4CDVA

Spectroscopically-validated structure of cytochrome c prime from alcaligenes xylosoxidans, reduced by x-ray irradiation at 100k
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fingerprinting Redox and Ligand States in Haemprotein Crystal Structures Using Resonance Raman Spectroscopy.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2013-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cdvA00
1LM3B 4D4NA 1CPRA 2YL7A 3U8PA 4WGYA 2XM4A 2YKZA 1EKYA 2YL3A 4N6HA 3DE9A 4U9DA 1E86A 5JT4A 3L1MA 4IARA 3ZWIA 2XLHA 1S05A 1JAFA 4EIYA 1CPQA 1CGNA 4N4WA 4WGZA 5JRAA 3HNLA 1MQVA 4IAQA 3ZQYA 2J9BA 4JEAA 3M79A 256BA 2XLVA 3ZTZA 3NMJA 2YLGA 3M4BA 2BC5A 3DE8A 4CJGA 4D4XA 1GQAA 3QW0A 3TOLA 4JE9A 5JS5A 2QLAA 4L6RA 4ULVA 1E85A 1YZCA 1E83A 3IQ6A 3ZTMA 3M15A 2XLMA 2XLEA 2YL0A 3ZQVA 5JSLA 2XLWA 3HNKA 3C62A 2J8WA 2CCYA 4CDAA 3NMKA 1NBBA 2XLDA 1YZAA 4JEBA 5JUAA 1YYXA 3VRCA 4IB4A 1E84A 5JLIA 3FOPA 4U9EA 3HNJA 3NMIA 3QVZA 1M6TA 3M4CA 3HNIA 2XM0A 1APCA 5B3IA 1CGOA 3QVYA 1QPUA 5JP7A 3C63A 4CDYA 4JKVA 3IQ5A 2YL1A 4CX9A 4ER9A 2YLIA 1RCPA 3FOOA 2YLDA 3TOMA 1QQ3A 4CIPA 2XLOA 4NC3A 3QW1A 4CJOA 2XL8A 1BBHA 5AGFA 1YYJA 2XL6A 4CDVA 5JVEA 1A7VA
chains in the Genus database with same CATH superfamily
5AC4A 2EIMC 1Q0MA 1LM3B 4MNDA 4D4NA 1TR2A 2YL7A 3U8PA 1UFBA 2PX0A 2VB6A 4MVSA 2Q00A 4PK4A 2LFFA 2WVOA 4LDRA 2LSEA 4YL3A 3R7CA 1ZYRF 4QI2A 2Q9BA 2Y3GA 1O5HA 1NU9C 1Z23A 2RD9A 3SNHA 3SXYA 1E86A 1BZ4A 2ZXOA 1QVXA 3DAFA 4U5EE 3CAXA 4IAOA 3ZWIA 2XLHA 3CZ6A 1AUEA 1V74B 4OD5A 4A4AA 1CPQA 2G3VA 1L7CA 1OR3A 4WGZA 3VAYA 3W4YA 2IXPA 4EIYA 5JRAA 3ZQYA 1MQVA 2HMZA 5T3WA 2J9BA 3JZ0A 4HE8D 3NKEA 4AL1A 2RSEB 5L0DA 1T9KA 5B1AC 2EIKC 2XLVA 3ASOC 1Z5ZA 4GQHA 4YN0B 4YL1A 2Y69C 1OCOC 1N1CA 1BDJB 3WODF 2B0HA 2Q4FA 4AE4A 5E2QA 1NU7D 2R7OA 3Q6NA 2CNWD 3QW0A 3UMIA 1Z3IX 4CBEA 3G4ZA 3EZIA 3TOLA 2J9VA 4JE9A 2GDCA 1FAPB 1TWAA 5JS5A 1GGQA 5KYYB 3DKAA 4L6RA 1FTSA 3MLGA 2VCBA 4E0IA 1T5OA 4EBJA 5DLJA 4NCQA 3ITFA 2VASA 3GM3A 3O10A 1L3PA 1E83A 4NTFA 3ZTMA 5T1DB 3B71A 3ZQVA 3RW0A 4AX2A 1G4WR 2CW0F 4PACA 3JRMO 1WASA 1MMNA 3K1IA 1TWHA 2CCYA 4BPMA 1BR2A 4CDAA 2M64A 4FWVA 1VYIA 3NG1A 2W4BA 1MMGA 2GWWA 4PR9A 3DMDA 4Q5SF 1H6GA 4NTBA 1I5NA 3TJ5A 1YYXA 3EH1A 3C8GD 3O6XA 1GS9A 3Q7GA 1E84A 4IGGA 4EWCA 3IQTA 2GAQA 3U9JA 3K6BA 3W8IA 2G62A 3SEOA 1M6TA 3OEOA 3VM6A 4KI2A 3HNIA 2I15A 1H9TA 1APCA 3H2UA 1CGOA 2Z15A 2NUTB 3G50A 1LE2A 2F22A 1HMDA 3Q7LA 1VB5A 4XEFA 1E2XA 2MYSA 1FFTC 1NG1A 1QLEC 4MVMA 4DBRA 3C63A 4JTDB 3ZDLA 5DS4A 1EI7A 5KYWB 2NUPB 3IQ5A 3O55A 4JKVA 1NZEA 3CSKA 4CX9A 2NG1A 3K33A 1WWPA 4ZLDA 1U89A 3N24A 4H54A 1ORJA 2YEVA 4CSAC 3JCUQ 1J8YF 2YLDA 4QDLA 3UNGC 4OIPF 2A68F 2AVKA 2P7VA 1VK5A 3AG1C 3K1HA 4R32A 5KYNA 5HSWA 3TOMA 2TMVP 5HV9A 1DOWA 2IOQA 3ASNC 2OKUA 3I4UA 3MX3A 4JRZA 4WJ0A 3JT1A 1HW1A 4YK5A 4OIRF 2XLOA 