4CDFC

Human dpp1 in complex with (2s,4s)-n-((1s)-1-cyano-2-(4-(4- cyanophenyl)phenyl)ethyl)-4-hydroxy-piperidine-2-carboxamide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cathepsin C Inhibitors: Property Optimization and Identification of a Clinical Candidate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DIPEPTIDYL PEPTIDASE 1 EXCLUSION DOMAIN CHAIN
total genus 7
structure length 68
sequence length 68
chains with identical sequence F
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2013-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4cdfC00
2DJFC 1K3BC 1MHWC 2DJGC 1ICFB 4OEMB 4CDFC 4CDEC 4CDDC 4OELB 4CDCC
chains in the Genus database with same CATH superfamily
4A93B 2NN6I 2PPBC 3J81c 3V96A 3BZKA 3SHLA 1JMCA 1GHJA 3PO2B 3IFDA 5IGFA 1BBWA 1QE6A 4WJ4A 2O5JC 1U4PA 2ALYB 3JAMi 1X54A 4G7HC 5I6YA 1V8QA 1D6EC 2Y0SG 2CWAA 3DWQA 1GXDC 1F9SA 4IUTA 4DV3Q 1LTID 4BY1H 4GOPB 5CBEE 2ZM6Q 3G7LA 3TRZA 1VQ7A 4IALA 3RD4A 1FD7D 3VR5A 3VYTA 2K04A 5K5PA 4A3JH 4A3DH 3HOYG 1KAWA 2DUDA 2HIVA 3EVQA 2SDFA 3FRPB 1HH2P 5KGUA 1BR9A 3ND9A 1CQFA 2YTYA 1Y14B 4A3EG 4X65L 1AZPA 3ONAB 3EBEA 1XNQL 2HUGA 1TWGB 2NN6G 2VQFL 1YITA 2F0HA 2EJMA 5GAGC 2FMCA 5IY0A 1CQVA 2F4IA 4FVMA 5CYUA 4F7XA 1LV9A 4KD3A 4LF6Q 1I4RA 1CSPA 3E9IA 5IYBG 4HCEA 1N33L 1FGBD 2VS1A 4YWMA 2K50A 2EE1A 2P5ZX 4RCOA 4NKLA 4MTNA 1N32L 3R93A 1L1OC 4H13C 2Q8IB 5C3EG 1PYWD 1N8RC 1EEID 3PIP3 1ML0D 4NPSA 4PQXA 1TU2B 3PO3H 2UXCL 2AWOA 1PRTC 5H1SE 1RJTA 5JAVA 1I5FA 2A5HA 3STBD 5C0XI 1A8VA 4G7ZC 1II3A 1R9TH 3HOXH 1YJNA 1LTGD 5I2YA 4JOIA 5IP7H 5M5YB 4LF5L 1LUZA 3RNUA 2F0OA 1EFWA 4J15A 3MXNB 1FL0A 1S4ZA 3Q22A 1RDPD 1SE3A 1M90C 5FLXL 1CKNA 3L7ZC 1B3AA 2QKIC 2HCCA 4OIJA 4OXPA 3PIO3 1YIJA 4OX9L 3HOXG 1VQ9A 4ZQ3A 5I6WA 1WI5A 3KDFB 3C2PA 2TMPA 3OWFA 1RL2A 5CMDA 4KHVA 4IPHA 4GLVB 1PH5A 3TZDA 4PMBA 2F0WA 1S5DD 3J80i 1A3VA 2VXWA 1JWUD 1GVPA 2AQ3B 2ZTEA 1O7YA 2A69C 2EYLA 5CV5A 3AMUA 1Z6HA 3NK9A 2R7DA 1I94L 5IYBH 4BA2I 4NB3A 1TWHH 4RFBA 2B2YC 3SR1A 1SYEA 1WCMG 2SNMA 2UUCQ 2YTXA 1WOCA 3L9AX 2WV6D 2V4DA 1U4RA 1FR3A 3Q0AA 4R1JA 4H44C 5M5XH 1CZWA 1JWMD 3NQIA 3I4MH 2HCIA 3S15H 2Z4HA 5T1IA 1N34L 1GHKA 3NXWA 2SEBD 2F52A 4IOAA 3CHBD 3AQQA 2YU9B 2KUMA 4AYBE 2WP8J 4L5SA 2QILA 3GTJB 1A6XA 1JICA 3TQYA 5C0XH 5C44B 4JI7Q 4HJ5A 5DNFA 4A3IB 1XTDA 2JA6B 4LUZA 5ELNA 1K73C 1PH7A 2XVSA 5JVG3 2Z1CA 2IL8A 4BBSH 3BZCA 1HQMC 4X3KA 2SOBA 4JI2L 3I55A 1X9NA 3D8GA 1SNMA 3NEMA 4JK1C 4DXGA 3N6RA 2F0EA 4L6TB 1AE2A 1C7YA 1X6OA 3Q6SA 2CVRA 3KK7A 3E5SA 1X3FA 2Q2UA 2K33A 1M4VA 5ELBA 5J39A 1HQRD 2QW7A 3VYRA 1VQ6A 5IGDA 2UUBQ 4LMQD 4A3JB 1STGA 1EQQA 2QCPX 1EY7A 1UE5A 4BY7B 4BWGB 2ES2A 1GUWA 2H5XA 3CCQA 2WAQB 4P71A 5D3IB 3BS1A 3R3OA 4PG3A 3I4OA 4PV1C 4DV7Q 4IO9A 1PH4A 2HT1A 5GAHC 4UP8A 2Z4IA 1ZKOA 2NZOA 1A2UA 1U0LA 4A3EH 4X3TA 1OXXK 4DV4L 1L0YB 1SAPA 4CGYB 4DPGA 1WTXA 4IPGA 4TSSA 3H0GG 4DR6L 2GVAA 1PYBA 3NPPA 5IP9G 4BY1B 3Q23A 1XXGA 3A7LA 1LTRD 5LL6X 4JI5L 4K2LA 2F1MA 3VDYA 4ZK9B 4GN4B 4X66Q 2Y0SB 5G3LF 3KBXA 2BCOA 2E2IB 1HTPA 5IGEA 1Q46A 3HG9A 4JI2Q 4MN3A 1TKWB 4R4IA 1KHIA 3AYHB 3KF8A 4PNYA 3KUPA 1PZKD 5ELOA 2E2JB 3TREA 2E2JH 3O13A 3PCOB 3K81C 2Q2HA 3IL8A 1TS2A 1PLFA 2DY7A 3D6WA 3IRBA 5M3FG 3FPPA 1L0WA 3FKIB 1QVGA 3VA7A 2B39A 2UXDQ 2AQ1B 2JEAI 5DAUA 2NVYH 4NMZA 4A3GG 2IY5B 1HZAA 1VS0A 3ERSX 5IWAL 3HOVH 4IUNA 2RA4A 4DV0Q 1HNZQ 1HNWL 3PUYA 3TBIB 1HZ9A 3FHWA 1A15A 1KNEA 1VF7A 3K7AB 4CDDC 4OELB 4Q0FA 3S1MB 2AMCB 1W6KA 2NVYB 1B8AA 1MJEA 2O5IC 2KCCA 1ENCA 1KLGD 2NN6H 1EQRA 2IX1A 4IFDG 4DR7Q 3M4QA 2FXQA 3I4NH 1GO3E 2A74C 1TWHB 1YNJC 3P20A 2N55A 2K32A 3Q8DA 4QMGA 1PDQA 4HIOA 5K36H 1LTLA 4XQJA 3CC2A 2N88A 2WKCA 1K0SA 3T56B 2XN9C 3E0EA 1EIYB 1J8IA 1LT4D 2R92B 1QNKA 4JI3L 1STHA 2D62A 3GDEA 1WYDA 4A4IA 1YNND 4BY1G 2EJFC 4WRDA 5IYCG 3S1NH 1I3QH 2F3WA 2KOLA 1PTOF 4FXKC 1VQEA 1WCMH 2JEBI 3VR4A 3M3YH 5CV4A 2JA7B 2E2DC 3DWAA 2ICEC 4EVOA 3RZDH 2NTTA 4DUZQ 2EYMA 2IX3A 4HIDA 4POFA 3CQZH 5C44H 3S1MH 1LLRD 2JA5B 2L11A 3CCRA 1MI2A 3UDFA 3VR6A 4HCSA 3DLLA 5IGCA 3M7GA 1E2VA 4JI4Q 3UI2A 3PUXA 1PH8A 5JEAH 1IW7C 1CZGA 5C4ZA 3QJYA 4FF3A 1PFBA 4JI5Q 1TS3A 3GTQH 2K75A 2ID0A 3K5OA 1NUCA 2EYHA 2L1BA 4IFDJ 1SYBA 3I4NG 1PHJA 2E2HB 5BR8L 1PFMA 4IFDH 2I5HA 3LWEA 3F1ZA 4FNFA 3QO2A 2CH4A 4LFCL 2HQEA 4A3CG 1VQ5A 1K8OA 4RGOS 1L2FA 1ESFA 4KY7A 3J7ZC 1PH3A 3R2TA 2XRQD 1XPUA 1SE8A 2F4VQ 4FF1A 4QUCA 1U5KA 1TWFH 1WTOA 3CD6A 4DV1Q 4LJZC 4C3IG 2HHHQ 4ZKBB 2MNAA 4MHEA 2UXDL 3EROA 2UU9L 1EQTA 5J3BA 4IOCA 2RDHA 4X6AH 4WORA 2WACA 4OGQC 2K5NA 3FP9A 1NMFA 3PUVA 2J4XA 2LFNA 2NTSA 2PI2A 4QL5A 4ABNA 3S1QB 1Y1VB 4ULLA 2KCNA 2DN8A 4X3UA 2CCZA 1STEA 1NR2A 4KY5A 4DR5Q 1Y1WG 3S24A 3HOWG 3GTPB 1AZQA 4DV5L 2E5LL 3NP8A 2K14A 4XIGS 2LXJA 3OMGA 2Y0SE 5CGKA 1KDAA 1HNXL 3DEPA 4X66L 4C3HB 3H91A 1BVSA 4AQYL 1PRTF 5IGGA 1B44D 1NNXA 3NE5B 2OF1A 2WAQG 2FHTA 4KLKA 4V0BA 1K3RA 1EY6A 3S16H 2RSNA 2MP1A 3OW7A 2IWHA 2XTIA 1KNAA 3FDTA 5C4HA 2KCTA 4CJ2C 4ZLTF 4EX5A 3SVMA 4QGUA 5FK9C 3IKJA 1GJXA 3HKSA 2OT2A 2C35B 2JSOA 1CFMA 4JBWA 2D0PA 2GA4B 1SSOA 5A35A 1Y1VG 3D4WA 4JI0L 3HOXB 1JORA 1F2ZA 1J5EL 1TQOA 2Z9HA 1E7ZA 2LKVA 1F9QA 3I4NB 4RWSC 