4CDAA

Spectroscopically-validated structure of ferric cytochrome c prime from alcaligenes xylosoxidans
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
127
structure length
127
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fingerprinting Redox and Ligand States in Haemprotein Crystal Structures Using Resonance Raman Spectroscopy.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 49
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cdaA00
1CPRA 1YYXA 1YYJA 5JS5A 3DE8A 4JE9A 4N6HA 2YL1A 2CCYA 3QVYA 5AGFA 4JEAA 1EKYA 3M15A 2XLOA 4IARA 3M79A 4IB4A 1NBBA 2XLHA 3L1MA 4JKVA 4NC3A 3TOMA 1YZCA 4U9EA 2XLWA 2XM4A 4JEBA 1LM3B 1E86A 1RCPA 4EIYA 3HNKA 2XL6A 4ER9A 256BA 5JVEA 4CDAA 2YL3A 2XLVA 2YL7A 2YLIA 1CPQA 4U9DA 3ZQVA 3IQ6A 4L6RA 2XLEA 2YL0A 2J9BA 1CGNA 3M4CA 4WGZA 3HNLA 5JLIA 2YLGA 3ZTZA 1A7VA 3QW0A 2QLAA 4CJGA 3C62A 1E84A 4N4WA 1JAFA 3HNJA 4D4NA 3DE9A 1M6TA 4WGYA 1APCA 3NMIA 4ULVA 4CJOA 3FOPA 3VRCA 4D4XA 1E85A 1BBHA 4CX9A 5JSLA 2YLDA 3U8PA 3NMKA 3IQ5A 4CDYA 1QQ3A 5JUAA 1E83A 4CIPA 2XLDA 3QW1A 4IAQA 1YZAA 3HNIA 3C63A 3ZQYA 2XM0A 1QPUA 2J8WA 5B3IA 2XLMA 3ZWIA 5JT4A 1S05A 1CGOA 1GQAA 3TOLA 5JRAA 3QVZA 2XL8A 3ZTMA 3NMJA 5JP7A 1MQVA 3FOOA 3M4BA 2BC5A 2YKZA 4CDVA
chains in the Genus database with same CATH superfamily
4C7OB 1KU2A 2KQ9A 5L0HA 1Q0GA 2AWYA 3C7JA 2J46A 3JSEO 3EHNA 4JE9A 4N6HA 4U5BE 4DJ9A 2OQMA 3GWNA 3SXYA 1V4AA 3WODF 2J9VA 1RKEB 5AC4A 4JCZA 4AX2A 4A2NB 1NG1A 2MWQA 2HZ8A 3SNHA 1VLSA 3JYHA 2EPNA 4IGGA 3ABLC 1YZCA 4N06A 1TWGA 4U9EA 4K7BA 4ULWA 4W8KA 4DVYP 4GEHA 4BEMJ 3EGDB 1U0BB 1HMDA 5E3AA 3DWWA 2WZGA 3HNKA 4R32A 3RQGA 4GQHA 2HKVA 1ST6A 2VC9A 256BA 2X51A 3DD7A 4RBNA 1TQGA 1U6HA 1YDIA 1OKKA 1SZIA 2MHRA 1A7DA 2BE5F 3FXHA 4QDLA 4WABA 1Q0MA 4G78A 2EPLX 3G50A 2YLIA 3LEVA 3U3FA 5A69A 2J45A 2PP4A 2NSGA 1Z7Qc 1Y4CA 4MW8A 3F46A 3R2PA 4IJJA 1VK5A 1M57C 4PK4A 1H7IA 2V3CC 2FGYA 1HE1A 4XPYA 4YT5A 3ZQVA 4Q7CA 5COGA 1NSGB 2NG1A 1TKNA 1TFOB 3U5SA 1HMOA 2YL0A 4MVQA 4PJJA 4KC9A 2CGEA 1CGNA 4CSAA 3M4CA 5TJ5E 4OIPF 3MFNA 3DI5A 2G62A 2XS8A 1TWAA 2P0NA 4RD9A 3V5YA 1E2XA 1I5NA 1LE2A 3HNLA 4AL0A 3AG3C 2V26A 5L3VA 4CS9A 1ZHYA 2Y39A 4J7YA 1V74B 4A4AA 2JD3A 2R7UA 4MVRA 3R7CA 5BQHA 3IEEA 2WVOA 1VLTA 3AJMA 2CYDA 1YARO 2IM8A 4C7OA 3Q6NA 2OJQA 2EINC 3HJCA 4CS9C 1ZZPA 3K7DA 5CI8A 3U3BA 2R7SA 2QTVA 3K1HA 2UUHA 1B68A 1I4ZA 1OCCC 2W4MA 2M64A 2PX3A 1T6UA 1TWHA 1JAFA 2Y3HA 4N4WA 2HV6A 3DE9A 4U5DE 4D4NA 4LDKA 5KYNA 3S84A 4CSAC 2YQYA 5A6BD 1IZMA 4MW3A 3UR3C 3RH3A 4OIOF 3GEHA 3K1IA 2A0UA 2DB4A 2KC3A 1NZEA 4YL3A 4EBBA 1Z63A 2KNHA 2R9RB 4KNVA 5E3CA 1HW1A 3VRCA 2KYHA 2ZXPA 1U89A 2DI3A 3WHNA 3GM3A 2EIJC 3PDMP 3C8GD 2R7RA 3W8HA 4CX9A 5JSLA 1BR4A 1K40A 3G4XA 1YJGA 1D0ZA 4OD4A 2FFHA 3AGUA 3H2UA 3SXZA 3NMKA 3IQ5A 4CDYA 3POVA 1E83A 3GM1A 5KYWA 3ZIBA 4J32B 2YZSA 4IAQA 1AEPA 4J30B 