4CDVA

Spectroscopically-validated structure of cytochrome c prime from alcaligenes xylosoxidans, reduced by x-ray irradiation at 100k
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
molecule tags Electron transport
source organism Achromobacter xylosoxidans
publication title Fingerprinting Redox and Ligand States in Haemprotein Crystal Structures Using Resonance Raman Spectroscopy.
pubmed doi rcsb
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2013-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cdvA00
1YYJA 2XLVA 3ZQYA 1E84A 1CPRA 3QW1A 2XM4A 4JEAA 4ER9A 3M15A 4U9EA 4CDYA 2XLWA 2XLDA 4NC3A 3TOMA 5JSLA 3L1MA 1BBHA 1MQVA 4IAQA 3ZWIA 3M4CA 2QLAA 5JT4A 1LM3B 1APCA 4JE9A 4WGYA 2J8WA 4JKVA 1QQ3A 3NMKA 1E85A 1EKYA 2YLGA 4D4XA 5JRAA 2YLDA 3FOPA 2BC5A 1GQAA 3QVYA 3HNKA 3M4BA 3FOOA 4JEBA 1E86A 1NBBA 2J9BA 1JAFA 4WGZA 3C62A 2YL7A 3HNLA 5JP7A 4N4WA 3IQ5A 2YLIA 2YL1A 3VRCA 2YKZA 3QW0A 1CGNA 4CDVA 4CJOA 5AGFA 2CCYA 3DE8A 4CJGA 4CDAA 1YZCA 5JUAA 1A7VA 2XLMA 4D4NA 5B3IA 5JLIA 2YL0A 4EIYA 2XM0A 3IQ6A 1S05A 2XLOA 1YZAA 4N6HA 3U8PA 4ULVA 5JVEA 2XL8A 1QPUA 1YYXA 3ZTMA 3QVZA 4CX9A 1CPQA 5JS5A 3HNIA 1CGOA 3M79A 2XLHA 2YL3A 3NMJA 4IB4A 4CIPA 2XLEA 2XL6A 3DE9A 1RCPA 3C63A 4IARA 3TOLA 256BA 3ZTZA 4U9DA 1E83A 3ZQVA 3HNJA 1M6TA 3NMIA 4L6RA
chains in the Genus database with same CATH superfamily
1Y6DA 4PK4A 3S0XA 2XLVA 1EA8A 3JCUQ 4YN0B 3ZQYA 1E84A 4OIPF 4PJLA 3U9JA 1ZHZA 1CPRA 2XM4A 1Q0MA 4ER9A 3C8GB 3M15A 4DRIB 1QVXA 4GEHA 4U5HA 1W2WA 2OQMA 3FHDA 3K6BA 4U5CE 2GA0A 3VM6A 2XLDA 5BQHA 1FNTc 2DI3A 3E70C 4DOZA 4Q5SF 1GM5A 1OCRC 1Z6AA 4QDLA 4MVRA 3IPMO 4IAQA 3M4CA 4G7OF 3EHNA 2QLAA 3C8GA 2A6EF 2Q7RA 1LM3B 1APCA 2ZXPA 1FMWA 2Y3BA 2NUTB 5A69A 2YHSA 3NKDA 4RDAA 5DQTA 2J8WA 