4CDRA

Human o-glcnac transferase in complex with a bisubstrate inhibitor, goblin1
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
717
structure length
698
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bisubstrate Udp-Peptide Conjugates as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANSFE
total genus 268
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4cdrA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4cdrA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4cdrA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4cdrA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cdrA03
3OXGA 3RO2A 5LCWC 5D00A 1IIRA 3G2NA 4LDPA 3SF4A 4EKEA 4YUAA 4YVQC 1K06A 3D0QA 4FKZA 3IA7A 4YI5A 4X7MA 1C50A 3CUVA 1ABBA 3MRXA 4LEIA 1Y6FA 5JJTA 1LWOA 2GPNA 5BW8C 5BNWA 4UI9J 4MICA 1M5RA 3CEMA 3TAXA 2IYFA 2JLBA 2VGXB 3G2LA 3S2UA 4X7PA 2C9ZA 3EDTB 3CK7A 5JJ6A 3MT9A 1P4JA 2QRPA 4GA1A 3MTAA 4PQGA 2BFWA 2YJNA 1EM6A 3Q4AB 3OXLA 4Y6WA 3PDNA 4GCNA 2KCVA 3MT7A 5G04C 1WW3A 4KBQA 2G9VA 3RJVA 2IYAA 4G2TA 1OUVA 3QDNA 3OTIA 4G26A 2UWJG 3Q3IA 3EBPA 2JJMA 3MTDA 4N9WA 2GM9A 1QM5A 2VSNA 3C48A 4MRAA 1PN3A 2XGOA 4IN3B 1FU8A 1E4OA 4NQ0A 1HXIA 2VSYA 1E1YA 5LCWJ 2C4MA 4CTMA 5CHEE 4RELA 3UQ3A 1FTQA 2KS6A 5G05J 4N39A 1GFZA 1RRVA 2QRQA 1SXQA 3GYZA 1F6DA 1XL1A 3T3HA 2PQRA 3G2IA 1JIXA 4RIHA 2L6JA 1Y8MA 2R4UA 1RZVA 4WNEA 4O6FA 1F0KA 3Q3EA 3NCHA 3SYRA 1QQEA 4UI9K 4BT9A 3ZCPA 2VGYA 5JTTA 2GEKA 3RO3A 2X0DA 3TSAA 3GUHA 3CEHA 4KXKB 3BCUA 5KJNA 2F3UA 4WUYA 4AMBA 4N2SA 4YI3A 3DDSA 2C1ZA 3KS2A 2X6RA 4BQEA 1GPBA 3H4TA 1P2BA 3E3OA 2SKDA 3MS2A 3LY8A 4JA7A 4U0UA 3FFLA 5TMDA 1PC2A 3CVNA 3GZ2A 3O48A 2QN7A 3CX4A 3D1JA 3NC4A 4GZ6A 2O6LA 4M83A 1WV0A 2SKEA 3TOVA 1IYGA 2FBNA 1NLMA 2G9UA 3CKCA 4AM9A 2QNBA 2F3QA 3H4IA 4J8FA 4HOQA 5DBKA 1IXYA 2QN8A 2XGMA 4ME2A 1FS4A 1JIVA 2MHKA 5FZSA 3U4TA 5LQDA 4I9CA 1PSWA 1GG8A 3LKUA 3QWVA 2IV7A 3C4QA 3UYLA 4AMGA 4F96A 4F97A 2KC7A 2KCLA 5D0QD 3ZN3A 5TMBA 1L5QA 3S7DA 3COPA 4A1SA 1XC7A 2IUYA 2F3PA 2C1XA 1H5UA 1HZ4A 3L79A 5HXAA 3TG5A 5A6CA 3ZCVA 4U07A 3HBNA 2WQHA 3KAEA 3MBOA 1VGVA 1NOIA 2X6QA 4MI6A 3ZCRA 1XL0A 2GPAA 1XKXA 1WM5A 3VUEA 5FZQA 4KYOB 1KT0A 1WUYA 4MHOA 2E2EA 1A17A 3SYMA 2QN1A 3S7BA 2PYIA 3OKAA 2XMPA 1ZU2A 2P6PA 4UQYA 2WTXA 3GW4A 4M7PA 3L7DA 5C1DA 1P2DA 2UY1B 3AS8A 3MKRA 3ZHEA 2PQ6A 1FCHA 3C4VA 4AN4A 1FTYA 2GT1A 3D0RA 3G2KA 4WADA 3TG4A 5HI7A 3T3DA 2ATIA 4BWRA 5IKOA 2XCCA 2Y4TA 2I6HA 3L7CA 4BFCA 1NZFA 3Q49B 1FU7A 3BEOA 4HORA 2F3SA 4N3AA 2FI7A 1JG6A 2Y4UA 2YQ8A 3VTYA 3RSZA 4I2ZA 4YVOA 1WUTA 1FU4A 3L7BA 3MT8A 2PRJA 4MI9A 4REMA 4F3VA 3CV3A 1A8IA 3ZHEB 2Q6VA 3NF1A 3RSCA 3OKPA 4U0ZA 4EL0A 3VDMA 3BDAA 4KQ2A 3IEGA 5FJYA 3CEJA 2FEZA 2QRHA 3L01A 3VDNB 3R9AB 5FZRA 1ELRA 4ABNA 2H1FA 2IW1A 3ASGA 5DIZA 3PE4A 4XI0A 2XCBA 3S27A 3Q5MA 3ASHA 3MTBA 4HOSA 1P4HA 1JEJA 1L6IA 2FFRA 4JHRA 2QN9A 5ARGA 4CTNA 4LEUA 3ESKA 4X7RA 2X0EA 2XA2A 3BCRA 3ZCQA 3ASFA 1NOKA 3MA5A 5I45A 3ZPJA 2AW3A 5TVGA 2LSVA 3WXXA 3T7DA 2ACVA 4APOA 3O3CA 3DZCA 5FTPA 1LWNA 1GZ5A 2PYDA 4B94A 3CUUA 5GPBA 2P58C 4N3CA 3ZGQA 2QRMA 3QKYA 2NC9A 3MRVA 3NB0A 4NC9A 3E3NA 2AVPA 3RKVA 3SZ7A 2GJ4A 3Q3HA 8GPBA 3MV3B 2QLMA 1P4GA 3S7FA 1B89A 3PE3A 3WC4A 4BQIA 2IFUA 1C8KA 4UQZA 1FTWA 3NPAA 2BUGA 4RG6A 1XNFA 2QLNA 4GYWA 3MS4A 1J39A 2OOEA 1WW2A 2VCEA 5KJKA 4F9FA 5IKPA 4J8DA 2HO1A 2PL2A 3S29A 3BD6A 4GA0A 5D0OD 3Q47B 2PRIA 4HOUA 1L5WA 4RIEA 3VTXA 1P2GA 3MEKA 2VCHA 4GYOA 3AMVA 3AS4A 3HBMA 2ONDA 3RU0A 5G04J 2H1HA 1B4DA 4KQ1A 4YNDA 3LY9A 3CUYA 2BGUA 2FF4A 4RIIA 3G2JA 3T3EA 2IF4A 3MRTA 3GPBA 2YHCA 1AXRA 2G9RA 4HLNA 2VQ2A 2BISA 4WACA 3RIBA 4GPKA 3FROA 2C0LA 5EX3A 2AZDA 3BD7A 5DU2A 1C8LA 3JYSA 4RIFA 4XIFA 1L5RA 1K08A 1BX3A 3T5TA 3TGOA 3E3LA 4KQMA 3ZCTA 1L5SA 5KJLA 2HR2A 4I1AA 2J9QA 1PYGA 2AMVA 5TMEA 4H7YA 4RENA 2FETA 3CKBA 1O6CA 1Z6PA 2R60A 2WPVA 5D01A 2V5FA 2VG8A 3DD1A 4G2VA 4N2QA 2HY7A 2DBAA 1NOJA 1P5QA 3LYAA 3GZ1A 4Y6CA 3NAZA 4GPBA 4HWGA 1Y6GA 3OY2A 4NRHB 3UPVA 1NA0A 4RBNA 4UQXA 2SKCA 4NEQA 4QLBA 1NZNA 3AS5A 3E4BA 4MI3A 4J0UA 5HQ8A 1UQTA 5CCLA 2ACWA 4BT8A 4U0SA 5KJMA 2UY1A 1FC0A 1JG7A 1SXPA 4JA9A 1WV1A 3K9IA 3S0JA 2KATA 3ZCUA 4XI9A 1EXVA 2F9FA 3QKWA 4JL0A 4AY5A 4WNFA 1QZ2A 3L7AA 3QHPA 3KD7A 1GPYA 2LNIA 1NZDA 4U04A 1YA0A 4CGVA 3HBJA 2IEGA 1FA9A 5EKQD 2C0MA 1L5VA 5FT9A 3BD8A 4G23A 3OKCA 4GYYA 3MS7A 1JIUA 7GPBA 4CTOA 4RG9A 1TJCA 4L22A 4W9RA 1UZUA 2HYZA 3MV2B 1UQUA 2C2LA 3HBFA 4EJ2A 2GEJA 2R68A 3LY7A 1GGNA 3MSCA 3U3WA 2ECPA 5A7DB 5ARFA 4I17A 3CK9A 1E96B 4M60A 3URZA 4G24A 3CUWA 3FWVA 1IHGA 2LSUA 1HLFA 2XA9A 1Z62A 1KT1A 5G05C 2QN2A 3CVPA 1YGPA 2XCIA 2XEVA 2XGSA 3T3IA 4I9EA 2ASVA 4EL5A 2R66A 1V4VA 3CEQA 3S28A 2G9QA 3UUXA 2BGTA 4FZRA 4Z5XA 3UYKA 3S7JA 2R5SA 4WNDA 1XV5A 2ZB2A 3ZCSA 2GW1A 1ELWA 1QKJA 4I2WA 3CUTA 4BTBA 3ASDA 1Y8ZA 3LPZA 4NESA 2IEIA 2QZSA 5JJ7A 3QWWA 5CCMA 4EQFA 3OY7A 4G1TA 4G25A 2OFFA 1C3JA 3ZFWA 3NP7A 4W6QA 3T3GA 5M72A 3ULQA 4AY6A 3QWPA 4CDRA 2R4TA 3NP9A 3BCSA 1ZBPA 1NVKA 2XPIA 2QLLA 4H7XA 2X0FA 1W3BA 3CVLA 1RZUA 5DLDA 1Z6QA 3QOUA 1PNVA 3FP3A 3RT1A 6GPBA 1YA6A 1WAO1 2PQNA 4AIFA 4MHSA 1Z8DA 4WNGA 3BEEA 3OTGA 1GPAA 5BT1A 2QFCA 3N71A 4UI9C 3WADA 9GPBA 3CV0A 5JTUA 3VUFA 1NA3A 2KCKA 3Q15A 2QRGA 2IV3A 2PZIA 1HH8A 2FF5A 1KLXA 4WHMA 1AHPA 4HOTA 3LCAA 4GCOA 1L7XA 5AYWD 2XCUA 5ENZA 5EX0A 3G2HA 4EKYA 4BQFA 3OTHA 2QN3A 3IAAA 2VYIA 4X6LA 4N3BA 2GPBA 4J8EA 2AV6A 4CGWA 4N5CA 4BTAA 3CVQA 3DDWA 3MQFA 2FO7A 1P29A 3OT5A 2JZCA 2VGXA 4GA2A 5DXFA 3OXFA 3HYMB 1XOIA 2XA1A 4RIGA 2Q7FA 3CK8A 3WAGA 4GZ5A 1KTIA 4GZ3A 3RHZA 3EBOA
