The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
268
|
sequence length |
717
|
structure length |
698
|
Chain Sequence |
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Bisubstrate Udp-Peptide Conjugates as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb |
molecule keywords |
UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANSFE
|
source organism |
Homo sapiens
|
molecule tags |
Transferase/transferase inhibitor
|
total genus |
268
|
structure length |
698
|
sequence length |
717
|
chains with identical sequence |
B, C, D
|
ec nomenclature |
ec
2.4.1.255: Protein O-GlcNAc transferase. |
pdb deposition date | 2013-11-05 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF13414 | TPR_11 | TPR repeat |
A | PF13844 | Glyco_transf_41 | Glycosyl transferase family 41 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Alpha Horseshoe | Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat | Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat | ||
Mainly Alpha | Alpha Horseshoe | Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat | Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat | ||
Alpha Beta | 2-Layer Sandwich | Signal recognition particle alu RNA binding heterodimer, srp9/1 | Signal recognition particle alu RNA binding heterodimer, srp9/1 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Glycogen Phosphorylase B; | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |