4CDKA

Structure of znrf3-rspo1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
152
Chain Sequence
ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Wnt-Antagonist Znrf3 and its Complex with R-Spondin 1 and Implications for Signaling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
total genus 40
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4cdkA00
3BHXA 4OC4A 1Z8LA 3SJXA 1XF1A 3D7HA 3BXMA 4LQGA 4C9RA 4TJVA 4JYWA 3EIFA 4P44A 4P45A 4C8CA 2JBJA 3IIBA 2C6CA 2JBKA 2XEJA 4C9UA 4P4IA 3D7GA 4P4JA 4NGSA 2C6GA 4OC3A 3FEEA 4CDKA 3SJFA 3BI0A 3BI1A 3VTAA 1V6CA 2C6PA 4W9YA 3I6SA 3KASA 3FF3A 4MCSA 2EK8A 4C8PA 4NGQA 4NGNA 5IB9A 3S9NA 3RBUA 3FEDA 3S9MA 4C9AA 2XEFA 4TWEA 2CIJA 4C8FA 4KNGE 5D29A 4NGPA 4X3RA 4MCQA 2XEIA 3I74A 4OC5A 3D7DA 2PVVA 4JZ0A 4NGRA 4OMEA 4C86A 4C99A 5ELYA 4CDJA 3SJGA 1WVMA 4TJXA 4NGMA 4P4BA 4C8UA 1DE4C 4YN3A 5F09A 1Y9ZA 3SJEA 4C8AA 4C8TA 2XEGA 4OC0A 4MCRA 4P4EA 3FECA 3S9LA 3D7FA 3IWWA 4C9VA 4C85A 4C9EA 4P4DA 4OC2A 4OC1A 4C84A 2OR4A 2OOTA 2PVWA 1CX8A 4P4FA 4MCPA 2EK9A 4NGTA 3ICUA
chains in the Genus database with same CATH superfamily
3BHXA 2C5QA 4OC4A 1Z8LA 2HI6A 5F1YA 5JYBA 3SJXA 1XF1A 3D7HA 1NXJA 3BXMA 4LQGA 4C9RA 1Q5XA 4TJVA 4JYWA 4IIYA 3EIFA 4CO9A 4P44A 2EZAA 4P45A 4M8DA 4C8CA 2JBJA 1J3LA 2C6CA 3IIBA 3KRVA 1KC7A 2JBKA 3TLGA 2XEJA 3NOJA 4C9UA 1JDBC 2FM4A 1VI4A 3D7GA 4P4IA 4MI1A 1T36B 4P4JA 2OLSA 4NGSA 2C6GA 2PCNA 4OC3A 3FEEA 3K9TA 4CDKA 3SJFA 1JDEA 3T5MA 3TLAA 2GP4A 3BI0A 3TLYA 3BI1A 3VTAA 1V6CA 3EZBA 2C6PA 4W9YA 3EZAA 3I6SA 4JVOA 3KASA 3FF3A 4MCSA 2EK8A 2B0AA 4C8PA 4NGQA 4NGNA 5IB9A 3S9NA 1R61A 1ZRSA 4INJA 3RBUA 3FEDA 3S9MA 4C9AA 1VBHA 2XEFA 4TWEA 2CIJA 4C8FA 1KBLA 3EZEA 2E28A 4KNGE 3TLGB 1CS0B 5D29A 3K4IA 4NGPA 4COGA 4CZ1A 4X3RA 1C3OB 1A9XB 1C30B 4MCQA 3GJZA 2XEIA 3I74A 4OC5A 3TLEA 1ZL0A 3D7DA 2PVVA 4COBA 1NBWA 4JZ0A 4NGRA 4OMEA 3SR3A 1BXRB 4C86A 4C99A 4E94A 5F9MA 2DIKA 5ELYA 4CDJA 1GGOA 3SJGA 1WVMA 4TJXA 3TLZA 2HROA 4NGMA 4P4BA 1KEEB 4C8UA 1EZBA 4H1HA 5FD8A 1DE4C 4YN3A 5F09A 1Y9ZA 2MP0A 3SJEA 4C8AA 1ZYMA 2YJVA 2EZBA 4C8TA 2XEGA 4OC0A 2D0PA 4MCRA 4P4EA 3G23A 3TYXA 5K99A 2AUMA 3FECA 1M6VB 3S9LA 1DIKA 3D7FA 3IWWA 4E5SA 4J0NA 1CE8B 4C9VA 1EZAA 2R82A 4C85A 4C9EA 3TLCA 2EZCA 4P4DA 2YJTA 4OC2A 4EYSA 4OC1A 3T05A 2D0OA 2HWGA 3T0TA 3TLBA 4C84A 3T07A 5JVLA 1VBGA 2OR4A 2X0SA 2OOTA 5IR2A 5F5XA 2PVWA 2AUNA 4IIXA 4MJXA 3U1BA 1CX8A 3C8OA 4P4FA 4MCPA 2EK9A 4NGTA 3ICUA
chains in the Genus database with same CATH topology