chains in the Genus database with same CATH superfamily
1M72A 3OEHA 4K46A 3UJBA 2I7VA 1PLJA 1LFDB 1CUBA 1YRWA 2IELA 2K4MA 4KNYA 2MYTA 3V79K 1SOVA 1TF5A 1RWVA 4HH0A 3ZXSA 2Q50A 3O90A 3ZU2A 1A8PA 1B76A 4IH1A 4MV4A 3O31A 1M2FA 4JNKA 1G1AA 1V8FA 3JQAB 1RSZA 3IMGA 3NXKA 1JLLB 4KQHA 4RXMA 3S99A 7YASA 1N7JA 3GFRA 5L4NA 3ZVMA 1V3VA 2BCJQ 2R8XA 4OP2A 4IHQA 1V7PC 1N2ZA 5BXOA 5GQSA 2O8DA 3HDXA 3V9AA 1K2VN 2Z4RA 3D81A 3OEWA 1IAVA 5E6UB 3C6KA 1WX1A 2HF8A 4BJ3A 4BAZA 4JXZA 4GA1A 3ZIMA 1O95C 2ANCA 4YRBA 1AKNA 1FZQA 1I3OA 3M9WA 1DJOA 1FDTA 2FR8A 4JR1A 4MVWA 1TDJA 4RVCA 3EFBA 1YRAA 3ESBA 4F2GA 3OJWA 1E96A 1NASA 3DPUA 3MMPA 4LTNA 3P97A 1DAOA 1PGOA 2R44A 3PVZA 1TIBA 3LGSA 1WZIA 1PJ3A 3EGOA 3JQAD 3Q0TA 4FQ5A 4PLFA 4UQPA 5LB2A 3WLIA 1AUOA 3WLRA 1VG0B 1NN0A 2A78A 1GGVA 2E4UA 3DZHA 1JRLA 4IY1A 2GVNA 5F73A 3TPZA 2WXRA 3LOQA 2A5JA 3UK6A 3ES9A 3U44A 4EW1A 2JGNA 3NBMA 3O7MA 2PL1A 4H3SA 4JJKA 5KYVA 4UWHA 1PN3A 3OEHD 5IJWA 1AURA 5IDQA 2VF2A 3GFOA 5AJDA 4L9AA 3HHEA 4QPJC 1HXIA 3U26A 1R6TA 1XVAA 3U4QA 1GKKA 4K5QA 3L06A 4E09A 3LX6A 3GZSA 2R79A 3QKUA 3T7TA 2OV6A 4ZDIA 4J6IA 3E4CA 1T8YA 1VB3A 4ONEA 4WLOA 3KBOA 1HE8B 4POAA 4X5OA 7MHTA 2FE1A 4ZCQA 2IP4A 3DWGA 3SP1A 1UXIA 4UDNA 4M8SA 2ZOSA 1F2TB 3HVHA 4NLLA 2DYSE 4FT2A 2TMKA 2PZGA 2J9FA 5AVJA 4CKYA 2A9KA 3IUSA 1MX4A 1VLHA 4WNEA 3EDQA 4N47A 2Z6UA 1QQEA 3WA6A 4OFXA 3QY9A 4LYJA 3J5PA 1DC8A 1XDGA 1P0CA 2B3DA 4P7JA 1WRBA 2O2ZA 4ZTBA 5T6BA 3VOAA 3NFRA 2A6PA 5IYZF 1WXHA 4Z4IA 2IOYA 1DFIA 3NBUA 1DRKA 2I1LA 5CA1B 1AZWA 3IC5A 5D5PA 4CU5A 1TNDA 4OHFA 3RFFA 3ID6C 3OIYA 5BSFA 2CXOA 2WRZA 1X8XA 4KGXA 1X81A 3KT6A 4L75A 2L82A 5LR6A 2E6UX 1WUHS 2JFVA 1OPRA 3WNDA 3GT7A 1I0LA 3L08A 1G2IA 2J0VA 3GEIA 5ECYA 4OYSA 2FQXA 2QTCA 3SR4A 3LUPA 4H3VA 3PPWA 4FDMA 4HTFA 4XYEA 1XZCA 2YFQA 3HUEA 2G7MC 3O1JC 2FBNA 4NY1A 4O2RA 4AM9A 1TOAA 4YMIA 3SSMA 1KSFX 1S0PA 2P9ZA 5FWDA 1FBTA 1A72A 3RVSA 4CZ2A 1YH3A 3LLVA 3CRZA 4Q93A 2M6KA 5F2NA 1KZOA 2PNJA 2ZULA 3HJNA 4O5OA 1GTJ1 1CUCA 1K6EA 4IIXA 1K8XB 3D31A 1Y7HA 1GG8A 3FHJA 4RK4A 3RDPA 2JDIA 1RTTA 3FTXA 1JDSA 1MW8X 2IHBA 1HLPA 2ZRIA 4JYPA 4PSKA 3TINA 3HXQA 1O6ZA 3EYAA 2PRZA 2O05A 3V30A 1ZI8A 4HGPA 1FDSA 2QL6A 2XAUA 3PEWA 4G0VA 4GKJB 3KQWA 1Y4SA 2VXCA 1RYHA 3EXG1 4Q7JB 1II0A 1ZHOA 3X2EA 1HZ4A 1HT2E 1IJEA 2ZK7A 3O4JA 2OCBA 2QAJA 4R0VA 3LYUA 4RV5A 1HRDA 2NO6A 4FLHA 2RHHA 4HMPA 1ZEMA 2WDZA 3CM0A 3VMMA 1KI8A 3JD1A 1L5KA 1NVXQ 3UCFA 1IXSB 2OGTA 5EN4A 4ALNA 1FMJA 2XE8A 1OC4A 2INGX 1GQFA 2QYSA 4Q47A 4XRRA 1DCKA 4M0PA 3T34A 3GDHA 2X0IA 4DDWA 2HN9A 3T0FA 3TL3A 2I2WA 3Q8WA 3C43A 1WM5A 3ETEA 1NBIA 2GR9A 3FSJX 4H1WA 3CVOA 1HE3A 2NVBA 1ZXBA 2V0CA 1NP7A 4ES6A 4NFLA 2BKKB 5IEBA 4J6FA 2PYIA 3OKAA 4H6XA 4LHZA 4MTCA 3WGNA 4D92A 5HQ3B 2X6HA 1K7XB 2VP2A 3O73A 2IS4A 1XRSB 1TZMA 1GPDG 3KL4A 3QNUA 4X44A 3UKOA 2WWVD 2IONA 3FU3A 4IH9A 2Z58A 3GGOA 4IP0A 4JNCA 4JQSA 3WAKA 3I9JA 3C41J 3UC9A 4H6VA 2WVIA 1JEOA 2GT1A 2GZ2A 3Q9UA 3QVVA 1MVLA 3PCXA 4YFVA 1PGPA 2Q45A 3NRBA 2PKCA 1Z7EA 3I76A 4R1LA 4MQ6A 2WD7A 1TCAA 2K4NA 5FBQB 2CVOA 1WDKA 3PNTB 3ZHZA 1MIHA 4MUGA 3MMNA 5EJEA 3HTXA 2JATA 1URPA 2EVWX 4UDXX 4B4UA 4DPRA 1JS1X 4OQQA 2Y4UA 4B79A 1IONA 4RFLA 4JIGA 1NYRA 3FETA 4E6HA 1ZBDA 1EWQA 3CUSA 5CB4A 1QQBA 3T1OA 3I2YX 3QMWA 4OLHA 2C95A 3L7BA 2PT6A 1PRYA 1NHGA 2F8LA 5H7PA 1IQ0A 2WW8A 4QG7A 3UY4A 3OMLA 4DILA 1HYHA 1E7WA 1NM5C 1NE2A 3EJNA 4OHYA 2VJ8A 4PZ9A 4BU1A 4ER6A 3ZHEB 3UGJA 1WDWB 2HA0A 3GEMA 2WI8A 1B1AA 1VRWA 3HL4A 4M0UA 4FMDB 4PICA 1ZM4A 1MH9A 1UPCA 3Q3JB 1VYHA 5K0GA 1EUQA 1NC1A 4GH5A 1HDGO 1R4MB 4BL5A 3AVYA 2AR0A 2YMLA 3F6SA 4GGMX 4OSPA 3HO6A 4LQLA 2D4HA 5FJYA 3DBLB 3TJMA 3ZW8A 1FRNA 3O83A 4E85A 1M1YE 3GJXC 4G0NA 3K2BA 3QENA 4K6HA 4BLOA 2IW1A 5C35A 5FR2A 3BA6A 3LDGA 4JGBA 3Q5MA 4MGEA 2AFRA 4JKOA 1NXTA 3LD9A 3QPVA 3WB9A 2V65A 3BWEA 5ENQD 4NDZA 4BFVA 3QNWA 4HDRB 3ORRA 1SQ6A 3ICWA 1P4SA 3PQCA 1AHHA 3T0GA 1RYEA 1JB9A 2VJLA 2JI7A 1TD1A 3BH6A 3BCRA 5AVUA 5JLJA 3CIFA 2AWOA 1O96B 1HZJA 1OXKB 2VA9A 2YXPX 4OM7A 1BCSA 1UEXC 4BJ5A 2VAMA 1JTFA 1JXOA 5CAEB 5GIPE 3FGNA 1P19A 4Z0PA 1YAJA 4ZEXA 3ZLVA 2FX5A 5AKYA 5BVGA 1V3TA 3GFFA 1S8NA 4DJDC 2FR0A 4L72A 2YIVX 5FNVA 2I9CA 4B94A 1T0HB 2PU5A 4R8VA 3IFSA 4D3DA 1AM4D 3UM9A 1X19A 3TS1A 3ZN2A 1L7RA 1MO2A 2D5AA 3S2YA 2HBRA 4DE5A 3LXUX 4UFNA 3MRVA 3O8QB 3THYB 3R0VA 5K09A 3E3NA 3D0KA 3R76A 2J4CA 5B53A 2B4AA 1O94D 2WV7A 4I1VA 3IP9A 2DB3A 1B26A 4LXHA 3CLRC 4KTTE 3ZY6A 4E7PA 3Q5DA 1XCOA 1AGPA 1QHHA 1E99A 2QQ5A 3CKYA 1GEGA 4UUAA 3SDBA 4B80A 1CJBA 1SM4A 1W59A 4A3VA 3EYWA 4H4DA 5E2BA 3TXMA 4ZCTA 2EFCB 1N6LA 3V4ZA 1EB9A 4GYWA 3MS4A 3RVDA 5JNUA 3RI3A 3BT7A 1N5JA 1RBMA 5BUSA 2IDZA 2O3RA 4QU5A 1S3GA 2V8OA 1Z83A 4D57A 4JI0B 1VE6A 3ZHOA 3BXOA 3LBHA 5ICMA 3L1IA 1A27A 4R2HA 3Q47B 1VCIA 4KUGA 1JEDA 2Q62A 3IO5A 4FFRA 5DHRA 5TIIA 3VTXA 5CCEA 1WMSA 1T15A 2RJ3A 4IRXA 4Q94A 5ECDA 3U49A 1MRSA 4CE6A 1M1YA 3PFKA 4B6RA 4I3HA 1FFEA 3N8KA 3TD9A 3WLPA 4OI0A 2H1HA 3CLUC 1B4DA 2NO0A 2YZKA 1PL8A 1Q1AA 3JCZA 5DGXA 4A1OA 2O5EA 1MT3A 3F97A 3QVLA 4YK7A 1ORRA 3UJHA 2HJWA 4AS2A 1QOQB 5HMMA 1GA1A 1RC1A 1T9CA 1W4CA 2XTMA 3UAVA 1TCUA 1ADFA 3ZK9A 1F0YA 2R1TB 4G4JA 4NVRA 1T4GA 1SU6A 1JEQA 2H5IA 2P4HX 1NLZA 1W30A 4G07A 4FYXA 4J0QA 3P0IA 1KTVA 4G56A 2YHCA 3FJ1A 2I8CA 3APDA 3KLOA 2WXNA 3QK0A 5JD6A 5AW1A 4URWR 2CXPA 5JNSA 2IUTA 2A0YA 5KO2A 1HG0A 4ZTUB 5K0JA 4A2WA 1DBQA 1X4RA 2P4EA 1UXGA 2FRVA 4EKDA 1JSRA 4Q01A 4YMWA 4XIFA 4RO0A 4WZZA 4DLTA 5JASA 2NXJA 2GRMA 1Z68A 4GICA 2AJBA 1QGUB 3FUIA 4X6YA 2IS2A 4YGYA 2D74A 2OXFA 4LX0A 3BT3A 3I73A 3IMFA 4MV5A 3UK0A 5FINA 2MSLA 4EFKA 4J0DA 2CUZA 3CKBA 5EGSA 3CWZA 2XUJA 3RU2A 2XLBA 4KPFC 4A8JC 4X8HA 4CMBA 5J47A 3PFFA 2VG8A 3V8PA 2UKDA 3O91A 3VSAA 3RAGA 4V0MA 4J7AA 4EQ6B 3DE0X 3JQ6A 1TRHA 1MAHA 4OUDB 5TQJA 1F0PA 2Z6VA 1W93A 3RHTA 4Y6CA 1FNBA 1G6Q1 1NBME 3DPDA 2BJWA 1AF4A 5H70A 1Y9EA 5DHUA 1QC5A 2VDQB 3KZNA 2H4WA 4P93A 4NRHB 4Y9RA 2I62A 4WERA 1HYEA 4OG2A 1SRQA 3TDNA 1IUKA 2SKCA 1SC1A 2WHQA 1PFGA 3JZIA 3AEKA 5FJIA 4PLWA 1XVVA 5B6IA 1F1JA 2BFDA 4M1KA 4DDMA 1OR8A 2ZWOA 3IP1A 3E82A 2AJCA 3ADBA 2XIQA 3K1YA 5C8YA 2V45A 4LSWA 3HJUA 4KHZA 1SXPA 3G0IA 3QOFA 4X90A 3SHWA 1T35A 2GJ8A 2RK6A 3HVEA 4PLCA 2C97A 3E53A 1U8EA 4L0CA 2QT0A 3HY3A 2V5VA 5CU7A 3MGBA 1RPNA 2ZUTA 1Z4JA 1A9ZA 4DJ5X 1E98A 4RV4A 1EHYA 1QFSA 2Y1DA 1VG1A 1Z37A 2YMMA 3TWRA 1U0OC 3BXPA 3KT0A 1Z12A 3KJEA 4UXJA 4UU1A 2YYYA 1TN8A 5A7FA 5B2EA 3AJIA 4W99A 5I7RA 2YHEA 3IIEA 3HJTA 3P1JA 1ZB1A 4PHTA 4DGQA 3GUZA 4Q4AA 5LN1A 5EFZA 2OHIA 5JMWA 5AKZA 1QG0A 1Z88A 4NAVA 2RFLA 4I55F 4Y2XA 3RIMA 3T5XA 5JD4A 4U8YD 3EXEB 4RETA 2GCNA 4BZWA 1SG9A 2NVUA 2QB5A 2W2LA 3OC6A 7GPBA 4RABA 4YMGA 1PZGA 4RXTA 3MV2B 2EW1A 3ZWOA 5AOAA 4RORA 4MTLA 1LY1A 1QAMA 4UCWA 4S24A 3BK2A 3ONEA 4XW2A 4K5CA 1C14A 2G5TA 3U9WA 3P5SA 4OQPA 1ENYA 4G6ZA 5CLJA 1NRIA 2KI5A 2SBTA 5C8YF 4RAOA 2LUHA 4CQMD 5G05C 4QTTB 3K70D 1ULUA 3BL5A 4BUZA 3LDAA 3F71A 3PICA 2CK3D 3AUJB 1T3LA 1EE9A 3GYBA 1YDMA 1EFPB 4I9EA 1GPH1 2AGVA 3ZGZA 1J97A 4F1SA 2HA3A 2HUNA 3CEQA 3HFJA 1VHWA 3KQOA 2FSUA 4PAGA 4EW2A 4BETA 3NQPA 2A3NA 3QVGA 3UB3A 3NANA 3H5LA 4ND8B 4QBIA 5JNRA 4M9UA 3U62A 1QH1A 3OM8A 4MQMA 4NZYA 1K4KA 4P80A 3Q7QA 4J6EA 4RF5A 1MZVA 1W2WB 4RLFA 4PLPA 4XJVA 4ZEMA 3EIUA 2EF1A 4NOJA 5KQPA 3BXGA 3OT1B 5E76A 1NLUA 2WHRA 3OX2A 2PM8A 5LZ9A 3HY4A 4LKRA 1X7WA 1JWFA 3OMXA 3R75A 4N9QA 4K9QA 1E1NA 3ZFWA 3P9QA 2GERA 4XEUA 2AR7A 1Z25A 4DKJA 3GEDA 2PX3A 3P2YA 4J3JA 1KK2A 2AHOA 4OFBA 1PWEA 1E8OB 1MX9A 2IEAA 2XQFA 1O89A 1PU2A 3M33A 1EK1A 5D2MC 4KLRA 2PR7A 5B4TA 1UC8A 3GWGA 4D8XA 2DTEA 5BYAA 1K7EB 3D1LA 1JDVA 5ITZB 2HMUA 2WXQA 3M3HA 3R7LA 2B9EA 1EHIA 1R15A 1SIWA 2R84A 2YYAA 3CVUA 3DV9A 2NYRA 4AZVA 3FP3A 1C9KA 1VTKA 2CSUA 5EJMA 1EX6A 4LDJA 4K81B 3X0DA 4K9LA 2CK3A 2Q2WA 1VSUA 2IYSA 2C84A 2IYYA 1QIKA 4EYGA 1MOZA 1QCYA 1QX4A 3NC0C 3O94A 1XROA 3LT4A 1G6HA 4ZJUA 1SQFA 2RG1A 4UCQA 1QCDA 1D6NA 2REXB 4EFLA 5EIBC 9GPBA 3S44A 4DX1A 2HJGA 4KT6B 3RD5A 1RRMA 1JZSA 3FFAA 4GOJA 1JVSA 1RAIA 1VI6A 3M1IA 5BV8A 2J85A 2J0QA 2E5WA 2QTLA 4PS8A 3K31A 3OLXA 1TI7A 4FP7A 1RHUA 3EFEA 2XZOA 3KFXA 2JGRA 3T9AA 4ZI7B 4YMHA 2ZWVA 2FE4A 2IYQA 1BKDR 1GR0A 1UT6A 2JRCA 3Q9LA 5E1MA 5FADA 3T7KA 1SVKA 1K7YA 3BG5A 4HGNA 4NBTA 2H31A 5AI8A 5DGCA 3PFBA 1KY4A 2F4VB 1UBLS 2FFQA 1TYEB 3RF7A 1T5TA 3BK7A 4M86A 3CX6A 3HXOA 4OXYA 2O6HA 1LD7A 2UYOA 4DB4A 1AKTA 4GZ5A 1Q57A 4HDKB 5AQ7A 4HNVA 3NBZC 1OT5A 3FTEA 1W25A 2PMFA 3INRA 5BN1A 3TFWA 3I4FA 5KNLA 4WZAE 3IAM1 2I6FA 1UANA 5B7QA 3UXMA 3QA3E 1E3QA 2HEGA 2BBSA 2QM7A 3EUEA 4F84A 1EQ2A 2AMLA 1QZZA 1E2EA 3T61A 3JR3A 4I4IA 1DCMA 2PR2A 4MW2A 2BRUC 5M29A 4PG4A 4YNBA 1XTBA 3AKEA 3OWHA 4G01B 4X7MA 1XKQA 4PONA 3QYAA 4FZVA 4M0FA 4MLCA 5AW9A 4A9AA 2BN4A 4LY9A 4PGFA 2ZXWE 2JK0A 3BRWA 2P5SA 3BJEA 1KBOA 1RWKA 3CH4B 3I42A 4FIDA 5ALKA 5FJJA 1VYUA 2GLTA 3ILHA 3PNOA 4UBJA 3F6PA 5C32A 3QU7A 3WWOA 3V4PB 3MWGA 4NENB 4RNDB 2ORVA 1SCQA 3C3OA 3GRVA 3MCWA 5KDOA 4WZBE 2LD4A 2B6CA 1L8LA 1TVKA 1BH2A 3Q88A 4HAVA 2WU3A 4URFA 3HJFA 4UTRA 4CKCA 1GL7A 3GZNB 1IHDA 2O20A 3FGZA 4ZCLA 1T4DA 5C4MA 3OQNA 1THGA 2B0CA 2ZAGA 2WIBA 3PL5A 3OXLA 4N0EA 2YW2A 4GCNA 2GD1O 2RHMA 1MAWA 1E3MA 1HDYA 4LUCA 2MRIA 4D56A 4KR0A 2HH9A 2G9VA 3ZQUA 3R6DA 3VJKA 1D8EA 5KVSA 5AKJA 3QDNA 3TRDA 3VI3B 4ARIA 3EU5A 3TVYA 4Y98A 3BDIA 3GGPA 5JSUA 5CECB 3ZV4A 3CIAA 2P9GA 4RDCA 3KETA 5C7YA 4HRYA 3GRZA 5ESXA 4R8LA 1NF9A 1EYZA 3QWAA 4CLRA 3VR5A 4JBNA 1M8JA 3FYHA 3OFKA 2VSYA 4FEGA 4O2BF 1ZCJA 3UGTA 1CDEA 1GNPA 3E84A 4N5LA 1FJXA 1CQWA 2G76A 2WJHA 3AESB 4DSAA 3IURA 4EA8A 3LEWA 1BW9B 1OXXK 1Z18A 2QRQA 3HWSA 3PKZA 3UGQA 5KTSA 5JISA 3N9IA 2KM4A 3VNQA 2E7ZA 5TJ9A 2BD0A 2HWXA 4U7HA 1DKOA 5IJ0B 2I22A 5M5BA 2NTYC 2ZUCA 1F0KA 3NR2A 3ZCPA 3CG4A 1Z39A 2ILRA 4B7CA 1D2GA 4PN3A 1UAAA 3KQTA 1Q92A 1OTXA 5F5XA 3GPIA 4E7OA 3R7NA 2DHDA 2OUIA 5E6SB 5HS6A 1EX1A 2VDRB 2WG1A 1JG2A 2Y1EA 3JQGB 4C0BA 4CHTA 4HYQA 1UMDA 2IF2A 1UEIA 2II6A 1J9EA 2NQTA 2PH7A 2RK3A 2VAPA 2YJ5A 3OJ0A 3P0JA 5FI1B 2FLWA 3WGHA 3FI9A 3ZU3A 1FDIA 4F8JA 2VXOA 3VQTA 3EF3A 1Q0PA 1VYVA 1E9SA 5LKRA 2VA8A 4IO1A 4BDTA 4DZRA 3T4PA 2VQEB 2PUVA 4MPRA 2GPJA 4AKGA 4JI2B 5EIEA 2DBZA 3PIRA 1OWPA 4F4DA 5KC8A 4MV9A 2QD4A 3D1JA 5BQXA 2DYKA 2QROA 2W6MA 3CG0A 2FMFA 5JCOA 5EQDA 4X3PA 3VSCA 3GA5A 1ZDMA 4NYMR 3FTPA 5B6JA 3DGEC 2KB0A 3GI1A 1D9XA 3R5FA 3PGKA 4W1RA 1M7HA 3CGWA 3OSZA 5D6NA 1HSOA 2CDRA 5P8WA 1JQLB 3TZKA 3OTOB 1KK0A 1XJQA 3MPOA 1OAOC 3ZE7A 1LNZA 3QWVA 3UG7A 3C4QA 4HQRA 2NV2B 2OC4A 3RF6A 1M2VA 1CWUA 4BEWA 4HDMA 2PWPA 3DTVA 4M88A 2W6PA 1E1QD 3ZY4A 2HHAA 3DQPA 1N1MA 2MJLA 2YDXA 1QNLA 3PTZA 4EJMA 2CB0A 1FDVA 4B8AA 5E3IA 3LQKA 4BNZA 3U3RA 1WBDA 3M3PA 3EWAA 4RULA 4FN4A 5A6CA 4IMIB 4DN6A 1GNLA 1W8IA 3LVFO 4ZVTA 4TLAA 2AUTA 5HCUA 3FVVA 2ERCA 4ZVQA 3GBVA 3BS4A 1H65A 1E1DA 4ZCMA 3BE4A 4GOLD 1LF0A 5LQAA 3SIPA 4U5QA 4IYRA 3QIVA 2CLSA 4HKTA 3B6EA 2Q6IA 2WG0A 3TX6A 3TZQA 1SIOA 2ORIA 4KYOB 1FNCA 1I6MA 5BW6B 2XD9A 5L7TA 4EF6A 1VPVA 4F92B 5CA1F 1WZEA 5ICGA 4Z1OA 3J7AC 3M6IA 1QGDA 1G55A 5EZQA 2RGRA 2ONCA 3R0XA 3IAUA 4IFBA 4RPKA 1LD3A 1RD4A 3L9XA 5JJIA 2ZJ1A 5KWDA 2FVYA 1ZGBA 2GGSA 1HE1C 3ZVLA 2UY1B 4EZKA 3USCS 3SZ3A 1ZS9A 3BGVA 5BSRA 3H2YA 4P82A 3LRXA 2QX6A 3HH8A 2JCSA 4X1KA 4MRUA 3PSHA 1RFLA 4V0NA 4ERNA 1I1OA 2YHIB 3D4IA 2W42A 2JGFA 1OCRE 3G1WA 1AXGA 4O4LB 3EG9A 1Z82A 3OWXA 4XWTA 6PFKA 3RAFC 1UQRA 1N6HA 3Q49B 1QFYA 2Z08A 1J21A 3N7TA 4KKVA 4RC9A 5FHQA 3G8YA 4PZDA 4Y1RA 2OEVA 3Q15C 3R8FA 1PJCA 1VMKA 2IHJA 2DPMA 2Y4OA 3KXPA 3WLKX 1XXLA 1RLIA 1KZ9A 3AUAA 3CRMA 4NS4A 2ZAMA 5EJ4A 2EL9A 3EG9B 1J2RA 1X7WB 4RTJA 2AXUA 3AVOA 4BTVA 4B46A 4L6CA 4WL0A 2MSEB 3PGXA 2YMPA 2IXEA 2X86A 2V97A 3G2QA 4GGPA 4DR2B 1GM5A 2VF5X 4JELA 2PLNA 5E1OA 3HO1A 2P7IA 3WFJA 1T1EA 2AMJA 4ZXFA 4G0YA 1AMOA 4C6RA 1DBWA 1LLFA 1Q3HA 2HSDA 3KXLA 3QF7A 2M1ZA 1C0PA 5IUNC 3LYHA 4US1R 2R4QA 3K6JA 4KYUA 1LPBB 2VHWA 4JT8A 2L9BA 2QP3A 3IXLA 5ENDA 2FEZA 3OPMA 2K2QB 2PMKA 1KQNA 5FZRA 2PQ2A 3GPLA 3ZDBA 3I04A 4ZYLA 1DUVG 4CT4B 3A10A 2C5AA 3OI7A 5I5GA 3REGA 3IAFA 3I5XA 2JLWA 2HTEA 4EHBA 3A2NA 1RNLA 5EKUA 3EVTA 1JEJA 9ATCA 2EZ9A 4OVUA 3QOXA 1B23P 1K68A 3GX1A 3DEPA 4YPVA 4D4IA 3JWIA 2CLCX 4ACBA 3KHKA 4LNUA 5CG2A 3O5AA 3CZAA 5HIJA 1N3IA 3OUUA 3ZDAA 3B13A 3QB2A 3ASFA 1XQWA 9LDBA 3FCOA 5DW3A 2J4DA 5H68A 1ANKA 3OA2A 1XZQA 3ADPA 5H80A 3ZNQA 3VAZA 4AJKA 1DMSA 1ISSA 4DCTA 4UU8A 2RGGA 1BYIA 3VISA 4RZ2A 2J45A 3TWWA 1ORHA 2AN3A 1E89A 5JHAA 1JN0A 3O8NA 2QQGA 3EXHB 4LBYA 4BO8A 4OH1A 1T4MA 3ICOA 3UH1A 3V2IA 1TR4A 4TWRA 2C82A 1U0HC 3HUUA 4L4RA 3AF5A 1JIQA 5FYQA 1GXSA 4NIKA 1ZWKA 1SBTA 2JFZA 3Q3HA 4WFIA 3ZIAD 1NLYA 2DY0A 3MV3B 4IZOA 3MMSA 3TPCA 2OFPA 1MB2A 2PDAA 3C15C 1HQDA 1LV8A 2H9AA 4FYJA 6YASA 1U8ZA 2OHFA 3BWBA 2E49A 1K6IA 3K0FB 4FCTA 1GZSA 2Q1XA 4Q82A 4OFZA 5CVUA 3DSWA 1MB9A 2OV1A 4A16A 4FHDA 1L7BA 3IOEA 1F60A 1HS6A 1H42A 3LDFA 3UX4A 4WY2A 1QIMA 4ECEA 4EZEA 1I51A 1RACA 1JHDA 1D2CA 2QMZA 1OFUA 1Q1ZA 3I2GA 4CRWB 1V0JA 2BZSA 2G0TA 3PX2A 3R24A 1JV2B 1TN7A 3MTIA 1V6AA 4CCYA 4CV0A 4FN5A 5E6SA 1UPXA 4L02A 2WYUA 3UWOA 4EYSA 3OAWA 1CF9A 5CDTA 4OUDA 2I65A 2Q49A 3VU3A 4LJSA 1H2RS 5LZ8A 2CHZA 2BFOA 3LT1A 4C2AA 1DTWA 4HUTA 3X1ZA 4KVFA 1WPQA 5EDSA 5KSPA 1SCNE 5CFNA 2AJLI 3TLCA 1P9NA 4Z8XA 4A0QA 1NBAA 5HKAA 3W6OA 3FNQA 3KB2A 4YNDA 3EVNA 1BFKA 4L76A 1ZUD1 4ZPXA 3EJ6A 1RZRA 5HCNA 1TEXA 4PYRA 3DCIA 3RYHB 2IH5A 4GEKA 3D02A 5C18A 5BORA 5I7WA 1XTVA 1Y7PA 2E9SA 2Q5CA 5FD8A 4J03A 4PV7A 4XYBA 2PIAA 1H8HA 3V8MA 1ZM9A 4MCJA 1Y7IA 3U1VA 3ONFA 1AXRA 1U7UA 1I3CA 3R8XA 5COBA 1C3EA 2D1YA 3QIAA 2ZYSA 3G5TA 5K03A 4O1MA 2LRHA 3K71B 3N8DA 2OL4A 4Y30A 1Q5PA 1GRVA 5K01A 3U7GA 5B1IA 1YR2A 3GLHA 5FTMA 3M1YA 3DOEA 1THTA 1QWOA 3C1AA 4DLSA 4GPEA 3OEEA 4EPZA 1PFKA 1EJ0A 1JHUA 3E3LA 4ZDJA 1H0SA 1W85A 2JG3A 4Q34A 1VPTA 1KI9A 3RT7A 4BV2A 4C7XA 1V2GA 2H6FA 5JDIC 3OSUA 2GARA 2QYJA 1U5AA 3HNRA 3I39X 1N9GB 3AR5A 4BIMA 4RPJA 5K3SA 1B2LA 2OB2A 1BWRA 3GB9A 3TQCA 421PA 4FFLA 2ALJA 4G2VA 2C8LA 4IKPA 5F9MA 4YAGA 3LYAA 4EHHA 1J2UA 1UFKA 4I8IA 2AFHA 5SYNA 1HURA 2J9XB 4QOIA 3IPRA 2PRYA 4U1RA 2X8LA 1PZFA 1E2UA 4OHMA 3U4DA 2PVPA 3WDMA 2D54A 4DT1B 3ZHRA 4UQXA 1S4MA 1H2HA 2CXNA 4KQ9A 1EFRD 5DHQA 1LPSA 2CVZA 4PYKA 5DM0A 2O3TA 4BT8A 2XRZA 4DRXE 4A10A 1HDIA 2LE0A 2BBWA 3D3JA 3VZQA 2N75A 1U9IA 3CINA 1V95A 3KSAC 3K9BA 1XDDA 2XMRA 4UUBA 2KZTB 2XHEA 2I1KA 4YJGB 1UAYA 5C7IO 1T3ZA 4CM8A 3DS8A 5AQAA 1P17A 1XTZA 5A2QA 2ACKA 4NFHA 4KVGA 1QQ7A 3L0IB 5EMLA 3T5AA 4AKTA 2Y67A 4M1OA 4ZMSA 2KE5A 4I1MA 4FMDF 1XTUA 1ZVVA 3VA7A 3NNSA 1QLJA 3K4HA 1QO0D 3K2QA 4M89A 3VVMA 4MUYA 1ZK1A 1OIWA 4BWFB 4EG4A 1RQ2A 3PUXA 5DNUA 2FSPA 1D0VA 4HNQA 2YXEA 5B58T 4GWGA 3RG2A 3HYLA 4BS9A 2DULA 2X0JA 2NU7A 3VNSA 4JB8P 3RSFA 4EFDA 1E79D 3Q3VA 4BFUA 4D4KA 3OA0A 5DYNA 5HJEA 3RNLA 4M0DA 4O6VA 5K3FB 2XS8A 2BHNA 1BKSB 1BU8A 2VR1A 1KYXA 2EFDB 1WO8A 3IPCA 3RRFA 1QMPA 5DBEX 2ZXFA 3M9LA 1IN1A 3TG2A 3ADCA 3GDGA 4FKBA 1E3WB 3RBXA 4D82A 3INTA 1BI7B 4EZIA 1L5LA 1W5SA 3FOWA 2V6MA 5LKAA 1C0IA 4CM6A 5EPUA 4EG0A 2QN2A 5JA4D 3UXHA 3VV2A 5LP6B 5BUCA 1B00A 1UEJA 4D10C 4D3SA 5AJVB 2A4KA 4ME6A 2NXNA 3CXRA 3SD5A 3VYUB 3KSZO 3WLTA 3JRNA 3ZK7A 4BVGA 2NUAA 3OQVA 1WCIA 2P2SA 3GAMA 3IAEA 1L4KA 3ZCSA 1RKBA 1BA3A 1XCBA 1SXIA 4TZ0A 5ILGA 1GZ7A 4UD6A 2F0YA 2EYUA 5G3YA 1JAHA 3DDUA 1CG6A 3V2HA 4KSYA 2JBAB 1BIFA 2VJCA 4YRCA 1TJ3A 5CCMA 2VDWB 3NATA 4BBPA 4G25A 1I7PA 2FFAA 4C0SA 4B3SB 4G0PA 3DEJA 1JLSA 2XYVA 1FQKA 2VQDA 3ELYA 4YUVA 3RC7A 3RC8A 2F8YA 4QXAA 4DM4A 2FZ4A 4HYYA 4B3MB 2ABWA 1RXCA 1NX9A 2WM8A 2DEUA 3IEPA 4CDRA 4TVSA 3KPUA 2PUHA 2Z5VA 1YK0A 3EUWA 1H6KA 3ILYA 2UZIR 4GW3A 4Q05A 5AI6A 4BOYA 3S1SA 5IY5E 1USKA 4HLEA 1JQKA 1NNLA 1SK8A 1CUEA 1EFPA 3EG5A 4II2A 1RI3A 4AG3A 1ZRMA 2Z9DA 4Y0NA 4PVDA 1SMKA 1AV6A 3E7DA 2PZLA 3FE2A 3CXUA 4JHJA 2CHWA 4DCGA 3R5KA 3EE6A 4DV3B 1G38A 3EHMA 4AIFA 1EM8B 3FZYA 4MAAA 5CIQA 4NU0A 4AJ9A 4BYGA 1RR6A 4LG6A 5CRVA 5JSHA 4AKIA 2N42A 1J9GA 1GQSA 5JC8A 1C3OA 2OK8A 4G3XA 1JAZA 3GMSA 1SXGA 2JI9A 2VT2A 3AYZB 4R2KA 4UHHA 5C31A 5I7HA 5LQCA 1IVYA 3ESYA 1U1IA 4DQKA 2PZIA 4R7TA 3GLTA 1FVHA 1PS0A 2GTPA 2ECOA 4REOA 1DKMA 4OQ4A 4Z9FA 5JSYA 3ROXA 1MGPA 4HDAA 1OBVA 3MJDA 4V3BA 4AMZA 4U3JA 2XEHA 1CB0A 2OENG 4TSKA 1RKQA 4H1VA 3KJNA 4DI4A 2N9UA 4LXQA 2GPBA 4PX5A 5UKDA 3T9FA 4L51A 1TKBA 2OHHA 2UDPA 1FDUA 4YRIA 4D0GA 2B35A 5LC1A 3DL0A 2CMHA 5AKIA 2FP4A 1VL6A 1GR1A 3THWB 1G5TA 4AJWA 3SBDA 3N3AC 1GO2A 1TJPB 4J3NA 1AC5A 2JW5A 2FG5A 3ROPA 4B17A 1W1UA 2W6ZA 2AXPA 3F96A 3QFCA 5ENPD 2Q2QA 3KVNA 5EI5A 4EGJA 4ZALA 1YCSB 2ZIXA 4HUJA 1Q6ZA 3MN1A 3NBNB 1YYHA 2JCYA 2RD0A 1PT8A 3JARB 2WFLB 4EYQA 3ZWVA 2FPOA 3I01A 1BGVA 4QQRA 4X91A 4OFWA 5H02A 4BAGA 1IPFA 3LW8A 3MCAA 4BGUA 4JOBA 2V03A 2W2NA 4WXRA 3UAZA 5CDFE 3KP1A 1R4NB 1GG2A 2QD3A 4EENA 3R1IA 3UJ6A 2WMOB 4QVGA 3W5SA 1QLWA 2R48A 2R6ZA 3AILA 5LZ2A 2YYZA 1RQRA 3TEMA 3NOCD 2IH2A 1PFVA 2F00A 4YI5A 3AEUA 3IBSA 1C50A 4NCHA 1NVVQ 1N5RA 2AW6A 4ZYYA 4EPXA 4YV7A 1JKIA 2B7LA 1OE0A 3CLRD 4P7BA 2JD1A 4LEIA 3VU8A 1MNAA 1UJNA 2OQIA 3EU9A 3M1AA 4BO7A 4OAPA 2A9VA 2KHZA 3IUEA 4YC7A 3LL7A 5LXTB 3PEVB 4UI9J 1G7TA 2VK4A 3OLYA 3OOJA 3KSDO 1VE5A 4QNMA 1EWVA 1EDUA 5A4AA 3NKFA 5KYKA 4PO9A 2CJWB 3KLMX 3CK7A 2X6KA 1ABFA 1H66A 3L0PA 3OQIA 4ENRA 1ZH4A 2FFBA 1W35A 3B7WA 4PQGA 1HC7A 1DKNA 2IE8A 2CNDA 2XUDA 4NU5A 5FUBA 4AQDA 1VOTA 3U3XA 4WESB 3Q4AB 4B0OA 4AY4A 1JHMA 1I10A 3N2KA 1IL0A 3REQA 1R10A 2JFFA 1T5OA 2B8EA 4U7FA 5E4FA 3N86A 4N40A 2QRVB 4GKAA 5L3RA 3SD7A 4ARAA 4EJSA 2M9MA 1L5MA 1DTSA 3BX1A 3DZIA 4A8JB 5GJCA 2YZ2A 3UPUA 1IEWA 3ODGA 3HBLA 2A1TR 4LV5B 2FEKA 1QM5A 5B55A 3CEAA 1N2JA 2W2KB 3D4NA 1V11B 1MR3F 1CDOA 1Q0SA 4JSRA 3E9EA 2I2BA 1XPOA 4YGXB 1AKYA 1U8TA 3ZHCA 2J3DA 1SKUA 3PFNA 4F04A 3N0TA 2O7RA 3M2PA 4GU5A 1D9SA 1VSQA 4AZ3A 3FH7A 2ZKLA 4KQXA 1CCWA 1PVOA 3LGAA 2O3UA 2O2CA 3V1LA 2V0NA 1P45A 3THSA 4NG5A 2BEUA 1CY1A 3TXXA 2QMHA 4M4SA 3OCVA 4FBMA 3OPYB 1HL3A 5GJVC 4QPPA 4AJEA 2VLBA 4A0FA 1FLAA 5DIFA 4K9RA 5FUVA 4U7DA 2NZUG 2VUUA 3PWZA 5FV7A 1JDBB 3GH1A 4E70A 1E3LA 2YN4A 3IBCA 3K9FC 1NJ1A 4GXQA 3LNCA 4K1LA 4WUYA 3FTFA 2YMQA 1EXWA 3GCDA 4B3BA 3DDSA 1D0SA 1Y9AA 4P7FA 1YA8A 1ZKDA 1G21B 3NM6B 4O4JA 2GETA 4FUQA 1PKXA 1W8DA 2QGZA 2WG2A 1P1FA 1KI7A 1KZ7B 4ARBA 1Z2CA 1NXXA 3JAKB 1PHPA 2XUQA 3X1WA 1HTTA 1VA5A 1ZD2P 2RGDA 4MUHA 5JH7B 1N0QA 5JECA 2X7HA 1A98A 1J8DA 1RYNA 3VTAA 2LTAA 4F21A 4EA6A 3HVJA 2WQ6A 2DFPA 2RGXA 3QNMA 4KIWA 1SZ9A 1NLMA 3S2EA 3CKCA 3TOVA 3C16C 3WR5A 1XMVA 4EYEA 1W85B 2PJRA 3IERA 4Q7LA 3ZBQA 4N01A 3TGLA 2OUKA 5B1SA 4WZBB 3PXAA 2PQMA 2HRQA 1KI2A 5EJGA 3F6EX 2I7CA 2WJGA 3M6LA 1ATIA 4MBGA 3MAGA 1UUFA 4I9CA 1Y8AA 5HE8A 2HU8A 2VPZA 3UM2A 1DDGA 1LSSA 2BTOA 3ONLA 3JYOA 4QOSA 1ODCA 2QU7A 4G5XA 3OOSA 1U7PA 2WAXA 4A1SA 1JHOA 1QMOE 2R7MA 4IR7A 1GQYA 2V7TA 4W5WA 2VJDA 3ZV3A 5AARA 3YASA 1Y1LA 1RPTA 3SG0A 1XAJA 2VEDA 3GRCA 3A36A 4OMCA 4PE5B 2QWXA 3ZCVA 4Q00A 4LTDA 2VYND 2OXIA 5F9HA 3ICQB 1KDRA 3K1ZA 4G8DA 3PUVA 3NV9A 3KAEA 1ADYA 1ONOA 3UGKA 4J90A 4MH0R 5DPMA 3JWJA 3IEMA 4PX2A 4G81A 2UXBB 3FNIA 3JYPA 4HNGA 4TV9B 2W83A 3HNOA 1U1EA 2VOEA 3HGQA 1J8QA 1KKLA 4CMJA 5HKKA 3GFBA 3TGWA 4BDSA 2RBKA 3T9BA 2YICA 3WL7A 4NCBA 2IU4A 3HJBA 1L7DA 3C6XA 2QN1A 3LPAA 1JF8A 3S7BA 1DINA 2SNIE 3DCJA 1SZJG 1WZUA 3DBSA 1QTNA 2I1QA 2I3AA 2YYSA 3A4LA 2ZSIA 3JD2A 1ELOA 1Q44A 4MUAA 4M7PA 3HEMA 3TEJA 1E2JA 1RHQA 1ECCA 3A31A 3N8GA 5IVDA 5FTWA 4BNMA 3SI7A 1M9NA 2QTVB 4LCBA 3RSHA 4YIHA 4Q66C 4DW8A 2PUGA 4H2DA 2WY2D 1Z3YA 1Z8FA 2BKVA 1U4SA 3R9XB 2X6IA 2WABA 2B1JA 4WADA 4FHGA 2XCOA 1TL7C 2QXYA 4IHAA 1QYXA 2GZDA 2PBZA 1YL7A 4BWRA 2NSYA 4F3CA 5CYGA 2PUWA 3FNHA 1HE2A 3NOQA 4BFCA 2Z6QA 2CVHA 3EHRA 3H7IA 721PA 3AHHA 5BMVA 3B1FA 5KNCD 4JN6B 4FCVA 2IYPA 3DKRA 3KV1A 1SY7A 3AQIA 3LLUA 1TUGA 4XLLA 3ZD9A 4BLTA 5A4KA 3AERA 5I8PA 1LDGA 1JJVA 1OFGA 1JG4A 4MGZR 4UJ5A 5K3AA 3U3OA 2JLCA 3DYVA 4FGSA 4ZAFA 4ZHQB 1EE1A 4L7QA 1ZOOA 4QBHA 4XXHA 4I6JA 1Q16A 3HVIA 3TIGA 3WKAA 1IOVA 3TMYA 4XYLA 5I4CA 1UZAA 4RH1A 1WHSA 4E5NA 3P4UA 5JROA 2WICA 4G2NA 3IRUA 2AN5A 4QYWA 3ZLUA 1UFRA 1NG9A 1HORA 2IIBA 1NRJB 3BXFA 3CV3A 1K66A 1VMEA 2SHKA 4TYMA 1E8YA 5FTJA 5C34B 3L1UA 3TW0A 5AD1A 3AF6A 3TWTA 5JHBA 1TT5B 4EP1A 4M53A 4ZHQF 2HPHA 