4CDRA

Human o-glcnac transferase in complex with a bisubstrate inhibitor, goblin1
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
717
structure length
698
Chain Sequence
b'SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANSFE
publication title Bisubstrate Udp-Peptide Conjugates as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 268
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4cdrA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4cdrA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4cdrA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4cdrA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cdrA03
1QZ2A 2VQ2A 4RG9A 2X6QA 3CX4A 2AV6A 1RZVA 2X6RA 1QM5A 2GM9A 3WADA 2XGSA 3U4TA 1WV1A 4HLNA 4RIGA 3VUFA 2F3SA 3NPAA 4J0UA 3OY7A 3CEJA 3URZA 4N2QA 2G9QA 4H7XA 4BWRA 2QN1A 2XPIA 4HORA 4KQ2A 4I2WA 2JLBA 2R4TA 3NP9A 1ABBA 5FZSA 3L79A 5KJLA 4HOTA 2UY1B 2GEKA 3VDNB 3IAAA 2ONDA 3OXGA 5FJYA 1P2BA 4WHMA 3C4VA 4BQFA 3Q5MA 1IHGA 2G9UA 1PC2A 4YI5A 4I2ZA 3BD8A 3GYZA 1EXVA 1K08A 2FBNA 3QKWA 5CHEE 3WAGA 5A6CA 3U3WA 2YJNA 3NAZA 3G2NA 2SKCA 4FKZA 4G26A 2UWJG 3LY8A 5IKPA 3MS4A 1ELWA 3RKVA 2P58C 4GZ3A 4F97A 1W3BA 3DZCA 2Y4UA 2F3UA 1UQTA 3OY2A 3AS8A 1JG6A 2C2LA 2PQRA 3OT5A 3PE3A 2LNIA 2QN3A 5D0QD 4FZRA 3OTHA 3SF4A 1B4DA 1P4GA 4W6QA 2QRQA 4M7PA 3ASDA 3L7BA 3QWWA 4AMGA 5LQDA 4KQMA 4YI3A 2C1XA 1V4VA 1VGVA 4GYWA 2QLLA 3E3LA 4N39A 5FTPA 3ZN3A 3L7AA 4A1SA 5TVGA 4MRAA 3Q3HA 3KS2A 2FF4A 3EBOA 2LSUA 4HOQA 2IEIA 1YGPA 3D0RA 4XI0A 3L7DA 4REMA 4X7MA 1Z6QA 3IA7A 3LYAA 4WNFA 3WC4A 4AMBA 3K9IA 1IYGA 2VCHA 1L5QA 2E2EA 3S7BA 3TOVA 4EL0A 5ENZA 3AS5A 1P4HA 1LWOA 5ARFA 3S27A 2QRMA 4BT9A 5HQ8A 3S29A 3TG5A 2FETA 1EM6A 2IYFA 3NF1A 2FEZA 5C1DA 1PYGA 3C4QA 3AMVA 3QOUA 3G2JA 4G23A 2PRJA 2C1ZA 3QWVA 3G2KA 3OKAA 4WNDA 2BFWA 4WNGA 1GPYA 4WNEA 3ZFWA 1Y8ZA 5BNWA 3QWPA 4BQEA 1HLFA 4HWGA 2HR2A 1WUTA 2GT1A 3CEMA 1HH8A 2SKEA 2NC9A 3MA5A 3CVPA 2QLNA 4EJ2A 2X0EA 3ASGA 2ACWA 3WXXA 2XEVA 4RENA 2GEJA 1L5RA 2LSVA 2WQHA 3CK9A 3DDSA 1P2GA 1NOKA 2YQ8A 4UI9C 4N9WA 4I1AA 3Q47B 2KATA 4YUAA 1WW3A 3Q15A 4BT8A 1E4OA 1A8IA 2VYIA 3H4TA 4GPKA 4U0SA 3KAEA 2IV3A 1XL0A 2IV7A 4U0ZA 2I6HA 3ASFA 2XCBA 3TAXA 1IIRA 4F96A 1C8LA 4PQGA 2PQ6A 1YA0A 3ZCPA 4L22A 2C0LA 4AN4A 3N71A 2YHCA 5G05J 3E3NA 4CTOA 4GZ6A 2VGXA 1NA0A 1UZUA 2QLMA 5JTUA 1E96B 3ESKA 1A17A 2QZSA 3Q3EA 1NVKA 4GCNA 4GYOA 3D0QA 3UUXA 1HXIA 3SZ7A 2WTXA 2HO1A 1F0KA 2IUYA 3ZCQA 1JIUA 3O3CA 1WW2A 2GPAA 1NOIA 2PRIA 4J8DA 5G04C 3S7JA 5LCWC 1PN3A 1RZUA 3MT8A 4EKYA 2F3QA 2VGYA 3CVQA 7GPBA 1SXPA 1NA3A 2KS6A 1BX3A 3R9AB 5FZQA 4EQFA 2XGMA 4LEUA 4ME2A 1L5WA 3CVLA 1P5QA 2VSYA 1FU8A 5D01A 2PZIA 3ASHA 2PL2A 4N3CA 3G2HA 2HYZA 2GW1A 4UQZA 3BCUA 4W9RA 3GZ1A 3EBPA 5TMBA 1KT0A 5IKOA 3LKUA 5FT9A 2JZCA 3MQFA 1JG7A 1GPAA 1OUVA 3CKCA 3JYSA 2UY1A 4KBQA 3CKBA 4I17A 1P29A 2QNBA 2QFCA 3FP3A 2ZB2A 2X0FA 1KLXA 1GPBA 1WUYA 3RT1A 1Y6FA 4Y6WA 1FCHA 2H1FA 3ZCSA 3BDAA 1XNFA 3FWVA 3PDNA 2XA2A 2Q6VA 3HBJA 1FTQA 3CUWA 3G2LA 5BW8C 3HBFA 1PNVA 2O6LA 1P2DA 4BQIA 4RIFA 3LY7A 4X7RA 3ZCVA 4Z5XA 2XMPA 4F3VA 1C8KA 3NC4A 3QDNA 5DIZA 1NZNA 5KJMA 5CCMA 2KCVA 4KQ1A 4M60A 3QKYA 3DD1A 3ZCTA 5DU2A 3D1JA 1AHPA 3BD6A 1JIXA 3MEKA 2KC7A 4RIHA 3AS4A 4LDPA 2KCKA 4NQ0A 3MT7A 2R4UA 2ASVA 4YNDA 4MI9A 1L5VA 3GZ2A 4RG6A 1TJCA 2HY7A 1L7XA 3CUVA 1GGNA 3MSCA 2GJ4A 3MBOA 4B94A 1F6DA 1WAO1 4MICA 1QQEA 2PYIA 1KTIA 4BFCA 2QN9A 3NP7A 4NC9A 3CEQA 2MHKA 5EX3A 3TG4A 3ZGQA 3SYRA 3T3HA 4BTBA 4CDRA 2Y4TA 1Z6PA 2QRGA 3GPBA 2R66A 1FTWA 3MRTA 1GG8A 5EX0A 4WUYA 3BD7A 3COPA 2G9RA 4GA1A 3BEEA 4MHOA 3CV0A 3RSZA 4J8FA 2VSNA 5HI7A 5I45A 5LCWJ 4U04A 3HBMA 3MS2A 3C48A 3SYMA 3T3IA 4O6FA 4ABNA 1K06A 4GYYA 4EKEA 1H5UA 2G9VA 3BCSA 3OTGA 4LEIA 2ACVA 4JL0A 4RBNA 2JJMA 2QRHA 1FA9A 2AVPA 2FF5A 4RIIA 1P4JA 4RELA 2C4MA 2OFFA 4KYOB 1ZBPA 4XI9A 4N2SA 4I9CA 1Z62A 4CTNA 5CCLA 2L6JA 4UQXA 5M72A 4G1TA 1L5SA 1B89A 5JJ7A 3T5TA 1PSWA 3ZHEA 4JHRA 4N3BA 5FZRA 3S7FA 1FU4A 4N3AA 3CUTA 5AYWD 3HBNA 3OKCA 2XCCA 3CK8A 1YA6A 4HOSA 3RIBA 1QKJA 3QHPA 4CGVA 2J9QA 1FTYA 3MTBA 3MT9A 4NEQA 3S28A 3G2IA 5JJ6A 2R68A 3L01A 1JEJA 4BTAA 3CEHA 8GPBA 1NZFA 3MTDA 1FS4A 3EDTB 1C50A 2VCEA 1RRVA 4G24A 3S2UA 1ZU2A 3RU0A 5KJKA 1J39A 2PQNA 3CVNA 2P6PA 2IFUA 4GA0A 2Q7FA 3GW4A 2VG8A 4X6LA 3Q49B 3RJVA 2FO7A 1FC0A 3NB0A 5A7DB 4U0UA 4NRHB 3FROA 1Z8DA 3MV2B 3T3EA 4XIFA 1NOJA 4GCOA 5DBKA 3RHZA 2ECPA 3T3DA 3ZCUA 2XCUA 9GPBA 3LCAA 2SKDA 1FU7A 4YVOA 3PE4A 2X0DA 5JTTA 1NZDA 1KT1A 5ARGA 5KJNA 2FFRA 3RO2A 3H4IA 4G2VA 3OKPA 1LWNA 5D00A 4JA9A 4WADA 4CGWA 2WPVA 4G25A 1GZ5A 2QN7A 3CV3A 3KD7A 4GZ5A 2V5FA 1WM5A 4YVQC 3TGOA 4EL5A 3OXFA 1L6IA 4GPBA 3TSAA 1AXRA 2IF4A 4KXKB 5EKQD 2H1HA 3OXLA 4AM9A 1XL1A 4IN3B 2QN2A 4M83A 2ATIA 1M5RA 5G05C 5DLDA 4G2TA 2BUGA 4UI9J 5DXFA 1ELRA 3T7DA 4MHSA 3HYMB 3FFLA 3LPZA 4X7PA 1HZ4A 3CUYA 2QRPA 1E1YA 1NLMA 2C9ZA 1XV5A 3BEOA 3UYKA 3VDMA 1GFZA 1Y6GA 4APOA 3MTAA 3UYLA 4U07A 2AMVA 3VTYA 2PYDA 3RSCA 1XKXA 2IYAA 3CUUA 5GPBA 3VUEA 5HXAA 2XA1A 5D0OD 3IEGA 3MS7A 3CK7A 4CTMA 4N5CA 3T3GA 3NCHA 3ULQA 3MRVA 2FI7A 3RO3A 3VTXA 2BGUA 2OOEA 3UPVA 3Q4AB 4J8EA 4AY6A 2XA9A 4UQYA 2C0MA 5TMDA 3E4BA 3MRXA 1JIVA 1UQUA 2AW3A 4RIEA 2GPBA 2R60A 1C3JA 4AY5A 5G04J 3S0JA 1O6CA 2IEGA 4HOUA 3GUHA 3ZCRA 3UQ3A 4GA2A 2BGTA 2GPNA 4NESA 2DBAA 3OTIA 5TMEA 3ZPJA 3ZHEB 1WV0A 2BISA 1XC7A 2VGXB 4JA7A 3Q3IA 2XCIA 4AIFA 4I9EA 5JJTA 4MI6A 5BT1A 3LY9A 3BCRA 4WACA 6GPBA 4H7YA 3S7DA 2AZDA 4QLBA 2F9FA 2XGOA 2R5SA 2F3PA 2KCLA 4Y6CA 3DDWA 3O48A 1SXQA 3MKRA 2IW1A 1IXYA 3MV3B 4UI9K 3L7CA 1XOIA 2QN8A 4MI3A 1Y8MA 4F9FA 3E3OA
