4CDRA

Human o-glcnac transferase in complex with a bisubstrate inhibitor, goblin1
Total Genus 268
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
268
sequence length
717
structure length
698
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANSFE
publication title Bisubstrate Udp-Peptide Conjugates as Human O-Glcnac Transferase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 268
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2013-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4cdrA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4cdrA01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4cdrA04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4cdrA05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cdrA03
4AY5A 1Z62A 4AMGA 3LCAA 3T3EA 4CGWA 3NF1A 1Y6GA 2X6RA 2XCCA 4MICA 2QLNA 3IAAA 2XCBA 2DBAA 4GPBA 3BD8A 2OFFA 4EL0A 2JZCA 5G04J 1SXQA 1VGVA 1UZUA 4QLBA 3CV3A 5ENZA 4YVQC 1HZ4A 5BT1A 1ELWA 4BQIA 4ME2A 4WNDA 3VTXA 1JIXA 2X0EA 2FI7A 4GA1A 5BW8C 3O48A 5JTTA 4UI9C 2QN1A 4CGVA 2G9VA 3ASFA 3LY7A 2F3UA 3D0QA 3MV2B 1RZUA 5ARGA 4Z5XA 4CTNA 2ZB2A 4Y6CA 2VQ2A 4GPKA 4GZ6A 1XL1A 1JG7A 1IIRA 2ASVA 4J8EA 1KLXA 1C3JA 3OXGA 3Q3EA 1WUYA 4GA0A 1NVKA 5KJKA 3QWVA 3ASHA 4GYYA 1GPAA 1YA0A 2C4MA 2ACVA 2BFWA 3NP9A 4RIIA 4G25A 2BGTA 2GPNA 2XEVA 3CUUA 4F9FA 3FP3A 4F97A 3FWVA 2XMPA 2IV3A 4WHMA 1BX3A 4HLNA 1SXPA 2E2EA 2XGSA 4I1AA 1FA9A 5GPBA 4GZ5A 3CVQA 1HXIA 4H7YA 3G2KA 1HH8A 4CTMA 1WAO1 2FO7A 1NOIA 3GPBA 1GFZA 2KCVA 1XKXA 5IKOA 4U0SA 1WV1A 3MTDA 4EL5A 3OKAA 1K08A 5ARFA 3L7CA 2QNBA 3H4TA 2IYAA 3BDAA 3U4TA 3MTBA 4CTOA 4A1SA 2PQ6A 1UQUA 4NQ0A 3ZCPA 1L7XA 4MRAA 1YA6A 3T5TA 2X0FA 1P5QA 3QWPA 3U3WA 4Y6WA 2HYZA 2AW3A 1L5SA 3ZPJA 2KCLA 4RIHA 3L7DA 1W3BA 1NOKA 2PRJA 1GGNA 3KS2A 1LWOA 2XGMA 3PDNA 4HOSA 3NP7A 1XC7A 4MI6A 5AYWD 3MKRA 3S29A 4XI9A 5FZQA 3QDNA 2FFRA 3S2UA 1XNFA 5JTUA 3ZCTA 4HOTA 1L5QA 2ACWA 4LDPA 1Y6FA 3HBNA 5EX0A 1XL0A 2QLMA 2WTXA 3G2LA 4F3VA 3RT1A 3WC4A 4UQXA 2QRGA 2SKCA 1XOIA 2QN2A 1GG8A 4GZ3A 3OTGA 3T3DA 1YGPA 2FBNA 5G05C 3C4QA 3CUYA 2G9UA 4JA9A 3TSAA 4MI9A 3COPA 4U0ZA 2GJ4A 3CV0A 2O6LA 1FU7A 1IHGA 1L5RA 4UI9J 1Z8DA 3RO3A 3AS4A 3HBMA 3OXLA 4J8FA 2BGUA 3Q49B 4APOA 3ZFWA 4WACA 4G24A 2F9FA 1OUVA 5JJ6A 2XCUA 4I2ZA 3MT9A 2FF5A 2C2LA 4WUYA 3ZGQA 1NLMA 2PYIA 5DLDA 3VUFA 4J0UA 4AIFA 2Y4UA 2KC7A 4B94A 2IUYA 3ZHEA 3RIBA 2QRMA 4JL0A 4F96A 2LSUA 2VCEA 4U07A 4JHRA 4N2QA 4N2SA 3MBOA 1PSWA 3T3GA 3ZCRA 1FTYA 3CK7A 2WQHA 3MT7A 3UQ3A 4N9WA 1NZDA 1Y8ZA 3PE4A 5DU2A 4O6FA 3CVLA 1FTWA 5JJTA 4N3CA 2F3SA 2X6QA 3BEOA 4RIFA 4GYWA 4YVOA 4X7RA 1TJCA 1P4HA 2QN9A 3E4BA 3D1JA 3E3NA 4FZRA 4YI3A 3ASGA 1L5WA 3C48A 1AXRA 1K06A 4N3AA 2ONDA 3QWWA 1E96B 4MI3A 3CUVA 3CUWA 4RBNA 4RIGA 2PRIA 1P4JA 3OT5A 1LWNA 5TMEA 4BFCA 2ATIA 2QN8A 4KQ1A 1WUTA 3S7BA 1JIUA 3FROA 3BEEA 4UQYA 1ELRA 4RIEA 3ESKA 4RG9A 1P2GA 3MS4A 2QRQA 3Q4AB 1NA3A 1EM6A 3CKCA 3GZ1A 1NZFA 1C50A 3NB0A 4NEQA 3AS8A 4XI0A 3S7JA 5D0QD 3EBPA 2PQNA 4G2VA 1QM5A 2P6PA 4FKZA 4MHOA 2VGXB 3S7DA 3S27A 3QHPA 1V4VA 1IYGA 3BCRA 1QZ2A 3S7FA 3E3LA 3MQFA 3RO2A 3LKUA 3LPZA 5G05J 3R9AB 3CVNA 3IA7A 5M72A 5A7DB 5G04C 2H1FA 2VGXA 4BQFA 3N71A 4GCNA 4YNDA 3CEHA 3AS5A 6GPBA 3RHZA 1ABBA 2IV7A 2QFCA 3S0JA 4ABNA 3L7AA 4KQ2A 3FFLA 4RENA 2Q6VA 3UPVA 3K9IA 2FETA 2FEZA 2R5SA 5TMBA 1P29A 3MS7A 1F0KA 3OKPA 1ZU2A 4BT8A 3DDWA 1JEJA 3UYLA 4I9EA 3ZCQA 2R60A 2MHKA 2XGOA 4XIFA 3CEJA 3RSCA 4G2TA 3TG4A 2GT1A 2VG8A 3TGOA 2R68A 3RKVA 2XA9A 7GPBA 3Q47B 2NC9A 1P2DA 3LYAA 5HXAA 4M7PA 3VUEA 4HORA 2C0LA 2HR2A 2V5FA 2BISA 3OY2A 3HYMB 2IF4A 3ZCSA 1FS4A 1L5VA 2G9QA 3QOUA 5FT9A 2R4TA 4W6QA 3MA5A 3TG5A 3DDSA 1FTQA 3G2IA 4G26A 1QQEA 4REMA 3SZ7A 1B4DA 4M83A 1E1YA 1WW2A 2C1XA 2GPBA 3QKYA 3L7BA 4LEIA 4X7MA 2AV6A 4KXKB 2ECPA 3ZHEB 1QKJA 2GPAA 3CVPA 1PN3A 3PE3A 1KTIA 2GM9A 5LCWC 2R66A 2P58C 8GPBA 1JIVA 1B89A 3UYKA 2Y4TA 4UQZA 2QRHA 2IFUA 3NAZA 4I17A 4EKYA 3L01A 5FZRA 1Y8MA 2GW1A 4I2WA 2IEIA 3ASDA 2C0MA 1KT1A 4N5CA 1PNVA 2AZDA 5D0OD 2C9ZA 4X6LA 5CCLA 1JG6A 4NESA 3Q5MA 2QLLA 2PL2A 4H7XA 4WNEA 3D0RA 3BD7A 2XCIA 4W9RA 3H4IA 3AMVA 2IYFA 2F3QA 3G2JA 3RJVA 5EX3A 2VSYA 3WAGA 2KCKA 5KJLA 1EXVA 4X7PA 3CX4A 3BCSA 5FZSA 4BT9A 1RRVA 2XA1A 4EQFA 1FU8A 3DD1A 4CDRA 3MRTA 1GPBA 2PQRA 1H5UA 2H1HA 2KS6A 1ZBPA 4HOQA 4GCOA 2FF4A 3SYMA 4EJ2A 3CK9A 1A8IA 1IXYA 3EBOA 2BUGA 2LNIA 5DXFA 2YHCA 1O6CA 2QZSA 3VDNB 2HY7A 1E4OA 3T3IA 3IEGA 3WADA 5DIZA 2IW1A 3L79A 2C1ZA 4NC9A 1NOJA 2IEGA 5TMDA 3UUXA 5A6CA 4AM9A 1WM5A 3LY9A 4JA7A 5HI7A 1Z6QA 2JLBA 4KYOB 3TAXA 3O3CA 1FCHA 3MEKA 3RU0A 1F6DA 4G23A 3CK8A 4KBQA 1WW3A 2SKDA 3MRXA 4PQGA 4HOUA 3SF4A 4L22A 3MTAA 3NPAA 3ZCVA 5TVGA 4NRHB 3BCUA 2I6HA 3ULQA 5I45A 4BQEA 4HWGA 1AHPA 2Q7FA 2QN7A 3BD6A 4AY6A 1RZVA 4BTAA 2AVPA 3KAEA 3CEQA 5CCMA 2WPVA 3T3HA 1KT0A 3RSZA 2AMVA 4N39A 3G2NA 3C4VA 3OTIA 2UY1B 4WADA 4GA2A 3VTYA 5BNWA 5LCWJ 3E3OA 5D01A 5DBKA 1FC0A 3HBFA 5EKQD 3CEMA 3DZCA 4MHSA 3GYZA 2R4UA 5D00A 2VCHA 1C8LA 3TOVA 2LSVA 4J8DA 3Q15A 1PYGA 3ZCUA 2VYIA 2G9RA 1Z6PA 4IN3B 2UY1A 4UI9K 4LEUA 3OXFA 5JJ7A 3GZ2A 3MS2A 1P4GA 4RG6A 1NZNA 3URZA 4WNFA 4N3BA 1HLFA 3Q3IA 9GPBA 4AMBA 3QKWA 4KQMA 3SYRA 2UWJG 5CHEE 3NC4A 1UQTA 2XA2A 3T7DA 4BTBA 4G1TA 2PYDA 1WV0A 4U04A 1PC2A 4YI5A 2XPIA 4YUAA 3GW4A 1GZ5A 2QN3A 1XV5A 2OOEA 5HQ8A 3CUTA 2J9QA 5KJMA 3OKCA 3KD7A 2X0DA 3S28A 3OY7A 2VSNA 3MV3B 2VGYA 2GEKA 4GYOA 4BWRA 3MRVA 4RELA 5KJNA 1FU4A 2YJNA 4EKEA 5C1DA 3EDTB 3NCHA 5FTPA 2GEJA 2F3PA 1A17A 2JJMA 2KATA 5FJYA 2HO1A 4AN4A 3WXXA 1J39A 3LY8A 3MSCA 1C8KA 1L6IA 3OTHA 3HBJA 2YQ8A 2L6JA 4I9CA 4U0UA 3G2HA 3JYSA 2SKEA 3ZN3A 2PZIA 3CKBA 5IKPA 1GPYA 5LQDA 1P2BA 3GUHA 1M5RA 4M60A 3VDMA 3MT8A 2QRPA 4WNGA 3Q3HA 1NA0A
chains in the Genus database with same CATH superfamily
2MJLA 3H6HA 1YB5A 3V6MA 3RJTA 4NMLA 3JXEA 4QLBA 3PYMA 3RT7A 2WXPA 3TDNA 3ENEA 1KR2A 3A26A 2FSPA 5BQ3A 4QE3A 5DE3A 4A2PA 2O19A 4GBJA 3IOMA 4C9BB 3KQQA 1MYOA 4HJXA 1PJCA 3IPYA 3ZDQA 4Q4HA 4TRQA 4BVEA 1KO5A 1Y1TA 3WR5A 2QVBA 3SF0A 2VDKB 2X2PA 3FUVA 2PCLA 1GUDA 1GFZA 3RRJA 1XGKA 4UPVA 4LV8B 3NVKI 4IDGA 3A36A 4XFJA 4RY9A 2OCYC 2BN4A 3K0CC 1YZUA 3ZDFA 4PLPA 1ULHA 3RSOA 2IOQA 4YLGA 1QMPA 2RIRA 3FPLA 5HUJA 1L7DA 4EFNA 3FJYA 4XVRA 1IRXA 1OYOA 2G67A 3D3WA 3OPYB 2JLSA 4HDQB 3HU3A 3GGGA 4NMHA 4Q4AA 4HN9A 1CQIB 3TB6A 5SY9A 2HHAA 2PEZA 5IN5A 2Z6AA 5A06A 1HSZA 1BWQA 1KPSB 3RHFA 3ADOA 3RJ5A 1BE0A 3BJMA 1XKTA 4UM9D 2FYTA 2OBXA 2Q4OA 4LVUA 2BMJA 2BHNA 1G98A 4NV0A 2QX9A 2PS3A 2OP0A 2PIAA 2CXOA 1UOEA 3FOEC 5HYVA 3E4BA 2VPZA 1RQ2A 3OI7A 4CMIA 5FTNA 4LKRA 2O2DA 1RKUA 5BQXA 4JFRA 4PSAA 5D7BA 1PJQA 4JP5A 3DFUA 3KPYA 1NA3A 3LNCA 4YAFA 4N54A 4YMVA 2ZTVA 2AE2A 2PD3A 2Z6VA 4HMPA 3ZZNA 2R6ZA 4MB6A 2JEZA 2GRRB 4KQIA 4CR6A 2J08A 1JQBA 2H4ZA 5JYBA 3O2QB 4GTVA 3U09A 4DDUA 4BQFA 4OHPA 3COYA 4LZZA 2LAIA 2GJ8A 4NBWA 5IG2A 2EAUA 3FTWA 4XM2A 4M1OA 5KTNA 1Z5GA 2WT8A 4YT2A 1SXJA 3JR7A 2AEEA 2WB2A 4BX0A 1E6WA 1A9RA 1DBWA 2C4WA 2G8LA 1IOWA 2A5GA 1QQEA 2VDUE 4KACA 1DAHA 4LEIA 3IMGA 4B5LA 1CR1A 4OTZA 3CVPA 4NNJA 1UH5A 4B47A 5KNDH 1LS1A 3EMVA 3LLSA 4IS2A 4CR8A 1TLLA 1H0KA 3EIUA 4B45A 2AXVA 3FKJA 3ZLVA 4KUGA 2BEUB 4NIKA 3E22A 2JFWA 2RAPA 3C7AA 3BD7A 2I5PO 4WRRA 5T4EA 1VLJA 1S01A 5D5HA 1UOQA 3IP5A 4RH1A 1ORRA 2D6FA 2GA8A 1VJRA 4ND2A 1QK3A 1H2XA 3L7NA 1DDIA 2NVOA 3L93A 1RLJA 1ZJJA 4Y1RB 1YT5A 3GUUA 4CIWA 4P98A 4GC5A 2O2YA 3ESYA 1XXHA 4HNSA 3TTXA 2DJIA 3EXHA 3OUZA 4QRDA 1E1KA 2AMVA 2GZRA 3L1IA 1JDZA 4R9VA 2VJPA 4BNTA 1ZGZA 3ZWMA 3RIXA 3K70B 1VCOA 3Q15A 2ZSJA 5HSGA 3RKUA 4YLEA 1I4DD 1N5LA 4LNBA 2IBTA 3EVAA 4ZODA 2IHBA 2X9GA 3PC4A 3TQCA 4QGBA 1VL0A 2HGZA 1J2UA 3ZZ0A 1A5BB 1YCDA 5C4MA 4RLQA 4MEBA 1KDRA 1TI7A 1E3TA 5BT9A 4RC9A 1NXXA 4F86A 3NDJA 4BMPB 3NTUA 3DWLG 5CYGA 2FULA 4PYKA 1SBIA 3TCNA 3V1YA 4RL6A 3BE6A 4M36A 3LKVA 3PRHA 3M33A 4PR3A 3HB5X 2P6OA 1GADO 4V1CI 4WQMA 3MGAA 2DBRA 4GP9A 1BPOA 2VQ2A 1T4CB 2XXBA 2N1MA 3OQJA 1IIRA 4KN6A 5DF1A 3EGDB 5TQ2B 4PU0A 1JJBA 5EQDA 3WICA 4ZK6A 3DZHA 4UYJA 4G25A 3B9PA 2IV3A 3UJ7A 1CT9A 5FR1A 4HF7A 2HU8A 2DCPA 3CQCB 1VKRA 3VVLA 3OKAA 1EX1A 5F1PA 4B6RA 1N54A 1YB2A 4BV3A 3C0KA 3AT1A 4YX9A 1FX0A 2A5YB 1HDXA 1MB4A 4D98A 1N3YA 4P4UA 3NHYA 4KXUA 3CV0A 2CLFB 3AG4E 2FEPA 1QFZA 4UD6A 4ZVNA 2C0QA 2BC9A 1OWMA 1B8PA 1UC5B 3GELA 3ZYMA 4WZAB 1CEEA 3AINA 4XFKA 3ZHSA 2WVIA 2DCMA 5AQ9A 3N8KA 1R12A 1TD1A 3HFRA 1XZJA 2KB0A 1MORA 1MLDA 4DUGD 2EZ4A 2WZDA 4HO1X 2MYPA 5A0TA 2FX5A 3QOFA 2VDRB 2HWUA 1TK2A 3UMSA 2PT6A 4R9RA 4LNUD 4LC0A 2XPYA 1U11A 3IAFA 2Q7XA 5DI3B 1Q95A 4GSKA 4LXTA 4B3MB 2VBIA 1JFTA 2XKKA 3G2WA 3BT3A 4XXHA 2F62A 4BMZA 5A62A 4QQIA 1MAHA 5F9MA 2JGDB 4WAUA 1RC8A 4EATA 1E1CB 4E0BA 2QMQA 2I62A 2VG8A 4ENUA 1CDEA 1UEJA 1RR6A 5EE1A 3K1AB 4PM4A 3BCHA 5C3MA 5CVUA 5CB0A 3G5MA 1NE7A 2I65A 2IKSA 1NBOA 3R5TA 3P0IA 5CCEA 4MVXA 4E30A 1RZ4A 3TZKA 1P80A 5EMLA 3G49A 5ALOA 1TTPB 2IP2A 2POCA 4JP8A 3CFYA 4MA0A 4XX0B 2L9BA 2BFDB 2W22A 3ULYA 3D0RA 1D6MA 1UFQA 1JKJA 2VSYA 1Y8CA 1GRVA 5C2YA 1DXYA 4H7IA 4AJ1A 1UJJA 2AKAB 2PBRA 3Q5GA 2X1VA 5J58A 3NCTA 4UUOA 3HCEA 4JYMA 3DSUA 1QLWA 3MINA 1RBMA 1ODKA 2VSQA 4KQ6A 3KXDA 2YDXA 1HRKA 4WXMA 1GNPA 2C7RA 3UK0A 1NBMA 1P5JA 3IERA 4GXQA 1PS0A 2BJVA 4XZ3A 4JV5B 3CLTD 4IDQA 3C6KA 2PSHA 1EFLA 4C3VA 2H0AA 4GIBA 1NF2A 1Z5UA 3JXIA 4DDKA 2M9MA 5MFPA 4IGFA 4ZPJA 3TOVA 3N7UA 1YS9A 2IE0A 5B6IA 4ETWA 2A9QA 3RYFB 3KV1A 2LNDA 1IK4A 2DBQA 1LPAB 2QQGA 2X4DA 4I81A 5BPFA 3LHSA 4WFQA 4MR9B 4MAFA 1NW3A 2Y1CA 3HIZA 2PLWA 1QS0B 3F6PA 4MAMA 3DW3X 5DOZA 3FYDA 3B1FA 1C7QA 4NHOA 3ULEG 1V5WA 1T10A 2JJMA 5LYYA 1GIAA 1EVLA 5HJ2A 1THTA 4BNXA 4DLXA 4U0UA 3VC3A 3DEZA 3HM2A 1QYIA 5EWLB 4GLOA 5EJMA 2PKWA 4NQRA 3AVOA 3PVSA 3V4OA 2OV6A 3EGIA 1UMKA 5YASA 2ZGVA 3BL8A 1CY6A 4CTJA 2F55A 1FDRA 3TRIA 1WCWA 1YB6A 2X0RA 4IYPA 5CJJA 1RKXA 1PJRA 1JT9A 3DTVD 3ASHA 3KUDA 1YR1A 1BSVA 2UYYA 5EMNA 1QTRA 1P60A 1UZAA 3NIDB 4IG4A 2HCJB 2P0AA 2O06A 1BU9A 4TYPA 1YR2A 2YJ4A 1C9JA 4H1VA 3PNOA 3RRBA 5THXA 2ZBPA 1RLUA 3H4TA 1LS6A 2JG3A 3WZ2A 1Z06A 5JAUA 3HA2A 4Q94A 2O3TA 3D3WB 3E03A 4BFVA 1ZUNA 4Q4AB 4RGQA 4G37A 1L3IA 3LCUA 3BQOA 3C85A 5A04A 4O2RA 2GD6A 5EXPA 1WD7A 2A5UA 5PNTA 2O3QA 1GILA 3AEQA 1K8ZB 3KXPA 1I51A 5AVSA 1YZGA 2C2ZA 3BQMB 4RCYA 3IHVA 2HGSA 1MX1A 3T61A 4DA6A 2LBPA 2F9FA 5JJ6A 4HPXB 3R7FA 4F2WA 3WQRA 4E7OA 3EZGA 1N4RA 5IVKA 