4CDRA

Human o-glcnac transferase in complex with a bisubstrate inhibitor, goblin1
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
717
structure length
698
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bisubstrate Udp-Peptide Conjugates as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANSFE
total genus 268
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4cdrA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4cdrA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4cdrA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4cdrA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cdrA03
1E1YA 1KTIA 3ASGA 2R4TA 4KQ2A 3CUVA 3Q15A 2SKDA 2XCBA 2VGYA 3PDNA 4GPKA 1ELWA 2QRPA 5HXAA 4GZ5A 5KJKA 1A8IA 5LCWJ 2QLLA 1FU7A 2GT1A 3NAZA 1PC2A 3ASFA 2C0LA 2PYIA 2X0DA 3SYRA 1FU4A 3DZCA 3HBMA 4QLBA 3T3GA 5TMDA 3T3HA 2E2EA 3BEEA 5FZSA 4YI5A 4X6LA 2VG8A 1L5RA 2ASVA 3MRVA 2VQ2A 1NOJA 2X0FA 4BTAA 3CV3A 4U0SA 1P2DA 2PRIA 2VYIA 5CHEE 3NP9A 3RT1A 1Y6FA 2IV3A 4JA9A 4UI9C 3MS2A 2G9QA 2QN3A 3OY2A 4HWGA 5JTUA 1E4OA 2X6QA 3WC4A 4IN3B 2IFUA 3QKYA 4YI3A 1GFZA 2QRGA 4REMA 1M5RA 2C0MA 2Q7FA 1C8KA 3L7CA 2R66A 2DBAA 2QN8A 4EL0A 3OT5A 1WUYA 5G05C 2QNBA 3IA7A 4RIFA 1ZU2A 3CEQA 2C1ZA 5BT1A 1GPAA 3Q49B 4M60A 1PYGA 2KATA 3FFLA 4EKEA 3HBJA 3MTBA 3MTAA 3ZCRA 2ZB2A 4HOUA 4BT8A 1FTQA 2XCUA 3MTDA 2IEGA 2AW3A 2QN7A 5JJTA 2IF4A 1NA0A 4CGWA 4FKZA 3VTXA 3LYAA 4MRAA 3OXFA 1FCHA 4UQXA 3CK9A 3ZFWA 4AY6A 2G9UA 4GA1A 5JTTA 2VCHA 1P4JA 3L7AA 4LDPA 1AXRA 1H5UA 2XGSA 2PL2A 4J8FA 2FETA 1L5SA 3OKAA 4NESA 4I1AA 2R5SA 1IHGA 4XI0A 1A17A 2BISA 3CV0A 2UY1B 1JG7A 3RIBA 1YA0A 4BTBA 1UQTA 4XIFA 1NZNA 2HY7A 1RZVA 1HZ4A 3KAEA 3TG4A 3WAGA 4Y6CA 4BWRA 5DBKA 1J39A 2PQNA 3D0RA 5ARFA 4N3BA 2WQHA 4GA0A 2VGXA 4GCNA 4AY5A 2BFWA 5TMEA 1YA6A 3CUWA 2GW1A 3RU0A 1Y6GA 4NRHB 3VDNB 1FS4A 3NPAA 3T3EA 3FROA 2Y4UA 4F3VA 4WACA 1QM5A 1HXIA 1EM6A 3OTHA 3G2HA 2AV6A 4GYOA 3D0QA 3G2LA 4WHMA 2VSYA 2NC9A 2HR2A 2HYZA 3LKUA 2GPNA 4RG6A 4BQEA 5A7DB 3ULQA 3AS5A 3BD8A 3CKCA 3ZHEA 1K06A 1O6CA 3Q3HA 5D0QD 1E96B 2G9RA 4RIEA 5KJNA 1ABBA 1F6DA 5BNWA 3OKPA 4RENA 5FT9A 5BW8C 3MBOA 5D00A 4J8EA 2UWJG 3NC4A 3MV2B 1IXYA 3D1JA 4GZ6A 5G04J 2R4UA 5C1DA 1JG6A 3RSZA 2QRMA 2F9FA 1L5VA 3MS7A 5EX0A 3SF4A 4G24A 1C8LA 4WUYA 5EKQD 3OY7A 1JIVA 3GZ2A 3MRTA 4GZ3A 4YVOA 1XC7A 4KQ1A 4RIHA 1Z6QA 1ZBPA 2XA9A 4LEIA 1WAO1 2BGUA 3ZCSA 4RELA 1GPYA 2BGTA 4ME2A 5G04C 1IIRA 3TG5A 4MHSA 3C4VA 2ATIA 3RO3A 4EQFA 4A1SA 3L7BA 4KXKB 5G05J 1HH8A 2VSNA 5JJ6A 2V5FA 4F9FA 5EX3A 3QDNA 8GPBA 4BQIA 3HYMB 1OUVA 5ARGA 1NZDA 2O6LA 4MHOA 3NCHA 3CEHA 3OXGA 4G23A 3RO2A 2GJ4A 1WV0A 2QFCA 2OFFA 2QRHA 4N2SA 2SKEA 4KYOB 1GPBA 4YNDA 4G25A 4I9EA 3T5TA 2IV7A 3UYLA 3T3IA 1NLMA 2X6RA 4J8DA 3E3OA 3Q3EA 5AYWD 4PQGA 4X7PA 1QKJA 3KD7A 2GPBA 3CUTA 3H4IA 3ZPJA 3VUEA 3ESKA 3MKRA 3WXXA 2FFRA 4F96A 3K9IA 5GPBA 1ELRA 1WV1A 2KS6A 2BUGA 1RRVA 4UQZA 2KCLA 2XCIA 4U0ZA 2ACWA 2QZSA 3CVLA 5D01A 3MSCA 2AVPA 4F97A 3OTIA 4FZRA 1QZ2A 3GW4A 4WNGA 1UQUA 4HORA 2H1FA 1Y8MA 4G2VA 4CTNA 3VDMA 3QWVA 3GPBA 4M7PA 2XCCA 5M72A 1GZ5A 3LY9A 3H4TA 4RG9A 1XNFA 2YHCA 2AMVA 3CEJA 2HO1A 4Z5XA 3QOUA 4APOA 3Q3IA 4I2ZA 3E3NA 3DD1A 5IKOA 3Q47B 3S7JA 1WW2A 1PNVA 3E4BA 2WTXA 2FF4A 2JLBA 3MS4A 4BFCA 4KQMA 4CTMA 2C4MA 5A6CA 4Y6WA 3ASDA 1K08A 1P2GA 3ZHEB 3QHPA 1SXQA 3ZCPA 3PE4A 5DU2A 3ZCUA 2F3QA 3O3CA 2QN1A 3U3WA 3LY7A 2GM9A 4JHRA 5D0OD 4N3CA 4N5CA 3UQ3A 2QLMA 2PYDA 1C50A 3U4TA 3RHZA 4NEQA 6GPBA 3SYMA 4W9RA 1WUTA 4LEUA 1XL0A 2JZCA 3G2NA 3G2KA 2GEKA 1GGNA 1C3JA 2OOEA 1Z8DA 3S2UA 1JIUA 4H7XA 3MV3B 4GYYA 2VCEA 2KCVA 1L6IA 1L7XA 1L5QA 3BDAA 2FEZA 2SKCA 1BX3A 3UYKA 4AN4A 2YJNA 4JA7A 2IW1A 1P29A 3AS4A 5JJ7A 4I17A 4WADA 3S0JA 1HLFA 3T7DA 3UPVA 2XPIA 3BEOA 1XV5A 2G9VA 1IYGA 4G26A 4YVQC 1Z62A 4CGVA 1P4HA 2QN9A 1UZUA 2C2LA 5DIZA 3E3LA 3MRXA 2R68A 2IUYA 4RIIA 3T3DA 3ZGQA 4MI3A 4N2QA 2ACVA 2WPVA 1PN3A 2H1HA 4O6FA 3S27A 1NOIA 5TMBA 3MEKA 1FA9A 1VGVA 4G2TA 2ONDA 4YUAA 5CCLA 3GUHA 3CVPA 3KS2A 4U04A 3UUXA 1XOIA 3MT8A 4UQYA 4H7YA 3ASHA 4WNEA 1L5WA 1WW3A 3ZCVA 1KT1A 2QN2A 4BT9A 4GA2A 1F0KA 3CUUA 3LY8A 4NQ0A 3CVNA 4I9CA 5KJLA 4N39A 3QWPA 1QQEA 2PQRA 1WM5A 3Q4AB 1FTYA 1LWOA 3CUYA 4RBNA 4BQFA 1SXPA 3FP3A 2VGXB 3NP7A 3TOVA 4CDRA 3MT7A 2FBNA 2IYAA 4JL0A 7GPBA 3LCAA 3MA5A 2XEVA 2PZIA 3URZA 4J0UA 1NZFA 4L22A 1V4VA 3C4QA 3ZCTA 1Y8ZA 4N9WA 4G1TA 3IEGA 1P4GA 1W3BA 3SZ7A 3EBOA 3QWWA 3LPZA 4GYWA 3S7BA 1EXVA 1TJCA 2XGOA 4HOSA 4HOTA 2C1XA 3O48A 4NC9A 1Z6PA 3VTYA 2R60A 3BD7A 5IKPA 2P58C 1B89A 3NB0A 4XI9A 3DDSA 2XA2A 5DXFA 3S28A 3OTGA 3S7FA 2F3SA 3OXLA 3AS8A 3RKVA 3HBNA 3IAAA 3L79A 1FC0A 5FTPA 3L01A 3CK7A 4AMBA 3HBFA 1JIXA 2YQ8A 3EDTB 2JJMA 3BCRA 4I2WA 5TVGA 2LNIA 4GPBA 5FJYA 5FZQA 3PE3A 3VUFA 1KT0A 1JEJA 4UI9J 3TGOA 3CEMA 2F3UA 2IEIA 3BCUA 4B94A 5DLDA 3CX4A 3G2JA 3NF1A 5FZRA 5HQ8A 3TAXA 3RSCA 3C48A 4HLNA 1P5QA 2FF5A 3MQFA 4MI9A 2LSUA 3AMVA 3OKCA 3DDWA 2IYFA 3L7DA 4HOQA 1GG8A 2Q6VA 5ENZA 1LWNA 2KC7A 2XMPA 3ZN3A 1NVKA 2C9ZA 3CVQA 5LQDA 2MHKA 3CK8A 5KJMA 3S29A 4AMGA 2L6JA 4MI6A 4EKYA 4AM9A 4W6QA 3TSAA 4U0UA 3EBPA 3QKWA 2F3PA 9GPBA 5LCWC 2KCKA 4WNDA 4ABNA 3FWVA 3R9AB 3COPA 3MT9A 2P6PA 4U07A 2ECPA 2I6HA 3G2IA 4M83A 1P2BA 3S7DA 3GYZA 1NA3A 1RZUA 3BCSA 3CKBA 3ZCQA 2LSVA 2XA1A 5I45A 4EL5A 4UI9K 2QRQA 4KBQA 1XKXA 2PRJA 3JYSA 4RIGA 4GCOA 2X0EA 5HI7A 3RJVA 2PQ6A 5CCMA 1B4DA 2AZDA 1FTWA 3GZ1A 4EJ2A 2UY1A 1NOKA 4WNFA 2Y4TA 2FI7A 4X7MA 1FU8A 2QLNA 1XL1A 4X7RA 3Q5MA 2GEJA 1PSWA 2XGMA 2GPAA 4CTOA 4MICA 4N3AA 1YGPA 2J9QA 1KLXA 3N71A 3BD6A 2FO7A 1AHPA 3WADA 4AIFA