chains in the Genus database with same CATH superfamily
4PZZA 1LTKA 4DK5A 2WZQA 4C14A 2Q2VA 2JK0A 4HNAA 3UT6A 4YDEA 4X6UA 4J8YA 1F0NA 1P9WA 1KNXA 1MT0A 4K2AA 1GZ7A 2VP4A 1RLUA 4TUUA 4DZRA 1DJMA 5JXGA 4XGKA 2RHDA 1YF3A 5FTKA 4CM9D 2DRIA 4Q3KA 3AS8A 5B37A 3AF6A 5BR4A 2Z8YM 4PR3A 3QVJA 1G4HA 4JYPA 3QXJA 2B8JA 3CZMA 1DPGA 3GROA 5T67A 1KY4A 2RJNA 1XMQB 5JCOC 4LJYA 1CUAA 2O8EB 1FDWA 1EFUA 1O5OA 4GMDA 2MSCB 2Z8YA 3FDZA 2IKSA 4RDXA 3CW8X 5FBZA 1UP6A 1Q5PA 3FJ1A 1CC1S 1GTL1 2HIAA 1II8B 1WKCA 2R7KA 1A2BA 2FPOA 3TW6A 5LZ5A 5SY9A 3B9BA 2M32A 4RZIA 3WO1A 3H9GA 1II9A 5IAJA 4LJ7A 3CK9A 2FW1A 4IV5A 4GGMX 5ITVA 3N2YA 1E58A 1CFZA 3FLMA 2X3YA 3FTSA 4PVDA 3FYUA 2Q0SA 2GFQA 3W2GA 2RGUA 3F3YA 1YSCA 2R59A 4XKJA 5K8LA 3IQXA 2XKKA 2ECOA 4DSNA 1E9BA 2GPAA 3VJRA 3HP7A 4WIAA 2FMUA 3ME5A 2BKAA 4YWJA 4FLHA 1W5TA 3KYCA 5FWNA 5REQB 4RZHA 5IKOA 4DDHA 3A9TA 2ZBRA 3NS7A 1SD5A 4L8LA 2EBUA 3GEBA 3LM8A 2II6A 3GEIA 3IO5A 1X15A 1NI1A 3BG1B 2VJKA 3H3FA 4OVKA 1JP7A 2XNHA 1X7XB 2ISSD 1FRFS 5FPYA 3BDIA 5F76A 2EJCA 4BKOA 3R5JA 2OHJA 2RBGA 1JIXA 1QFJA 2VJOA 2WG0A 4RPJA 1T8YA 3AIKA 2I2DA 2FWRA 5DRYA 2BMFA 2CJYA 2ANCA 4F2DA 1ZKDA 1TIPA 4KO4S 5T4HA 4MKRA 4QM7A 1XZEA 1PVDA 5DTJA 4LNGA 4RJTA 1ZH2A 5JCXA 3C48A 3CF6R 4BFXA 3FUHA 2GZ3A 2W0MA 3WMFA 2H29A 4FFRA 4PO8A 3ZW8A 2HE0A 2HM7A 2JCVA 1E60A 1SCBA 4AF6A 4JI0B 2BTOA 4WNAA 4QPPA 2BGGA 5FIOA 3G2IA 2YKGA 4V0ME 4H3KB 3GRRA 4KLCA 3D3MA 3CCBA 2HMVA 2Q2NA 2V6BA 4OMFG 4ZC1A 4X54A 2MMCA 3NGMA 2PSHA 3B7RL 2PEYA 1NC1A 4ZPJA 4B7AA 2ECPA 4EYKA 2V7QD 3E37A 2FN7A 1S9DA 4WX2B 3ZQJA 3NGLA 4AJKA 4UEOA 4JS0A 2CMKA 4MV7A 5HKAA 3GPCA 4PNEA 2V4UA 2VDVE 2V6FA 5DX1A 2REXB 1O94C 4J0KA 3QA9A 4X7PA 3CUYA 2L2QA 3UG7A 4U07A 5HXAA 3H5WA 1GDDA 3S2EA 1KYQA 4ZHQA 1D2CA 3DEFA 5EIEA 1MNAA 4A0RA 2G82A 2QUJA 4MV0A 1M1ZA 4Q48A 4P3XA 4QHTA 2DLDA 4E11A 3AL2A 1V3QE 3BGWA 1QIKA 2Q1XA 3DTVD 3A9CA 2P2CA 3E0QA 4URUR 1O9BA 4R2LA 5EUQB 1UAAA 2D2IA 2PMCA 4Q4LA 1DAFA 3TUZC 2BTEA 2ZI9A 3OMXA 5CA0A 3CR3C 2GCNA 3JZDA 5AK4A 2XGOA 5FA6A 4MGYR 3AR7A 2P67A 2JAPA 2IF0A 3ETHA 4F9FA 4JP2A 2G5PA 4QFBA 2C29D 5EWMB 3RVKA 3UHAA 4Z1MA 4XKCA 1EP2B 1E1NA 1RTKA 3PLNA 1JAXA 2XXBA 3KHUA 1NIJA 3URZA 2D3TA 2OAP1 3I2HA 5L6LB 4NECA 3CUSA 4X45A 4CI9A 4N76A 1HFAA 1E89A 5I4IA 4KMSA 1OC2A 3NOGD 1PK7A 2ZIEA 1HLPA 4Q4JA 4EQ6B 1EWQA 2YJNA 2HR1A 3VZRA 4KDRA 2N3ZA 3LSTA 3LOPA 3QX8A 1NMYA 1EE9A 1KVQA 2JFHA 1DBQA 3ZDBA 3JD3A 3EVTA 5LQDA 3HLYA 2UZAA 3G17A 1V4VA 4DUYB 2PL3A 1HDGO 2GS9A 2YCLA 2V98A 1AS3A 2KBFA 2X7JA 3IVCA 1KQPA 2AD5A 2WNHA 2WFZA 4K8OA 4OI0A 1PKEA 2XUZA 2VZ0A 1E4YA 5ENOD 2XNDA 3GG9A 1H0HA 2IYFA 4Z8YA 2DR2A 1BS9A 3K1TA 1G8PA 4LZZA 4QNMA 4MUIA 3ZW3A 1V16A 1TT5A 4NE7A 4B8YA 4ARZA 4KE9A 1KVRA 2R7NA 4Z54A 3ZQ6A 2QY7A 4E07A 1EVLA 1KKMA 3FTXA 1B8UA 3OMSA 3MAAC 4CWAA 3DZGA 5ENSD 1UMDA 4JI7B 1KYVA 4ZHQF 3ZS8A 3PT5A 2J6BA 1JSRA 5G05J 3DFFA 3UBTA 4L5JA 4KQGA 5JTUA 1C3OA 1GDHA 3AUUA 4I1OB 2CLHB 3U17A 5CA0F 1Q7EA 1U31A 3U66A 2QQ5A 1DELA 3SXUA 2C20A 3ELYA 4J49A 5CNKA 4OXYA 3OFJA 2YYYA 1TR4A 2A0WA 3G2VA 4M55A 1ZO8A 3A1TA 3TSYA 4QQIA 4RS3A 4NDZA 4Y6WA 1MAHA 1W76A 4PDXA 1SH7A 4LE1A 5TY0A 3FPFA 4NONA 1RZRA 1Z0UA 1KEPA 4UNIA 2C97A 4B1FA 4GI5A 1ISPA 2BGWA 3TLJA 4JEHA 1VL2A 5JMOA 1PR0A 3ZU3A 1EH5A 1KYWA 2HWWA 2CNWA 1RC8A 4UFNA 1FSZA 3COZA 1LC3A 3OF5A 1H0KA 4FOOA 2EP5A 2I2CA 4QG3A 2AXPA 5CFMA 4FFNA 1DXQA 3KD2A 1BRMA 1KAGA 2G70A 3SQWA 4G9EA 4WBSA 4TMZA 2V7GA 5D51S 3OAWA 2JH9A 2QSZA 3H1PA 2L6JA 3CHSA 3MYYA 1S70B 2VZ9A 1V25A 2I3ZA 3G9ZA 2H5JA 4O6VA 4YA6A 5AYWD 1XUOA 4M8KA 5F7ZA 4H35A 3WGZA 3MBKA 3RIXA 3EHNA 1S3FA 5IPFA 3GZJA 1N6LA 1OFUX 1UANA 4LF6B 1G16A 3QE9Y 1X8XA 3CBQA 1CEEA 1VGQA 4OHYA 1OHHA 2RJOA 1V1RB 2ZZKA 3T3DA 1TTHA 3RG8A 3WGVA 1AO0A 4DG9A 3PREA 3MVEA 4YAFA 4RLFA 2G4VA 1GKLA 1DAMA 2I6FA 2XZLA 3HVUA 4G25A 4YCNA 3HYLA 3V1MA 4GT1A 2WXOA 5I7RA 1X9HA 4R4JA 2FPLA 1E1YA 2CK3A 3FI9A 2RHRA 3QJYA 3R40A 1PR5A 1PL0A 3VI4B 4Y0VA 1WXHA 2NO9A 3RRMA 4E2FA 2WNIA 5TQ2A 3UPVA 5LJLA 1USUA 5A7GA 3KEFA 1MC1A 3KSLA 1M34B 3FDXA 5JSKA 3R74A 3DV2A 4R84A 5TMEA 3AVTA 1WUKS 4WK4B 2IY7A 4FDMA 4QQRA 4BPRA 1JQAA 3W6OA 3V1UA 4Y6CA 3WZLA 3MOGA 4WUTA 1IXYA 4A5SA 4C2AA 2C0QA 2P9ZA 4S2UA 5KMGA 1SCKA 2BN4A 5K8IA 1B93A 4MWBA 3F1LA 2GAOA 3KKZA 1DB3A 3U4TA 4BETA 4HNRA 1U3UA 3UX4A 2I3BA 2F3SA 1OUMA 1WB5A 2GGFA 2Q5EA 3P9IA 4B79A 4ITRC 3G59A 4NNJA 1GA4A 2BJVA 4K88A 3F5DA 4I0WB 1BWRA 2P4EA 1T35A 2LR0A 1D2AA 3LT2A 3X1XA 1T1EA 3DPIA 3OY2A 1OVMA 4EFDA 1OT8A 2QRQA 1ECJA 3EZYA 3B1ZA 2Z2XA 2W6MA 3A1VA 5TVGA 4XE0A 4N18A 3OJLA 3H4VA 4A3SA 4F91B 3B3GA 1J5EB 3M34A 3QE3A 3GLVA 4KRFA 3RAFC 5TEWA 3RU3A 1NVVR 1W2HA 4EIWA 4XGQA 3ZD6A 1UP7A 