3V3TA 1YZHA 2A3RA 4LKOA 4CMIB 1JB1A 3MT7A 3ICCA 4V0QA 1N2GA 2VDPB 1KJJA 4MRUA 1XZKA 4EG3A 1ZJ5A 2X3UA 1Z5ZA 3DXYA 3H2GA 4DS3A 2VH2A 4LYEA 3HL4A 4MDYA 4OXNA 3L6DA 4M2LA 2QB5A 4RG9A 1D9ZA 1W29A 2IYRA 4G0WA 3AUXA 1CZHA 2ZJAA 5L3ZA 3GJSA 4MVJI 4MQ5A 2QTHA 3BA1A 2CXPA 4DA9A 3LFTA 1MJNA 1UP7A 3F97A 3QG1A 4LJRA 2IV7A 2VNKA 1JAYA 1JSCA 4UWHA 5I7OA 5KEIA 3MWDA 5A0FA 5K2OA 4J0GA 4I9GA 2XYRA 2JFFA 4KSBA 2CXNA 2A7QA 3PFIA 2IF4A 3RS3A 1BEZA 1CJBA 4CLEA 4KR0A 3CWZA 1MAUA 1FTQA 1XJ0A 1ISGA 4RVGA 3PWKA 4UUBA 1SBNE 3QKYA 1ZZEA 3UWMA 3E22B 5DTJA 5E7IA 2AQ8A 4K6MA 5J23A 2ZB7A 4FHEA 4Q4CA 3DSRA 3VH2A 1NY6A 2WV9A 4WOPA 1MJFA 3S8EA 4ZKEA 3MILA 1KT1A 1NF8A 2D8AA 1AZTA 2DX7A 3K73O 3ABME 3AJRA 1I94B 3OG9A 4K28A 2PT5A 2A1UB 3BFPA 2L42A 4OGGA 1ORHA 4K7JA 2BMDA 3TTVA 3OMSA 1C80A 2FR1A 3RVDA 4FQ8A 4MIEA 3IHWA 2ZIFA 1NP6A 5HE8A 1XXHB 3GR6A 1F60A 4LRWA 2FSVA 4L5AA 4RMNA 3EXHB 1H22A 1G9XA 1PZXA 4RQTA 5F5XA 3QU2A 5C4GB 4HZUA 2EGUA 3KAEA 3V55A 2OE2A 1AQUA 3C14C 2GXSA 1IY2A 2VUUA 4Q00A 1PW7A 3K8YA 2EKZA 5E95A 1ZITA 1E9FA 2JIMA 3R41A 2FOXA 3E1KA 2VF7A 3U80A 3N2IA 4BNGA 4XEUA 3H2YA 1EEHA 4INJA 1KYTA 4BNMA 4AF7A 5G0UA 1SD5A 5BWMA 2FQQA 4V0KA 2Q21A 2DKOA 4ZRDA 1X1AA 1XZBA 2G9ZA 1E3IA 2Z9DA 3C6XA 2FW0A 5FO1A 2CE2X 3U9TA 1QZZA 3I9LA 2WU3A 1P2TA 3FUJA 4ESHA 3DYIA 3C3CA 2D7CA 3PT5A 2Q5CA 1SXJD 2KBEA 1KYIA 4TTTS 4BQRA 1US8A 2IYXA 1LDGA 5KQPA 2LDBA 5LSAA 4LERA 3FEYA 2X6RA 1H93A 2OO3A 1WTAA 5AW0A 3OJFA 2JZCA 1EZ1A 3P96A 3UIOC 3HB0A 2OO5A 3FUTA 5AENA 1EUDB 5DMHA 2FUKA 1OY3D 1JIXA 5JNSA 4FLMA 4PO9A 3U1VA 1OCZE 5JROA 1BOFA 1HI9A 3L6UA 4GYYA 4ICIA 3LJ3A 4IKEA 1U0FA 4KVGA 3ZDDA 4Z86A 3JZMA 5G3YA 3Q7TA 4U96D 3L0BA 5CCBA 4LXIA 3PNVA 3HI4A 2OFPA 3UJDA 1M7BA 2P2CA 4W8HA 3MW8A 3U48A 4QYTA 4XGRA 4P7JA 1K4KA 1FX0B 2XMDA 5DNVA 3A4TA 2VZ9A 1Z4OA 2BEJA 3HO8A 2OYRA 2NXWA 1DIOB 3I64A 4KR7A 1ZM2A 4OP2A 4H6PA 1CY1A 4NECA 1N2OA 2HWXA 3PL1A 1V11A 4II7A 3V7FA 1WY7A 2J3LA 2ODQA 3ZCTA 1Q74A 5AM0A 3RT1A 3ZY2A 1B1AA 4WCFA 3EWNA 1TZ2A 4EJFA 2VDVE 1U8CB 2QUAA 4NONA 2W71A 3KAPA 4TLAA 1YL5A 1DRJA 1VJGA 5DBIA 1X8LA 4TYWA 1SFRA 5AK4A 4C05A 1LQTA 4WDRA 4EPTA 4EARA 4LYJA 1A5SB 5EWJA 3K15A 1DEKA 3ML1A 4ZO8A 4OY3A 5BV7A 3F9IA 1V35A 5IUNC 1G20A 3D4BA 2HSJA 4K6CA 3CVXA 2VH5R 3UW1A 2JBHA 1V96A 3ORQA 5JNTA 2ERXA 4OJNA 1P1FA 5CURA 3DNMA 4FKMA 3R6TA 2CJWA 4XI0A 4NZMA 1W85A 2ZXUA 2G40A 1TDJA 4DX5D 3LH5A 1NI3A 1G5QA 3F46A 1OY1A 4TS1A 4DIEA 4RKQA 1KK1A 1BVRA 4HDMA 3DOIA 4LQ4A 4LI3X 4BNJA 5F5NA 1G8YA 4A55A 1X87A 3KU4A 2YXLA 1GEGA 5I7SA 2YZMA 1WBDA 5J90A 1UOHA 2OP1A 2GF9A 5FT9A 4NYJQ 2HA7A 4N7MA 1IHUA 3ND7A 1Q2ZA 3EBLA 3TTUA 4WEQA 2QE6A 2AG5A 3I9OA 5JAHA 4PZYA 1KTIA 3PL5A 4AX4A 3UXGA 5HE9A 2QX7A 3VHXB 1HA3A 5COQA 5LP0A 1E2DA 1JKJB 2XE4A 3C8ZA 4U6QA 5ITZA 4Q9AA 1Y6IA 4EG0A 1KVTA 4WNEA 3ZOKA 3QVVA 4B87A 3I3NA 4IW3B 3LA6A 3W90A 4Y98A 3MINB 1Z88A 1LZKA 1D09A 2AC4A 3O9VA 1SD1A 4MK4A 2FE4A 2XNKA 4GW3A 4QQRA 3DBVO 3JVDA 5DSZA 2WXJA 1GD1O 2C1ZA 4ID9A 4NZYA 2G88A 3ME5A 3CINA 3F90A 3CHSA 2LXLA 5K8VA 1B6RA 3HB4X 2AXNA 4UREA 4ZEOA 5EZ5A 3E7XA 4EIWA 3HZRA 5C8YF 2GYVA 2J32A 5U1PA 1EGQA 3JQBC 3KR0A 2QYTA 2WPDA 2Y99A 2IF2A 2W98A 1W46A 3OJOA 4WLEA 1YRBA 1ZAYA 2WJ4A 2EWWA 1X81A 1T5IA 1JECA 4Q9NA 5ENTD 2ZR0A 3LLUA 1CZKA 2HO5A 2ZBUA 3R0JA 2XVZA 3ITDA 3V31A 4KQJA 3IPLA 4BNWA 4LXYA 4DQVA 3L9TA 2ZZMA 3QKTA 2X0DA 3K9WA 1GL9B 5KOHB 5EMMA 5EILA 1TD9A 4MB0A 2OORA 5FTPA 2QTRA 4TMXA 2UUOA 3EUEA 4IYJA 3CSDA 4IXWA 4B8ZA 1K8YB 3G2HA 2WQZA 1G3QA 2O2SA 2WYVA 1HS6A 2Y68A 3HR4A 3LTNC 5K3DA 3VNSA 3M5DA 1K7FB 3H9CA 4CGWA 1DO2A 5TT0A 1SKMA 1URPA 2BMWA 1LSSA 1QHEA 1D2GA 4NNOA 3WGMA 2YUTA 2C4TA 3BJZA 2WJAA 3CVWA 1F2TA 2CDRA 2YXPX 3GVIA 3QEOA 4BO0A 4Q1VA 1QP0A 3REFA 3STHA 3UHAA 3D6UA 1UKBA 3MKQA 1E9RA 1RACA 3AHDA 2Z8YM 1C8BA 2OG1A 3ASZA 4L73A 3IAS6 1HH8A 4QJ5A 3GFSA 3THYA 1WV1A 1HG1A 5ARFA 1ZUNB 5B7PA 3JD2A 4TX1A 1DIBA 1EE2A 3AZQA 5L7TA 2ZSFA 5KJCA 1I4EB 2HF8A 5B12A 2ZB8A 1LWOA 1JR2A 3B13A 1PKEA 4I1RA 4YRRA 5SV2A 1ANKA 2E87A 3MBIA 4UE2A 3EIFA 4JIMA 1IB0A 5JXGA 3U49A 1V55E 2FV8A 4WASA 2DKNA 1X9IA 1P19A 3O9MA 5IAGA 4CDNA 1RLMA 1OH7A 4QUBA 3NHPA 4WOBA 5HIJA 3EODA 3D8SA 4DBLE 1SVMA 4OQNA 1T6BY 2C2LA 1A71A 2P9BA 3F96A 4UCFA 2PGJA 5H0IA 3NR2A 2IPNA 4YUVA 4AL4A 1NC3A 4J8YA 2Q3CA 4YACA 2ZS8A 2IK8A 2EJBA 1ZK3A 4RTMA 3DKRA 4MQEA 2PM7A 3D1JA 2OBBA 3OD1A 1OT8A 2V96A 1GL6A 2ZPAA 5I9SA 4UZFA 3BJEA 3IJRA 2Q5IA 1ZMBA 5CLFA 2EKQA 3UXYA 1YCSB 1Z73A 4MGYR 2VYCA 3ZDZB 2F64A 4URZR 4Y2GA 3W8EA 1OJ7A 3KPVA 3E3LA 4CQLA 1Q20A 3U13A 3MWDB 3LAWA 1TK9A 3ZS9A 3X1DA 2XE8A 3P8ZA 4NYIQ 4RHCA 3CEHA 4HEJA 5ENVA 3E9YA 4MAAA 3K9IA 3MS7A 2FI1A 1PG0A 4WX2B 1NVGA 1BDMA 5DT2A 4OL9A 1XYVA 1AQ6A 4G2TA 4TTSA 4XOIA 3HYMB 1K97A 2XQVA 1LGYA 3TMKA 2P35A 1XNJA 3WNZA 5K99A 4D8WA 5AM2A 5BNIA 3HEBA 5IAAA 4BV9A 1QKJA 4URKA 1N6KA 2VHYA 4UPEA 4XJXA 4Z0TA 5CCDA 1GSIA 1EXWA 4GOND 3RC3A 1X0VA 4I14A 4TWIA 4BWFB 4JSYA 1QIKA 3EXAA 2N42A 4HRYA 1PWHA 1G9SA 1FRNA 1VKJA 3HYCA 3ZQJA 1U3WA 3FNEA 1GPH1 3S5UA 4LUNU 3CRNA 2HFKA 4P31A 1DRKA 1QHFA 3U3JA 3UB4A 1B8VA 1SXHA 1ECBA 4RZSA 1QQBA 4ZTZB 4RK1A 3PPXA 2QZSA 3PICA 4HZUB 2FJDB 3MZ0A 