2YVKA 2H8AA 1RMVA 1EA8A 5F5HA 3LEVA 1SF8A 2P0NA 3HJCA 3MBGA 1PD0A 2WB7A 2XS8A 3EHMA 3GM1A 2A69F 4FESA 3RQGA 4KNWA 5AGFA 5FZTA 3JSZA 4KNVA 2OJED 2GFHA 3S29A 3KYJA 4O7GA 2R7RA 2HV7A 1ST6A 3GWLA 3KKBA 3KPHA 2A0BA 5JVEA 1A7VA 2A1DD 1H9GA 3EG9A 4E18A 3AG2C 4U5DE 1CPRA 1K05A 3PCVA 4DVZA 3GM2A 4IRUA 3FMSA 2XM4A 1FFHA 1LI5A 2KYHA 4LERA 4JCHA 2JPUA 1LS1A 1LS4A 2Q3TA 3K1IC 4G7OF 3Q6MA 1D1BA 1VYKA 4U9DA 4C3DA 3X1OA 2R7UA 4MVUA 2EPKX 4O79A 4X0RA 1WTYA 2LCHA 3L1MA 4DXWA 2OEVA 3LLKA 4CS9A 2R25A 2ETSA 3AQCA 4E17A 4XEKA 5KYXB 2C04A 1V55C 1M2OA 1S05A 1Y6DA 2P6VA 1OCZC 2Q7RA 4DRJB 2R7WA 3DZAA 1VMAA 1HE1A 1OXBA 3LAYA 5F5FA 3ABLC 4G7ZF 1K40A 3HNLA 5L0CA 4ULWA 1AVOB 4JEAA 1A7DA 5AC5A 4JTAB 3LS1A 2P1AA 2V3CC 3LNMB 2EILC 1YVIA 2DYSC 3ZTZA 4GYTA 4DVYP 2QY9A 3W8HA 1XZQA 1D1CA 3V7OA 4C7OA 2R7XA 4HEAJ 4AK9A 4D4XA 1ZZPA 2HSBA 4XEVA 3X2QC 2XSEA 1KNYA 1YA7O 4FX5A 1QZXA 2AWYA 1D0YA 4H4KC 4EBBA 1G4US 2PX3A 5E3AA 2OG2A 3RFYA 1E85A 1A7EA 1OCRC 1TFOB 1ZHWA 1OCCC 3A11A 4U5GA 3U9MA 3SZRA 1OW7A 3NRHA 3ZC4A 4BJTA 2H7VC 3UGOA 3DJUB 1G5ZA 2OOCA 1V54C 4AL0A 1OXKA 1JRAA 3IPMO 2XLWA 4C7OB 1YAUO 2V26A 1ZW2A 1NFOA 1O3UA 3KYIA 5COFA 4G0HA 5EK0A 2X0CA 2J8WA 5L3VA 2HZ8A 1OKKA 4J7YA 3NMKA 1RJ9A 5A6JA 4LDQA 2IM8A 4G78A 4YJWA 2QE9A 2JX0A 3M1CB 3GEIA 4JEBA 5T3TA 3U2LA 3DJNB 5JUAA 3VRCA 4J32B 5JLIA 3FOPA 4U9EA 3OA1A 4O6MA 4YWQA 2L81A 3HLZA 1SMYF 4YT2A 2Y3HA 5B3IA 3QVYA 5KYYA 1T01A 3SXZA 5KYUA 5EHHA 4JIOA 1GM5A 1HW2A 3WHNA 4CS9C 3S90A 5JP7A 2ZXWC 4W8PA 4CS8A 4ONSA 1RKEA 2J45A 4LACB 4CDYA 2YL1A 4O6YA 1D0XA 2YZSA 3C8GA 3FDQA 1YDIA 2OCCC 3QMKA 2AWCA 4GEHA 5F28E 2Q9CA 4K0DA 3T4RA 3T6GB 4F4BA 3QTHA 3I5QA 4DJ9A 3LNRA 4BJ5C 2H7OA 4G7HF 3T6BA 4CIPA 2HJMA 5DS6A 2CDQA 2DB4A 2YQYA 3R2PA 4YL0A 4CIHA 2XRHA 1RKCA 1R4TA 2MHRA 3GEEA 2PFDA 3H2VA 1JOGA 3SXKA 3JYYA 2E87A 2XL4A 3RKOF 4DOZA 5DVWA 3RVYA 4BEMJ 4FAPB 3SP1A 1YYJA 2XL6A 3IHUA 5A6BD 4Q4ZF 5D91A 1VTMP 3EJNA 4XPYA 4CDVA 3PHF2 1YLMA 4OIQF 2L6FA 1RXQA 2R03A 2NUTA 2ZXRA 4EKWA 4RD9A 1Q0KA 2ASRA 2A6EF 1M56C 3KMIA 3TULA 2IXMA 3DM9B 3K66A 4WGYA 5COGA 5L0GA 2J46A 5DQTA 4ZLCA 2HS5A 3U5SA 3AJMA 2FAPB 2DYRC 2L7AA 5KYXA 3DE9A 2LP4A 1LI7A 3C18A 5D92A 3FXHA 5DS5A 3AQBA 5BUOA 3S0XA 4I1MA 1NFNA 3E9VA 4IARA 2D4UA 3C7JA 1WN0A 2ZXPA 2R9RB 1RKEB 1JAFA 2KK1A 4RBNA 4XTKA 2EINC 2LIGA 4N4WA 1SYQA 1DOVA 1O87A 1T6QA 1ZHZA 3HKKA 4LLCA 1OQCA 4Z9HA 3TD7A 4EBKA 4UDVA 2FGYA 4MQ9F 5L0HA 3EQLF 1D0ZA 2OEXA 2W45A 4W8KA 3CEXA 3HTKC 1JPNA 2HMQA 4DRHB 256BA 3KH2A 3L8JA 3DAGA 3L34A 2Y3BA 1B68A 5CIVA 3ZVRA 3NDBB 2W9YA 1MMAA 1ZU4A 1V4AA 1C17M 1OKKD 2KQ9A 3MFNA 2W4MA 3H65A 3AG4C 1A41A 2QLAA 1UG7A 1ZHXA 5L0FA 4ULVA 2EPNA 2EPMX 2HKVA 1YZCA 4ANJA 1XZPA 5B3SC 2MWQA 2HSQA 4QI0A 4EUKB 1EQ1A 2IXNA 3QZCA 1F1MA 3BRJA 5L3QA 2HV6A 2HJ3A 3EPVA 3B0VC 4YT8A 4XQ1A 2XLMA 3EH2A 1VLSA 2XLEA 4U5HA 4E0HA 2KGOA 1Q0DA 