4CDKA

Structure of znrf3-rspo1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
152
structure length
152
Chain Sequence
b'ETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
publication title Structures of Wnt-Antagonist Znrf3 and its Complex with R-Spondin 1 and Implications for Signaling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 40
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18212 ZNRF_3_ecto ZNRF-3 Ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4cdkA00
4C9EA 3S9MA 4OC3A 4C8UA 2OR4A 4C9UA 4NGSA 4P4EA 3SJFA 4MCPA 3I6SA 2C6PA 4P4FA 4JZ0A 3SJEA 5IB9A 4C84A 4C9AA 2EK9A 3BHXA 4OC0A 4C8TA 3FECA 3S9NA 4OC4A 2EK8A 2CIJA 4C8FA 4NGTA 1V6CA 3BI1A 2JBKA 4P4IA 1XF1A 3D7HA 1WVMA 3RBUA 4P4DA 4W9YA 3SJGA 4C8AA 2XEFA 3FEDA 4OMEA 3FF3A 4TJVA 3EIFA 4NGNA 4C85A 4P4BA 1CX8A 5ELYA 2PVWA 4OC5A 2XEGA 4OC2A 4C8PA 3D7DA 4CDKA 4LQGA 1Y9ZA 3D7GA 4C9RA 4NGPA 4P44A 4C9VA 3SJXA 4C8CA 2XEIA 4MCQA 2PVVA 4TJXA 2C6CA 2XEJA 3VTAA 4TWEA 1Z8LA 4X3RA 4JYWA 3IIBA 4NGMA 3IWWA 4MCRA 4P4JA 3I74A 2JBJA 3D7FA 3BXMA 3KASA 4OC1A 1DE4C 4MCSA 4C99A 3BI0A 4YN3A 3S9LA 2C6GA 4NGQA 2OOTA 3ICUA 4KNGE 3FEEA 4CDJA 4C86A 5D29A 4P45A 5F09A 4NGRA
chains in the Genus database with same CATH superfamily
4C9EA 2GP4A 1M6VB 3T0TA 3S9MA 4H1HA 5F5XA 4OC3A 4C8UA 2OR4A 4C9UA 4NGSA 4P4EA 1CE8B 3SJFA 1VBGA 1ZL0A 4MCPA 3I6SA 2C6PA 4P4FA 4JZ0A 3SJEA 5IB9A 5IR2A 4C84A 4C9AA 2EK9A 1JDEA 5F9MA 5JYBA 2HWGA 3GJZA 4OC0A 4C8TA 3FECA 2HROA 4JVOA 3TLBA 3TLCA 3S9NA 4OC4A 2EK8A 2CIJA 4C8FA 5FD8A 2R82A 4NGTA 4J0NA 1V6CA 1R61A 3BI1A 2JBKA 2D0OA 3EZEA 3TLEA 1CS0B 4P4IA 1GGOA 3EZAA 1XF1A 1C30B 3D7HA 2OLSA 2FM4A 1WVMA 2MP0A 4M8DA 3RBUA 1KBLA 1JDBC 2EZAA 2HI6A 2AUMA 4P4DA 4W9YA 2EZBA 4COGA 3TLGB 3SJGA 4C8AA 1J3LA 2XEFA 3FEDA 4OMEA 3FF3A 4TJVA 3EIFA 4NGNA 4C85A 4P4BA 1CX8A 2X0SA 3SR3A 5ELYA 2PVWA 5F1YA 4E94A 2XEGA 4OC5A 3T07A 4OC2A 4C8PA 3D7DA 3TLGA 4CO9A 3EZBA 4CDKA 3KRVA 4LQGA 1Y9ZA 3D7GA 3T05A 4C9RA 4MI1A 1KEEB 3C8OA 3K9TA 2D0PA 3G23A 4NGPA 4P44A 1VBHA 4C9VA 4CZ1A 1KC7A 1A9XB 3T5MA 1NBWA 3SJXA 3TLYA 4C8CA 2XEIA 4MCQA 2PVVA 3U1BA 4TJXA 4IIYA 2C6CA 1EZAA 2XEJA 1T36B 1EZBA 2B0AA 3TLZA 3VTAA 4TWEA 3TYXA 1Z8LA 4X3RA 4JYWA 3IIBA 4NGMA 4NGRA 3IWWA 4MCRA 2E28A 1VI4A 4P4JA 3I74A 2JBJA 3D7FA 3BXMA 3KASA 4OC1A 1C3OB 2YJTA 1DE4C 5JVLA 4MCSA 4E5SA 4C99A 1BXRB 2C5QA 3BI0A 4YN3A 3S9LA 3K4IA 1ZYMA 4INJA 2C6GA 4COBA 3TLAA 1DIKA 2DIKA 4MJXA 3ICUA 4NGQA 2OOTA 4EYSA 3NOJA 4KNGE 1NXJA 5K99A 3FEEA 4CDJA 4C86A 2AUNA 4IIXA 1Q5XA 2PCNA 5D29A 4P45A 2YJVA 1ZRSA 5F09A 3BHXA 2EZCA