2ZJRA 1Y1VH 5ELCA 4A3KH 3NBIA 5KNCA 3IFTA 3U4VA 4TRDA 4ZRZA 4JI4L 1PTOH 4JBKA 5ELDA 2OXPA 1TR5A 1SNQA 1MGSA 3NHHA 2B2UA 3MXGA 4CDEC 4BS9A 5JJKA 2EDGA 4H02A 2F0FA 2M9VA 2N78A 2EY2A 2PNHA 2B29A 2VUMG 2Z6KC 1GUGA 1V9PA 1XWEA 1AFPA 3CQZB 1MKHA 4CKCA 3X3MA 1JQYD 1J5EQ 3FKIH 3MTSA 4MNOA 1WCMB 3EFXD 4K5XA 2VL6A 1YNXA 3A7AB 3S16B 1MIUA 2MO0A 1DYQA 2D5DA 4FXDA 3M4OB 3ITPA 1HR0W 3CXCA 2GN5A 5IE8A 3V05A 1KQSA 3BG3A 3ZYYX 1SNOA 2VB2X 1E22A 5M5WH 1YHAA 4DV5Q 1SR3A 2E2IH 4DAMA 1QVCA 2NZHA 5M3MB 1RTOA 3TDQA 1D1IA 1R4PB 2IPKD 5M5YH 3JAMc 3UDXA 4TVAB 4C3JG 4DV6Q 3K8AA 2NBFA 2H4OA 3D6CA 3ULLA 1A62A 3P1HA 1TWAB 3A8JE 3SEBA 1WTWA 5M3FB 4DV3L 3CCLA 3J80c 1Q81C 1BQQT 3RLFA 4EGVA 5C4JH 2N3SA 2B2UC 2JA8G 3S17B 1PH2A 1W6JA 3E3XA 3H3VH 2F0GA 1EEFD 2K01A 3V2TA 3U4ZA 2N8NA 4A3CH 4JBMA 3RUZA 1E0BA 5C4XH 3GTLH 1BDOA 3S2HB 1NR4A 1V1PA 1GUNA 1X3QA 4YCUA 4K5WA 3OW2A 4PZ7A 1PFSA 2F0QA 5M5WB 1A3TA 2RVLA 3LNNA 4M1UB 4DV1L 3J81L 3RZOH 4C56C 1WTRA 1CKNB 2F3VA 1JT8A 2F0DA 3NUCA 3U50C 5EKIA 4A3FG 3S14B 5C0XJ 3TZUA 1STNA 1HZCA 4OWWB 3IAYA 3P7JA 2CW0D 4X3SA 1XPOA 1BBUA 1YBYA 3TP8A 2RCFA 3LWUA 3TP5A 1G2SA 1VCIA 5C4XB 3GTJH 1WD0A 4DAYA 1SJED 3ICEA 2L9HA 1STYA 1LYLA 2WFWA 2CHBD 1KL9A 4DU9A 3PMFA 1M1KC 2E76C 4DUYQ 5K36G 4UDUC 1A3UA 2E75C 4A3BH 4JC0A 4K0KL 1SNDA 2EYFA 4GNXB 1EQVA 1HPCA 3HKZE 4A3KB 3GTKH 3KLSA 4DNIA 2KJXA 4NW2A 3A74A 2CWPA 3G6JB 2AQ2B 1ET9A 1E2ZA 1C0AA 2LXKA 1BOSA 1UEAB 5IP9H 1TWCH 3PQIA 2A69D 2WIIB 2F0NA 5I9OA 1HRJA 1BKBA 3D31A 1E3PA 4N9PA 1AW7A 2K52A 2IHFA 2X6LA 2MQHA 2BDOA 3GV6A 2NVXH 1B7YB 1FNUA 4GZYC 1WTQA 1SE4A 1I4QA 2DNEA 2R7FA 5COYA 1QG7A 1S5BD 3CCVA 1G6ZA 4HJAA 1E1TA 1BXTA 1SXTA 3MFGA 1YZ6A 1EYGA 4ME3A 1RF2D 4C2MB 1DXMA 3QG1A 4KKSA 3CCJA 1Q1BA 3NTHA 5KYLA 1E2WA 4JI1Q 4LFCQ 4P73A 2DNCA 3AEVA 3RR5A 4RG1A 1LTBD 1VQFA 1Z7TA 4DR4Q 4GLXA 1BCPB 5CORA 4A76A 1GUSA 4M8AA 2F0LA 4LAAA 1S5FD 5CV8A 3BYTB 4KD4A 2J7ZA 5JJZA 2IX0A 4CDFC 4MZ9A 4DV0L 4OONA 1EY9A 5JPMC 3KF8B 2RF4A 3EN2A 4BBRH 4BBRB 1S5CD 3F8TA 4XTCS 2NVTB 3M7NA 2B2TA 4C3JH 4JV5Q 1IBML 1XPRA 2PZWA 2EYOA 2JYOA 4DKAC 2RQXA 1VQHA 2A8VA 1LO5D 2K5DA 2JN4A 2JXMB 1NE3A 4QY7A 3AFPA 2B2WC 2RHQB 1K83H 3D4DA 3S2HH 1NAPA 4HJ8A 3HOVG 3G4SA 4I7AA 4P74A 3S2DB 3NELA 4RHRA 3T53B 4RKBA 4BBRG 3PO3B 1SEBD 3K5NA 5HGQA 3BDCA 3GQBA 4B3TL 2L12A 1QWYA 2MPMA 1L1OA 4DN4M 4JI8Q 4DUYL 1AP0A 3KYHC 4JI3Q 3W1GA 1EOTA 2EOTA 4QQBX 5I2XA 3S2DH 3A5UA 3CMAA 2Q8TA 4RKLA 3CCMA 4IURA 3S1NB 4OL7A 1J6QA 5EJWA 1I4HA 1KIXA 2Q8RE 3MFYA 4GN5A 2A68C 3K0XA 3I3CA 4LFAL 2F0VA 1S40A 1DOMA 1VQBA 2FMMA 4IUPA 1O78A 1TWGH 3UDIA 1I3QB 1VDZA 4JVZA 2A73B 3G6EA 3ULPA 2EXDA 4KK7A 3J7AV 1H9RA 4A3LH 1J9OA 3GD7A 2QDLA 4JG2A 1YVCA 4KKTA 2ZXPA 1SROA 4K6LA 5JEAJ 1EYDA 5HGTA 1IBMQ 4C3HH 4DR5L 1GKHA 3SDZA 2JA6H 3WDNA 1YEZA 3DUZA 2VB3X 1OXSC 1RODA 5D3DA 1FVIA 1FJGL 1CI3M 2F0SA 4I65A 3CC7A 1HZBA 2Z0SA 5C3WA 2JE6I 1SJHD 2J0TD 3JAME 4B9WA 2OWOA 1V1QA 1EY8A 1HFGA 3HKZG 3X3NA 3K57A 4C3HG 1VQPA 3W2DA 3CC4A 1IKMA 5M5XB 1SDFA 3GTQB 2BA1A 5GQOA 1VQ8A 4LUVA 2O4XA 5EQ0A 4ZAIA 3VYSA 1V1OA 4IZ8A 4JI8L 2R93G 1G2TA 3A56A 1UUPA 2JK8A 5DEHA 5AJ3L 2F03A 2KENA 3EIVA 4A3FB 2JP1A 4PMCA 1STBA 2PMZE 3I70A 3M85A 1HUNA 1B1ZA 2JA5H 5T1GA 3MXPA 5IT9c 3J80L 2RHSB 1KDBA 4CBVA 1DOKA 4HN7A 1TWFB 4RGNA 1LT6D 4LW1A 4J6HA 5FLMG 1A63A 2QA4A 1TS4A 2D0OA 2JA5G 5E3FA 5C3XA 4YHHQ 1VMCA 1KAAA 4LF8L 4YY3L 1HFNA 1VQJA 1UWVA 3F2DA 2OCEA 1EWCA 1LABA 1X55A 3VR2A 1SMYC 4DV2L 1QNUA 2R93H 3BDLA 3STBC 1O7ZA 1VF5C 3HOUG 4ODGA 2WB1B 4HTHA 4DR1L 4A3DB 1XYIA 1DJRD 1ONLA 1TWAH 4ZUJA 4NDXA 2ZTCA 2F0TA 2K05A 5IWAQ 3T1YQ 3TEHB 1EL0A 2X6GA 4KHPQ 4B3SQ 4IUUA 4L5RC 2F0IA 4XYQA 3R8BA 3U9SA 3MZ5A 4QUFA 4U68A 5FJ8G 4YY3Q 1B2TA 5JVH3 3P75A 3BDOA 4KTAA 1DONA 2AUJD 5DM73 1O7LA 2KVMA 3T1HQ 4DR7L 1A2TA 2LS01 3HEJA 2UUAQ 2TSSA 1SNCA 1UNSA 2D2CC 3W1BA 1QVFA 3BVMA 1W2BA 1CUKA 5A2QE 2B2VC 3TN2A 4A3BG 4B3RQ 1XNQQ 3NTKA 4BY7G 1CT1D 2B8FA 3C3LA 1RTNA 1TXYA 4YHHL 2B3GA 4EQNA 3KJOA 2ZJQA 5IP7G 1QCBD 2WB1G 4X62Q 4A3DG 1IYUA 3J80E 1H9SB 4OWTB 2XSCA 3CCUA 1AE3A 3R2IA 1HJPA 2F4VL 1UAPA 4L5TA 1HR0Q 3OHXC 4DR3L 3J81j 3K6OA 4CJ0B 1T9HA 2DY8A 2MGSA 4QCLA 3SGIA 4R4QA 2N49A 2A19A 1DZ1A 4FXGC 1JWSD 3L2PA 3DM1A 1LT5D 1KC8C 2PQEA 2ZXOA 2K5WA 5M3FH 3PIPA 1DCZA 4DAPA 1ZYRC 3MHBA 3GO5A 1SFOH 3FVQA 3CF5A 2AKWB 5NUCA 3I7FA 3W3AA 1SYCA 2AHOB 5J22A 3HRZC 1I6VC 3HFZB 4KN7C 1YNNC 1IHZA 1ZXTA 2ICIA 1JJCB 4X62L 3GTGB 1RIPA 3AU7A 5E1FA 3PGZA 1ZYRD 1ASZA 2ZJPA 2R93B 1T5EA 4FYDA 3A54A 4A3GB 5LL6S 2FFKB 4HSPA 5JEAG 3NQTA 1VQNA 1JE5A 1OXVA 2HD3A 1IXRA 3OOCA 4A3JG 4KHZA 3NWSA 4DV2Q 4IPCA 2NVXB 3AFQA 3K80C 3WOEA 3KJPA 1IBLQ 1FJGQ 1TVXA 4GNXC 2IW3A 3G71A 1PTOD 3NSWA 4H0LC 4Y7NB 3MEFA 1D2BA 3CU7A 2JQOA 2RBMA 2Z6KA 5BR8Q 4EQ5A 2B63G 5JJIA 1S72A 1V1PB 4J1MA 4HEDA 1IL8A 3T1HL 2K5VA 1XMOL 4O42A 1U4MA 3UDGA 1GUTA 1NTGA 4P2CB 1BO0A 1FNVA 4R8IA 3I56A 4B3RL 3T4AC 2MHVA 4FP5D 4JYAL 4LF9L 1N9WA 1D7QA 3LGJA 1L0XB 2K5QA 3CMEA 4DXFA 2HIXA 1G91A 1VQOA 1KTKA 2DJGC 1WTVA 5IOCA 2E5LQ 2XWBB 5KNDA 4X64Q 1EWHA 1GD7A 3A5ZB 4DR3Q 1EFID 3RN2A 2PO4A 2O2LD 3H94A 5FJ8H 1SMXA 3BZDB 4DK6C 2K7VA 4RMFA 4C3JB 4KMUC 3D0FA 2MFIA 1I4PA 