2NPUA 3HNKA 3PMRA 3I5PA 1BR1A 3K7DA 3US6A 3S28A 1OW8A 3RH3A 1U0BB 1Z6AA 2LQGA 2LK4A 5B1BC 3ABMC 4O6NA 4U5CE 2XLDA 4N6CA 3DI5A 1YZAA 3U0CA 2R7SA 4P9TA 4CS7A 1K04A 2WVQA 1JR8A 3FHDA 3WAQA 1MMDA 4J7TA 3N0TA 2IYLD 2R7VA 4U5FE 3LJBA 2ZD9A 3HNJA 5A6AA 5KYUB 3MYIA 2J7PA 4PJJA 3WG7C 2CGEA 3DWWA 4RDAA 2Y39A 2XM0A 4IJJA 2LFDA 5KYWA 2VCCA 3O39A 4MVRA 5A69A 5COMA 3LUTB 3ECSA 3TJ6A 4PJMA 3V5ZA 3ZG1A 4DRIB 1QPUA 4Z9IA 4K7BA 4NY3A 5DQZA 4MVOA 3UR3C 3GWNA 1PCXA 2GA0A 4I44A 1SZIA 4A2NB 1Z7Qc 4U5BE 4JW1A 2L9JA 3EGXB 1A0BA 2IXOA 1S7ZA 3B9QA 1J8MF 4KC9A 1ZU5A 3JRTA 2B0JA 1FMVA 3TK0A 3U3FA 1ZVZA 3POVA 4KBLA 2KSFA 1RJ9B 3ABKC 2ZPAA 1QQ3A 2VH3A 4NQFA 2Q9AA 4P9FA 3ZIBA 4BJ6A 3KL4A 2XS1A 3IEEA 4MTFA 2XXAB 3DM5A 4CSAA 3OWTA 3UGPA 1OW6A 2WZFA 3EGDB 3QW1A 5BQGA 3B0UX 1C02A 2OU6A 1IW7F 4J30B 1Q0FA 3A9CA 2PP4A 2FFHA 3V5XA 3SYNA 2PBEA 4CS8C 3UMHA 4IWBA 4HFKB 3EFOA 2QNLA 5TJ5E 5A6KA 1TWCA 2AP3A 2YHSA 4B6IA 3LEOA 1TFKB 1YJGA 2EPOA 3S84A 4P6IC 2R02A 3LS0A 4PFPA 3AGTA 4XLPF 2IBFA 5K0IA 2EPLX 1QKRA 4LLEA 3EHNA 3T9OA 2UUHA 2YKZA 4I1OB 1EKYA 2YL3A 4N6HA 4JC7A 4HFFB 2A6HF 2D5RB 3EGXA 2L6GA 1ZHYA 1CGME 1KU2A 5JT4A 2OQMA 1Z63A 3JSEO 2A0UA 2NSFA 1JMWA 3JYHA 4BG0A 1NSGB 5CI8A 1HE9A 3C8ZA 1TQGA 3BEHA 4PFOA 3EFOB 2HUJA 3L8IA 2QTVA 2YRFA 2M4EA 2YWAA 3PDMP 2PF4E 2XXAA 1CGNA 3N2ZB 1H7IA 1M2VA 3NYMA 4JJFA 4OINF 4IAQA 3S9OA 1U6HA 1C03A 1IZMA 1WGWA 3AGUA 1FR0A 3LLIA 4WABA 3M79A 5FCLA 1SR2A 3RF3A 4JZAA 4MVQA 3NMJA 2YLGA 2R05A 2J9UA 3F46A 3FAJA 2KNHA 3GODA 5IY5C 4OIOF 1BR4A 4MTOA 3M4BA 1PD1A 1XWJA 2BC5A 3FAPB 3DE8A 4CJGA 4Z9JA 3RYLA 1GQAA 4DBQA 1ZW3A 1I4YA 2WZLA 3S27A 2J9WA 3T6JA 2VCAA 3EZHA 1YA9A 2I8BA 4MW8A 1WOLA 4E7SA 2J0WA 4NTAA 2DI3A 3UMKA 4C3EA 2BL2A 2OJQA 3B0PA 3F47A 4XPXA 1YARO 3NYJA 3IQ6A 3M15A 4E7ZA 2NUPA 1FNTc 2J0XA 5GPGB 2X51A 1WATA 2CYDA 2Y3DA 1AEPA 2YL0A 3E70C 1FMWA 4XWJA 5JSLA 3B29A 2G3KA 2H7BA 2CNWA 1HMOA 4MVZA 3C62A 3VYWA 2UUIA 3V5YA 3VF0A 1HY5A 1M2VB 4MTGA 1LE4A 1NBBA 1R5ID 2O9XA 2QUPA 1Q0GA 4K1OA 3GANA 1VLTA 3CQZA 2WVNA 5E3CA 4BEJA 3JTLO 4XLNF 2BE5F 5A6BA 4JTCB 4IB4A 1VOMA 4Q7CA 4M63A 3W2WA 4PJNA 2R7QA 1MNEA 3ATPA 1KTMA 3RQFA 3NMIA 3QVZA 1M57C 1T6UA 2WL8A 4JURI 3NKDA 3M4CA 3RQEA 1OR2A 5CI9A 1I4ZA 1LVKA 4I3MA 2DGJA 3EG9B 3LESA 4PJLA 4JCZA 3J06A 2HFIA 4OD4A 1LPEA 2VC9A 1W2WA 2ICWG 2NSGA 1NLXA 3NYLA 2EIJC 3AG3C 4BJ1A 4ER9A 3RVZA 1ORYA 3GEHA 3RIPA 4EHPA 2AU5A 2YLIA 1RCPA 1MNDA 2P61A 3U3BA 3W2VA 5L0IA 2R7TA 4BJ6C 1T6IA 2J7PD 3FOOA 3EGDA 1TKNA 3IQCA 4JVSA 1Y4CA 1D1AA 3C8GB 3MYFA 4XPWA 5EGYA 2JD3A 4AE4B 2PNOA 4LDKA 4YT5A 3L0IA 3DD7A 5BQIA 1PV3A 4N06A 4NC3A 2KJGA 1G8XA 4MS2A 3FVYA 1LKXA 3U8VA 3G4XA 3ZSUA 5L0JA 4BJ5A 3DXJF 3U2MA 1JPJA 1QSPA 4CJOA 2XL8A 1ORSC 1BBHA 2KW3C 2L6HA 4C3BA 3SXMA 2C03A 5BQHA 3AOUA 4YT4A 3GORA 5E33A 2WZGA 4JJGA 1TWGA 3TQOA 2KC3A 4MW3A 2LD6A 1LIHA 1ZHTA