4G5RA 4WGFA 5IT9A 2OT3B 3REQA 5BSFA 1G64A 3T15A 3U7QB 2FI1A 3FAZA 5I8WA 1ONOA 5KBAA 3P0HA 1NLZA 3NH6A 5AICA 4HGQA 5E6SB 1ZCZA 4DVJA 1JG4A 3X0DA 2LIPA 5K0SA 4XX5A 2JFXA 2ACWA 3I8SA 3HP1A 4G0VA 4S1TA 5CXSA 3AF3A 5CM9C 3M49A 2HJGA 4HWRA 3WYEA 1Z0SA 4I8XA 4DV0B 3KAJA 1UINA 2QQGA 2W9XA 1N5OX 3JD1A 2PG3A 1UODA 3X2QE 3T8KA 2IEDA 2UXDB 5JRJA 3IILA 3KZMA 1Z38A 3DBVO 2CDAA 4XDGA 1P73A 3B1FA 1BVYF 2RH4A 3BJEA 4ERNA 1TQ6A 4EDFA 1IYZA 3FGOA 3O3NB 4IEEA 5BYJA 3O5AA 4F1WA 3VSEA 4HNAD 2WMDA 4FINA 4P29A 1RU3A 3OLXA 1LDGA 3C6ZA 2OYRA 1YS7A 3BG5A 1AQ6A 2VH2A 1DUSA 3DBSA 1VHLA 4TMXA 4WSOA 3T7AA 1W48A 4B3CA 3F1KA 4G89A 2A88A 4AS2A 1KR5A 2I7DA 1P33A 4QTZA 5TQJA 3AESA 3AKDA 2QIPA 5J3JA 5DU2A 3Q7IA 3TOZA 4YWHA 1N2HA 1IMOA 3SHTA 3IDAA 3TF5A 2INGX 1TO2E 3LX4A 1YMVA 4MICA 5BSHA 1F2VA 3NIWA 4C0MA 1QIFA 5EX3A 1WE2A 3IBFA 3TNFA 4RTKA 2JGKA 3QPAA 5DGCA 1OT3A 3FH0A 2VO1A 3LXMA 2BJHA 3HB4X 4RQAA 4WZAA 1ZBPA 1ZUNA 2ATVA 2HQ1A 1C9MA 5AJLA 3LFUA 3LUPA 1IG3A 2R48A 2ZTUA 2AG0A 3SZUA 2PS0A 4GUAA 2IU4A 1PQWA 2KM4A 3CGGA 1J0BA 2VATA 1Q3HA 1XK6A 3HCBA 3NYQA 4GSLA 4X6LA 1C30A 5JH7B 4ACLA 3R6WA 4ZQGA 5EWLA 1T10A 3SOPA 3EVBA 4X85A 5CHYA 1XNRB 3KPJA 1EFDN 2LXLA 4RGYA 3ZEFA 2BV3A 5CDUA 5FF9A 4A63B 5HFJA 1RE1A 4K6MA 2WPVA 1PGQA 1PWXA 3CLSD 2JC3A 3PC8C 3LUKA 2DY1A 1PDWA 3G7NA 3V7YA 3ZW9A 4BP1A 3U7JA 1Y7PA 3QTBA 1JKFA 3K1ZA 1RWOA 1IL0A 4BX8A 1UK8A 3TPCA 4FN5A 1GCAA 1XXHE 4DG8A 1CJKC 4URFA 5AI9A 4YK7A 3SQXA 2H85A 2HJ9A 3JCZA 2P9GA 1XMSA 3ZJYA 3AUXA 2AIRA 2ZI6A 1OI4A 1AY0A 1BE0A 3IPCA 4ANXA 3BQOA 1GADO 5LNK1 4GLBA 5ALEA 3D0KA 3VVLA 2YMMA 1ETUA 4RC9A 5DSXA 1SUPA 1AK9A 2I2OA 4ASUD 4BB6A 3ZZUA 2AWOA 4DLZA 3ZXPA 1WG0A 1KH1A 2O4UX 2AOTA 5CH5A 2CDBA 4D0GA 4H4CA 4TV8A 1YRWA 3WJAA 5SV2A 2C7BA 2CVOA 2QN1A 5K0NA 1H5QA 3AI7A 4CIXA 4R0VA 3UUEA 1SVSA 5H3CA 3WSVA 3V7WA 1ADBA 2GEKA 4GQIA 1A8HA 3T12A 1UKYA 3LZCA 1SIOA 4F2PA 2R79A 1JR6A 2CBGA 5FUVA 2UWJG 2FU5C 2D5LA 2DH5A 2RSFA 2ZM5A 3QWWA 4GPEA 3ZS9A 2AOVA 1I13A 4F93B 3IQZA 2XMZA 2W2LA 3GQBA 2NZUG 1XVVA 3SICE 3TBKA 4WKPA 2Q3MA 1H6CA 3HU2A 4FUQA 2DPHA 2O2XA 1N57A 1YJAA 3KUCA 4Y9TA 3MC1A 4QIHA 2C5FA 5IF3A 4TTJA 3RKRA 4CKCA 6YASA 3IBTA 4Q7JB 2GM5A 4FBLA 5TS3A 4YAIA 4MVJE 3GRFA 2QZJA 3WK7A 1GQSA 3V33A 3T1VA 2YQZA 5AYVA 2Y93A 4BY9E 1TKAA 3ET4A 5JXIA 2FDXA 4CHGA 3FFTA 4L85A 4U0SA 1BQEA 3GFFA 1A2QA 2W22A 1H94A 1YIAA 1BU5A 4KAAA 5L7TA 1TUEA 4HRVA 1G8FA 3RUPA 1UBMS 3IPXA 4Z1MD 3FUMA 1ZRHA 4IHKA 5KPDA 5E75A 5EQJB 3DZBA 4A8PA 1GSAA 2KS6A 3OJEA 2ZUWA 5G4KA 4UCFA 4ZT6A 5FUQA 1IUKA 1FP1D 3OESA 1GYPA 4TTTS 2IGTA 3OU2A 1IB0A 4JJ8A 4YBRA 4TV8F 1WM1A 3VOSA 1FCHA 2FRDC 2H4FA 2VHYA 3EK2A 2P9JA 1X1AA 3GGOA 5LBIA 1VE7A 1ZSYA 4RABA 3M4YA 1Z7WA 3MWEB 2H1WA 1N8SA 1GL9B 3B1YA 3DQPA 4L1KA 4Q66C 4JB3A 4NH0A 4DIOA 4IZIA 3N6VA 3N8IA 3MYRA 4I55A 1JPNA 4GVLA 4AVXA 1QO7A 4YMSA 5HKOA 1QE5A 2ZRLA 2XNDD 2B99A 2GZDA 3T9CA 4AS3A 4NCNA 4U04A 2JF0A 4X94A 1X1SA 3CGWA 1PJAA 4AURA 2FAXA 4BX3A 2AKAB 3BTOA 1QS0A 4ZARA 3N7TA 3HM9A 1H42A 3SC2B 4EELA 5FZRA 3E8MA 1H4SA 5I3CA 1SVKA 5EIBE 2ACKA 3VSBA 4NTZA 2H48A 3I3NA 1ZM7A 4FHDA 1GPNA 5EE5B 3O3MB 4I1RA 4QNNA 2ZYTX 1E2IA 1J23A 1EA5A 3D9KA 3UKJA 4IWXA 3STWA 1DCEA 2PR2A 1BG6A 3S5JA 4QUHA 5CPBA 3AB7A 4RGQA 1IPHA 2O8BA 1BWPA 2O8VA 4X64B 4AY3A 1NG1A 2W2KB 3R3XA 3TRKA 1N4SA 1DJOA 4LOLA 5E1BA 4BERA 3WGNA 1M5RA 3Q8WA 1APBA 3WLNA 5AKIA 3KOZA 4OLJA 2IWRA 2XA1A 1D8TA 4KIFA 2YOGA 4WXHA 5INTA 4O0LA 1C0PA 2RC5A 2AMLA 3GELA 1X7GA 1Y9ZA 3TXYA 3CGHA 3UHJA 4PSVA 2VSQA 2Q4RA 1W75A 2D2VA 3PPVA 1MRZA 1N95A 2QVXX 2VL7A 4HWKA 2CNWD 3RVJA 1Y6JA 2X4DA 1RAGA 1K5DA 1HDIA 1JPUA 3ABZA 3HP4A 4G4SP 3PJEA 4FFBB 5I6DA 5JAHA 1BCRA 2H2HA 4I55F 2QRNA 1FVHA 1SZ9A 4PG4A 2SHKA 2VDWA 5KNGA 4TV9A 1Z7GA 4M1KA 2R2LA 1C3XA 2VS1A 2A9KA 2I6GA 2YYZA 2P3SA 5JANA 4GTTA 4G97A 3S8EA 4WEOA 4KACA 3K70C 4B32A 1KOFA 4YAOA 3A6DA 5E95A 5LOVF 3HJRA 2RHTA 5GOZA 1WKVA 1OHHD 3EGXB 1Q1NA 4BYMA 2CNLA 1NMSA 3JAWA 3WE7A 2AEEA 4LX8A 2J3HA 5ESWA 2XR1A 1O6BA 3H5OA 3M2TA 1VKHA 3S7ZA 5SICE 5I8PA 3RHTA 4XEIG 4EBFA 4G1CA 5H8WA 5FQ6A 4EJ0A 2CK3D 3WDLA 1ODJA 3QNKA 2PQ2A 3HBAA 4WBNB 5CU7A 2G25A 3H13A 2O9JA 2BKEA 2QLNA 4EJ2A 3UINC 4LCBA 4Q3LA 4RXUA 3ZC3A 4AO6A 4CMKA 1NQVA 1KK3A 1OLUA 3D6HA 1E8OA 3CTPA 1W36D 2J1LA 1NMEA 1A69A 3RANA 4AZ3B 2GBGA 2FUNB 4ZVOA 4BO7A 3HNRA 1XZJA 2BGLA 5ENPD 1XR3A 2QR3A 2NU6A 4MPRA 3VR5H 4DLYA 3OCUA 3L3BA 4CI0B 2FZEA 3V8MA 2IHBA 3MIZA 3IL2A 3IIEA 5FWXA 2J7KA 1ICEA 2P90A 3Q78A 2F4NA 4C21A 3I4FA 2EARA 1CS0A 2B36A 2IELA 3KEAA 4H60A 5HQ3A 4A7PA 5K7SA 1KEKA 4ZVMA 4G8CA 3CRNA 4FNOA 1M75A 1QYCA 4E21A 4F06A 5CH3A 4BKUA 4TV9F 2BFPA 3BVPA 3ZVKA 3PFBA 3EOZA 1YO6A 2W2VA 3VI3B 3QFRA 1QGYA 2A8YA 3P5SA 4HUQA 3BQ9A 2ONKA 4ENQA 2XMGA 4FS3A 4YJ2B 3JZFA 4FILA 1N0IA 1TJ3A 2PZGA 4B94A 3CLVA 4U00A 3B5IA 3AHJA 2BMEA 1TL7C 2MHKA 4EABA 5JSZA 3QK7A 3CSFA 3DVSX 1EXDA 1V71A 2O0HA 4RFLA 1GD1O 3W5AA 4N48A 4JJ7A 4B44A 1D6SA 2FWMX 2BKVA 2P2DA 3B7WA 1Y33E 1G5IA 2IXTA 1EGHA 2ODTX 1K4MA 1XZCA 4UTRA 2VN8A 4IJMA 4GW3A 1ESDA 4F72A 4ETMA 4C4SA 1T0HB 3UMBA 3X2EA 1Z82A 2WF7A 4J76A 2QI9C 2FO7A 4YP6A 3G49A 3ZDZB 4BZQA 4UFOA 5EJFA 3L84A 