3OIQA 4GN3B 2DJFC 1IL2A 4ALPA 3L3OC 4PZ6A 4DNRB 1X65A 5GROA 1DM0B 1TT2A 4XT1B 4LF9Q 2JA8B 5IIFA 2A6EC 1VQMA 2I0QA 4IPDA 1Z47A 2NUCA 2BE5D 3GTGH 4L63B 1STAA 4AQYQ 1ICFB 3OIPA 5EKLA 1X56A 4I7ZC 4ZUIA 2B63H 1QOHA 2EY6A 4ILWA 4LFAQ 3H15A 1MJCA 1PXUA 3MEHA 1JB7A 4KHPL 1XMQL 3HS0C 2CKZB 4DAYB 2A6ED 1EYAA 2PNRC 2KHIA 1HA6A 5M9OA 2E74C 3E6ZX 1UEBA 2BH2A 4KJNA 2XGTA 2K1BA 3GTMH 4LFBQ 3I91A 4GNXA 5HY6A 3CPFA 3WWVA 4OO1H 4A93G 5CV6A 2KCMA 2RDGA 3TMEA 4JI0Q 3TP6A 3SK5A 4UP7A 5TSSA 5EBCA 1PZJD 4DK1A 1TY0A 1QZHA 1MSGA 3CP0A 2I5MX 1I50H 2WKDA 3DEOA 1N32Q 3DHQA 1Q12A 1ILQA 4OO1G 1HA5A 5C44G 2R7ZH 1PV4A 1SYGA 2Q2TA 1VMPA 4F87A 2EXZA 4APVA 4A3KG 1PH1A 2Z8LA 2JA7G 3TP7A 2EZVA 1CKOA 3NENA 3J81E 2NWGA 4XQQA 1K8MA 3GP7A 2R7ZB 5FKAC 1IZ6A 2WAQE 2QF7A 3S17H 2QDBA 2PZUA 3B6YA 4BBSB 1G291 1YJWA 4A3MB 3GV3A 2EYPA 3CRLC 3T51B 3GTLB 1C8CA 3E0JA 3KLWA 4WFN3 2KEEA 1S3OA 4DF7A 5JPNC 4JV5L 3S9WA 4HMIA 1WTPA 1LTSD 2I46A 2KHSA 3S15B 2QEXA 1ENFA 1K9MC 4G57A 4AIMA 2R61A 3QB3A 4U673 1G51A 2MO1A 2RSOA 3S1RB 2F0PA 1EZ6A 4GOPA 1X3PA 2IT1A 2VNUD 5C5LA 1VQLA 1CM9A 5C0XG 4H7BA 4LK1C 1EY4A 3ZJYC 2R92H 3OTOQ 1HTLD 4LUOA 3OWEB 1CHPD 2HQLA 3GTOB 4YIJA 4KJOA 4RH6A 3ULJA 5C3EH 4QF4A 1YI2A 1KRSA 1K8AC 4PMWA 4A3MG 2ZTDA 1JR0D 1KXLA 1Y8NB 4DNTB 2G5DA 2C5CA 3J81i 3VA5A 4UP9A 2UXBQ 2L5TA 3SXHA 1I6HH 1UE1A 3OMCA 5CBAE 3GTKB 2FJ2A 3C46A 2UU9Q 1PTOB 1VQAA 3A8IE 2MUYA 3DWPA 3KF6B 3K59A 1HHVA 1HNZL 1L1OB 2EYJA 3F2CA 4OX9Q 3BVGA 2ZT9C 2M2LA 4HJ9A 3RLOA 1PZID 3NWTA 3WOFA 1XTCD 4NXNQ 1WTHA 4A3FH 4LWCA 1C4QA 4KN4C 3MAQA 4LF5Q 3TS2A 2LMCB 1Y8OB 1U4LA 3MC0B 4RGTA 5CC4A 1Q3LA 2CQOA 2Z6BA 4IJHA 1FNWA 2K4KA 4S3SA 3A0JA 4P72A 2VUMH 2OEOA 2L55A 4B3ML 1SRUA 2OQ0A 1KDCA 1PTOC 2L4NA 3PO3G 1M8AA 3MVVA 3TS0A 5G3LD 3E9HA 1YJ9A 2XWJB 3FMCA 2D9UA 5GADC 3BYYB 3CRKC 1AH9A 2L15A 5AJ3Q 1Q7YC 1NJIC 4K0KQ 1X3EA 3FPUB 1OO9B 1WD1A 3QIAA 3QOLA 4FO2A 4Y52H 5F2DA 4YCWA 1Y1WB 4JOIC 1F2LA 2YYZA 1NSNS 4LF4Q 2UXBL 1CK1A 1JOOA 5KEEA 1B3QA 2KHJA 5IYDH 3KLSX 4UY8C 2ZXRA 3I4LA 2RCNA 3VR3A 5IGBA 1X32A 2BOSA 3CKIB 4LF7L 1XMQQ 3I4MB 4A3IG 4A3EB 3HP3A 1W3SA 1GUOA 4B3SL 3L0OA 1DD2A 2AWNA 4IUQA 1YHBA 3EQLC 1JB3A 5IYDG 2K6AA 3OTOL 3F2BA 2F3IA 2PW7A 3RLNA 1LT3D 2DGYA 4K6DA 1IKLA 1B53A 2B2TC 2ASBA 4GKKQ 4C3IB 4LFBL 2B63B 1EIFA 1RKNA 2R7ZG 4A3LG 4HIMA 4HMJA 3AB9A 1EZ8A 1PH9A 1E1OA 1TS5A 4K5VA 1HNXQ 4JI7L 3CW2C 4LNQA 4BXXH 5EPLA 1BBXC 2BDNA 1E24A 2OTJA 4UHVA 5I9PA 3QR8A 1PRTB 5E4XA 4HAEA 4QIWB 1BNZA 3SE0A 3ER0A 3HKZB 2OQKA 2R6GA 1SYDA 4ZKCB 1U9RA 1XMOQ 5FO9B 2BE5C 1B50A 3HOYH 1YHQA 3HOUB 3PSIA 3ERQA 1SN8A 3KLRA 1XNRQ 1EY5A 3LX0A 1TWCB 3RZOB 3D3RA 5FO7B 4NXNL 3DM3A 3CPWA 5LHY1 1JC7A 1F77A 4DK0A 3VYUA 1CKMA 3K5MA 1I4XA 1Q82C 4HIKA 5LMUQ 1JCKB 3I72A 3JC66 2E8GA 1D1KA 2EQSA 4LF4L 1Q8KA 2KEDA 4O0AA 1O80A 1CA6A 4IUVA 3SK6A 5BN5A 2OTLA 4C3IH 4B3MQ 2NVQB 5KRUA 2AUKA 3K5LA 3M9BA 4L5QA 1BCPD 5FLMH 2VZAA 2I07B 4DV4Q 4DR2Q 3K0YA 4C2MH 2V1CC 3QOJA 1JOQA 2PI2E 2NVQH 5LMNL 1EU4A 3PO2G 1I6HB 1IBLL 1QJOA 5ELFA 4R8NA 1CSQA 1HCZA 1BCPC 5AFWA 4E6IA 4EQPA 1OXUA 3KBGA 4JI6L 1ILPA 4GOPC 5CV7A 5C6AA 1D8LA 4HR7B 1H9JA 1MBYA 5M3MH 3N52A 1EIHA 1EUJA 2ZM6L 3UE1A 1O7IA 1D5ZC 2JJQA 4L8JA 4BXXG 1CA5A 3Q24A 1H95A 2UXCQ 1DOLA 1C48A 3CAMA 5EBDA 1F9PA 4B9XA 3PV0A 1EY0A 2PW5A 4OIKA 1ASYA 4OO1I 2WB1E 2IJ0A 1JE4A 1K28A 3U58A 3UE0A 4JW0A 4A3BB 5D14A 4K14A 2A6HD 2JA9A 5DLQE 1SNPA 1YNJD 2RKSA 2Q2IA 4DR1Q 1IBKQ 1HNWQ 2BA0A 4NP5A 5KYIA 2VW9A 3T13A 3BVZA 5HURA 4XQNA 4IQZA 2JA6G 1EOVA 3S1QH 2VQFQ 3T1YL 4J8QA 4YWKA 5J1ZA 3SK4A 1X3GA 4ZCKA 1H9KA 3H3VI 2F0JA 2IHEA 1PH6A 2R92G 1G8ZD 1Q1EA 1UE6A 3HOZH 4CKBA 2L0CA 1SMYD 1JOKA 3CCEA 5IT9E 1HXYD 1RD9D 1I94Q 1Y69U 4JI6Q 4OWXB 4HJ7A 1R4QB 5E4WC 2RDFA 1D5MC 1LTAD 2B2YA 3K7UC 5E7NA 5LMNW 3T16A 5EPJA 1VQDA 1VQIA 2JA8H 1ZEQX 3OYYA 5FO8B 3DMUA 4DK3C 3H0GB 3H0GH 4C1NK 2G9DA 4V190 2VY3A 2F0KA 2NVTH 4ZYSA 1UE7A 5LMUL 4N9TA 1DGSA 4UAIA 3I8ZA 3OPOA 3KDFA 1A0IA 4R4CA 1C9OA 3W5OA 4X65Q 4BA1I 1CTMA 2PCFB 1WJJA 4AYBG 4F88A 1IBKL 3K7AH 3FEWX 1P8LA 1GM5A 4N8X1 1S5ED 1K0RA 1ENAA 4HSVA 5EGTA 3J7YW 3RN5A 4GLAC 2KQ3A 1D5XC 4KV6A 4RAUC 4G7OC 2LY7A 4BY7H 4DFAA 4Q5VA 5JOBA 1AEXA 2XRSD 2EJGC 1B9NA 3NTIA 1WFQA 2EPBA 1JJGA 1Y8PB 2PQAA 5ELEA 4IN3A 3M3YB 2LSSA 4QJFA 3JAML 2ATWA 4O2DA 1PVOA 2B2WA 4TQUS 3C1EA 3A8KE 4JBJA 4QB4A 5C4XG 4A93H 4AYBB 3OSOA 5KNBA 3DXJC 2KBNA 1PRTD 3TSSA 4RCNA 4XT3B 3I73A 3G48A 4Y7NH 5C3EB 1JJ2A 1XNRL 3HOZG 1FYCA 2VQEL 2GVBA 1PA6A 4YWLA 2H1EA 1ET6A 3KOJA 4ID6A 4CDCC 4WJWA 2ENBA 2X69A 2F0MA 1H9SA 1IW7D 2PZTA 4A3IH 3EJIA 5IT9L 3M4OH 2EIFA 5KIXA 2B8GA 3J7AF 1N34Q 3HOWB 2K28A 3HZXA 1VQKA 2NYZD 1TIID 4IJLA 1RHPA 3A55A 2UUAL 2NB0A 3I90A 1SLJA 3HOZB 1N36L 2F0UA 2C9OA 3MA2B 1MSHA 1B4OA 1SYFA 1K3BC 1NY4A 1T5XD 2XNAC 1Q8IA 3H6MA 4OHJA 2QEJC 2PYKA 4MTKA 4RHSA 4LF8Q 1RCVD 5IYCH 1BCPF 1WVLA 4DR4L 4DV7L 4C1NI 1CHQD 4B3TQ 4R9WA 3NBHA 5LMNQ 4R4OA 5A2QL 4FDBA 1SE2A 5EPKA 3F2UA 2CW0C 1VQ4A 1K83B 4XDXA 4DR6Q 3M4YA 5FLXc 1QB5D 1KRTA 1OTCA 1K8GA 4GKJL 1NMGA 5EAYA 1QUQB 2YV5A 1OXTA 2HDLA 4DGZA 1BF4A 2XIWA 5ISRA 4DV6L 2G9HD 1LTTD 4DAVA 1Z9FA 2QGQA 5CV9A 5BN4A 4R4TA 1ESRA 2HHHL 3BU2A 4RA8A 