chains in the Genus database with same CATH superfamily
1KTIA 2WHYA 2FLVA 1GL7A 2ATCA 4C7KA 4H7KA 4K5CA 1J97A 1NBMA 4IGIA 2GD1O 5AOBA 4DV7B 4K9KA 5HXAA 5BV8A 4MRRA 3RSSA 2NQTA 5FWXB 4QG3A 3R9XA 4IJ5A 1KFKB 3BMXA 4BL5A 5CFPA 1RKVA 4YPFA 1XWIA 4CMBA 1XK7A 1VM6A 3QYPA 4RLQA 3MWGA 4DLUA 5T57A 2YNQA 1U04A 3E5MA 3PWSA 5AKYA 5BSFA 2VDOB 5JVDA 3F6RA 3M4NA 1TKBA 5BR7A 5AQ9A 4IXDA 1T24A 5DW3A 3EXHC 2MR5A 4N76A 2IHUA 4HLEA 3AEXA 4J3JA 2DWOA 1N3LA 1TJPB 3BMOB 1L5RA 1QANA 2BKXA 4R01A 3V8BA 3LPNA 5DEOA 1V45E 3L8ZA 1IBLB 5ALWA 3JQ9C 1N33B 4IHQA 5C1IA 1JYSA 1U0HC 4DIMA 4BO1A 3ZDAA 4IHJA 3WK6A 4JOCA 2BKKB 3IBSA 3R9MA 4JUFA 3PPWA 2ODAA 2IV3A 1JJIA 1GQRA 2J3HA 3MS2A 4MQEB 2WIKA 4XVCA 1LSJA 4E51A 3I76A 3CG0A 2XNDD 3M2PA 4TRNA 1QX4A 1OD6A 4AXXA 1JEYA 4GMXA 4I4NA 3A1CA 1M5RA 3C0KA 1V7ZA 5BV7A 5CA1B 5KEIA 5G1PA 5AVVA 4DJFC 2UZ4A 3O7MA 5H1YA 2BF0X 3TL2A 5JH7B 4J3NA 2RGAA 3OF2A 2DBAA 1WIWA 2V7EA 1CZRA 2FFAA 2JIDA 3ZGLA 1U1IA 2OUIA 2VEDA 4IILA 4F6CA 2PUBA 2XOEA 4XEIG 3UFBA 1FTSA 1AKEA 3VR3D 1F8YA 3ZI0A 1DMRA 4JEUA 3VR6H 2JCBA 2QM7A 3LZ6A 3TVYA 5EXTA 3WOHA 4C88A 3G0GA 2ZRFA 1NC3A 1WM1A 3K1YA 4PHGA 1WY7A 2MYUA 1MZCA 2HYDA 1YDMA 2QRNA 4KI7A 1ZOPA 1Z34A 4CYMD 2IDMA 3MT0A 4I50F 2XUDA 4CN9A 5C5IA 3FNIA 3RIEA 3ACBA 2K5UA 4O1MA 3WIOA 2AN9A 3QJZA 4RLFA 2GRNB 3OG9A 3TOZA 3E82A 2RHMA 4HK4A 2PKWA 2Y1KA 5AW8A 2QZZA 2HMSA 4K6MA 3MTAA 4PPQA 4UMEA 3G49A 1X0XA 4FZ3A 1U8YA 4E2XA 1ZRMA 4Y9UA 3T5DA 4IJWA 4IV5A 3IDOA 2FP3A 3MWEB 2XSZD 3CLRC 3IDSA 3AUKA 3KELA 3QA9A 2OV4A 4JVSB 1V71A 5IWCA 3PDWA 1XDGA 2RG7A 3VTXA 1G1AA 1LD8A 3G9QA 3E8MA 3HDVA 3LHDA 4G6ZA 1AZLA 3N2IA 3Q9UA 4YRFA 5FADA 2X5KO 4O5AA 3NC0C 2QX4A 3OZ7A 1NQXA 4C2AA 5M2QA 1T2VA 1IXKA 1BE1A 3BRSA 3OOSA 3OX3A 4UATA 3C39A 3C1OA 5EHNA 2VCHA 3NQ41 3OEHD 3PD0A 1ENZA 4IIEA 1AQNA 1WB9A 1RPTA 1Q0RA 4BGIA 3OJLA 1JR6A 3V2XA 4OHWA 4B3BA 1CV2A 3MLAA 4D42A 1OX4A 2X1VA 7AT1A 4TQUS 4YGYA 3KAKA 2E87A 1CG6A 2IYQA 3QHQA 3CR8A 2ZRCA 3WNCA 1JH9A 2OPBA 5TE9A 2HU7A 3RRZA 3B20A 2NO1A 1S7GA 3CNNA 2ERCA 1CERA 2W4QA 1UKZA 2OAP1 3PQDA 4DV4B 4GE0A 4EHNA 5B7GA 1A9XB 3D6TB 1XU9A 3TJMA 3FFBA 3I5YA 2GEUA 3OMWA 4MMXB 3ER6A 1ZNXA 4DJJA 3F6BX 4DXAA 4H16A 4J0KA 1OXKB 2WXKA 3OZCA 3D9OA 1SUDA 1Z6ZA 4KLZA 2RK4A 3AOGA 2GBPA 2YJ4A 4D0LB 4PW0A 3ZW3A 2G72A 4OXRA 3U7FB 2DJ5A 4QPPA 1E9CA 2PPVA 1H94A 1N54A 3NATA 1G66A 2QVBA 2HYZA 3LKUA 1WU8A 2W6IA 3UB4A 4BIIA 2CNWA 2JB9A 1XD2A 3JPWA 3O1JC 2P78A 4HRAA 4EW3A 4EITA 2WIDA 1X8KA 3I9OA 4FP9A 1H1LA 4MS1A 1GG2A 4ZVUA 3D3QA 4BVBA 4Z1OA 1K4MA 5FOQA 2E1PA 1ABBA 1G3QA 1FNSA 1G3RA 1P2SA 4LZPA 5G40A 4AXHA 2BKLA 4TTRA 4IJKA 4TTQA 1INZA 1C30B 2CFRA 4TMVA 2W8BB 1D0IA 3GNTA 4KYTA 5JJLA 3KWJA 1AN0A 3OFKA 3PCRB 1JI3A 2YJ5A 3GW8A 1EEHA 4OJNA 2FX2A 1ZL2A 3ABRB 4WZAA 3ANYB 3RC8A 1FSFA 3H1BA 4GU5A 2OG2A 3UBTA 2WP8J 3IE0A 2GEDA 1G42A 4IZ6A 4R8RA 2J6BA 4RGVA 2UUOA 2HHAA 2F1KA 5EIXA 4LEIA 3UA3A 2R4QA 2NGRA 1FE8A 1G2OA 4Q1FA 1V96A 3QNWA 5AOXA 5B3JC 2YHAA 3HXLA 4F6RB 3KOWA 4Q0MA 4EQFA 2N42A 3ZH9B 2ZYAA 4IUCS 4KE7A 3WQHA 3K70B 1NUUA 4FGUA 2QUBA 2Y1FA 4HWOA 2EF0A 4IH9A 4QAQA 2V5FA 1SWWA 3EEYA 1JS1X 2VDQB 5FOTA 2XBLA 2Y0EA 4IJUA 1XU7A 4NBTA 4CR8A 5JMTA 4ALMA 4W5RA 3HYMB 4LZNA 1FDUA 3EXG1 2RBGA 4JOQA 2X42A 3NXKA 4G1BA 4LWZA 4PSKA 4Q3BA 5CIQA 3ZI4A 3DLIA 1VRWA 2A33A 1SULA 2Y4OA 3TNYA 3ABME 3F6QA 1BS1A 5KTPA 3QYFA 2YIJA 1VJTA 2C57A 5J47A 1LQ2A 1OAAA 1Z4PX 4IM7A 3QVJA 3MHTA 4Q9LA 1NFIE 3ZDBA 3VMFA 4X1IB 4PN7A 2PANA 4DC1A 1VBKA 2WG1A 4DR4B 1PGNA 4OHFA 1TN8A 3SSOA 4U0JA 4D8WA 3MZ0A 2VNAA 1J1ZA 1F8GA 1JTVA 4E32A 3PZRA 2XZOA 2V1XA 2XJ4A 3FVTA 4UHFA 3HU5A 1VLMA 2HRZA 2H0AA 1JNYA 4BO6A 1A98A 3SU8A 3I28A 3NASA 3V5NA 4AXBA 5E95A 1GNQA 3UNXA 4LAFA 3ENQA 3V42A 1U7HA 2I4TA 2WJPA 1KKUA 3F97A 3KB2A 4I36A 4CR7A 5SICE 4J0DA 2VDRB 1M7GA 3ZX5A 1YCFA 4IIYA 2Y8EA 4NIMA 4IOMA 4JVMA 1QZ2A 4KRXA 5JAQA 3REQA 3U7JA 3E81A 4OVVA 3MTIA 4KMSA 5IKEA 3DMRA 1G7SA 4ALLA 2BTDA 3ZR4B 2WLSA 3DXYA 3GJQA 5FI5A 3VR3A 5ESDA 4MKHA 1HQCA 5EI5A 4U2GA 3KQUA 1JJVA 2P4UA 2YW2A 5T6MA 1W4AA 2AMVA 4WIAA 2YNMC 2QAGA 4U2KA 1R1DA 3V4LA 3DZHA 1XCMA 3R5FA 1E5TA 3FKJA 4FOTA 2W48A 5ER9A 5DNCA 2GZ2A 3BH7A 3EIWA 5HM8A 2NAPA 4BX3A 3AETA 3URKA 2Z5VA 3NHRA 5ECGC 3SYKA 2ONJA 1VLZA 5A6CA 3DBOB 4JSTA 4M36A 3IVAA 3ASDA 2W70A 2OC9A 4FA6A 3WDMA 2C04A 4QZVA 5ICCA 4K2AA 5G4KA 1XMJA 2YJGA 1E2HA 4BVLA 2H29A 3DEZA 3JQ7B 1W4CA 3U7HB 4OFXA 3TSWA 2OQVA 1T29A 4E03A 3D6AA 4O5OA 2GVZC 3O3CA 3WKCA 4ZMBA 1YBAA 4XB6B 4EFNA 3R1IA 3I09A 1SXJE 1P0CA 2VDKB 4I8IA 1QZXA 4NJEB 5BV1A 1BCSB 1ZW1A 2CLOB 1M2KA 3T8MA 3LFTA 3PGKA 3E1GA 4Q4AA 5KYKA 1U5CA 2G07A 1U6KA 5F7OA 1R37A 4ARIA 4XYEA 3WWYA 2YVUA 5I4KA 2VTDA 1JHQA 1C41A 