3FG9A 1G1AA 4RACA 2EKBA 5TDHA 3GLFE 1L3CA 1UIRA 3X2QE 1GTZA 3JCKC 1YZYA 4D9HA 3IP6A 4C9BA 1P81A 3ZXUB 5MF6A 3NAGA 1L5MA 4QYMA 2P9ZA 2LSVA 1JNYA 1X7HA 4Q16A 3QV2A 2UVQA 2QF7A 4RZ2A 3UW3A 5BW8A 1TNZA 1WOMA 3SQLA 3PX2A 3SP1A 2BCGY 2WWVD 4YT8A 4L5BA 1NWHA 2BGNA 1ULTA 2AK3A 5AWFC 1OFVA 3WX0A 1IQUA 3L0YA 4WXRA 2V1UA 1VHTA 1SNYA 4FDVA 5DNUA 2AK2A 4IAOA 4ZOAA 2DU8A 1IQRA 1LTXA 3KL2A 1T8PA 2D2IA 4S0XA 2H2GA 3S81A 4M7WA 3IP9A 4CM3A 1EI9A 1HRDA 4IUBS 4LCJA 1EDDA 4K9LA 2JH3A 2AR7A 2IJGX 1PD0A 4HUTA 3L1HA 3WIDA 3P0FA 4PLYA 1C30A 1XTKA 5A05A 1QF6A 3B7RL 1FP2A 2F67A 4KLRA 3L40A 1KP3A 4J0IA 4B7ZA 4F3TA 1JHQA 1VP9A 5BW6B 4X1OA 4FADA 4OUDA 3COZA 3G2MA 2XD9A 5DYWA 3FYTA 4KKVA 3CRMA 2FPGA 4RGVA 3TGLA 1U7HA 4XX1A 3NEPX 3L46A 3UT0A 1V11B 2ECFA 4DRZA 2AD1A 1AN0A 4ZAVA 4BP8A 5AHOA 4NX2A 1Y81A 4TKUA 2HA3A 1M5UA 3PFKA 3KE9A 1CY0A 1SUAA 4GOLD 3GMIA 1UXIA 3L16A 4KIWA 4G01B 4HZGA 2PRZA 3G2LA 3HYSA 2CL6X 2OHOA 3ND9A 2H5IA 1QGAA 3B20A 1DNPA 5B3JC 1PWEA 2DWUA 2E6KA 1MC4A 4BJ3A 1NRWA 4M0UA 2WYHA 3IAXA 2A14A 4WUYA 5EWJB 2WSMA 4MWTA 5LIPA 1TNDA 1UM9A 3T9FA 2C8VA 1G4UR 2PK3A 4FU3A 4TL8A 1C7ZA 4QO7A 1TXGA 4N3CA 4J7XA 4BAGA 1DS6A 4QXAA 1B2RA 2WVGA 5AVJA 2ZWAA 4CETA 1MGPA 4IIXA 2C3YA 3SQMA 4U6SA 3ZHZA 4NZNA 3CNBA 2QRVA 4E4RA 3PKJA 2X6KA 1M6NA 2HCTA 2EW1A 1CR6A 4EHFA 1X7XA 1TT7A 1J1IA 4LZWA 5GGYA 3H13A 1DBRA 4HDMB 4JQYA 3T52A 4EJSA 3W3AA 3AVUA 1N6NA 5FRDA 2RHMA 4JWKA 1UPUA 3K16A 5CRIA 5KNGA 3P2JA 5JD5A 3QYFA 3W1EA 2YUIA 2NVWA 3SVZA 3H8WA 4I5IA 3RSCA 4GTPA 1T4BA 4IIYA 4ZK2A 3SVTA 1KPGA 1T9CA 2X4GA 5HGXA 2PYZA 3PPWA 4F8YA 3T9DA 5ITZB 1BA2A 1MT3A 3OWOA 1UWVA 2SCUB 5CA1F 1QG2A 3LCCA 1SCNE 5K51A 3DMTA 3FWNA 2XBMA 1P5RA 4RYLA 5J2TF 2BUAA 3QLVC 2O2IA 1Z18A 4B8CB 5JU6A 3D81A 1RSZA 1V45E 1NN0A 1MO2A 3PHLA 2EQXA 2BDUA 3KSQA 4L78A 1TPYA 4BQOA 3KEZA 5CLJA 3OHMA 1RFGE 2UUPA 4WKCA 2IYSA 1DCEA 4YMIA 3TWXA 4A6EA 3X1MA 3MEKA 5AI9A 1EBFA 2EX1A 3O0DA 1TQ6A 4QASA 4HWGA 4H3SA 1XRSB 2HUNA 3GLSA 5A4AA 3UB2A 4D0RA 5CCMA 3V1UA 3EGDA 5TQ2A 5JD3A 2J09A 3K2QA 5HF6A 5CEAA 1FFXB 1XN4A 3TO5A 1R1DA 5ALFA 2ZSEA 1G8HA 1H4SA 4DX1A 3FCCA 3V9AA 4Q3CA 5I7AA 4X1IA 4RETA 2FR0A 3QTBA 3ZQ6A 1DCKA 4QOSA 4TT8A 4LQDA 2IITA 4OQPA 2K5UA 2O5CA 4IGEA 4QODA 2C2WA 2J9ZB 5SZIA 3JD4A 5IJ0B 2Q1XA 4C0WA 1YVPA 4V0ME 4A3TA 2F0YA 2YJNA 1QF9A 2YC2C 3EZYA 4WY2A 3B6JA 4FMDF 4UE3S 5A5DA 4PRLA 3LVRE 1DIRA 4YQZA 3TDKA 2FOIA 1L6IA 4IP0A 2RGYA 5B1IA 1E2NA 4WSOA 4Y2HA 3EA5A 3X1JA 2FEXA 4D9NA 3QI7A 2UZIR 2QL5A 3Q98A 4C14A 4OB6A 1X1DA 3FX2A 1F2TB 3IAAA 2WTMA 2PS9A 4Q48A 4MKGA 4FHJA 2Y92A 4WZAA 5DGTA 2NTEA 1XTQA 2UZ0A 4FZ3A 3RRMA 1G60A 3MKQB 1A04A 2C5HA 2PY6A 4XQ9A 4ND4A 5A9SB 1BS1A 1NUQA 5CEEA 1N32B 3G0BA 3GIWA 4DIBA 3IQGX 4YCSA 1RC1A 3DGFC 3SJ7A 5EVJA 5CNJA 2X5JO 3NP9A 4MQMA 4LI0A 3THYB 4IIEA 5CD9A 4BUCA 3FPGA 3EVTA 2XT9A 1FNSA 1RQRA 1NPTO 2IHNA 3S2YA 4ZT6A 2VHEA 4QOEA 1PDVA 5KNHD 3J5PA 1MH9A 2J3DA 1UQRA 2ZJ5A 4Z4FA 2VTKA 3PLAE 1I6LA 3B13B 4AU1A 1Q1EA 3Q7AA 4XCXA 5DI3A 2GLTA 3SIRA 7MDHA 1WG8A 4RJLA 4PTLA 1RQPA 1YU6A 4U7PB 2ATCA 1GTMA 2JLUA 3K8OE 2WPDD 1F8GA 2HV8A 2YY7A 3ZEIA 2WWHA 4XRRA 3EEYA 1W8IA 4LUCA 4UI9J 5HOEA 3AM5A 4EKGA 2MMGA 3UA4A 3OZTA 4XYMA 3JQGA 3T7CA 1MQ8B 2PYIA 4IH4A 2K4MA 2HK7A 3W9GA 2ZI6A 3P9QA 1T1SA 2QRUA 4WECA 5DM4A 4MQEB 3VPXA 2W2LA 1TIPA 1DHTA 2YKGA 3U19A 4OP1A 2IHJA 3BEOA 3LYHA 3WNBA 1CR0A 4XX0A 2JF0A 4M0DA 1BVUA 2M63A 4QVIA 3SXJA 4PZ9A 5K20A 1XYYA 2YMQA 3NG1A 4UUPA 2R79A 4PONA 4CQLB 1JE0A 1YA4A 1TU0A 5D84A 1H42A 4I36A 1DXQA 3RT9A 1T1RA 1I5EA 3ZVRA 3AU9A 4ALKA 2QJFA 1ONBA 3UJPA 2WA1A 4EB6B 4JVOA 4HB0A 1UL1X 4DLBA 1QDLB 4PICA 1ZX1A 4MUBA 3AV3A 4YCNA 4F3YA 3S2EA 5A5EA 3JASA 3QUAA 1Q7TA 1KXJA 5A5GA 4RGYA 2EOAA 1J25A 1RXYA 3CSSA 3FBWA 4UDXX 3MLBA 1EG7A 5ALTA 1ZR2A 1I1QB 1HL3A 4GLFA 2CVOA 3PUKA 2DC1A 2R66A 4IIFA 1XJQA 4Q66C 2F6RA 2KYRA 2OKGA 2G5GX 1JS1X 3APCA 3OOHA 1JT2A 2X8BA 5BNFA 5FINA 2QLLA 2RH9B 2H4FA 1F4VA 2NUBA 3I52A 1JQ3A 5HF5A 5FUXA 4Z4EA 2WG2A 3WAGA 1FU8A 4ENQA 5FQ4A 3HJUA 3V32A 5EWLA 5AXBA 4BO8A 1IXSB 3AJIA 2R87A 2GH1A 4ZVLA 2E4ZA 5HMLA 5CXQA 5IM4F 3L6CA 2BFMA 1SGWA 4ED9A 5JECA 3JALA 4GLLA 3NETA 4I3HA 1BA3A 1SK9A 4GC9A 1RQNA 2FX3A 3D2CA 1Z4QA 5EIFA 3IAS1 2CUZA 2NYRA 2AVPA 2XUKA 1U3TA 3LPDA 3PNKA 1R4AA 2JIPA 2XH8A 3G2NA 3G9QA 4KAXA 3V3LA 2VPWA 1F0YA 3TW0A 1N4DA 3HDJA 3GYZA 5CLGA 4KIGA 1SBCA 4IN3B 1EVQA 2FZEA 3APDA 3FAZA 3UPDA 5CHEE 4ZI2A 2JAUA 4BTVA 5IXYA 4HVTA 4GRIA 2PWYA 3OO0A 2V7QD 4OFZA 5G4KA 1O0BA 1ZRHA 1CWUA 4O1PA 2LCQA 5DXJA 4QGFA 4HAOA 5HZHA 4HDAA 3VU9B 1A2QA 3TBKA 2P6RA 2QJRA 1GRCA 5B2ZA 5FCDA 1R0BA 5EMJA 4G2NA 3KSRA 1XF1A 5DW3A 2D2XA 1EEXB 1RHRA 4GRAA 4KDCA 4HK4A 4MLPA 4L6CA 1C30B 2H0RA 4Z4GA 2COEA 1KI4A 4F8JA 1JXAA 2JHCA 4K86A 4H17A 1S2DA 1SVIA 1D4ZA 2OCLA 1SUPA 2Y77A 4FLEA 4JJEA 4ENSA 1BNCA 1MAVA 5BURA 4OAQA 5DGIA 1P77A 1FP1D 1B14A 1HWYA 4IRUA 4OUDB 4QNMA 1V26A 3UK6A 4MCJA 4KZ0A 3CB2A 2WBLC 2WINI 2FPGB 4JD2G 3N2KA 5KNLA 4GPEA 5HTKA 4JCCA 3NANA 2BKLA 2IDKA 2CKDA 2ZJ6A 5ICCA 3X2FA 4W9NC 3ESAA 4V1CB 2H59A 3M4XA 1GG9A 1LLQA 4TKUB 4M8IA 1VIDA 1ZH8A 4K9RA 1DL5A 1XAIA 1LSUA 3T5TA 3ZJ5A 4B89A 1H2AS 1UOPA 1GYPA 1XA3A 