2KECA 5JJLA 4A75A 5I4DA 3HGBA 4LF6L 5C5MA 4KY6A 5CR3A 3D4RA 4OEMB 5FLXE 3HOUH 3HOYB 2CFMA 3GTPH 5FOBB 1R9TB 2E2HH 3GTMB 3J7A5 1ICWA 1QUQA 3EA6A 3URYA 4XYOA 4IFDI 1VQCA 1Q90A 2I5LX 1P16A 1IYJB 4P75A 5C4JB 1B70B 1F9RA 5DM63 4KKUA 2WINB 4K8IA 4POGA 3CCSA 4MIUA 1MD2D 2CQAA 2A1AA 2KA7A 1EYCA 2JA7H 4BBSG 4EQOA 1HR0L 3MXNA 3NBHB 5L37A 2UUBL 3H09A 4F8MA 1GOZA 1NBWA 3MWYW 4FF2A 3SK8A 4NXML 1PYSB 1SBBB 3PF4A 4ME5A 3PUWA 1KD1C 4LF7Q 2M00A 1HUMA 1Q86C 1F2YA 1I4GA 3GTOH 2NZ1D 3BJUA 1B9MA 2YTVA 3PIOA 4RGMA 3I4MG 4QIWE 4O1NA 4G4KA 1LACA 2A6HC 4CHTB 4JYAQ 4B08A 3PUZA 3HOWH 2K5HA 1Y1WH 4K8JA 1PMRA 1AN8A 1QILA 1TY2A 2EY1A 1BUVT 4GKKL 2SNSA 4FF4A 2FINB 2MJ8A 4X64L 3S1RH 1F2MA 1V43A 1H9MA 1MHWC 1N36Q 5BN3A 2A68D 3M4PA 2YU9H 1N33Q 5IODA 4AH6A 4NXMQ 2PMZB 3H3VC 4JCVE 1XX8A 2B2VA 3FKIG 1QZGA 2UUCL 4PZ8A 1SFOB 2VUMB 4XXEA 3PF5A 5M3MG 2K03A 4UPAA 4Z9CB 1EU3A 1XJVA 4YCVA 3HOVB 2PQAB 4JPBW 5GAEC 4A3MH 3RZDB 2R3ZA 1EIGA 1VQGA 4DA2A 4KI0A 4GKJQ 2EY5A 1PFNA 1G6PA 1EWIA 4DUZL 2BH8A 4N8FA 3MXUA 4CJ1B 2CH4W 3KF6A 1NCVA 1LM0A 5EKKA 3I2ZA 1KLUD 2VQEQ 1IYVA 4K2KA 3U9OA 3KFUA 4GS3A 3C1FA 3QWNA 3RMHA 3K58A 3PO2H 3ND8A 3S14H 1I50B 4JI1L 4WJ3M 1KABA 4CKEA 4DR2L 2HDMA 5D65A 4A3GH 1FGUA 4TKOB 2EVBA
chains in the Genus database with same CATH topology
2DJFC 1K3BC 1MHWC 2DJGC 1ICFB 4OEMB 4CDFC 4CDEC 4CDDC 4OELB 4CDCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJF C;  1K3B C;  1MHW C;  2DJG C;  1ICF B;  4OEM B;  4CDF C;  4CDE C;  4CDD C;  4OEL B;  4CDC C; 
#chains in the Genus database with same CATH topology
 4A93 B;  2NN6 I;  2PPB C;  3J81 c;  3V96 A;  3BZK A;  3SHL A;  1JMC A;  1GHJ A;  3PO2 B;  3IFD A;  5IGF A;  1BBW A;  1QE6 A;  4WJ4 A;  2O5J C;  1U4P A;  2ALY B;  3JAM i;  1X54 A;  4G7H C;  5I6Y A;  1V8Q A;  1D6E C;  2Y0S G;  2CWA A;  3DWQ A;  1GXD C;  1F9S A;  4IUT A;  4DV3 Q;  1LTI D;  4BY1 H;  4GOP B;  5CBE E;  2ZM6 Q;  3G7L A;  3TRZ A;  1VQ7 A;  4IAL A;  3RD4 A;  1FD7 D;  3VR5 A;  3VYT A;  2K04 A;  5K5P A;  4A3J H;  4A3D H;  3HOY G;  1KAW A;  2DUD A;  2HIV A;  3EVQ A;  2SDF A;  3FRP B;  1HH2 P;  5KGU A;  1BR9 A;  3ND9 A;  1CQF A;  2YTY A;  1Y14 B;  4A3E G;  4X65 L;  1AZP A;  3ONA B;  3EBE A;  1XNQ L;  2HUG A;  1TWG B;  2NN6 G;  2VQF L;  1YIT A;  2F0H A;  2EJM A;  5GAG C;  2FMC A;  5IY0 A;  1CQV A;  2F4I A;  4FVM A;  5CYU A;  4F7X A;  1LV9 A;  4KD3 A;  4LF6 Q;  1I4R A;  1CSP A;  3E9I A;  5IYB G;  4HCE A;  1N33 L;  1FGB D;  2VS1 A;  4YWM A;  2K50 A;  2EE1 A;  2P5Z X;  4RCO A;  4NKL A;  4MTN A;  1N32 L;  3R93 A;  1L1O C;  4H13 C;  2Q8I B;  5C3E G;  1PYW D;  1N8R C;  1EEI D;  3PIP 3;  1ML0 D;  4NPS A;  4PQX A;  1TU2 B;  3PO3 H;  2UXC L;  2AWO A;  1PRT C;  5H1S E;  1RJT A;  5JAV A;  1I5F A;  2A5H A;  3STB D;  5C0X I;  1A8V A;  4G7Z C;  1II3 A;  1R9T H;  3HOX H;  1YJN A;  1LTG D;  5I2Y A;  4JOI A;  5IP7 H;  5M5Y B;  4LF5 L;  1LUZ A;  3RNU A;  2F0O A;  1EFW A;  4J15 A;  3MXN B;  1FL0 A;  1S4Z A;  3Q22 A;  1RDP D;  1SE3 A;  1M90 C;  5FLX L;  1CKN A;  3L7Z C;  1B3A A;  2QKI C;  2HCC A;  4OIJ A;  4OXP A;  3PIO 3;  1YIJ A;  4OX9 L;  3HOX G;  1VQ9 A;  4ZQ3 A;  5I6W A;  1WI5 A;  3KDF B;  3C2P A;  2TMP A;  3OWF A;  1RL2 A;  5CMD A;  4KHV A;  4IPH A;  4GLV B;  1PH5 A;  3TZD A;  4PMB A;  2F0W A;  1S5D D;  3J80 i;  1A3V A;  2VXW A;  1JWU D;  1GVP A;  2AQ3 B;  2ZTE A;  1O7Y A;  2A69 C;  2EYL A;  5CV5 A;  3AMU A;  1Z6H A;  3NK9 A;  2R7D A;  1I94 L;  5IYB H;  4BA2 I;  4NB3 A;  1TWH H;  4RFB A;  2B2Y C;  3SR1 A;  1SYE A;  1WCM G;  2SNM A;  2UUC Q;  2YTX A;  1WOC A;  3L9A X;  2WV6 D;  2V4D A;  1U4R A;  1FR3 A;  3Q0A A;  4R1J A;  4H44 C;  5M5X H;  1CZW A;  1JWM D;  3NQI A;  3I4M H;  2HCI A;  3S15 H;  2Z4H A;  5T1I A;  1N34 L;  1GHK A;  3NXW A;  2SEB D;  2F52 A;  4IOA A;  3CHB D;  3AQQ A;  2YU9 B;  2KUM A;  4AYB E;  2WP8 J;  4L5S A;  2QIL A;  3GTJ B;  1A6X A;  1JIC A;  3TQY A;  5C0X H;  5C44 B;  4JI7 Q;  4HJ5 A;  5DNF A;  4A3I B;  1XTD A;  2JA6 B;  4LUZ A;  5ELN A;  1K73 C;  1PH7 A;  2XVS A;  5JVG 3;  2Z1C A;  2IL8 A;  4BBS H;  3BZC A;  1HQM C;  4X3K A;  2SOB A;  4JI2 L;  3I55 A;  1X9N A;  3D8G A;  1SNM A;  3NEM A;  4JK1 C;  4DXG A;  3N6R A;  2F0E A;  4L6T B;  1AE2 A;  1C7Y A;  1X6O A;  3Q6S A;  2CVR A;  3KK7 A;  3E5S A;  1X3F A;  2Q2U A;  2K33 A;  1M4V A;  5ELB A;  5J39 A;  1HQR D;  2QW7 A;  3VYR A;  1VQ6 A;  5IGD A;  2UUB Q;  4LMQ D;  4A3J B;  1STG A;  1EQQ A;  2QCP X;  1EY7 A;  1UE5 A;  4BY7 B;  4BWG B;  2ES2 A;  1GUW A;  2H5X A;  3CCQ A;  2WAQ B;  4P71 A;  5D3I B;  3BS1 A;  3R3O A;  4PG3 A;  3I4O A;  4PV1 C;  4DV7 Q;  4IO9 A;  1PH4 A;  2HT1 A;  5GAH C;  4UP8 A;  2Z4I A;  1ZKO A;  2NZO A;  1A2U A;  1U0L A;  4A3E H;  4X3T A;  1OXX K;  4DV4 L;  1L0Y B;  1SAP A;  4CGY B;  4DPG A;  1WTX A;  4IPG A;  4TSS A;  3H0G G;  4DR6 L;  2GVA A;  1PYB A;  3NPP A;  5IP9 G;  4BY1 B;  3Q23 A;  1XXG A;  3A7L A;  1LTR D;  5LL6 X;  4JI5 L;  4K2L A;  2F1M A;  3VDY A;  4ZK9 B;  4GN4 B;  4X66 Q;  2Y0S B;  5G3L F;  3KBX A;  2BCO A;  2E2I B;  1HTP A;  5IGE A;  1Q46 A;  3HG9 A;  4JI2 Q;  4MN3 A;  1TKW B;  4R4I A;  1KHI A;  3AYH