMV A;  2GFH A;  4NTA A;  4P9F A;  3LAY A;  1NSG B;  1JAF A;  1RCP A;  2KK1 A;  1B68 A;  1QSP A;  1D1B A;  4HEA J;  3L34 A;  4C7O A;  3S29 A;  3WG7 C;  3IQ5 A;  4I1M A;  1RMV A;  1TFK B;  4NTB A;  2LFD A;  1YYJ A;  3LUT B;  3GWN A;  1W2W A;  3B71 A;  2LQG A;  3GAN A;  3M1C B;  2VCC A;  2WZL A;  1BDJ B;  3DAG A;  2HKV A;  3NMK A;  1OW7 A;  3LEV A;  3FXH A;  2R7W A;  3E9V A;  4WAB A;  3DMD A;  5KYW B;  4BJT A;  1S05 A;  5IY5 C;  1OCC C;  2EPO A;  3W4Y A;  2ICW G;  4CS8 A;  2OEX A;  4YL0 A;  2PF4 E;  1OCZ C;  4PFP A;  1LIH A;  3W8H A;  3EGX B;  3U2L A;  2J7P A;  3U5S A;  3MX3 A;  2A6H F;  4RDA A;  2OG2 A;  1QLE C;  2VCA A;  1YVI A;  3C8G A;  4MQ9 F;  2R7V A;  3TK0 A;  5B3S C;  3ECS A;  3HNL A;  1YDI A;  2PNO A;  1Z7Q c;  5L3Q A;  1OQC A;  3DJN B;  1L7C A;  5DQT A;  1U0B B;  3QTH A;  1NFO A;  1N1C A;  1O87 A;  4RBN A;  1F1M A;  3LLK A;  3U8P A;  2J7P D;  4BEJ A;  5A69 A;  2ZXP A;  3ASO C;  1D0Z A;  4W8P A;  3K1I A;  4XPY A;  3C8G D;  3SZR A;  3MBG A;  4K1O A;  3POV A;  2JX0 A;  256B A;  4IAQ A;  4DVZ A;  2Q4F A;  3O55 A;  2EPK X;  1YYX A;  2BC5 A;  2YLD A;  2Q9A A;  5COM A;  4D4X A;  2XLM A;  5HV9 A;  4WJ0 A;  3AQC A;  3JYY A;  1JOG A;  2DI3 A;  3PMR A;  4XLN F;  4CX9 A;  2XXA A;  4BJ5 A;  4ZLD A;  3L0I A;  3G4Z A;  1H9G A;  3GEI A;  2UUH A;  2Z15 A;  1IW7 F;  4BPM A;  4U5C E;  4QI0 A;  1HE1 A;  2XLV A;  3VYW A;  4ANJ A;  4OIQ F;  4CDV A;  1JRA A;  1PD0 A;  2J45 A;  2P0N A;  5L0J A;  1CGN A;  4AL0 A;  3FDQ A;  2YL3 A;  1TWC A;  3G50 A;  1WGW A;  5EK0 A;  1CPR A;  1G4U S;  3AG2 C;  1FNT c;  2LD6 A;  1H7I A;  3O39 A;  1TFO B;  2CW0 F;  1LI7 A;  1YA9 A;  1E86 A;  2ZXW C;  3RKO F;  4I3M A;  4C3D A;  1K40 A;  5BQH A;  4PJL A;  1Q0K A;  1VYK A;  2HMZ A;  3ASN C;  3DZA A;  1Q0D A;  2W4B A;  3JRM O;  1Q0F A;  3M15 A;  3Q7G A;  4NY3 A;  4PR9 A;  3US6 A;  3VF0 A;  1U6H A;  2HS5 A;  2X51 A;  4N6H A;  2YL7 A;  3RYL A;  5DS6 A;  2L6F A;  3TQO A;  1CGM E;  1HY5 A;  4Q4Z F;  1A41 A;  2EPL X;  4OIP F;  1OXB A;  2WVN A;  3FHD A;  1A7E A;  2PFD A;  1OXK A;  1LI5 A;  4J7Y A;  4L6R A;  4G7Z F;  3BRJ A;  3LES A;  4FWV A;  4FAP B;  3EHM A;  3DXJ F;  3LS0 A;  2W45 A;  4K7B A;  1SF8 A;  2GA0 A;  2HZ8 A;  2V26 A;  5A6J A;  3L8I A;  3R2P A;  3QZC A;  2M64 A;  1V4A A;  2CCY A;  4EBJ A;  5BQI A;  4LDR A;  3DM5 A;  3RF3 A;  1I4Y