4CDKA

Structure of znrf3-rspo1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
152
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structures of Wnt-Antagonist Znrf3 and its Complex with R-Spondin 1 and Implications for Signaling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 40
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4cdkA00
4C8UA 4OC1A 3BHXA 4OC2A 3BI0A 2JBKA 4NGQA 2XEIA 5D29A 3FEDA 2XEFA 4C8PA 4CDJA 3SJGA 4P4FA 2XEJA 2JBJA 4NGTA 4NGMA 4P4JA 4LQGA 4OC3A 4MCPA 4C8AA 4NGPA 4OC4A 3S9LA 3D7HA 3FF3A 3I74A 4C9AA 2PVWA 4P4BA 4P45A 2XEGA 4TWEA 3SJXA 3IIBA 3ICUA 3S9MA 3VTAA 4KNGE 1XF1A 4C9RA 4W9YA 3I6SA 5ELYA 3BI1A 4NGRA 4YN3A 4OC0A 4OMEA 4JZ0A 4C8TA 3D7GA 2EK9A 1DE4C 2C6GA 3BXMA 4P4DA 3SJEA 4P4IA 4P4EA 1Z8LA 3D7DA 4MCSA 2OR4A 3FEEA 2C6PA 1WVMA 3EIFA 4NGNA 3S9NA 2EK8A 3SJFA 4C8CA 3RBUA 4CDKA 4TJVA 3IWWA 5IB9A 2CIJA 4C86A 4MCQA 4MCRA 1V6CA 4C85A 4X3RA 4JYWA 2PVVA 4TJXA 4OC5A 4C8FA 2OOTA 4P44A 3KASA 1CX8A 4C84A 4C99A 4C9EA 5F09A 4NGSA 3D7FA 4C9VA 2C6CA 1Y9ZA 4C9UA 3FECA
chains in the Genus database with same CATH superfamily
4MJXA 4C8UA 4JVOA 3TLGB 4OC1A 3BHXA 1VBHA 2D0OA 3BI0A 4OC2A 1NBWA 2JBKA 4NGQA 1VI4A 2XEIA 1NXJA 5D29A 3FEDA 2XEFA 3T0TA 1EZAA 4C8PA 4CDJA 3SJGA 4P4FA 1T36B 1ZRSA 1A9XB 2GP4A 2JBJA 2XEJA 4NGTA 4NGMA 4P4JA 1ZYMA 4CO9A 1VBGA 2YJVA 4LQGA 2AUMA 2EZAA 4OC3A 1KBLA 3TLBA 4MCPA 2R82A 3C8OA 5F9MA 4C8AA 4NGPA 1CE8B 4OC4A 3S9LA 3D7HA 3FF3A 4M8DA 3I74A 1EZBA 4C9AA 2PVWA 2HROA 4P4BA 4P45A 2XEGA 1JDBC 1J3LA 4TWEA 3SJXA 3IIBA 3SR3A 5K99A 3T05A 1C30B 3ICUA 3S9MA 3VTAA 2B0AA 4KNGE 1XF1A 3K4IA 3EZEA 4C9RA 2DIKA 4W9YA 3I6SA 5ELYA 1ZL0A 3BI1A 4NGRA 2EZCA 3TLAA 4J0NA 4YN3A 2E28A 4OC0A 2OLSA 4OMEA 4MI1A 4JZ0A 4C8TA 3K9TA 1DIKA 2EK9A 3D7GA 1DE4C 3TLEA 2C6GA 2EZBA 3BXMA 4P4DA 5F5XA 3SJEA 4EYSA 3EZBA 2AUNA 4P4IA 2MP0A 4P4EA 1BXRB 1JDEA 1Z8LA 3TLCA 2HWGA 2HI6A 1Q5XA 1KEEB 3D7DA 4MCSA 2OR4A 3FEEA 3TLZA 2C6PA 2C5QA 3U1BA 1WVMA 5F1YA 4CZ1A 3EIFA 4INJA 3TLYA 4NGNA 3S9NA 1CS0B 2EK8A 3GJZA 4IIXA 3SJFA 3TYXA 3RBUA 4C8CA 4COGA 4CDKA 3EZAA 4H1HA 3IWWA 4TJVA 5IB9A 2CIJA 1M6VB 4C86A 4MCQA 1C3OB 3T5MA 4MCRA 1V6CA 4C85A 4X3RA 1GGOA 2PVVA 4JYWA 4TJXA 1R61A 3T07A 4E5SA 3TLGA 4OC5A 4C8FA 2OOTA 2X0SA 4P44A 3KASA 1CX8A 2D0PA 4C84A 5FD8A 4C99A 4COBA 3NOJA 4C9EA 4IIYA 3KRVA 5IR2A 4E94A 5F09A 5JVLA 1KC7A 2FM4A 2PCNA 2YJTA 4NGSA 3D7FA 4C9VA 5JYBA 2C6CA 1Y9ZA 3G23A 4C9UA 3FECA
chains in the Genus database with same CATH topology