1WCYA 2O57A 4LA4A 3HXEA 1P5ZB 4HWTA 4D96A 2GGFA 2A3NA 1LCIA 4OQQA 4GHWA 4GTRA 1YDEA 4AURA 1QHSA 1KIAA 2R62A 4XIIA 1RHUA 3I23A 3ICEA 4L4YA 4FGLA 4AC9A 5KKNB 5BPHA 5ER9A 1UM9B 3EHQA 1A2KC 5B64A 3FZYA 1A4RA 2QMOA 4MTLA 4BB9A 3OM0A 3CZ5A 4OGWA 2HU5A 2ZUBA 5CVEA 4NAUA 1IUPA 2WTBA 4EB3A 1SZ9A 3ABIA 2IZ5A 4A03A 4ARAA 4QL3A 3KSLA 4LHVA 5FTKA 2QRVB 1N57A 4N12A 4BRZA 1FTGA 4DWJA 1OH8A 1X7XB 1A8UA 2OG2A 2A1UA 1W4LA 1IG3A 1LWNA 1WUTA 1JIKA 3K09A 2EJVA 5FWQA 4EJSB 1PFVA 3SLKA 4EYSA 2PZKA 3GZ1A 3U66A 4ARSA 2P6PA 4K2HA 3B1WA 1IZ0A 1RM5A 2ZYRA 3JWEA 1PWYE 4W6ZA 1NLUA 2Q5OA 4AJIA 4PFQA 1NA5A 3PPIA 1SOVA 4A6XA 3QE4A 1K6XA 5DSTA 4YJGB 3GCGA 1SWWA 1AQYA 1N2XA 1E2MA 1P2UA 1SZJG 1MD9A 2O3RA 3PUHA 4AB1A 1KQGA 2RHBA 3KJGA 3BMCB 2H7XA 3TR0A 1UXHA 5LP6A 5E3IA 3X1XA 2BJWA 4YREA 3L7BA 3SF8A 2WSLA 2VOJA 5IJXA 2PX4A 1J0AA 3KXIA 2W00A 1Q7RA 3TGWA 4LNGA 1KDOA 1G2OA 1BDIA 2NP6A 5F5LA 1T4MA 3KE8A 1LQUA 4EB0A 1N52A 4WWPA 3C3WA 2EQBA 1HMYA 4LJLA 1GT91 4XEHA 4QEZA 4QGGA 3PGLA 5E8RA 1BCSB 5I47A 5T8KA 1S70B 1XBTA 1ZB1A 5BV0A 3C3OA 4KXXA 4RD4A 5A7GA 3R75A 4WWNA 3V30A 3HN2A 3G02A 4JBHA 1K6JA 3TVYA 1YE3A 3I04A 1ZONA 1G6OA 3V8EA 3T3IA 5DCUA 5DIZA 1OXVA 4GBMA 3ETLA 3A37A 2RHOA 4D9MA 2BBOA 3MF4A 1EUDA 2BHTA 3C6QA 3U56A 3ZYQA 1NJSA 1KERA 1HNWB 1NL3A 3KTOA 2VT7A 3BD6A 1NVBA 3MCAA 3MJWA 2VEOA 1T6NA 1CC1S 1W35A 4X1IB 4HWOA 3L8ZA 4IUCS 1LDBA 4MDEA 4J0HA 3DBHB 1O1RA 1COWD 4OQ4A 2VP5A 3GZJA 3URZA 3WK5A 2WWGA 4EHAA 5HKKA 2NU6B 2PG3A 1D8DA 1EINA 1FYEA 2DERA 3VSBA 4H15A 4JI8B 1GGEA 2HD4A 3JQRA 3ANLA 3WQQA 2Y3AA 2Z83A 4BMVA 1RXWA 3I4GA 3ESDA 1IVNA 3MEQA 5CERB 4B80A 4HWSA 4EQ6B 3CT4A 2IYYA 4GTSA 3Q40A 2J9YB 2B2CA 3K70D 4XQGA 3LCAA 4CF6A 3RRMB 4EHBA 2ECQA 2H3EA 2OWDA 3NHAA 4DR6B 3JYPA 3M6FA 4YT5A 4BLOA 1NM5A 1CUGA 3L0CA 1GU1A 4GEKA 3LY7A 2F3UA 2XMBA 4GKVA 4EX6A 2GVDC 4BLUA 4A9AA 4LZPA 5EDSA 4MI1A 1V95A 1P73A 3R3WA 1SKBA 5IW8A 4IHQA 1F0PA 2OQVA 1ZK0A 2BKEA 2JI8A 2FEOA 3O7MA 4X8HA 1VKZA 4JOSA 2PLFA 5FO0A 4UC0A 4XOUA 2F8XK 5KDDA 4YRSA 3EXEA 3RQIA 4TMZA 3GJZA 3QVTA 3L13A 3NOCD 3GPBA 3ZHRA 2VF8A 5L6MB 3BG5A 2WF8A 1Z45A 1XDSA 1U9ZA 3UMMA 4H27A 3DR5A 2Q3FA 3I5XA 4RCZA 1GGNA 2IEJA 3H2KA 2HV9A 3H18A 4MGIR 1V5EA 3ORSA 1KS9A 2J3EA 4OAUC 1FRQA 3BTSA 5EZYF 4UD2A 5SICE 3RC8A 3JQGB 4X45A 2AFVA 2HRCA 3NC0C 3VJMA 2BZSA 2VUTA 3E48A 5DMXA 3AS4A 4FUQA 1JVSA 3GRKA 3SU8A 3LQRA 5K0TA 4KIJA 2VJCA 4LYFA 4KJZA 4ZO7A 1MFPA 4U7TB 2PVCA 5LQRA 2QWXA 3R9IA 3VHXA 2Y4OA 3GGJA 1AKEA 1KAQA 5HRAA 1T0HB 4Y1EA 3BGIA 2LKDA 2NO7A 1TJCA 2QN9A 4UTRA 1O4WA 4R54A 4GWLA 4KX5A 4PHTA 5K6TA 3CHPA 4MI3A 4PIVA 3QARA 1TT5B 3BEEA 4RIEA 1FDWA 2DTDA 3KOOA 3D8UA 3TIGA 3U4QB 2GN2A 3GROA 4PGGA 2VBFA 2VYFA 4CLHA 1VSQA 2JCXA 4MWEA 1XCPA 4E5UA 4ZHQA 2QY9A 4TMTA 3FFXA 3L1UA 4JGGA 3JASB 5BYAA 2AUNA 1QBKC 1QIMA 4ZYUA 4C22A 3UUEA 1DEOA 2ORED 2P11A 4LVNA 3ETGA 2DQKA 3MWFA 3MXOA 3HU5A 3R20A 5EJIA 1PJBA 3VH1A 4PSVA 4XX5A 2FG5A 4M7CA 5H68A 4QG7A 1H3NA 2QSJA 1F14A 1ABEA 3SK0A 1L7RA 1A9SA 4IJ5A 3CSTA 2XZPA 4R3WA 3CLRD 2FK8A 2CXUA 1QRDA 1T0BA 1Q17A 5KOHA 4MVCA 3JARA 4TKVA 3TZLA 1JG6A 3MJEA 5L7YA 2Q2NA 3N75A 5IK2A 2C83A 3AM3A 2P40A 4MUKA 3UM3A 3FH5A 2FPOA 4E5YA 1QYRA 3JALB 4CNQA 1M3SA 3O3OB 4W1QA 5UKDA 2I2AA 4Y3UA 5HS6A 3W7BA 3MC1A 3JWHA 5GONA 1RI4A 4Y2XA 2YC4C 2H6EA 1KEPA 1JDSA 1GXSA 3S2FA 3RU0A 1YBFA 3OQHA 5DNAA 9ATCA 1NFRA 2W2LD 4U7WA 4Z0HO 1B6SA 1NLYA 4Q7QA 2ZM6B 1V48A 2ETAA 3MAJA 3P27A 4G1MB 1P2VA 1QORA 4MYDA 2AD5A 3P2MA 4FEAA 4UBLA 1O08A 1MNAA 4DV5B 4KZCA 3OFND 4INOA 2RGCA 3ELDA 4MPDA 1U7XA 2V6IA 5J4HA 1DBPA 2F7SA 2C59A 4INAA 4QUHA 4B6SA 2QLFA 1WPGA 5G4KB 3E05A 3NFRA 3LD9A 1P1HA 2C4NA 3GEHA 3VR0A 5KU1A 4IHJF 1PC2A 3ZIAA 1P2FA 2NSZA 1E98A 1NIPA 2C4VA 5BWOA 4C4PA 1MU0A 3OTWA 1CQZA 4EKEA 1W88A 4BO9A 4DAEA 5A9TA 1L7BA 1Z0ZA 3OPXA 2OK8A 3D3NA 3FR7A 2ODWA 2BKXA 1D8EA 3PI6A 1RVDA 3LY5A 1PF7E 1PNRA 5AKIA 4V2IA 3AUKA 2Q4TA 1R6DA 2GMWA 1MEEA 1X7GA 3RO7A 3IDAA 5G53C 1U7UA 3AFIA 3B6IA 1V41E 4OQYA 4DA7A 4TQGA 5J08A 4NF2A 2XCBA 4IRUB 4EG8A 3JYNA 1WHTA 2F2TA 3T9BA 5MGNA 1GUZA 1FNDA 3N2KB 1U7PA 4WNAB 3RU2A 1QQTA 4JLOA 2W11A 2A0FA 2YIVX 4JC0A 2H9YA 2B6CA 3SSNA 1VPLA 5FKJA 3G2UA 1K4YA 4MVYA 1FUYB 4QDKA 4PYJA 2OMEA 4FYMA 4NRDA 4WH0A 4MMZB 2J30A 3WRYA 1HV8A 3ZU3A 1ISHA 3WGGA 3C87A 1SOUA 3L7DA 3HG7A 3DBRA 3OCYA 3WRVA 1M1YE 1WU7A 1HDYA 3IVCA 4BVLA 1QZ3A 3D6JA 4P5PA 4BC1A 4WUTA 4CE6A 2RH8A 3T3DA 1XZEA 1M2WA 2CBGA 2A9FA 1WG0A 1P61B 1QFXA 3A6FA 3OUUA 1NSTA 5AVYA 1PR2A 1G7RA 2ZRJA 3AW9A 4M0KA 2NU7A 3AU8A 4CHGA 2C8KA 2Y4UA 1SCQA 4NATA 4O4IF 1N5JA 3OQ6A 4F4FA 4K2AA 1LSOA 3N8HA 4IG9A 2LVBA 4B3XA 3EHNA 5AM4A 4DG8A 3E15A 1BE8A 1SVWA 2GNAA 1AXRA 2NPFA 3QPVA 5T67A 1XMIA 4BZQA 4EGSA 1NI5A 4Z9FA 4UOQA 3WL6A 3OM1A 4ZPXA 2ZRDA 5J47A 1PX0A 2H1RA 2J0EA 4EFKA 3B85A 1N6IA 4OHBA 1H9BA 1FMTA 2UV8A 5B1BE 1GTG1 3GH3A 2HA2A 2OHHA 5EE0A 5FBRB 1RE0A 1XU4A 3T7TA 3FUWA 1YBMA 4DEYA 2JHGA 1PR0A 2GZAA 3OE7A 4MYUA 3RC9A 4P4GA 5LP6B 2JEOA 3PD0A 3SF8B 1U99A 2WEKA 3PQ2A 1YVEI 3RAPR 3PEUB 4ZIRA 4HQLA 1U1GA 2Q9BA 3F6YA 2H92A 3SZ7A 3ZY4A 2I54A 4UAGA 1JBKA 4ZJZA 4Y7CA 1EQUA 3AERA 2VGEA 1L5GB 4OAOA 3ROKA 1YWGO 3NAZA 2VO1A 