B;  3KF8 A;  4PNY A;  3KUP A;  1PZK D;  5ELO A;  2E2J B;  3TRE A;  2E2J H;  3O13 A;  3PCO B;  3K81 C;  2Q2H A;  3IL8 A;  1TS2 A;  1PLF A;  2DY7 A;  3D6W A;  3IRB A;  5M3F G;  3FPP A;  1L0W A;  3FKI B;  1QVG A;  3VA7 A;  2B39 A;  2UXD Q;  2AQ1 B;  2JEA I;  5DAU A;  2NVY H;  4NMZ A;  4A3G G;  2IY5 B;  1HZA A;  1VS0 A;  3ERS X;  5IWA L;  3HOV H;  4IUN A;  2RA4 A;  4DV0 Q;  1HNZ Q;  1HNW L;  3PUY A;  3TBI B;  1HZ9 A;  3FHW A;  1A15 A;  1KNE A;  1VF7 A;  3K7A B;  4CDD C;  4OEL B;  4Q0F A;  3S1M B;  2AMC B;  1W6K A;  2NVY B;  1B8A A;  1MJE A;  2O5I C;  2KCC A;  1ENC A;  1KLG D;  2NN6 H;  1EQR A;  2IX1 A;  4IFD G;  4DR7 Q;  3M4Q A;  2FXQ A;  3I4N H;  1GO3 E;  2A74 C;  1TWH B;  1YNJ C;  3P20 A;  2N55 A;  2K32 A;  3Q8D A;  4QMG A;  1PDQ A;  4HIO A;  5K36 H;  1LTL A;  4XQJ A;  3CC2 A;  2N88 A;  2WKC A;  1K0S A;  3T56 B;  2XN9 C;  3E0E A;  1EIY B;  1J8I A;  1LT4 D;  2R92 B;  1QNK A;  4JI3 L;  1STH A;  2D62 A;  3GDE A;  1WYD A;  4A4I A;  1YNN D;  4BY1 G;  2EJF C;  4WRD A;  5IYC G;  3S1N H;  1I3Q H;  2F3W A;  2KOL A;  1PTO F;  4FXK C;  1VQE A;  1WCM H;  2JEB I;  3VR4 A;  3M3Y H;  5CV4 A;  2JA7 B;  2E2D C;  3DWA A;  2ICE C;  4EVO A;  3RZD H;  2NTT A;  4DUZ Q;  2EYM A;  2IX3 A;  4HID A;  4POF A;  3CQZ H;  5C44 H;  3S1M H;  1LLR D;  2JA5 B;  2L11 A;  3CCR A;  1MI2 A;  3UDF A;  3VR6 A;  4HCS A;  3DLL A;  5IGC A;  3M7G A;  1E2V A;  4JI4 Q;  3UI2 A;  3PUX A;  1PH8 A;  5JEA H;  1IW7 C;  1CZG A;  5C4Z A;  3QJY A;  4FF3 A;  1PFB A;  4JI5 Q;  1TS3 A;  3GTQ H;  2K75 A;  2ID0 A;  3K5O A;  1NUC A;  2EYH A;  2L1B A;  4IFD J;  1SYB A;  3I4N G;  1PHJ A;  2E2H B;  5BR8 L;  1PFM A;  4IFD H;  2I5H A;  3LWE A;  3F1Z A;  4FNF A;  3QO2 A;  2CH4 A;  4LFC L;  2HQE A;  4A3C G;  1VQ5 A;  1K8O A;  4RGO S;  1L2F A;  1ESF A;  4KY7 A;  3J7Z C;  1PH3 A;  3R2T A;  2XRQ D;  1XPU A;  1SE8 A;  2F4V Q;  4FF1 A;  4QUC A;  1U5K A;  1TWF H;  1WTO A;  3CD6 A;  4DV1 Q;  4LJZ C;  4C3I G;  2HHH Q;  4ZKB B;  2MNA A;  4MHE A;  2UXD L;  3ERO A;  2UU9 L;  1EQT A;  5J3B A;  4IOC A;  2RDH A;  4X6A H;  4WOR A;  2WAC A;  4OGQ C;  2K5N A;  3FP9 A;  1NMF A;  3PUV A;  2J4X A;  2LFN A;  2NTS A;  2PI2 A;  4QL5 A;  4ABN A;  3S1Q B;  1Y1V B;  4ULL A;  2KCN A;  2DN8 A;  4X3U A;  2CCZ A;  1STE A;  1NR2 A;  4KY5 A;  4DR5 Q;  1Y1W G;  3S24 A;  3HOW G;  3GTP B;  1AZQ A;  4DV5 L;  2E5L L;  3NP8 A;  2K14 A;  4XIG S;  2LXJ A;  3OMG A;  2Y0S E;  5CGK A;  1KDA A;  1HNX L;  3DEP A;  4X66 L;  4C3H B;  3H91 A;  1BVS A;  4AQY L;  1PRT F;  5IGG A;  1B44 D;  1NNX A;  3NE5 B;  2OF1 A;  2WAQ G;  2FHT A;  4KLK A;  4V0B A;  1K3R A;  1EY6 A;  3S16 H;  2RSN A;  2MP1 A;  3OW7 A;  2IWH A;  2XTI A;  1KNA A;  3FDT A;  5C4H A;  2KCT A;  4CJ2 C;  4ZLT F;  4EX5 A;  3SVM A;  4QGU A;  5FK9 C;  3IKJ A;  1GJX A;  3HKS A;  2OT2 A;  2C35 B;  2JSO A;  1CFM A;  4JBW A;  2D0P A;  2GA4 B;  1SSO A;  5A35 A;  1Y1V G;  3D4W A;  4JI0 L;  3HOX B;  1JOR A;  1F2Z A;  1J5E L;  1TQO A;  2Z9H A;  1E7Z A;  2LKV A;  1F9Q A;  3I4N B;  4RWS C;  2ZJR A;  1Y1V H;  5ELC A;  4A3K H;  3NBI A;  5KNC A;  3IFT A;  3U4V A;  4TRD A;  4ZRZ A;  4JI4 L;  1PTO H;  4JBK A;  5ELD A;  2OXP A;  1TR5 A;  1SNQ A;  1MGS A;  3NHH A;  2B2U A;  3MXG A;  4CDE C;  4BS9 A;  5JJK A;  2EDG A;  4H02 A;  2F0F A;  2M9V A;  2N78 A;  2EY2 A;  2PNH A;  2B29 A;  2VUM G;  2Z6K C;  1GUG A;  1V9P A;  1XWE A;  1AFP A;  3CQZ B;  1MKH A;  4CKC A;  3X3M A;  1JQY D;  1J5E Q;  3FKI H;  3MTS A;  4MNO A;  1WCM B;  3EFX D;  4K5X A;  2VL6 A;  1YNX A;  3A7A B;  3S16 B;  1MIU A;  2MO0 A;  1DYQ A;  2D5D A;  4FXD A;  3M4O B;  3ITP A;  1HR0 W;  3CXC A;  2GN5 A;  5IE8 A;  3V05 A;  1KQS A;  3BG3 A;  3ZYY X;  1SNO A;  2VB2 X;  1E22 A;  5M5W H;  1YHA A;  4DV5 Q;  1SR3 A;  2E2I H;  4DAM A;  1QVC A;  2NZH A;  5M3M B;  1RTO A;  3TDQ A;  1D1I A;  1R4P B;  2IPK D;  5M5Y H;  3JAM c;  3UDX A;  4TVA B;  4C3J G;  4DV6 Q;  3K8A A;  2NBF A;  2H4O A;  3D6C A;  3ULL A;  1A62 A;  3P1H A;  1TWA B;  3A8J E;  3SEB A;  1WTW A;  5M3F B;  4DV3 L;  3CCL A;  3J80 c;  1Q81 C;  1BQQ T;  3RLF A;  4EGV A;  5C4J H;  2N3S A;  2B2U C;  2JA8 G;  3S17 B;  1PH2 A;  1W6J A;  3E3X A;  3H3V H;  2F0G A;  1EEF D;  2K01 A;  3V2T A;  3U4Z A;  2N8N A;  4A3C H;  4JBM A;  3RUZ A;  1E0B A;  5C4X H;  3GTL H;  1BDO A;  3S2H B;  1NR4 A;  1V1P A;  1GUN A;  1X3Q A;  4YCU A;  4K5W A;  3OW2 A;  4PZ7 A;  1PFS A;  2F0Q A;  5M5W B;  1A3T A;  2RVL A;  3LNN A;  4M1U B;  4DV1 L;  3J81 L;  3RZO H;  4C56 C;  1WTR A;  1CKN B;  2F3V A;  1JT8 A;  2F0D A;  3NUC A;  3U50 C;  5EKI A;  4A3F G;  3S14 B;  5C0X J;  3TZU A;  1STN A;  1HZC A;  4OWW B;  3IAY A;  3P7J A;  2CW0 D;  4X3S A;  1XPO A;  1BBU A;  1YBY A;  3TP8 A;  2RCF A;  3LWU A;  3TP5 A;  1G2S A;  1VCI A;  5C4X B;  3GTJ H;  1WD0 A;  4DAY A;  1SJE D;  3ICE A;  2L9H A;  1STY A;  1LYL A;  2WFW A;  2CHB D;  1KL9 A;  4DU9 A;  3PMF A;  1M1K C;  2E76 C;  4DUY Q;  5K36 G;  4UDU C;  1A3U A;  2E75 C;  4A3B H;  4JC0 A;  4K0K L;  1SND A;  2EYF A;  4GNX B;  1EQV A;  1HPC A;  3HKZ E;  4A3K B;  3GTK H;  3KLS A;  4DNI A;  2KJX A;  4NW2 A;  3A74 A;  2CWP