4C8UA 4OC1A 3BHXA 4OC2A 3BI0A 2JBKA 4NGQA 2XEIA 5D29A 3FEDA 2XEFA 4C8PA 4CDJA 3SJGA 4P4FA 2XEJA 2GP4A 2JBJA 4NGTA 4NGMA 4P4JA 4LQGA 4OC3A 4MCPA 4C8AA 4NGPA 4OC4A 3S9LA 3D7HA 3FF3A 3I74A 4C9AA 2PVWA 4P4BA 4P45A 2XEGA 4TWEA 3SJXA 3IIBA 3ICUA 3S9MA 3VTAA 4KNGE 1XF1A 4C9RA 4W9YA 3I6SA 5ELYA 3BI1A 4NGRA 4YN3A 4OC0A 4OMEA 4JZ0A 4C8TA 3K9TA 3D7GA 2EK9A 1DE4C 2C6GA 3BXMA 4P4DA 3SJEA 4P4IA 4P4EA 1Z8LA 3D7DA 4MCSA 2OR4A 3FEEA 2C6PA 2C5QA 1WVMA 3EIFA 4NGNA 3S9NA 2EK8A 3SJFA 4C8CA 3RBUA 4CDKA 4TJVA 3IWWA 5IB9A 2CIJA 4C86A 4MCQA 4MCRA 1V6CA 4C85A 4X3RA 4JYWA 2PVVA 4TJXA 4OC5A 4C8FA 2OOTA 4P44A 3KASA 1CX8A 4C84A 4C99A 4C9EA 5IR2A 5F09A 4NGSA 3D7FA 4C9VA 2C6CA 1Y9ZA 4C9UA 3FECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8U A;  4OC1 A;  3BHX A;  4OC2 A;  3BI0 A;  2JBK A;  4NGQ A;  2XEI A;  5D29 A;  3FED A;  2XEF A;  4C8P A;  4CDJ A;  3SJG A;  4P4F A;  2XEJ A;  2JBJ A;  4NGT A;  4NGM A;  4P4J A;  4LQG A;  4OC3 A;  4MCP A;  4C8A A;  4NGP A;  4OC4 A;  3S9L A;  3D7H A;  3FF3 A;  3I74 A;  4C9A A;  2PVW A;  4P4B A;  4P45 A;  2XEG A;  4TWE A;  3SJX A;  3IIB A;  3ICU A;  3S9M A;  3VTA A;  4KNG E;  1XF1 A;  4C9R A;  4W9Y A;  3I6S A;  5ELY A;  3BI1 A;  4NGR A;  4YN3 A;  4OC0 A;  4OME A;  4JZ0 A;  4C8T A;  3D7G A;  2EK9 A;  1DE4 C;  2C6G A;  3BXM A;  4P4D A;  3SJE A;  4P4I A;  4P4E A;  1Z8L A;  3D7D A;  4MCS A;  2OR4 A;  3FEE A;  2C6P A;  1WVM A;  3EIF A;  4NGN A;  3S9N A;  2EK8 A;  3SJF A;  4C8C A;  3RBU A;  4CDK A;  4TJV A;  3IWW A;  5IB9 A;  2CIJ A;  4C86 A;  4MCQ A;  4MCR A;  1V6C A;  4C85 A;  4X3R A;  4JYW A;  2PVV A;  4TJX A;  4OC5 A;  4C8F A;  2OOT A;  4P44 A;  3KAS A;  1CX8 A;  4C84 A;  4C99 A;  4C9E A;  5F09 A;  4NGS A;  3D7F A;  4C9V A;  2C6C A;  1Y9Z A;  4C9U A;  3FEC A; 
#chains in the Genus database with same CATH topology
 4MJX A;  4C8U A;  4JVO A;  3TLG B;  4OC1 A;  3BHX A;  1VBH A;  2D0O A;  3BI0 A;  4OC2 A;  1NBW A;  2JBK A;  4NGQ A;  1VI4 A;  2XEI A;  1NXJ A;  5D29 A;  3FED A;  2XEF A;  3T0T A;  1EZA A;  4C8P A;  4CDJ A;  3SJG A;  4P4F A;  1T36 B;  1ZRS A;  1A9X B;  2GP4 A;  2JBJ A;  2XEJ A;  4NGT A;  4NGM A;  4P4J A;  1ZYM A;  4CO9 A;  1VBG A;  2YJV A;  4LQG A;  2AUM A;  2EZA A;  4OC3 A;  1KBL A;  3TLB A;  4MCP A;  2R82 A;  3C8O A;  5F9M A;  4C8A A;  4NGP A;  1CE8 B;  4OC4 A;  3S9L A;  3D7H A;  3FF3 A;  4M8D A;  3I74 A;  1EZB A;  4C9A A;  2PVW A;  2HRO A;  4P4B A;  4P45 A;  2XEG A;  1JDB C;  1J3L A;  4TWE A;  3SJX A;  3IIB A;  