4JXTA 2YNMC 1TUBA 5C37A 5L4SA 1RC0A 2G0NA 1L7PA 2JA2A 4GRDA 4DV1B 1Y7LA 2C7QA 3DH0A 1RYYA 3FFBA 4XSHA 4NXNB 2KCKA 3ML8A 3RS4A 3UGJA 3CUSA 3FCSB 3MRTA 4A2QA 5KTYA 1ZR4A 3HU2A 1PJTA 3ONLA 3V80A 3FUIA 4QEKA 4F3NA 4MZXA 3WJ2A 1LH0A 2HRZA 2PM6A 4N76A 2NLOA 4X95A 3K6SA 3AONB 1WOYA 4PBSA 3DPYA 4FSXA 5CXXA 1RI5A 1UK8A 1CUXA 1Z37A 4KRXA 3PZ2A 1U3UA 3OZGA 3GG2A 4URFA 2X77A 1W94A 4HGQA 4UQOA 4GMHA 4BQQA 3OECA 1B76A 2XNHA 1ISIA 5F9HA 2DFPA 4WOKA 4EA9A 4IRXA 2OCKA 4JU8A 2HMUA 4LSZE 1D6NA 1HQKA 3K4PA 2WQ6A 1SC3A 1KOFA 2AF4C 4OO3A 1T5SA 1VMEA 1M8PA 1U2PA 5JZ9A 5EJAA 4O2BF 3ZI7A 3HJBA 4M37A 2HRQA 2Q99A 1R9JA 4D1YA 1E89A 3LY8A 5KVAA 3HBJA 1GR1A 2FW9A 4LQCA 2VA8A 1VMIA 3CKKA 1YRQA 3DJYA 4GPAA 2FPPB 2CHVA 4EYKA 3AF3A 1DQZA 2YCBA 4LJYA 3RVQA 2C9BA 1JTEA 1G0NA 3MUFA 2XOKA 4NZOA 4BNZA 4WNYA 3B1ZA 5JSZA 4LHSA 1RZUA 4G89A 1OMOA 3EIQC 3EXEB 3R76A 2ZWVA 5CM2Z 4EUKA 1R0LA 1KH1A 1XE3A 1I5OA 5GPBA 1QQAA 4GZ5A 1JSRA 3IKMB 1ZCAA 2IFTA 1NW4A 5H80A 3QVMA 5HM8A 3T8MA 2VHJA 4AP9A 3ADKA 5I7HA 2CHZA 5AM1A 1CYDA 4BY9E 1Q0HA 1QCCA 2AW3A 4V0LA 2IZOA 2IVFA 5IWAB 2VJDA 4PRYA 2ROQA 2E5LB 3TWWA 3WG7E 2XEHA 4KAJA 3PXXA 4JAVC 3HBLA 3ZD9A 5EX0A 4UEJA 2R6CA 1NQUA 3VTKA 3CPHA 3C4QA 2XXJA 4ZHBA 4JQZA 2PSFA 4X61A 3TBHA 4GZDA 4I2ZA 2IGBA 2FF5A 5HFJA 3U3OA 4EO9A 4J0UA 1C9KA 2KC7A 3PUZA 4E94A 5HKKD 4ZGWA 2XVXA 5F2KA 4OM7A 1J0DA 2NADA 2SCUA 3ADDA 1YS4A 1NUSA 4UM8B 1ZEJA 3GNQA 4W7HA 5GZ1A 1J49A 3NIGB 4WNCA 4Z99A 5KQSA 2VYQA 3CUVA 3LCMA 4OXKA 2PRIA 3LUJA 5H82A 2PKCA 4C2AA 2VZEA 1WB9A 4K1XA 1FRVA 3AY3A 3HA3A 1LPMA 5DNWA 3CKCA 3LX5A 4ZHQB 3JUIA 4EUEA 3TLEA 3PA8A 1PQYA 1B26A 4FLHA 1G5TA 3ZKAA 3IB6A 3MQFA 4RLYA 5D8DA 1AGPA 2CFRA 3OIWA 1HE2A 1Q3TA 1MKYA 1P0PA 1TYEB 5E6RB 4BFTA 5AOXA 1FB5A 1W1WA 2C4UA 3AVWA 4FU0A 4WZBB 4CL8A 4BP1A 1YA8A 4TTPA 4DY6A 4Q3KA 4TKLA 1NXOA 2AFHA 1FFXA 5TB5A 5AW2A 3C3EA 3R3JA 1G4AE 2L6BA 2GKOA 2IH2A 5DGDA 2CVZA 3MYVA 3BRWA 1JAZA 3C7TA 3ZE6A 3ZYLA 5K01A 3JARB 4TKVB 3O92A 2P58C 4WLNA 3PQ4A 3EQ2A 5IJ0A 5DGCA 3QP9A 3BE5A 3WJ1A 1Z9BA 3A9VA 1JWGA 3FGNA 5CHYA 2HO4A 2M6KA 5GONB 2KLHA 2FEKA 1JBQA 3Q9NC 1KDTA 4F71A 3SYKA 2WIFA 1GXSB 4L9SA 1GCAA 3W1WA 3STTA 2AOVA 1FNCA 1G3MA 1XDGA 1JVNA 3L7IA 2WUDA 4BV8A 1BIFA 1ZVVA 3GRPA 1WMBA 4KFSA 2PHZA 3E5MA 2VAWA 4YCJA 3NUQA 1U8AA 5A9SA 3DAOA 3W2HA 1WJGA 4KREA 3T3HA 3E84A 1EZZA 3BWXA 3DBSA 3TLKA 1Z0JA 1R64A 3RB8A 2HU2A 5C81A 3JRNA 5LYJF 2C5SA 2V7BA 3FHEA 2VAVA 2BTQA 3QLUC 5AKKA 4K5CA 1NBMD 4BSZB 3SYRA 4S1TA 1PEDA 3GN1A 2LIVA 2Y0PA 4AICA 1W88B 4X0EA 3GAMA 3O8LA 5JCJA 2WUWE 2GEKA 4PCVA 5L6LB 2IXAA 5IS2A 2ZRQA 1RM3A 3QX7A 4R2LA 4XKJA 3FKQA 5EMHA 2JK0A 4RW0A 2W0MA 3NU1A 2LTAA 1WHTB 3OMXA 2X4IA 3OPMA 3KO8A 2GK4A 4DNXA 2RSFA 4LF4B 1TVCA 3L8YA 3R9XB 3RC7A 4YRLA 4WN9A 4AMVA 4C0AC 4OXYA 3P0EA 2V9CA 3KUUA 4DLTA 4NXMB 2Z8YA 4CQMA 5A2QA 4IS3A 1C1YA 3PH0C 3D4NA 4KE6A 4OMCA 4GZ6A 5JJBA 4DCSA 4RXTA 1QGYA 4AWXA 1NY5A 3KNZA 2BFWA 3A6ZA 4BVHA 3EVGA 4JA2A 1ZUWA 4NCBA 5JSKA 2GB4A 4AN1A 2O5VA 3CY6A 3O8CA 1KSJA 3DB2A 3I01M 4BWVA 3DBRB 1YI1A 3FMOB 1MX2A 3HP7A 4ZJUA 4OHOA 2IONA 1CHDA 4HKTA 1DFIA 2FDRA 1XZCA 3NM6B 4QPDA 4C0MA 3JWIA 1W3BA 5B4VA 1U2RA 4EB6A 3FAKA 2RIPA 2X9LA 1ZH0A 1IHDA 5EYPF 2IHVA 5FIOA 3T5PA 1SQSA 2NU7B 1PZGA 1YL6A 1CFJA 5B57C 1RRMA 2QC9A 5TNXA 3G8BA 2XXAA 3IESA 2W6MA 4G65A 1HXHA 4MLZA 3AHIA 4HNVA 3QXHA 2Z58A 2IUYA 4EBAA 4DCVA 3JTEA 1BX0A 3IO5A 4IJVA 3IUNA 2ZR8A 4Y9UA 2ZFUA 1GFWA 2FVXA 4UYKA 1YQEA 3A11A 4TL6A 4E5NA 3NOGD 1NULA 4RM3A 3GLIB 4RCVA 2GRLA 4V24A 1M76A 3BICA 4KH1A 3B78A 4M98A 1EFPA 2COKA 3FDJA 5E1MA 3RHTA 2PFSA 3FBGA 4YDHB 4KFTA 3E0XA 4TMVA 1H8HA 4TYNA 3RTEA 3K0SA 1IYGA 1VG0B 4LFAB 4YAUA 1D4OA 5E2AA 3BRSA 2D0OB 3NM4A 4LNHA 5I8PA 6GPBA 1SRQA 3UT4A 3VFDA 3AF6A 2RC6A 1WQ4A 2ZRMA 4ZIRB 1UBGA 4DTCA 2G06A 2NO5A 2XUDA 5BMVB 1JHAA 3AERB 2FMXA 4MUXA 2XWJI 4IXDA 3TL2A 3W0LB 4HFNA 4RTPA 3BIXA 2VQFB 2XENA 2A4MA 2Y67A 5CVTA 4NI5A 4GUDA 3MTGA 2DHCA 1TUBB 4EI7A 4C21A 2G3YA 3RVNA 4MWDA 2EKLA 5JDIA 2HBQA 4KTVE 4N5CA 2NSJA 3F98A 3JU3A 4HBDA 4NOKA 3VU9A 4MBGA 1PO7A 1BMDA 5H02A 5JEEA 1QX3A 5AKJA 4DV2B 1N7IA 4IF6A 1FSPA 3BXGA 1G5HA 4M0CA 5AW9A 4EI2A 1PV4A 5J4YA 3K6SB 5KX5A 2JGKA 1YFJA 5LM3A 3VO8A 5L40A 3ONFA 4HWKA 3GGSA 5HIAA 3PEFA 4KR6A 1XVUA 4B6JA 4N5DA 3ZNOA 2JVKA 5ANRA 4D02A 1G3UA 1ISJA 1ELKA 1TEHA 2ZYUX 3C4VA 1ZVMA 3SC4A 4A63B 3ELBA 4MULA 3TRFA 4KLZA 1TEVA 1X3LA 4LOIA 2CMHA 4I4IA 4MLDA 1CE8B 3ND5A 2NACA 2F00A 4V1CA 4HGNA 1GU0A 1JDBB 5LLDA 1C0PA 3FIUA 1A3CA 4GQIA 4G1FA 4BTEA 2XPIA 3KQHA 3VC7A 3GJ5A 1X92A 4C3UA 4CMKA 4NBRA 1Y42X 4JUFA 5DOVA 4RELA 5DGXA 1KKMA 3PC2A 2XB8A 1ZN8A 5GWXA 1P72A 3OE7D 5KOYA 4RHYA 2G7MC 1JJAA 3HA7A 3QPAA 4WK6A 5C7YA 4GF5A 4JB8A 3OM8A 1NA0A 2XAAA 3BH0A 5JSZB 4QM6A 2BM9A 1QDEA 2QV0A 5DX1A 1GA6A 4JUCA 4J3NA 3E30A 4HI8A 1QIEA 2ZB2A 4KXQA 4PR0A 4N8SA 3IQDB 4YO7A 5KJEA 4HYYA 5BN4A 1PNQA 2P4QA 1YJAA 5ALQA 4XTRA 4J1TA 2DPHA 3FLEA 3KKPA 4XASA 1P45A 3MCTA 4NV1A 1K5PA 2BLNA 1QR2A 1RABA 3RSGA 3W5UA 2WZCA 2QX6A 1GGMA 4ZVRA 4L8GA 4N0PA 1G8FA 1IEXA 4R5MA 1KJIA 2ZT8A 4PHHA 2G28A 2WXGA 3AEUA 1YRLA 2FN8A 2JLCA 4YJGA 4XE0A 3TJPA 1XVIA 2VPIA 3PQ3A 1R5BA 