chains in the Genus database with same CATH topology
1LM3B 4D4NA 1CPRA 2YL7A 3U8PA 4WGYA 2XM4A 2YKZA 1EKYA 2YL3A 4N6HA 3DE9A 4U9DA 1E86A 5JT4A 3L1MA 4IARA 3ZWIA 2XLHA 1S05A 1JAFA 4EIYA 1CPQA 1CGNA 4N4WA 4WGZA 5JRAA 3HNLA 1MQVA 4IAQA 3ZQYA 2J9BA 4JEAA 3M79A 256BA 2XLVA 3ZTZA 3NMJA 2YLGA 3M4BA 2BC5A 3DE8A 4CJGA 4D4XA 1GQAA 3QW0A 3TOLA 4JE9A 5JS5A 2QLAA 4L6RA 4ULVA 1E85A 1YZCA 1E83A 3IQ6A 3ZTMA 3M15A 2XLMA 2XLEA 2YL0A 3ZQVA 5JSLA 2XLWA 3HNKA 3C62A 2J8WA 2CCYA 4CDAA 3NMKA 1NBBA 2XLDA 1YZAA 4JEBA 5JUAA 1YYXA 3VRCA 4IB4A 1E84A 5JLIA 3FOPA 4U9EA 3HNJA 3NMIA 3QVZA 1M6TA 3M4CA 3HNIA 2XM0A 1APCA 5B3IA 1CGOA 3QVYA 1QPUA 5JP7A 3C63A 4CDYA 4JKVA 3IQ5A 2YL1A 4CX9A 4ER9A 2YLIA 1RCPA 3FOOA 2YLDA 3TOMA 1QQ3A 4CIPA 2XLOA 4NC3A 3QW1A 4CJOA 2XL8A 1BBHA 5AGFA 1YYJA 2XL6A 4CDVA 5JVEA 1A7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LM3 B;  4D4N A;  1CPR A;  2YL7 A;  3U8P A;  4WGY A;  2XM4 A;  2YKZ A;  1EKY A;  2YL3 A;  4N6H A;  3DE9 A;  4U9D A;  1E86 A;  5JT4 A;  3L1M A;  4IAR A;  3ZWI A;  2XLH A;  1S05 A;  1JAF A;  4EIY A;  1CPQ A;  1CGN A;  4N4W A;  4WGZ A;  5JRA A;  3HNL A;  1MQV A;  4IAQ A;  3ZQY A;  2J9B A;  4JEA A;  3M79 A;  256B A;  2XLV A;  3ZTZ A;  3NMJ A;  2YLG A;  3M4B A;  2BC5 A;  3DE8 A;  4CJG A;  4D4X A;  1GQA A;  3QW0 A;  3TOL A;  4JE9 A;  5JS5 A;  2QLA A;  4L6R A;  4ULV A;  1E85 A;  1YZC A;  1E83 A;  3IQ6 A;  3ZTM A;  3M15 A;  2XLM A;  2XLE A;  2YL0 A;  3ZQV A;  5JSL A;  2XLW A;  3HNK A;  3C62 A;  2J8W A;  2CCY A;  4CDA A;  3NMK A;  1NBB A;  2XLD A;  1YZA A;  4JEB A;  5JUA A;  1YYX A;  3VRC A;  4IB4 A;  1E84 A;  5JLI A;  3FOP A;  4U9E A;  3HNJ A;  3NMI A;  3QVZ A;  1M6T A;  3M4C A;  3HNI A;  2XM0 A;  1APC A;  5B3I A;  1CGO A;  3QVY A;  1QPU A;  5JP7 A;  3C63 A;  4CDY A;  4JKV A;  3IQ5 A;  2YL1 A;  4CX9 A;  4ER9 A;  2YLI A;  1RCP A;  3FOO A;  2YLD A;  3TOM A;  1QQ3 A;  4CIP A;  2XLO A;  4NC3 A;  3QW1 A;  4CJO A;  2XL8 A;  1BBH A;  5AGF A;  1YYJ A;  2XL6 A;  4CDV A;  5JVE A;  1A7V A; 
#chains in the Genus database with same CATH topology
 5AC4 A;  2EIM C;  1Q0M A;  1LM3 B;  4MND A;  4D4N A;  1TR2 A;  2YL7 A;  3U8P A;  1UFB A;  2PX0 A;  2VB6 A;  4MVS A;  2Q00 A;  4PK4 A;  2LFF A;  2WVO A;  4LDR A;  2LSE A;  4YL3 A;  3R7C A;  1ZYR F;  4QI2 A;  2Q9B A;  2Y3G A;  1O5H A;  1NU9 C;  1Z23 A;  2RD9 A;  3SNH A;  3SXY A;  1E86 A;  1BZ4 A;  2ZXO A;  1QVX A;  3DAF A;  4U5E E;  3CAX A;  4IAO A;  3ZWI A;  2XLH A;  3CZ6 A;  1AUE A;  1V74 B;  4OD5 A;  4A4A A;  1CPQ A;  2G3V A;  1L7C A;  1OR3 A;  4WGZ A;  3VAY A;  3W4Y A;  2IXP A;  4EIY A;  5JRA A;  3ZQY A;  1MQV A;  2HMZ A;  5T3W A;  2J9B A;  3JZ0 A;  4HE8 D;  3NKE A;  4AL1 A;  2RSE B;  5L0D A;  1T9K A;  5B1A C;  2EIK C;  2XLV A;  3ASO C;  1Z5Z A;  4GQH A;  4YN0 B;  4YL1 A;  2Y69 C;  1OCO C;  1N1C A;  1BDJ B;  3WOD F;  