A;  3G6J B;  2AQ2 B;  1ET9 A;  1E2Z A;  1C0A A;  2LXK A;  1BOS A;  1UEA B;  5IP9 H;  1TWC H;  3PQI A;  2A69 D;  2WII B;  2F0N A;  5I9O A;  1HRJ A;  1BKB A;  3D31 A;  1E3P A;  4N9P A;  1AW7 A;  2K52 A;  2IHF A;  2X6L A;  2MQH A;  2BDO A;  3GV6 A;  2NVX H;  1B7Y B;  1FNU A;  4GZY C;  1WTQ A;  1SE4 A;  1I4Q A;  2DNE A;  2R7F A;  5COY A;  1QG7 A;  1S5B D;  3CCV A;  1G6Z A;  4HJA A;  1E1T A;  1BXT A;  1SXT A;  3MFG A;  1YZ6 A;  1EYG A;  4ME3 A;  1RF2 D;  4C2M B;  1DXM A;  3QG1 A;  4KKS A;  3CCJ A;  1Q1B A;  3NTH A;  5KYL A;  1E2W A;  4JI1 Q;  4LFC Q;  4P73 A;  2DNC A;  3AEV A;  3RR5 A;  4RG1 A;  1LTB D;  1VQF A;  1Z7T A;  4DR4 Q;  4GLX A;  1BCP B;  5COR A;  4A76 A;  1GUS A;  4M8A A;  2F0L A;  4LAA A;  1S5F D;  5CV8 A;  3BYT B;  4KD4 A;  2J7Z A;  5JJZ A;  2IX0 A;  4CDF C;  4MZ9 A;  4DV0 L;  4OON A;  1EY9 A;  5JPM C;  3KF8 B;  2RF4 A;  3EN2 A;  4BBR H;  4BBR B;  1S5C D;  3F8T A;  4XTC S;  2NVT B;  3M7N A;  2B2T A;  4C3J H;  4JV5 Q;  1IBM L;  1XPR A;  2PZW A;  2EYO A;  2JYO A;  4DKA C;  2RQX A;  1VQH A;  2A8V A;  1LO5 D;  2K5D A;  2JN4 A;  2JXM B;  1NE3 A;  4QY7 A;  3AFP A;  2B2W C;  2RHQ B;  1K83 H;  3D4D A;  3S2H H;  1NAP A;  4HJ8 A;  3HOV G;  3G4S A;  4I7A A;  4P74 A;  3S2D B;  3NEL A;  4RHR A;  3T53 B;  4RKB A;  4BBR G;  3PO3 B;  1SEB D;  3K5N A;  5HGQ A;  3BDC A;  3GQB A;  4B3T L;  2L12 A;  1QWY A;  2MPM A;  1L1O A;  4DN4 M;  4JI8 Q;  4DUY L;  1AP0 A;  3KYH C;  4JI3 Q;  3W1G A;  1EOT A;  2EOT A;  4QQB X;  5I2X A;  3S2D H;  3A5U A;  3CMA A;  2Q8T A;  4RKL A;  3CCM A;  4IUR A;  3S1N B;  4OL7 A;  1J6Q A;  5EJW A;  1I4H A;  1KIX A;  2Q8R E;  3MFY A;  4GN5 A;  2A68 C;  3K0X A;  3I3C A;  4LFA L;  2F0V A;  1S40 A;  1DOM A;  1VQB A;  2FMM A;  4IUP A;  1O78 A;  1TWG H;  3UDI A;  1I3Q B;  1VDZ A;  4JVZ A;  2A73 B;  3G6E A;  3ULP A;  2EXD A;  4KK7 A;  3J7A V;  1H9R A;  4A3L H;  1J9O A;  3GD7 A;  2QDL A;  4JG2 A;  1YVC A;  4KKT A;  2ZXP A;  1SRO A;  4K6L A;  5JEA J;  1EYD A;  5HGT A;  1IBM Q;  4C3H H;  4DR5 L;  1GKH A;  3SDZ A;  2JA6 H;  3WDN A;  1YEZ A;  3DUZ A;  2VB3 X;  1OXS C;  1ROD A;  5D3D A;  1FVI A;  1FJG L;  1CI3 M;  2F0S A;  4I65 A;  3CC7 A;  1HZB A;  2Z0S A;  5C3W A;  2JE6 I;  1SJH D;  2J0T D;  3JAM E;  4B9W A;  2OWO A;  1V1Q A;  1EY8 A;  1HFG A;  3HKZ G;  3X3N A;  3K57 A;  4C3H G;  1VQP A;  3W2D A;  3CC4 A;  1IKM A;  5M5X B;  1SDF A;  3GTQ B;  2BA1 A;  5GQO A;  1VQ8 A;  4LUV A;  2O4X A;  5EQ0 A;  4ZAI A;  3VYS A;  1V1O A;  4IZ8 A;  4JI8 L;  2R93 G;  1G2T A;  3A56 A;  1UUP A;  2JK8 A;  5DEH A;  5AJ3 L;  2F03 A;  2KEN A;  3EIV A;  4A3F B;  2JP1 A;  4PMC A;  1STB A;  2PMZ E;  3I70 A;  3M85 A;  1HUN A;  1B1Z A;  2JA5 H;  5T1G A;  3MXP A;  5IT9 c;  3J80 L;  2RHS B;  1KDB A;  4CBV A;  1DOK A;  4HN7 A;  1TWF B;  4RGN A;  1LT6 D;  4LW1 A;  4J6H A;  5FLM G;  1A63 A;  2QA4 A;  1TS4 A;  2D0O A;  2JA5 G;  5E3F A;  5C3X A;  4YHH Q;  1VMC A;  1KAA A;  4LF8 L;  4YY3 L;  1HFN A;  1VQJ A;  1UWV A;  3F2D A;  2OCE A;  1EWC A;  1LAB A;  1X55 A;  3VR2 A;  1SMY C;  4DV2 L;  1QNU A;  2R93 H;  3BDL A;  3STB C;  1O7Z A;  1VF5 C;  3HOU G;  4ODG A;  2WB1 B;  4HTH A;  4DR1 L;  4A3D B;  1XYI A;  1DJR D;  1ONL A;  1TWA H;  4ZUJ A;  4NDX A;  2ZTC A;  2F0T A;  2K05 A;  5IWA Q;  3T1Y Q;  3TEH B;  1EL0 A;  2X6G A;  4KHP Q;  4B3S Q;  4IUU A;  4L5R C;  2F0I A;  4XYQ A;  3R8B A;  3U9S A;  3MZ5 A;  4QUF A;  4U68 A;  5FJ8 G;  4YY3 Q;  1B2T A;  5JVH 3;  3P75 A;  3BDO A;  4KTA A;  1DON A;  2AUJ D;  5DM7 3;  1O7L A;  2KVM A;  3T1H Q;  4DR7 L;  1A2T A;  2LS0 1;  3HEJ A;  2UUA Q;  2TSS A;  1SNC A;  1UNS A;  2D2C C;  3W1B A;  1QVF A;  3BVM A;  1W2B A;  1CUK A;  5A2Q E;  2B2V C;  3TN2 A;  4A3B G;  4B3R Q;  1XNQ Q;  3NTK A;  4BY7 G;  1CT1 D;  2B8F A;  3C3L A;  1RTN A;  1TXY A;  4YHH L;  2B3G A;  4EQN A;  3KJO A;  2ZJQ A;  5IP7 G;  1QCB D;  2WB1 G;  4X62 Q;  4A3D G;  1IYU A;  3J80 E;  1H9S B;  4OWT B;  2XSC A;  3CCU A;  1AE3 A;  3R2I A;  1HJP A;  2F4V L;  1UAP A;  4L5T A;  1HR0 Q;  3OHX C;  4DR3 L;  3J81 j;  3K6O A;  4CJ0 B;  1T9H A;  2DY8 A;  2MGS A;  4QCL A;  3SGI A;  4R4Q A;  2N49 A;  2A19 A;  1DZ1 A;  4FXG C;  1JWS D;  3L2P A;  3DM1 A;  1LT5 D;  1KC8 C;  2PQE A;  2ZXO A;  2K5W A;  5M3F H;  3PIP A;  1DCZ A;  4DAP A;  1ZYR C;  3MHB A;  3GO5 A;  1SFO H;  3FVQ A;  3CF5 A;  2AKW B;  5NUC A;  3I7F A;  3W3A A;  1SYC A;  2AHO B;  5J22 A;  3HRZ C;  1I6V C;  3HFZ B;  4KN7 C;  1YNN C;  1IHZ A;  1ZXT A;  2ICI A;  1JJC B;  4X62 L;  3GTG B;  1RIP A;  3AU7 A;  5E1F A;  3PGZ A;  1ZYR D;  1ASZ A;  2ZJP A;  2R93 B;  1T5E A;  4FYD A;  3A54 A;  4A3G B;  5LL6 S;  2FFK B;  4HSP A;  5JEA G;  3NQT A;  1VQN A;  1JE5 A;  1OXV A;  2HD3 A;  1IXR A;  3OOC A;  4A3J G;  4KHZ A;  3NWS A;  4DV2 Q;  4IPC A;  2NVX B;  3AFQ A;  3K80 C;  3WOE A;  3KJP A;  1IBL Q;  1FJG Q;  1TVX A;  4GNX C;  2IW3 A;  3G71 A;  1PTO D;  3NSW A;  4H0L C;  4Y7N B;  3MEF A;  1D2B A;  3CU7 A;  2JQO A;  2RBM A;  2Z6K A;  5BR8 Q;  4EQ5 A;  2B63 G;  5JJI A;  1S72 A;  1V1P B;  4J1M A;  4HED A;  1IL8 A;  3T1H L;  2K5V A;  1XMO L;  4O42 A;  1U4M A;  3UDG A;  1GUT