1DIHA 4X1YA 4BNVA 4YPOA 3DTTA 2VXOA 5ICGA 3NETA 4M0FA 4GX2A 3G8CA 1WUTA 4PVCA 4RGQA 1FCJA 5AOXB 1WTCA 3OSUA 4NBRA 5A4IS 3H3JA 1R9NA 4M0CA 3BQOA 3F67A 4LE2A 1LA2A 4A2CA 4LDNA 2Z2YA 5AO9A 2CXNA 1S89A 2A30A 2QU7A 1TUGA 3FFWA 4UVIA 4U7DA 2XPYA 3Q8LA 3PE6A 4H7XA 1R10A 2PGXA 1D1QA 5ENTD 2C2OA 2QL9A 1L5QA 2J3MA 2JJ8A 3C6XA 3O03A 4KQCA 4L75A 4WESA 2B5OA 3W2EA 2FEZA 4D9HA 4UTVA 2H65A 4U2CA 3HVEA 3SYNA 2MSEB 5SYNA 1ZITA 3L0BA 4E1AA 1MEEA 2JGKA 4B6QA 2JS7A 1K6IA 3K9HA 3N70A 5KOJB 5DYGA 1HYBA 1IXZA 4MWEA 3B7TA 4WADA 6REQB 1Z7BA 2FPPB 3KT0A 3P71T 1AT1A 1G60A 1KU0A 1V3QE 4Q6WA 3B5EA 4JHLA 1EK6A 1AGXA 1KMMA 2WR8A 1VJGA 3BMNB 1UG3A 2WJAA 4ZV7A 1IYGA 3I6QA 4F4DA 3RFTA 3FA2A 4UM9B 4QJIA 2C2LA 1YJXA 2P77A 3INNA 4ISBA 3LHFA 4O3FA 1HLPA 4ZCMA 4MI3A 4EGCB 5LDHA 1NXQA 3Q12A 5EXDA 3I34X 4EUEA 2J7KA 5AUOB 1RXVA 5JJIA 4DPLA 4EZLA 4PLVA 1WP4A 1W75A 2CL6X 4A5OA 2ZQZA 4DADA 3WWDA 8LDHA 3CS3A 2A3NA 3OOWA 2MYTA 2QT0A 5CCLA 1QGAA 1X1TA 3DKRA 1FP2A 3V3LA 1GDHA 5ALQA 3I9FA 4M22A 2X5GA 3TNFA 2C99A 1ZESA 4EO7A 3MT8A 3O82A 4KXQA 1V2HE 5TT0A 2QT9A 4E70A 1WW3A 3ROMA 1EU1A 1WVGA 4YAWA 1LNQA 4Z0PA 2BF7A 5DEIA 3STXA 4NZPA 1D6SA 2OHXA 2C5BA 3BF8A 4PINA 5E9AA 4HNAD 5CM2Z 1V35A 3BJEA 4ZXPA 1FXWA 4O02B 3K15A 3HDHA 2Z08A 2O1WA 4KQ9A 4F56A 5J08A 5C80A 5IH7A 4JI2B 3EPKA 1GEGA 2OXRA 3FPAA 1TNBA 1C4KA 1FMLA 1ZIPA 1X3LA 3NHYA 5E6UA 3NVKI 3MA5A 1TYZA 4G5HA 3RWOA 3URZA 2AJTA 1XZJA 1Y98A 2LAIA 2J3IA 2PQ2A 2PT6A 3B82A 5ABPA 2A9PA 2EWWA 5AI0A 1WSAA 3H6GA 3DLAA 3LQYA 4OBXA 5TR9A 1S4MA 3QLTA 3RWMB 4PG5A 1JDZA 3FIUA 4MI1A 1T4MA 3C5HA 1T25A 4HLCA 2OPHA 3TLMA 1IATA 2AGVA 4YJ3A 1U0FA 1Z7WA 3OUTA 3QBVA 2CB0A 3KQTA 4BFXA 1VA5A 4WXEA 3Q78A 3H5IA 4LNBA 4A0FA 1DC5A 2HJWA 2NUAA 3BD7A 1BS9A 5DBGA 5DW0A 3DMPA 2UVDA 5IKPA 1UZMA 1MMFB 3NB0A 2CNKA 4CF3A 3IVGA 2ZIWB 4HYEA 5FTPA 1NW5A 1IVNA 1E59A 4CMJA 5FUXA 3EDTB 4PZZA 1KDYA 3FEYA 1QX3A 3F5QA 4NQZA 4DE5A 5BV0A 1B8PA 4J0QA 1DKQA 3KT6A 2FWIA 5DE3A 5HGJA 1EVEA 2X5HA 1NIPA 3VUFA 4CM3A 2P3OA 4YUWA 5B7QA 2ZJ5A 2ZJ8A 2CLIB 4QGSA 2XRZA 4RORA 4JD2G 1OYVA 2PZJA 1U7ZA 4TWZA 2Y0DA 1TMKA 2FW9A 3HU2A 1ZKMA 1T9CA 2JIBA 2YFYA 1ADFA 2IEIA 2VRCA 4B94A 3BMCA 1VIAA 4KB5A 1ULBA 2H5EA 5GJVC 1T13A 2IWRA 2AUNA 5A3RA 2B4RO 3VISA 3DHNA 1XZQA 3NS7A 3N0VA 2CHFA 4I9GA 1O95D 2G0NA 4WWHA 4UUNA 4QQNA 3QVXA 2HWKA 4RETA 4QT4A 3UHFA 4UDNA 4CMIB 3BWBA 3U4MA 1IBRA 4TMFA 2P9PG 2E4XA 2IZ7A 5C34B 1KEKA 4Z99A 3RAFC 2PK3A 2Y6VA 3GK3A 3L06A 3O4ZA 4RMJA 4DDVA 1BHJA 1TFRA 4IVNA 4D3SA 5AW3A 3BVPA 5I9TA 4O2AA 1QV9A 2PX6A 1PT5A 2IOSA 5EQTA 3TSAA 3LPCA 5AESA 3R2JA 2XTNA 2GX6A 3HBLA 3UJ3X 4KR3A 3IAM6 2DB3A 1AA6A 3D7KA 3GN2A 3IEXA 2QTCA 5BNZA 1JNXX 3VYTB 1GUBA 4K9PA 3ER9A 3PDIA 1ZAYA 4U2DA 1IH8A 2XNHA 2OBLA 1U9CA 3UW3A 4Z54A 3H9QA 5B7NA 5JEDA 4BXOA 3JARA 3M1YA 2OQRA 3A37A 1ZBQA 4FYYA 2QENA 4Y6SA 1E3DA 1LPOA 3OE5A 4CFZA 5LP1A 4MUKA 3HL4A 3KR2A 2GF9A 5KMGB 4LUNU 1MBZA 3JD2A 4G0UA 2AHRA 3RVKA 2JFOA 5CG1A 5E1MA 4YTEA 1KJIA 4L08A 1RZ4A 3P32A 4XIJA 4GXNA 4IDQA 4E11A 3L9XA 5KNHD 4AKXB 1OR8A 1QKIA 2VNHA 1QK4A 2WIGA 2XZPA 2ZT7A 3BB3A 2J6CA 1R6BX 3HL0A 3V4PB 1KZ9A 5DLYA 1XYVA 3MUEA 5LYJA 2A9KA 3ROTA 1ADYA 2GILA 5LFAA 2YN2A 1N78A 5U1PA 5ALKA 4X7MA 3QF7A 2RARA 5AJYA 2ZEJA 4OQMA 4KIGA 5LA6B 3I9KA 4M4SA 4G09A 3NAGA 4GUAA 1KY3A 3UM2A 2WRZA 4AY4A 1LTXA 1ECBA 4RA6B 3TPZA 2QV7A 1K3ZD 4WWNA 2GK6A 4DRZA 1KVUA 2IC5A 4I3FA 5LNK6 1DI0A 4DWVA 5JI2E 4H3HB 3BDVA 3BG5A 1DEOA 3DNPA 3EIHA 2YV2A 3P1JA 3TTVA 3WADA 2PTHA 1FDSA 1RT9A 1S3FA 3LK6A 2CBGA 3L8GA 6ADHA 2V59A 3E34A 3Q15A 1J0AA 4GZMA 4K86A 5HS0A 1YUMA 3LCUA 1R3UA 3PDNA 4PQRA 3LWZA 1XTJA 1TGYA 4EGAA 5K0TA 2A4MA 4EA8A 1KARA 1ODFA 1FU7A 1PD1A 4OHYA 2MT9A 5B3JA 2OOSA 2WTAA 3D7SA 1W59A 4QVGA 3RRNA 5IUNC 3K9BA 3D5TA 1CB7A 3Q9NA 3B3QA 4WFIA 1WDWB 1KOFA 2H7VA 4IGFA 4I1YA 1FDTA 4XR4A 2RKKA 1EMDA 4B5KA 5EJIA 2VWPA 1DHTA 1SR8A 1W4RA 1WF3A 2HV9A 3AEQA 2PLWA 1GO2A 1Z9BA 1BQ4A 2NUBA 3CZ5A 2R9VA 3PK0A 3QENA 4X1KA 4OK5A 4EFLA 4Z7NB 5AVXA 5BPPA 2NYAA 3FDIA 2FDCA 3UUEA 3V2HA 1Y8AA 2AOUA 1HDCA 1CULC 5E9WA 3PITA 3CV3A 4U0SA 1CPYA 5CLQA 3B89A 3RWBA 1HDIA 2VP5A 3VV3A 2D00A 1OLUB 3IP1A 2GBIA 3R20A 5BW6B 3RT1A 4IH4A 3DEPA 2HPVA 4KVFA 3SYLA 1WQ1R 3A2KA 4I43A 2Z2XA 3S70A 2QN3A 3INGA 3JD1A 4GR9A 3DEOA 3IIKA 5F33A 4PZCA 1T3SA 3HU3A 1U7WA 2CF6A 5HIJA 3SQXA 3GPLA 4MDHA 2VDUE 3PUYA 5LYJF 2Q5CA 4FYPA 1D5CA 1FDWA 4ZHSA 3CVJA 2VF4X 3MWDB 4RMIA 4B3CA 3H6HA 4JYMA 5DHTA 1UJNA 1KPIA 2ZS8A 4CZ2A 5JCXA 2QB5A 1S96A 1Z7GA 1M6VB 3IRVA 3I5UA 2DFLA 4HL6A 2N9UA 4KR6A 5HBGA 1WUIS 3UB2A 3NC1C 4S1PA 2C9BA 4UBIA 4BJ6A 5JSFA 4ZTZB 4C01A 1D4FA 4D3FA 2W8ZA 4OOFA 1K9SA 2BFFA 2ZIFA 3Q49B 3OIUA 1M72A 3C2QA 3IMGA 1PK9A 3LQQA 2PLFA 3V8QA 4QVKA 3K16A 5P8WA 3WKAA 2GA9A 2PFKA 3FB4A 2H1VA 1A1SA 2IITA 2RC6A 5JW6A 4AP2A 1ZO8A 4EKGA 4PSAA 2AFVA 4EJSB 2A7XA 2G28A 2MYOA 6LDHA 3CLUD 4JROA 3RAEC 1CJUC 1DG1G 1IBMB 1UAAA 3GJ5A 1QIFA 2VNSA 4FKMA 1RXYA 4IP0A 4UVHA 4ZT3A 2O3QA 2XCUA 3AB8A 1FX1A 2HK9A 3F5MA 4WDRA 4S1VA 1P5FA 4ZALA 4DRXB 2NN3C 5KPJA 2UXCB 2AX3A 3NOXA 2HMYB 3HJFA 5JIBA 3LY5A 2GXUA 3HDJA 5K51A 1FCHA 3EGEA 3CK9A 4L85A 3QBEA 4PZYA 