2B0H A;  2Q4F A;  4AE4 A;  5E2Q A;  1NU7 D;  2R7O A;  3Q6N A;  2CNW D;  3QW0 A;  3UMI A;  1Z3I X;  4CBE A;  3G4Z A;  3EZI A;  3TOL A;  2J9V A;  4JE9 A;  2GDC A;  1FAP B;  1TWA A;  5JS5 A;  1GGQ A;  5KYY B;  3DKA A;  4L6R A;  1FTS A;  3MLG A;  2VCB A;  4E0I A;  1T5O A;  4EBJ A;  5DLJ A;  4NCQ A;  3ITF A;  2VAS A;  3GM3 A;  3O10 A;  1L3P A;  1E83 A;  4NTF A;  3ZTM A;  5T1D B;  3B71 A;  3ZQV A;  3RW0 A;  4AX2 A;  1G4W R;  2CW0 F;  4PAC A;  3JRM O;  1WAS A;  1MMN A;  3K1I A;  1TWH A;  2CCY A;  4BPM A;  1BR2 A;  4CDA A;  2M64 A;  4FWV A;  1VYI A;  3NG1 A;  2W4B A;  1MMG A;  2GWW A;  4PR9 A;  3DMD A;  4Q5S F;  1H6G A;  4NTB A;  1I5N A;  3TJ5 A;  1YYX A;  3EH1 A;  3C8G D;  3O6X A;  1GS9 A;  3Q7G A;  1E84 A;  4IGG A;  4EWC A;  3IQT A;  2GAQ A;  3U9J A;  3K6B A;  3W8I A;  2G62 A;  3SEO A;  1M6T A;  3OEO A;  3VM6 A;  4KI2 A;  3HNI A;  2I15 A;  1H9T A;  1APC A;  3H2U A;  1CGO A;  2Z15 A;  2NUT B;  3G50 A;  1LE2 A;  2F22 A;  1HMD A;  3Q7L A;  1VB5 A;  4XEF A;  1E2X A;  2MYS A;  1FFT C;  1NG1 A;  1QLE C;  4MVM A;  4DBR A;  3C63 A;  4JTD B;  3ZDL A;  5DS4 A;  1EI7 A;  5KYW B;  2NUP B;  3IQ5 A;  3O55 A;  4JKV A;  1NZE A;  3CSK A;  4CX9 A;  2NG1 A;  3K33 A;  1WWP A;  4ZLD A;  1U89 A;  3N24 A;  4H54 A;  1ORJ A;  2YEV A;  4CSA C;  3JCU Q;  1J8Y F;  2YLD A;  4QDL A;  3UNG C;  4OIP F;  2A68 F;  2AVK A;  2P7V A;  1VK5 A;  3AG1 C;  3K1H A;  4R32 A;  5KYN A;  5HSW A;  3TOM A;  2TMV P;  5HV9 A;  1DOW A;  2IOQ A;  3ASN C;  2OKU A;  3I4U A;  3MX3 A;  4JRZ A;  4WJ0 A;  3JT1 A;  1HW1 A;  4YK5 A;  4OIR F;  2XLO A;  2YVK A;  2H8A A;  1RMV A;  1EA8 A;  5F5H A;  3LEV A;  1SF8 A;  2P0N A;  3HJC A;  3MBG A;  1PD0 A;  2WB7 A;  2XS8 A;  3EHM A;  3GM1 A;  2A69 F;  4FES A;  3RQG A;  4KNW A;  5AGF A;  5FZT A;  3JSZ A;  4KNV A;  2OJE D;  2GFH A;  3S29 A;  3KYJ A;  4O7G A;  2R7R A;  2HV7 A;  1ST6 A;  3GWL A;  3KKB A;  3KPH A;  2A0B A;  5JVE A;  1A7V A;  2A1D D;  1H9G A;  3EG9 A;  4E18 A;  3AG2 C;  4U5D E;  1CPR A;  1K05 A;  3PCV A;  4DVZ A;  3GM2 A;  4IRU A;  3FMS A;  2XM4 A;  1FFH A;  1LI5 A;  2KYH A;  4LER A;  4JCH A;  2JPU A;  1LS1 A;  1LS4 A;  2Q3T A;  3K1I C;  4G7O F;  3Q6M A;  1D1B A;  1VYK A;  4U9D A;  4C3D A;  3X1O A;  2R7U A;  4MVU A;  2EPK X;  4O79 A;  4X0R A;  1WTY A;  2LCH A;  3L1M A;  4DXW A;  2OEV A;  3LLK A;  4CS9 A;  2R25 A;  2ETS A;  3AQC A;  4E17 A;  4XEK A;  5KYX B;  2C04 A;  1V55 C;  1M2O A;  1S05 A;  1Y6D A;  2P6V A;  1OCZ C;  2Q7R A;  4DRJ B;  2R7W A;  3DZA A;  1VMA A;  1HE1 A;  1OXB A;  3LAY A;  5F5F A;  3ABL C;  4G7Z F;  1K40 A;  3HNL A;  5L0C A;  4ULW A;  1AVO B;  4JEA A;  1A7D A;  5AC5 A;  4JTA B;  3LS1 A;  2P1A A;  2V3C C;  3LNM B;  2EIL C;  1YVI A;  2DYS C;  3ZTZ A;  4GYT A;  4DVY P;  2QY9 A;  3W8H A;  1XZQ A;  1D1C A;  3V7O A;  4C7O A;  2R7X A;  4HEA J;  