4CDFC

Human dpp1 in complex with (2s,4s)-n-((1s)-1-cyano-2-(4-(4- cyanophenyl)phenyl)ethyl)-4-hydroxy-piperidine-2-carboxamide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
total genus 7
structure length 68
sequence length 68
chains with identical sequence F
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4cdfC00
4CDFC 4OEMB 2DJFC 4CDCC 4OELB 1ICFB 4CDEC 1K3BC 4CDDC 2DJGC 1MHWC
chains in the Genus database with same CATH superfamily
2F0UA 2L12A 5EKIA 1VQEA 2BH2A 4FVMA 4J15A 1X9NA 2HT1A 3KOJA 1HNZQ 4HR7B 5ISRA 1R9TH 2Q2HA 1F9SA 2L15A 5FLXE 4DK1A 4C3IB 3K7AB 1VQLA 3S2DH 1E22A 1GXDC 3SDZA 2LXJA 1GJXA 4OX9Q 4C2MH 4QUCA 2PMZE 1KD1C 1HQRD 1QZGA 2JA7B 5CV9A 4K8JA 4GKKQ 2OQKA 1PRTB 2RHSB 3I73A 3AU7A 3RLFA 3NQTA 2JA6B 1SE2A 1PH9A 4YY3L 4A3CH 3VR3A 3EA6A 1LT5D 3D4DA 3EROA 1ESRA 4GZYC 5IP9G 4DR3L 1GD7A 3PMFA 4UPAA 4B9XA 1HNXL 1S5ED 4XT3B 3A5UA 2QILA 4DUYL 3BZDB 1CM9A 2UUCQ 2F0PA 1D5MC 2MQHA 4OXPA 3S1RB 3CHBD 4KY6A 2E2JH 4QIWB 5KGUA 5I6WA 5GQOA 5IYCG 1DOKA 4JI6L 1G6ZA 4DR6Q 3G71A 2M2LA 2B63B 1CHQD 5KYIA 3PSIA 1Z7TA 1C48A 3I8ZA 4HJAA 1SSOA 1SFOH 3PIO3 4R4OA 1PLFA 2MPMA 3TDQA 3H0GG 1UAPA 1YNJD 2UU9Q 1TKWB 2DNCA 5DM63 5IYDG 4FP5D 4WRDA 3PIP3 1F9RA 5M5XB 2BH8A 4IOCA 1PRTD 5L37A 5IIFA 1SAPA 4A3MH 4A3EG 3PF5A 3KDFA 2WACA 3FPPA 1KL9A 1XXGA 2XRSD 5A2QL 1SJHD 1QWYA 5IODA 4C3JB 2JN4A 2B2YA 1JB7A 2MHVA 4GNXB 1BBXC 3KJOA 4TKOB 2PPBC 1LT6D 2OQ0A 2N49A 3I70A 5KNDA 2A6HD 4JI4Q 2MFIA 3GTOB 1YIJA 1C4QA 4JI5L 4A3MG 4ME3A 1O7IA 4LF4L 4X66L 4FO2A 2L5TA 1NNXA 3C1FA 3GTMB 5IT9E 2EY1A 2F0EA 1LACA 4I7AA 4IZ8A 2IT1A 2HHHL 3VYTA 2MNAA 4KHZA 1UE1A 2CVRA 3EFXD 3S1RH 2KCNA 1TY2A 3H0GB 4JYAQ 3UE1A 1RF2D 4RHSA 5FJ8H 3GTOH 2E76C 2CQAA 1SLJA 1VQAA 3IL8A 4NP5A 3W1GA 5C4HA 1JJGA 2ZJQA 4JV5L 4X65Q 3H91A 3S1NH 2B2TC 2PI2E 3AYHB 2ZTDA 1EZ6A 2J4XA 2Z4HA 2RSOA 4K5XA 4LFAQ 4A3EH 3RLOA 1LT4D 4U673 4K0KQ 2R92B 4NXMQ 2K75A 3DXJC 3D8GA 5AJ3L 3M7NA 3WDNA 5GROA 1I4HA 4LF5Q 3CRKC 5GAEC 3STBD 4LFBQ 2HCCA 1BBWA 2PW5A 5COYA 1AW7A 1K83B 4PNYA 1JR0D 3NQIA 2O5JC 1XX8A 4DNTB 1QUQA 5K5PA 4K2KA 4DU9A 3OYYA 3CKIB 2XGTA 1E2VA 1HRJA 1WCMB 4L8JA 5FOBB 2XRQD 4EQPA 1EY8A 1PTOB 4JOIA 1SR3A 1JB3A 5IWAL 1RKNA 1D1KA 4DAPA 1UNSA 1YJNA 2Z6KA 4CGYB 1EUJA 4TSSA 3GTMH 4KY7A 3GTLB 1YBYA 1WJJA 1T5XD 5FO7B 3GTQH 1Z47A 4IO9A 4A93G 3PGZA 1FD7D 3HOZH 1EYCA 3PO2H 1GO3E 5AFWA 2F52A 1W6KA 1CA6A 4OO1I 1C9OA 2LS01 3P20A 4XIGS 2BE5C 1ASZA 3W2DA 2XIWA 2NVQH 1IYVA 3ULLA 4LW1A 1X6OA 4QQBX 3TMEA 2N8NA 2E8GA 3I56A 4LK1C 1W2BA 4LFBL 1R4PB 3BDOA 3RN2A 1W3SA 1B9NA 2B39A 1R4QB 4LFCQ 3NHHA 1JC7A 3FKIG 1XMOL 1TR5A 2E2DC 1RDPD 1LTSD 4R8NA 4JI1Q 4A3EB 2K52A 1KDBA 2F3WA 2D62A 3CCUA 2ZXRA 4NKLA 2KA7A 2NUCA 3RN5A 3SK4A 3PO3B 2R93G 4KI0A 3KF6A 4ME5A 1QVFA 4U68A 3J80c 1X3PA 3QG1A 3PCOB 1Q86C 1EY5A 1D7QA 1F9PA 4A3BG 4A3GG 3CCQA 1K8AC 1TS3A 3BZKA 3E9HA 3KDFB 4C3HB 3K59A 1IXRA 4V0BA 3I7FA 4JYAL 5BR8L 4IPHA 2VL6A 2NVYH 4BY1H 4JPBW 5EPLA 3VA5A 3DWQA 4GS3A 4PV1C 1GHKA 4WORA 5CC4A 1KAWA 1YI2A 3HOWB 2DJGC 4GNXC 3GV3A 1I4GA 2FMCA 5IGCA 3GTKH 3HZXA 1HQMC 1S4ZA 1B50A 3FVQA 1XPRA 2G5DA 4X62Q 1KNAA 2V1CC 3I90A 3J80E 2FHTA 2RKSA 4N9TA 5M9OA 1KIXA 4DR7Q 4DV3Q 4KHVA 5C5LA 2EYMA 2JA5H 3D31A 4B3TQ 2DN8A 2K14A 2ZXPA 3MXUA 3VYUA 4APVA 2I5LX 1L1OB 2VQFL 2EJFC 1SNCA 3M4OH 4HIMA 3OW2A 1QG7A 1CKOA 2IJ0A 5JJIA 4LUOA 4P73A 2AQ3B 3G6EA 2L55A 4LF6L 1N9WA 4H02A 3Q8DA 1VQFA 3CQZB 4B3RQ 2OEOA 4B3ML 5M3MG 5EKKA 1IBLL 1SNOA 2VB2X 4KN4C 4AQYL 3K6OA 3Q6SA 2EZVA 1PH6A 2FFKB 3FMCA 3I4OA 1PMRA 2XNAC 2J7ZA 1F2ZA 2RCNA 3J7AV 3VYSA 3M4OB 1WVLA 4GLVB 1J8IA 2GA4B 4B3TL 1LTLA 1G91A 1HZ9A 3ULPA 2VXWA 3EQLC 3BDLA 4IJHA 2H1EA 2AKWB 4BXXG 1QVCA 2QGQA 1VQ8A 1AZQA 5ELCA 4PZ7A 4OWWB 3K5LA 4KKTA 3Q23A 4GKJL 3K0XA 5G3LF 4KHPQ 3IFDA 4CJ2C 1HNXQ 2Z0SA 2WFWA 5C4XB 1G51A 1L2FA 5D3IB 1WYDA 4BA2I 1JQYD 4IQZA 2AQ2B 2PQAA 4C1NI 1A0IA 4DV7Q 3FDTA 4DV5Q 3D4WA 5LMNW 1PVOA 1G6PA 3A7AB 4K14A 3TN2A 5LL6S 4DXFA 1TU2B 1IBML 3FP9A 1B3QA 4YY3Q 4DV6L 2EIFA 1FNUA 2WAQE 2O4XA 4A3MB 1PZID 2JA8G 3S16H 1VCIA 1X3EA 3OMCA 2JE6I 1IYJB 4LF7L 1DOMA 4BXXH 3UI2A 4ZKCB 1BR9A 1H9SA 2OTJA 3A5ZB 2SOBA 2K5HA 1BDOA 1A63A 3MEFA 4OONA 1NAPA 2L1BA 4JCVE 4GLAC 1RTOA 3KLSA 4HMJA 5C0XI 4J6HA 3DHQA 3AEVA 2UUBQ 3NBHB 2E2IH 5C0XH 4KJNA 1ONLA 1PFSA 3K0YA 3D6WA 4OIKA 2DNEA 1S3OA 3NP8A 1NR4A 1HR0L 1E3PA 3CRLC 2JA8H 5IYDH 1EYAA 1QE6A 2M00A 2KHIA 4C56C 3HS0C 1K8MA 2UXBL 2F0DA 1N33L 5J3BA 4OO1H 1XMOQ 1FNVA 1ENCA 1I4QA 3T1YL 5JJLA 1G2TA 4K6LA 3CU7A 2I5MX 3S15B 3HOUB 1I3QB 2KENA 3ERQA 2E2HH 4YHHL 3CCEA 3ZYYX 1MHWC 3OHXC 1BXTA 4GLXA 1STYA 4DPGA 1EOTA 1ET9A 1FGUA 5IYCH 1HCZA 2AUJD 4LMQD 5I6YA 2A8VA 4BBRH 4IUNA 1RD9D 3PO3G 4PG3A 3VYRA 3F2DA 1PH1A 2VW9A 1PTOD 2CHBD 4QJFA 1N32L 5CV8A 2C5CA 1CKMA 3L0OA 3TP8A 4LF8Q 4NDXA 3E6ZX 2WB1G 5G3LD 2OTLA 5C3XA 2DJFC 3K81C 1JE5A 4C1NK 2RA4A 4UY8C 5DNFA 3I4NG 4A3LH 2Z8LA 2NZOA 5C4JH 2VB3X 1H9SB 5A35A 2NVTH 2A6EC 2MGSA 2F0SA 3RZOH 1EY4A 2IPKD 1M90C 3KF8A 1IKLA 1H9KA 4DXGA 3HEJA 5C0XG 4RCOA 1NTGA 5ELEA 2K32A 4UHVA 2D0OA 3K5OA 1SMYD 1SE3A 2DY7A 1DYQA 2KJXA 4ZYSA 4YCUA 3V2TA 1VQJA 1D2BA 3BJUA 4L5QA 