3N8NA 4JB8A 2MOWA 3WK9A 2FFRA 3W77A 4J0DA 2D7JA 2IDJA 4QJ4A 2V5FA 4P31A 3KSQA 4FHGA 3HGMA 4AM9A 2XB2A 1SZAA 3I6ZA 1BS1A 4WBXC 4D9CA 1ZC3A 1W6RA 5FNZA 1E6EA 2C4UA 4ZGGA 2ZTVA 5HSGA 5DYNA 4CMHA 1N1DA 3RSCA 3K8QA 1SBCA 3TFQA 4LZPA 1RLOA 5J4VA 2IQ5A 2ZM6B 3RSFA 1E9FA 2VTDA 2GZRA 3JALA 5TMDA 3UJCA 1C0LA 4BWVA 3W6UA 4QFCA 1SBTA 2EKPA 3OTIA 2FWJA 1ESMA 1O1SA 5E9JA 1TJ4A 3B78A 3PJDA 3WFZA 4LQ4A 3UAZA 3FZGA 2EIME 1D2RA 1IK4A 2BKGA 4B89A 4ZU3A 2C8VA 1Z15A 1G8MA 3EFOA 4DUIA 2H59A 1Q14A 4KVAA 2B78A 4Y98A 1CQIA 2RE8A 1YDHA 4J0GA 1W34A 4OXNA 4G11A 1TKRA 2WC1A 4HQ0A 1MHTA 1XMIA 5BN4A 2I71A 1D2HA 2C4TA 3I2KA 3SOZA 4P4NA 2EFEB 1DWUA 3X3HA 2VEOA 2CBZA 1H05A 3MERA 3CCFA 3FSGA 4FHJA 3QX3A 4JJ6A 3L6BA 1MZCA 5TQVA 2ZAIA 2D1YA 2WF8A 2AC2A 2A2ZA 5LLDA 4FE4A 1A9YA 2IYWA 2NAPA 2FF4A 1UKAA 3GWZA 1TD9A 3LUGA 3PUXA 3I83A 3K09C 1M1XB 4BZXA 5BUCA 2I2WA 3SS9X 2QZ9A 3ZY3A 1SOWA 1T3LA 2C99A 3E5NA 3G8DA 3WKEA 1YS1X 1E3WA 5K0ZA 1GZHB 4Y6QA 1PYGA 4E85A 4WINA 2Y1GA 4IWYA 1I2ZA 4XIIA 3L04A 1BCSA 3TQSA 4WNDA 4ECAA 1EBFA 3T4UA 4Y30A 5G3ZA 4DMLA 1G6HA 2NXNA 3DVRX 2X15A 4ZQCB 4ARSA 4BMSA 1II0A 2PWZA 1DEHA 3QV2A 3SMVA 4YO7A 5DYTA 3KAEA 3D6MA 3U4AA 1H66A 4GAEA 3BIWA 4KPEC 1CZNA 3MB5A 2ZIGA 4W9NC 3EODA 2TMDA 3AOGA 4NV0A 3H42B 3LYLA 2ZATA 4QU5A 4QQKA 1V3VA 1AU9A 2X0KA 3QXXA 3TL5A 3C3OA 4EJSB 2G77B 2QV7A 2FUEA 3EMBA 1WRBA 2QLBA 1ULHA 3HXTA 1P4SA 4NZYA 1BQ4A 2DC1A 2H1FA 1VFNA 1I4WA 3O0DA 1XWIA 3EH2A 2J3JA 3KJEA 3JVUA 3PNMA 5I9NA 4WXPA 2P1ZA 3DTTA 2PWAA 1P2FA 2HNKA 3KVRA 4NS4A 1DG1G 4NQ0A 4HCJA 1OX5A 3ISJA 3OCVA 2QRZA 3OUZA 1WMBA 3O4IA 2NSLA 4TL8A 2X8JB 4GTOA 4D9IA 4B6JA 1PGOA 3I0MA 2G5TA 4ZJUA 4M3NA 1X42A 3NBUA 1T6YA 4JJFA 1HL3A 3X43A 1PNQA 1KMMA 3VR4A 1IN1A 1THGA 2D74A 5ALDA 1KZ4A 1JGTA 3GY0A 3FUDA 4CKEA 2WJYA 3H99A 2IU0A 2HUNA 4QGHA 5HILA 2EGUA 1SVIA 1W52X 2ZTSA 4UM7A 4IJUA 4XB6B 3VOBA 1V1JA 3BM5A 3UWDA 2LRHA 4EZJA 4D8VA 1CUHA 3ZGZA 1MB3A 4L0DA 1A5BB 1JA1A 1HNXB 4PLFA 1QB7A 3TZBA 3GLSA 3IBGA 2XQJA 3F67A 3MZ0A 3UT7A 3DWLG 1U7ZA 4RTOA 4Z2AA 1N7JA 3TR0A 3NV7A 3DUFA 5L51A 2A14A 2HJRA 2WG2A 3DQZA 4YUZA 1MTOA 5JNRA 2FPPB 2JFWA 5LYJB 1YE5A 3DKPA 1EPUA 5LU8A 4APOA 1V1MB 4TRQA 3MTAA 1Y5IA 2V7WA 2X14A 4KCGA 3IMGA 5LZ2A 5ALKA 1RT9A 4B48A 1RAIA 1QIHA 4DT1B 5F12A 3ZK8A 2ZGGA 2V59A 4MK4A 2DR3A 1WHTB 3DW3X 5LVAA 2ERCA 1BHQ1 1RW4A 1L3BA 3M8KA 2ZSAA 1H2EA 1FVFA 4GBJA 3OZEA 4AJIA 1G2PA 4EX7A 1ZN2A 1W8IA 2CLLB 2ECKA 1KAQA 4MP6A 2WDZA 4LY0A 2R6R1 3KKPA 4JJIA 1M2KA 3I23A 5JS1A 2Y69E 2X5JO 3BIJA 3E4CA 3M5CA 2R17C 2ZGDA 1DBIA 4HZUB 1QM5A 4OYRA 3DC2A 5CB8A 1EFHA 4CV2A 4NYJQ 1ABBA 1NC3A 3Q88A 5KYYB 1V5FA 2HX1A 4QKQA 5JO9A 1VHWA 3UXMA 1DP4A 3K0AB 3MKQA 2NAFA 4O2AB 2FBNA 1Y3AA 2H7CA 1OGIA 3OJFA 2G83A 4DXDA 2QZPA 4F85A 1MAVA 4YC7A 8ATCA 5JLAA 2QD1A 2QTWB 3OQHA 1E2HA 1QVAA 2JGMA 5HUQA 2ZT6A 4EA9A 4G63A 4KG7A 2ZJ8A 4DSOA 3OWXA 4YJHB 1PX2A 3UB2A 3IUEA 3P9ZA 4CL8A 4G5OA 1SELA 2V55B 4Z1OA 1RWWA 4F2GA 2XOEA 2BGIA 1VE5A 1V39A 3IMEA 1I6LA 4MEBA 1M1YA 3FUVA 4IDAA 2YC2C 4UARA 4K05A 4EHDA 1JSZA 2B21A 4WKNA 3UGKA 2FETA 4NZNA 4P08A 2YINA 1LZKA 2P5UA 5AHOA 1NMXA 3SJUA 4N6GA 2OO7A 5DYWA 3ZFWA 1FYVA 1XTRA 3SQVA 1YCDA 3LCRA 4ARBA 1GHTA 1CWUA 4DSAA 3EARA 3OT4A 2PLRA 1MD9A 1DZ3A 1LJUA 2GN4A 3DHYA 5F9FA 4J0EA 2IYYA 1UJRA 3JD0A 3ROKA 4CUKA 2GX6A 1DDIA 3JQBA 3AEKA 4OKSA 2XCBA 3QWFA 5IMSA 5KDLA 5L3SA 3THYA 5E6UA 4CFSA 3A1SA 4AJWA 1HR0B 3TWXA 5B1BE 5EYLA 1RC0A 3LTEA 1F0KA 2O7NA 3OP4A 2PRIA 3MF4A 4DCTA 1LQTA 1ZA2A 5C8YA 2L6BA 1ATIA 4O2RA 2DKNA 2KQUA 3ZQUA 3AHGA 5AW7A 2FEMA 4F7DA 3BA6A 4CMIB 3GFSA 2QTAA 4C2UA 1WDMA 3GCWA 2NUBA 2G17A 1FVOA 4PNZA 4RIFA 3RUFA 5F1OA 1C5KA 4YRMA 3OE1A 2VBGA 4FXPA 5CCMA 2ZIVB 3NBNB 4L02A 3DM5A 1SC6A 3TKYA 1YVEI 1L1RA 4J1QA 3QKRA 1WKBA 2R6JA 2O5VA 5CIWA 2PVPA 2QP3A 2NTVA 4HEA6 4GP7A 5BWLA 3VNAA 1PFWA 1QHNA 1S64A 1DRKA 2ZJ3A 4MMXB 2HXSA 2AXNA 2XVAA 1OB5A 2Q3LA 2P35A 4AJOA 3P9NA 1SB9A 4MGZR 3L0IB 4KN6A 3HWX1 3DOUA 3KVOA 2OFFA 2XNCA 1GNSA 4KDFA 3BGIA 2E3JA 3AUJB 3PDHA 2GTHA 5TE9A 3VR2A 5HIAA 3W8EA 1J97A 4Q9AA 1FTYA 2C4WA 2QX6A 1MGPA 4NPCA 4WH0A 3CVWA 3L01A 3MPUA 3RNLA 3PX3A 3KTAB 5L7YA 3RRYA 1G8AA 1XFAA 4XW2A 1XTJA 3OM9A 3JD2A 2CFUA 1N9GB 5DTQA 2HMTA 3UM1A 3KTDA 5I8ZA 3G7SA 2HU5A 4IV8A 1EMDA 4MW7A 2WP0A 1CLUA 4FEAA 2QSJA 1T2EA 4QLOA 3D2LA 1RJ9A 4LBYA 3K7EA 1JILA 3OIYA 5JZSA 2QDXA 2D7CA 1RM5A 4G8LA 5I7FA 4Q96A 3FOZA 2FJAB 5C8YF 4TYPA 1RRMA 1F3OA 2AXUA 3FKSD 1NVXQ 4FOSA 5G1PA 2O2CA 1Q91A 1E66A 4BC0A 4DWJA 3SKYA 4HB4A 1Z6AA 3K0CA 2FP4A 3AEQA 3GT3A 1XPUA 3QEMB 1QCCA 5I4KA 4ZI2A 1YQTA 3FLBA 4RQTA 5K8CA 3KQMA 3F9IA 3F97A 6REQA 1EE1A 1NFIE 2ZXEA 4TRMA 4PQEA 5D3MA 2H4JA 4HDOB 4ZA2A 3E3OA 2V3CC 5LPNA 4G9GA 3JXJA 1KAMA 4CLOB 1F5NA 2AV6A 4RXMA 4D3FA 1OH7A 5AI8A 5KWEA 1P2UA 4H3HB 4B82A 4FE3A 1EA7A 3C5EA 1TJPB 5TDHA 4J6EA 2C9MA 1L0BA 1ZGJA 2Q7OE 1WOYA 3T1QA 3VJKA 5T8KA 3KDPA 1IZYA 3OCXA 4K3UA 3GMTA 5C52B 5FLKA 4LF8B 3Q7EA 1Z25A 5AVQA 1TA9A 5IAGA 1QRDA 2PQRA 3S1LA 3RBXA 3B6JA 4FCVA 1H2ZA 4KOAA 2EJUA 2E89A 2BRUC 2R6ZA 3TZKA 4R5HA 1V8FA 4BRWA 4DA0A 1I2AA 5EP3A 4LYDA 3FTQA 3A6PC 3V2OA 1B6GA 1AK1A 2C7PA 4BTVA 1M6YA 