A;  1NTG A;  4P2C B;  1BO0 A;  1FNV A;  4R8I A;  3I56 A;  4B3R L;  3T4A C;  2MHV A;  4FP5 D;  4JYA L;  4LF9 L;  1N9W A;  1D7Q A;  3LGJ A;  1L0X B;  2K5Q A;  3CME A;  4DXF A;  2HIX A;  1G91 A;  1VQO A;  1KTK A;  2DJG C;  1WTV A;  5IOC A;  2E5L Q;  2XWB B;  5KND A;  4X64 Q;  1EWH A;  1GD7 A;  3A5Z B;  4DR3 Q;  1EFI D;  3RN2 A;  2PO4 A;  2O2L D;  3H94 A;  5FJ8 H;  1SMX A;  3BZD B;  4DK6 C;  2K7V A;  4RMF A;  4C3J B;  4KMU C;  3D0F A;  2MFI A;  1I4P A;  3OIQ A;  4GN3 B;  2DJF C;  1IL2 A;  4ALP A;  3L3O C;  4PZ6 A;  4DNR B;  1X65 A;  5GRO A;  1DM0 B;  1TT2 A;  4XT1 B;  4LF9 Q;  2JA8 B;  5IIF A;  2A6E C;  1VQM A;  2I0Q A;  4IPD A;  1Z47 A;  2NUC A;  2BE5 D;  3GTG H;  4L63 B;  1STA A;  4AQY Q;  1ICF B;  3OIP A;  5EKL A;  1X56 A;  4I7Z C;  4ZUI A;  2B63 H;  1QOH A;  2EY6 A;  4ILW A;  4LFA Q;  3H15 A;  1MJC A;  1PXU A;  3MEH A;  1JB7 A;  4KHP L;  1XMQ L;  3HS0 C;  2CKZ B;  4DAY B;  2A6E D;  1EYA A;  2PNR C;  2KHI A;  1HA6 A;  5M9O A;  2E74 C;  3E6Z X;  1UEB A;  2BH2 A;  4KJN A;  2XGT A;  2K1B A;  3GTM H;  4LFB Q;  3I91 A;  4GNX A;  5HY6 A;  3CPF A;  3WWV A;  4OO1 H;  4A93 G;  5CV6 A;  2KCM A;  2RDG A;  3TME A;  4JI0 Q;  3TP6 A;  3SK5 A;  4UP7 A;  5TSS A;  5EBC A;  1PZJ D;  4DK1 A;  1TY0 A;  1QZH A;  1MSG A;  3CP0 A;  2I5M X;  1I50 H;  2WKD A;  3DEO A;  1N32 Q;  3DHQ A;  1Q12 A;  1ILQ A;  4OO1 G;  1HA5 A;  5C44 G;  2R7Z H;  1PV4 A;  1SYG A;  2Q2T A;  1VMP A;  4F87 A;  2EXZ A;  4APV A;  4A3K G;  1PH1 A;  2Z8L A;  2JA7 G;  3TP7 A;  2EZV A;  1CKO A;  3NEN A;  3J81 E;  2NWG A;  4XQQ A;  1K8M A;  3GP7 A;  2R7Z B;  5FKA C;  1IZ6 A;  2WAQ E;  2QF7 A;  3S17 H;  2QDB A;  2PZU A;  3B6Y A;  4BBS B;  1G29 1;  1YJW A;  4A3M B;  3GV3 A;  2EYP A;  3CRL C;  3T51 B;  3GTL B;  1C8C A;  3E0J A;  3KLW A;  4WFN 3;  2KEE A;  1S3O A;  4DF7 A;  5JPN C;  4JV5 L;  3S9W A;  4HMI A;  1WTP A;  1LTS D;  2I46 A;  2KHS A;  3S15 B;  2QEX A;  1ENF A;  1K9M C;  4G57 A;  4AIM A;  2R61 A;  3QB3 A;  4U67 3;  1G51 A;  2MO1 A;  2RSO A;  3S1R B;  2F0P A;  1EZ6 A;  4GOP A;  1X3P A;  2IT1 A;  2VNU D;  5C5L A;  1VQL A;  1CM9 A;  5C0X G;  4H7B A;  4LK1 C;  1EY4 A;  3ZJY C;  2R92 H;  3OTO Q;  1HTL D;  4LUO A;  3OWE B;  1CHP D;  2HQL A;  3GTO B;  4YIJ A;  4KJO A;  4RH6 A;  3ULJ A;  5C3E H;  4QF4 A;  1YI2 A;  1KRS A;  1K8A C;  4PMW A;  4A3M G;  2ZTD A;  1JR0 D;  1KXL A;  1Y8N B;  4DNT B;  2G5D A;  2C5C A;  3J81 i;  3VA5 A;  4UP9 A;  2UXB Q;  2L5T A;  3SXH A;  1I6H H;  1UE1 A;  3OMC A;  5CBA E;  3GTK B;  2FJ2 A;  3C46 A;  2UU9 Q;  1PTO B;  1VQA A;  3A8I E;  2MUY A;  3DWP A;  3KF6 B;  3K59 A;  1HHV A;  1HNZ L;  1L1O B;  2EYJ A;  3F2C A;  4OX9 Q;  3BVG A;  2ZT9 C;  2M2L A;  4HJ9 A;  3RLO A;  1PZI D;  3NWT A;  3WOF A;  1XTC D;  4NXN Q;  1WTH A;  4A3F H;  4LWC A;  1C4Q A;  4KN4 C;  3MAQ A;  4LF5 Q;  3TS2 A;  2LMC B;  1Y8O B;  1U4L A;  3MC0 B;  4RGT A;  5CC4 A;  1Q3L A;  2CQO A;  2Z6B A;  4IJH A;  1FNW A;  2K4K A;  4S3S A;  3A0J A;  4P72 A;  2VUM H;  2OEO A;  2L55 A;  4B3M L;  1SRU A;  2OQ0 A;  1KDC A;  1PTO C;  2L4N A;  3PO3 G;  1M8A A;  3MVV A;  3TS0 A;  5G3L D;  3E9H A;  1YJ9 A;  2XWJ B;  3FMC A;  2D9U A;  5GAD C;  3BYY B;  3CRK C;  1AH9 A;  2L15 A;  5AJ3 Q;  1Q7Y C;  1NJI C;  4K0K Q;  1X3E A;  3FPU B;  1OO9 B;  1WD1 A;  3QIA A;  3QOL A;  4FO2 A;  4Y52 H;  5F2D A;  4YCW A;  1Y1W B;  4JOI C;  1F2L A;  2YYZ A;  1NSN S;  4LF4 Q;  2UXB L;  1CK1 A;  1JOO A;  5KEE A;  1B3Q A;  2KHJ A;  5IYD H;  3KLS X;  4UY8 C;  2ZXR A;  3I4L A;  2RCN A;  3VR3 A;  5IGB A;  1X32 A;  2BOS A;  3CKI B;  4LF7 L;  1XMQ Q;  3I4M B;  4A3I G;  4A3E B;  3HP3 A;  1W3S A;  1GUO A;  4B3S L;  3L0O A;  1DD2 A;  2AWN A;  4IUQ A;  1YHB A;  3EQL C;  1JB3 A;  5IYD G;  2K6A A;  3OTO L;  3F2B A;  2F3I A;  2PW7 A;  3RLN A;  1LT3 D;  2DGY A;  4K6D A;  1IKL A;  1B53 A;  2B2T C;  2ASB A;  4GKK Q;  4C3I B;  4LFB L;  2B63 B;  1EIF A;  1RKN A;  2R7Z G;  4A3L G;  4HIM A;  4HMJ A;  3AB9 A;  1EZ8 A;  1PH9 A;  1E1O A;  1TS5 A;  4K5V A;  1HNX Q;  4JI7 L;  3CW2 C;  4LNQ A;  4BXX H;  5EPL A;  1BBX C;  2BDN A;  1E24 A;  2OTJ A;  4UHV A;  5I9P A;  3QR8 A;  1PRT B;  5E4X A;  4HAE A;  4QIW B;  1BNZ A;  3SE0 A;  3ER0 A;  3HKZ B;  2OQK A;  2R6G A;  1SYD A;  4ZKC B;  1U9R A;  1XMO Q;  5FO9 B;  2BE5 C;  1B50 A;  3HOY H;  1YHQ A;  3HOU B;  3PSI A;  3ERQ A;  1SN8 A;  3KLR A;  1XNR Q;  1EY5 A;  3LX0 A;  1TWC B;  3RZO B;  3D3R A;  5FO7 B;  4NXN L;  3DM3 A;  3CPW A;  5LHY 1;  1JC7 A;  1F77 A;  4DK0 A;  3VYU A;  1CKM A;  3K5M A;  1I4X A;  1Q82 C;  4HIK A;  5LMU Q;  1JCK B;  3I72 A;  3JC6 6;  2E8G A;  1D1K A;  2EQS A;  4LF4 L;  1Q8K A;  2KED A;  4O0A A;  1O80 A;  1CA6 A;  4IUV A;  3SK6 A;  5BN5 A;  2OTL A;  4C3I H;  4B3M Q;  2NVQ B;  5KRU A;  2AUK A;  3K5L A;  3M9B A;  4L5Q A;  1BCP D;  5FLM H;  2VZA A;  2I07 B;  4DV4 Q;  4DR2 Q;  3K0Y A;  4C2M H;  2V1C C;  3QOJ A;  1JOQ A;  2PI2 E;  2NVQ H;  5LMN L;  1EU4 A;  3PO2 G;  1I6H B;  1IBL L;  1QJO A;  5ELF A;  4R8N A;  1CSQ A;  1HCZ A;  1BCP C;  5AFW A;  4E6I A;  4EQP A;  1OXU A;  3KBG A;  4JI6 L;  1ILP A;  4GOP C;  5CV7 A;  5C6A A;  1D8L