3DWPA 3DEOA 2G9HD 1TVXA 3E0JA 4LNQA 3HKSA 3DUZA 2IX1A 2IWHA 4LUVA 1KC8C 2HCIA 4DV7L 5DEHA 1H9JA 1T5EA 3VR5A 1XPOA 2NN6I 4F87A 2EYJA 5CR3A 4HSVA 4BS9A 2YTYA 2VQEQ 2A6HC 5HGQA 2NVXB 4NB3A 3MAQA 1HA5A 1Y14B 2LY7A 1HTLD 1VQCA 1WTQA 1JE4A 3CAMA 1CUKA 2QDBA 1IW7C 3LGJA 3H15A 4RFBA 1Y1VG 3H3VI 3JAME 4XYOA 5E4XA 2WKDA 5NUCA 3DWAA 3G48A 3T1HL 1VMCA 3D3RA 1BF4A 1EY0A 4H0LC 1ET6A 2ES2A 1GKHA 2NBFA 2MP1A 4IUVA 4ZUIA 4A3LG 4O2DA 2KCTA 3GQBA 4DR5Q 4HJ8A 2VS1A 3NTIA 4C3IG 3BS1A 1B70B 3CPFA 4I7ZC 1HZCA 1XNQQ 4MTKA 1WTVA 4DAMA 3Q24A 1SEBD 1JMCA 2EYLA 5GAGC 4JI4L 1Y1WG 1VDZA 1I94Q 2CFMA 5I2XA 3TQYA 4WJ3M 4JOIC 2LXKA 3K57A 2XSCA 3U9SA 1PYWD 3GTJB 3S24A 1D8LA 1STNA 4A3JB 3U4VA 2LKVA 3GTPB 3M4YA 1EQTA 5JPNC 4POGA 1Q8IA 3PO2G 2LFNA 4IN3A 2Y0SB 4ODGA 1Y8OB 2F3VA 2AQ1B 1FL0A 2L0CA 3GP7A 4H44C 1K0SA 1YVCA 4B3SQ 5IOCA 4GN5A 1HNWQ 3X3MA 1YNJC 3Q0AA 2UU9L 3S17B 2EYPA 3W1BA 1TWAB 1I4PA 2AHOB 2JP1A 5I2YA 4R1JA 1I50B 4DR5L 4HIOA 1C0AA 1R9TB 3JC66 2KUMA 4X3UA 5BN5A 3OTOQ 4KD3A 5KIXA 1NSNS 3HOXH 4G4KA 2X6LA 1AE2A 2R93B 4A3BB 1Q1EA 2JA5B 2F0MA 5FKAC 2ICIA 2ASBA 3I4MH 1D5ZC 3U50C 3M3YH 1OXUA 1VQIA 4X3SA 1KQSA 3QIAA 2SEBD 1HUMA 3F8TA 2HIVA 1PTOH 1PRTC 1WCMG 1I6HB 1X32A 4BA1I 1BBUA 2XN9C 2F0OA 4KLKA 1X54A 4RKLA 1TWCB 1EWCA 3MVVA 4QL5A 5CV5A 3KUPA 4DK6C 2VZAA 3UDFA 1A2TA 1NMGA 3JAML 5EGTA 4RH6A 1Y8PB 3HOXG 1SMXA 1PDQA 5J39A 3GV6A 3S1NB 4M8AA 3OOCA 1PH3A 3ZJYC 5FO8B 4P72A 2Q8IB 3HOZB 2LSSA 4LJZC 5E4WC 2B2UA 3EJIA 2L11A 1LO5D 5HGTA 3HOYB 4JI0Q 3M9BA 2ZM6L 2YTXA 3KK7A 3NSWA 5FO9B 5KEEA 3WWVA 2B63G 3OMGA 3KF6B 1I4RA 3VR2A 1EFID 1OO9B 1PHJA 4A3DG 1SE4A 4A3GH 1GUSA 3RZDH 3P7JA 1VS0A 3D6CA 2F0GA 2FJ2A 4GNXA 4RMFA 3D4RA 1SYCA 4KD4A 1HFGA 2ZXOA 4BBSH 1IBMQ 1XPUA 5M5YB 1K3RA 3HOYG 2RBMA 2NTTA 3VA7A 2B2TA 5IGBA 3BVMA 4G7HC 3RD4A 3PV0A 1YJ9A 3I3CA 2ZJRA 4DV2Q 3W3AA 5C0XJ 1N32Q 3U58A 3I4MG 3S14B 3QOLA 2CW0D 1HTPA 1PFMA 1STGA 4DV4L 2I0QA 3GTQB 5IWAQ 2XWBB 1LTRD 3L9AX 1MSGA 1GUWA 1G8ZD 4L5TA 3G7LA 4JBJA 2QDLA 2WB1B 3N6RA 2G9DA 1VQBA 1C8CA 1WFQA 2JQOA 4OWXB 1UEAB 2QKIC 4TVAB 5EJWA 4DR1L 4AQYQ 1JJCB 3M7GA 4PMBA 4IUUA 1PA6A 1HNWL 4B3MQ 3C3LA 3JAMi 3HP3A 1HH2P 2RVLA 4NXML 2K50A 4QF4A 1ZEQX 1GVPA 3A7LA 4LF6Q 2VUMB 1QB5D 2N3SA 3J80L 4N8X1 4A75A 1S5BD 2F0JA 4ID6A 4XDXA 2IX0A 4P75A 4HCSA 5M3FH 3UDIA 2XWJB 3R93A 1WI5A 4QB4A 1SNDA 1C7YA 4KJOA 1U5KA 3PQIA 3GDEA 5HURA 4DV3L 2ZTCA 2A69C 1BCPF 2EY5A 1DD2A 4E6IA 4L63B 4GOPB 4LF7Q 4JBKA 1MJCA 2BOSA 1SDFA 4DN4M 1SROA 1EEID 2JEBI 3MTSA 4OO1G 1IHZA 5BN4A 1KLGD 3OWEB 2PCFB 1V9PA 3MHBA 2Q2IA 1TIID 2F1MA 2R61A 5JJKA 4PZ8A 3R2IA 3V96A 1IZ6A 3SE0A 1EYGA 4A76A 4LF4Q 2ALYB 3S2HB 1CT1D 2L4NA 5CYUA 2NVQB 3S1QH 5EKLA 3ER0A 4CJ1B 1ASYA 3K5MA 1QVGA 2VQEL 1I6HH 2WB1E 1YHAA 3A54A 4FF4A 2B2VC 2KHSA 1I4XA 2H5XA 1HHVA 1O7ZA 2KBNA 1AH9A 3K8AA 3A55A 2E5LQ 1B1ZA 1SFOB 5JPMC 1OXSC 3EIVA 1NBWA 1BUVT 4XYQA 3KYHC 1F77A 5IP9H 2X6GA 4YWKA 4ZK9B 4OL7A 3L3OC 4IALA 1JWSD 3AQQA 3PO3H 2NVTB 4J1MA 4DR1Q 4CKCA 3CPWA 1KLUD 1E7ZA 4IPCA 2R7FA 2YV5A 4KK7A 2RF4A 4MIUA 2OWOA 1U9RA 2K7VA 2EXDA 2RQXA 3M4QA 1LTID 1TS5A 3ITPA 3RZDB 1H9MA 2F0WA 2K5QA 2PNRC 3H6MA 1BKBA 4GOPA 2Q2TA 3HOVB 2JA7G 1JICA 3HKZG 1SJED 2JA9A 4RGOS 1HR0W 4PMWA 4FXKC 2HIXA 2D5DA 3IFTA 5EQ0A 4JI2L 1E2ZA 2B2YC 3NPPA 1K0RA 2QEJC 3MFYA 3CF5A 3TRZA 1SYFA 1SYBA 3EBEA 2PZUA 2N55A 4BY1G 2K01A 2JSOA 3J7YW 1W6JA 1MJEA 2NTSA 4KN7C 1B44D 2D0PA 3H3VC 4IUTA 3KBGA 1Z6HA 3WOEA 1U4PA 1KDCA 1ENAA 1Q90A 2N88A 1EY9A 2FXQA 4KY5A 5BN3A 2NVXH 1KRTA 2IHFA 4Y7NH 1EIFA 4ALPA 3A8KE 3OWFA 1CK1A 3CCSA 2EJGC 1NCVA 2JK8A 2MJ8A 5LHY1 1ZYRC 2EYFA 3TS0A 4YHHQ 4HJ7A 1VMPA 1Q7YC 2JA5G 3TREA 1V1PA 3S2DB 4EQ5A 1FNWA 3FPUB 3R2TA 2CW0C 1U4MA 1STEA 5EPJA 1HNZL 1VQ7A 5E3FA 1LTBD 1SNMA 3CQZH 2UXBQ 1KTKA 2R7ZG 2QW7A 1AE3A 1CQFA 3CMAA 2JA6H 3GO5A 2EDGA 1QNKA 3W5OA 5M3MB 4MNOA 4FF2A 3R8BA 1N8RC 5C4JB 5CV6A 2UXDL 1EYDA 2UUAQ 1OXVA 2K6AA 1I50H 1P8LA 2MO0A 1JWMD 4X65L 4Y52H 5KNCA 3WOFA 4R8IA 3TBIB 4UP8A 2IHEA 2ENBA 4JVZA 4GN3B 3T51B 4HIKA 1TWFH 2F0QA 1STHA 5IT9L 1UE5A 5H1SE 1RIPA 1WTXA 2BA1A 2OT2A 3BG3A 5JAVA 2NYZD 3K7UC 2KCMA 3FKIB 4MZ9A 2SNMA 3ND9A 4YWLA 1TT2A 5IE8A 2BDNA 1B53A 3KLWA 2RDHA 2KEEA 3Q22A 2K28A 3K7AH 1TWAH 4GKJQ 1J6QA 1KHIA 1IL8A 1X3GA 4X66Q 3PUXA 4R4TA 1EWHA 1L0YB 1D5XC 1TWFB 2Z4IA 1NMFA 4JI2Q 1FJGL 1NY4A 4R9WA 4A3IB 4Q0FA 3EN2A 4A3BH 1A6XA 3J80i 5C44H 4XQJA 1Q81C 4AIMA 2R7ZB 1WOCA 1BVSA 3S1QB 1V1QA 1EQQA 3U4ZA 1TWHB 3AFPA 4C3HG 4HTHA 2R3ZA 3I2ZA 3BDCA 2Z9HA 3QWNA 4DV0L 1D6EC 4POFA 1XMQQ 2EYHA 5TSSA 2O2LD 4K6DA 5D65A 4DR2Q 4QGUA 2B29A 4LF5L 1GUTA 5EBCA 4IPGA 4Z9CB 1JOQA 2EXZA 1RODA 1PXUA 1B2TA 4F8MA 4A93B 1T9HA 4K0KL 3CXCA 4JK1C 1YHBA 1WCMH 2MO1A 4K2LA 1J9OA 3ICEA 1A15A 1FYCA 1LLRD 2PMZB 3S1MH 2MUYA 3T1HQ 3BU2A 1UE6A 3MEHA 4DR6L 1MIUA 4A3DH 3IAYA 3GTLH 3DLLA 4X64L 5IYBG 4IFDH 3QB3A 1CKNA 4YWMA 3PUZA 3E0EA 4FXGC 3H09A 5E7NA 2RCFA 3PUVA 1YJWA 1JOOA 2UUCL 1E24A 1EZ8A 1PV4A 1STAA 4R4CA 2OF1A 1EQRA 1P16A 1ZKOA 3DM3A 1TS2A 2HHHQ 2F4VL 1VQNA 2B2VA 1CTMA 2EE1A 4G7ZC 2B2WC 3SHLA 2A73B 3C46A 1EEFD 4A3DB 3HOWH 5LMNL 1SN8A 2CQOA 3HKZB 5LMUL 3TSSA 1DXMA 4BBSG 