3DGEC 3L7AA 1GYRA 4F4CA 1JHMA 3PRYA 4W5TA 2JLZA 4ZCPA 3Q9SA 4WKNA 3UT0A 4AKIA 4MLPA 2FEPA 3IP9A 4NESA 2Y0BA 1Y81A 2GN9A 5IMBA 5L7TA 4R7LA 1A17A 1KMHB 1TJFA 5CERB 1NVWQ 4IMIB 3ZZMA 4HDNA 1YA0A 1Y3HA 4XIFA 1Y9DA 1LF0A 3HWX1 3QOFA 3IO5A 1HZ4A 2REBA 3HZZA 1P9WA 1P61B 3R3JA 4Y6CA 4BWRA 2AG8A 5ARFA 1A2QA 2WQHA 1ZEMA 2GWRA 3AW8A 4AY5A 3DTYA 3HWSA 4ZT2A 3L8HA 3MCXA 1N77A 2IQIA 2KYRA 2Z5FA 3LPMA 2X1MA 3IR5A 3OOYA 2PO7A 1I1HA 1U0EA 2G04A 3KTAA 4L5CA 1W581 1ZR2A 3DT6A 2ZAIA 3H84A 2WABA 1DRKA 5FV7A 4GP9A 1YB5A 4DGQA 3ABLE 1D2GA 4Q03A 1MAWA 3VC7A 2FPGB 1U2SA 2EGGA 1QV7A 4ZREA 3QSGA 3VRHA 4CHGA 3S8YA 5B3SE 3EIOA 2QUAA 3K5HA 3BTVA 1VB5A 4PICA 3ZGXA 4EJ0A 2VSYA 2HR2A 1EVYA 1MNAA 1Q1ZA 3A31A 1ZWKA 1C29B 3AHGA 1GPMA 3W6UA 3AKZA 3ZIAA 3ZE6A 4F72A 1T9GS 3QVTA 1RYFA 1Y3DE 2ZW9A 2ZU6B 1F2UA 4CETA 1WXWA 5CRUA 5AI9A 1Z5OA 2NPIA 3PGA1 3TMAA 3ZEFA 3OCWA 2QC9A 4V0NA 3KQVA 1P7VA 1ST2A 4HLQB 4MWDA 4D8YA 4HSEA 2HBRA 1XHEA 2Q9CA 5T6BA 2R1VB 4BKPA 4IIHA 2UWJG 5JROA 3UPTA 3L3BA 1XR3A 3LP6A 3LKDA 4JBYA 4PZUA 5HOQA 4KXWA 1Z0FA 4RULA 5B3LA 5H80A 3FTVA 1AXEA 2QRMA 3AVUA 4GPIB 3OZGA 3P1UA 2F1HA 2IPNA 2VK4A 2XVMA 4TUUA 3L0CA 4Q1VA 5TEWA 4GX1A 4MQEA 4G11A 4LZJA 5EXXA 4B2IA 3ZQUA 4N41A 3D9JA 3E33A 3Q1LA 4RIHA 1SHLA 4CNBA 1R4NA 4DR2B 1OHHD 4KX5A 1Q2UA 1SG0A 6GPBA 2ZCJA 2VNIA 4MRPA 1Q21A 2E89A 2PKXA 4NV1A 4XCVA 4YCJA 5CXXA 5F12A 1IYZA 2WJGA 4DHEA 5LD2B 3UWMA 1Y3FE 3P2JA 4MQMA 5JH7A 1DVRA 4ZOQI 3KIPA 1G6Q1 3L6CA 5CH8A 1VBFA 2OD7A 3PGXA 1RXEA 5CDFE 4BJHB 1E7MA 5ENQD 2IZZA 3OTNA 3GJ3A 2VSNA 4ECAA 3V1MA 1N32B 1SB9A 4FS3A 1V25A 2NWQA 4LRZA 3ILXA 5FH9A 1LU9A 4JP3A 1SCAA 2VHXA 4TRMA 5UKDA 3PVSA 5DTIA 2G70A 1XJ0A 2GASA 2IYUA 3TN7A 2CXTA 2GTHA 2FG5A 3GCGA 5CM9C 5EVCA 1I13A 3ZZ0A 3M1IA 4UE3S 3W5DA 1J09A 3GNQA 3A06A 3A1TA 1G3NB 2XOKD 3I9V6 4RK5A 1XDZA 2NUPA 3LLMA 1S2IA 2W2LD 2Z1NA 3B9RA 4DMHA 4KO3S 3RUHA 1UOQA 3TX2A 3V6LA 1RYEA 4FR0A 4TV9B 1XAHA 2G8LA 1Z63A 4MRNA 1ELKA 2G83A 4RPGA 3MWEA 3CX7A 4PC2A 4PGHA 5IKMA 5JD4A 1NRJB 5K0FA 4P2GA 3EHNA 4LKOA 3WLAA 3AR6A 1HFAA 1P0QA 4F2HA 3Q7SA 5L40A 2WM9A 3F9IA 4KO2S 4EQ6B 1YOBA 1KFCB 2D8MA 1WHSA 1EFUA 2D54A 2QG4A 4OREX 2HRBA 1K88A 3PZ4A 1CHDA 1E6UA 5GPBA 4S05A 3M2TA 1N0WA 5GOTA 2EFGA 2REQB 2ACWA 2W2KA 3AUAA 5CMYA 3JY6A 3MSCA 3H4VA 1I0IA 2DG2A 1W48A 4MV4A 4GC5A 3Q7AA 1KMCA 2C95A 3USES 3N2KB 4BGDA 1JXOA 2BRUA 3QEMA 4KW7A 1JBEA 2HT6A 3UJ6A 1GNLA 1T5LA 3EZNA 2XCCA 3CY6A 3AYZB 4N6OA 4NOJA 1CS0B 5KNCA 2XD9A 1OXVA 4U2BA 1D07A 1KHHA 3U37A 2P35A 5TXGA 1OXMA 3LSYA 5D5QA 3ONLA 2WUEA 3O75A 1ZD2P 2DCMA 2IVZA 4RH0A 4WE3A 4FEAA 5IYZF 1Y89A 1RZRD 2G17A 1JEQA 3CGWA 3VBCA 1WW2A 4CIYA 2BTQA 3M6WA 4ZO4A 4CLRB 3P9ZA 2DCPA 3MS4A 4EB6A 1DRVA 4B3MB 1MA0A 3ITDA 1H22A 1YIAA 1X80A 3PP8A 4OMCA 3RS4A 1AJEA 4DV2B 3ZHEB 4E4YA 4TWRA 4EY5A 3V8MA 5ED4A 1ODLA 4I4TA 1SXQA 4FCWA 5HMLA 4EWLA 5H83A 3IXLA 4QDZA 1I7QB 4CTNA 2X9GA 2ONKA 3KZCA 3PL1A 3ZCUA 1MXHA 4EPVA 1H4SA 3MF4A 2FEMA 821PA 5KTRA 1RQXA 3OP1A 5FUQA 5B1BE 2FEAA 4GKVA 5BT8A 1P3DA 2IHZA 4IBOA 2I2BA 4S3MA 3D8NA 2B2CA 1UJ6A 3F3KA 3K2BA 5KNBA 3IBYA 2R17C 5T5QA 4PYIA 3O90A 2H7CA 4Y0NA 2XMZA 5G0TA 1GNSA 3DM5A 1QYIA 4UAJA 3WRYC 4K8OA 1UMBB 4DJ5X 4ZAWA 3GD5A 4PLPA 1NONA 3QV2A 3LJKA 1I4WA 5T41A 3M6VA 3ZOKA 3AEKA 3SJ7A 1HURA 1USVA 1BWPA 4D10C 1XZ8A 4WXHA 5H82A 5HR5A 3PWKA 7MHTA 5AHKA 3S2UA 3ZHOA 2WB2A 4BV2A 1L7NA 3FNRA 4GYYA 1FLDA 4FFWA 4HH4A 1DAKA 1VYVA 3DGFC 1C9EA 1WZIA 1NNI1 4MUNA 1W46A 3I72A 5IP5A 3INRA 4C78A 1QE0A 3HI6A 2NMVA 1BX3A 1W93A 2X7JA 621PA 3GD7A 1N95A 3NTVA 4JA7A 4XWGA 3ZHSA 5KTOA 1KZ6A 1P62B 1S3IA 5KC9A 4B6JA 1U3CA 3E48A 4MWTA 1YWGO 1VMIA 3UPVA 4OU4A 3DZFA 5A9SA 3UQYS 5A62A 1NR7A 2P9IG 2ENWA 2R85A 3BE4A 2PGIA 4RABA 1AKQA 1KP9A 4RU1A 1M2GA 5K8VA 5AK5A 1Q7TA 1LDBA 3BJMA 4H35A 5KTKA 3W5AA 4MQ4A 4O63O 4HNSA 1L5GB 1DRJA 1NATA 4XCXA 2BFNA 4Q69A 4RGBA 2BDTA 4ROSA 3KKKA 4GLLA 4BEWA 1GZDA 5IZ4A 2N3ZA 3STVA 3UGQA 4W1PA 5I8ZA 3JQFC 1KMIY 4CMCA 4YRGA 3BZWA 1QG6A 1M6NA 2WK1A 1G8FA 3A9TA 3I01M 3GUHA 4YUAA 2J1LA 2V65A 2VTEA 1EX9A 1WVMA 3D1VA 3HKBA 2QROA 2NADA 1K6JA 4KQKA 5LUBA 3KYJB 5L4LA 1P91A 3KZXA 2FTKE 2QN2A 4HN2A 1QQAA 2C0PA 2WSSA 2OT3B 3K8ZA 4GKJB 1ODSA 1MN6A 1RKBA 3EGWA 2IHNA 4B76A 2J31A 3EA0A 3PC7A 1LWOA 3BK2A 2O2EA 1Z29A 4BVJA 4LQDA 3WFJA 3AKYA 3FYTA 2AD5A 3HA7A 1EP3B 4L95C 3FRHA 3B3FA 4IDAA 1UFKA 2ZRIA 3L9TA 4HDKA 3HGTA 4RZUA 2YZGA 4JUBA 4RK4A 1AKTA 2HCJB 4MPDA 3A1EA 4JW1A 1Q16A 2QU8A 3JSAA 5T8IA 3T7SA 4DF3A 4BFSA 1E6MA 3L8CA 4P3KA 1OXTA 1NYQA 3UUWA 3ZCTA 2QYSA 3AFGA 2EKDA 1KEWA 2VQ3A 3OPMA 1EJ0A 4TS1A 1NQ5A 4HNVA 1C7RA 3K1TA 3GFGA 3PF8A 3F6SA 2HT1A 1P6UA 2C1XA 2OEWA 1TQDA 4V1CB 4P33A 2JLXA 1KYWA 2CW5A 4WCFC 2R60A 3K9QO 2ZI3A 3BTSA 3GRUA 1BXGB 5E6SA 2X6JA 3BBPA 3UJAA 2QY6A 3GFVA 4EOGA 2QGZA 1KKLA 5CX1B 4Q4HB 5A5DA 2ZDHA 2P6NA 4MKFA 4MV0A 4QRDA 4WLEA 4NAUA 1VSVA 3D43A 2QD5A 4QDKA 3ZHYA 3GDGA 2A67A 4R54A 5JDIC 5C2YA 4CUKA 1WOYA 3OQVA 1N4DA 3EK2A 3OPYA 2P9BA 3VU8A 2X76A 1UC5B 5BPHA 3IUBA 3T7IA 2J3KA 5IHPA 3TGLA 1NAIA 4HGOA 4CKCA 1CP3A 2QTRA 5K0JA 4TV3A 1BGWA 1JLKA 2DR0A 4HN4B 4KFUA 5CA1A 5IF9A 3AJRA 3NNSA 3N8KA 3I37X 