4AK9 A;  4D4X A;  1ZZP A;  2HSB A;  4XEV A;  3X2Q C;  2XSE A;  1KNY A;  1YA7 O;  4FX5 A;  1QZX A;  2AWY A;  1D0Y A;  4H4K C;  4EBB A;  1G4U S;  2PX3 A;  5E3A A;  2OG2 A;  3RFY A;  1E85 A;  1A7E A;  1OCR C;  1TFO B;  1ZHW A;  1OCC C;  3A11 A;  4U5G A;  3U9M A;  3SZR A;  1OW7 A;  3NRH A;  3ZC4 A;  4BJT A;  2H7V C;  3UGO A;  3DJU B;  1G5Z A;  2OOC A;  1V54 C;  4AL0 A;  1OXK A;  1JRA A;  3IPM O;  2XLW A;  4C7O B;  1YAU O;  2V26 A;  1ZW2 A;  1NFO A;  1O3U A;  3KYI A;  5COF A;  4G0H A;  5EK0 A;  2X0C A;  2J8W A;  5L3V A;  2HZ8 A;  1OKK A;  4J7Y A;  3NMK A;  1RJ9 A;  5A6J A;  4LDQ A;  2IM8 A;  4G78 A;  4YJW A;  2QE9 A;  2JX0 A;  3M1C B;  3GEI A;  4JEB A;  5T3T A;  3U2L A;  3DJN B;  5JUA A;  3VRC A;  4J32 B;  5JLI A;  3FOP A;  4U9E A;  3OA1 A;  4O6M A;  4YWQ A;  2L81 A;  3HLZ A;  1SMY F;  4YT2 A;  2Y3H A;  5B3I A;  3QVY A;  5KYY A;  1T01 A;  3SXZ A;  5KYU A;  5EHH A;  4JIO A;  1GM5 A;  1HW2 A;  3WHN A;  4CS9 C;  3S90 A;  5JP7 A;  2ZXW C;  4W8P A;  4CS8 A;  4ONS A;  1RKE A;  2J45 A;  4LAC B;  4CDY A;  2YL1 A;  4O6Y A;  1D0X A;  2YZS A;  3C8G A;  3FDQ A;  1YDI A;  2OCC C;  3QMK A;  2AWC A;  4GEH A;  5F28 E;  2Q9C A;  4K0D A;  3T4R A;  3T6G B;  4F4B A;  3QTH A;  3I5Q A;  4DJ9 A;  3LNR A;  4BJ5 C;  2H7O A;  4G7H F;  3T6B A;  4CIP A;  2HJM A;  5DS6 A;  2CDQ A;  2DB4 A;  2YQY A;  3R2P A;  4YL0 A;  4CIH A;  2XRH A;  1RKC A;  1R4T A;  2MHR A;  3GEE A;  2PFD A;  3H2V A;  1JOG A;  3SXK A;  3JYY A;  2E87 A;  2XL4 A;  3RKO F;  4DOZ A;  5DVW A;  3RVY A;  4BEM J;  4FAP B;  3SP1 A;  1YYJ A;  2XL6 A;  3IHU A;  5A6B D;  4Q4Z F;  5D91 A;  1VTM P;  3EJN A;  4XPY A;  4CDV A;  3PHF 2;  1YLM A;  4OIQ F;  2L6F A;  1RXQ A;  2R03 A;  2NUT A;  2ZXR A;  4EKW A;  4RD9 A;  1Q0K A;  2ASR A;  2A6E F;  1M56 C;  3KMI A;  3TUL A;  2IXM A;  3DM9 B;  3K66 A;  4WGY A;  5COG A;  5L0G A;  2J46 A;  5DQT A;  4ZLC A;  2HS5 A;  3U5S A;  3AJM A;  2FAP B;  2DYR C;  2L7A A;  5KYX A;  3DE9 A;  2LP4 A;  1LI7 A;  3C18 A;  5D92 A;  3FXH A;  5DS5 A;  3AQB A;  5BUO A;  3S0X A;  4I1M A;  1NFN A;  3E9V A;  4IAR A;  2D4U A;  3C7J A;  1WN0 A;  2ZXP A;  2R9R B;  1RKE B;  1JAF A;  2KK1 A;  4RBN A;  4XTK A;  2EIN C;  2LIG A;  4N4W A;  1SYQ A;  1DOV A;  1O87 A;  1T6Q A;  1ZHZ A;  3HKK A;  4LLC A;  1OQC A;  4Z9H A;  3TD7 A;  4EBK A;  4UDV A;  2FGY A;  4MQ9 F;  5L0H A;  3EQL F;  1D0Z A;  2OEX A;  2W45 A;  4W8K A;  3CEX A;  3HTK C;  1JPN A;  2HMQ A;  4DRH B;  256B A;  3KH2 A;  3L8J A;  3DAG A;  3L34 A;  2Y3B A;  1B68 A;  5CIV A;  3ZVR A;  3NDB B;  2W9Y A;  1MMA A;  1ZU4 A;  1V4A A;  1C17 M;  1OKK D;  2KQ9 A;  3MFN A;  2W4M A;  3H65 A;  3AG4 C;  1A41 A;  2QLA A;  1UG7 A;  1ZHX A;  5L0F A;  4ULV A;  2EPN A;  2EPM X;  2HKV A;  1YZC A;  4ANJ A;  1XZP A;  5B3S C;  2MWQ A;  2HSQ A;  4QI0 A;  4EUK B;  1EQ1 A;  2IXN A;  