3RVZA 3NYMA 3HNIA 3LUTB 3KH2A 5AC5A 1EI7A 1VTMP 3LNMB 3EHMA 5L0FA 2LFDA 2J8WA 2PFDA 3IHUA 5F5FA 2YWAA 3MX3A 1OW7A 1JPJA 1S7ZA 2G3VA 1C03A 5B1BC 3HKKA 2XLMA 2C04A 1AUEA 1MMNA 1CGOA 4OINF 5DLJA 4C3DA 2NUPB 2W45A 3TOLA 3S9OA 1FNTc 4J7TA 5EK0A 4Z9IA 3AGTA 1MQVA 3DZAA 3FOOA 1O5HA 1T9KA 3VYWA 3ECSA 5D92A 2OOCA 3PHF2 4EBJA 1YYXA 4YK5A 1Z23A 1YYJA 2IXOA 5JS5A 4O6MA 3SP1A 2A69F 2LFFA 3SYNA 3GODA 3TK0A 5T1DB 1UG7A 4G7ZF 1QZXA 3QZCA 5B3SC 3QVYA 3EFOA 1H9TA 2RD9A 4G7OF 2P61A 3OWTA 4IARA 1NBBA 2XLHA 3DM5A 3L1MA 4JKVA 4NC3A 4O7GA 3SEOA 4C3EA 3B29A 1IW7F 2PNOA 4KNWA 2DYSC 3NG1A 3VF0A 2KW3C 2XM4A 4I3MA 4DXWA 2EIMC 1LM3B 2ZD9A 1O3UA 2ZXOA 1RCPA 4E7ZA 2XXAA 1ORYA 4BJ1A 4Z9JA 2JPUA 2KK1A 2D4UA 2OJED 3K33A 2EILC 1RJ9B 3LESA 1BR1A 3BRJA 4CDAA 2XL4A 3EGXA 2ZXWC 3V7OA 3UGOA 3U8VA 3GEIA 2CW0F 4LDRA 3CZ6A 1OW6A 1OCOC 3RFYA 3U9MA 4BJ5C 1CPQA 3JYYA 2J7PD 5CIVA 3RQFA 2L81A 1OR3A 1LI7A 2A68F 3N0TA 3ZVRA 3Q7LA 3NRHA 2YEVA 4PACA 3AQCA 4IAOA 4E0IA 2VH3A 1V55C 4YL1A 5F5HA 3J06A 3FMSA 1OW8A 1G5ZA 4JC7A 5JRAA 4U5GA 1T6IA 5JLIA 4XEFA 2GAQA 4H54A 4IWBA 4AL1A 1D0XA 1FFHA 1C17M 3ZTZA 1MNDA 3RIPA 5A6KA 4I1OB 2ETSA 2HUJA 1MNEA 2QLAA 3DMDA 2A6EF 3EH2A 2IXNA 5HV9A 2PF4E 2BL2A 5E33A 1M2VA 2PX0A 3C62A 4XTKA 4G7HF 2HJMA 1YVIA 1ORSC 2Q3TA 4LERA 3IPMO 5EHHA 3AG1C 3CEXA 3AQBA 4U5FE 2TMVP 2H7VC 1WWPA 1RJ9A 2QNLA 1Z6AA 3GM2A 3EFOB 1LS1A 1O87A 1T6QA 3FAJA 3W2WA 5KYWB 3FOPA 4G0HA 3DXJF 2XXAB 1LS4A 3DJNB 3EQLF 4NTAA 2NUPA 1ZU5A 2AU5A 1FAPB 5E2QA 1Q0FA 3N2ZB 3OEOA 3ABKC 4E7SA 2NUTA 2DGJA 2VASA 2UUIA 2HMQA 3EGXB 3E70C 2Q4FA 2OKUA 2WZLA 2L6HA 1YA9A 3GEEA 3JT1A 3OA1A 4YL0A 3ZC4A 5DQTA 3ZDLA 2ASRA 2XLDA 3PMRA 3QW1A 3KKBA 1A0BA 3T6GB 4UDVA 2EIKC 3C63A 3CSKA 1D1AA 4MVMA 3ZQYA 3GORA 3B0VC 5F28E 3QTHA 5L0IA 2Q00A 2R7WA 4ONSA 2MYSA 1PD0A 2R7TA 3SXKA 4LACB 2R7VA 1Y6DA 1N1CA 3FHDA 2F22A 4RDAA 3RW0A 5EGYA 5FCLA 3NYLA 3RVYA 4C3BA 1BZ4A 1XZQA 3EGDA 3S28A 3U2MA 4DOZA 1AVOB 2YHSA 4PJLA 2HFIA 3B71A 2RSEB 1OR2A 4NY3A 4QI2A 2AWCA 3M4BA 2LQGA 4MVZA 3U9JA 3I4UA 3Q6MA 4YN0B 4DRHB 4MTGA 4U5HA 2Y3BA 4CS8A 2LSEA 2IOQA 1CPRA 4JJFA 2AP3A 1OQCA 3LJBA 1QLEC 2HJ3A 3DE8A 4DRJB 1JPNA 3B9QA 3LLKA 3NYJA 3U2LA 3RQEA 4IRUA 2J0WA 3L8JA 4BEJA 4E18A 2QY9A 4ZLCA 5KYUB 1G8XA 2CCYA 3DM9B 3KMIA 4YJWA 5AGFA 4JEAA 1H6GA 3TJ5A 1EKYA 4JTAB 4IB4A 4LLCA 3M79A 3TOMA 5T3WA 2Q9AA 3CQZA 5CI9A 4BJ5A 3K66A 2HS5A 2XLWA 3LAYA 3A11A 3H2VA 4O79A 2J9UA 2J9WA 5COFA 5KYYB 1E86A 4JIOA 3QMKA 2ZXRA 4PR9A 3US6A 2Y69C 4JURI 3S29A 2AVKA 2P7VA 2XL6A 3DAGA 3EPVA 1XZPA 3CAXA 3ATPA 4K1OA 1NFOA 3G4ZA 4ER9A 5JVEA 3UGPA 2EPKX 2NUTB 4YT4A 2YL3A 3SXMA 1TWCA 2HSQA 2E87A 2J7PA 2YL7A 3AG4C 2B0JA 3WAQA 1I4YA 2W4BA 2G3KA 1J8MF 3E9VA 1H9GA 3ASNC 3FAPB 1VB5A 2GA0A 3FVYA 2R03A 4U9DA 1NLXA 2Z15A 1C02A 3UMKA 5BQIA 3N24A 3S90A 3T4RA 1T5OA 3IQ6A 4HFKB 4L6RA 4JTCB 3V5XA 2GFHA 2Y3GA 1PD1A 2XLEA 