A;  2CGE A;  2Y3D A;  5F5H A;  4EIY A;  5A6B A;  5KYY A;  4U5F E;  1R5I D;  3B9Q A;  2DYS C;  3CAX A;  3DD7 A;  4JRZ A;  1WOL A;  5CIV A;  2IBF A;  1H9T A;  2ZD9 A;  1OCO C;  4O6Y A;  4E7S A;  3JT1 A;  1LS1 A;  3U9M A;  2P61 A;  2OEV A;  4MVR A;  4JUR I;  4YT5 A;  4JW1 A;  3HJC A;  3EZH A;  3W2V A;  1AUE A;  4NTF A;  4NC3 A;  3LLI A;  4CJO A;  1VTM P;  2ZXO A;  4GYT A;  5F5F A;  2XM0 A;  4IGG A;  4MVQ A;  2HJM A;  3NMI A;  1WTY A;  4JCH A;  5B1A C;  1VB5 A;  2OKU A;  2W4M A;  5COF A;  1YJG A;  1WAS A;  4F4B A;  1GGQ A;  1YA7 O;  3EG9 B;  3HNJ A;  4XLP F;  2L6G A;  1Y6D A;  1GS9 A;  4LDQ A;  4BEM J;  2R02 A;  3RQG A;  3CEX A;  4PAC A;  3JYH A;  5JP7 A;  1LE4 A;  4O7G A;  5JVE A;  4AK9 A;  4J7T A;  4IJJ A;  2KNH A;  4Z9H A;  3GM1 A;  1M56 C;  4YK5 A;  3N24 A;  2VC9 A;  4KI2 A;  2WB7 A;  3K7D A;  4CDA A;  2H7B A;  3Q7L A;  1MNE A;  2KC3 A;  3OA1 A;  1L3P A;  3CSK A;  2J9B A;  2MWQ A;  4QI2 A;  2NUT B;  3AOU A;  3I4U A;  1M6T A;  3S28 A;  2Y3H A;  2Y39 A;  4YT2 A;  4KNV A;  3QW1 A;  1K04 A;  2A69 F;  2AWY A;  1NG1 A;  3G4X A;  3UMK A;  1T6U A;  5KYN A;  3E70 C;  4WGZ A;  4X0R A;  2HV6 A;  1XZQ A;  2XL6 A;  3GEE A;  3N0T A;  5KYX B;  1GQA A;  1M2V B;  2A6E F;  3K66 A;  2XS1 A;  3ZVR A;  3DKA A;  4ULV A;  2W9Y A;  2GAQ A;  1T6Q A;  1MND A;  2QNL A;  2J8W A;  2Y3B A;  2NUP A;  5KYW A;  3L1M A;  3EJN A;  3IQ6 A;  2L7A A;  4HE8 D;  4XWJ A;  3S84 A;  1FFH A;  4Z9J A;  1VMA A;  1G5Z A;  5GPG B;  4OIN F;  2AWC A;  5EHH A;  5L3V A;  1TQG A;  3GM3 A;  4N06 A;  3UNG C;  3EGX A;  2XLE A;  2MYS A;  4HFK B;  5EGY A;  4Z9I A;  4E0H A;  1G8X A;  1ZYR F;  3DJU B;  4MTO A;  3RQE A;  1NU7 D;  3FAP B;  5JRA A;  3AG1 C;  2YKZ A;  2YL1 A;  3U0C A;  4ULW A;  3F47 A;  1E83 A;  1T5O A;  1EI7 A;  1O3U A;  1OR3 A;  1T01 A;  2MHR A;  1ZHT A;  3WOD F;  1ZW2 A;  2UUI A;  2IM8 A;  1T9K A;  4H54 A;  5CI9 A;  5T3W A;  4G7O F;  2R03 A;  4XEV A;  1QVX A;  1OKK A;  4E0I A;  4EBK A;  1O5H A;  1D0Y A;  4BJ6 A;  3ABK C;  2IXO A;  1A7V A;  1I4Z A;  1Y4C A;  1Q0G A;  3EZI A;  1J8Y F;  2YZS A;  3NMJ A;  3TOM A;  3SXY A;  4JTC B;  3RW0 A;  1FTS A;  2LIG A;  3NG1 A;  2HV7 A;  5BUO A;  4CSA C;  3GWL A;  3LJB A;  5JT4 A;  3JZ0 A;  3B0V C;  3IQC A;  3S90 A;  1RKE B;  2A68 F;  4A4A A;  3RQF A;  3ZIB A;  5L0G A;  3PHF 2;  1OKK D;  4FX5 A;  3JCU Q;  