chains in the Genus database with same CATH topology
4C9EA 2GP4A 3S9MA 4OC3A 4C8UA 2OR4A 4C9UA 4NGSA 4P4EA 3SJFA 4MCPA 3I6SA 2C6PA 4P4FA 4JZ0A 3SJEA 5IB9A 5IR2A 4C84A 4C9AA 2EK9A 3BHXA 4OC0A 4C8TA 3FECA 3S9NA 4OC4A 2EK8A 2CIJA 4C8FA 4NGTA 1V6CA 3BI1A 2JBKA 4P4IA 1XF1A 3D7HA 1WVMA 3RBUA 4P4DA 4W9YA 3SJGA 4C8AA 2XEFA 3FEDA 4OMEA 3FF3A 4TJVA 3EIFA 4NGNA 4C85A 4P4BA 1CX8A 5ELYA 2PVWA 4OC5A 2XEGA 4OC2A 4C8PA 3D7DA 4CDKA 4LQGA 1Y9ZA 3D7GA 4C9RA 3K9TA 4NGPA 4P44A 4C9VA 3SJXA 4C8CA 2XEIA 4MCQA 2PVVA 4TJXA 2C6CA 2XEJA 3VTAA 4TWEA 1Z8LA 4X3RA 4JYWA 3IIBA 4NGMA 3IWWA 4MCRA 4P4JA 3I74A 2JBJA 3D7FA 3BXMA 3KASA 4OC1A 1DE4C 4MCSA 4C99A 2C5QA 3BI0A 4YN3A 3S9LA 2C6GA 4NGQA 2OOTA 3ICUA 4KNGE 3FEEA 4CDJA 4C86A 5D29A 4P45A 5F09A 4NGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C9E A;  3S9M A;  4OC3 A;  4C8U A;  2OR4 A;  4C9U A;  4NGS A;  4P4E A;  3SJF A;  4MCP A;  3I6S A;  2C6P A;  4P4F A;  4JZ0 A;  3SJE A;  5IB9 A;  4C84 A;  4C9A A;  2EK9 A;  3BHX A;  4OC0 A;  4C8T A;  3FEC A;  3S9N A;  4OC4 A;  2EK8 A;  2CIJ A;  4C8F A;  4NGT A;  1V6C A;  3BI1 A;  2JBK A;  4P4I A;  1XF1 A;  3D7H A;  1WVM A;  3RBU A;  4P4D A;  4W9Y A;  3SJG A;  4C8A A;  2XEF A;  3FED A;  4OME A;  3FF3 A;  4TJV A;  3EIF A;  4NGN A;  4C85 A;  4P4B A;  1CX8 A;  5ELY A;  2PVW A;  4OC5 A;  2XEG A;  4OC2 A;  4C8P A;  3D7D A;  4CDK A;  4LQG A;  1Y9Z A;  3D7G A;  4C9R A;  4NGP A;  4P44 A;  4C9V A;  3SJX A;  4C8C A;  2XEI A;  4MCQ A;  2PVV A;  4TJX A;  2C6C A;  2XEJ A;  3VTA A;  4TWE A;  1Z8L A;  4X3R A;  4JYW A;  3IIB A;  4NGM A;  3IWW A;  4MCR A;  4P4J A;  3I74 A;  2JBJ A;  3D7F A;  3BXM A;  3KAS A;  4OC1 A;  1DE4 C;  4MCS A;  4C99 A;  3BI0 A;  4YN3 A;  3S9L A;  2C6G A;  4NGQ A;  2OOT A;  3ICU A;  4KNG E;  3FEE A;  4CDJ A;  4C86 A;  5D29 A;  4P45 A;  5F09 A;  4NGR A; 
#chains in the Genus database with same CATH topology
 4C9E A;  2GP4 A;  1M6V B;  3T0T A;  3S9M A;  4H1H A;  5F5X A;  4OC3 A;  4C8U A;  2OR4 A;  4C9U A;  4NGS A;  4P4E A;  1CE8 B;  3SJF A;  1VBG A;  1ZL0 A;  4MCP A;  3I6S A;  2C6P A;  4P4F A;  4JZ0 A;  3SJE A;  5IB9 A;  5IR2 A;  4C84 A;  4C9A A;  2EK9 A;  1JDE A;  5F9M A;  5JYB A;  2HWG A;  3GJZ A;  4OC0 A;  4C8T A;  3FEC A;  2HRO A;  4JVO A;  3TLB A;  3TLC A;  3S9N A;  4OC4 A;  2EK8 A;  2CIJ A;  4C8F A;  5FD8 A;  2R82 A;  4NGT A;  4J0N A;  1V6C A;  1R61 A;  3BI1 A;  2JBK A;  2D0O A;  3EZE A;  3TLE A;  1CS0 B;  4P4I A;  1GGO A;  3EZA A;  1XF1 A;  1C30 B;  3D7H A;  2OLS