5A6JA 1GM5A 1WASA 2EPOA 2J9BA 2O9XA 2W9YA 4WGZA 4NQFA 4AK9A 4HEAJ 1K04A 2PBEA 5KYXB 4U5CE 3JTLO 4O6YA 4BPMA 2WL8A 1ZHXA 1UFBA 1WOLA 2YLGA 1FR0A 1SYQA 5L3QA 1A7VA 2CNWD 3QW0A 4XPXA 4DRIB 3LNRA 2J0XA 4CJGA 4XEKA 3MBGA 2WB7A 4P9FA 4PFOA 1OCZC 3C8GA 1F1MA 3EJNA 2OEXA 4E17A 1WGWA 1E84A 3TD7A 3KL4A 3HNJA 1JR8A 1Q0DA 3H65A 1TR2A 3GWLA 4WGYA 1APCA 3NMIA 1ZHWA 2GDCA 5L0CA 2LD6A 4FWVA 2IXMA 3PCVA 4CJOA 2JX0A 2OU6A 3L8IA 4OIQF 4JTDB 1HW2A 1MMDA 1L7CA 2A0BA 3T6JA 1J8YF 4JZAA 2LK4A 2WZFA 2R7XA 3JSZA 5KYYA 1BBHA 1GS9A 2YVKA 3IQTA 5B1AC 3L0IA 4XLNF 1JOGA 1VYIA 4JW1A 4YT2A 2R02A 2L6FA 4OIRF 3UNGC 4B6IA 1MMGA 1QQ3A 3GANA 5JUAA 5K0IA 3TULA 1OCRC 2HSBA 3O55A 4F4BA 4CIPA 1Q0KA 5DVWA 1TFKB 3JRMO 3ASOC 2A1DD 4HE8D 3EZHA 4PJMA 1EQ1A 1ZU4A 2L7AA 1M2OA 2XM0A 2WVQA 3JZ0A 2XRHA 4LDQA 4MVOA 2VB6A 2ZPAA 1KNYA 1LIHA 4FX5A 1M2VB 5KYXA 3ZWIA 3O10A 4GYTA 1VMAA 3UMIA 4YWQA 3EG9B 2H8AA 4HFFB 1GQAA 2EPMX 5T3TA 3K6BA 1VOMA 2X0CA 4MVSA 4CS7A 3L34A 3QVZA 4CS8C 4Z9HA 5IY5C 1T01A 5DS5A 3O6XA 4XQ1A 1YLMA 2Q9CA 3UMHA 1OKKD 1HY5A 3C8ZA 4XLPF 4I1MA 2BC5A 4WJ0A 3LEOA 4JJGA 1SMYF 1HE9A 3ZG1A 1WN0A 2A6HF 3B0UX 2VCAA 3HLZA 4CIHA 2P1AA 1VYKA 5BQGA 2YL1A 3B0PA 3C18A 4MVUA 4ANJA 4MS2A 1PV3A 2QE9A 1FMVA 1Z5ZA 5HSWA 3MYIA 3RKOF 1R5ID 3M15A 3VM6A 2XLOA 5B3IA 2Q7RA 3NDBB 4PFPA 4O6NA 4MQ9F 3NKEA 3KPHA 2YRFA 4JEBA 1QSPA 1YAUO 5DS6A 3FDQA 2NPUA 4EIYA 4XEVA 4XPWA 4U5EE 1ZW2A 2R25A 4AE4B 1ORJA 4P6IC 3LS1A 2R7QA 3DKAA 1PCXA 3S27A 1D1CA 5L0GA 1RKEA 2H7OA 2LCHA 1FFTC 1LPEA 1ZYRF 2XLVA 3X1OA 4CBEA 4DVZA 2KSFA 3W4YA 3X2QC 1GGQA 3ABMC 4KI2A 1D0YA 4ZLDA 1XWJA 2L6GA 3KYIA 4M63A 4N6CA 4QI0A 1RMVA 2CNWA 1WATA 4NTFA 1OXKA 1ZHZA 3MLGA 3SZRA 2VCCA 3TQOA 2C03A 1V54C 5A6BA 5FZTA 3ITFA 2XSEA 2OEVA 5L0DA 1WTYA 1FMWA 3F47A 3RYLA 1ZVZA 3JRTA 1OXBA 3JCUQ 1G4WR 1NFNA 1EA8A 3IQCA 2QUPA 1LE4A 1QKRA 2HMZA 4I44A 4K0DA 3T6BA 3ZSUA 5BUOA 4BJ6A 1NU9C 2GWWA 2NSFA 2R05A 4Q5SF 2P6VA 5GPGB 1BR2A 3TJ6A 4EHPA 1DOVA 2HV7A 3WG7C 5A6AA 1R4TA 3M1CB 2B0HA 3NKDA 4P9TA 3RF3A 1LI5A 3HTKC 5D91A 2Q9BA 3VAYA 4EBKA 3AOUA 1M6TA 4FESA 4YT8A 2VCBA 3LLIA 1K05A 3V5ZA 1NU7D 1ZW3A 4ULVA 1JRAA 4LLEA 5COMA 1M56C 1DOWA 1A41A 4EKWA 2XS1A 3DJUB 4NCQA 5DS4A 1QVXA 4H4KC 1MMAA 4BG0A 1G4US 3T9OA 4D4XA 1A7EA 1BDJB 1SR2A 2H7BA 3LS0A 4JVSA 3EG9A 3EZIA 4JRZA 4W8PA 4AE4A 3AG2C 3O39A 1E85A 3BEHA 1SF8A 1LKXA 2LIGA 3W8IA 2YLDA 3A9CA 4MTFA 3DAFA 2I8BA 1ZHTA 2R7OA 1RXQA 1W2WA 2OCCC 3EH1A 2DYRC 4MTOA 3U8PA 4Q4ZF 3KYJA 4PJNA 1JMWA 3Q7GA 5L0JA 3U0CA 2WVNA 5DQZA 4EUKB 4OD5A 3MYFA 1YZAA 4E0HA 1L3PA 2D5RB 4DBQA 4JCHA 5KYUA 2L9JA 3K1IC 1QPUA 2CDQA 1KTMA 2LP4A 4NTBA 4BJTA 1CGME 2ICWG 2IXPA 3C8GB 1D1BA 5JT4A 1S05A 4MNDA 4DBRA 2KGOA 2IBFA 2KJGA 2XL8A 2Y3DA 4KBLA 1Z3IX 3W2VA 3ZTMA 3NMJA 4XWJA 5JP7A 1RKCA 2FAPB 4BJ6C 1FTSA 4EWCA 3I5QA 3S0XA 2IYLD 2M4EA 3I5PA 2OG2A 2YKZA 4X0RA 1YA7O 1LVKA 4FAPB 4CDVA 2I15A