1JXQA 2LXNA 4UMFA 1REQA 3B53X 3A2LA 1AN9A 5K0BA 4CKBA 5HQ8A 3RU3A 1XLUA 1BW9A 4HLNA 2EBWA 2VUHB 1CSEE 3RAPR 4D9MA 3PJEA 4GL2A 4R6XA 1TLFA 3HVHA 4XR9A 4HOQA 1C80A 1GILA 1E5LA 1T4CB 2P2ZA 4OXXA 5DP2A 3T1NA 3UZUA 5JY1A 1WPQA 3W8FA 4ZTBA 2ZIUB 5KJEA 1TVEA 2QI9C 3BH0A 3CKLA 4LJRA 3IMCA 4L0CA 3ABZA 3DE2X 4C7OB 5AHWA 2ZZMA 1X19A 1T0HB 3BIJA 2G67A 1YA8A 2AL7A 2JCYA 4ZCSA 9GPBA 3SEFA 5LMUB 4AMVA 1DDGA 2V6MA 3COPA 3C43A 2EARA 1C9YA 3EG9A 3UJ8A 1VKJA 2Y93A 4UEQA 5FTWA 2YWBA 1LCIA 3P2YA 1N2IA 1RRGA 2R8OA 4R1NA 2ODQA 4TTJA 5A0TA 3ZRHA 3EXHA 1D2CA 4JJ7A 1T0PA 5DBEX 4G8DA 1V43A 3CNHA 4ZVQA 1LPSA 3ZZNA 3N39C 4FQ7A 5KWVA 2HLDA 2QRQA 3DC2A 4D9IA 4X62B 4D9EA 1P80A 1OPXA 2XCQA 2L6BA 2YZNA 5NLLA 5TARA 1UPUA 1KO8A 1SA4A 4BZXA 4EDFA 5IU6A 1BA3A 3EIFA 2FZVA 2NO7A 4QFMA 5CLFA 2R8EA 1CUFA 5E2BA 2IF2A 3AF2A 3B52X 4WL0A 2ZI4A 4Q4CA 4WK4B 5JT1A 2GRUA 3SQMA 3V8NA 1ZUHA 5EPOA 1EJ2A 4EECA 2BIFA 7ADHA 2NSDA 4JUDX 3D64A 3TAHA 2Y4TA 1PZNA 2ZSHA 1FU8A 4XYBA 3HXPA 1E3IA 2Q4TA 5CJPA 3L7OA 3RYIA 3SVZA 3TQRA 1IE3A 2QVLA 4YP1A 1TDJA 2OL4A 2ID4A 3I42A 5FEUA 1RLUA 4A63B 3Q5MA 3I8OA 1TYAE 3K0CC 1TU4A 3DSSA 3AV0B 3O74A 3Q5EA 5IJAA 1KEEB 1S7CA 3SXUB 3V3KA 2M32A 1DTEA 1G8SA 4D92A 1O6BA 4JT9A 5EZYA 3ROQA 2AMFA 5HG0A 1QS0A 2GAOA 2YWJA 4Z68A 2FA9A 3C3XA 3PEUA 4YUYA 3DBLB 3TZQA 3G5LA 1OTHA 3MD0A 2IYRA 3GXOA 3LFHA 3OZRA 4B32A 3RUPA 3ROKA 3ASGA 5JQWA 1SEVA 1C0LA 1TE2A 3CZRA 4GYJA 3T99A 1LBIA 3U61B 2O8EB 1T10A 2PGJA 4AUMA 4FNOA 1GUDA 3TSZA 1WEHA 2QLLA 2GRMA 4TXRA 3MUOA 3NTOA 4D5GA 3IDFA 4BRSA 1IN8A 3JZIA 4D9GA 1UANA 1TN6A 2ORED 3E1SA 3TIXB 1X2BA 3G82C 1BQEA 5T8KA 5FOXA 4O29A 5EUQB 3AHDA 1FMFA 1MO2A 3H13A 4LFBB 4R1SA 2P40A 3NTRA 3P2EA 3QUSA 2VIIA 3NHLA 1NQAO 4BKQA 5T4YA 1G6HA 1XFAA 1NI5A 1SQMA 5E3JA 4OHKA 2VQ2A 2ZUEA 2ZI7A 2BW0A 1Z5ZA 3DHYA 4G4IA 3DS8A 1KVRA 2GETA 3KEAA 3OEHA 1ULAA 1G98A 2C4NA 2OV1A 2XMCA 2ZRHA 3O9MA 1P19A 4XX0A 4YP5A 2I2DA 5FQ6A 5AJXA 5JD3A 5J4LA 5BYKA 2VDJA 4Z3DA 1U8ZA 1Z2AA 1IEXA 1ZOSA 4AG3A 3J80A 3RIGA 1BI7B 4APFA 2GCEA 3RGGA 3SF8B 3DV0A 3QKYA 2QRGA 1OA1A 2Z0MA 3THYB 4A8JC 5LQKA 3U26A 2Q7FA 1HE4A 1R8YA 2WT8A 2V7QA 3COVA 3EZ6A 2DUUA 2FAXA 2R66A 1K3TA 3K20A 2PXXA 4Q3KA 3C3BA 3MLEA 4RFSA 1TJNA 4MQFA 1T2NA 4F12A 1E7RA 2DHDA 3JZMA 2Y68A 3I23A 1SK9A 3R77A 1L5KA 3JXEA 3CKKA 2J09A 1U7OA 2FSIA 4LK2A 4UDOA 1TAUA 2R0QC 2M6KA 5JCJD 2WC1A 1O9HA 1GOTA 4XGNA 4ZK6A 3Q3GE 4Z1MA 4R2IA 1C3XA 3DMDA 3G2TA 1Z8FA 3LT5A 5KVSA 2ORVA 2ZRPA 4WKBA 3KB6A 3U40A 1SUPA 1MAUA 2F1RA 5FTJA 4DZZA 5BQFA 2B35A 3DE3X 4AZVA 1N0HA 3AQIA 4L9PA 1FBNA 3B2NA 3HWWA 3VC3A 4L72A 5JHGB 1YE5A 2F17A 5JXHA 3C87A 1PDVA 4JLPA 4YLYA 1OZGA 1W88A 3LM8A 4FTWA 5TF0A 4CGWA 1SVOA 3HN6A 4ENSA 2JIRA 1K4KA 3F49S 3K0KA 2DQYA 5ILQA 4ZYLA 3HCRA 4FYXA 5DNWA 5FP0A 3LYUA 4MUHA 3REFA 4BNUA 5LQNA 4LXUA 2DQ4A 2JI8A 3C4JA 2IODA 4JMLA 3WS7A 1O6FA 4EAAA 4EYGA 4KXUA 1PV2A 2E37A 1O94A 4KPEC 3QE9Y 2PL2A 3RYIB 5EWJB 2A5LA 3HCEA 1NTRA 2OV6A 3AB7A 1G3MA 1OVGA 2VGEA 3U5TA 2NUTA 4PTZA 5E7QA 3MTJA 3T7TA 5IJWA 3W4KA 2OSBA 4Q9IA 1FSSA 3GELA 4XJXA 1YACA 4EABA 5EGNA 3FX2A 3D59A 1FVOA 3OPQA 4I55A 3JQ0A 2ZRDA 1OIWA 3KYDA 4M1KA 3Q7EA 4IRUA 4N3BA 1QH0A 3RM3A 3VVCA 4DDHA 4ZGGA 1YA6A 2A0UA 1COWA 2BFWA 4PAOA 4RHEA 5EC8A 4Z2YA 4OBEA 4NL4H 1DX6A 1ZW6A 1Q50A 4R6WA 3FWKA 1EXNA 2ZANA 3KPVA 3ZD6A 3VDNB 1LRJA 4D26A 3OPXA 4QJ5A 4HWRA 4EH1A 1KOGA 3BUSA 2Y4UA 1G4AE 2AI2A 4M76B 1KSJA 5TQ0A 4J8YA 1QPGA 3A11A 3KQKA 4TYWA 2I9KA 3DMFA 4PRKA 4AYXA 1T3HA 4JAVC 2K7ZA 1K89A 5GV8A 3H5LA 4HFJA 5AP9A 3SN6A 5IT0A 1N1EA 4CM6A 1QF6A 1IUNA 1BVRA 4OIMA 5AQBA 1NYLA 3CISA 4ZO8A 1TNOA 3DNFA 2C2GA 2CFIA 4CF5A 2C83A 1L9XA 4F60A 1SC1A 1DKNA 3WHPA 3WZLA 5CYGA 2Y3IA 4WKGA 2R05A 4NJEA 2OO5C 2IV2X 5SY6A 3CT4A 1DAIA 5A03A 2Z3ZA 1Q1EA 5AN8A 1QF9A 1EH5A 3WXBA 1WUHS 3KP1A 3QPBA 4NE7A 5AHRA 5D00A 4KQHA 1ML4A 1A9SA 2AXQA 2P79A 5KNGA 4P83A 4YMGA 3QXCA 1QHSA 5C8YB 5HUHA 3GQVA 3N6VA 3OQNA 1L4GA 1CY8A 1CUZA 1NZJA 1MH9A 2E5FA 1ORTA 3MPOA 4MMZB 4R7GA 4ZT7A 2CUZA 3EJWA 5GP1A 3VOAA 1C8LA 1UFVA 2O7RA 4MPPA 1JAXA 4W1SA 5EKQD 2D1SA 2RHDA 5CGQB 3D3NA 1JLHA 2EJCA 4X63A 5NULA 1HO3A 4WUVA 5KQMA 3ZLUA 3EXAA 1PF7E 2B69A 2IP4A 3M34A 4QQKA 4YONB 4AK9A 3J81A 4BZPA 1Z6QA 5JAIA 1WL8A 2A57A 3ZCSA 4A8JA 1W5AA 2VXBA 1B8VA 2ZQ5A 4GL4A 4IOJA 5HFAA 3UJPA 3I4FA 4F7DA 5BXYA 5IN4A 1AUQA 4UEJA 1RI3A 1GZHB 4PXAA 1Q0QA 1AF4A 4NYMR 3W9UA 4PV7A 3ZDRA 1LFAA 2PGOA 5LP0A 1XZAA 3R09A 4M7OA 4BFLA 3CQ9A 2IXEA 2YVKA 4J3FA 1WDMA 2Q5QA 1EWRA 1YBHA 2YC4C 4O1OA 3U4DA 3EVFA 1MAAA 3ONDA 1R50A 3TX6A 5BR8B 1E4EB 1H6BA 4RANA 5FNVB 3WNBA 1N2GA 2D5AA 1GTVA 5K6AA 2FZCA 3NOOA 2QA5A 1XX6A 3GGPA 3FPGA 4INPA 4WN9B 1R66A 2EJUA 3P7MA 1MO3A 3L07A 4U63A 2H08A 4KUGA 1O89A 1PD0A 1WNFA 1RZRA 4MUYA 1NLMA 1Y5MA 4WWOA 4FGWA 3QX3A 2GJSA 3O5AA 5ALXA 4R2XA 1Q20A 3GLHA 3UTDA 4Y1EA 2X0JA 4OQDA 2POCA 4URHA 4D0SA 1MB4A 4RS4A 2ZG6A 3C3KA 1XA0A 1WPGA 3KKLA 2QAJA 3QX8A 2LXLA 3PGVA 2Q7XA 2Q1SA 1R0CA 2NZXA 3DT8A 3RF7A 4EG1A 3KR0A 1R27A 1E79A 4NU0A 5IDYA 1BO6A 5THXA 3H4MA 5JISA 3PUHA 4YYEA 2GHTA 4DNXA 4B75A 3KR1A 2R44A 4QM6A 2G08A 3RASA 5D2MC 4DS3A 3GJ8A 3ENKA 1KXZA 1JHZA 