3QOJA 4ULLA 5C4ZA 3T53B 1MBYA 1HFNA 1F9QA 1DZ1A 1SMYC 1TQOA 4OX9L 4RGMA 4BBRB 1HPCA 3CMEA 2RSNA 5LMUQ 2A1AA 2F4IA 2FMMA 4HCEA 3UE0A 5T1GA 2YU9H 3OIPA 3RR5A 1GHJA 4G7OC 1LTGD 1EIHA 1CFMA 1HA6A 4ZAIA 3I72A 3RMHA 3J81c 2HQEA 2AUKA 3TEHB 1LT3D 3TP7A 3C1EA 4GOPC 3HFZB 3D0FA 2AWNA 1E1OA 4IPDA 2Y0SG 1QILA 4C2MB 4QUFA 1VQPA 3MA2B 3RUZA 4IOAA 1Z9FA 3LX0A 2VUMH 4LFCL 4CJ0B 1N36L 5JOBA 1MKHA 3M4PA 1EFWA 1ICFB 1IL2A 4B9WA 4IFDJ 1HUNA 1LUZA 4DAVA 1M1KC 1GOZA 1QUQB 2F0NA 2H4OA 1KRSA 4I65A 4ABNA 1PH8A 3L2PA 1L0WA 2M9VA 2NZHA 2R92H 4EQNA 3A8IE 1MD2D 3PF4A 4MN3A 4O42A 2IL8A 4XTCS 4A3KG 3HRZC 1PYBA 4DV4Q 3M3YB 1UWVA 2Q8TA 3P1HA 4NW2A 5IGEA 4DV2L 1FR3A 1JT8A 4DUYQ 1A3TA 2KVMA 3VDYA 1JORA 1UE7A 1QOHA 1KNEA 3CW2C 1N33Q 1DCZA 2C9OA 5C4XG 1UEBA 2HQLA 4LAAA 3C2PA 4DGZA 1HR0Q 1STBA 3J7ZC 3GTGH 2K1BA 2PNHA 3J81i 2PQEA 4GKKL 5EBDA 1VQKA 1JCKB 1G291 3A8JE 3ULJA 2F3IA 1AP0A 4F88A 1F2LA 4FF1A 4RA8A 1N34Q 1O78A 3FHWA 1HJPA 5C3WA 1E0BA 1WTHA 4JI0L 2GVAA 3NENA 2E2IB 2D9UA 3J81j 3DMUA 5IGFA 3TZDA 1IKMA 1Y1WB 4RAUC 4P2CB 3I4MB 2JA8B 4DAYB 4F7XA 1XNRQ 1TXYA 1KDAA 1L1OC 5M5YH 1B8AA 4X3TA 1XYIA 5FLXL 3P75A 5JVH3 1O7LA 3TP5A 1PRTF 1TWGB 3GTJH 2EQSA 1EY6A 1A2UA 2PO4A 3CCMA 3A0JA 1K73C 4BY7H 4J8QA 2WKCA 5D14A 2JJQA 2UXDQ 3J81E 3KJPA 5FK9C 5EPKA 3MFGA 1PFNA 3AFQA 3I4LA 1TWHH 4H7BA 3NELA 5CGKA 4P74A 3BZCA 1SNQA 2B8FA 4JBMA 2ZTEA 4X6AH 3T16A 3MXPA 1MGSA 4FYDA 4OIJA 5FLMH 1N34L 3NBHA 3RNUA 4P71A 4EX5A 2ATWA 3SR1A 3ONAB 5IGDA 1Q1BA 2K04A 5IT9c 1YITA 4B3SL 4XQNA 4JI7Q 3HOZG 3SK6A 4B3RL 5ELDA 4XQQA 1YNNC 1AFPA 4EVOA 2Z6KC 5CBEE 4YCVA 2VQFQ 3NBIA 4C3JH 3K80C 3HG9A 4LF9Q 1PZJD 5K36H 4A3GB 2AMCB 2YU9B 1A3UA 5JVG3 1SNPA 1NR2A 1SE8A 3B6YA 1YHQA 4RGTA 1VQMA 3OW7A 2E2HB 1I94L 2A69D 3FKIH 4NXNL 4DUZQ 4DR7L 3MXNB 3HOVG 3KLRA 4DAYA 4X62L 4TQUS 1GUGA 1K8GA 2F0IA 3G6JB 1Y1WH 1BO0A 1H95A 2YTVA 3ERSX 1XNQL 2ICEC 3KFUA 4M1UB 2HUGA 2QCPX 4QMGA 4HN7A 4C3JG 1XTCD 4DV1L 4JI8Q 4JI3Q 1BOSA 5JEAH 4QCLA 4ZQ3A 4HIDA 1SRUA 2Z1CA 2B3GA 2SNSA 4ZLTF 1CA5A 3QJYA 4HMIA 4JI6Q 2K5NA 1E2WA 2V4DA 1ILPA 2K5DA 1ICWA 4R4QA 5C3EG 3S16B 3KBXA 1S72A 2A68D 1GM5A 4O0AA 1BCPC 1OXTA 4YIJA 1HZAA 3T13A 2EJMA 1VQHA 4CKEA 3KF8B 5KYLA 1NJIC 3CD6A 4RGNA 5FLMG 1DONA 2J0TD 4UAIA 3SXHA 1B3AA 1PH2A 2BE5D 1SYDA 1WTPA 2L9HA 1LM0A 4MHEA 3CCJA 2TMPA 3BYTB 4DR3Q 4CDDC 1H9RA 1I3QH 2ZJPA 5CMDA 3PO2B 2NZ1D 2EVBA 1YEZA 4JI1L 5M5WB 5GAHC 5IGGA 5E1FA 1UUPA 1RCVD 1VF7A 1ESFA 2E75C 5F2DA 4X3KA 5DAUA 1E1TA 4OWTB 3PUWA 1CQVA 2KEDA 3A74A 3IKJA 2F4VQ 1O80A 4JI3L 4JI8L 3NEMA 1X3QA 4UDUC 4DV1Q 1QCBD 1DM0B 3KLSX 2SDFA 4NPSA 2UXCL 1YNXA 3GTPH 1RL2A 2LMCB 3UDXA 2XTIA 5IP7G 2C35B 5M5XH 2FINB 2F03A 1VQDA 1K28A 2X69A 2CH4W 3T56B 2Z6BA 4KMUC 4DF7A 2HD3A 2F0TA 4HSPA 3PIOA 4DR4Q 1VQOA 2F0VA 4CHTB 3M85A 1WD0A 4LF8L 1S5CD 1X3FA 4BBRG 1Y1VB 3F2BA 2GN5A 3S2HH 4DFAA 2I46A 3I91A 5ELFA 2VNUD 3QR8A 4OEMB 1EL0A 3K58A 4A3FH 5IYBH 4IFDG 4WFN3 5IP7H 3OPOA 1B4OA 4EQOA 3I4NH 1EIYB 2A5HA 4Y7NB 1Q12A 3RZOB 1XWEA 1Y69U 1XTDA 2PI2A 4JW0A 4PQXA 2DGYA 3HKZE 1PH5A 2B8GA 2EYOA 2CWPA 4DR2L 2QF7A 2A74C 3PUYA 5ELBA 3T1YQ 1MI2A 4XT1B 3GTKB 3TZUA 5AJ3Q 3CC7A 1ZXTA 4S3SA 3EVQA 3F2UA 1XMQL 5ELNA 1AZPA 1B9MA 3H0GH 4A3FG 2PZTA 4H13C 3OIQA 2K05A 4LFAL 3N52A 5C44B 1HXYD 5EAYA 3I4NB 1RHPA 2JEAI 4L5SA 1EU4A 4RHRA 1F2YA 2IX3A 2UUBL 1F2MA 4KV6A 1WD1A 2I07B 1CZGA 1LYLA 3SK8A 1LTAD 4N8FA 4K8IA 2NVYB 4FF3A 4CBVA 1U4RA 3O13A 2Y0SE 5GADC 2NB0A 4IURA 3HOWG 2B2WA 3CCLA 2N78A 4ZRZA 2KHJA 1XNRL 4PZ6A 4HEDA 4DV6Q 1CZWA 2JYOA 5ELOA 2QEXA 4JG2A 2IY5B 1AEXA 2UXCQ 5T1IA 3H94A 4DV5L 2A6ED 2ZT9C 1X55A 4HJ5A 1Y8NB 3BYYB 5D3DA 1MSHA 1PFBA 1WTRA 1ZYRD 3BVGA 3DM1A 4KHPL 2CKZB 4FDBA 2HDMA 1Y1VH 3E5SA 1RJTA 3I55A 4K5WA 1CHPD 1IBKQ 4JI5Q 2CWAA 3NXWA 4A3JG 1B7YB 2BA0A 5CV7A 5DLQE 2IW3A 4IFDI 2ZM6Q 1A8VA 1BQQT 4CKBA 2E2JB 2PW7A 3SK5A 3T4AC 2VY3A 3QO2A 2KECA 1XJVA 5HY6A 2BCOA 5CBAE 1X65A 3LNNA 4A3KH 1ILQA 2JXMB 5FJ8G 2VUMG 1VQ6A 2KOLA 1TWCH 3HGBA 4QIWE 2WV6D 1X56A 3R3OA 4TRDA 1V1PB 1V1OA 3NTKA 1VQ4A 1TY0A 4L6TB 4LWCA 5JJZA 1K9MC 1KAAA 2EPBA 4HAEA 2ID0A 1IBLQ 3E9IA 3J7AF 1BCPD 2KCCA 3VR6A 4BY7B 4K5VA 3HOYH 1CKNB 4XXEA 1BCPB 1FGBD 5J22A 4PMCA 2PZWA 1YZ6A 1CSPA 5I4DA 2P5ZX 1EY7A 2JA6G 4BY1B 2KQ3A 3H3VH 2WIIB 4DA2A 1K8OA 1WTOA 4L5RC 1EU3A 2K4KA 3OTOL 1Q3LA 1LABA 2DY8A 5JEAJ 4HJ9A 2CH4A 3S15H 1TS4A 4DNIA 4KKSA 2EOTA 1SBBB 2R92G 4AYBB 4YCWA 3E3XA 4BBSB 1GUOA 4DR4L 1S40A 4N9PA 4IUPA 4UP9A 3URYA 4DUZL 1WTWA 4NXNQ 4V190 4DK0A 1OTCA 1LTTD 2EY6A 5CORA 4DK3C 4B08A 3CCRA 1EQVA 2R6GA 3V05A 3LWEA 4A3JH 2EY2A 1DGSA 2R7DA 5C4XH 5IY0A 4LF9L 1KXLA 2XVSA 1K83H 2K33A 1TWGH 4NMZA 3NWSA 1NUCA 1A3VA 4IUQA 1OXXK 5BR8Q 2TSSA 5J1ZA 2JA7H 1YNND 3F2CA 1DJRD 3MC0B 3MZ5A 2F0FA 4DNRB 1Q82C 4JI7L 1CSQA 4CDCC 1SYGA 1II3A 2A19A 2WAQB 2OCEA 5C44G 3S17H 1IW7D 2F0KA 1PTOC 3U9OA 2D2CC 5KNBA 1FVIA 3SVMA 5LMNQ 1L1OA 3CCVA 3UDGA 1I5FA 2CCZA 4AYBG 4AYBE 2E5LL 1CI3M 1RTNA 2WAQG 2BDOA 1Q46A 3HOXB 2R93H 2F0HA 4A93H 3OSOA 3X3NA 3NWTA 2QA4A 5CV4A 1KABA 4BY7G 3S14H 2NWGA 1GUNA 1EWIA 3NE5B 1G2SA 2RDGA 4ZUJA 1SXTA 4A3IH 2Q2UA 1JOKA 2A68C 5FLXc 4X64Q 3S1MB 1M4VA 1AN8A 1L0XB 1IBKL 2HDLA 3K5NA 4JBWA 2F0LA 1SYEA 3HOUH 1O7YA 3DEPA 2NN6H 5I9OA 4UP7A 1J5EQ 2WINB 1S5FD 4RG1A 3AMUA 1K3BC 1V43A 2R7ZH 1BNZA 4RCNA 4FNFA 5C5MA 1JJ2A 3HOVH 3L7ZC 1LV9A 4A3IG 2K5WA 2OXPA 5DM73 1HZBA 1U0LA 4WJWA 3NTHA 4OGQC 2K03A 3ND8A 4LUZA 3J7A5 4ZKBB 4R4IA 5K36G 4RWSC 5I9PA 3TS2A 4GN4B 3FEWX 3MWYW 5LL6X 5M3FB 5JEAG 3MXGA 1VQ5A 1V8QA 5A2QE 2PQAB 3F1ZA 4Q5VA 4OHJA 3SGIA 2YYZA 3TP6A 5C3EB 2DUDA 4DV0Q 3NUCA 3BVZA 1D1IA 3CC4A 4OELB 4CDEC 4A3KB 1QJOA 3A56A 1M8AA 3CP0A 1JWUD 4KKUA 1QZHA 4MTNA 2PYKA 3S9WA 1Q8KA 2K5VA 1PH4A 1FJGQ 3SEBA 4EGVA 4BWGB 1DOLA 4A3CG 2I5HA 1PTOF 3LWUA 4RKBA 4ZCKA 3JAMc 1U4LA 4KTAA 5M3FG 3NK9A 4CDFC 1A62A 3MXNA 2E74C 3AB9A 3IRBA 1ENFA 5C3EH 3RLNA 3PIPA 1EOVA 1NE3A 4A3FB 1VF5C 1PYSB 4ILWA 5M5WH 3STBC 2WP8J 5KRUA 4DKAC 3HOUG 1EIGA 4WJ4A 2GVBA 5M3MH 2NN6G 4C3HH 1ML0D 1IYUA 4AH6A 1J5EL 2B63H 1VQ9A 3FRPB 1I6VC 1PZKD 4JV5Q 4JC0A 1VQGA 4C3IH 1QNUA 4IJLA 1PH7A 2RHQB 5C6AA 2AWOA 1N36Q 3VR4A 3G4SA 2O5IC 1S5DD 2B2UC 3GD7A 4G57A 3CC2A 2Q8RE 2UUAL 3J81L 4O1NA 4FXDA 2RDFA 4A4IA 4QY7A 3GTGB
chains in the Genus database with same CATH topology
4CDFC 4OEMB 2DJFC 4CDCC 4OELB 1ICFB 4CDEC 1K3BC 4CDDC 2DJGC 1MHWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDF C;  4OEM B;  2DJF C;  4CDC C;  4OEL B;  1ICF B;  4CDE C;  1K3B C;  4CDD C;  2DJG C;  1MHW C; 
#chains in the Genus database with same CATH topology
 2F0U A;  2L12 A;  5EKI A;  1VQE A;  2BH2 A;  4FVM A;  4J15 A;  1X9N A;  2HT1 A;  3KOJ A;  1HNZ Q;  4HR7 B;  5ISR A;  1R9T H;  2Q2H A;  1F9S A;  2L15 A;  5FLX E;  4DK1 A;  4C3I B;  3K7A B;  1VQL A;  3S2D H;  1E22 A;  1GXD C;  3SDZ A;  2LXJ A;  1GJX A;  4OX9 Q;  4C2M H;  4QUC A;  2PMZ E;  1KD1 C;  1HQR D;  1QZG A;  2JA7 B;  5CV9 A;  4K8J A;  4GKK Q;  2OQK A;  1PRT B;  2RHS B;  3I73 A;  3AU7 A;  3RLF A;  3NQT A;  2JA6 B;  1SE2 A;  1PH9 A;  4YY3 L;  4A3C H;  3VR3 A;  3EA6 A;  1LT5 D;  3D4D A;  3ERO A;  1ESR A;  4GZY C;  5IP9 G;  4DR3 L;  1GD7 A;  3PMF A;  4UPA A;  4B9X A;  1HNX L;  1S5E D;  4XT3 B;  3A5U A;  2QIL A;  4DUY L;  3BZD B;  1CM9 A;  2UUC Q;  2F0P A;  1D5M C;  2MQH A;  4OXP A;  3S1R B;  3CHB D;  4KY6 A;  2E2J H;  4QIW B;  5KGU A;  5I6W A;  5GQO A;  5IYC G;  1DOK A;  4JI6 L;  1G6Z A;  4DR6 Q;  3G71 A;  2M2L A;  2B63 B;  1CHQ D;  5KYI A;  3PSI A;  1Z7T A;  1C48 A;  3I8Z A;  4HJA A;  1SSO A;  1SFO H;  3PIO 3;  4R4O A;  1PLF A;  2MPM A;  3TDQ A;  3H0G G;  1UAP A;  1YNJ D;  2UU9 Q;  1TKW B;  2DNC A;  5DM6 3;  5IYD G;  4FP5 D;  4WRD A;  3PIP 3;  1F9R A;  5M5X B;  2BH8 A;  4IOC A;  1PRT D;  5L37 A;  5IIF A;  1SAP A;  4A3M H;  4A3E G;  3PF5 A;  3KDF A;  2WAC A;  3FPP A;  1KL9 A;  1XXG A;  2XRS D;  5A2Q L;  1SJH D;  1QWY A;  5IOD A;  4C3J B;  2JN4 A;  2B2Y A;  1JB7 A;  2MHV A;  4GNX B;  1BBX C;  3KJO A;  4TKO B;  2PPB C;  1LT6 D;  2OQ0 A;  2N49 A;  3I70 A;  5KND A;  2A6H D;  4JI4 Q;  2MFI A;  3GTO B;  1YIJ A;  1C4Q A;  4JI5 L;  4A3M G;  4ME3 A;  1O7I A;  4LF4 L;  4X66 L;  4FO2 A;  2L5T A;  1NNX A;  3C1F A;  3GTM B;  5IT9 E;  2EY1 A;  2F0E A;  1LAC A;  4I7A A;  4IZ8 A;  2IT1 A;  2HHH L;  3VYT A;  2MNA A;  4KHZ A;  1UE1 A;  2CVR A;  3EFX D;  3S1R H;  2KCN A;  1TY2 A;  3H0G B;  4JYA Q;  3UE1 A;  1RF2 D;  4RHS A;  5FJ8 H;  3GTO H;  2E76 C;  2CQA A;  1SLJ A;  1VQA A;  3IL8 A;  4NP5 A;  3W1G A;  5C4H A;  1JJG A;  2ZJQ A;  4JV5 L;  4X65 Q;  3H91 A;  3S1N H;  2B2T C;  2PI2 E;  3AYH B;  2ZTD A;  1EZ6 A;  2J4X A;  2Z4H A;  2RSO A;  4K5X A;  4LFA Q;  4A3E H;  3RLO A;  1LT4 D;  4U67 3;  4K0K Q;  2R92 B;  4NXM Q;  2K75 A;  3DXJ C;  3D8G A;  5AJ3 L;  3M7N A;  3WDN A;  5GRO A;  1I4H A;  4LF5 Q;  3CRK C;  5GAE C;  3STB D;  4LFB Q;  2HCC A;  1BBW A;  2PW5 A;  5COY A;  1AW7 A;  1K83 B;  4PNY A;  1JR0 D;  3NQI A;  2O5J C;  1XX8 A;  4DNT B;  1QUQ A;  5K5P A;  4K2K A;  4DU9 A;  3OYY A;  3CKI B;  2XGT A;  1E2V A;  1HRJ A;  1WCM B;  4L8J A;  5FOB B;  2XRQ D;  4EQP A;  1EY8 A;  1PTO B;  4JOI A;  1SR3 A;  1JB3 A;  5IWA L;  1RKN A;  1D1K A;  4DAP A;  1UNS A;  1YJN A;  2Z6K A;  4CGY B;  1EUJ A;  4TSS A;  3GTM H;  4KY7 A;  3GTL B;  1YBY A;  1WJJ A;  1T5X D;  5FO7 B;  3GTQ H;  1Z47 A;  4IO9 A;  4A93 G;  3PGZ A;  1FD7 D;  3HOZ H;  1EYC A;  3PO2 H;  1GO3 E;  5AFW A;  2F52 A;  1W6K A;  1CA6 A;  4OO1 I;  1C9O A;  2LS0 1;  3P20 A;  4XIG S;  2BE5 C;  1ASZ A;  3W2D A;  2XIW A;  2NVQ H;  1IYV A;  3ULL A;  4LW1 A;  1X6O A;  4QQB X;  3TME A;  2N8N A;  2E8G A;  3I56 A;  4LK1 C;  1W2B A;  4LFB L;  1R4P B;  3BDO A;  3RN2 A;  1W3S A;  1B9N A;  2B39 A;  1R4Q B;  4LFC Q;  3NHH A;  1JC7 A;  3FKI G;  1XMO L;  1TR5 A;  2E2D C;  1RDP D;  1LTS D;  4R8N A;  4JI1 Q;  4A3E B;  2K52 A;  1KDB A;  2F3W A;  2D62 A;  3CCU A;  2ZXR A;  4NKL A;  2KA7 A;  2NUC A;  3RN5 A;  3SK4 A;  3PO3 B;  2R93 G;  4KI0 A;  3KF6 A;  4ME5 A;  1QVF A;  4U68 A;  3J80 c;  1X3P A;  3QG1 A;  3PCO B;  1Q86 C;  1EY5 A;  1D7Q A;  1F9P A;  4A3B G;  4A3G G;  3CCQ A;  1K8A C;  1TS3 A;  3BZK A;  3E9H A;  3KDF B;  4C3H B;  3K59 A;  1IXR A;  4V0B A;  3I7F A;  4JYA L;  5BR8 L;  4IPH A;  2VL6 A;  2NVY