3AXSA 7AT1A 3EUFA 1OROA 4P81A 4M99A 5LQNA 3QMMA 1I1OA 1QWOA 1SUDA 2IIVA 1Y6ZA 3CIOA 4NENB 4MROA 1NFRA 4I3GA 4DNFA 5FOWA 2CL0X 1MJ0A 4LXIA 4HQOA 3VKHA 1UPUA 2J4CA 4EJMA 2FW9A 4ASUA 3FPEA 1KU6A 4BNKA 1P60A 1XLTA 4O29A 4Q03A 4YREA 2DR0A 5AVJA 2ZE8A 5JXWA 3VR0A 2QE6A 3PEWA 1KXJA 2CLOB 3SYNA 1E79A 4M46A 2OXFA 3JQFC 1J42A 4OFZA 1HORA 2C57A 5EHGA 2QNRA 5AM1A 4KXNA 2A1TR 4CG2A 2FLVA 4UREA 4MWEA 4W8GA 3GH1A 1JDSA 1SU4A 4LECA 1MW9X 1U5AA 3KPVA 3IR5A 5BR1A 4KPYA 3X1MA 5IX8A 2L17A 5DGDA 3HN6A 2WJPA 1CF4A 4RQUA 1LLCA 1OXMA 1DAHA 3FSGD 5IVDA 1I7NA 5DIZA 3HK2A 4YRSA 5ARDA 2P6UA 2W9JA 1RJEA 2KC7A 4CM4A 5FNVF 1OWMA 2GWRA 3MSCA 2GJ4A 1WAO1 3T3OA 2R5NA 4YAKA 1VJCA 1YK0A 1RYYA 4I6GA 4MS4B 2IUSA 1YJ5A 2O50A 4MR9B 1GTG1 2AKEA 4LY3A 4JR0A 6LDHA 1Z0IA 3ONWA 4M0UA 1OW3B 2Y4OA 3ZHRA 2UUPA 1KK0A 1IULA 2VR1A 4MQLA 4MUFA 5P8WA 3C5VA 2JFZA 4YIHA 4JOCA 4Z7OB 2NADA 1T4GA 1WD5A 3NZUA 2NUTA 4WKGA 1HSZA 1XQ6A 2VAMA 5FRDA 4UKDA 5HX7A 3AM5A 4RS4A 3RH0A 4M0KA 1XAJA 2ZJOA 4Q6WA 4OH1A 3Q12A 2WFLA 4CR8A 1XXLA 3L6AA 2OBLA 2D59A 2V7XA 1CUWA 1KDTA 2LO6A 2CXQA 1DDGA 3L8MA 1YS2X 4EL5A 1KJYA 4HWPA 2QN2A 2R751 4PG8A 3DBHB 4K9RA 2FG7C 1DEXA 3FFLA 2PUFA 1YZTA 2QUZA 1Z73A 4TYNA 4Q7KA 3QY9A 4O2BB 3G2OA 2GD2A 5GY7A 2Q3HA 3KYIB 1QIGA 1U7HA 3UK2A 5H3HA 4DCOA 4F3RA 4GTRA 3QHAA 4W5NA 3PEFA 3L7KA 4YPFA 4HX9A 4BNMA 4RETA 4JEIA 4PC2A 3LUHA 3KELA 3CXRA 3A04A 4GS5A 1UBOS 4RORA 5EUMA 3V7NA 1E62A 1KY2A 1VIAA 2BOVA 4YCBA 3ZBQA 2V3VA 4KFUA 5G40A 4LYFA 1T1IA 3I76A 4AB1A 4FKBA 1KK2A 1CEXA 3PH0C 1TPZA 2CFTA 4ZV4A 3G2WA 3VR4D 3ZXSA 3NC1C 3UGQA 4ZCTA 2COUA 3KTOA 1IHGA 5BV1A 2F6RA 1WR8A 2B34A 4TQ9A 2YR0A 2UUOA 2IZZA 2YC4C 3L9TA 4LNUA 3WIVA 3B13A 4DMMA 3PE3A 3RC1A 2JFYA 2P8JA 2AYXA 2GBPA 2YHAA 1CQZA 3SAJA 1ISIA 2WQZA 4CCYB 4JUDX 3UB3A 4U02A 3OEWA 3DPSA 2SBTA 2QW1A 1FRZA 1KXZA 1LWOA 4XSVA 3P7MA 3LUFA 2O52A 4LOAA 1P6QA 4OVUA 3D4LA 1TPYA 4QBFA 4PG5A 1TUIA 3GXBA 3LW7A 3ASGA 4FBMA 5IJ0B 3A6ZA 3PEYA 2E85A 4P5PA 3UK1A 2VSXA 5IDWA 3FUKA 1Z5NA 2ORWA 2UZ0A 2XDWA 5CLFA 1D4OA 2P9UG 3IOCA 5DNYB 3N05A 1E0JA 5C7OO 3TXMA 1OB2A 4KUHA 5AP9A 5AK3A 3PRJA 1PJBA 3LECA 4Q4AA 2CHZA 2AHOA 3BXFA 3GFOA 3KXDA 1NJ8A 1BWSA 3H6HA 3G0CA 1E1LA 1ULUA 5IXJA 1RZ3A 4GMXA 1DU4A 3RRFA 3FU6A 4XM1A 3PXEA 2QYHA 5B4TA 2R3SA 4OJKA 1M5UA 5I7AA 3N2LA 3HZRA 1SOMA 4BNXA 3AIMA 2FWNA 4JH0A 3BDAA 4MQEA 4BNUA 1IAVA 4B85A 4UMFA 1G2OA 1T9CA 1E3IA 4M0CA 4NPHA 3F6SA 2UYYA 1AHPA 3U7IA 4BNJA 4RGVA 4WKOA 2QYOA 1WUIS 3CUVA 1D9ZA 3I32A 2HMYB 2O57A 2FCAA 3TTYA 3BE4A 2KSQA 4AYXA 1UZNA 1GGVA 3DE5X 3BD7A 3NM5A 2FJEB 1XDDA 1W9HA 4LYYA 5JNSA 4PGGA 3KP1A 1XZMA 3OX4A 1VE1A 3THSA 3GYXB 1UJBA 3F2IA 5BSKA 2E0IA 4NATA 3GJSA 3TIVA 5DGTA 2HA2A 4AMVA 3FFWA 1P4JA 3SVLA 4AXBA 1VGRA 2VJPA 4NE2A 4RM2A 1K63A 1JI0A 2P9HA 2ZRJA 4Q02A 1HNNA 4ZVLA 3G2TA 4N3NA 3DOOA 3TFWA 5FWQA 3KNZA 1H0AA 2E1PA 2R6CA 1EVJA 2VCEA 5JBQA 2V4HC 4ZOQI 4KYUA 4PLHA 4U0UA 3SO8A 5I9SA 4GCOA 3TW8B 1RI2A 1XRRA 4KIGA 2I03A 3SFTA 2HFJA 4AMYA 2JBWA 1M2JA 5JTTA 1M6EX 2P41A 4ZXPA 1PRYA 5JT1A 3IB3A 1BMFD 3QFFA 5J1SB 3CH5A 2BDEA 2WA2A 4E03A 1NJGA 4K5QA 4AWBA 4CRWA 3Q3CA 2VBIA 3S81A 3GEDA 2KM1A 4ZYZA 4OHPA 1RHKA 1YZLA 3O9ZA 1M3SA 4ZYYA 4XYEA 2I5PO 3AWDA 2YBDA 1AKMA 1KR2A 1G20E 1Q12A 4H2DA 4KODA 4EITA 1U04A 4TVOA 3JAMA 1IBSA 3Q7AA 1U2SA 1LI7A 1ZR4A 3K1AA 1QIMA 2B6NA 1VC2A 1G3IA 2G1UA 5G04J 1YTLA 4RFSB 1GDTA 2IPXA 4B3XA 4HTAA 1KFEB 2XCIA 4J1TA 4MV9A 4YLYA 3KE9A 1M72A 3BX1A 1YNOA 1BKYA 3I5PA 4B35A 3T0GA 1EM8B 3AAAC 3EXHA 4C4XA 1UFOA 3KUKA 2DLNA 4CF5A 2EBFX 4JBYA 2B4YA 3L16A 1THZA 4N2QA 3I2IA 4UWFA 4NIKA 4I2WA 5FPQA 2ZTLA 1YU9A 4QVIA 4DMHA 4IDGA 5C32A 3VR2D 3R4VA 4RSHA 1C9EA 5JVDF 4E1BA 2ZRGA 3EU5A 4Y6OA 4FKZA 4X1YA 3GVXA 2GRUA 4IKOA 4EH1A 4DCSA 2ZI5A 4X1KB 1VLQA 2O3RA 4PS8A 3VDQA 2WJ6A 3D7RA 3JWIA 1I7QB 5ALOA 3T9AA 3W5SA 1J09A 3PDWA 3H5AA 4UZSA 1GUBA 3K96A 1DX4A 4QLAA 2DOKA 3PJGA 1VHDA 4ENTA 1TGYA 1JPJA 1PF7E 1NYTA 4PEVA 5A23A 4ND6A 4H18A 5FHQA 3UAXA 3U64A 2Y0EA 4AKXB 4GUDA 4RU1A 5CG1A 4S1NA 4H7PA 3AQ4A 1N8NA 3LBAA 6ADHA 4TMFA 4ZOCA 4QO7A 1N9AA 3GGCA 1KI2A 3C5HA 2WHPB 3GJ3A 3PK0A 3X2SA 3NAMA 3L43A 1Z28A 1ECFA 2O2ZA 3N2KA 1Z08A 1KJ9A 2QRVA 2LSVA 1IHDA 1AWCB 4G5XA 3ONFA 2W5UA 5C1IA 1E4OA 1J06A 2ZRCA 3BXPA 1FUKA 2JHPA 4U0KA 1TD1A 3ZCPA 3D6AA 4K9OA 4GZ6A 4EY5A 1SXGA 4JPSA 1HEIA 5ADVA 1T9GS 4QXPA 3OQVA 3H9EO 3UMCA 1RS0A 3E1GA 5B58C 1OBVA 4ZOAA 3DZJA 3H2IA 3SEFA 4R9UC 2DTDA 5J1TB 1DBRA 1G8HA 4FI3F 3DMHA 2R0QC 1F2UA 5J40A 2VSOE 1X7WB 1WB6A 2IE0A 5F4ZA 2VSYA 4ZDKA 3HADA 2PL2A 2CWDA 3T6KA 1XRQA 4HDSA 1JECA 4BJ1A 4PXYA 2EQAA 1W93A 1CE8B 2IZ1A 1COWA 3RVPA 1QE0A 3DT8A 1EB8A 3NHPA 4G2NA 2WFAA 3U09A 5LP1A 3KFLA 3SZOA 1NZNA 1VBMA 5KAPA 3WOVA 4IEFB 4LC9A 5J63A 1ZA1A 2ORYA 1NXXA 1CY1A 5UKDA 3ZWMA 1M2OA 3VKWA 4DJTA 3ZE7A 2QN9A 4IZHA 5DISB 2PSJA 5FINA 1GL3A 3SHQA 1IONA 4K0RA 4EHKA 4V0KA 5B3JA 5CTAA 4BJ6A 3WGQA 1P9LA 2OB1A 2ZVDA 2JB9A 3SFYA 3OZIA 5JSFA 3WJ7A 1E5XA 1M8GA 1JXQA 3AZQA 1FNBA 1KWGA 1J56A 4BBPA 2A7QA 2I4TA 3W5CA 2BFEA 5KTPA 2N0SA 2BR4A 4DR7B 4EYOA 2OORA 3K2BA 1N33B 4UU0A 4YH1A 3RYFB 2X3UA 2BTQB 3MCWA 1PHRA 3ZX4A 1FB5A 1E79D 1B3RA 