1ORJA 1SYQA 4JKVA 1QQ3A 4MVUA 2QNLA 4JCZA 3F47A 3UMHA 4MVSA 4PFOA 3DJNB 1D1AA 5L0JA 1E85A 2MWQA 2R03A 1HY5A 1NU7D 1BDJB 2LIGA 3IQTA 1L7CA 1LPEA 1T9KA 2A0BA 3DXJF 3I4UA 1SF8A 1M2VB 2DYSC 1G5ZA 1ZHXA 2YLDA 3V5YA 4C7OA 3DWWA 3WG7C 3U9MA 2CDQA 4IRUA 3FOOA 4JEBA 4MNDA 1NBBA 1RKEA 2J46A 3H2UA 2Q9BA 4PJMA 3QZCA 3K1IC 1JAFA 1OQCA 2MYSA 4JRZA 4IAOA 5KYWA 3SP1A 4U5EE 2EPLX 1FFHA 2O9XA 2AVKA 5KYYA 3ABLC 4PACA 1XZPA 3LUTB 1TKNA 4B6IA 4NY3A 5L0DA 1RJ9A 1AUEA 1LI7A 5A6BD 2VH3A 3CSKA 4BJ6A 4E0IA 3AG4C 2YKZA 2CGEA 3S84A 5F5FA 3MLGA 1PD0A 2Y39A 5AC5A 1U0BB 4CJOA 4XQ1A 4EKWA 2HFIA 4NTAA 4NTBA 3RQGA 4DBRA 2CCYA 2CNWD 1A7DA 4BJ1A 3S29A 4CS9C 1A7VA 2DB4A 2EIMC 1WATA 1D1BA 2XLMA 2OJED 3ABMC 1OCOC 3L34A 3L8JA 3RF3A 4C3BA 2YL0A 4D4NA 2HZ8A 3LNRA 3JTLO 4IJJA 2QTVA 1N1CA 3ZDLA 5A6KA 3FDQA 1HE1A 1V4AA 3EJNA 2R7RA 1RXQA 2PX3A 1OCZC 2TMVP 1DOWA 1YJGA 4LACB 3GANA 2KQ9A 1MMNA 3EGXA 2ETSA 4N6CA 5BQGA 3GWNA 4EBBA 1U6HA 2CYDA 2Y3DA 4P9TA 3OEOA 3I5PA 5A6BA 1YZAA 4KI2A 1LIHA 4BJ5A 1PV3A 1H7IA 2CW0F 2EIKC 4XEVA 3AJMA 2OEXA 1YVIA 5HV9A 3LEOA 3WODF 1ZHWA 2EINC 3V5ZA 1M2VA 1T6IA 1CPQA 3U2MA 1JRAA 3KKBA 5T1DB 4E18A 4JJFA 3M79A 2AP3A 3A9CA 2VC9A 3UR3C 1M56C 3ZC4A 4AK9A 1BR2A 1I4YA 4CIPA 4Q4ZF 1KNYA 3TOLA 2R02A 3TD7A 2IXPA 3EGDB 4U9DA 3TQOA 4BJ6C 3HTKC 3EGDA 1NU9C 3JYHA 2W4MA 2EPNA 5A6JA 3GEIA 2PX0A 3OA1A 3LS0A 2XXAB 1M6TA 1LS4A 1VOMA 2HJ3A 1OKKD 2P0NA 3NMIA 3L1MA 4NQFA 1SMYF 2WZFA 1WN0A 3AGUA 4O7GA 4U5GA 1WOLA 3US6A 1D0XA 3IEEA 1A0BA 3GEEA 2LCHA 3BEHA 3MBGA 1EQ1A 3AQBA 3SXZA 4OD4A 4U9EA 4HFFB 2FGYA 1HMDA 3R2PA 2Y3HA 4JW1A 3RYLA 2XSEA 2XRHA 2HMQA 2OCCC 4MW8A 3TOMA 5K0IA 5COFA 1C02A 4DRHB 2R7WA 1ZW2A 1NLXA 2DGJA 1ZU4A 2LD6A 3W8IA 3ABKC 1NFNA 1MQVA 2IXMA 4CS8A 3U5SA 5E2QA 1NG1A 3KPHA 4PJNA 1V55C 2ZPAA 