H;  4BY1 H;  4JPB W;  5EPL A;  3VA5 A;  3DWQ A;  4GS3 A;  4PV1 C;  1GHK A;  4WOR A;  5CC4 A;  1KAW A;  1YI2 A;  3HOW B;  2DJG C;  4GNX C;  3GV3 A;  1I4G A;  2FMC A;  5IGC A;  3GTK H;  3HZX A;  1HQM C;  1S4Z A;  1B50 A;  3FVQ A;  1XPR A;  2G5D A;  4X62 Q;  1KNA A;  2V1C C;  3I90 A;  3J80 E;  2FHT A;  2RKS A;  4N9T A;  5M9O A;  1KIX A;  4DR7 Q;  4DV3 Q;  4KHV A;  5C5L A;  2EYM A;  2JA5 H;  3D31 A;  4B3T Q;  2DN8 A;  2K14 A;  2ZXP A;  3MXU A;  3VYU A;  4APV A;  2I5L X;  1L1O B;  2VQF L;  2EJF C;  1SNC A;  3M4O H;  4HIM A;  3OW2 A;  1QG7 A;  1CKO A;  2IJ0 A;  5JJI A;  4LUO A;  4P73 A;  2AQ3 B;  3G6E A;  2L55 A;  4LF6 L;  1N9W A;  4H02 A;  3Q8D A;  1VQF A;  3CQZ B;  4B3R Q;  2OEO A;  4B3M L;  5M3M G;  5EKK A;  1IBL L;  1SNO A;  2VB2 X;  4KN4 C;  4AQY L;  3K6O A;  3Q6S A;  2EZV A;  1PH6 A;  2FFK B;  3FMC A;  3I4O A;  1PMR A;  2XNA C;  2J7Z A;  1F2Z A;  2RCN A;  3J7A V;  3VYS A;  3M4O B;  1WVL A;  4GLV B;  1J8I A;  2GA4 B;  4B3T L;  1LTL A;  1G91 A;  1HZ9 A;  3ULP A;  2VXW A;  3EQL C;  3BDL A;  4IJH A;  2H1E A;  2AKW B;  4BXX G;  1QVC A;  2QGQ A;  1VQ8 A;  1AZQ A;  5ELC A;  4PZ7 A;  4OWW B;  3K5L A;  4KKT A;  3Q23 A;  4GKJ L;  3K0X A;  5G3L F;  4KHP Q;  3IFD A;  4CJ2 C;  1HNX Q;  2Z0S A;  2WFW A;  5C4X B;  1G51 A;  1L2F A;  5D3I B;  1WYD A;  4BA2 I;  1JQY D;  4IQZ A;  2AQ2 B;  2PQA A;  4C1N I;  1A0I A;  4DV7 Q;  3FDT A;  4DV5 Q;  3D4W A;  5LMN W;  1PVO A;  1G6P A;  3A7A B;  4K14 A;  3TN2 A;  5LL6 S;  4DXF A;  1TU2 B;  1IBM L;  3FP9 A;  1B3Q A;  4YY3 Q;  4DV6 L;  2EIF A;  1FNU A;  2WAQ E;  2O4X A;  4A3M B;  1PZI D;  2JA8 G;  3S16 H;  1VCI A;  1X3E A;  3OMC A;  2JE6 I;  1IYJ B;  4LF7 L;  1DOM A;  4BXX H;  3UI2 A;  4ZKC B;  1BR9 A;  1H9S A;  2OTJ A;  3A5Z B;  2SOB A;  2K5H A;  1BDO A;  1A63 A;  3MEF A;  4OON A;  1NAP A;  2L1B A;  4JCV E;  4GLA C;  1RTO A;  3KLS A;  4HMJ A;  5C0X I;  4J6H A;  3DHQ A;  3AEV A;  2UUB Q;  3NBH B;  2E2I H;  5C0X H;  4KJN A;  1ONL A;  1PFS A;  3K0Y A;  3D6W A;  4OIK A;  2DNE A;  1S3O A;  3NP8 A;  1NR4 A;  1HR0 L;  1E3P A;  3CRL C;  2JA8 H;  5IYD H;  1EYA A;  1QE6 A;  2M00 A;  2KHI A;  4C56 C;  3HS0 C;  1K8M A;  2UXB L;  2F0D A;  1N33 L;  5J3B A;  4OO1 H;  1XMO Q;  1FNV A;  1ENC A;  1I4Q A;  3T1Y L;  5JJL A;  1G2T A;  4K6L A;  3CU7 A;  2I5M X;  3S15 B;  3HOU B;  1I3Q B;  2KEN A;  3ERQ A;  2E2H H;  4YHH L;  3CCE A;  3ZYY X;  1MHW C;  3OHX C;  1BXT A;  4GLX A;  1STY A;  4DPG A;  1EOT A;  1ET9 A;  1FGU A;  5IYC H;  1HCZ A;  2AUJ D;  4LMQ D;  5I6Y A;  2A8V A;  4BBR H;  4IUN A;  1RD9 D;  3PO3 G;  4PG3 A;  3VYR A;  3F2D A;  1PH1 A;  2VW9 A;  1PTO D;  2CHB D;  4QJF A;  1N32 L;  5CV8 A;  2C5C A;  1CKM A;  3L0O A;  3TP8 A;  4LF8 Q;  4NDX A;  3E6Z X;  2WB1 G;  5G3L D;  2OTL A;  5C3X A;  2DJF C;  3K81 C;  1JE5 A;  4C1N K;  2RA4 A;  4UY8 C;  5DNF A;  3I4N G;  4A3L H;  2Z8L A;  2NZO A;  5C4J H;  2VB3 X;  1H9S B;  5A35 A;  2NVT H;  2A6E C;  2MGS A;  2F0S A;  3RZO H;  1EY4 A;  2IPK D;  1M90 C;  3KF8 A;  1IKL A;  1H9K A;  4DXG A;  3HEJ A;  5C0X G;  4RCO A;  1NTG A;  5ELE A;  2K32 A;  4UHV A;  2D0O A;  3K5O A;  1SMY D;  1SE3 A;  2DY7 A;  1DYQ A;  2KJX A;  4ZYS A;  4YCU A;  3V2T A;  1VQJ A;  1D2B A;  3BJU A;  4L5Q A;  3DWP A;  3DEO A;  2G9H D;  1TVX A;  3E0J A;  4LNQ A;  3HKS A;  3DUZ A;  2IX1 A;  2IWH A;  4LUV A;  1KC8 C;  2HCI A;  4DV7 L;  5DEH A;  1H9J A;  1T5E A;  3VR5 A;  1XPO A;  2NN6 I;  4F87 A;  2EYJ A;  5CR3 A;  4HSV A;  4BS9 A;  2YTY A;  2VQE Q;  2A6H C;  5HGQ A;  2NVX B;  4NB3 A;  3MAQ A;  1HA5 A;  1Y14 B;  2LY7 A;  1HTL D;  1VQC A;  1WTQ A;  1JE4 A;  3CAM A;  1CUK A;  2QDB A;  1IW7 C;  3LGJ A;  3H15 A;  4RFB A;  1Y1V G;  3H3V I;  3JAM E;  4XYO A;  5E4X A;  2WKD A;  5NUC A;  3DWA A;  3G48 A;  3T1H L;  1VMC A;  3D3R A;  1BF4 A;  1EY0 A;  4H0L C;  1ET6 A;  2ES2 A;  1GKH A;  2NBF A;  2MP1 A;  4IUV A;  4ZUI A;  4A3L G;  4O2D A;  2KCT A;  3GQB A;  4DR5 Q;  4HJ8 A;  2VS1 A;  3NTI A;  4C3I G;  3BS1 A;  1B70 B;  3CPF A;  4I7Z C;  1HZC A;  1XNQ Q;  4MTK A;  1WTV A;  4DAM A;  3Q24 A;  1SEB D;  1JMC A;  2EYL A;  5GAG C;  4JI4 L;  1Y1W G;  1VDZ A;  1I94 Q;  2CFM A;  5I2X A;  3TQY A;  4WJ3 M;  4JOI C;  2LXK A;  3K57 A;  2XSC A;  3U9S A;  1PYW D;  3GTJ B;  3S24 A;  1D8L A;  1STN A;  4A3J B;  3U4V A;  2LKV A;  3GTP B;  3M4Y A;  1EQT A;  5JPN C;  4POG A;  1Q8I A;  3PO2 G;  2LFN A;  4IN3 A;  2Y0S B;  4ODG A;  1Y8O B;  2F3V A;  2AQ1 B;  1FL0 A;  2L0C A;  3GP7 A;  4H44 C;  1K0S A;  1YVC A;  4B3S Q;  5IOC A;  4GN5 A;  1HNW Q;  3X3M A;  1YNJ C;  3Q0A A;  2UU9 L;  3S17 B;  2EYP A;  3W1B A;  1TWA B;  1I4P A;  2AHO B;  2JP1 A;  5I2Y A;  4R1J A;  1I50 B;  4DR5 L;  4HIO A;  1C0A A;  1R9T B;  3JC6 6;  2KUM A;  4X3U A;  5BN5 A;  3OTO Q;  4KD3 A;  5KIX A;  1NSN S;  3HOX H;  4G4K A;  2X6L A;  1AE2 A;  2R93 B;  4A3B B;  1Q1E A;  2JA5 B;  2F0M A;  5FKA C;  2ICI A;  2ASB A;  3I4M H;  1D5Z C;  3U50 C;  3M3Y H;  1OXU A;  1VQI A;  4X3S A;  1KQS A;  3QIA A;  2SEB D;  1HUM A;  3F8T A;  2HIV A;  1PTO H;  1PRT C;  1WCM G;  1I6H B;  1X32 A;  4BA1 I;  