chains in the Genus database with same CATH topology
1CPRA 1YYXA 1YYJA 5JS5A 3DE8A 4JE9A 4N6HA 2YL1A 2CCYA 3QVYA 5AGFA 4JEAA 1EKYA 3M15A 2XLOA 4IARA 3M79A 4IB4A 1NBBA 2XLHA 3L1MA 4JKVA 4NC3A 3TOMA 1YZCA 4U9EA 2XLWA 2XM4A 4JEBA 1LM3B 1E86A 1RCPA 4EIYA 3HNKA 2XL6A 4ER9A 256BA 5JVEA 4CDAA 2YL3A 2XLVA 2YL7A 2YLIA 1CPQA 4U9DA 3ZQVA 3IQ6A 4L6RA 2XLEA 2YL0A 2J9BA 1CGNA 3M4CA 4WGZA 3HNLA 5JLIA 2YLGA 3ZTZA 1A7VA 3QW0A 2QLAA 4CJGA 3C62A 1E84A 4N4WA 1JAFA 3HNJA 4D4NA 3DE9A 1M6TA 4WGYA 1APCA 3NMIA 4ULVA 4CJOA 3FOPA 3VRCA 4D4XA 1E85A 1BBHA 4CX9A 5JSLA 2YLDA 3U8PA 3NMKA 3IQ5A 4CDYA 1QQ3A 5JUAA 1E83A 4CIPA 2XLDA 3QW1A 4IAQA 1YZAA 3HNIA 3C63A 3ZQYA 2XM0A 1QPUA 2J8WA 5B3IA 2XLMA 3ZWIA 5JT4A 1S05A 1CGOA 1GQAA 3TOLA 5JRAA 3QVZA 2XL8A 3ZTMA 3NMJA 5JP7A 1MQVA 3FOOA 3M4BA 2BC5A 2YKZA 4CDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CPR A;  1YYX A;  1YYJ A;  5JS5 A;  3DE8 A;  4JE9 A;  4N6H A;  2YL1 A;  2CCY A;  3QVY A;  5AGF A;  4JEA A;  1EKY A;  3M15 A;  2XLO A;  4IAR A;  3M79 A;  4IB4 A;  1NBB A;  2XLH A;  3L1M A;  4JKV A;  4NC3 A;  3TOM A;  1YZC A;  4U9E A;  2XLW A;  2XM4 A;  4JEB A;  1LM3 B;  1E86 A;  1RCP A;  4EIY A;  3HNK A;  2XL6 A;  4ER9 A;  256B A;  5JVE A;  4CDA A;  2YL3 A;  2XLV A;  2YL7 A;  2YLI A;  1CPQ A;  4U9D A;  3ZQV A;  3IQ6 A;  4L6R A;  2XLE A;  2YL0 A;  2J9B A;  1CGN A;  3M4C A;  4WGZ A;  3HNL A;  5JLI A;  2YLG A;  3ZTZ A;  1A7V A;  3QW0 A;  2QLA A;  4CJG A;  3C62 A;  1E84 A;  4N4W A;  1JAF A;  3HNJ A;  4D4N A;  3DE9 A;  1M6T A;  4WGY A;  1APC A;  3NMI A;  4ULV A;  4CJO A;  3FOP A;  3VRC A;  4D4X A;  1E85 A;  1BBH A;  4CX9 A;  5JSL A;  2YLD A;  3U8P A;  3NMK A;  3IQ5 A;  4CDY A;  1QQ3 A;  5JUA A;  1E83 A;  4CIP A;  2XLD A;  3QW1 A;  4IAQ A;  1YZA A;  3HNI A;  3C63 A;  3ZQY A;  2XM0 A;  1QPU A;  2J8W A;  5B3I A;  2XLM A;  3ZWI A;  5JT4 A;  1S05 A;  1CGO A;  1GQA A;  3TOL A;  5JRA A;  3QVZ A;  2XL8 A;  3ZTM A;  3NMJ A;  5JP7 A;  1MQV A;  3FOO A;  3M4B A;  2BC5 A;  2YKZ A;  4CDV A; 
#chains in the Genus database with same CATH topology
 4C7O B;  1KU2 A;  2KQ9 A;  5L0H A;  1Q0G A;  2AWY A;  3C7J A;  2J46 A;  3JSE O;  3EHN A;  4JE9 A;  4N6H A;  4U5B E;  4DJ9 A;  2OQM A;  3GWN A;  3SXY A;  1V4A A;  3WOD F;  2J9V A;  1RKE B;  5AC4 A;  4JCZ A;  4AX2 A;  4A2N B;  1NG1 A;  2MWQ A;  2HZ8 A;  3SNH A;  1VLS A;  3JYH A;  2EPN A;  4IGG A;  3ABL C;  1YZC A;  4N06 A;  1TWG A;  4U9E A;  4K7B A;  4ULW A;  4W8K A;  4DVY P;  4GEH A;  4BEM J;  3EGD B;  1U0B B;  1HMD A;  5E3A A;  3DWW A;  2WZG A;  3HNK A;  4R32 A;  3RQG A;  4GQH A;  2HKV A;  1ST6 A;  2VC9 A;  256B A;  2X51 A;  3DD7 A;  4RBN A;  1TQG A;  1U6H A;  1YDI A;  1OKK A;  1SZI A;  2MHR A;  1A7D A;  2BE5 F;  3FXH A;  4QDL A;  4WAB A;  1Q0M A;  4G78 A;  2EPL X;  3G50 A;  2YLI A;  3LEV A;  3U3F