A;  4HR7 B;  1H9J A;  1MBY A;  5M3M H;  3N52 A;  1EIH A;  1EUJ A;  2ZM6 L;  3UE1 A;  1O7I A;  1D5Z C;  2JJQ A;  4L8J A;  4BXX G;  1CA5 A;  3Q24 A;  1H95 A;  2UXC Q;  1DOL A;  1C48 A;  3CAM A;  5EBD A;  1F9P A;  4B9X A;  3PV0 A;  1EY0 A;  2PW5 A;  4OIK A;  1ASY A;  4OO1 I;  2WB1 E;  2IJ0 A;  1JE4 A;  1K28 A;  3U58 A;  3UE0 A;  4JW0 A;  4A3B B;  5D14 A;  4K14 A;  2A6H D;  2JA9 A;  5DLQ E;  1SNP A;  1YNJ D;  2RKS A;  2Q2I A;  4DR1 Q;  1IBK Q;  1HNW Q;  2BA0 A;  4NP5 A;  5KYI A;  2VW9 A;  3T13 A;  3BVZ A;  5HUR A;  4XQN A;  4IQZ A;  2JA6 G;  1EOV A;  3S1Q H;  2VQF Q;  3T1Y L;  4J8Q A;  4YWK A;  5J1Z A;  3SK4 A;  1X3G A;  4ZCK A;  1H9K A;  3H3V I;  2F0J A;  2IHE A;  1PH6 A;  2R92 G;  1G8Z D;  1Q1E A;  1UE6 A;  3HOZ H;  4CKB A;  2L0C A;  1SMY D;  1JOK A;  3CCE A;  5IT9 E;  1HXY D;  1RD9 D;  1I94 Q;  1Y69 U;  4JI6 Q;  4OWX B;  4HJ7 A;  1R4Q B;  5E4W C;  2RDF A;  1D5M C;  1LTA D;  2B2Y A;  3K7U C;  5E7N A;  5LMN W;  3T16 A;  5EPJ A;  1VQD A;  1VQI A;  2JA8 H;  1ZEQ X;  3OYY A;  5FO8 B;  3DMU A;  4DK3 C;  3H0G B;  3H0G H;  4C1N K;  2G9D A;  4V19 0;  2VY3 A;  2F0K A;  2NVT H;  4ZYS A;  1UE7 A;  5LMU L;  4N9T A;  1DGS A;  4UAI A;  3I8Z A;  3OPO A;  3KDF A;  1A0I A;  4R4C A;  1C9O A;  3W5O A;  4X65 Q;  4BA1 I;  1CTM A;  2PCF B;  1WJJ A;  4AYB G;  4F88 A;  1IBK L;  3K7A H;  3FEW X;  1P8L A;  1GM5 A;  4N8X 1;  1S5E D;  1K0R A;  1ENA A;  4HSV A;  5EGT A;  3J7Y W;  3RN5 A;  4GLA C;  2KQ3 A;  1D5X C;  4KV6 A;  4RAU C;  4G7O C;  2LY7 A;  4BY7 H;  4DFA A;  4Q5V A;  5JOB A;  1AEX A;  2XRS D;  2EJG C;  1B9N A;  3NTI A;  1WFQ A;  2EPB A;  1JJG A;  1Y8P B;  2PQA A;  5ELE A;  4IN3 A;  3M3Y B;  2LSS A;  4QJF A;  3JAM L;  2ATW A;  4O2D A;  1PVO A;  2B2W A;  4TQU S;  3C1E A;  3A8K E;  4JBJ A;  4QB4 A;  5C4X G;  4A93 H;  4AYB B;  3OSO A;  5KNB A;  3DXJ C;  2KBN A;  1PRT D;  3TSS A;  4RCN A;  4XT3 B;  3I73 A;  3G48 A;  4Y7N H;  5C3E B;  1JJ2 A;  1XNR L;  3HOZ G;  1FYC A;  2VQE L;  2GVB A;  1PA6 A;  4YWL A;  2H1E A;  1ET6 A;  3KOJ A;  4ID6 A;  4CDC C;  4WJW A;  2ENB A;  2X69 A;  2F0M A;  1H9S A;  1IW7 D;  2PZT A;  4A3I H;  3EJI A;  5IT9 L;  3M4O H;  2EIF A;  5KIX A;  2B8G A;  3J7A F;  1N34 Q;  3HOW B;  2K28 A;  3HZX A;  1VQK A;  2NYZ D;  1TII D;  4IJL A;  1RHP A;  3A55 A;  2UUA L;  2NB0 A;  3I90 A;  1SLJ A;  3HOZ B;  1N36 L;  2F0U A;  2C9O A;  3MA2 B;  1MSH A;  1B4O A;  1SYF A;  1K3B C;  1NY4 A;  1T5X D;  2XNA C;  1Q8I A;  3H6M A;  4OHJ A;  2QEJ C;  2PYK A;  4MTK A;  4RHS A;  4LF8 Q;  1RCV D;  5IYC H;  1BCP F;  1WVL A;  4DR4 L;  4DV7 L;  4C1N I;  1CHQ D;  4B3T Q;  4R9W A;  3NBH A;  5LMN Q;  4R4O A;  5A2Q L;  4FDB A;  1SE2 A;  5EPK A;  3F2U A;  2CW0 C;  1VQ4 A;  1K83 B;  4XDX A;  4DR6 Q;  3M4Y A;  5FLX c;  1QB5 D;  1KRT A;  1OTC A;  1K8G A;  4GKJ L;  1NMG A;  5EAY A;  1QUQ B;  2YV5 A;  1OXT A;  2HDL A;  4DGZ A;  1BF4 A;  2XIW A;  5ISR A;  4DV6 L;  2G9H D;  1LTT D;  4DAV A;  1Z9F A;  2QGQ A;  5CV9 A;  5BN4 A;  4R4T A;  1ESR A;  2HHH L;  3BU2 A;  4RA8 A;  2KEC A;  5JJL A;  4A75 A;  5I4D A;  3HGB A;  4LF6 L;  5C5M A;  4KY6 A;  5CR3 A;  3D4R A;  4OEM B;  5FLX E;  3HOU H;  3HOY B;  2CFM A;  3GTP H;  5FOB B;  1R9T B;  2E2H H;  3GTM B;  3J7A 5;  1ICW A;  1QUQ A;  3EA6 A;  3URY A;  4XYO A;  4IFD I;  1VQC A;  1Q90 A;  2I5L X;  1P16 A;  1IYJ B;  4P75 A;  5C4J B;  1B70 B;  1F9R A;  5DM6 3;  4KKU A;  2WIN B;  4K8I A;  4POG A;  3CCS A;  4MIU A;  1MD2 D;  2CQA A;  2A1A A;  2KA7 A;  1EYC A;  2JA7 H;  4BBS G;  4EQO A;  1HR0 L;  3MXN A;  3NBH B;  5L37 A;  2UUB L;  3H09 A;  4F8M A;  1GOZ A;  1NBW A;  3MWY W;  4FF2 A;  3SK8 A;  4NXM L;  1PYS B;  1SBB B;  3PF4 A;  4ME5 A;  3PUW A;  1KD1 C;  4LF7 Q;  2M00 A;  1HUM A;  1Q86 C;  1F2Y A;  1I4G A;  3GTO H;  2NZ1 D;  3BJU A;  1B9M A;  2YTV A;  3PIO A;  4RGM A;  3I4M G;  4QIW E;  4O1N A;  4G4K A;  1LAC A;  2A6H C;  4CHT B;  4JYA Q;  4B08 A;  3PUZ A;  3HOW H;  2K5H A;  1Y1W H;  4K8J A;  1PMR A;  1AN8 A;  1QIL A;  1TY2 A;  2EY1 A;  1BUV T;  4GKK L;  2SNS A;  4FF4 A;  2FIN B;  2MJ8 A;  4X64 L;  3S1R H;  1F2M A;  1V43 A;  1H9M A;  1MHW C;  1N36 Q;  5BN3 A;  2A68 D;  3M4P A;  2YU9 H;  1N33 Q;  5IOD A;  4AH6 A;  4NXM Q;  2PMZ B;  3H3V C;  4JCV E;  1XX8 A;  2B2V A;  3FKI G;  1QZG A;  2UUC L;  4PZ8 A;  1SFO B;  2VUM B;  4XXE A;  3PF5 A;  5M3M G;  2K03 A;  4UPA A;  4Z9C B;  1EU3 A;  1XJV A;  4YCV A;  3HOV B;  2PQA B;  4JPB W;  5GAE C;  4A3M H;  3RZD B;  2R3Z A;  1EIG A;  1VQG A;  4DA2 A;  4KI0 A;  4GKJ Q;  2EY5 A;  1PFN A;  1G6P A;  1EWI A;  4DUZ L;  2BH8 A;  4N8F A;  3MXU A;  4CJ1 B;  2CH4 W;  3KF6 A;  1NCV A;  1LM0 A;  5EKK A;  3I2Z A;  1KLU D;  2VQE Q;  1IYV A;  4K2K A;  3U9O A;  3KFU A;  4GS3 A;  3C1F A;  3QWN A;  3RMH A;  3K58 A;  3PO2 H;  3ND8 A;  3S14 H;  1I50 B;  4JI1 L;  4WJ3 M;  1KAB A;  4CKE A;  4DR2 L;  2HDM A;  5D65 A;  4A3G H;  1FGU A;  4TKO B;  2EVB A; 
#chains in the Genus database with same CATH homology
 2DJF C;  1K3B C;  1MHW C;  2DJG C;  1ICF B;  4OEM B;  4CDF C;  4CDE C;  4CDD C;  4OEL B;  4CDC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...