1ORY A;  2QY9 A;  2WZF A;  2X0C A;  3R7C A;  4AE4 B;  3IEE A;  1OW6 A;  3WHN A;  2OOC A;  5E3A A;  1BR1 A;  4JVS A;  4IRU A;  1SMY F;  2L6H A;  1RJ9 A;  4I1O B;  4YT8 A;  2ETS A;  3HTK C;  4MVO A;  3ZTZ A;  2PP4 A;  4LAC B;  3K33 A;  3W2W A;  2L81 A;  4O79 A;  1VLS A;  4PJN A;  1D0X A;  1ZVZ A;  3EFO B;  4M63 A;  1A7D A;  2WZG A;  4U5H A;  1EKY A;  4DVY P;  4G0H A;  2YLI A;  4U5B E;  1QKR A;  1YAR O;  2J46 A;  2HSB A;  2P7V A;  4PJJ A;  1SYQ A;  3K6B A;  2OU6 A;  4O6N A;  4XEF A;  3NRH A;  1FMW A;  2G3K A;  2H8A A;  5T3T A;  1PD1 A;  1QZX A;  4MTG A;  4ZLC A;  3B29 A;  1XZP A;  1YLM A;  1J8M F;  4JZA A;  4NQF A;  1VOM A;  3IQT A;  2C04 A;  3AG3 C;  3S0X A;  1SZI A;  1TWA A;  2YLG A;  3SYN A;  1CGO A;  1Z23 A;  3EPV A;  3C8Z A;  1YAU O;  3H2V A;  3AGT A;  3HNK A;  3OWT A;  3JSE O;  3GM2 A;  1U89 A;  4CDY A;  3SXZ A;  2J9U A;  4LER A;  3C7J A;  2KJG A;  3LNM B;  1DOV A;  2DYR C;  4MVU A;  3HNI A;  3K1H A;  2G3V A;  3H65 A;  4H4K C;  4DRJ B;  3RVY A;  3M4C A;  5DLJ A;  4DRI B;  1JPN A;  2A1D D;  4JEB A;  4J32 B;  3V5Z A;  2BL2 A;  1EA8 A;  4EUK B;  5JLI A;  3ZDL A;  3NYM A;  1WN0 A;  2OJE D;  4JC7 A;  1NBB A;  2P1A A;  1WWP A;  1ORJ A;  1A0B A;  2NPU A;  3KYI A;  3HLZ A;  3LS1 A;  1ZHZ A;  4R32 A;  2QLA A;  3RVZ A;  3T9O A;  2XXA B;  2EIN C;  3UMH A;  2H7O A;  4LLE A;  1NLX A;  2F22 A;  5DS5 A;  2R9R B;  3EH1 A;  2R7U A;  1YZA A;  4UDV A;  5E33 A;  3EG9 A;  4YL3 A;  3TJ5 A;  3LNR A;  2AVK A;  3VM6 A;  3C62 A;  4NCQ A;  3U3F A;  3DI5 A;  3GEH A;  1M2O A;  2M4E A;  4XTK A;  3ZWI A;  3FVY A;  1SR2 A;  2KSF A;  1VK5 A;  2PX0 A;  3Q6M A;  4CS9 C;  4D4N A;  2DB4 A;  3ABL C;  4HFF B;  4U5E E;  2RD9 A;  2ZPA A;  1KU2 A;  4CS7 A;  4RD9 A;  3HKK A;  3NKD A;  2CNW A;  1D1A A;  3CZ6 A;  4MW3 A;  3TUL A;  3B0P A;  4OD4 A;  1ZU5 A;  5L0I A;  2V3C C;  1ZU4 A;  3EH2 A;  2NUT A;  4YWQ A;  3A9C A;  5KYU B;  2I8B A;  1ZHW A;  4P9T A;  3EQL F;  4P6I C;  3S27 A;  4KNW A;  3H2U A;  2QE9 A;  2GWW A;  4C3B A;  1FR0 A;  1JR8 A;  5KYX A;  1LVK A;  1TR2 A;  1TWH A;  4IB4 A;  2EIL C;  3ZQV A;  3T6B A;  1M2V A;  2JPU A;  4CIP A;  2YHS A;  3QVZ A;  2LFF A;  2CNW D;  2DGJ A;  2E87 A;  2HFI A;  2J0W A;  4U5G A;  3ZQY A;  1WAT A;  5A6B D;  1KNY A;  3SNH A;  2PBE A;  4E18 A;  1TWG A;  2EIM C;  2R7O A;  4XPX A;  1LKX A;  2YVK A;  4XPW