A;  5A69 A;  2J45 A;  2PP4 A;  2NSG A;  1Z7Q c;  1Y4C A;  4MW8 A;  3F46 A;  3R2P A;  4IJJ A;  1VK5 A;  1M57 C;  4PK4 A;  1H7I A;  2V3C C;  2FGY A;  1HE1 A;  4XPY A;  4YT5 A;  3ZQV A;  4Q7C A;  5COG A;  1NSG B;  2NG1 A;  1TKN A;  1TFO B;  3U5S A;  1HMO A;  2YL0 A;  4MVQ A;  4PJJ A;  4KC9 A;  2CGE A;  1CGN A;  4CSA A;  3M4C A;  5TJ5 E;  4OIP F;  3MFN A;  3DI5 A;  2G62 A;  2XS8 A;  1TWA A;  2P0N A;  4RD9 A;  3V5Y A;  1E2X A;  1I5N A;  1LE2 A;  3HNL A;  4AL0 A;  3AG3 C;  2V26 A;  5L3V A;  4CS9 A;  1ZHY A;  2Y39 A;  4J7Y A;  1V74 B;  4A4A A;  2JD3 A;  2R7U A;  4MVR A;  3R7C A;  5BQH A;  3IEE A;  2WVO A;  1VLT A;  3AJM A;  2CYD A;  1YAR O;  2IM8 A;  4C7O A;  3Q6N A;  2OJQ A;  2EIN C;  3HJC A;  4CS9 C;  1ZZP A;  3K7D A;  5CI8 A;  3U3B A;  2R7S A;  2QTV A;  3K1H A;  2UUH A;  1B68 A;  1I4Z A;  1OCC C;  2W4M A;  2M64 A;  2PX3 A;  1T6U A;  1TWH A;  1JAF A;  2Y3H A;  4N4W A;  2HV6 A;  3DE9 A;  4U5D E;  4D4N A;  4LDK A;  5KYN A;  3S84 A;  4CSA C;  2YQY A;  5A6B D;  1IZM A;  4MW3 A;  3UR3 C;  3RH3 A;  4OIO F;  3GEH A;  3K1I A;  2A0U A;  2DB4 A;  2KC3 A;  1NZE A;  4YL3 A;  4EBB A;  1Z63 A;  2KNH A;  2R9R B;  4KNV A;  5E3C A;  1HW1 A;  3VRC A;  2KYH A;  2ZXP A;  1U89 A;  2DI3 A;  3WHN A;  3GM3 A;  2EIJ C;  3PDM P;  3C8G D;  2R7R A;  3W8H A;  4CX9 A;  5JSL A;  1BR4 A;  1K40 A;  3G4X A;  1YJG A;  1D0Z A;  4OD4 A;  2FFH A;  3AGU A;  3H2U A;  3SXZ A;  3NMK A;  3IQ5 A;  4CDY A;  3POV A;  1E83 A;  3GM1 A;  5KYW A;  3ZIB A;  4J32 B;  2YZS A;  4IAQ A;  1AEP A;  4J30 B;  3RVZ A;  3NYM A;  3HNI A;  3LUT B;  3KH2 A;  5AC5 A;  1EI7 A;  1VTM P;  3LNM B;  3EHM A;  5L0F A;  2LFD A;  2J8W A;  2PFD A;  3IHU A;  5F5F A;  2YWA A;  3MX3 A;  1OW7 A;  1JPJ A;  1S7Z A;  2G3V A;  1C03 A;  5B1B C;  3HKK A;  2XLM A;  2C04 A;  1AUE A;  1MMN A;  1CGO A;  4OIN F;  5DLJ A;  4C3D A;  2NUP B;  2W45 A;  3TOL A;  3S9O A;  1FNT c;  4J7T A;  5EK0 A;  4Z9I A;  3AGT A;  1MQV A;  3DZA A;  3FOO A;  1O5H A;  1T9K A;  3VYW A;  3ECS A;  5D92 A;  2OOC A;  3PHF 2;  4EBJ A;  1YYX A;  4YK5 A;  1Z23 A;  1YYJ A;  2IXO A;  5JS5 A;  4O6M A;  3SP1 A;  2A69 F;  2LFF A;  3SYN A;  3GOD A;  3TK0 A;  5T1D B;  1UG7 A;  4G7Z F;  1QZX A;  3QZC A;  5B3S C;  3QVY A;  3EFO A;  1H9T A;  2RD9 A;  4G7O F;  2P61 A;  3OWT A;  4IAR A;  1NBB A;  2XLH A;  3DM5 A;  3L1M A;  4JKV A;  4NC3 A;  4O7G A;  3SEO A;  4C3E A;  3B29 A;  1IW7 F;  2PNO A;  4KNW A;  2DYS C;  3NG1 A;  3VF0 A;  2KW3 C;  2XM4 A;  4I3M A;  4DXW A;  2EIM C;  1LM3 B;  2ZD9 A;  1O3U A;  2ZXO A;  1RCP A;  4E7Z A;  2XXA A;  1ORY A;  4BJ1 A;  4Z9J A;  2JPU A;  2KK1 A;  2D4U A;  2OJE D;  3K33 A;  2EIL C;  1RJ9 B;  3LES A;  1BR1 A;  3BRJ A;  4CDA A;  2XL4 A;  3EGX A;  2ZXW C;  3V7O A;  3UGO A;  3U8V A;  3GEI A;  2CW0 F;  4LDR A;  3CZ6 A;  1OW6 A;  1OCO C;  3RFY A;  3U9M A;  