4HE8D 3CEXA 2LSEA 5A6AA 5JT4A 3ECSA 5EK0A 1K04A 4J30B 3DM5A 2P61A 3SEOA 3MYIA 3ATPA 4E7ZA 4W8PA 2OEVA 3EG9B 2J0WA 5B3IA 4YL3A 4ANJA 3NMKA 1EKYA 4OIRF 2IXOA 5KYXB 4H4KC 2YLGA 3JRTA 2H8AA 3I5QA 1UFBA 4XPWA 3T6BA 4DVYP 3H2VA 4MTOA 5L0FA 3PDMP 1JR8A 4BEJA 5CIVA 3CZ6A 3DD7A 3MX3A 3HNKA 3L0IA 1YARO 3QVYA 3O6XA 3EH1A 3KH2A 3M4BA 4YK5A 4XEKA 3WAQA 3FVYA 5KYXA 3DMDA 4U5FE 4WGZA 3C62A 4YWQA 2GAQA 2YL7A 3DAFA 3K1IA 4P6IC 3TJ5A 2JD3A 1K40A 2LP4A 1Y4CA 1JPJA 2C03A 3GODA 4XLNF 1V54C 4XPXA 4BEMJ 2HSBA 4J7TA 2WVOA 1G4WR 3PMRA 2PNOA 2DYRC 3EZIA 4AX2A 2QY9A 3EZHA 4JIOA 5DS4A 3RFYA 1RMVA 1Z5ZA 3K33A 5KYYB 3FAPB 1R5ID 1MNDA 3JZ0A 2YVKA 4FESA 5L0HA 4WABA 2LFFA 3W4YA 4XEFA 2B0HA 3AOUA 1AEPA 3DE8A 3NYJA 3SYNA 4CJGA 4CDAA 3EGXB 3VAYA 5EHHA 3RVZA 1DOVA 3E9VA 3DZAA 2HUJA 3G50A 5HSWA 1LE4A 4CSAC 2L81A 2OOCA 4HEAJ 1Q0KA 4CS8C 5DS5A 1I5NA 2VASA 2L6GA 1O3UA 5B1AC 3W2WA 3IQ6A 2WL8A 1S05A 1SR2A 2AWYA 1NSGB 4I1OB 2Q4FA 3O10A 5DS6A 1LI5A 4N6HA 1OW7A 4ULVA 1TWHA 4O6YA 5E33A 4EBJA 5JVEA 4NCQA 2XL8A 2H7BA 4AL1A 1BZ4A 5FZTA 4C3DA 3Q7GA 3KYJA 1OW8A 2PFDA 3QVZA 5L3QA 4R32A 3LNMB 3EH2A 1PD1A 3UMIA 3Q6NA 3UGPA 3U8VA 4CBEA 1GS9A 5L0GA 1MMDA 2D5RB 2VCBA 2YL3A 3NMJA 4WJ0A 4YT8A 5BQIA 4IB4A 4OIOF 2XLEA 2XL6A 3BRJA 1RCPA 3DE9A 2OU6A 4YL1A 1E2XA 4IARA 3W8HA 3ZVRA 2ZXOA 1M2OA 2G3KA 1TWGA 4ONSA 1TR2A 3C8ZA 4XTKA 2Y69C 4CS9A 3PHF2 3ZQVA 4BJTA 2WVQA 3EHMA 2V3CC 1RKEB 4YJWA 1GGQA 1D1CA 3HNJA 2J45A 3JSEO 1XWJA 2YWAA 3FAJA 1Z63A 2YZSA 2ASRA 4PFPA 4L6RA 4UDVA 4G7HF 3J06A 5KYNA 2BL2A 1F1MA 1ORSC 2A68F 4K0DA 4PJJA 1ZVZA 4ZLDA 2XXAA 4KC9A 2H7VC 2L6HA 4J32B 2P6VA 4JEAA 5D92A 1YLMA 3K66A 2ZXWC 4XWJA 1QZXA 4CDYA 1FR0A 3AG1C 3TJ6A 3ZSUA 4NC3A 2UUIA 3N2ZB 2ICWG 3GM3A 4U5DE 2NUTA 1U89A 1BBHA 3A11A 1OR2A 1I4ZA 1PCXA 3DKAA 