2RI1A 5FPPA 4MQ6A 2OHVA 3SPXA 3G88A 5ANRB 3S2FA 3ENEA 2ICAA 4AKEA 3SVZA 3MFQA 5LDDC 3ROGA 1AVTA 4BLTA 4JGIA 1TNYA 3THRA 2Q8QA 1ZVKA 3P9QA 3QV1A 3RBAA 1U3CA 2H5EA 4D4GA 1UMCB 3MA0A 2W8ZA 1GRNA 3K6SA 2BHNA 2VKTA 4G41A 3KJNA 3DSXA 1YHZA 3E5MA 5J5CA 4EHJA 4PG6A 4CLDA 1QHHB 2JI9A 3HUDA 3CK7A 1PD1A 4I5FA 3IHTA 5EJ7A 1NJSA 3EIXA 4M1SA 3U4DA 2FR0A 1J0XO 4UM8B 1CYEA 4IIFA 2J4DA 3TWRA 4DSTA 2JLXA 4JR1A 4KU4A 4DBLE 4V0LA 3J7AC 1J0EA 1YCHA 1BTOA 1Q7TA 2O0LA 4UEJA 4YDWA 2R8XA 1W35A 1CJCA 1XCJA 3DAOA 4Q37A 3QXSA 5IS2A 3OFKA 4BCBA 3U3XA 3U13A 4RG9A 3MXTA 3O9VA 1HU3A 5F9HA 3GJ8A 1RWVA 4EF5A 4H7XA 2W2TA 2QB5A 3NB2A 3TLAA 2BEUA 3QB2A 1KJQA 4B3HA 1IK6A 1PQ4A 3R6LA 1JHOA 2O2YA 4CM7A 1EXVA 3V00A 2JI8A 2C2GA 3SMQA 2WM9A 2W6CX 3ACDA 2ZR8A 3OF2A 4DRZA 4UXHA 3G5LA 3VJMA 3OTNA 2PA0A 4DY4A 1QRUA 3KX2A 2P6NA 5JUWA 3DE3X 3E3LA 5KS2A 2I6SA 3ZVVA 2RBEA 5KJCA 1BXGB 3BPSA 4JENA 3G8CA 4BO3A 2LD4A 2JDIA 5IYZA 3UXEA 3ENNA 2YWCA 1W4RA 3U62A 4D92A 2IX3A 1MB0A 3E03A 5HFAA 1EIWA 5JQGA 4LXYA 1SUFA 1KYXA 2GT1A 4V02A 2FRVA 4M6WA 2Q8NA 3GLHE 3ZGXA 3TB4A 5FUXA 3K2IA 5ALTA 4PS0A 1D9XA 3F4BA 3G9XA 4JD2G 1HTBA 2I6XA 1JE0A 4N01A 2YYSA 2V7VA 4PQGA 2H6FA 1GEEA 1DTWA 5LOVA 4K28A 4NBUA 3ICEA 3AF1A 4ZO8A 2J6HA 5H83A 1JKJA 3ZBUA 2WE8A 4N82A 1WW2A 4Q9LA 1MA0A 1SHZA 1Q21A 4Q4HB 2POCA 4RQBA 4ZCMA 2VP6A 5A5EA 1DXOA 4WDQA 5AW0A 2PX4A 4B40A 3DDHA 3RBZA 1K6EA 3JYSA 4RSYA 3FP3A 2ZB2A 3OZAA 5JSQA 3L82A 4D4LA 3HQ4O 4V0NA 1G1AA 4O4JB 3PUYA 4IYPA 4LNUD 2IC5A 5AQ9A 4IMIB 4LGCA 2I29A 3KEOA 3C7KA 3LIIA 4L78A 2XTZA 4ZVPA 1RFLA 4UHDA 4E08A 3K70B 1E5DA 3I42A 4MW9A 2Y92A 3HUEA 4QA9A 3FB1A 5FBKA 3DBRA 2NYAA 4HMPA 3ZY5A 2NYUA 1Q77A 2GK7A 4C6TB 4MEJA 4WV3A 3JATB 3PUWA 4P36A 5FBWB 3W3AD 5JXJA 1UMBA 5JHAA 3ZH9B 5KYWA 5IYZF 3H19A 3T5TA 2BFDB 1Z0DA 4RZXA 4QTXA 4X8MA 1TAHA 1Y5MA 1S4QA 1PBTA 4Q01A 2NXWA 4MKFA 5DW3A 5HGXA 1QBKC 2CLEB 4I6JA 5JQGF 3NM4A 3V7FA 3AH8A 2W00A 3P5BA 4MUKA 1TI7A 2B0JA 1KTVA 1IXSB 2ZTHA 1CNMA 5LUAA 5BOSB 4XIFA 4A8TA 1S2LA 5BQ3A 4LYEA 5BN5B 2ZUEA 2HFKA 1U28C 5GJCA 3A9WA 3N8DA 4Q1BA 2X6KA 5IASA 4KR3A 4RPGA 4LRWA 4JI4B 5COBA 3IHYA 4H1TA 5HBRA 2Z57A 4FYPA 5C1PA 3QAQA 4YVQC 1DIBA 2BM9A 2PLNA 4MRSA 3OXFA 4GPBA 3JWPA 3U3RA 1Q1EA 4GRIA 2G5CA 3JV7A 3R09A 3IOYA 3KQSA 4MX8A 4Y2RA 1G98A 4LHVA 4DQLA 3HFSA 5K3FA 2C2YA 4Y9UA 3A3YA 1ISJA 2WHXA 1CS4C 1U1DA 3FTDA 4EB6A 4NJMB 4ZCIA 3TJPA 2OOEA 1Z2EA 2H16A 4MMYB 3LIPA 4J7CA 3MRXA 4OY3A 4OFBA 1VJ5A 4Q39A 4UFPA 1ST2A 3DF7A 3T94A 4Q34A 3IP5A 3QLUC 3GNLA 1N2CA 2SCUB 3E33A 3NRJA 2Y0PA 1OXJA 3KJZA 3QYJA 1UXOA 2IZ0A 1DAOA 4CPDA 4E5YA 4IJWA 4NXNB 2NPIA 1WV1A 2FPWA 3D8HA 5ALGA 4OUDB 1H19A 3C3JA 5G0SA 1E59A 2XCQA 4QYIB 4UNRA 1TCBA 2CXNA 4AFNA 2QTCA 4RANA 4XCVA 5B7GA 3ZHQA 3HBLA 3LP8A 2F3TA 2ILRA 1WVIA 3PBKA 1WZ2A 2QBYB 1TC1A 1JG6A 3MD9A 3ELWA 4PAWA 3LPAA 1R5OA 4KE7A 5KYTA 3NRBA 2QLLA 1Q0PA 2C78A 3FKSA 2OTCA 4MYRA 3GLGB 5ALFA 2BBWA 1SBIA 1NQUA 1N5DA 4KXYA 2BJWA 2X4GA 3RSQA 2A59A 2VXCA 5CLLA 4E46A 2X5GA 2PSFA 3ZIUA 1JCRA 1R18A 1UZAA 4P5DA 3D9LA 4V3CA 4C08A 1ID8A 4AO7A 1YOVB 3Q3GE 1MRNA 1BA3A 3C24A 3C7CB 3QUSA 3EN0A 4LI3X 1X0XA 1Z2AA 3WB1A 2AFIA 2IYVA 4U2EA 3PU6A 4C0WA 2ASEA 3Q47B 4MQUA 2R6FA 1WB9A 3MHPA 2XUOA 1YQ9A 4YMWA 2K7FA 4B2LA 1QMOE 3I3OA 4HHEA 3HJTA 5HNKA 4R2IA 2MINA 1P5HA 3C45A 1YDFA 3U2QA 3NV9A 4HXYA 2NSDA 2AYZA 2H9IA 3F98A 1O6ZA 5H9VA 2HRCA 2RG7A 3DE7X 1UFQA 5TNXA 4H6VA 5FR1A 3WNQA 1VP9A 3CM0A 2HYZA 1U0GA 3D02A 1KI6A 4CLXA 3H11A 4CCAA 3E4DA 1XZBA 1KO1A 3D4IA 4KOEC 4CODB 3FYUC 5FO0A 4Q3OA 3K0FA 4BMXA 2EQXA 5A04A 1UK9A 3LPNA 4YJFA 1RBMA 1JEQA 3D64A 4YCAA 1GG5A 4H6PA 4CMJA 2DBRA 4D9KA 3I62A 4ZAYA 4J29A 3IDOA 3RSOA 4NR0A 2ZE7A 2VJYA 4DIMA 2OGZA 1F06A 2EYQA 3VR6D 3ROZA 3AX6A 3QTTA 1UKBA 2EJWA 3T3HA 1KZOA 1VDMA 4IRMA 2H3HA 1ECPA 3CV0A 2IJGX 2WHRA 1KJJA 2PVCA 1CIPA 2X7XA 3V5NA 5JYDA 3ZDQA 1L3IA 2JVIA 3U5ZB 2A67A 3FSJX 3GLQA 2ZWVA 3AYXB 1VG9B 2CMGA 1A8QA 4G01B 2PH7A 4UQPA 3BGDA 2IP2A 3CEPB 3IR7A 4ND8B 3T9EA 2VJMA 2PH1A 4KJXA 4GKBA 3BIOA 3S5UA 4PS7A 1JEJA 2DWQA 1EDDA 3MTDA 4DLNA 1Z5WA 3V2XA 2Q6LA 5DNEA 1NFQA 1I6KA 5LXTF 5KX5F 7ADHA 3RFXA 2BSAA 1I36A 3KOOA 3GD5A 1SKYE 1X77A 1LRJA 1VRVA 2WJZB 4DILA 2OM6A 4HNUA 3QFCA 4XWTA 1NASA 3S3TA 1U99A 2HXGA 1MU0A 2O8NA 3QVGA 1Q1BA 2ZXFA 3IT1A 3LVBA 4YROA 2PS3A 1KMNA 5A2GA 2XS1A 3HCFA 1H69A 1H2UA 4FOLA 4M8SA 3DNMA 4I5DA 3AIOA 2QA5A 2EYUA 4NG5A 1COWD 3FCUB 2VYFA 4DWOA 5B57C 4GDFA 3PPXA 4GZMA 1J9ZA 1AKVA 1U6KA 3FPBA 2ROQA 3DV9A 1NKTA 1TA0A 5K0JA 2AW3A 2DTEA 2GPBA 2QPOA 1A9TA 1UKVY 1JH8A 4J7XA 3R44A 1CULC 1QHSA 1RKUA 4D9NA 1U2DA 2UZ1A 2YJTD 1XD2B 4IGFA 2OL4A 4ILGA 5T64A 2IW1A 2VHCA 4HJRA 3D9QX 3OOYA 4LJ5A 3P0IA 1Z9BA 4WGGA 4E33A 1FDTA 2QPAA 4DCGA 4HO1X 2RI0A 2ZJBA 1WF6A 2Z2KA 1YHYA 2X6JA 1DRUA 1Q0LA 3ACCA 1LLUA 3ETNA 3M0EA 1PR4A 3LVFO 3KR0A 4KQ2A 1Q57A 4O33A 3T5MA 2OCKA 2OFWA 3LPCA 2D1SA 1ZY2A 4UUNA 3Q5MA 4YMLA 1LSOA 2FPUA 1U2TA 3LI2A 3ZWNA 2A5EA 4J6IA 4EM6A 3TQRA 3QEKA 3EPPA 5IM5A 4TTPA 1PFYA 2IVFA 1FFHA 4G1BA 4AY2A 3INNA 2RD2A 3W4KA 3FXAA 3OJWA 2LSUA 3OEYA 5JWHA 5KIAA 3B3FA 3P9KA 3IA7A 2OV8A 2SECE 5B3KA 4M0EA 3ZU2A 4NF2A 4D02A 