4BJ5 C;  1CPQ A;  3JYY A;  2J7P D;  5CIV A;  3RQF A;  2L81 A;  1OR3 A;  1LI7 A;  2A68 F;  3N0T A;  3ZVR A;  3Q7L A;  3NRH A;  2YEV A;  4PAC A;  3AQC A;  4IAO A;  4E0I A;  2VH3 A;  1V55 C;  4YL1 A;  5F5H A;  3J06 A;  3FMS A;  1OW8 A;  1G5Z A;  4JC7 A;  5JRA A;  4U5G A;  1T6I A;  5JLI A;  4XEF A;  2GAQ A;  4H54 A;  4IWB A;  4AL1 A;  1D0X A;  1FFH A;  1C17 M;  3ZTZ A;  1MND A;  3RIP A;  5A6K A;  4I1O B;  2ETS A;  2HUJ A;  1MNE A;  2QLA A;  3DMD A;  2A6E F;  3EH2 A;  2IXN A;  5HV9 A;  2PF4 E;  2BL2 A;  5E33 A;  1M2V A;  2PX0 A;  3C62 A;  4XTK A;  4G7H F;  2HJM A;  1YVI A;  1ORS C;  2Q3T A;  4LER A;  3IPM O;  5EHH A;  3AG1 C;  3CEX A;  3AQB A;  4U5F E;  2TMV P;  2H7V C;  1WWP A;  1RJ9 A;  2QNL A;  1Z6A A;  3GM2 A;  3EFO B;  1LS1 A;  1O87 A;  1T6Q A;  3FAJ A;  3W2W A;  5KYW B;  3FOP A;  4G0H A;  3DXJ F;  2XXA B;  1LS4 A;  3DJN B;  3EQL F;  4NTA A;  2NUP A;  1ZU5 A;  2AU5 A;  1FAP B;  5E2Q A;  1Q0F A;  3N2Z B;  3OEO A;  3ABK C;  4E7S A;  2NUT A;  2DGJ A;  2VAS A;  2UUI A;  2HMQ A;  3EGX B;  3E70 C;  2Q4F A;  2OKU A;  2WZL A;  2L6H A;  1YA9 A;  3GEE A;  3JT1 A;  3OA1 A;  4YL0 A;  3ZC4 A;  5DQT A;  3ZDL A;  2ASR A;  2XLD A;  3PMR A;  3QW1 A;  3KKB A;  1A0B A;  3T6G B;  4UDV A;  2EIK C;  3C63 A;  3CSK A;  1D1A A;  4MVM A;  3ZQY A;  3GOR A;  3B0V C;  5F28 E;  3QTH A;  5L0I A;  2Q00 A;  2R7W A;  4ONS A;  2MYS A;  1PD0 A;  2R7T A;  3SXK A;  4LAC B;  2R7V A;  1Y6D A;  1N1C A;  3FHD A;  2F22 A;  4RDA A;  3RW0 A;  5EGY A;  5FCL A;  3NYL A;  3RVY A;  4C3B A;  1BZ4 A;  1XZQ A;  3EGD A;  3S28 A;  3U2M A;  4DOZ A;  1AVO B;  2YHS A;  4PJL A;  2HFI A;  3B71 A;  2RSE B;  1OR2 A;  4NY3 A;  4QI2 A;  2AWC A;  3M4B A;  2LQG A;  4MVZ A;  3U9J A;  3I4U A;  3Q6M A;  4YN0 B;  4DRH B;  4MTG A;  4U5H A;  2Y3B A;  4CS8 A;  2LSE A;  2IOQ A;  1CPR A;  4JJF A;  2AP3 A;  1OQC A;  3LJB A;  1QLE C;  2HJ3 A;  3DE8 A;  4DRJ B;  1JPN A;  3B9Q A;  3LLK A;  3NYJ A;  3U2L A;  3RQE A;  4IRU A;  2J0W A;  3L8J A;  4BEJ A;  4E18 A;  2QY9 A;  4ZLC A;  5KYU B;  1G8X A;  2CCY A;  3DM9 B;  3KMI A;  4YJW A;  5AGF A;  4JEA A;  1H6G A;  3TJ5 A;  1EKY A;  4JTA B;  4IB4 A;  4LLC A;  3M79 A;  3TOM A;  5T3W A;  2Q9A A;  3CQZ A;  5CI9 A;  4BJ5 A;  3K66 A;  2HS5 A;  2XLW A;  3LAY A;  3A11 A;  3H2V A;  4O79 A;  2J9U A;  2J9W A;  5COF A;  5KYY B;  1E86 A;  4JIO A;  3QMK A;  2ZXR A;  4PR9 A;  3US6 A;  2Y69 C;  4JUR I;  3S29 A;  2AVK A;  2P7V A;  2XL6 A;  3DAG A;  3EPV A;  1XZP A;  3CAX A;  3ATP A;  4K1O A;  1NFO A;  3G4Z A;  4ER9 A;  5JVE A;  3UGP A;  2EPK X;  2NUT B;  4YT4 A;  2YL3 A;  3SXM A;  1TWC A;  2HSQ A;  2E87 A;  2J7P A;  2YL7 A;  3AG4 C;  2B0J A;  3WAQ A;  1I4Y A;  2W4B A;  2G3K A;  1J8M F;  3E9V A;  1H9G A;  3ASN C;  3FAP B;  1VB5 A;  2GA0 A;  3FVY A;  2R03 A;  4U9D A;  1NLX A;  2Z15 A;  1C02 A;  3UMK