3SR3 A;  5K99 A;  3T05 A;  1C30 B;  3ICU A;  3S9M A;  3VTA A;  2B0A A;  4KNG E;  1XF1 A;  3K4I A;  3EZE A;  4C9R A;  2DIK A;  4W9Y A;  3I6S A;  5ELY A;  1ZL0 A;  3BI1 A;  4NGR A;  2EZC A;  3TLA A;  4J0N A;  4YN3 A;  2E28 A;  4OC0 A;  2OLS A;  4OME A;  4MI1 A;  4JZ0 A;  4C8T A;  3K9T A;  1DIK A;  2EK9 A;  3D7G A;  1DE4 C;  3TLE A;  2C6G A;  2EZB A;  3BXM A;  4P4D A;  5F5X A;  3SJE A;  4EYS A;  3EZB A;  2AUN A;  4P4I A;  2MP0 A;  4P4E A;  1BXR B;  1JDE A;  1Z8L A;  3TLC A;  2HWG A;  2HI6 A;  1Q5X A;  1KEE B;  3D7D A;  4MCS A;  2OR4 A;  3FEE A;  3TLZ A;  2C6P A;  2C5Q A;  3U1B A;  1WVM A;  5F1Y A;  4CZ1 A;  3EIF A;  4INJ A;  3TLY A;  4NGN A;  3S9N A;  1CS0 B;  2EK8 A;  3GJZ A;  4IIX A;  3SJF A;  3TYX A;  3RBU A;  4C8C A;  4COG A;  4CDK A;  3EZA A;  4H1H A;  3IWW A;  4TJV A;  5IB9 A;  2CIJ A;  1M6V B;  4C86 A;  4MCQ A;  1C3O B;  3T5M A;  4MCR A;  1V6C A;  4C85 A;  4X3R A;  1GGO A;  2PVV A;  4JYW A;  4TJX A;  1R61 A;  3T07 A;  4E5S A;  3TLG A;  4OC5 A;  4C8F A;  2OOT A;  2X0S A;  4P44 A;  3KAS A;  1CX8 A;  2D0P A;  4C84 A;  5FD8 A;  4C99 A;  4COB A;  3NOJ A;  4C9E A;  4IIY A;  3KRV A;  5IR2 A;  4E94 A;  5F09 A;  5JVL A;  1KC7 A;  2FM4 A;  2PCN A;  2YJT A;  4NGS A;  3D7F A;  4C9V A;  5JYB A;  2C6C A;  1Y9Z A;  3G23 A;  4C9U A;  3FEC A; 
#chains in the Genus database with same CATH homology
 4C8U A;  4OC1 A;  3BHX A;  4OC2 A;  3BI0 A;  2JBK A;  4NGQ A;  2XEI A;  5D29 A;  3FED A;  2XEF A;  4C8P A;  4CDJ A;  3SJG A;  4P4F A;  2XEJ A;  2GP4 A;  2JBJ A;  4NGT A;  4NGM A;  4P4J A;  4LQG A;  4OC3 A;  4MCP A;  4C8A A;  4NGP A;  4OC4 A;  3S9L A;  3D7H A;  3FF3 A;  3I74 A;  4C9A A;  2PVW A;  4P4B A;  4P45 A;  2XEG A;  4TWE A;  3SJX A;  3IIB A;  3ICU A;  3S9M A;  3VTA A;  4KNG E;  1XF1 A;  4C9R A;  4W9Y A;  3I6S A;  5ELY A;  3BI1 A;  4NGR A;  4YN3 A;  4OC0 A;  4OME A;  4JZ0 A;  4C8T A;  3K9T A;  3D7G A;  2EK9 A;  1DE4 C;  2C6G A;  3BXM A;  4P4D A;  3SJE A;  4P4I A;  4P4E A;  1Z8L A;  3D7D A;  4MCS A;  2OR4 A;  3FEE A;  2C6P A;  2C5Q A;  1WVM A;  3EIF A;  4NGN A;  3S9N A;  2EK8 A;  3SJF A;  4C8C A;  3RBU A;  4CDK A;  4TJV A;  3IWW A;  5IB9 A;  2CIJ A;  4C86 A;  4MCQ A;  4MCR A;  1V6C A;  4C85 A;  4X3R A;  4JYW A;  2PVV A;  4TJX A;  4OC5 A;  4C8F A;  2OOT A;  4P44 A;  3KAS A;  1CX8 A;  4C84 A;  4C99 A;  4C9E A;  5IR2 A;  5F09 A;  4NGS A;  3D7F A;  4C9V A;  2C6C A;  1Y9Z A;  4C9U A;  3FEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...