3BHXA 2C5QA 4OC4A 1Z8LA 3SJXA 1XF1A 3D7HA 3BXMA 4LQGA 4C9RA 4TJVA 4JYWA 3EIFA 4P44A 4P45A 4C8CA 2JBJA 3IIBA 2C6CA 2JBKA 2XEJA 4C9UA 4P4IA 3D7GA 4P4JA 4NGSA 2C6GA 4OC3A 3FEEA 3K9TA 4CDKA 3SJFA 2GP4A 3BI0A 3BI1A 3VTAA 1V6CA 2C6PA 4W9YA 3I6SA 3KASA 3FF3A 4MCSA 2EK8A 4C8PA 4NGQA 4NGNA 5IB9A 3S9NA 3RBUA 3FEDA 3S9MA 4C9AA 2XEFA 4TWEA 2CIJA 4C8FA 4KNGE 5D29A 4NGPA 4X3RA 4MCQA 2XEIA 3I74A 4OC5A 3D7DA 2PVVA 4JZ0A 4NGRA 4OMEA 4C86A 4C99A 5ELYA 4CDJA 3SJGA 1WVMA 4TJXA 4NGMA 4P4BA 4C8UA 1DE4C 4YN3A 5F09A 1Y9ZA 3SJEA 4C8AA 4C8TA 2XEGA 4OC0A 4MCRA 4P4EA 3FECA 3S9LA 3D7FA 3IWWA 4C9VA 4C85A 4C9EA 4P4DA 4OC2A 4OC1A 4C84A 2OR4A 2OOTA 5IR2A 2PVWA 1CX8A 4P4FA 4MCPA 2EK9A 4NGTA 3ICUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BHX A;  4OC4 A;  1Z8L A;  3SJX A;  1XF1 A;  3D7H A;  3BXM A;  4LQG A;  4C9R A;  4TJV A;  4JYW A;  3EIF A;  4P44 A;  4P45 A;  4C8C A;  2JBJ A;  3IIB A;  2C6C A;  2JBK A;  2XEJ A;  4C9U A;  4P4I A;  3D7G A;  4P4J A;  4NGS A;  2C6G A;  4OC3 A;  3FEE A;  4CDK A;  3SJF A;  3BI0 A;  3BI1 A;  3VTA A;  1V6C A;  2C6P A;  4W9Y A;  3I6S A;  3KAS A;  3FF3 A;  4MCS A;  2EK8 A;  4C8P A;  4NGQ A;  4NGN A;  5IB9 A;  3S9N A;  3RBU A;  3FED A;  3S9M A;  4C9A A;  2XEF A;  4TWE A;  2CIJ A;  4C8F A;  4KNG E;  5D29 A;  4NGP A;  4X3R A;  4MCQ A;  2XEI A;  3I74 A;  4OC5 A;  3D7D A;  2PVV A;  4JZ0 A;  4NGR A;  4OME A;  4C86 A;  4C99 A;  5ELY A;  4CDJ A;  3SJG A;  1WVM A;  4TJX A;  4NGM A;  4P4B A;  4C8U A;  1DE4 C;  4YN3 A;  5F09 A;  1Y9Z A;  3SJE A;  4C8A A;  4C8T A;  2XEG A;  4OC0 A;  4MCR A;  4P4E A;  3FEC A;  3S9L A;  3D7F A;  3IWW A;  4C9V A;  4C85 A;  4C9E A;  4P4D A;  4OC2 A;  4OC1 A;  4C84 A;  2OR4 A;  2OOT A;  2PVW A;  1CX8 A;  4P4F A;  4MCP A;  2EK9 A;  4NGT A;  3ICU A; 
#chains in the Genus database with same CATH topology
 3BHX A;  2C5Q A;  4OC4 A;  1Z8L A;  2HI6 A;  5F1Y A;  5JYB A;  3SJX A;  1XF1 A;  3D7H A;  1NXJ A;  3BXM A;  4LQG A;  4C9R A;  1Q5X A;  4TJV A;  4JYW A;  4IIY A;  3EIF A;  4CO9 A;  4P44 A;  2EZA A;  4P45 A;  4M8D A;  4C8C A;  2JBJ A;  1J3L A;  2C6C A;  3IIB A;  3KRV A;  1KC7 A;  2JBK A;  3TLG A;  2XEJ A;  3NOJ A;  4C9U A;  1JDB C;  2FM4 A;  1VI4 A;  3D7G A;  4P4I A;  4MI1 A;  1T36 B;  4P4J A;  2OLS A;  4NGS A;  2C6G A;  2PCN A;  4OC3 A;  3FEE A;  3K9T A;  4CDK A;  3SJF A;  1JDE A;  3T5M A;  3TLA A;  2GP4 A;  3BI0 A;  3TLY A;  3BI1 A;  3VTA A;  1V6C A;  3EZB A;  2C6P A;  4W9Y A;  3EZA A;  3I6S A;  4JVO A;  3KAS