A;  5BQI A;  3N24 A;  3S90 A;  3T4R A;  1T5O A;  3IQ6 A;  4HFK B;  4L6R A;  4JTC B;  3V5X A;  2GFH A;  2Y3G A;  1PD1 A;  2XLE A;  5A6J A;  1GM5 A;  1WAS A;  2EPO A;  2J9B A;  2O9X A;  2W9Y A;  4WGZ A;  4NQF A;  4AK9 A;  4HEA J;  1K04 A;  2PBE A;  5KYX B;  4U5C E;  3JTL O;  4O6Y A;  4BPM A;  2WL8 A;  1ZHX A;  1UFB A;  1WOL A;  2YLG A;  1FR0 A;  1SYQ A;  5L3Q A;  1A7V A;  2CNW D;  3QW0 A;  4XPX A;  4DRI B;  3LNR A;  2J0X A;  4CJG A;  4XEK A;  3MBG A;  2WB7 A;  4P9F A;  4PFO A;  1OCZ C;  3C8G A;  1F1M A;  3EJN A;  2OEX A;  4E17 A;  1WGW A;  1E84 A;  3TD7 A;  3KL4 A;  3HNJ A;  1JR8 A;  1Q0D A;  3H65 A;  1TR2 A;  3GWL A;  4WGY A;  1APC A;  3NMI A;  1ZHW A;  2GDC A;  5L0C A;  2LD6 A;  4FWV A;  2IXM A;  3PCV A;  4CJO A;  2JX0 A;  2OU6 A;  3L8I A;  4OIQ F;  4JTD B;  1HW2 A;  1MMD A;  1L7C A;  2A0B A;  3T6J A;  1J8Y F;  4JZA A;  2LK4 A;  2WZF A;  2R7X A;  3JSZ A;  5KYY A;  1BBH A;  1GS9 A;  2YVK A;  3IQT A;  5B1A C;  3L0I A;  4XLN F;  1JOG A;  1VYI A;  4JW1 A;  4YT2 A;  2R02 A;  2L6F A;  4OIR F;  3UNG C;  4B6I A;  1MMG A;  1QQ3 A;  3GAN A;  5JUA A;  5K0I A;  3TUL A;  1OCR C;  2HSB A;  3O55 A;  4F4B A;  4CIP A;  1Q0K A;  5DVW A;  1TFK B;  3JRM O;  3ASO C;  2A1D D;  4HE8 D;  3EZH A;  4PJM A;  1EQ1 A;  1ZU4 A;  2L7A A;  1M2O A;  2XM0 A;  2WVQ A;  3JZ0 A;  2XRH A;  4LDQ A;  4MVO A;  2VB6 A;  2ZPA A;  1KNY A;  1LIH A;  4FX5 A;  1M2V B;  5KYX A;  3ZWI A;  3O10 A;  4GYT A;  1VMA A;  3UMI A;  4YWQ A;  3EG9 B;  2H8A A;  4HFF B;  1GQA A;  2EPM X;  5T3T A;  3K6B A;  1VOM A;  2X0C A;  4MVS A;  4CS7 A;  3L34 A;  3QVZ A;  4CS8 C;  4Z9H A;  5IY5 C;  1T01 A;  5DS5 A;  3O6X A;  4XQ1 A;  1YLM A;  2Q9C A;  3UMH A;  1OKK D;  1HY5 A;  3C8Z A;  4XLP F;  4I1M A;  2BC5 A;  4WJ0 A;  3LEO A;  4JJG A;  1SMY F;  1HE9 A;  3ZG1 A;  1WN0 A;  2A6H F;  3B0U X;  2VCA A;  3HLZ A;  4CIH A;  2P1A A;  1VYK A;  5BQG A;  2YL1 A;  3B0P A;  3C18 A;  4MVU A;  4ANJ A;  4MS2 A;  1PV3 A;  2QE9 A;  1FMV A;  1Z5Z A;  5HSW A;  3MYI A;  3RKO F;  1R5I D;  3M15 A;  3VM6 A;  2XLO A;  5B3I A;  2Q7R A;  3NDB B;  4PFP A;  4O6N A;  4MQ9 F;  3NKE A;  3KPH A;  2YRF A;  4JEB A;  1QSP A;  1YAU O;  5DS6 A;  3FDQ A;  2NPU A;  4EIY A;  4XEV A;  4XPW A;  4U5E E;  1ZW2 A;  2R25 A;  4AE4 B;  1ORJ A;  4P6I C;  3LS1 A;  2R7Q A;  3DKA A;  1PCX A;  3S27 A;  1D1C A;  5L0G A;  1RKE A;  2H7O A;  2LCH A;  1FFT C;  1LPE A;  1ZYR F;  2XLV A;  3X1O A;  4CBE A;  4DVZ A;  2KSF A;  3W4Y A;  3X2Q C;  1GGQ A;  3ABM C;  4KI2 A;  1D0Y A;  4ZLD A;  1XWJ A;  2L6G A;  3KYI A;  4M63 A;  4N6C A;  4QI0 A;  1RMV A;  2CNW A;  1WAT A;  4NTF A;  1OXK A;  1ZHZ A;  3MLG A;  3SZR A;  2VCC A;  3TQO A;  2C03 A;  1V54 C;  5A6B A;  5FZT A;  3ITF A;  2XSE A;  2OEV A;  5L0D A;  1WTY A;  1FMW A;  3F47 A;  3RYL A;  1ZVZ A;  3JRT A;  1OXB A;  3JCU Q;  1G4W R;  