3RUIA 3KQQA 2B2XA 2I55A 1N6OA 4EBAA 4LYFA 4C0HA 4DS3A 3SICE 2FPIB 4R1PA 5AVOA 4FNAA 1BA2A 2IOFK 3WJ7A 4OKSA 1EFVA 4BJ1A 1QOZA 1U3GA 2PS0A 5BOVA 3VSEA 5DLEA 3SQNA 1O08A 3BN3A 3JQ9A 3QXXA 4MZDA 4PFJA 3PB3A 2PS9A 3IQWA 2G28A 3KHUA 5IWAB 4W5OA 4RHFA 5DSZA 4V38A 4HOSA 1N77A 2IE0A 1DXOA 4DMKA 3SFYA 1VZ2A 3PWKA 2P0AA 3ZHYA 2L2QA 1SH7A 1UWKA 3OZUA 4JOCA 5IK2D 1LD8A 2AL7A 4BQNA 2VQSA 1Y81A 3ISVA 3ZCQA 3AR8A 1W76A 1VGQA 3AUYA 3MA5A 5MHTA 1GKYA 4M1EA 4CIYA 1FJHA 1JT9A 2VAVA 3ZBUA 4F3NA 5B3SE 3C3DA 1V1RB 3EZ6A 4P32A 3RKSA 2YXLA 2G09A 4L0MA 1LDYA 3BQOA 3CUUA 4PHGA 3ZI0A 2QYOA 4JHKA 1MOPA 3IR6A 5C46F 4L7TA 4AFNA 1JR6A 2Y9MB 4HX5A 3BWCA 5G3ZA 3WZLA 1D8TA 1EVJA 3IYLW 1MP0A 4ZIRB 4KRGA 3G7UA 3N2NA 4MPDA 3D43A 4AURA 4BQIA 1NSTA 1G9SA 4ZOLB 2IFUA 3U4AA 3OQIB 5FDFA 5BN3A 3L7JA 4ZPJA 1APBA 2CJWA 3UANA 4J4HA 4JVOA 2RBEA 2AXNA 1YJBA 5NULA 1JSXA 3K6SA 3ZE1B 3PEVA 1MAUA 1T1SA 5BPHA 3D9IA 1FFCA 4W8GA 4BLQA 4X6XA 4J1SA 4B3FX 2YQZA 2WJPA 2Q3CA 5DHTA 1X9IA 3LLSA 3WQSB 2HA2A 2ZJ0A 3PDIB 3IDQA 1LW7A 2G40A 4JJFA 1M2EA 4HB3A 3NBAA 1E2KA 4D3YA 1DC4A 4WESA 1WMAA 4QT0A 4YASA 1PZHA 5L7YA 1Q22A 3DUFB 4C05A 3O4ZA 3VPCA 4EJ0A 4J1TA 3KPYA 2B1RA 3ETDA 4NBRA 3TLEA 3W9YA 1I36A 3LUJA 5FWXA 4B31A 1QFXA 2CHFA 2OCKA 3R40A 4PLYA 5EXSA 5GONF 1SFRA 4LXTA 1FXWF 4PIMA 4JT4A 2Q4TA 3WBJA 5AW6A 1TCBA 5C53B 3UMBA 5JS1A 4XJXA 3P0FA 2XNKA 4RTLA 1ZG3A 3EGXA 3WB0A 1ISMA 2XPZA 2Z2ZA 1XLUA 3BMCA 3TW8B 5H59A 1KI4A 3H8WA 1ZGGA 2XDWA 5LUAA 3UM3A 5EKXA 4C5BA 1ZHFA 2EJBA 2VQ3A 2HPAA 4JJ6A 2D7CA 1KEPA 5BSMA 1E7MA 3URKA 3S2AA 2W6CX 4P5EA 4WACA 5TQ0A 3OJXA 1PJTA 3M6WA 3AL0C 4ROTA 1Q0ZA 4UE3S 3T5DA 2X2FA 4YLGA 5TPWB 4YN3A 3MUOA 4MCAA 1D2EA 2GTHA 4DY4A 2CNKA 2OQ2A 3QUSA 5ALOA 1Z0ZA 4XM0A 5LQNA 4JFRA 1JWAB 1OGJA 3I9FA 4ZOEA 2ZJ5A 3TI7A 4LXXA 1Z0IA 4TOIA 3UWPA 2J08A 4CEHB 2W2VA 2FPXA 3SYLA 4JJAA 5A5VA 5IDXA 1KH2A 5D01A 2NVWA 1XQ1A 2IEBA 1RDFA 4M55A 4MWDA 4RPGA 1U2ZA 3RM3A 4J8YA 3ZXYA 4AF6A 1V7ZA 3IKVA 3KC2A 2ZREA 2FJ0A 3GZ1A 2EBUA 3BGOS 3GO4A 2C20A 4QTYA 2W6JA 4FKMA 4HWGA 4KE8A 4RD2A 1JLLA 4GQAA 2P11A 2LV8A 1U5CA 3JAWA 1RHJA 1F38A 4QQIA 2F90A 3HWRA 4GXNA 3D0OA 4F6RA 2XB4A 3PNMA 2KJQA 4Z1MD 1NVGA 4N5NA 1J22A 4U0SA 1J2JA 4XKBA 3DC2A 3P27A 1J5EB 3S3TA 2NLOA 3PHJA 3Q6MA 3W4JA 4ND1A 2HT1A 1I1NA 4EW6A 3H5OA 3PL1A 4LJ9A 3OQPA 4I1OA 4BLSA 3SEZA 3OPYA 5LP0A 3K2EA 1KE1A 2E5LB 2OWDA 4YALA 1KFCB 2VTVA 3SX4A 3T3NA 4X41A 4AY5A 4I4TA 1QZ2A 4S1WA 2QV7A 4QRIA 5ALPA 1L5GB 4YLEA 2VEOA 4L57A 1NBEA 2RHDA 5FBHA 4LZOA 4KPEC 4RDIA 3EZLA 2L6BA 2X4IA 1ISGA 1Q7RA 1KEZA 3AT1A 1GGKA 1QG4A 2WXHA 1GT91 3I3OA 3IQFA 3BMNA 4UNRA 1P7PA 3PR3A 4NL4H 3UTMA 2ZATA 2CWDA 3KZCA 4KQKA 2WVJA 5FT9A 2XKJE 3A1VA 3CPJB 4KI0A 4DLRA 1OH5A 2WLSA 4D9JA 3DQQA 5JO9A 3RC2A 4RG9A 1ZW6A 3L8MA 3LBAA 2HQBA 1UZUA 3MB5A 4ZT6A 4YQEA 1RLJA 3HKCA 1KZHA 3AW9A 3DOJA 4UM5A 3H1PA 3X44A 2HIHA 4BNLA 3ZDCA 2ZBEA 4J29A 3U31A 3HSYA 4QX6A 1TKRA 5FLYA 1NWHA 3KE9A 4K0RA 4B3GA 3AZQA 1EH5A 1UJKA 3X3HA 2BGGA 3EIQC 3P8ZA 3U0BA 2HDWA 2BFMA 4PYIA 2YBDA 2PMDA 2LSUA 3IELA 3KB6A 4KMRA 2ZSKA 1QR6A 3AFNA 1QCCA 3L0BA 4JQYA 3W6PA 4JI4B 4PGMA 3PJGA 1Q1GA 4L5BA 2CFZA 2IZ7A 5CA0F 5F76A 1CK4A 2LCQA 1G3IA 4RGVA 3VGJA 3G8BA 2WXMA 1EG2A 4WDQA 1LI5A 3FLAA 1SBCA 4QECA 1JWBB 2NO4A 2TS1A 1JALA 1H9BA 3AKYA 1XN1A 2Q28A 1KDOA 4TN1A 2GMWA 1PHRA 3QYFA 4MYUA 1S8AA 3RU3A 4COOA 5I7FA 1RYBA 1FYFA 3SC2B 1U31A 2P9BA 1OQAA 3WGQA 4BNDB 2CY0A 2YWBA 5TS3A 1TF7A 1N0UA 4KZCA 2WF9A 3FUMA 4R81A 4TVKA 3WJAA 3RC9A 2JLVA 2QVBA 3JWPA 1VJ5A 4CM3A 3F7NA 5K3BA 1ZP6A 1SQ0A 2ZR8A 2PT5A 4GPAA 3ZWBA 2YRFA 4TTVA 3DZKA 1KKMA 4EATA 2APJA 2VBCA 2C03A 2PGAA 1SD2A 5AH0A 1XWIA 4GDMA 2JARA 2RAUA 2VS1A 5DN6D 3TQQA 1FSSA 1Q2ZA 4KOAA 2QLLA 1V7QA 2R8YA 5GTDA 4RFVA 5CUQA 4L73A 3COZA 5AW2A 2GOYA 1GD1O 3LECA 2ZROA 5T3YA 1T91A 2E1PA 3NIBA 3PR1A 2AH5A 5THXA 3IQEA 4WVLA 4XEHA 4OGWA 5HF6A 4KHPB 3ANMA 1QYDA 5A0FA 2F1OA 2ODBA 3M6XA 1CRZA 3U56A 1Z8DA 2Z30A 4X7BA 2KZTA 2ZDHA 4ZQCB 1KYZA 1P39A 2J32A 4MNTA 4U2GA 4DANA 4E21A 3C3YA 3WADA 3AFOA 4URZR 7ABPA 2XJ9A 2C5HA 4B9AA 1Z2DA 1NA3A 3FUNA 4CMGA 3ANYB 1TJYA 1FOEB 3DZBA 4NWIA 4OHWA 5CPFA 4BP1A 4D8UA 4QRHA 2BOVA 3WO0A 4UFPA 3VC2A 1XZMA 4HOTA 4EVSA 1Q7BA 1PS9A 3BG0B 4V0SA 3KZ1E 4DX5D 4D98A 2JIZD 2QM8A 4DUYB 3T1YB 1OXMA 1U8UA 3EARA 4HGRA 4X6LA 4AJHA 1HE5A 3O3NB 4AXBA 3P4XA 3KTFA 1TM1E 3HFRA 3F49S 4EK9A 1YQXA 2H0RA 2ZJ7A 3KG2A 1ODLA 1SAYA 2OV3A 3PQ7A 2ZYIA 2VP4A 3H2JA 2OXEA 1U3UA 1EUDA 1IBCA 4RYDA 2A8YA 2QT9A 1ZUWA 4JVNA 5F77A 4MDEA 1N4PA 1E0DA 2W8BA 1JJ7A 2PM7A 3ASVA 5JAQA 3TR6A 1UJMA 2JEYA 4DRZA 5LOVF 1DDOA 1PLLA 2C42A 2NADA 3HZHA 4BVLA 1KTIA 1ETHA 3F6BX 3WSWA 1XTIA 2OO5C 1M6HA 2HPVA 4ZU3A 2Y1LE 2Y68A 1IULA 1ZEJA 1SG0A 3I04M 4BNNA 1E2QA 3OCJA 3MCZA 4EKEA 1K06A 3RAEC 3OT1A 3U48A 1XU7A 5CB4B 1P3Y1 4GO1A 2C5EA 3IA7A 1G2PA 1MC8A 2ZTLA 4ZVVA 5PGMA 2RHBA 1W94A 4I3GA 4C3OB 1A04A 3IVCA 3DD5A 3W7BA 2HQ1A 1JU4A 2NTVA 3L1HA 3RCBA 3TG8A 1ZMRA 2GM3A 5JJTA 1POWA 2NUAB 5T8KA 3VNVA 1SQGA 2GBPA 4P58A 2PSHA 3JD3A 3E0QA 3R7WA 1HNXB 2X9QA 1ZIPA 3CRNA 4B8WA 2QU8A 5CT4A 1G9TA 1I1HA 3EA0A 3OG9A 4LK3A 2XMGA 2AF3C 3C7TA 4PVCA 