2BAGA 1U5BA 3KP1A 1Y3DE 5FDFA 3N07A 1EDEA 4HQ6A 2P9TA 1M66A 3F4KA 5IM5A 4FYJA 3BMCA 5FV4A 3ZE1B 1SU6A 3RUHA 4HGYA 1EX9A 3LUDA 1TC2A 1Y1LA 4BMDA 2VJQA 1ZD4A 1V4BA 4UBMA 3G23A 1XDBA 3ZCRA 5ICMA 1FZTA 4G3XA 4HEA6 3D3QA 4B6QA 5FUBA 2P5UA 6PFKA 4IDBA 4GYWA 1N0IA 2HMAA 2X5KO 2Y1DA 4YB8A 1H2BA 3KWMA 3MWEA 4DJ5X 1BCSA 1PZNA 2ATIA 2F43A 1YI8A 3ZE7A 1MVLA 1NMZA 1E96A 1Q1AA 3AY7A 3ZU4A 3JVEA 3QHPA 1QXSA 1YULA 5BQOA 1TVKB 3ZBPA 5AOXB 3GLGA 3KUXA 3NH9A 4J1QA 5AKGA 1GUYA 2VXYA 2CFTA 5IPFA 4NULA 5JMTA 3U17A 1K75A 3KQPA 3WMRA 3G0GA 1W1IA 4F5EA 3SBEA 1D2MA 2AFHB 2ODAA 2H7CA 4RGBA 4CUZA 1IPEA 2ZPTX 1DG9A 5A7FA 1NDUA 5DEIA 3ZCSA 4K0KB 3DBHA 1OZGA 3AXSA 4E85A 3DHYA 1E58A 1IQ0A 3INTA 3OLYA 4DABA 3IPCA 2NU6A 2O1XA 1JIVA 3N6XA 3O95A 2IEAA 3FYUB 3F4BA 3ZI4A 4LTDA 5EZSA 1DFGA 3ZJUA 2QEQA 3VOAA 4F4DA 4ZICA 5IABA 1FVFA 4LW8A 3DT9A 3GGDA 2Q1SA 5JRDS 5KTOA 2PZMA 5KQLA 3IH5A 4FYIA 1L5KA 4EQ6A 4GICA 1OAKA 3O8RA 3A6DA 3WL4A 3HY6A 2EF1A 3BHJA 2P6NA 2ZJZA 5K45A 4H3VA 1P6UA 4OHVA 4E1AA 1VBFA 3OWXA 1TM5E 4U2DA 1IMJA 4DR4B 4XVQA 4MROA 4B6FA 1S8NA 3BE4A 5TPZA 3NYWA 2ZT6A 3WDMA 4HVAA 8LDHA 1MGOA 1KO4A 3R7DA 1FFSA 4BP3A 4IRMA 2I2BA 2QX8A 2BTQB 3HY4A 4FI3C 2B0OE 1I2CA 3PSAA 1ECPA 1ZH6A 3VA7A 1HLDA 3EQ8A 2HADA 5KBYA 1SC6A 1NZNA 3K6JA 1E2FA 3QKWA 3PHCA 2E2WA 3J80A 2JGMA 2JDIA 1B0AA 4G85A 2EKDA 2I71A 3F6CA 4K9QA 3MTEA 2PQ0A 4I5GA 3CT6A 4LTNA 1LRLA 3LBHA 4HDSA 1EHCA 3EFEA 3KKMA 3MTQA 1XP8A 4P4TA 3V79K 2QAGC 3RCBA 3I39X 4NFLA 3FMIA 3I58A 3U5TA 1G17A 4NK4A 2ZVQX 4EECA 4YIKA 4WN9B 1LFAA 3N1UA 4ZEXA 3RR2A 5I7FA 3H2HA 5FOXA 5SZKB 1VFPA 4CQMB 4YRZA 1EX7A 3BRWD 2QL9A 1ZESA 3FRJA 3SLRA 5E1OA 4ZVMA 3KXLA 4LG6A 5ALJA 3ASFA 3P71T 4RVSA 1B41A 1XTIA 5ARGA 3RVRA 3LCJA 4R2JA 3OXGA 2B34A 5F4BA 5KJKA 4AKTA 1FDVA 2HMYB 5HCNA 4ZDIA 4D99A 3OZFA 1O0SA 4QOFA 2C31A 3SHVA 3IOBA 4RSMA 3ROXA 4JB0A 1TT5A 5IKOA 3ZH2A 1GZHB 3U4QA 4K8RB 3FNQA 3IMEA 1PR4A 3L7CA 1CUJA 3ZCPA 4XJTA 3Q2IA 3PHJA 2C5EA 2CLKB 5ITWA 3AKZA 1CK4A 4RTNA 3RNLA 3MLEA 4XDGA 1E3EA 3DEPA 1M1XB 1PTJC 2XXAB 3LK6A 3WC4A 2OKCA 2J3JA 2A9KA 1QIFA 4WWOA 4O29A 2HBYA 4OLHA 5AVUA 3W5VA 1KZ1A 1RWWA 4MVJA 3KIPA 4QU5A 2G17A 4XA8A 1MZVA 3B36A 4WZZA 1Y1QA 5BN3B 5DNCA 3AKDA 3ACCA 4P7BA 1J8VA 5GZ6A 4UYKB 2FFHA 1JJIA 1ADBA 1KHTA 1ACLA 4WJLA 1J33A 4IOMA 4BZPA 1R4NA 3CCCA 5CAEB 3E9CA 1NW9B 2JRLA 1YZNA 1NMQA 1EFPB 3QV1A 1XNRB 4GX2A 1RHJA 2WKSA 3H97A 4MVWA 3L4SO 5JAMA 1BJTA 1P2GA 3WJ7A 1JLHA 4AJLA 3VX3A 1N0HA 4OSPA 5JZMA 2H1OA 2ATXA 1L9KA 1W5SA 2D7DA 1O3YA 1ULZA 1DI0A 4BAUA 5HCIA 2YINA 2CY0A 1CERA 4ABNA 3L7AA 3U0BA 2R5SA 4KYVA 3PC3A 3ZWWA 3WGZA 4IJMA 3C70A 3O8QA 4LGYA 1QE3A 1OGIA 4M0PA 3HV0A 3PRYA 2R4TA 3IAHA 2LCFA 1NVUQ 4DR7B 1U2GA 1KDPA 1WW8A 3F6SA 4CV1A 2CVHA 5GIPE 1WXEA 5JUWA 5CP8A 1LBTA 4JNCA 2GEFA 3NUZA 4JLPA 5JD6A 4I50A 3OLQA 1X15A 1T2FA 2INGX 3GFTA 2DZNA 4IWXA 2H6IA 1G1MA 2VL7A 1PI3A 1YBVA 1FJGB 5AVWA 3WWYA 1KE1A 4LZAA 5KX5B 2IOLA 1DSSG 5I7RA 2O59A 5KYYA 1EU1A 4FR2A 2H2FA 1CU1A 3ASOE 3PGMA 3DQPA 3RFTA 4MUFA 3FKSA 4ZU1X 5AVVA 5IMSA 5IZCC 5ANRB 4G23A 2L0IA 5FWNA 5FNZA 4FBMA 4L22A 3WNCA 3ZCVA 2H48A 2FGKA 4R1NA 3KOMA 3HSSA 5D66A 3ZGZA 4AD8A 1N6LA 2NZJA 4WNAA 4GA2A 2CXSA 5FWYA 3ES9A 5JBIA 3R6LA 2JGLA 4Q3AA 2VZ0A 1V1RA 3PC8C 4DIOA 3OXFA 2CHXA 4J7UA 4R8SA 1I0IA 1KEEB 4UNQA 4KK3A 2JS7A 4EY4A 2ZAMA 5LDGA 2FWBA 3IXEA 2JD0A 5ER6A 3L1VA 2X7XA 2DT8A 1Z63A 5F64A 4LHZA 1E64A 3U4CA 2Q4BA 3LIIA 2I66A 4DX7D 3A4MA 5C80A 4L28A 5JQGA 1VM6A 4RD3A 4BN0A 2FW8A 3ZGLA 3WLNA 3TSCA 4J3JA 2VWHA 2PH5A 3GDGA 1O87A 4U2CA 2BR3A 4NMMA 1U3GA 2QRKA 2H1IA 1P39A 2EP8A 4KQHA 2HXSA 3SEAA 3IP8A 2B25A 4WNIA 1OI3A 1AK9A 1YZVA 3CV3A 4EG5A 4L5CA 2O3SA 3GVXA 1X42A 2AIRA 3DDOA 3HJCA 1GUFA 2H4JA 4AKSA 3PXGA 4XPIA 4OBXA 2G9VA 5JC8A 3FTZA 5BN4B 4HQFA 3LKBA 4NWIA 2Q5EA 2CMGA 1JLKA 2R17C 3N3AC 4CKWA 3HXKA 3LBYA 5LQJA 4KMRA 3H5LA 2IOFA 4R8KA 1Q7GA 2PUTA 3L4KA 2JB9A 1KY3A 5BNZA 1RLTA 4K5QA 1N1GA 3GUYA 3UM1A 1UK9A 1M0TA 2J4FA 2TRSB 1FYFA 5AW7A 4QXQA 3OFKA 5DWVA 2IPAB 2IYAA 4LJ8A 2X0JA 5BVGA 3AEUB 4MIYA 3RVLA 3LM8A 4IO1A 5TF0A 1SO8A 2H0QA 3VLEA 4H7FA 2EFEB 5AYWD 1U5BB 2FR8A 1QKIA 1UBRS 4CLRA 4WY8A 4C1NA 2GPYA 2ZAGA 4RXMA 3R9KA 2PNJA 3FHTA 3HBNA 2PL9A 3QJZA 4DCCA 3KEQA 3CURA 5BNTA 3LZCA 3UI2A 2WHPA 3IEVA 2Q6IA 3FD8A 3KKLA 2E4VA 1CUVA 3VH4A 2GO7A 3UANA 1EAYA 3GT7A 3PEUA 3NRCA 3MT9A 1JPNA 2EFYA 3QXSA 2FSHA 4U07A 4WI1A 4B2PA 1G0OA 3LWDA 3AZPA 2CSXA 3MWEB 4YALA 2ALJA 4BBAA 1USUA 1HEIA 4P6VF 4F2PA 2KI5A 2F43B 3V42A 1AGXA 2A84A 4JYBA 4WLVA 1E96B 1Z0UA 4RFVA 5JCZA 4E3WA 2BF7A 3S7BA 4P3KA 1P3DA 1X5BA 5I4KA 1C50A 3GLGB 3O31A 4WBXC 3I5UA 4S1OA 3MIZA 3RO2A 4PS7A 3OE1A 2J07A 2PV0A 2A0WA 1R8JA 3HYLA 4JC8A 2FN3A 4FS8A 3S0JA 4UQLA 3CN7A 3ECCA 1P29A 3IBYA 4AJNA 4AO6A 3QVGA 3SFTA 3GJ3A 3HNRA 5AKLA 3WGOA 3ZZUA 4P93A 4UXHA 3WIBA 1J0CA 2QRLA 2J0UA 2FPRA 3LMKA 3GO4A 4QC2A 3W6PA 3VTFA 3TVDA 1HTWA 3UCEA 4HB5A 5FQ7A 3W3AD 2CLDX 1RYMA 1MG5A 4DLVA 3TR6A 5B7NA 2XWBF 1W7AA 4DCGA 5M29A 1RIFA 5AARA 4FSDA 2Y4TA 1EYHA 1ZO8A 1LD8A 1ZLYA 5C34B 3A9CA 1KC3A 4JX8A 3BK2A 5AVQA 5FZRA 2J0SA 1ZM7A 1E3MA 1X38A 4NFHA 2F4NA 2XCIA 3ROPA 1DKQA 2JFGA 3NXKA 2NQ2C 