A;  2Y69 C;  2VCB A;  1Z5Z A;  2LK4 A;  4Q7C A;  4AX2 A;  4CJG A;  4DOZ A;  4W8K A;  1HE9 A;  4U9E A;  3DWW A;  3C63 A;  2XLD A;  3ITF A;  5JSL A;  3LEO A;  4IAR A;  2NSF A;  1HW2 A;  1APC A;  1LE2 A;  2IXN A;  3EGD B;  2Q9C A;  3FMS A;  2R05 A;  2RSE B;  3FOP A;  3NKE A;  4EKW A;  3M4B A;  4MTF A;  2D5R B;  3Q6N A;  5JUA A;  2VH3 A;  3SXK A;  1PV3 A;  1V74 B;  3VAY A;  2P6V A;  1VYI A;  1C03 A;  4XQ1 A;  1C02 A;  5E3C A;  3V5X A;  4CS8 C;  4C7O B;  1UFB A;  4MND A;  5D92 A;  1NZE A;  2HJ3 A;  2L9J A;  2LP4 A;  4JCZ A;  1Z6A A;  5HSW A;  2R7S A;  1MMD A;  2Q3T A;  2R25 A;  2XLO A;  3JSZ A;  5AC4 A;  2HSQ A;  3T6J A;  3FAJ A;  3VRC A;  4IWB A;  4EHP A;  4JTA B;  3FOO A;  2NUP B;  1IZM A;  1OR2 A;  1ZHX A;  4EBB A;  3O6X A;  2R7T A;  2VB6 A;  5FZT A;  2KGO A;  1ZZP A;  2NG1 A;  3KL4 A;  3I5P A;  2PX3 A;  2J0X A;  2ASR A;  5TJ5 E;  1RKE A;  2AU5 A;  4MVZ A;  3RH3 A;  2H7V C;  4BJ6 C;  1Z63 A;  2A0U A;  3IPM O;  3J06 A;  2Q9B A;  4I44 A;  4YT4 A;  4DBR A;  3C8G B;  3K1I C;  2XLH A;  3L8J A;  3T6G B;  1ZW3 A;  2Q00 A;  3KMI A;  3ZTM A;  2YWA A;  4AL1 A;  4E7Z A;  4AE4 A;  2VAS A;  2EIK C;  3UGO A;  1ZHY A;  2EPM X;  4CIH A;  2WVO A;  3UR3 C;  1G4W R;  2R7R A;  3GOD A;  3SXM A;  2XLW A;  2AP3 A;  3SP1 A;  3W8I A;  1C17 M;  1E84 A;  3ZC4 A;  4CSA A;  3QMK A;  3AJM A;  3NYL A;  5B3I A;  1JPJ A;  2B0J A;  4BG0 A;  4BJ5 C;  2FFH A;  1YZC A;  4IAO A;  2IXP A;  2QUP A;  3MFN A;  3N2Z B;  3O10 A;  1LPE A;  1T6I A;  1LM3 B;  3S9O A;  1JMW A;  2JD3 A;  1I5N A;  3BEH A;  3EFO A;  3WAQ A;  2XRH A;  2NSG A;  3PDM P;  2YL0 A;  2B0H A;  3CQZ A;  5BQG A;  3U8V A;  1MMN A;  4FES A;  2OCC C;  3I5Q A;  4XEK A;  3MYI A;  3RIP A;  4G7H F;  2R7X A;  4MW8 A;  4YN0 B;  3GOR A;  2HMQ A;  2IYL D;  5B1B C;  1OW8 A;  2YRF A;  1M57 C;  3ABM C;  3TD7 A;  3KPH A;  3DE8 A;  4MVS A;  2HUJ A;  2J9V A;  2GDC A;  3UMI A;  1BR2 A;  4YJW A;  3U3B A;  3X1O A;  3AQB A;  2OQM A;  2TMV P;  1K05 A;  2EPN A;  2I15 A;  3M79 A;  1FFT C;  1BBH A;  1RJ9 B;  2OJQ A;  1ST6 A;  3A11 A;  4G78 A;  2XSE A;  1NU9 C;  2IXM A;  4GEH A;  2KYH A;  2XS8 A;  3OEO A;  3U9J A;  5DQZ A;  4ER9 A;  5A6K A;  3JRT A;  5T1D B;  2LCH A;  3NYJ A;  3T4R A;  4U9D A;  2R7Q A;  1BR4 A;  3TOL A;  1R4T A;  2A0B A;  2CDQ A;  1XWJ A;  3AG4 C;  1MMG A;  3F46 A;  4U5D E;  4JIO A;  