4I9UA 3ZXIA 5BW5A 2J9YB 2WK1A 2VUIB 3H5NA 1SOAA 3EIHA 5FYDA 2OAQ1 3X43A 3ZS9A 2EQAA 4BEBA 2R59A 3L1JA 4R5MA 5IZCC 1YC5A 2B99A 3NKVA 4FFOA 2DFKB 1OTYA 1SOMA 4XTRA 4TLLB 4BE4A 1KJ8A 2G72A 3JVIA 1XMOB 3EY9A 1WW3A 3P26A 3P7MA 1KPGA 4KO3S 5EZ5A 5SV2A 3UAWA 3I12A 1YR3A 1A4XA 3W5DA 3K0SA 4RGQA 1VI2A 3GFSA 3OTIA 4M9ZA 4WN3A 1PJAA 4YUXA 5M7EA 2C7RA 3M6UA 1K8RA 4GEGA 1TNYA 4LK2A 2VSNA 3C48A 4MROA 2WWHA 1VSVA 1E0KA 1DEKA 3MOSA 1EFHA 2NU7B 2QL5A 2AFIE 3C3MA 1DV2A 5J08A 1EBBA 2LPMA 3RRZA 3NDBB 3H5VA 1NQWA 3DLCA 4HMOA 3UXGA 3VDXA 3AP3A 2PXAA 2RJNA 3AG5A 4LJ8A 3C3RA 1W4RA 2HT6A 5BR7A 3B53X 4IXNA 2VSQA 1N4RA 1U2GC 2X8AA 1EZ1A 3FVTA 2LXMA 4YDOA 1DTEA 2XQVA 4JBWA 5CX4A 3N53A 2IYRA 1Y8MA 1RZVA 4A5SA 5KHLB 3F4BA 2AQHA 1IRXA 3LOPA 2ZT7A 4IICA 2IDJA 1XU9A 2Q4EA 3D5TA 4TV8F 5K6RA 1MEJA 4QYMA 1ODKA 1ZN2A 2WSSD 3DO8A 3WICA 2X0DA 1PJBA 2BP7B 4XOIA 3TSAA 3UT5A 2OCDA 4UXIA 1XDZA 4Q3KA 3L4SO 4IM7A 1CTQA 4HFNA 5CMWA 3JD0A 4I1IA 1MQ8B 2Z98A 4C2BA 2C1ZA 4N5MA 1VDYA 2XH8A 2VJKA 1LRJA 2O1SA 1KMNA 1ACLA 1U80A 5AW8A 3FTVA 5HW0A 3RJ9A 5LJIA 2P4SA 2XT0A 2XNSA 1VJCA 2QTAA 4U0UA 4L3OA 3OJOA 1E5TA 5FFFA 2IO2C 2FX2A 2RGCA 2ZBFA 3MQ4A 1F8FA 3A70A 4G5SA 2DGDA 2MOKA 4WOCA 5CTJA 1IPHA 1KL7A 2ETXA 2QTHA 3UVEA 3ZZTA 1WQ1R 2G9UA 2VYCA 2M98A 4UEQA 2PLRA 4AD8A 2NIPA 1QG6A 2L42A 3FR8A 4FE3A 4K9KA 5EJAA 3RRXA 2PGJA 2QN8A 3CE9A 1Z73A 3GUVA 2ZJZA 4GLLA 4MRNA 5E9AA 2WE8A 5FOVA 4DCOA 2G83A 3OE5A 5IABA 3TIVA 5GY7A 1PSWA 2X40A 3MUNA 4PHCA 5E4TA 4WCVA 4YO7A 4ZVUA 3VJLA 4DQ0A 3OVMA 1DRVA 5SZIA 1P0MA 5FL7A 3CW8X 4LJ6A 4JLNA 4N12A 4U7JA 4ANUA 1CUHA 4NE7A 3V8RA 4EX6A 5KPJA 2QW8A 4PNPA 4YRSA 5YASA 3L13A 1D2MA 1KMIY 2OLKA 4QBKA 4UWGA 3WMEA 3CBQA 4DMGA 1NUHA 4C6TB 3CRVA 4ZV4A 5I7UA 1HWYA 4ON9A 2TMDA 2O3SA 3EXIA 5EHGA 1UADA 1KJNA 5SZHB 2I9PA 1KWGA 3PRHA 4MI6A 4KVAA 4NBVA 4ZI3A 1E60A 5GWXA 2FW9A 5J90A 3SK1A 2WXGA 5FIUA 2R8EA 1KT0A 2V5AA 1WUYA 3JRXA 4TKZA 3LHIA 5BUZA 2OXTA 3W5UA 8ABPA 2O59A 2VJQA 1BVUA 4Z0HO 4FFDA 5JSFA 5AR1A 4NURA 2QMYA 3G6KA 1MYOA 1SZAA 1EJ6A 1K3FA 2D0DA 5AK4A 4BVFA 1RBZA 2TSYB 4JX8A 5C1PA 5ILOA 1P2DA 3NRCA 2F3RA 5C1IA 2QRZA 3RWMB 4CLDA 1CXZA 2QUAA 5KKAA 5REQA 4XM1A 4C1BA 3LTEA 3DE7X 5FBLB 3HB5X 4G67A 4AN4A 2P5UA 2OHXA 4D6PA 4RJKA 4Y9SA 3SSOA 3RVBA 4YRZA 1UP6A 1SCJA 2A0UA 5E6UA 5BSEA 1QVAA 4FW8A 4NK4A 3AEXA 1NQAO 4ADSG 2PL9A 1CY4A 4MR7A 1JE0A 3P9NA 4GYKA 1WKBA 4R2IA 1XKLA 5JCPA 4NYJQ 3OZRA 2QS9A 3PT5A 3Q9UC 4G65A 4EHIA 1J2EA 1GGEA 3SZRA 2NTJA 4LJ4A 1H0AA 4IDBA 1IKND 5IKEA 2IZZA 2IIPA 4GTSA 3R7BA 5AW3A 1RXWA 3FZGA 5I9IA 4GTMA 4FEYA 3RFCA 4LOIA 1DUIA 2FPMA 3A6EA 2WA2A 4NZ9A 4BNXA 5HBRA 3HDGA 4P36A 1XZBA 3TBFA 3DRAA 2HA6A 3Q1LA 1JJIA 4REMA 4ZQHA 2J3LA 1IN7A 3UKJA 3LSTA 4FJ2A 1COWA 1M2VB 1NVDA 3T7IA 2VGEA 2PZEA 1XJ0A 4CZ2D 4TV9F 4I5FA 3RRBA 1I14A 4OHRA 1POXA 2WHPB 3B48A 3KTAA 2I7DA 1QH8B 4OGKA 2FSSA 1A9XB 1EVZA 3VU0A 5C3UA 1CIPA 2X7JA 1MO4A 4LXUA 1WZCA 2BI7A 3AJ9A 3AX6A 1QSGA 3FDIA 3L9WA 4ZEWA 1FX0B 4II3A 3U9SA 2OCAA 2HJSA 3NVMB 2PSSA 2VO1A 5DIZA 5C8VA 3FPKA 1FPMA 4XI0A 1RYDA 4LYDA 3AL2A 1U8AA 3D7SA 3LFTA 3REFA 2DQZA 1U1GA 2NMVA 1Q0HA 3CFYA 2O8DB 5TNXA 3BIFA 1E92A 5AM2A 3G3EA 2Q5FA 3SZLA 1DEXA 4JC0A 3N2GB 3AIIA 3FKSD 1ULZA 2EZ4A 3LP6A 3KEZA 3VNRA 1QH0A 2X0EA 4WBXC 3IAXA 4QREA 4Y1GA 2CN1A 4IKOA 2H1OA 1Z7YA 2OG2A 4J1QA 1YOVA 2ZZKA 4G4SP 4G86A 4QLOA 5I45A 2PG3A 2FCRA 1IZZA 2P1ZA 1QYIA 2Z9CA 2G08A 2LSVA 2RSFA 1E2HA 5B64A 4IOMA 4M38A 1M3SA 2Y3IA 4JT9A 4MUEA 1FDOA 3CSFA 1YI0A 3MZ0A 5FTPA 4Y8VA 1PEKE 4QGHA 3T41A 1XD9A 4BP3A 4CQNA 1QQ5A 1MZCA 2HKIA 4ZYUA 4UWLA 4D74A 2Z1MA 1E7SA 4LHVA 4D79A 1UL1X 3KM0A 4XE5A 3FBWA 2D5BA 3QH4A 3IUQA 3AY6A 1SELA 2O0HA 4DPLA 5B3KA 4B6SA 2F1JA 4FJZA 3ONVA 4ZOLA 1ESDA 1LSOA 5EJ6A 3UKUG 3RYFB 4K6FA 1V41E 2DHRA 4E5UA 1SBIA 2YWCA 3EF1A 3IPXA 2ZP1A 5TLSA 4UPDA 521PA 2BGRA 5C80A 3DR3A 3I4RB 2QLNA 1U2RA 4ALMA 4Q03A 2GK4A 1NNUA 4BN4A 3Q85A 3GFTA 4UEJA 3WK6A 4JA0A 3UPTA 2Y3AA 5EMJA 2WSMA 1GAXA 4ILHB 2Y66A 3PKJA 3HDTA 4CIXA 3A3NA 2D2XA 2EW2A 2ZE8A 3GLVA 4NH0A 4TUMA 2LGJA 2JGAA 4B45A 3BJZA 2AC7A 3OPNA 2I2OA 4QUJA 2R17C 4B32A 1L7NA 4C76A 3AVVA 6AT1A 1V25A 2H2IA 3AMVA 3B1WA 5DV9A 4TTQA 4UMFA 1KI6A 3ZD8A 4BCDA 5G04J 3HJGA 1KMMA 1YFKA 2P69A 2COEA 5H83A 2A88A 4HGYA 2D13A 3A3KA 4LMRA 1BD3A 4FYPA 4R16A 4Z68A 2UUPA 2VBGA 3LY9A 2DM6A 2RAPA 3FSGA 3J7TA 3V3KA 1BJKA 1TK2A 3M6FA 3R7QA 4YT8A 3A0RB 5ESDA 5IBPA 1W36B 4HDNA 4WEQA 1JXMA 4DIBA 4TYNA 4F4FA 1W9HA 3SKXA 4UHCA 4D46A 1PR1A 1G5HA 1H4VB 3PVSA 4YAEA 3UPDA 3GPBA 4P0PB 2WIKA 4RD4A 4GSYA 2AZMA 3HG7A 1ZN8A 4FMCF 4GVLA 3VAAA 2OHGA 2IODA 1U7DA 2E89A 4OQZA 3W7AA 5JS6A 1A5AB 5ISMA 5BRNA 4GPKA 2C4WA 4BLRA 3ZRHA 1OIVA 3RADC 2ORYA 3FCUB 5KOIA 1J1ZA 4KLAA 1UP7A 1HDZA 1Y8RB 1B0UA 1NFRA 3GJTA 5CA0A 5LP1A 1K08A 4CV2A 2IPMA 2BZ1A 3ZKWA 1Z5UA 3RVOA 3TRIA 1X94A 4JUFA 1G8GA 1TQ2A 1PNQA 2W8ZA 5KJLA 2ZDGA 4I1AA 1DWOA 1DAMA 3ASUA 3F9CA 4HDKA 2QQ0A 2JCBA 4R5HA 5EMNA 4KGVA 5TMEA 1LTXA 2C7GA 3H0EA 3DR5A 3TO5A 2WVAA 5FOXA 2H57A 2BLLA 2LIVA 1R0CA 3I30X 4RE6A 3UN1A 1ZXXA 1Y6QA 4F4UA 1E6MA 3COSA 1Z75A 3DD1A 2SCUA 2ZEJA 3GNSA 3F98A 4Q6WA 1B6GA 1DC3A 1C7JA 