3QZC A;  1F1M A;  3BRJ A;  5L3Q A;  2HV6 A;  2HJ3 A;  3EPV A;  3B0V C;  4YT8 A;  4XQ1 A;  2XLM A;  3EH2 A;  1VLS A;  2XLE A;  4U5H A;  4E0H A;  2KGO A;  1Q0D A;  2NPU A;  3HNK A;  3PMR A;  3I5P A;  1BR1 A;  3K7D A;  3US6 A;  3S28 A;  1OW8 A;  3RH3 A;  1U0B B;  1Z6A A;  2LQG A;  2LK4 A;  5B1B C;  3ABM C;  4O6N A;  4U5C E;  2XLD A;  4N6C A;  3DI5 A;  1YZA A;  3U0C A;  2R7S A;  4P9T A;  4CS7 A;  1K04 A;  2WVQ A;  1JR8 A;  3FHD A;  3WAQ A;  1MMD A;  4J7T A;  3N0T A;  2IYL D;  2R7V A;  4U5F E;  3LJB A;  2ZD9 A;  3HNJ A;  5A6A A;  5KYU B;  3MYI A;  2J7P A;  4PJJ A;  3WG7 C;  2CGE A;  3DWW A;  4RDA A;  2Y39 A;  2XM0 A;  4IJJ A;  2LFD A;  5KYW A;  2VCC A;  3O39 A;  4MVR A;  5A69 A;  5COM A;  3LUT B;  3ECS A;  3TJ6 A;  4PJM A;  3V5Z A;  3ZG1 A;  4DRI B;  1QPU A;  4Z9I A;  4K7B A;  4NY3 A;  5DQZ A;  4MVO A;  3UR3 C;  3GWN A;  1PCX A;  2GA0 A;  4I44 A;  1SZI A;  4A2N B;  1Z7Q c;  4U5B E;  4JW1 A;  2L9J A;  3EGX B;  1A0B A;  2IXO A;  1S7Z A;  3B9Q A;  1J8M F;  4KC9 A;  1ZU5 A;  3JRT A;  2B0J A;  1FMV A;  3TK0 A;  3U3F A;  1ZVZ A;  3POV A;  4KBL A;  2KSF A;  1RJ9 B;  3ABK C;  2ZPA A;  1QQ3 A;  2VH3 A;  4NQF A;  2Q9A A;  4P9F A;  3ZIB A;  4BJ6 A;  3KL4 A;  2XS1 A;  3IEE A;  4MTF A;  2XXA B;  3DM5 A;  4CSA A;  3OWT A;  3UGP A;  1OW6 A;  2WZF A;  3EGD B;  3QW1 A;  5BQG A;  3B0U X;  1C02 A;  2OU6 A;  1IW7 F;  4J30 B;  1Q0F A;  3A9C A;  2PP4 A;  2FFH A;  3V5X A;  3SYN A;  2PBE A;  4CS8 C;  3UMH A;  4IWB A;  4HFK B;  3EFO A;  2QNL A;  5TJ5 E;  5A6K A;  1TWC A;  2AP3 A;  2YHS A;  4B6I A;  3LEO A;  1TFK B;  1YJG A;  2EPO A;  3S84 A;  4P6I C;  2R02 A;  3LS0 A;  4PFP A;  3AGT A;  4XLP F;  2IBF A;  5K0I A;  2EPL X;  1QKR A;  4LLE A;  3EHN A;  3T9O A;  2UUH A;  2YKZ A;  4I1O B;  1EKY A;  2YL3 A;  4N6H A;  4JC7 A;  4HFF B;  2A6H F;  2D5R B;  3EGX A;  2L6G A;  1ZHY A;  1CGM E;  1KU2 A;  5JT4 A;  2OQM A;  1Z63 A;  3JSE O;  2A0U A;  2NSF A;  1JMW A;  3JYH A;  4BG0 A;  1NSG B;  5CI8 A;  1HE9 A;  3C8Z A;  1TQG A;  3BEH A;  4PFO A;  3EFO B;  2HUJ A;  3L8I A;  2QTV A;  2YRF A;  2M4E A;  2YWA A;  3PDM P;  2PF4 E;  2XXA A;  1CGN A;  3N2Z B;  1H7I A;  1M2V A;  3NYM A;  4JJF A;  4OIN F;  4IAQ A;  3S9O A;  1U6H A;  1C03 A;  1IZM A;  1WGW A;  3AGU A;  1FR0 A;  3LLI A;  4WAB A;  3M79 A;  5FCL A;  1SR2 A;  3RF3 A;  4JZA A;  4MVQ A;  3NMJ A;  2YLG A;  2R05 A;  2J9U A;  3F46 A;  3FAJ A;  2KNH A;  3GOD A;  5IY5 C;  4OIO F;  1BR4 A;  4MTO A;  3M4B A;  1PD1 A;  1XWJ A;  2BC5 A;  3FAP B;  3DE8 A;  4CJG A;  4Z9J A;  3RYL A;  1GQA A;  4DBQ A;  1ZW3 A;  1I4Y A;  2WZL A;  3S27 A;  2J9W A;  3T6J A;  2VCA A;  3EZH A;  1YA9 A;  2I8B A;  4MW8 A;  1WOL A;  4E7S A;  2J0W A;  4NTA A;  2DI3 A;  3UMK A;  4C3E A;  2BL2 A;  2OJQ A;  3B0P A;  3F47 A;  4XPX A;  1YAR O;  3NYJ A;  3IQ6 A;  3M15 A;  4E7Z