4ZVMA 4A4DA 3WOVA 4CQMA 2VJOA 5EIBE 2XE4A 4EELA 1YUBA 1PE0A 1QQ5A 2AXPA 1Y8MA 2HRCA 3R3HA 4I3GA 1VKNA 2GBLC 4KSBA 5AVZA 4RE5A 1MH1A 1R0BA 2BR3A 1A1VA 3LX8A 4OQQA 1LBTA 1RDFA 4K2HA 3TDMA 3CEJA 4KITB 3WDSA 4IDPA 4DIKA 3PUXA 5LP6A 3LT4A 1O58A 4P54A 1JWBB 4K6CA 4KN6A 4KZPA 1I94B 4FFDA 4DJAA 1TKCA 3BWCA 4UDXX 1J8VA 4NBSA 3KTAB 4YJ2F 1GQ2A 2DC1A 3W3AH 1ZKDA 2DX7A 2IXGA 3LXUX 3OQHA 1CY0A 1UCFA 3OZEA 4W7HA 1PT6A 2YMMA 4YUVA 1OFGA 4JI7B 1HV8A 4Q19A 2V3VA 3BIWA 4JIMA 4EHLA 1NNEA 4N5IX 3Q75A 1JZTA 1KAOA 1QP8A 1V1JA 2QS9A 4HNQA 1JILA 5CEAA 3IJPA 2FG6C 1BDJA 1ZGCA 2B98A 4XVQA 3QLUC 4TKZA 3SNHA 1GV1A 2XUQA 4X60A 1NVBA 2HLNA 1NSFA 2BEVB 2QIOA 3E0QA 2RFMA 3EHRA 3N75A 2WSYB 2CVZA 2O2IA 3FWNA 2DE0X 1M8PA 3FUKA 1RXWA 1PRYA 1YZFA 1XRNA 4Y3UA 5BSKA 4I6GA 5D0OD 5J63A 1ONOA 1RWPA 1TK9A 2XE6A 1XCGB 3DYBA 3FUUA 1KPSB 1LSSA 3LUGA 2K7FA 1X7XB 2QBYA 4U9HS 1O8BA 2Y67A 3EAFA 3PPYA 4NBNA 3WYFA 1EFVB 1GXSB 1C1XA 1EDZA 1I7LA 3K1ZA 4OM7A 4HUQB 5DNEA 5JSKA 3U7RA 4AI6A 5DK6A 4JHJA 1A3CA 5IM4F 1GTRA 4J07A 3G2NA 1B6GA 3G2PA 2QOEA 1BD3A 2C58A 3R24A 3S1AA 2ILTA 1DPGA 3ZOZA 1EPUA 1QOQB 4G5OA 2BGIA 1COWD 1N3YA 2I65A 2I9PA 1KDVA 4ASUA 2XENA 2WUFA 2FWPA 3Q2KA 4ZZ0A 5B7PA 1I2BA 1N1DA 1L6IA 2J4DA 1L7XA 1VCOA 4GXRA 4LNUD 2VAVA 2OYSA 3H9BA 2A5DA 3BDAA 4A2WA 4DAOA 1U1CA 4FOOA 2RGXA 2EBUA 3WMEA 4KR7A 4ZDJA 1BPOA 2PL3A 3TCKA 4B3GA 3FH7A 1CC1S 3CN7A 1P29A 2BFEB 3FPLA 3M9LA 5F1OA 2R02A 3AFIA 3LUDA 1NRWA 5AW0A 1YS9A 5LBUA 4E6EA 1Z45A 3GVHA 5K3OA 4X94A 3JZAA 4TXMA 3SM3A 4L5YA 2XPZA 2H8GA 3R7AA 4E85A 1U3UA 3ABIA 4F8YA 1E0SA 4WZBA 1MG5A 1H8HA 5E2AA 1Y3AA 1YMPA 5DIZA 1S63A 2IYEA 2RSLA 4TYMA 4CQLA 2GPYA 5KB3A 2O8DB 4ZIRA 4RHFA 1XZNA 1NQWA 1H1DA 4TKVA 2C5GA 1EG7A 4LRYA 3RK1A 1PWYE 4N03A 4NYMQ 4KNVA 4CKWA 3NBNB 1GL3A 2IQ5A 4M46A 2Q29A 4YYZA 4AN0A 3A25A 4HR7A 3VR4H 3D0OA 3I45A 1RRKA 1WZEA 1HEYA 2GZRA 4NF2A 4WZAE 1VG8A 2RMKA 4EYKA 5GTDA 1T3GA 3CVPA 1FLNA 1N25A 3AJ9A 5EG5A 1H2HA 4CT4A 4OQEA 3IP7A 5TGZA 4GECA 3A3NA 1D8EA 4WNEA 1D2EA 4BESA 1XDBA 1QHEA 2MDTA 2B6HA 2N1MA 3LKBA 4R9SA 4GMGA 2VRCD 3VZBA 1AD2A 1E7SA 1YCDA 5GY7A 5JH7F 5KQRA 3KETA 4JD5A 4QDOA 2C29D 4ESHA 4N39A 5E4YA 2JLUA 4PG6A 2FPUA 1T9ZA 1L7EA 1CUSA 4U6SA 4BQFA 4RD4A 4AZ3B 1X1SA 3C3YA 2QBYB 3QUBA 3MT7A 4DCCA 4Q9AA 4L6AA 3S7TA 5EKTA 2I2WA 4ROTA 5C2JB 4FU3A 4MGZR 2VT3A 2Q3CA 4OYLA 3ZJ5A 3LTNC 2HD4A 4N0EA 1NBMD 1AZSC 2R1TB 4YACA 3V1UA 5K3DA 1A9XA 4CXMA 1ZJ4A 2PUEA 1W3BA 1SRRA 4IZIA 2XZLA 3I1YA 3ZE7A 1GKKA 1KAEA 4CEIA 3KJGA 3U4CA 3S7BA 1Z74A 2YZKA 4HOSA 4YJGB 3SJBA 4M89A 1H4TA 1KNXA 1MJNA 2YZMA 4PWZA 3EQ9A 2BTQB 3EIQC 1MEOA 2C3OA 3PV0A 5CLGA 2PH1A 1LGYA 5EJ4A 4AKHA 1LFDB 3EB9A 3GWGA 3KJQA 1C2YA 1LPMA 2AEJA 3OMLA 2X5TA 2E49A 4WT7A 1NBAA 3OIFA 4YRJA 4DR1B 2Z6UA 1M74A 2X4IA 2HMTA 1KK2A 2W2MA 4ZZ1A 1KH3A 1U1GA 3G9ZA 1YU9A 1H2VC 3HBNA 4Q5IA 3HKEA 3VNUA 2XUJA 3GEGA 1XDUA 4UHCA 1S8AA 3TD2A 5DKFA 3ROPA 3V4SA 1MG0A 3HYRA 3PNPA 3SICE 5TVGA 4L4RA 1RTKA 3Q0EA 4TUYA 3VX4A 2OVFA 3T9DA 2ZUUA 4B8ZA 4DBLC 4NCNA 3RS5A 4E09A 1RPJA 4ED9A 5F98A 1G5HA 4ND8B 3WL8A 1RM0A 3KUXA 4F85A 4K5BA 2DQKA 2F3UA 4QLOA 3ZEIA 1R6TA 3GNSA 3W3AD 3HYTA 4Y6GB 4CQMD 4K5AB 1DKPA 3GEMA 4HT3B 4B35A 2JFHA 3IRUA 4RESA 4WSOA 5GWXA 3SHFA 4TKMA 4MI9A 3PUVA 2PZMA 2VEOA 3HJAA 3QF4B 5LQCA 3VJKA 1UBJS 3H2YA 3MOSA 5FPHA 1YT5A 2IPAB 1JBQA 2YHIB 4WOJA 1FNNA 4JLAA 1SFRA 3Q72A 1EQUA 5L6MB 3ZVNA 2IYYA 4EHJA 3LUFA 3NTLA 5D1HA 4FFRA 1H19A 3IBTA 1RAGA 1E9SA 4C5CA 1BHO1 3KZMA 5FTKA 5KJMA 1F38A 3C14C 1Y1KE 2L6JA 4MI6A 3EU5A 1S2OA 2QQGA 5BW4A 1MJFA 5TY0A 1VJ1A 3O4GA 2R6DA 3L02A 5KWDA 3NV9A 4JNCA 4OQ4A 4KAJA 2PL9A 3O2JA 1P4RA 1HX7A 2LR0A 4ZYXA 4RVGA 3MSXA 1DEXA 1M8GA 4F8EA 3I6IA 2ECPA 2CDNA 3KKNA 1EF1C 1JR3E 2PH5A 3QPUA 4O4IA 4PX2A 4TMWA 2DBVO 3U2QA 5A23A 5JMOA 1GARA 4N47A 3L6UA 3RVLA 3RYHB 5HE9A 3U56A 3FZQA 5I45A 4PR0A 1WQ4A 1HQYE 2NW6A 1KZ1A 2OZEA 1D4ZA 4Q9JA 2BEKA 4JX8A 3Q98A 1RBYA 3Q87B 4QXRA 1GRRA 3EVNA 5ENPD 2O3JA 3ED1A 5G55A 1AO3A 3B9QA 3OUZA 2A9OA 3RE1A 3UJ9A 5BR4A 2CUKA 4HLLA 5CCMA 3IBGA 3LD9A 5CB0A 1KJNA 2EFCB 2P9EA 5F1KA 2DERA 4H6WA 5ILGA 3DE1X 1CETA 2VYVD 4WBSA 2YW9A 5CDSA 2EC5A 3H2GA 1Z6AA 3ANLA 4C3UA 4U3JB 1TF7A 4QYIB 3T0GA 4DLYA 4F2PA 1ZSYA 1L5OA 1EFHA 2OZKA 3BJZA 4EHFA 4AZ3A 4HC4A 2HSGA 2HUNA 1XAGA 4R1PA 2D1RA 4KMOA 2PVSA 1C3OA 2MSLA 1QYVA 5HM6A 3TGPA 2W0SA 1IY8A 5FDFA 1SUIA 4HDCA 4ZOLA 2V4LA 1KHTA 1RADA 1YDHA 3CGHA 2F7SA 3ST7A 4ZCTA 2QQ5A 1G55A 2JGNA 2QAIA 3MNFA 2EIXA 5DTRA 1JEEA 3O47A 3REGA 2IS6A 2VDNB 3P26A 2P6RA 3WL4A 2CJYA 1AQIA 2GN6A 2DHCA 1SC6A 2HQ1A 2WHPA 2VPTA 1CNEA 3K94A 5FO0A 1A8IA 4C0LA 4QHTA 5A0VA 4FFOA 5AJLA 1FFGA 1ZGHA 2W6QA 4KKVA 2HMWA 2WILA 4HDRA 4QLAA 4C4SA 3RNOA 2Q8QA 3OQIA 2RB4A 3CLKA 3MJFA 4QBFA 4G85A 3TXAA 3W0LB 5A6VA 3DZCA 4YIHA 5K8UA 4CEHA 3GQBB 4JXZA 1SM4A 2BPOA 4G0OA 4HXYA 3DEJA 4DQXA 3F6YA 4XWTA 4UWLA 1Y3CE 2GDZA 3B5IA 3SBDA 4ZEVA 4MQ5A 3EAQA 3F4LA 4QE3A 3BT3A 2WINI 4L0MA 1KI6B 2E2EA 1SBCA 3D6MA 1W85A 4UTXA 2WF5A 1ADCA 4Y2JA 2AQIA 4X6LA 2YVQA 2VG8A 4ABYA 1BCRB 1OW3B 2OHOA 3UKJA 1A77A 1N6HA 5JG7A 4WA8A 2OXTA 4QNNA 5CAEB 3PFKA 1MJ5A 1W2WB 3UT5B 2WTUA 5BSGA 