1UKEA 2AW5A 3KAQA 3ML9A 2NZYA 5IJXA 3SQMA 4DA0A 1AS2A 3EH1A 3OJFA 3FHTA 2QM0A 4IYJA 2WIFA 3FDJA 4DG8A 4DCPA 1EJ2A 4MP8A 4IV5A 2B3TA 3V4FA 1JFSA 1FP4A 3UFXA 4QM7A 1GAEO 4P5DA 4NEQA 1VIVA 2H6HA 1CV2A 4NCNA 1J99A 4CV3A 4HQLA 1SUEA 1F14A 4H7EA 4RM2A 3ZHTA 4BO6A 4MMYB 2QJFA 1CLUA 2AI3A 1B2RA 4FK8A 3X2SA 2X9GA 1LH0A 5FOSA 2DBQA 4DMCA 4ZODA 3KXDA 4JLVA 2PX2A 3EBLA 2MSWA 4HS2A 3NHSA 4I1SA 4DDHA 2R2LA 1FJ2A 3TWVA 3BFKA 4XFJA 1C7IA 1EYHA 2WMOA 3QUAA 4Q4HA 4CEJA 1X87A 5T64A 3AOEA 1VLQA 1A9TA 2EJVA 3IT2A 1PT5A 4FMCB 1MHPA 4YUYA 1YF3A 4TMKA 2ZUBA 3GP5A 1MUUA 1DX4A 2JFNA 2QUIA 1GUZA 5EOVA 5CK5A 4TTSA 4OK5A 2EFEB 3CGHA 1FMCA 1HF3A 7ADHA 4MRMB 3QXJA 5KYYA 1M5UA 3LT0A 5EKQD 2MSNA 1TW3A 2J0EA 2JAXA 4FU0A 1U02A 3DOUA 2WWYA 4MHTA 4G23A 1O5MA 2D4AA 4TZ6A 3HXBA 4QFVA 2ZSDA 2Q9AA 2GUGA 3CT6A 4U00A 2JLZA 3R3YA 4EJ2A 2R68A 2ZI7A 5AI4A 3LY7A 4Q4JA 5ICSA 5T8IA 4TMWA 4D6XA 3CK9A 1GKUB 2LDBA 2RI1A 1R6BX 3KALA 3URZA 3GN2A 4DHWA 2PMEA 1LI4A 4QNRA 4B3TB 1RXSA 1CHNA 4Y2TA 1K3ZD 3LC0A 3PUIA 3QVGB 5EHZA 3OU2A 5LLSA 1JAYA 1OU4A 4EG5A 2FSIA 1YGPA 2ADFA 1Z0KA 4G0XA 4NICA 3M5DA 1KSGA 3SKVA 4QDZA 4LDQA 2H2AA 4D8TA 1LC0A 3ZE0B 4FHKA 2GFQA 1H85A 3TD2A 1CC1S 1U81A 2QAGA 1SKYE 1FNMA 3DFUA 3M5PA 4E2FA 4O25A 3LF2A 4Z5XA 5KJ6A 3I28A 4WNDA 2G9NA 1G66A 2DWZA 1LPAB 2Q0QA 1A2KC 2GW1A 1GNRA 2W37A 4YROA 4DWOA 3HYRA 1ONPA 2G82A 5LBIA 1XD8A 2A3RA 1NNI1 4C0XA 5LPNA 3OLWA 3D8HA 4KRFA 4UAGA 4JYZA 5D3MB 4OGLA 5J2UB 2JVKA 2NAPA 4RMJA 2I4NA 1Q0LA 4P0QB 4G1TA 2BUAA 4YBRA 3LO8A 1ZLYA 4L78A 4B4KA 3GQVA 4HLUA 3T3GA 1QBKC 3UCXA 3KB8A 3ULQA 1IZ9A 2DLNA 1C9JA 3VZDA 2CKDA 3QKRA 4EYOA 3CZQA 4OHZA 2BEKA 2XB6A 2O8NA 4EM6A 1DBIA 1N0IA 2BBTA 5EJ7A 1E0AA 3E1KA 5IYZA 2CDAA 1R0WA 2EHJA 2O8BB 5D66A 1W3BA 4ZAYA 3FMPB 3E30A 1I0ZA 4X93A 4GGOA 5DLDA 1Z6QA 2FW1A 5FI5A 1SN7A 1U0GA 1VL8A 4Q15A 1T1JA 3EEYA 2DCUA 1XSEA 3RT1A 3W06A 2AMFA 2QR5A 5EJIA 1JPLA 2VSXA 4NBKA 4OB7A 4KGDA 1QXSA 1SBZA 2EAUA 1ZOLA 2QNIA 4W7IA 2D5IA 1R0BA 1GPNA 3MTQA 4HEA1 4Y6GB 3STTA 3FHCB 2YNQA 1J25A 2W2QA 1WBBA 4PPQA 1KZPA 4LUNU 3WHPA 4H60A 4L6AA 2EKZA 4B43A 5BWLA 2GZHA 2HXGA 1C9MA 3PWTA 4EMUA 4KE7A 2KYRA 1DWQA 3CCBA 3KT3A 4DNXA 3QJYA 4U95D 1JKFA 4AVYA 4PPGA 1WUJS 3IEXA 1OLSB 2GFHA 1K89A 2VYIA 3S8YA 4P4NA 5JNLA 1OH7A 1PD1A 4OXQA 2VRBA 3DDWA 3HYTA 4LOHA 1BQEA 4XCXA 5JFGA 5JW6A 3D6NB 2OR3A 4HFJA 2PUCA 4KBGA 3NYQA 3AI2A 1TQDA 2N47A 2GA9A 3RTAA 5AM3A 2A9PA 1S9DA 4CCAA 5K6AA 5DXFA 1R4AA 2ZSUA 4Z1MA 3E15A 3GW8A 3SLGA 1LLCA 5K2MA 1AMUA 4QNNA 3CK8A 2BF0X 3ELBA 4RMNA 1WU7A 1M73E 4MKFA 4J8SA 4ZAGA 1NY5A 2YWRA 4RTRA 2AN1A 1C7EA 3BC1A 4KAAA 4CG3A 3IUPA 4CMCA 3RHZA 4DWWA 4YV1A 5AW7A 1IC6A 5KAPA 3RO2A 3FWNA 1Q95A 2FZCA 2KBXA 1M1ZA 2FVXA 2IUFA 3USES 1BVYF 3TQSA 4IH4A 1GWNA 3ESZA 5GJBA 3D0QA 1TUIA 1LLQA 1XLTA 2IYEA 4J7CA 4Q1BA 2VTBB 2Q9UA 2Y1KA 1I5EA 4KKXB 4TT3A 4AICA 1DVRA 4MQBA 2EZTA 1JEQB 2CJPA 4DV1B 1DBRA 2CMDA 2GPTA 3IOMA 4G4SO 4PIVA 1V16A 1VZ3A 1WCYA 4BMYA 1J23A 1GLNA 5K8IA 4G36A 1IBKB 5CEDB 4NI5A 3LS8A 3H2BA 2IL1A 3DZFA 1NDHA 2GWRA 3FWYA 4YCCA 3LDUA 4CQMB 3N0VA 1CZHA 2XOXA 1NJ6A 4X7PA 3EXIB 3E3MA 3ZDDA 1P7ZA 2BMFA 4JD5A 2VSXE 2F9LA 4RD3A 4CIAA 4LMBA 3D4BA 3DKVA 3WRYC 2QSJA 4MSUA 2C9BA 3AHCA 1E9FA 4BFYA 2X5HA 1GJRA 2JGDA 2R1VA 1R9JA 3A9RA 4CIDA 4J9VA 1E63A 1E64A 1Z28A 2GK3A 5E3HA 3U5TA 3IVAA 3DE1X 3QV2A 4W7HA 2ZRLA 4YJ2B 5JCOC 2W2TA 4G26A 2XDQA 5EHXA 2UUAB 3NBFA 4K6OA 3JQFC 5K6AC 4DLUA 1WEHA 1GUDA 2UVPA 1MW9X 1YACA 4EY7A 1SZDA 1YQQA 2WB4A 2J3EA 2WWTA 3I37X 4F0JA 4YR9A 2PUBA 1OW3B 4EG3A 2IIVA 3EXEA 2I3ZA 5A62A 1QHSA 3OIWA 4FQ7A 4UBOA 1MC5A 3ERCA 2C9CA 3EQ7A 3B7TA 3I2IA 2I6TA 4Y2JA 3G8AA 5L45A 5CYPA 1BXRB 5LYJF 2WUGA 2ZBDA 2QRUA 3ZUGA 1S4QA 1HLDA 3GYZA 1C7FA 1F6DA 1QJ4A 1ZQ9A 3U39A 3FPJA 3NZEA 4JGIA 2FSVC 2OSBA 3AUXA 4RIHA 2RHGB 4RZSA 5F1OA 1N8TA 4BECA 5CBKA 3KQUA 1HMPA 4P54A 4CN9A 3SFVA 1ODFA 3CNNA 4KUEA 4L8FA 1CT9A 2DR3A 2JD0A 2VGYA 4HBDA 1SGWA 3FCAA 2BR5A 4H4EA 4QFCA 1T34A 4MVYA 4XAQA 3SXUB 3TKLA 4MRVA 1MB3A 4N1AA 2ZRBA 1N75A 2P6OA 3DTTA 3OAAD 4AZ0A 4BKOA 2ODPA 4M0KA 3D6VA 3N76A 4RLSA 3GNTA 2ASEA 2COUA 2Z3VA 4GSLA 2PN1A 2JA1A 4JP1A 4UC0A 2GI4A 2Y2UA 4YI3A 3VMFA 4XKCA 3EQ9A 5HIKA 1CUFA 1HNWB 3Q7AA 2QG9A 5H3CA 5T6MA 4J2TA 5EYPF 3L93A 4GWKA 1NI1A 3B1YA 4HPWA 4JOSA 3H0CA 1SA0B 4B7XA 2WM9B 4CFZA 1C0KA 2J5KA 2EX0A 3LY8A 2HJ9A 5IXJA 2ES4A 2Y69E 1J8FA 3T3PB 3K70C 2NQ8A 3U4IA 3ROEA 3PQ6A 3KSMA 2BWJA 1ZGZA 1HMYA 2F62A 2QN7A 5JMND 5AIJA 3A4VA 5HF5A 3TW4A 3U1BA 4JP2A 3BDVA 3SFXA 2SKEA 4IQFA 4YH1A 1GUYA 5F7OA 1MZPA 3M6MD 2C59A 2ODEA 4B3JA 2C7OA 5CVEA 3N59A 3ABZA 5DI3A 1CVIA 1WXEA 2X6JA 1FFGA 1T1RA 4JUCA 1MV5A 2GROB 1FS4A 4MUKA 3VR4H 3CISA 4N3GA 2Y0BA 3ENQA 4QIHA 4BBAA 5A0VA 1KYIA 4XD7A 1JCRA 4JBIA 4B4DA 2JVJA 3CTMA 4K2HA 2HOQA 5A6SB 5D7NA 2KCLA 4UZFA 1JFTA 3KBBA 5F21A 2IPAB 3ZWXA 3C5RA 3VKHA 5FR1A 1GHTA 4XVCA 1ZIDA 3B20A 1NVUQ 2P68A 2Z3ZA 2ZIFA 3GRUA 4JLUA 5EWLB 3ISJA 1JFFB 2CNLA 2Q3DA 3L79A 3B51X 4XWAA 5FNVF 3T7RA 4AXHA 1V35A 2IY9A 1LQUA 3HZOA 3RVKA 1JA9A 3BIWA 3DDNA 3M34A 3C3QA 5JS7A 3PV0A 4TV8B 4QAJA 5G0VA 4Z7QB 5C5EA 3I3SR 4WBNB 4L8LA 3WMRA 1ID8A 5H81A