A;  2NUP A;  1FNT c;  2J0X A;  5GPG B;  2X51 A;  1WAT A;  2CYD A;  2Y3D A;  1AEP A;  2YL0 A;  3E70 C;  1FMW A;  4XWJ A;  5JSL A;  3B29 A;  2G3K A;  2H7B A;  2CNW A;  1HMO A;  4MVZ A;  3C62 A;  3VYW A;  2UUI A;  3V5Y A;  3VF0 A;  1HY5 A;  1M2V B;  4MTG A;  1LE4 A;  1NBB A;  1R5I D;  2O9X A;  2QUP A;  1Q0G A;  4K1O A;  3GAN A;  1VLT A;  3CQZ A;  2WVN A;  5E3C A;  4BEJ A;  3JTL O;  4XLN F;  2BE5 F;  5A6B A;  4JTC B;  4IB4 A;  1VOM A;  4Q7C A;  4M63 A;  3W2W A;  4PJN A;  2R7Q A;  1MNE A;  3ATP A;  1KTM A;  3RQF A;  3NMI A;  3QVZ A;  1M57 C;  1T6U A;  2WL8 A;  4JUR I;  3NKD A;  3M4C A;  3RQE A;  1OR2 A;  5CI9 A;  1I4Z A;  1LVK A;  4I3M A;  2DGJ A;  3EG9 B;  3LES A;  4PJL A;  4JCZ A;  3J06 A;  2HFI A;  4OD4 A;  1LPE A;  2VC9 A;  1W2W A;  2ICW G;  2NSG A;  1NLX A;  3NYL A;  2EIJ C;  3AG3 C;  4BJ1 A;  4ER9 A;  3RVZ A;  1ORY A;  3GEH A;  3RIP A;  4EHP A;  2AU5 A;  2YLI A;  1RCP A;  1MND A;  2P61 A;  3U3B A;  3W2V A;  5L0I A;  2R7T A;  4BJ6 C;  1T6I A;  2J7P D;  3FOO A;  3EGD A;  1TKN A;  3IQC A;  4JVS A;  1Y4C A;  1D1A A;  3C8G B;  3MYF A;  4XPW A;  5EGY A;  2JD3 A;  4AE4 B;  2PNO A;  4LDK A;  4YT5 A;  3L0I A;  3DD7 A;  5BQI A;  1PV3 A;  4N06 A;  4NC3 A;  2KJG A;  1G8X A;  4MS2 A;  3FVY A;  1LKX A;  3U8V A;  3G4X A;  3ZSU A;  5L0J A;  4BJ5 A;  3DXJ F;  3U2M A;  1JPJ A;  1QSP A;  4CJO A;  2XL8 A;  1ORS C;  1BBH A;  2KW3 C;  2L6H A;  4C3B A;  3SXM A;  2C03 A;  5BQH A;  3AOU A;  4YT4 A;  3GOR A;  5E33 A;  2WZG A;  4JJG A;  1TWG A;  3TQO A;  2KC3 A;  4MW3 A;  2LD6 A;  1LIH A;  1ZHT A; 
#chains in the Genus database with same CATH homology
 1LM3 B;  4D4N A;  1CPR A;  2YL7 A;  3U8P A;  4WGY A;  2XM4 A;  2YKZ A;  1EKY A;  2YL3 A;  4N6H A;  3DE9 A;  4U9D A;  1E86 A;  5JT4 A;  3L1M A;  4IAR A;  3ZWI A;  2XLH A;  1S05 A;  1JAF A;  4EIY A;  1CPQ A;  1CGN A;  4N4W A;  4WGZ A;  5JRA A;  3HNL A;  1MQV A;  4IAQ A;  3ZQY A;  2J9B A;  4JEA A;  3M79 A;  256B A;  2XLV A;  3ZTZ A;  3NMJ A;  2YLG A;  3M4B A;  2BC5 A;  3DE8 A;  4CJG A;  4D4X A;  1GQA A;  3QW0 A;  3TOL A;  4JE9 A;  5JS5 A;  2QLA A;  4L6R A;  4ULV A;  1E85 A;  1YZC A;  1E83 A;  3IQ6 A;  3ZTM A;  3M15 A;  2XLM A;  2XLE A;  2YL0 A;  3ZQV A;  5JSL A;  2XLW A;  3HNK A;  3C62 A;  2J8W A;  2CCY A;  4CDA A;  3NMK A;  1NBB A;  2XLD A;  1YZA A;  4JEB A;  5JUA A;  1YYX A;  3VRC A;  4IB4 A;  1E84 A;  5JLI A;  3FOP A;  4U9E A;  3HNJ A;  3NMI A;  3QVZ A;  1M6T A;  3M4C A;  3HNI A;  2XM0 A;  1APC A;  5B3I A;  1CGO A;  3QVY A;  1QPU A;  5JP7 A;  3C63 A;  4CDY A;  4JKV A;  3IQ5 A;  2YL1 A;  4CX9 A;  4ER9 A;  2YLI A;  1RCP A;  3FOO A;  2YLD A;  3TOM A;  1QQ3 A;  4CIP A;  2XLO A;  4NC3 A;  3QW1 A;  4CJO A;  2XL8 A;  1BBH A;  5AGF A;  1YYJ A;  2XL6 A;  4CDV A;  5JVE A;  1A7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...