1BBU A;  2XN9 C;  2F0O A;  4KLK A;  1X54 A;  4RKL A;  1TWC B;  1EWC A;  3MVV A;  4QL5 A;  5CV5 A;  3KUP A;  4DK6 C;  2VZA A;  3UDF A;  1A2T A;  1NMG A;  3JAM L;  5EGT A;  4RH6 A;  1Y8P B;  3HOX G;  1SMX A;  1PDQ A;  5J39 A;  3GV6 A;  3S1N B;  4M8A A;  3OOC A;  1PH3 A;  3ZJY C;  5FO8 B;  4P72 A;  2Q8I B;  3HOZ B;  2LSS A;  4LJZ C;  5E4W C;  2B2U A;  3EJI A;  2L11 A;  1LO5 D;  5HGT A;  3HOY B;  4JI0 Q;  3M9B A;  2ZM6 L;  2YTX A;  3KK7 A;  3NSW A;  5FO9 B;  5KEE A;  3WWV A;  2B63 G;  3OMG A;  3KF6 B;  1I4R A;  3VR2 A;  1EFI D;  1OO9 B;  1PHJ A;  4A3D G;  1SE4 A;  4A3G H;  1GUS A;  3RZD H;  3P7J A;  1VS0 A;  3D6C A;  2F0G A;  2FJ2 A;  4GNX A;  4RMF A;  3D4R A;  1SYC A;  4KD4 A;  1HFG A;  2ZXO A;  4BBS H;  1IBM Q;  1XPU A;  5M5Y B;  1K3R A;  3HOY G;  2RBM A;  2NTT A;  3VA7 A;  2B2T A;  5IGB A;  3BVM A;  4G7H C;  3RD4 A;  3PV0 A;  1YJ9 A;  3I3C A;  2ZJR A;  4DV2 Q;  3W3A A;  5C0X J;  1N32 Q;  3U58 A;  3I4M G;  3S14 B;  3QOL A;  2CW0 D;  1HTP A;  1PFM A;  1STG A;  4DV4 L;  2I0Q A;  3GTQ B;  5IWA Q;  2XWB B;  1LTR D;  3L9A X;  1MSG A;  1GUW A;  1G8Z D;  4L5T A;  3G7L A;  4JBJ A;  2QDL A;  2WB1 B;  3N6R A;  2G9D A;  1VQB A;  1C8C A;  1WFQ A;  2JQO A;  4OWX B;  1UEA B;  2QKI C;  4TVA B;  5EJW A;  4DR1 L;  4AQY Q;  1JJC B;  3M7G A;  4PMB A;  4IUU A;  1PA6 A;  1HNW L;  4B3M Q;  3C3L A;  3JAM i;  3HP3 A;  1HH2 P;  2RVL A;  4NXM L;  2K50 A;  4QF4 A;  1ZEQ X;  1GVP A;  3A7L A;  4LF6 Q;  2VUM B;  1QB5 D;  2N3S A;  3J80 L;  4N8X 1;  4A75 A;  1S5B D;  2F0J A;  4ID6 A;  4XDX A;  2IX0 A;  4P75 A;  4HCS A;  5M3F H;  3UDI A;  2XWJ B;  3R93 A;  1WI5 A;  4QB4 A;  1SND A;  1C7Y A;  4KJO A;  1U5K A;  3PQI A;  3GDE A;  5HUR A;  4DV3 L;  2ZTC A;  2A69 C;  1BCP F;  2EY5 A;  1DD2 A;  4E6I A;  4L63 B;  4GOP B;  4LF7 Q;  4JBK A;  1MJC A;  2BOS A;  1SDF A;  4DN4 M;  1SRO A;  1EEI D;  2JEB I;  3MTS A;  4OO1 G;  1IHZ A;  5BN4 A;  1KLG D;  3OWE B;  2PCF B;  1V9P A;  3MHB A;  2Q2I A;  1TII D;  2F1M A;  2R61 A;  5JJK A;  4PZ8 A;  3R2I A;  3V96 A;  1IZ6 A;  3SE0 A;  1EYG A;  4A76 A;  4LF4 Q;  2ALY B;  3S2H B;  1CT1 D;  2L4N A;  5CYU A;  2NVQ B;  3S1Q H;  5EKL A;  3ER0 A;  4CJ1 B;  1ASY A;  3K5M A;  1QVG A;  2VQE L;  1I6H H;  2WB1 E;  1YHA A;  3A54 A;  4FF4 A;  2B2V C;  2KHS A;  1I4X A;  2H5X A;  1HHV A;  1O7Z A;  2KBN A;  1AH9 A;  3K8A A;  3A55 A;  2E5L Q;  1B1Z A;  1SFO B;  5JPM C;  1OXS C;  3EIV A;  1NBW A;  1BUV T;  4XYQ A;  3KYH C;  1F77 A;  5IP9 H;  2X6G A;  4YWK A;  4ZK9 B;  4OL7 A;  3L3O C;  4IAL A;  1JWS D;  3AQQ A;  3PO3 H;  2NVT B;  4J1M A;  4DR1 Q;  4CKC A;  3CPW A;  1KLU D;  1E7Z A;  4IPC A;  2R7F A;  2YV5 A;  4KK7 A;  2RF4 A;  4MIU A;  2OWO A;  1U9R A;  2K7V A;  2EXD A;  2RQX A;  3M4Q A;  1LTI D;  1TS5 A;  3ITP A;  3RZD B;  1H9M A;  2F0W A;  2K5Q A;  2PNR C;  3H6M A;  1BKB A;  4GOP A;  2Q2T A;  3HOV B;  2JA7 G;  1JIC A;  3HKZ G;  1SJE D;  2JA9 A;  4RGO S;  1HR0 W;  4PMW A;  4FXK C;  2HIX A;  2D5D A;  3IFT A;  5EQ0 A;  4JI2 L;  1E2Z A;  2B2Y C;  3NPP A;  1K0R A;  2QEJ C;  3MFY A;  3CF5 A;  3TRZ A;  1SYF A;  1SYB A;  3EBE A;  2PZU A;  2N55 A;  4BY1 G;  2K01 A;  2JSO A;  3J7Y W;  1W6J A;  1MJE A;  2NTS A;  4KN7 C;  1B44 D;  2D0P A;  3H3V C;  4IUT A;  3KBG A;  1Z6H A;  3WOE A;  1U4P A;  1KDC A;  1ENA A;  1Q90 A;  2N88 A;  1EY9 A;  2FXQ A;  4KY5 A;  5BN3 A;  2NVX H;  1KRT A;  2IHF A;  4Y7N H;  1EIF A;  4ALP A;  3A8K E;  3OWF A;  1CK1 A;  3CCS A;  2EJG C;  1NCV A;  2JK8 A;  2MJ8 A;  5LHY 1;  1ZYR C;  2EYF A;  3TS0 A;  4YHH Q;  4HJ7 A;  1VMP A;  1Q7Y C;  2JA5 G;  3TRE A;  1V1P A;  3S2D B;  4EQ5 A;  1FNW A;  3FPU B;  3R2T A;  2CW0 C;  1U4M A;  1STE A;  5EPJ A;  1HNZ L;  1VQ7 A;  5E3F A;  1LTB D;  1SNM A;  3CQZ H;  2UXB Q;  1KTK A;  2R7Z G;  2QW7 A;  1AE3 A;  1CQF A;  3CMA A;  2JA6 H;  3GO5 A;  2EDG A;  1QNK A;  3W5O A;  5M3M B;  4MNO A;  4FF2 A;  3R8B A;  1N8R C;  5C4J B;  5CV6 A;  2UXD L;  1EYD A;  2UUA Q;  1OXV A;  2K6A A;  1I50 H;  1P8L A;  2MO0 A;  1JWM D;  4X65 L;  4Y52 H;  5KNC A;  3WOF A;  4R8I A;  3TBI B;  4UP8 A;  2IHE A;  2ENB A;  4JVZ A;  4GN3 B;  3T51 B;  4HIK A;  1TWF H;  2F0Q A;  1STH A;  5IT9 L;  1UE5 A;  5H1S E;  1RIP A;  1WTX A;  2BA1 A;  2OT2 A;  3BG3 A;  5JAV A;  2NYZ D;  3K7U C;  2KCM A;  3FKI B;  4MZ9 A;  2SNM A;  3ND9 A;  4YWL A;  1TT2 A;  5IE8 A;  2BDN A;  1B53 A;  3KLW A;  2RDH A;  2KEE A;  3Q22 A;  2K28 A;  3K7A H;  1TWA H;  4GKJ Q;  1J6Q A;  1KHI A;  1IL8 A;  1X3G A;  4X66 Q;  3PUX A;  4R4T A;  1EWH A;  1L0Y B;  1D5X C;  1TWF B;  2Z4I A;  1NMF A;  4JI2 Q;  1FJG L;  1NY4 A;  4R9W A;  4A3I B;  4Q0F A;  3EN2 A;  4A3B H;  1A6X A;  3J80 i;  5C44 H;  4XQJ A;  1Q81 C;  4AIM A;  2R7Z B;  1WOC A;  1BVS A;  3S1Q B;  1V1Q A;  1EQQ A;  3U4Z A;  1TWH B;  3AFP A;  4C3H G;  4HTH A;  2R3Z A;  3I2Z A;  3BDC A;  2Z9H A;  3QWN A;  4DV0 L;  1D6E C;  4POF A;  1XMQ Q;  2EYH A;  5TSS A;  2O2L D;  4K6D A;  5D65 A;  4DR2 Q;  4QGU A;  2B29 A;  4LF5 L;  1GUT A;  5EBC A;  4IPG A;  4Z9C B;  1JOQ A;  2EXZ A;  1ROD A;  1PXU A;  1B2T A;  4F8M A;  4A93 B;  1T9H