A;  3FF3 A;  4MCS A;  2EK8 A;  2B0A A;  4C8P A;  4NGQ A;  4NGN A;  5IB9 A;  3S9N A;  1R61 A;  1ZRS A;  4INJ A;  3RBU A;  3FED A;  3S9M A;  4C9A A;  1VBH A;  2XEF A;  4TWE A;  2CIJ A;  4C8F A;  1KBL A;  3EZE A;  2E28 A;  4KNG E;  3TLG B;  1CS0 B;  5D29 A;  3K4I A;  4NGP A;  4COG A;  4CZ1 A;  4X3R A;  1C3O B;  1A9X B;  1C30 B;  4MCQ A;  3GJZ A;  2XEI A;  3I74 A;  4OC5 A;  3TLE A;  1ZL0 A;  3D7D A;  2PVV A;  4COB A;  1NBW A;  4JZ0 A;  4NGR A;  4OME A;  3SR3 A;  1BXR B;  4C86 A;  4C99 A;  4E94 A;  5F9M A;  2DIK A;  5ELY A;  4CDJ A;  1GGO A;  3SJG A;  1WVM A;  4TJX A;  3TLZ A;  2HRO A;  4NGM A;  4P4B A;  1KEE B;  4C8U A;  1EZB A;  4H1H A;  5FD8 A;  1DE4 C;  4YN3 A;  5F09 A;  1Y9Z A;  2MP0 A;  3SJE A;  4C8A A;  1ZYM A;  2YJV A;  2EZB A;  4C8T A;  2XEG A;  4OC0 A;  2D0P A;  4MCR A;  4P4E A;  3G23 A;  3TYX A;  5K99 A;  2AUM A;  3FEC A;  1M6V B;  3S9L A;  1DIK A;  3D7F A;  3IWW A;  4E5S A;  4J0N A;  1CE8 B;  4C9V A;  1EZA A;  2R82 A;  4C85 A;  4C9E A;  3TLC A;  2EZC A;  4P4D A;  2YJT A;  4OC2 A;  4EYS A;  4OC1 A;  3T05 A;  2D0O A;  2HWG A;  3T0T A;  3TLB A;  4C84 A;  3T07 A;  5JVL A;  1VBG A;  2OR4 A;  2X0S A;  2OOT A;  5IR2 A;  5F5X A;  2PVW A;  2AUN A;  4IIX A;  4MJX A;  3U1B A;  1CX8 A;  3C8O A;  4P4F A;  4MCP A;  2EK9 A;  4NGT A;  3ICU A; 
#chains in the Genus database with same CATH homology
 3BHX A;  2C5Q A;  4OC4 A;  1Z8L A;  3SJX A;  1XF1 A;  3D7H A;  3BXM A;  4LQG A;  4C9R A;  4TJV A;  4JYW A;  3EIF A;  4P44 A;  4P45 A;  4C8C A;  2JBJ A;  3IIB A;  2C6C A;  2JBK A;  2XEJ A;  4C9U A;  4P4I A;  3D7G A;  4P4J A;  4NGS A;  2C6G A;  4OC3 A;  3FEE A;  3K9T A;  4CDK A;  3SJF A;  2GP4 A;  3BI0 A;  3BI1 A;  3VTA A;  1V6C A;  2C6P A;  4W9Y A;  3I6S A;  3KAS A;  3FF3 A;  4MCS A;  2EK8 A;  4C8P A;  4NGQ A;  4NGN A;  5IB9 A;  3S9N A;  3RBU A;  3FED A;  3S9M A;  4C9A A;  2XEF A;  4TWE A;  2CIJ A;  4C8F A;  4KNG E;  5D29 A;  4NGP A;  4X3R A;  4MCQ A;  2XEI A;  3I74 A;  4OC5 A;  3D7D A;  2PVV A;  4JZ0 A;  4NGR A;  4OME A;  4C86 A;  4C99 A;  5ELY A;  4CDJ A;  3SJG A;  1WVM A;  4TJX A;  4NGM A;  4P4B A;  4C8U A;  1DE4 C;  4YN3 A;  5F09 A;  1Y9Z A;  3SJE A;  4C8A A;  4C8T A;  2XEG A;  4OC0 A;  4MCR A;  4P4E A;  3FEC A;  3S9L A;  3D7F A;  3IWW A;  4C9V A;  4C85 A;  4C9E A;  4P4D A;  4OC2 A;  4OC1 A;  4C84 A;  2OR4 A;  2OOT A;  5IR2 A;  2PVW A;  1CX8 A;  4P4F A;  4MCP A;  2EK9 A;  4NGT A;  3ICU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...