1NFN A;  1EA8 A;  3IQC A;  2QUP A;  1LE4 A;  1QKR A;  2HMZ A;  4I44 A;  4K0D A;  3T6B A;  3ZSU A;  5BUO A;  4BJ6 A;  1NU9 C;  2GWW A;  2NSF A;  2R05 A;  4Q5S F;  2P6V A;  5GPG B;  1BR2 A;  3TJ6 A;  4EHP A;  1DOV A;  2HV7 A;  3WG7 C;  5A6A A;  1R4T A;  3M1C B;  2B0H A;  3NKD A;  4P9T A;  3RF3 A;  1LI5 A;  3HTK C;  5D91 A;  2Q9B A;  3VAY A;  4EBK A;  3AOU A;  1M6T A;  4FES A;  4YT8 A;  2VCB A;  3LLI A;  1K05 A;  3V5Z A;  1NU7 D;  1ZW3 A;  4ULV A;  1JRA A;  4LLE A;  5COM A;  1M56 C;  1DOW A;  1A41 A;  4EKW A;  2XS1 A;  3DJU B;  4NCQ A;  5DS4 A;  1QVX A;  4H4K C;  1MMA A;  4BG0 A;  1G4U S;  3T9O A;  4D4X A;  1A7E A;  1BDJ B;  1SR2 A;  2H7B A;  3LS0 A;  4JVS A;  3EG9 A;  3EZI A;  4JRZ A;  4W8P A;  4AE4 A;  3AG2 C;  3O39 A;  1E85 A;  3BEH A;  1SF8 A;  1LKX A;  2LIG A;  3W8I A;  2YLD A;  3A9C A;  4MTF A;  3DAF A;  2I8B A;  1ZHT A;  2R7O A;  1RXQ A;  1W2W A;  2OCC C;  3EH1 A;  2DYR C;  4MTO A;  3U8P A;  4Q4Z F;  3KYJ A;  4PJN A;  1JMW A;  3Q7G A;  5L0J A;  3U0C A;  2WVN A;  5DQZ A;  4EUK B;  4OD5 A;  3MYF A;  1YZA A;  4E0H A;  1L3P A;  2D5R B;  4DBQ A;  4JCH A;  5KYU A;  2L9J A;  3K1I C;  1QPU A;  2CDQ A;  1KTM A;  2LP4 A;  4NTB A;  4BJT A;  1CGM E;  2ICW G;  2IXP A;  3C8G B;  1D1B A;  5JT4 A;  1S05 A;  4MND A;  4DBR A;  2KGO A;  2IBF A;  2KJG A;  2XL8 A;  2Y3D A;  4KBL A;  1Z3I X;  3W2V A;  3ZTM A;  3NMJ A;  4XWJ A;  5JP7 A;  1RKC A;  2FAP B;  4BJ6 C;  1FTS A;  4EWC A;  3I5Q A;  3S0X A;  2IYL D;  2M4E A;  3I5P A;  2OG2 A;  2YKZ A;  4X0R A;  1YA7 O;  1LVK A;  4FAP B;  4CDV A;  2I15 A; 
#chains in the Genus database with same CATH homology
 1CPR A;  1YYX A;  1YYJ A;  5JS5 A;  3DE8 A;  4JE9 A;  4N6H A;  2YL1 A;  2CCY A;  3QVY A;  5AGF A;  4JEA A;  1EKY A;  3M15 A;  2XLO A;  4IAR A;  3M79 A;  4IB4 A;  1NBB A;  2XLH A;  3L1M A;  4JKV A;  4NC3 A;  3TOM A;  1YZC A;  4U9E A;  2XLW A;  2XM4 A;  4JEB A;  1LM3 B;  1E86 A;  1RCP A;  4EIY A;  3HNK A;  2XL6 A;  4ER9 A;  256B A;  5JVE A;  4CDA A;  2YL3 A;  2XLV A;  2YL7 A;  2YLI A;  1CPQ A;  4U9D A;  3ZQV A;  3IQ6 A;  4L6R A;  2XLE A;  2YL0 A;  2J9B A;  1CGN A;  3M4C A;  4WGZ A;  3HNL A;  5JLI A;  2YLG A;  3ZTZ A;  1A7V A;  3QW0 A;  2QLA A;  4CJG A;  3C62 A;  1E84 A;  4N4W A;  1JAF A;  3HNJ A;  4D4N A;  3DE9 A;  1M6T A;  4WGY A;  1APC A;  3NMI A;  4ULV A;  4CJO A;  3FOP A;  3VRC A;  4D4X A;  1E85 A;  1BBH A;  4CX9 A;  5JSL A;  2YLD A;  3U8P A;  3NMK A;  3IQ5 A;  4CDY A;  1QQ3 A;  5JUA A;  1E83 A;  4CIP A;  2XLD A;  3QW1 A;  4IAQ A;  1YZA A;  3HNI A;  3C63 A;  3ZQY A;  2XM0 A;  1QPU A;  2J8W A;  5B3I A;  2XLM A;  3ZWI A;  5JT4 A;  1S05 A;  1CGO A;  1GQA A;  3TOL A;  5JRA A;  3QVZ A;  2XL8 A;  3ZTM A;  3NMJ A;  5JP7 A;  1MQV A;  3FOO A;  3M4B A;  2BC5 A;  2YKZ A;  4CDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...