A;  4K0K L;  3CXC A;  4JK1 C;  1YHB A;  1WCM H;  2MO1 A;  4K2L A;  1J9O A;  3ICE A;  1A15 A;  1FYC A;  1LLR D;  2PMZ B;  3S1M H;  2MUY A;  3T1H Q;  3BU2 A;  1UE6 A;  3MEH A;  4DR6 L;  1MIU A;  4A3D H;  3IAY A;  3GTL H;  3DLL A;  4X64 L;  5IYB G;  4IFD H;  3QB3 A;  1CKN A;  4YWM A;  3PUZ A;  3E0E A;  4FXG C;  3H09 A;  5E7N A;  2RCF A;  3PUV A;  1YJW A;  1JOO A;  2UUC L;  1E24 A;  1EZ8 A;  1PV4 A;  1STA A;  4R4C A;  2OF1 A;  1EQR A;  1P16 A;  1ZKO A;  3DM3 A;  1TS2 A;  2HHH Q;  2F4V L;  1VQN A;  2B2V A;  1CTM A;  2EE1 A;  4G7Z C;  2B2W C;  3SHL A;  2A73 B;  3C46 A;  1EEF D;  4A3D B;  3HOW H;  5LMN L;  1SN8 A;  2CQO A;  3HKZ B;  5LMU L;  3TSS A;  1DXM A;  4BBS G;  3QOJ A;  4ULL A;  5C4Z A;  3T53 B;  1MBY A;  1HFN A;  1F9Q A;  1DZ1 A;  1SMY C;  1TQO A;  4OX9 L;  4RGM A;  4BBR B;  1HPC A;  3CME A;  2RSN A;  5LMU Q;  2A1A A;  2F4I A;  2FMM A;  4HCE A;  3UE0 A;  5T1G A;  2YU9 H;  3OIP A;  3RR5 A;  1GHJ A;  4G7O C;  1LTG D;  1EIH A;  1CFM A;  1HA6 A;  4ZAI A;  3I72 A;  3RMH A;  3J81 c;  2HQE A;  2AUK A;  3TEH B;  1LT3 D;  3TP7 A;  3C1E A;  4GOP C;  3HFZ B;  3D0F A;  2AWN A;  1E1O A;  4IPD A;  2Y0S G;  1QIL A;  4C2M B;  4QUF A;  1VQP A;  3MA2 B;  3RUZ A;  4IOA A;  1Z9F A;  3LX0 A;  2VUM H;  4LFC L;  4CJ0 B;  1N36 L;  5JOB A;  1MKH A;  3M4P A;  1EFW A;  1ICF B;  1IL2 A;  4B9W A;  4IFD J;  1HUN A;  1LUZ A;  4DAV A;  1M1K C;  1GOZ A;  1QUQ B;  2F0N A;  2H4O A;  1KRS A;  4I65 A;  4ABN A;  1PH8 A;  3L2P A;  1L0W A;  2M9V A;  2NZH A;  2R92 H;  4EQN A;  3A8I E;  1MD2 D;  3PF4 A;  4MN3 A;  4O42 A;  2IL8 A;  4XTC S;  4A3K G;  3HRZ C;  1PYB A;  4DV4 Q;  3M3Y B;  1UWV A;  2Q8T A;  3P1H A;  4NW2 A;  5IGE A;  4DV2 L;  1FR3 A;  1JT8 A;  4DUY Q;  1A3T A;  2KVM A;  3VDY A;  1JOR A;  1UE7 A;  1QOH A;  1KNE A;  3CW2 C;  1N33 Q;  1DCZ A;  2C9O A;  5C4X G;  1UEB A;  2HQL A;  4LAA A;  3C2P A;  4DGZ A;  1HR0 Q;  1STB A;  3J7Z C;  3GTG H;  2K1B A;  2PNH A;  3J81 i;  2PQE A;  4GKK L;  5EBD A;  1VQK A;  1JCK B;  1G29 1;  3A8J E;  3ULJ A;  2F3I A;  1AP0 A;  4F88 A;  1F2L A;  4FF1 A;  4RA8 A;  1N34 Q;  1O78 A;  3FHW A;  1HJP A;  5C3W A;  1E0B A;  1WTH A;  4JI0 L;  2GVA A;  3NEN A;  2E2I B;  2D9U A;  3J81 j;  3DMU A;  5IGF A;  3TZD A;  1IKM A;  1Y1W B;  4RAU C;  4P2C B;  3I4M B;  2JA8 B;  4DAY B;  4F7X A;  1XNR Q;  1TXY A;  1KDA A;  1L1O C;  5M5Y H;  1B8A A;  4X3T A;  1XYI A;  5FLX L;  3P75 A;  5JVH 3;  1O7L A;  3TP5 A;  1PRT F;  1TWG B;  3GTJ H;  2EQS A;  1EY6 A;  1A2U A;  2PO4 A;  3CCM A;  3A0J A;  1K73 C;  4BY7 H;  4J8Q A;  2WKC A;  5D14 A;  2JJQ A;  2UXD Q;  3J81 E;  3KJP A;  5FK9 C;  5EPK A;  3MFG A;  1PFN A;  3AFQ A;  3I4L A;  1TWH H;  4H7B A;  3NEL A;  5CGK A;  4P74 A;  3BZC A;  1SNQ A;  2B8F A;  4JBM A;  2ZTE A;  4X6A H;  3T16 A;  3MXP A;  1MGS A;  4FYD A;  4OIJ A;  5FLM H;  1N34 L;  3NBH A;  3RNU A;  4P71 A;  4EX5 A;  2ATW A;  3SR1 A;  3ONA B;  5IGD A;  1Q1B A;  2K04 A;  5IT9 c;  1YIT A;  4B3S L;  4XQN A;  4JI7 Q;  3HOZ G;  3SK6 A;  4B3R L;  5ELD A;  4XQQ A;  1YNN C;  1AFP A;  4EVO A;  2Z6K C;  5CBE E;  4YCV A;  2VQF Q;  3NBI A;  4C3J H;  3K80 C;  3HG9 A;  4LF9 Q;  1PZJ D;  5K36 H;  4A3G B;  2AMC B;  2YU9 B;  1A3U A;  5JVG 3;  1SNP A;  1NR2 A;  1SE8 A;  3B6Y A;  1YHQ A;  4RGT A;  1VQM A;  3OW7 A;  2E2H B;  1I94 L;  2A69 D;  3FKI H;  4NXN L;  4DUZ Q;  4DR7 L;  3MXN B;  3HOV G;  3KLR A;  4DAY A;  4X62 L;  4TQU S;  1GUG A;  1K8G A;  2F0I A;  3G6J B;  1Y1W H;  1BO0 A;  1H95 A;  2YTV A;  3ERS X;  1XNQ L;  2ICE C;  3KFU A;  4M1U B;  2HUG A;  2QCP X;  4QMG A;  4HN7 A;  4C3J G;  1XTC D;  4DV1 L;  4JI8 Q;  4JI3 Q;  1BOS A;  5JEA H;  4QCL A;  4ZQ3 A;  4HID A;  1SRU A;  2Z1C A;  2B3G A;  2SNS A;  4ZLT F;  1CA5 A;  3QJY A;  4HMI A;  4JI6 Q;  2K5N A;  1E2W A;  2V4D A;  1ILP A;  2K5D A;  1ICW A;  4R4Q A;  5C3E G;  3S16 B;  3KBX A;  1S72 A;  2A68 D;  1GM5 A;  4O0A A;  1BCP C;  1OXT A;  4YIJ A;  1HZA A;  3T13 A;  2EJM A;  1VQH A;  4CKE A;  3KF8 B;  5KYL A;  1NJI C;  3CD6 A;  4RGN A;  5FLM G;  1DON A;  2J0T D;  4UAI A;  3SXH A;  1B3A A;  1PH2 A;  2BE5 D;  1SYD A;  1WTP A;  2L9H A;  1LM0 A;  4MHE A;  3CCJ A;  2TMP A;  3BYT B;  4DR3 Q;  4CDD C;  1H9R A;  1I3Q H;  2ZJP A;  5CMD A;  3PO2 B;  2NZ1 D;  2EVB A;  1YEZ A;  4JI1 L;  5M5W B;  5GAH C;  5IGG A;  5E1F A;  1UUP A;  1RCV D;  1VF7 A;  1ESF A;  2E75 C;  5F2D A;  4X3K A;  5DAU A;  1E1T A;  4OWT B;  3PUW A;  1CQV A;  2KED A;  3A74 A;  3IKJ A;  2F4V Q;  1O80 A;  4JI3 L;  4JI8 L;  3NEM A;  1X3Q A;  4UDU C;  4DV1 Q;  1QCB D;  1DM0 B;  3KLS X;  2SDF A;  4NPS A;  2UXC L;  1YNX A;  3GTP H;  1RL2 A;  2LMC B;  3UDX A;  2XTI A;  5IP7 G;  2C35 B;  5M5X H;  2FIN B;  2F03 A;  1VQD A;  1K28 A;  2X69 A;  2CH4 W;  3T56 B;  2Z6B A;  4KMU C;  4DF7 A;  2HD3 A;  2F0T A;  4HSP A;  3PIO A;  4DR4 Q;  1VQO A;  2F0V A;  4CHT B;  3M85 A;  1WD0 A;  4LF8 L;  1S5C D;  1X3F A;  4BBR G;  1Y1V B;  3F2B A;  2GN5 A;  3S2H H;  4DFA A;  2I46 A;  3I91 A;  5ELF A;  2VNU D;  3QR8 A;  4OEM B;  1EL0 A;  3K58 A;  4A3F H;  5IYB H;  4IFD G;  4WFN 3;  5IP7 H;  