A;  2FM4 A;  1WVM A;  2MP0 A;  4M8D A;  3RBU A;  1KBL A;  1JDB C;  2EZA A;  2HI6 A;  2AUM A;  4P4D A;  4W9Y A;  2EZB A;  4COG A;  3TLG B;  3SJG A;  4C8A A;  1J3L A;  2XEF A;  3FED A;  4OME A;  3FF3 A;  4TJV A;  3EIF A;  4NGN A;  4C85 A;  4P4B A;  1CX8 A;  2X0S A;  3SR3 A;  5ELY A;  2PVW A;  5F1Y A;  4E94 A;  2XEG A;  4OC5 A;  3T07 A;  4OC2 A;  4C8P A;  3D7D A;  3TLG A;  4CO9 A;  3EZB A;  4CDK A;  3KRV A;  4LQG A;  1Y9Z A;  3D7G A;  3T05 A;  4C9R A;  4MI1 A;  1KEE B;  3C8O A;  3K9T A;  2D0P A;  3G23 A;  4NGP A;  4P44 A;  1VBH A;  4C9V A;  4CZ1 A;  1KC7 A;  1A9X B;  3T5M A;  1NBW A;  3SJX A;  3TLY A;  4C8C A;  2XEI A;  4MCQ A;  2PVV A;  3U1B A;  4TJX A;  4IIY A;  2C6C A;  1EZA A;  2XEJ A;  1T36 B;  1EZB A;  2B0A A;  3TLZ A;  3VTA A;  4TWE A;  3TYX A;  1Z8L A;  4X3R A;  4JYW A;  3IIB A;  4NGM A;  4NGR A;  3IWW A;  4MCR A;  2E28 A;  1VI4 A;  4P4J A;  3I74 A;  2JBJ A;  3D7F A;  3BXM A;  3KAS A;  4OC1 A;  1C3O B;  2YJT A;  1DE4 C;  5JVL A;  4MCS A;  4E5S A;  4C99 A;  1BXR B;  2C5Q A;  3BI0 A;  4YN3 A;  3S9L A;  3K4I A;  1ZYM A;  4INJ A;  2C6G A;  4COB A;  3TLA A;  1DIK A;  2DIK A;  4MJX A;  3ICU A;  4NGQ A;  2OOT A;  4EYS A;  3NOJ A;  4KNG E;  1NXJ A;  5K99 A;  3FEE A;  4CDJ A;  4C86 A;  2AUN A;  4IIX A;  1Q5X A;  2PCN A;  5D29 A;  4P45 A;  2YJV A;  1ZRS A;  5F09 A;  3BHX A;  2EZC A; 
#chains in the Genus database with same CATH homology
 4C9E A;  2GP4 A;  3S9M A;  4OC3 A;  4C8U A;  2OR4 A;  4C9U A;  4NGS A;  4P4E A;  3SJF A;  4MCP A;  3I6S A;  2C6P A;  4P4F A;  4JZ0 A;  3SJE A;  5IB9 A;  5IR2 A;  4C84 A;  4C9A A;  2EK9 A;  3BHX A;  4OC0 A;  4C8T A;  3FEC A;  3S9N A;  4OC4 A;  2EK8 A;  2CIJ A;  4C8F A;  4NGT A;  1V6C A;  3BI1 A;  2JBK A;  4P4I A;  1XF1 A;  3D7H A;  1WVM A;  3RBU A;  4P4D A;  4W9Y A;  3SJG A;  4C8A A;  2XEF A;  3FED A;  4OME A;  3FF3 A;  4TJV A;  3EIF A;  4NGN A;  4C85 A;  4P4B A;  1CX8 A;  5ELY A;  2PVW A;  4OC5 A;  2XEG A;  4OC2 A;  4C8P A;  3D7D A;  4CDK A;  4LQG A;  1Y9Z A;  3D7G A;  4C9R A;  3K9T A;  4NGP A;  4P44 A;  4C9V A;  3SJX A;  4C8C A;  2XEI A;  4MCQ A;  2PVV A;  4TJX A;  2C6C A;  2XEJ A;  3VTA A;  4TWE A;  1Z8L A;  4X3R A;  4JYW A;  3IIB A;  4NGM A;  3IWW A;  4MCR A;  4P4J A;  3I74 A;  2JBJ A;  3D7F A;  3BXM A;  3KAS A;  4OC1 A;  1DE4 C;  4MCS A;  4C99 A;  2C5Q A;  3BI0 A;  4YN3 A;  3S9L A;  2C6G A;  4NGQ A;  2OOT A;  3ICU A;  4KNG E;  3FEE A;  4CDJ A;  4C86 A;  5D29 A;  4P45 A;  5F09 A;  4NGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...