1LS4 A;  3DM9 B;  2O9X A;  4JE9 A;  3RFY A;  2Q7R A;  5K0I A;  3V7O A;  2EIJ C;  1RKC A;  5L0D A;  1Q0M A;  2ZXR A;  4ONS A;  2XM4 A;  4C3E A;  1Z3I X;  3U2M A;  5FCL A;  2XL4 A;  3QVY A;  4MS2 A;  3KYJ A;  3ZSU A;  1FAP B;  4J30 B;  1CPQ A;  3KKB A;  3QW0 A;  2WVQ A;  4LLC A;  3JTL O;  4OD5 A;  1EQ1 A;  3NDB B;  1HMO A;  1V54 C;  2IOQ A;  1PCX A;  1QQ3 A;  4CBE A;  1VLT A;  2CYD A;  5AC5 A;  2FGY A;  4YL1 A;  1QPU A;  4DXW A;  3ZG1 A;  4O6M A;  4WGY A;  4KBL A;  5CI8 A;  1E85 A;  3MLG A;  1MQV A;  1HW1 A;  3TJ6 A;  2YQY A;  4N6C A;  5E2Q A;  1RXQ A;  3PCV A;  4OIR F;  3DE9 A;  5L0C A;  1E2X A;  1GM5 A;  3B0U X;  4PK4 A;  4GQH A;  4DBQ A;  3EHN A;  1DOW A;  3IHU A;  2Y3G A;  5JS5 A;  2FAP B;  2J9W A;  4JJG A;  2WL8 A;  4E17 A;  5KYY B;  4JEA A;  2C03 A;  4B6I A;  2LSE A;  4JTD B;  1TKN A;  4A2N B;  3UGP A;  5DS4 A;  1H6G A;  5DVW A;  3X2Q C;  4MVM A;  5KYU A;  1NFN A;  1UG7 A;  1S7Z A;  2KQ9 A;  4EWC A;  4Q5S F;  4CS9 A;  4N4W A;  5AGF A;  2YEV A;  2D4U A;  5A6A A;  2XL8 A;  4K0D A;  5L0H A;  4DRH B;  5F28 E;  4QDL A;  4PFO A; 
#chains in the Genus database with same CATH homology
 3VRC A;  3FOO A;  4JKV A;  1EKY A;  2YLI A;  2CCY A;  4EIY A;  2XLH A;  3ZTM A;  1JAF A;  1RCP A;  2YLG A;  1CGO A;  3IQ5 A;  2XLW A;  3HNK A;  1E84 A;  4NC3 A;  4CJO A;  1YYJ A;  4CDY A;  5B3I A;  2XM0 A;  1YZC A;  3NMI A;  1LM3 B;  3HNI A;  3HNJ A;  3NMK A;  3M4C A;  2YL0 A;  1S05 A;  5JP7 A;  5JVE A;  4JEB A;  4CDA A;  3DE8 A;  5JLI A;  2J9B A;  1NBB A;  3HNL A;  3M79 A;  1BBH A;  1M6T A;  2QLA A;  3QW1 A;  4WGZ A;  4ER9 A;  2XL6 A;  1GQA A;  1YZA A;  3U8P A;  4U9D A;  3TOL A;  4ULV A;  3C62 A;  2J8W A;  3ZWI A;  3L1M A;  3IQ6 A;  256B A;  4IAQ A;  4JE9 A;  4D4N A;  1YYX A;  2BC5 A;  2YLD A;  4D4X A;  2XLM A;  2XM4 A;  2XLE A;  4CX9 A;  3QVY A;  1CPQ A;  3QW0 A;  5JRA A;  2YKZ A;  2YL1 A;  1E83 A;  1QQ3 A;  2XLV A;  1QPU A;  4WGY A;  4CDV A;  4IB4 A;  1E85 A;  1MQV A;  3ZQV A;  4CIP A;  1CGN A;  3QVZ A;  2YL3 A;  3DE9 A;  1A7V A;  3TOM A;  3NMJ A;  1CPR A;  3ZQY A;  1E86 A;  5JS5 A;  4CJG A;  5JT4 A;  4JEA A;  4U9E A;  3C63 A;  2XLD A;  5JSL A;  4IAR A;  1APC A;  3M15 A;  3FOP A;  3M4B A;  4N6H A;  2YL7 A;  5JUA A;  4N4W A;  5AGF A;  2XL8 A;  2XLO A;  4L6R A;  3ZTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...