2VYIA 1QVRA 1UBTS 2DWCA 3HA2A 1A4UA 4HQ6A 1E9DA 4WZ6A 2AXEA 5ALDA 3GLGE 4DEYA 4UM8B 4UI9C 3AI1A 3IVRA 2KZTB 3M6XA 4LF5B 2ZUFA 1R0SA 1S8NA 3S6JA 2JD2A 4MWGA 4D79A 1PY1A 5JTUA 5CFQA 5L51A 2NSJA 3EXEA 4IN3B 3VLEA 2Q5OA 1JMYA 1II0A 1RWKA 1VOTA 3NAMA 4REMA 3WA6A 3IKTA 3PQ5A 2VSFA 4AZWA 3SDSA 1IXRC 2LCQA 3AUYA 4EZKA 3W2GA 4NNPA 1Q1BA 4A5SA 1M9NA 1GIAA 3OUUA 3O7WA 4FNAA 4LSMA 2JRCA 3FWPA 9ABPA 3F6PA 4M9XA 5LR6A 4U8YD 3TTTA 4B0OA 4EZIA 5COAA 1I8TA 5MN6A 2QNIA 4OHMA 2Z2JA 3QAQA 2BVNA 3LBYA 2UUAB 3DOIA 2GTIA 4OAUC 3DZJA 4UUQA 4HVAA 1VRVA 4FB4A 1Z56C 4EKEA 3O73A 5AKGA 3N8NA 2H0RA 2OZPA 1J56A 2R8PA 3JVEA 4D43A 3UH0A 2HDNB 3N2EA 1WPRA 4E2YA 3L1JA 2RKWA 2EKZA 2Y92A 3X3HA 1PW7A 4CF7A 3RAJA 3X1KA 2UAGA 2GFHA 3ZYZA 2CZQA 4IKPA 1HLGA 3DMGA 4CM8B 4HAXA 2ZPTX 4A3TA 2VZ0A 4MRMA 3SY2A 3PJGA 4P4NA 4NH4A 1DZ3A 4DIFA 4X1IA 4WERA 4KLAA 1ZMRA 1K1EA 2VK1A 4BMCA 1V7PC 3SDZA 4Q9HA 3MCAA 1XPOA 1N8KA 3AL2A 3P0FA 2HEIA 1JPNA 1KQPA 2PIAA 1KQNA 2V1UA 2FSHA 3F1LA 4NCKA 1ZN8A 4I1AA 4MW5A 3BM5A 4NFSA 5DN9A 1T8PA 3B60A 2P2DA 3EZGA 3QPDA 4ZP1A 1RPNA 2VJMA 3AVYA 1OHHA 3CWCA 1UQTA 2C3YA 1GPDG 3IEKA 3OIYA 1Y5RA 1TTQB 1C7IA 3F6CA 1N1MA 1Y9EA 1M73E 3TG4A 1M66A 1HRDA 1Q84A 3GF4A 3JALB 3Q8WA 4GH5A 4H0NA 4XOUA 1O96B 4FXOA 1XTVA 2H1IA 3CLSC 1CKEA 1E9FA 1M34B 4GCNA 2WYUA 4RMGA 5E6RB 3D0KA 1OPRA 2Y9MB 4BNFA 1N2EA 1KDRA 2ISQA 4KPGA 2P65A 3EYWA 3AUTA 3EXG2 3KXPA 1CUXA 1QNLA 2WFMA 5DGIA 3VSBA 2OD9A 1HX8A 4BSZB 3IUPA 2I7TA 3ELWA 3HFSA 5JO9A 2JIOA 1QQBA 1XMIA 2QI9F 3TQIA 2ZBRA 5B57C 1QP4A 5SZIA 4K9RA 3NT4A 2I2AA 4DCVA 5BWOA 4RFVA 5KVCA 2QD4A 3BZUA 2VWQA 4UZFA 2UVPB 3A28A 2AJBA 3D0QA 4YJ3B 1IZ0A 1KI6A 2H2IA 5FBKA 4W5QA 4HWKA 3SIRA 3OZAA 3IKJA 3KL2A 3A9WA 5BT9A 1Y9ZA 1L7QA 1XEXB 1FFXB 2PSFA 2WYHA 4B4VA 1XDWA 1YI0A 3W7VA 3CB2A 1ULHA 4C48B 4V0OA 3R3VA 4DM7A 4RIEA 1E96B 1N0VC 1QF7A 5KJNA 5AKZA 3UT5A 2W8BA 5J5AA 4HRLA 1WQ3A 5ITZA 3PFFA 1T34A 4NDZA 9LDBA 1XVIA 2PZAA 4G8JA 1ZGBA 2IF0A 4PC3A 1OLXA 4JPSA 2EFHB 3V2UA 1D9SA 2H6IA 1RYMA 1CVRA 4BLPA 3GRZA 5CXSA 1JG6A 4MVWA 3DMTA 5BP7A 1QV6A 3IP3A 1H0RA 2Q1XA 1G8MA 1YZQA 1LLUA 1TW2A 3QMPA 1G18A 4DYHA 5A1TA 2XUHA 4GGMX 2JFQA 1YR1A 4I6EA 3RS3A 1XC7A 2TMKA 1TM4E 3S4YA 2DRIA 1WAO1 2BGUA 3WIBA 3VKVA 2G40A 2F3RA 3AG3E 2C1EA 3RJ5A 1ZA1A 2XQ0A 4ND2A 4A1SA 1P2VA 2ZRJA 4FWBA 4O3MA 3PTLA 2XEXA 2RGEA 4K03A 4Q4JA 1CY4A 7ABPA 4QXQA 4PWYA 1EWYA 4R69A 4LJKA 5FUMA 3T5BA 4LYYA 4MKZA 3AP3A 2FOLA 2I2FA 4DV3B 3AC0A 5B1SA 2DFPA 4MX8A 1WCXA 4EJMA 3ZWMA 5K0ZA 3H9EO 4EHMA 1O0SA 2J30A 2IVFA 2SKEA 5FIOA 2W7TA 3TVTA 1MZPA 3VA7A 1M8KA 5EE0A 4F3TA 2CMGA 4L5AA 4M9SA 4WKCA 3CLVA 4YRBA 4OD0A 2ZIGA 1XN1A 3SGLA 2HSEA 2GD6A 4H4DA 3IHVA 5JASA 1PKXA 4RTPA 4QOFA 5FULA 3E3OA 2HHJA 3WNZA 3JQCA 4MW7A 2FRDA 1MRNA 1T2EA 3OJWA 1GZVA 2CFTA 4FLEA 4JNKA 2ZWVA 1RVDA 2C98A 4W8GA 1G16A 2D5BA 2D74A 3EC7A 3KL4A 3GOQA 2OFPA 3VUEA 2ETCA 4IEIA 4BJ1A 4F96A 4HVLA 4RTNA 1XU4A 2FZGA 4OTZA 2MYNA 4Y0VA 2ETXA 2O3RA 5EHIA 1IQ0A 4DCNA 5IC6A 4JLSA 3L4BC 4AMZA 1WV1A 4ZOCA 3ZU6A 5EOVA 3VZDA 2BUGA 1SXJD 1SKUA 3QY0A 4X8MA 3KB1A 2JH3A 1RQNA 1HRKA 2FUKA 2H0QA 4NYJR 5EWJA 2ACEA 3PXGA 4CTJA 4QTUB 1OY1A 4BN0A 1FYEA 1RLIA 2QJFA 4YQZA 2J9YB 2C5AA 3EZ2A 4C22A 3GW4A 3N05A 2IIPA 4YDHB 3IMFA 4C5AA 4ERNA 1LVUA 4OXYA 2VUTA 1N7JA 2YY6A 3P8ZA 7MDHA 1IIBA 2CLEB 4G2VA 2H1FA 3IP8A 3KZOA 2W5UA 2VUIB 1OLSB 5CYOA 4D8TA 2BI8A 3YASA 3LBIA 2IJGX 3OWXA 3UMCA 2NZ2A 2AC4A 2Z30A 3AEUA 4Z8YA 3M33A 5ALNA 3TW0A 1LDMA 1HT3A 2PV7A 2YHCA 3GDWA 2VI5A 1H2EA 3OCUA 3Q3JB 1SHUX 3MERA 1QDLB 3CWZA 3NANA 4Y1RB 4EK9A 3FOFC 4AF8A 1OGIA 4YP9A 1GZ3A 3Q3IA 2OBMA 1X13A 1FFHA 3E3NA 4XGRA 3RLFA 2H6FA 2IYNA 4BQOA 4NACA 3MXTA 5C7IO 3GLTA 3DTVA 4RQTA 3CF2A 3CLTC 4KQMA 1IUKA 5KJ1A 1FNMA 4PZPA 3VPCA 4BVGA 2LUOA 3ZIMA 1YA4A 1QRSA 3OKFA 1LPNA 4GMKA 3CBGA 4KQGA 5KX5F 3EA5A 2R65A 1N9KA 2BE7A 4KLRA 2G3YA 1ORDA 1PFGA 1EFPB 1BCSA 1NG1A 1RQLA 2GH1A 2KHZA 1A95A 2DAPA 2P2NA 1R8SA 2ZWAA 3BA6A 3IHKA 3PKZA 4TTVA 4WLUA 3F6EX 3TFWA 4NYIQ 2GM9A 4U6NA 4JHRA 3HN7A 3ZQ6A 5C7OO 1A9TA 1Y80A 2W93A 1K4YA 4NZYA 1DCQA 2QLMA 2YXBA 2B3TA 5HRUA 3ADBA 4A91A 1CLEA 1PLKA 1KI9A 2FOXA 1NJFA 2ZDQA 4MEJA 5FOUA 5LQUA 1AG9A 2FVYA 3AFOA 3SE0A 3U19A 4CKBB 2PU7A 4LBVA 3E35A 2A9FA 3C6KA 1G9TA 5FFFA 4EW6A 5JEEA 5JCPA 2PE5A 4FDLA 3CX6A 2GHRA 1OXUA 5CA0B 3RADC 1C3JA 2J7PD 1JSRA 5DX1A 2UUPA 4BVKA 5ER6A 3UF0A 3HRIA 3WYCA 2PBRA 4E15A 5ITWA 4IG9A 2EG5A 4BLRA 3ONKA 4JA0A 3NDBB 3U1VA 3NOGD 3LC0A 3V30A 1A9PA 1C4XA 2QRVB 2ZBPA 4FC8A 3WLFA 1C9MA 6REQA 1L5LA 4YECA 1EDDA 5HS4A 1GPWB 3BQNB 2A0WA 3G2UA 4DCMA 1PYDA 3C7CB 2Z98A 5I9MA 1VE1A 1J42A 1ZSNA 1E8MA 2GWHA 3GWZA 3OSZA 4CM1A 4EB0A 1Q3HA 3AU9A 4CL8A 2B9EA 5ALTA 1WU7A 1XV5A 3IXEA 1E7VA 2OBXA 2QM0A 3BSYA 3R8CA 2WNHA 3H9JA 4C07A 1V9CA 1VLVA 4U39A 3O0DA 4IICA 1B43A 2NYRA 1G19A 5AKLA 3V8PA 4BN5A 4DYVA 1TF2A 3SJAA 2O8FB 4IQ4A 1JJFA 4C03A 5BWMA 1BQ3A 5U4QA 1D1PA 1P5ZB 3LECA 4Q1EA 1KI1A 3KHKA 1EK2A 1F06A 4TS9A 4CTKA 4POOA 1PN3A 5DM0A 1D04A 2H1HA 2HLDD 4I9FA 1JLSA 4ZQIA 1UJKA 3EWSA 3ML1A 5ECDA 3OBIA 2BM9A 3MQ2A 3MEKA 1WJGA 4GZLA 4YO7A 5TT1A 3KYCB 3SMVA 3TLEA 3FPCA 2HJRA 2OWDA 