1Z5OA 4S0XA 3QELA 2ZG6A 3HVHA 1IUOA 1M1NB 4TLCA 5T8IA 3G9TA 3EIEA 1VZ2A 4TROA 3REOA 5CT4A 5FA8A 1WF3A 4KXWA 4LVOA 5LDGA 2ZSUA 3P20A 4OX9Y 5F7XA 5JS8A 1QQ7A 4HADA 5B7PA 3TI9A 4CKYA 4C9BB 1QPBA 2E4UA 2PANA 4BX2A 4L5IA 5GZ1A 4HB2A 4D2IA 1AGXA 1UC4B 2YHCA 5BR8B 1SRQA 2VGXA 3B8HA 5PGMA 3HH8A 3DPDA 3DVLA 3IHWA 1IY8A 1E99A 4GCNA 1Z5GA 3GNSA 3OPYI 5ERXA 5HVNA 3BWXA 4DMKA 4YGYA 1DT3A 4E5DA 3WGGA 1U8ZA 4NSNA 1GCUA 3LFTA 2VRBA 4RH0A 1CEQA 2QRUA 3E34A 2IYRA 3OE5A 1TM5E 1P1KA 4P3YA 5AJZA 1TVKB 1BD3A 3D7NA 4BEBA 3TLEA 5EE1A 3QBDA 5CIQA 3ZHBA 1X70A 3M9WA 5KWDA 3QVKA 3KR9A 2QDKA 4O2LA 3RYHA 3WSTA 2J0QA 4KO3S 3JZMA 3UUGA 5ITZF 2R8YA 4OBEA 1LPMA 4M0LA 3CEQA 2JDID 2YNMA 3DFMA 3W8FA 3BEEA 3KOWA 4EG4A 2VZ8A 1T0JB 2FQXA 1T3HA 3DL7A 4DLWA 1EHIA 3CN7A 5GADl 2A4ZA 5JHGB 3F73A 3GA0A 1DZIA 2IXAA 4UWHA 3AQIA 4G0WA 4M86A 1ZYUA 1O3YA 4KRXA 5KSOA 4OGWA 3T1TA 2NTEA 1CUDA 1RXCA 3ZV3A 4Y6GB 3QITA 4I6EA 1QHYA 2ZYAA 1T2DA 1WPGA 3NBYC 3VU9A 3IUSA 1J33A 5ENTD 1U1EA 4UC0A 3P97A 4CTJA 3SQLA 2WBLC 4F6RB 1TEVA 4BQNA 4JBHA 1VPEA 2P78A 4EZIA 2MSKA 5A4AA 1FX0B 4HRYA 2OBNA 4IIVA 5EOVA 2BH2A 3R5XA 4PAGA 1MO3A 3QU5A 1JSXA 3UWMA 4UM9B 2HT1A 3IHLA 2R1TA 3HL4A 3ND7A 3UK0A 2ZJ5A 4C7KA 2V4ZA 4L4ZA 2JEKA 4Y2HA 4TPKA 4E1VA 3IUMA 4Z9AA 3VUEA 4TN5A 3PC4A 4WNIA 1JMYA 2VJCA 3FWPA 3CH7A 3ZWCA 5DNWA 3QVSA 4IDCA 1H3FA 2GF0A 2PPVA 3LOQA 1PJSA 3WG7E 4ANVA 1MV5A 4NS1A 2CB0A 1OIVA 1GTJ1 3GUVA 4PO3X 2QL9A 1JU9A 1SU8A 2G0NA 2DHDA 2UVDA 3ENWA 3R7WB 2P1RA 1E7VA 3ESZA 2O5EA 2ZJAA 1QR2A 3B7PA 3KQQA 2QVLA 2O4CA 3ZDRA 5BURA 3Q40A 3DEJA 1XE3A 1U1IA 1MENA 4RIGA 5D87A 4XRGA 1RPNA 1L4YA 3IAXA 2IYTA 3E8XA 3IXMA 3MJHA 2RHCA 2VDKB 4OIMA 4EZLA 3FHLA 3WNVA 2NU8B 3UA4A 5HZMA 1C9NA 2HCBA 3CKYA 2PXCA 5JR3A 1U94A 2YL2A 3KQLA 4YN3A 1MX6A 3O1HB 1BMFA 3MJ4A 3D4NA 4KWCA 4OYYA 2A30A 1XWWA 3RTBA 2ZREA 4GYJA 3SEAA 1P7YA 1RQLA 2P75A 2OQ2A 4DDTA 5EIFA 3IEPA 4J0JA 4J0HA 1P3JA 2HAEA 1DUVG 4DEYA 3ZYKA 3FTZA 1AO3A 4YRFA 2XCSB 3C7AA 3FOCA 4IHJA 3HVIA 1W581 2B1GA 1YACA 3MD0A 1IM2A 4MBGA 4AJHA 2R5FA 1WCYA 3LJKA 1UUFA 2WMOA 4HDMB 5DIFA 2JKZA 3D9NA 4KX3A 4BEWA 4YRRA 4MAFA 3ZD7A 1P0PA 4D8XA 3HR4A 3D43A 4C0KA 1JLKA 4CHTA 2CCGA 3U9LA 3ZV4A 4TSKA 2I76A 1P19A 1NN3A 1V9CA 1YZQA 2Q29A 2K7ZA 1GT6A 3FOBA 5IBRA 3DMTA 3IBSA 3KJHA 4I1UA 5H3LA 5G2NA 3FWKA 3AW9A 1NBMA 2H4ZA 4OIFA 3UUWA 3RVNA 3O8RA 4MITA 3HJFA 3HVJA 1RZUA 5J2TB 1U0HC 3PF8A 2NYRA 4AAYA 2E5WA 1P9NA 4DA9A 3GZ1A 4MR7A 4IYJA 5TPZA 3KWLA 1L7BA 1PHPA 4BB0A 3ESAA 4RYDA 4LOIA 3BWMA 1Z5UA 2OBFA 2Y76A 3FM9A 5DHUA 2J0UB 1BMDA 3BWEA 3JQ7A 2W6PA 4YDRA 4L57A 3OC0A 1QGOA 3RK4A 5JWOA 2VAVA 1U0LA 3HKDA 1L7XA 4X1IB 3EJNA 1E4EB 4UUQA 3C8DA 1UIMA 2XIJA 1PWYE 4WZBA 2H2WA 4J8SA 4B8WA 1RRKA 1I5RA 5DYGA 1ZK4A 3EWSA 1U9ZA 4FMBB 1Z8FA 3AGPA 3R41A 1QXSA 3W6PA 2HJVA 2J8SD 5CCLA 1RJWA 2AQIA 4IHJF 4QGSA 4OHVA 4BYGA 3MUFA 1UOEA 5BVGA 2XGJA 4HOSA 3FNBA 2VZLA 3DYBA 2Z5VA 1GYRA 3UICA 4NWIA 2J41A 1JYSA 2IVZA 3FTNA 1TFRA 1VKRA 4B6SA 1FX1A 3C1AA 4LBVA 3X2FA 1JYFA 5IRCD 1DVPA 4LTNA 4BV8A 1UM9B 3EQ8A 1ND6A 4HP8A 5FNVA 2BHTA 4B4UA 2FPKA 4JA9A 3M6UA 1BMQA 1ZUD1 4J6FA 3DJFA 1NR5A 1UT6A 2VLBA 2H1HA 4XDHA 1P7PA 1Y3FE 5A1JA 3P1JA 2JLYA 5G4LA 1ORDA 1KZGB 3CRMA 4DPRA 4XX0A 2W93A 4QULA 1JBEA 4COOA 3Q5EA 2ACEA 1GP2A 2O3QA 3DXXA 1OX4B 3SEQA 4RKRA 1ONNA 3GYBA 2FPXA 1TM2A 1OMOA 2AFHE 1XDWA 3CHPA 5F7OA 4C7VA 3CZ5A 3Q9SA 3DV0A 1PG5A 2X86A 3W06A 5KOYA 2ZIUB 5JJTA 2ZJ6A 2CEKA 1SXQA 4P0PB 2GRRB 4MVJG 4ITUA 4UI9K 3NANA 3RU9A 5FWYA 3PFWO 4EF6A 1OBCA 1GR1A 3L4EA 3VNSA 3JWJA 5HTOA 5FTMA 4K9SA 3SR4A 1H2WA 5IMBA 2PEZA 3KALA 3A8TA 1E63A 3PITA 4Y6LA 4FYMA 1Z12A 4H08A 1DQZA 1IOWA 3OOJA 4I36A 4KT6B 2IH5A 4BQFA 2X9NA 1A95A 3L08A 1LPPA 3PNYA 1DHRA 4O4IB 5FEUA 5I9IA 4KV9A 2GD0A 3MILA 2TSYB 5JSUA 4IO1A 3VV2A 1V95A 3HM2A 1XZIA 4W7SA 5LNK6 2V0PA 1W5EA 4MKZA 4WDRA 1TYQG 2O20A 4AJNA 4JJAA 2I2XB 3O83A 4I9NA 3CSUA 5BN3B 1LDNA 3SYTA 4DDWA 4F86A 1DE0A 1NUQA 1TMKA 4BV3A 4EFNA 2WYWA 4W63A 4K9DA 1Z56C 4DLBA 1ZHHA 2VHZA 4AP2A 1OXXK 1VMDA 2Q9BA 4JLOA 2VTBB 4FLFA 3O73A 2GXQA 3RIMA 3W2IA 3V2HA 2BFWA 4WNGA 5CEDB 1TRHA 3JSAA 3PNSA 1Z2PX 3RAUA 4X3CA 2PV0A 2JFVA 3HG0D 1D1PA 1L5HB 5I4BA 2EKZA 1R5BA 1U4OA 1WXGA 4HRAA 1IBLB 3ZNNA 2WILA 3I5UA 5LX8A 3BREA 3BWYA 3DPYA 4OATA 3IP8A 2P65A 3UIEA 3AEUA 2IU6A 1P0FA 2YS6A 4NARA 1I3OA 4F96A 3NM6B 4EK9A 3CW9A 4EHAA 4HWOA 2WU1A 5FV7A 4GLJA 1UZUA 3IULA 3MMNA 2GROB 4EYGA 2F1JA 2ZYWX 3SZ7A 1GXSA 1N4RA 3E1KA 3GDGA 2O2DA 2FPIA 2FRXA 2DMRA 3KLPX 1QC5A 2GEFA 4PGHA 2I66A 4EQFA 4LG1A 3SBTB 4AVYA 4L76A 2LCIA 2Y05A 4HGNA 5EMKA 4GOJA 3EF0A 1YB6A 2CDCA 1N9ZA 1C41A 4C0LA 2P1DA 1P2DA 1DAIA 5TGZA 3E9ZA 4UZEA 2YV1A 3WIDA 4QYMA 3B6IA 3DH0A 1L9XA 3WKDA 1EVZA 4XEUA 1ZEJA 3PQFA 3LHDA 8ABPA 4BTBA 1UF9A 1VQ1A 4YMUA 3OCJA 2X0IA 3O7MA 4ZALA 2VQ3A 4EMSA 1C1DB 5A9RA 4ROTA 3H2JA 3TGPA 3CWCA 2XDQB 1J90A 3D8UA 1PVVA 2W2QA 1INZA 1MH9A 3EYWA 3S7FA 2J5BA 2Q3CA 4HAUA 1DI0A 3SY2A 4G86A 1NRIA 1WZEA 2PVSA 2PT6A 4D3XA 2VT6A 1XROA 3P2OA 4GA0A 1KP3A 1KGSA 4HGOA 1ZIOA 1FC0A 5ED0A 4DCNA 2RG8A 2AUMA 1GAJA 3OHPA 2OAEA 2FB9A 4GLFA 5LCXA 2ZAGA 4UATA 1T36A 3IERA 3ON5A 1TIKA 