1ZRNA 2GZ1A 1E6MA 1V47A 1D1QA 3A9RA 2FPPA 1E5TA 3Q12A 1PZFA 2O0JA 3MGCA 3SC3A 5JMWA 1L1QA 2FSSA 4G4JA 4PHFA 1N5OX 2V6GA 3PI7A 4D42A 1W9HA 4CMHA 4E7PA 2JPDA 1C9EA 4HRNA 4E6HA 1U3DA 2FA9A 5C1OA 1Y3CE 4WBSA 2BSQA 3ROFA 1F1BA 2WHXA 2Z2IA 1A82A 2BFBA 2PT9A 3I9FA 2GCGA 1G5IA 1YDWA 1WQ3A 2AZ4A 4AKGA 4HDSB 4BO7A 3MUEA 1IYZA 3MRVA 3RUIA 4BFUA 3LXRA 2WU1A 4KVMA 3TAUA 1SHTX 1LBEA 5AH0A 4J0FA 1Y34E 3JYSA 3U26A 4DQXA 1P2BA 3G5UA 1K88A 5C46F 3MB5A 1VJ0A 4FDTA 3GBPA 5GM1A 4QVKA 4Z0PA 2VDOB 4HEA1 4UDOA 4DCNA 3T4PA 3QJGA 1KPHA 4M1MA 1KSGA 5EJFA 4BQSA 3RROA 5ALDA 3F8SA 4HXFB 3D8BA 2GN8A 4PUCA 2G4LA 3VDXA 2QTNA 3KPUA 2I7TA 4IFBA 5EJ8A 4IDFA 1DHRA 4KGVA 3PJFA 1VYUA 3FVVA 1B16A 1W93A 4AJKA 3EGCA 2YYSA 4EOGA 2AYZA 3B70A 4P53A 5CFRA 3EK2A 4LCEA 2GFHA 4BIIA 2QQ5A 4J9UE 1JH9A 3Q5DA 3ABKE 2HSZA 5ADVA 1QF7A 3I9KA 4ANWA 4FE3A 1P5QA 5HX7A 5CDSA 4JGBA 4P3YA 3FXAA 4AWBA 4L0CA 1E8YA 3DHWC 1ZCBA 4TN5A 4FE4A 5TPZD 3TSOA 4QYSA 1NN3A 5E6RA 5BXYA 1TTQB 4G8BA 1KVRA 3RIGA 2QRGA 2ODBA 1FJ2A 4L3VA 1VMKA 4AFNA 4WZBA 2FMFA 4LFBB 1RLIA 3ZR4B 1QRRA 3RFVA 3TW8A 4RQAA 4QECA 1Z3CA 4GE0A 3D9HA 1NJFA 3CVVA 3VNRA 4C48B 3V4PB 1FSFA 3PZRA 1GAEO 1R4NB 4UWKA 1VLVA 1OXTA 4J16C 4F96A 1E8WA 5FULA 2I9CA 4QPPA 4RM2A 1FTYA 4UU7A 4YCDA 2YNQA 1RQ7A 2FSIA 4E22A 4ETNA 1ESNA 3CR7A 3R5KA 1LDMA 1VJDA 2H54A 2WC1A 3QWWA 5FYDA 5KJFA 3PQDA 3JPWA 2Y6UA 3OT5A 2HDWA 2NYAA 3AG6A 5ISMA 1UWKA 3MQ4A 2QU7A 2DYRE 3ZDYB 4DNQA 1ODIA 1JAIA 4DRXE 2QM8A 4KSCA 2I6SA 5DBGA 1MC1A 1I32A 3ONNA 1QYWA 2DT5A 1CY8A 5FLKA 4IFTA 3U6KA 3EQ9A 4HLLA 3SQWA 4MPTA 1ZCJA 5LJIA 5G04C 2H1FA 3A3NA 1MABA 3RHZA 2QP3A 3O8QB 4KQ2A 1WETA 5CLHA 1ZMRA 5EJ5A 3T1VA 3GLUA 4YCAA 3KQSA 1Z36A 4QJ3A 4ZEMA 3HVIA 1J4AA 3ESLA 1SVOA 5AVOA 4ZRNA 1K7SN 2V5FA 3JQCA 1XF9A 2WM8A 2WUGA 5C0OE 4AUMA 2Y76A 2QOEA 2WT4A 4YJHB 5DO9A 1GL3A 3Q6MA 3HE3A 2YW9A 4YAOA 4I50B 5MN6A 3HMKA 1QK5A 4AKXB 4HLUA 3W5HA 1GLNA 3G3EA 3GDOA 3ZE2B 1H3EA 1RRGA 3QEMA 2GM3A 2AG8A 2YYYA 3LL4A 3EVNA 5KYYB 1I3LA 3NBZC 1K2VN 1K92A 3K2IA 2R48A 4TMYA 3QKIA 4R69A 3F1LA 3RTCA 4O3MA 4J0CA 2JATA 1E59A 4BB0A 1WF3A 4EYQA 3H5TA 3K5WA 1LLFA 3AM4A 3D2AA 3W2GA 3ZBQA 5CXUA 3RS0A 3NM5A 3UTDA 3R9XA 1IPFA 3LCVB 4YCLA 3IKTA 2C2MA 1BH6A 3EZ6A 4AG5A 4KBQA 1CNEA 3QM1A 1ZGBA 4PO1A 3F8TA 4EW1A 5FWYB 4LWZA 2HHHB 1ISMA 3K71B 1C5KA 1V1RB 3FCAA 4Q24A 1HLPA 4QREA 3V8QA 1YRYE 2XUFA 1YK0A 5FWXA 4Q39A 3TTTA 3ONKA 3LS2A 4C04A 1ORWA 3SBTB 1H66A 3DG9A 3T9AA 3CMMA 3QBEA 4KXWA 3EZ2A 2V3CC 1SD2A 3B3AA 5ARDA 1SBHA 5JQGB 1YCFA 4Q96A 3SXUB 3H04A 1OAOC 3EDRA 3A1DA 5KJMA 8ABPA 5TJHA 4L3WA 4C03A 4OHFA 3PZDA 2DUJA 3OBBA 5JMOA 3BZBA 1T9GS 1I3NA 4PYNA 5I8WA 1QZTA 1BRTA 1U8XX 2R751 2IHKA 5K5EA 2J31A 4XPIB 5ADHA 4QDUA 1ZICA 1HPLA 1PDWA 4YR9A 3BGVA 1RJDA 4XR9A 4MJ7A 4CKWB 2BE9A 5AVTA 3LE8A 2OOSA 4FNMA 4IDPA 3BH7A 1XRRA 3I6ZA 4O59O 5AJVB 1ETUA 3BJIC 5FAKA 4KR3A 4QXRA 2YCLA 2ISCA 3IR7A 1ZHOA 3GLIA 9LDTA 4KOAA 4F97A 4GR5A 2FFBA 3F47A 3HXTA 5BVGB 3IBCA 1WPXA 4OXRA 1DKOA 4R5HA 3IEMA 3WLLA 4H1UA 4N4AA 4CLRB 3L7JA 2FJEB 2HTEA 4DR1B 3ZRHA 3KC2A 4DHEA 5WRFA 3O21A 3D8TA 5JJCA 3DGEC 2WHPB 3WY9A 1XZAA 1ZQ9A 4QUJA 3BIJA 3TOSA 3N2LA 3TMAA 1PGNA 5J4LA 3DDNA 4FYWA 2NPOA 5BMVA 1XJCA 4B82A 3PIRA 4K6HA 3CW2A 5LQAA 2VQDA 4BKOA 3Q3VA 4QTXA 1K68A 3A7DA 3WRWA 5HQ3A 3FE2A 4MKIA 4N9WA 3AR4A 4QXPA 2N75A 3AW8A 4PZAA 5FF9A 4EBAG 3CF0A 7ABPA 1FMFA 2YZGA 3UJ8A 1YUNA 4LMRA 1YJCA 5JHBA 2YWHA 4UDNA 2YJ5A 1FLVA 4FJ0A 2IP1A 2JIZA 3QMMA 2YYAA 4ZANA 3G9ZA 2V1XA 5EJ2A 3D7KA 2DLNA 5BWLA 1EDZA 1IUKA 3PZ4A 2ZI7A 1TYZA 2Q5QA 4RY2A 2BBTA 3N8GA 3QVGB 1PFUA 2BHLA 2E5WA 2WSBA 2XBLA 1N36B 4UBOA 2JVIA 1JXMA 4JP1A 1U0SY 1ZVKA 4KIFA 4Q82A 2CG2A 2J0UB 4APFA 2YOFA 2ZXEA 3LJNA 5DP2A 4P0TA 1JMYA 3N5KA 2C2OA 1NIJA 1U1CA 3WA7A 5LNK6 1HKHA 2VHCA 2XDWA 2Q2QA 1L4HA 1CE8A 2PGNA 4DR2B 4DC9A 3K1ZA 4Z3OA 4X6XA 3TEFA 2A9OA 2BI4A 2P90A 2ADMA 2QSUA 4N5MA 3UJ3X 1XTZA 3ISMC 4ZV7A 3OIGA 3IUPA 5ITZF 3ZD7A 3GRRA 3LS8A 1ILEA 3HWSA 3FPJA 1EP1B 1U81A 3DXKG 2XA1A 3IDSA 2C3MA 1GV0A 3ROMA 4UHKA 5EIEA 2B2XA 4HJRA 4HX2A 3AG1E 3KPWA 4Z9AA 3B1YA 1OWOA 4DSTA 3EDOA 2WXFA 2HR1A 1F6DA 2HRRA 3MJSA 1OQAA 1T3ZA 2OXTA 1KNXA 4PRKA 2BFBB 4C2TA 2V74B 3O73A 2IUUA 5B7QA 4OUKX 3CXUA 3OJLA 4P2GA 2R4UA 2VCHA 3AL0C 4H7KA 1I2ZA 1XLUA 4I9NA 4A0RA 1RWVA 2Q2OA 1DQSA 3D1LA 3QFTA 3NZEA 2FXVA 2O8VA 2QHXA 4DW8A 5K3CA 4A92A 3GEEA 5GJWC 2HSGA 1B2LA 1PY1A 5J59A 3ZN3A 3KYCA 5I01A 4NYMQ 2J6HA 3QKSA 2JFBA 1D8AA 4QT0A 3OCZA 3ZWQA 5G2OA 1ZMXA 4NFYA 3PQEA 1PV2A 5ENZA 2AW6A 2L17A 3WLEA 4Z54A 1FMCA 1QVWA 4KZKA 3C2QA 3PHIA 1Q22A 4GO1A 4ISCA 3QRWA 3SAJA 3HNOA 1JF8A 4OXIA 2OD2A 3BDIA 2IIVA 5EGSA 1P3JA 2CYAA 2JI7A 3VR4A 2WF5A 5E4YA 4R2XA 3CA8A 3K5IA 4X5OA 1IBMB 5TRTA 3NIWA 5HBGA 2WLTA 3EZLA 2RBGA 4YEDA 5GJVC 4J1SA 3IHLA 5EAIA 4I1AA 3PWZA 3A4IA 4WFKA 3PFCA 3IUMA 1WAO1 4NP6A 1QU2A 3PJRA 2ZAOA 2Y0EA 4H31A 3TINA 3QMPA 2YZ2A 1TVKA 4B5KA 1DAKA 3VKFA 4ZI7A 4KUEA 4FJZA 1V7QA 3NP7A 2Z5LA 5F3RA 4IL5A 1J70A 1Y6QA 5FOSA 3TW8B 3FRIA 2I2FA 4B4WA 5G05C 3IYLW 5TY0A 1V9SA 4TV9B 1PDOA 2J67A 5JZVA 4YHHB 1QR6A 2AC2A 3HBMA 1QG6A 1YFZA 4R2IA 4BETA 4YRQA 4CDMA 3TNJA 3U0VA 2GXAA 4IGKA 3LQFA