1KK1A 2NX2A 2ZM5A 2QTHA 4U04A 3VPBA 3ZHBA 1HDXA 2KBFA 4NYJQ 4R3UC 4KHZA 1SUAA 1KOJA 3KLOA 1THMA 2XZDA 4HNAB 1SQFA 1Z22A 1GCGA 2Y77A 4YRPA 3A6ZA 5C37A 5J1SB 5LYJB 3OI7A 1SY7A 4P4LA 3NNNA 4BE7B 1UT5A 2JDIA 2WAXA 3LY8A 1914A 2I6XA 4B89A 3UKOA 1NBOA 2CLDX 3NBFA 3PKIA 2SNIE 2PZBA 2VDVE 3FP3A 1Z4OA 3MCWA 1EXMA 5TF4A 3FHEA 1VB3A 1E7QA 3NX4A 3OM8A 5AXBA 2OCAA 2XT0A 2I71A 3Q15C 4R2JA 3DBLA 2H6GA 5JLAA 4J7WA 3HJGA 4GNRA 2C5SA 4ZI7F 3ZU3A 2NZ8A 4TKUA 1KS9A 1HR0B 2VOEA 5K03A 1F0YA 2ZXEA 1V5EA 2P9JA 3OICA 2PSEA 4WLFA 3JWJA 4FUTA 5EEGA 2QSZA 3APDA 3BAZA 4KJXA 3F9RA 2EIHA 4XB2A 1NNLA 3PRHA 2QMOA 4GYWA 1NMYA 1RAIA 3O4JA 2GPTA 2OCGA 3EQ8A 4IF4A 5DYWA 2LKDA 3MKQA 2LIPA 3IOMA 1LLCA 1JIKA 5G4KB 5K3FA 1P7PA 3V4ZA 3W1VA 2GEFA 2ICAA 4RNDB 3RSLA 3HE3A 2P58C 3DF7A 1I0LA 5BMVB 1GYPA 2QW1A 2PR2A 2FVXA 3F47A 4KDEA 4QYXA 5DXFA 1F14A 4R1UA 4L0QA 4G41A 4C0BA 4IJVA 4KVAA 3UWPA 3HXCA 2GUWA 3W9BA 4AYWA 3H1PA 3PX7A 4D9BA 3NEAA 5FEMA 2YQ8A 1YTUA 2P62A 2WU3A 4ACKA 1ENYA 1RYNA 1ZJ5A 2W6MA 1GLVA 3A8TA 3GT7A 4GPAA 4RHYA 2R2LA 1LEHA 1VPTA 3V1LA 5DIFA 2OHIA 3TS1A 4EO9A 5JE8A 4YP7A 3W5IA 1JHYA 3MAGA 2WPDA 4N4AA 5F5NA 3KAQA 4DLSA 3QQPA 3ANMA 4KGXA 4UE2A 1T8WA 3OQBA 5TB5A 2DXIA 2XEEA 3SVLA 5EN4A 2WXNA 3CX4A 3MFYA 3RYCB 3ZD8A 4Q94A 4R2KA 3FD8A 3QJYA 3BWYA 1O5OA 5IASA 2BZSA 3AMVA 2V7QD 3R7BA 3WK5A 2J4CA 3EUVA 3R9WA 4KVMA 1GG8A 4JBNA 4QTXA 3TKYA 3RVNA 2X0IA 3N07A 1PNQA 4PNEA 4RQIA 5G02A 3UCEA 1G38A 1A8SA 2WF8A 3IAS6 3IUSA 2NU8B 4ON9A 3PT5A 3WNDA 2R6CA 4YRQA 5E7IA 2JGRA 4FFBA 4ZO6A 3FDFA 1JPJA 1L3CA 1T5SA 4P3NA 3WL3A 3ZW8A 3U31A 1H05A 1NM5A 4MB2A 3BMNA 2EINE 1XRLA 3H0EA 3QNMA 4UUOA 1QO9A 2ZT8A 3RK0A 4QDUA 1XQ9A 3AU8A 3JARB 3R9AB 4QAJA 1NWHA 1S2NA 4UZEA 2GN8A 3EXIA 4Z1MD 5ICFA 5DN6A 2JH8A 5HQ3B 1GLNA 1K8KG 3FY4A 3BHMA 3T9AA 1M2VB 2ONYA 1QZUA 2BFAA 1I1NA 5ALRA 5A3VA 1B00A 4HNUA 3ORYA 4RDHA 5EIAA 1ICEA 1PTJC 2O8DA 1P74A 3Q8MA 3ETLA 4XFKA 4GT1A 1B8OA 1VMEA 4HXEB 4MUMA 3CQGB 2F8XK 2WEKA 1OGYA 4B79A 4MIYA 1IOLA 2ZIXA 2ZVJA 2B6NA 2NNWB 3KJEA 1CNFA 3H2HA 2PWBA 4MS4A 2FQ1A 2ZU0C 1ZOLA 4EJ2A 2DMRA 2MYPA 4QWMA 1FTGA 2YXPX 1ZH0A 4HPWA 3RJMA 5HKLA 3ZYQA 3IB6A 1UK9A 4PR3A 4EVRA 4X44A 2C20A 5DM1A 4ZICA 1ZUIA 4IGAA 5G2NA 2VP3A 1O5TA 2P6UA 4KSCA 2V54A 3JQGB 1HTTA 3AKCA 2NVBA 4RA6A 3KSDO 2AXUA 3KYDB 5IBRA 2W2KB 4JT4A 1KMHA 3C6MA 1QPZA 5FLEX 2AR9A 2GK3A 2J9QA 1J25A 1LXCA 1XXLA 2RJ3A 3DW1X 4A92A 1CR1A 3EZ7A 3UY4A 2Q3DA 3LZCA 2LBPA 4Y30A 5JZOA 3DP9A 2ZS7A 3W78A 1FX0B 4LFCB 2ZJ1A 1LDEA 2JBWA 1RJ9B 3R6LA 1FRQA 2GNAA 3ASZA 4ITUA 4RSMA 3VO1A 3ZKAA 1PS8A 3PNOA 2IIBA 1WR8A 3QFCA 4QBKA 4BVAA 1BU8A 3AOEA 3G0IA 3UOAB 1G3IA 4I8DA 1Y1TA 1ZD4A 3AR9A 2XYPA 1EG2A 3GG2A 3E5RA 3HCBA 4K6KA 4RA9A 2TSYB 5CW1A 3NHWA 2SECE 4WBNA 4FJ2A 4WK2B 1HL7A 4QFVA 1PNRA 3WGYA 3CVVA 4JJGA 2IEBA 4DMGA 4X20A 1FYDA 1UL1X 3TOCA 3V00A 1DDIA 2NSHA 2VXYA 4A15A 2FPSA 1Y8QA 1CQWA 3AI3A 2OYCA 4D3ZA 2C7RA 3L77A 1SO8A 4RDXA 1VTKA 4KWEA 4UVDA 1ZJWA 3HKEB 3HK2A 3I2JA 4XM0A 3TB4A 3L82A 1X3SA 5ENOD 3TEFA 4JJ6A 3OJXA 3RPEA 3P2OA 1A9OA 1ECFA 3U4IA 4QEZA 1GZUA 3NTQA 4LHWA 4YUZA 9ATCA 2BC9A 1UXJA 2QPAA 3MTGA 5TGTA 4YDEA 5HKPA 3INTA 4UYKB 1U8TA 1XHLA 3CR3C 5DVZA 3D8BA 1L1RA 1QWOA 3CM0A 2BZ1A 3ZU5A 4B3FX 3PRJA 2JANA 5IXSA 3KOMA 3L46A 1UWCA 4BETA 1GPNA 1Z68A 2DUMA 4TMXA 5HF9A 1Q22A 1QHXA 3C41J 3HBAA 4A0SA 1LPAB 1W35A 4B6SA 4ENTA 1B42A 4KR0A 3RS2A 2QSUA 3PC3A 1L9KA 3E58A 2XEHA 3WJAA 2H1LA 2QLJA 3F74A 4KPUA 4UD6A 5EA2A 1E92A 1ZYUA 1JUDA 4AUNA 3CFYA 4I1PA 3VAZA 3C1AA 3H11A 3NV7A 2OK8A 1N34B 1WXEA 2JRLA 2H9YA 1WXQA 2R7MA 3IV9A 2O3TA 4BX2A 2HK6A 4M60A 2QRUA 3MVEA 4S12A 4D0GA 1AQJA 2X1HA 3OIVA 4UMDA 3I83A 1JPUA 5AW7A 1SUFA 1QBQA 3KSQA 4BWYA 4DM4A 4E33A 3HBJA 4NG4A 2ZTUA 4CG1A 2GN4A 1QIGA 5I4CA 3WZ2A 3UIEA 3HY3A 1JCRA 1IOZA 4L8LA 4B7XA 4PAQA 4TL7A 5J2UB 3W04A 4HOUA 4MW6A 3Q9NC 3MGCA 1B8UA 3GUUA 3HVJA 2HQRA 4Q4DA 4B0PA 3UBMA 1B2RA 2CHUA 1Z37A 3FCOA 4KWHA 2C4KA 4AMGA 3V55A 2B82A 1X1AA 2H11A 2V55B 3LYAA 2QD1A 4TLEA 5THKA 2WSLA 4KTTE 4YWHA 3SEQA 4QL3A 2AQHA 4MRAA 5CRVA 5CNKA 2UZ0A 1OBFO 2Q62A 3PJDA 4BDTA 4I6JA 4CRWA 1T43A 3MGGA 4GA1A 2HF7A 2YL2A 5IAGA 2GR9A 4OHVA 3RBXA 3T3OA 1H5UA 5EJ5A 3RRBA 2DYRE 5CHEA 4C4OA 1FNBA 1N5OX 1Z17A 3AV3A 4L07A 3OKAA 4IIVA 4RNCA 2ODPA 3AK4A 2EIJE 3B1XA 2QAGC 3UICA 1GUFA 4M37A 1UIRA 3LNTA 2JGAA 1NZNA 2UDPA 2J0QA 1ELOA 3BCHA 1NW6A 1ITZA 1OFVA 2V9ZA 2XB6A 1VCNA 1JKJB 4BFVA 4DQLA 1Q7GA 5FR1A 2VGXA 1IN1A 3G2SA 1AXGA 1U4NA 1L4HA 5HIAA 3FDZA 4L7TA 1HG2A 2NZWA 2W6NA 3LLCA 4DUPA 3AUFA 2GFQA 2PRZA 4FZVA 2H8KA 3REOA 3GLGB 1KRWA 4WINA 2IBTA 1Q95A 1NM5C 1Z0IA 4YIKA 3RVPA 2P8SA 3PBKA 4NNJA 4Y2TA 3M83A 4HQLA 5BN5B 4BYMA 1TO1E 1XTRA 1K0UA 4L7VA 1E2DA 4C3OB 4L27A 4WBNB 4FSXA 4RK0A 2X3FA 1P5HA 3OTQA 4MO9A 2OILA 5FYQA 4OUKX 3MEQA 2HA0A 1OAOA 1FBTA 2PWYA 3ZHEA 1FP4B 2ANBA 5J1TB 5REQB 2B21A 2OG1A 3TRDA 4YJFB 5BUCA 1AM4D 4Y6PA 4HXIA 2JFXA 5C4GB 5KNCH 1C0PA 2PLAA 3O9VA 1GA4A 1PJ2A 1NUSA 2CXQA 2WIFA 3OAAA 4EA6A 1X7XA 1D2AA 1U8AA 3KPYA 1M2OA 1Z5WA 2JHFA 3G7SA 3OKPA 4QUBA 4UPDA 5I7VA 3VJRA 3MV2B 1DJOA 3LBFA 4NOLA 4YT5A 3AY6A 2JAOA 2XRMA 1TCVA 2FP4B 3E5HA