1ICIA 2M2IA 5ADUS 2QN7A 1W9MA 4I3HA 3DMPA 3K20A 4MVJP 1QH1A 1YJ8A 4HFNA 1HG5A 2B83A 3FYSA 4JT4A 4OBBA 4HVLA 3VDRA 5AVTA 1EF1C 2ZW9A 3OPVA 1EAYA 5IEJA 3RVSA 1WP9A 5HFNA 3P9PA 4IJ5A 5GONA 2XQ0A 1S2IA 3DXZA 4KAJA 3H8VA 4ML3A 5F2NA 2Q5FA 3W3AA 2IEGA 1W4LA 3O74A 1TNDA 1FXUA 5GV7A 4KBYA 3VO9A 4OFXA 1ORHA 1NQAO 4L7QA 1G4AE 4R51A 1N1GA 4MRNA 2YNMD 3V1KA 4DGSA 1XOIA 2VJBA 3JARA 3OEHA 2QP9X 4GE3A 1IAQA 1QOPB 1YQXA 1Z88A 4Q9KA 3JASA 1KO7A 1ECLA 3FAKA 1W2WB 3FVTA 2HLPA 2Z2YA 4I2VA 2Q28A 1I9CA 3E7XA 3P96A 2OGWA 4Q0MA 2R4TA 1EEXB 2FFAA 3DFKA 5CFRA 5AI4A 1RPAA 4PBSA 1XRMA 2H1SA 4A0HA 4RA6A 5E1MA 3AG4E 2H6EA 2EOAA 1K08A 1TO1E 4MS6A 3V8BA 1Z8NA 5K6AA 1N36B 1FRNA 4GZ3A 1PJ4A 4IDQA 5AVZA 2C2LA 3HEAA 3WQRA 1QPGA 1QGED 4QXMA 2YV2A 3Q41A 1WHSB 1E6WA 2YN4A 4WASA 2J49A 3VC1A 1FNSA 1IBRA 2A4MA 1O6FA 4MRAA 2BE7A 1PSDA 2EFYA 4GKAA 4Z3KA 5JWRA 3RPEA 2H0AA 1Q92A 4AJLA 3JW8A 1AOXA 1Z6QA 3PUZA 5IBPA 3VLEA 1JWAB 4PIPA 3LC7O 5ARFA 1HI9A 3PQ2A 3GFRA 3GEGA 4UZFA 2GYWA 4DA6A 5E1OA 4NX2A 2G80A 4HG2A 5F73A 3Q73A 1DKPA 1SC9A 3J5PA 1F4PA 3M6VA 4F2WA 1ONSA 5JVDA 2EKLA 3R1IA 4LXQA 2KATA 4AKGA 4H16A 3Q15A 4GR4A 5GONF 1FUYB 5AXAA 2CC2A 5FIUA 6NULA 2Y71A 4Q05A 3EDOA 4XSGA 1ULZA 3EOAI 1KZ6A 4QYTA 3W0LB 9LDTA 4C22A 1YRHA 3O8NA 3A27A 3DO6A 4LK3A 1TQHA 4URKA 3QOYA 3Q8XB 1EX6A 1FNCA 3BULA 1NN5A 3VV3A 5EJ2A 3W7VA 4D79A 3CNEA 4KXFB 1NVDA 1Q44A 1QYIA 3RT1A 1U0JA 3EJ6A 4JJZA 4Z8XA 1X3SA 1KRXA 3BK1A 4ZI7F 5MN5A 1ZD8A 2ZYSA 4MV1A 3CG0A 2GAIA 5JZMA 4EPXA 2PUJA 1K1EA 1XCLA 3RK0A 1ZDMA 2F00A 4H0CA 4JL8A 3B2QA 4NFLA 2OBXA 1PLKA 3WBFA 4BESA 2B6CA 4QOGA 3MMSA 1XU7A 2WXMA 5JA4D 2XMBA 3UGJA 3PQ8A 4IDOA 1UJMA 4EJFA 3BT7A 1H5UA 2ACVA 4UXIA 4TKUA 2XAAA 4RIIA 2ZIZA 4PXAA 4I9CA 1K75A 1W85B 4DXAA 3ORHA 3T61A 4UNSA 5ILOA 3NFRA 3WQQA 4EG6A 2P4QA 2NXEA 5EIAA 1PEDA 3K9HA 3V8QA 1UH5A 2GJ9A 3CLRD 1LV7A 1Z4QA 4OMCA 5E38A 1BFKA 2XLBA 5HS0A 4XTCS 1QQ5A 5COAA 4C0QC 2GVNA 1VA5A 3CEAA 4O3MA 4HEJA 1NOJA 5E4TA 4K46A 1NBMD 3RHSA 5KTNA 2LCFA 1FU7A 5BO5A 4M1WA 1G7CA 4U2GA 4US0R 2IHJA 1SCUA 2JGDB 4LRQA 4NI5A 1Q16A 5HKKA 1U63A 3U6KA 2W2MA 4G5HA 1W88A 5LQAA 3ZK7A 1XL1A 1Z3IX 2G6BA 3KT3A 4PCVA 5TPZD 3U1TA 2YXEA 1A8SA 1GSIA 2APJA 4HAXA 2FXIA 2GD6A 2SICE 4X61A 3VR6A 4PGMA 2OFOA 3T3GA 2G71A 1PK8A 1XZFA 3K0BA 1V7ZA 3KLOA 1K7XB 2NV2B 1KVUA 4RVHA 3Q1KA 2YH2A 4DABA 5IG2A 1X7ZB 2NZ2A 1DC2A 4F11A 3DXMG 4QFDA 3PX2A 4N3GA 5AJHA 4FDAA 3SQDA 1G21B 4HH1A 4F9EA 4ISCA 3GDWA 2D1FA 3O8BA 1NBIA 4JXTA 4O5AA 2LPMA 3WL8A 2CXUA 3BXZA 3FOFC 4CF6A 3BFJA 3AETA 1ZOOA 5JV5A 4FDUA 1NXQA 8ADHA 2G9QA 2XTJA 3KZNA 1AQLA 1RYEA 4XJVA 3IEVA 3JWGA 1BU9A 1U3GA 3L7IA 1Y4UA 2IYEA 5HRAA 2PQ0A 3I4RB 3ETDA 2BKXA 5CAEB 4HVBA 4URXR 3DTVB 3CSTA 4GBGA 2W6ID 2RKBA 2F1KA 3PNLA 1JMVA 2QX8A 2C5LA 2CCKA 2R2AA 4FJYA 4D6XA 4RHUA 1JEYB 4CW7A 5KJ1A 1JB1A 1IZ0A 4M1YA 1S2DA 2YASA 4G65A 3E9MA 2FFGA 1GZ4A 4J90A 3N7UA 5CB6A 4U7JA 3K92A 2VIIA 1QX3A 4HS2A 3GVIA 3G2KA 1JEAA 1CT9A 4BQEA 4A6EA 1G9XA 1LFAA 1X0VA 1HLFA 2JCBA 4KYVA 4KR6A 3W1VA 4R9RA 4OAPA 4ALKA 3M6LA 4AP6A 3DMYA 1I4DD 5AVOA 2JZNA 2PGLA 4LZLA 4ENUA 4O1IA 5ICCA 5CCXA 2JGNA 2F1OA 4X63A 1URPA 4C06A 1XCPA 3IV9A 3PA8A 5JD5A 1GOTA 2PQ6A 3O92A 1IXKA 3VKVA 3AJ8A 3C72A 4FQ8A 4NU0A 4CEJB 2V9ZA 4Y1EA 1ZMTA 1BGVA 1RJFA 1V5GA 2C2ZA 1I7PA 1AA9A 3IDQA 4YCMA 1QF6A 1OI2A 5KJEA 1VMAA 3QNMA 3O7WA 4UHBA 5AJVB 4NNPA 4C03A 1HMPA 1KPIA 3NORA 4DLPA 1BA2A 4H59A 2JAHA 2CN1A 1HYGA 1UBCA 2QTVA 3EEIA 3BH7A 1ZVQA 4WY5A 2OESA 3L7OA 2X5TA 3BK7A 3FG9A 4C87A 3I8OA 5K3CA 4RPLA 1YR8A 5WRFA 4FX5A 3IGFA 3NTOA 1OYOA 1EI9A 2IIBA 3MWLA 1H4TA 1WXXA 4D82A 9MHTA 5GV8A 1SJ9A 3OAAD 4YBZA 4NFYA 1SPXA 4YRTA 1NL3A 5K8VA 2HPHA 4QOFA 1DKUA 1DIRA 1N54A 4UEQA 2IYLD 3PV0A 3DA8A 3L9XA 4IRUB 2HQOA 1LPAB 5JPIA 3I8XA 1HDCA 3CT6A 3ER8A 4L1BA 3VA7A 4KQCA 3RIEA 3M5DA 1L4GA 3ZE0B 2AE1A 3LBIA 3PUVA 2NO0A 4U8YD 2NTYC 2VOJA 4IMPA 5KUTA 2PKXA 4TXQA 3PWSA 1FJHA 1Z68A 3OE7A 3CRRA 1GTMA 1IY2A 3WTCA 5F77A 1J1ZA 3LVQE 2B9EA 3RJVA 1DDOA 4EBAA 3W2FA 3NYIA 4MQFB 2ZP1A 4Z4QA 2KYRA 1TEXA 2IWHA 3H2GA 4E32A 2DXIA 4MZDA 5L4NA 4W1QA 1YT5A 1TLTA 1DJNA 3H4IA 3SJCA 4NYIR 2JZOA 1U4SA 2XYHA 2WTNA 4LDZA 1A50B 1K8RA 1DC8A 3GJXC 2PKCA 3KFVA 3WRYA 3HCAA 1IHOA 3FGNA 1REQB 5CITA 2RAFA 5FOXA 1NLFA 3L0BA 4E22A 2OILA 2BEDA 4DDKA 5ESDA 5KCMA 5BMVB 2IYSA 2J4BA 1MN6A 2V65A 1A88A 1NVTA 4EW6A 4ON9A 2XD9A 1NUTA 3CPEA 3I6QA 4Z4CA 3QRWA 3WGKA 1GGHA 3WNZA 1Y1PA 4FC8A 5HF9A 4UYKA 5EHIA 4NDAA 1QNFA 2J6CA 3NOXA 4N7JA 3NATA 1P81A 5AOAA 5IUNC 4EO7A 4QAJA 4UASA 4OJYA 4QVKA 4ME6A 4AQ7A 2PL1A 1W94A 4BNLA 3L7CA 2V03A 3TCKA 3P2YA 1HX7A 3MNFA 5JYBA 4PYIA 3H75A 3DBOB 1E7UA 4AUKA 3SF8A 3O4HA 2WAAA 3VNVA 1M6HA 4LSZA 2RGNA 5BV0A 5AW8A 2I55A 2QD4A 1Q3KA 1AM4D 3PGKA 3D7KA 1GKIA 3KKNA 2HA7A 3HKEA 4R1MA 4I1YA 2NM0A 4ZU1X 4RF2A 1BJRE 3AR8A 3WDKA 3SHOA 1FIUA 3DSWA 4L2IA 1BD8A 5CFZA 3NHWA 1XF1A 5KYXA 3Q7FA 5EVJA 1Q19A 4ZREA 2B3DA 1MJ5A 3PPWA 3QM1A 3ZGYA 3AG3E 2FSUA 5ALIA 4GOLD 1T26A 4M9SA 3TLMA 4OQNA 3P4UA 1P5RA 3O84A 4NVRA 1JXMA 1LF5A 2J09A 2OK7A 1FFWA 3DEOA 2OCGA 3LYAA 4D96A 1E8XA 5HJ2A 1Y48E 1NG9A 3A05A 1B3BA 4L28A 4M1TA 4DF3A 2QGFA 3RKUA