3OPO A;  1B4O A;  4EQO A;  3I4N H;  1EIY B;  2A5H A;  4Y7N B;  1Q12 A;  3RZO B;  1XWE A;  1Y69 U;  1XTD A;  2PI2 A;  4JW0 A;  4PQX A;  2DGY A;  3HKZ E;  1PH5 A;  2B8G A;  2EYO A;  2CWP A;  4DR2 L;  2QF7 A;  2A74 C;  3PUY A;  5ELB A;  3T1Y Q;  1MI2 A;  4XT1 B;  3GTK B;  3TZU A;  5AJ3 Q;  3CC7 A;  1ZXT A;  4S3S A;  3EVQ A;  3F2U A;  1XMQ L;  5ELN A;  1AZP A;  1B9M A;  3H0G H;  4A3F G;  2PZT A;  4H13 C;  3OIQ A;  2K05 A;  4LFA L;  3N52 A;  5C44 B;  1HXY D;  5EAY A;  3I4N B;  1RHP A;  2JEA I;  4L5S A;  1EU4 A;  4RHR A;  1F2Y A;  2IX3 A;  2UUB L;  1F2M A;  4KV6 A;  1WD1 A;  2I07 B;  1CZG A;  1LYL A;  3SK8 A;  1LTA D;  4N8F A;  4K8I A;  2NVY B;  4FF3 A;  4CBV A;  1U4R A;  3O13 A;  2Y0S E;  5GAD C;  2NB0 A;  4IUR A;  3HOW G;  2B2W A;  3CCL A;  2N78 A;  4ZRZ A;  2KHJ A;  1XNR L;  4PZ6 A;  4HED A;  4DV6 Q;  1CZW A;  2JYO A;  5ELO A;  2QEX A;  4JG2 A;  2IY5 B;  1AEX A;  2UXC Q;  5T1I A;  3H94 A;  4DV5 L;  2A6E D;  2ZT9 C;  1X55 A;  4HJ5 A;  1Y8N B;  3BYY B;  5D3D A;  1MSH A;  1PFB A;  1WTR A;  1ZYR D;  3BVG A;  3DM1 A;  4KHP L;  2CKZ B;  4FDB A;  2HDM A;  1Y1V H;  3E5S A;  1RJT A;  3I55 A;  4K5W A;  1CHP D;  1IBK Q;  4JI5 Q;  2CWA A;  3NXW A;  4A3J G;  1B7Y B;  2BA0 A;  5CV7 A;  5DLQ E;  2IW3 A;  4IFD I;  2ZM6 Q;  1A8V A;  1BQQ T;  4CKB A;  2E2J B;  2PW7 A;  3SK5 A;  3T4A C;  2VY3 A;  3QO2 A;  2KEC A;  1XJV A;  5HY6 A;  2BCO A;  5CBA E;  1X65 A;  3LNN A;  4A3K H;  1ILQ A;  2JXM B;  5FJ8 G;  2VUM G;  1VQ6 A;  2KOL A;  1TWC H;  3HGB A;  4QIW E;  2WV6 D;  1X56 A;  3R3O A;  4TRD A;  1V1P B;  1V1O A;  3NTK A;  1VQ4 A;  1TY0 A;  4L6T B;  4LWC A;  5JJZ A;  1K9M C;  1KAA A;  2EPB A;  4HAE A;  2ID0 A;  1IBL Q;  3E9I A;  3J7A F;  1BCP D;  2KCC A;  3VR6 A;  4BY7 B;  4K5V A;  3HOY H;  1CKN B;  4XXE A;  1BCP B;  1FGB D;  5J22 A;  4PMC A;  2PZW A;  1YZ6 A;  1CSP A;  5I4D A;  2P5Z X;  1EY7 A;  2JA6 G;  4BY1 B;  2KQ3 A;  3H3V H;  2WII B;  4DA2 A;  1K8O A;  1WTO A;  4L5R C;  1EU3 A;  2K4K A;  3OTO L;  1Q3L A;  1LAB A;  2DY8 A;  5JEA J;  4HJ9 A;  2CH4 A;  3S15 H;  1TS4 A;  4DNI A;  4KKS A;  2EOT A;  1SBB B;  2R92 G;  4AYB B;  4YCW A;  3E3X A;  4BBS B;  1GUO A;  4DR4 L;  1S40 A;  4N9P A;  4IUP A;  4UP9 A;  3URY A;  4DUZ L;  1WTW A;  4NXN Q;  4V19 0;  4DK0 A;  1OTC A;  1LTT D;  2EY6 A;  5COR A;  4DK3 C;  4B08 A;  3CCR A;  1EQV A;  2R6G A;  3V05 A;  3LWE A;  4A3J H;  2EY2 A;  1DGS A;  2R7D A;  5C4X H;  5IY0 A;  4LF9 L;  1KXL A;  2XVS A;  1K83 H;  2K33 A;  1TWG H;  4NMZ A;  3NWS A;  1NUC A;  1A3V A;  4IUQ A;  1OXX K;  5BR8 Q;  2TSS A;  5J1Z A;  2JA7 H;  1YNN D;  3F2C A;  1DJR D;  3MC0 B;  3MZ5 A;  2F0F A;  4DNR B;  1Q82 C;  4JI7 L;  1CSQ A;  4CDC C;  1SYG A;  1II3 A;  2A19 A;  2WAQ B;  2OCE A;  5C44 G;  3S17 H;  1IW7 D;  2F0K A;  1PTO C;  3U9O A;  2D2C C;  5KNB A;  1FVI A;  3SVM A;  5LMN Q;  1L1O A;  3CCV A;  3UDG A;  1I5F A;  2CCZ A;  4AYB G;  4AYB E;  2E5L L;  1CI3 M;  1RTN A;  2WAQ G;  2BDO A;  1Q46 A;  3HOX B;  2R93 H;  2F0H A;  4A93 H;  3OSO A;  3X3N A;  3NWT A;  2QA4 A;  5CV4 A;  1KAB A;  4BY7 G;  3S14 H;  2NWG A;  1GUN A;  1EWI A;  3NE5 B;  1G2S A;  2RDG A;  4ZUJ A;  1SXT A;  4A3I H;  2Q2U A;  1JOK A;  2A68 C;  5FLX c;  4X64 Q;  3S1M B;  1M4V A;  1AN8 A;  1L0X B;  1IBK L;  2HDL A;  3K5N A;  4JBW A;  2F0L A;  1SYE A;  3HOU H;  1O7Y A;  3DEP A;  2NN6 H;  5I9O A;  4UP7 A;  1J5E Q;  2WIN B;  1S5F D;  4RG1 A;  3AMU A;  1K3B C;  1V43 A;  2R7Z H;  1BNZ A;  4RCN A;  4FNF A;  5C5M A;  1JJ2 A;  3HOV H;  3L7Z C;  1LV9 A;  4A3I G;  2K5W A;  2OXP A;  5DM7 3;  1HZB A;  1U0L A;  4WJW A;  3NTH A;  4OGQ C;  2K03 A;  3ND8 A;  4LUZ A;  3J7A 5;  4ZKB B;  4R4I A;  5K36 G;  4RWS C;  5I9P A;  3TS2 A;  4GN4 B;  3FEW X;  3MWY W;  5LL6 X;  5M3F B;  5JEA G;  3MXG A;  1VQ5 A;  1V8Q A;  5A2Q E;  2PQA B;  3F1Z A;  4Q5V A;  4OHJ A;  3SGI A;  2YYZ A;  3TP6 A;  5C3E B;  2DUD A;  4DV0 Q;  3NUC A;  3BVZ A;  1D1I A;  3CC4 A;  4OEL B;  4CDE C;  4A3K B;  1QJO A;  3A56 A;  1M8A A;  3CP0 A;  1JWU D;  4KKU A;  1QZH A;  4MTN A;  2PYK A;  3S9W A;  1Q8K A;  2K5V A;  1PH4 A;  1FJG Q;  3SEB A;  4EGV A;  4BWG B;  1DOL A;  4A3C G;  2I5H A;  1PTO F;  3LWU A;  4RKB A;  4ZCK A;  3JAM c;  1U4L A;  4KTA A;  5M3F G;  3NK9 A;  4CDF C;  1A62 A;  3MXN A;  2E74 C;  3AB9 A;  3IRB A;  1ENF A;  5C3E H;  3RLN A;  3PIP A;  1EOV A;  1NE3 A;  4A3F B;  1VF5 C;  1PYS B;  4ILW A;  5M5W H;  3STB C;  2WP8 J;  5KRU A;  4DKA C;  3HOU G;  1EIG A;  4WJ4 A;  2GVB A;  5M3M H;  2NN6 G;  4C3H H;  1ML0 D;  1IYU A;  4AH6 A;  1J5E L;  2B63 H;  1VQ9 A;  3FRP B;  1I6V C;  1PZK D;  4JV5 Q;  4JC0 A;  1VQG A;  4C3I H;  1QNU A;  4IJL A;  1PH7 A;  2RHQ B;  5C6A A;  2AWO A;  1N36 Q;  3VR4 A;  3G4S A;  2O5I C;  1S5D D;  2B2U C;  3GD7 A;  4G57 A;  3CC2 A;  2Q8R E;  2UUA L;  3J81 L;  4O1N A;  4FXD A;  2RDF A;  4A4I A;  4QY7 A;  3GTG B; 
#chains in the Genus database with same CATH homology
 4CDF C;  4OEM B;  2DJF C;  4CDC C;  4OEL B;  1ICF B;  4CDE C;  1K3B C;  4CDD C;  2DJG C;  1MHW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...