3JYYA 4Z9JA 2L7AA 3LJBA 2J0XA 4O79A 1S7ZA 3SNHA 3C8GD 2KYHA 4NTFA 3QMKA 4K1OA 1JOGA 4Z9IA 1OXKA 1M57C 4WGYA 2I8BA 3GM1A 1ORYA 1CGME 2HSQA 2A69F 2OJQA 1LS1A 2WB7A 2MHRA 3G4ZA 2Q00A 2KNHA 4MTFA 3RW0A 4G78A 3B71A 4JJGA 1A41A 2Q9CA 4RD9A 3U3FA 2EPOA 3EFOB 2FFHA 3FMSA 2VB6A 1LKXA 4C3EA 2KSFA 3AQCA 2YRFA 4X0RA 3UMKA 1VLTA 3NG1A 2BC5A 1GQAA 3POVA 3NDBB 1QKRA 2XS1A 2LQGA 4DXWA 3ITFA 4U5BE 1E86A 4QI2A 1OCCC 2R05A 2J9BA 1JMWA 2WZLA 3VYWA 4LLEA 3TULA 2RD9A 4ZLCA 3LLIA 1LE2A 2GFHA 3HNLA 2Y3GA 1FFTC 2CNWA 2VCCA 3B0UX 5CI8A 4OINF 4MVQA 3X1OA 4E7SA 3K7DA 4I1MA 2EPMX 1VK5A 5DLJA 1ZW3A 3T4RA 3ZIBA 2J9UA 3KMIA 4CS7A 4JZAA 2XL4A 4LDKA 4KBLA 2JX0A 3NKEA 3JRMO 2YL1A 3DAGA 3QW0A 1QLEC 1T5OA 2AWCA 3Q6MA 4JTDB 2A1DD 2G3VA 2G62A 3NYLA 4MW3A 5AGFA 4JCHA 1Z23A 3AGTA 5JUAA 2IM8A 1YZCA 3GM2A 4J7YA 3UGOA 3GWLA 2LFDA 3K1HA 5T3WA 2KGOA 3PCVA 3GORA 1G8XA 2HV6A 3UNGC 1VMAA 2OKUA 5COMA 3EG9A 4EIYA 2NPUA 2XM0A 4OIQF 2X0CA 1J8YF 2KK1A 4IWBA 3AG3C 4G0HA 5COGA 3R7CA 2Q3TA 2IBFA 1A7EA 1WGWA 1HE9A 5FCLA 1Q0DA 2A0UA 2RSEB 4I44A 2KC3A 4DBQA 3B29A 3U8PA 2EIJC 2R25A 1T6UA 4Z9HA 3OWTA 4C7OB 4H54A 1NFOA 2BE5F 2HV7A 2W4BA 3G4XA 1H9GA 2NSFA 3CQZA 4MS2A 3S27A 1VB5A 3O39A 5T3TA 4KNWA 1UG7A 2WZGA 4JTCB 1OR3A 1CGOA 1T6QA 2NUPB 4FAPB 4JC7A 2AU5A 1FTSA 1KTMA 2Q9AA 2XLHA 3HJCA 2OG2A 1RKCA 3FXHA 3TK0A 1IZMA 3ZG1A 2X51A 2R7SA 1IW7F 3EQLF 3LAYA 2M4EA 5DQZA 2IXNA 2F22A 4JVSA 4YT2A 1HW1A 3ZTZA 4AE4A 1G4US 5B1BC 2EPKX 4AE4B 1TFOB 1E83A 1RJ9B 5BUOA 1YDIA 3SXKA 1H6GA 1XZQA 3HKKA 4O6NA 1R4TA 3MYFA 5B3SC 5TJ5E 3V7OA 1HMOA 2GWWA 1YYJA 3ASNC 4MVOA 4E17A 4YL0A 3S28A 3C7JA 3QW1A 1MNEA 1WTYA 2J7PD 2NG1A 2B0JA 1K05A 3RVYA 5AC4A 5KYWB 2XLWA 2LK4A 2Z15A 3B9QA 3T9OA 5L0CA 1C03A 2R7QA 5JSLA 1VTMP 4JTAB 2YEVA 1J8MF 1VLSA 4EHPA 3KYIA 1BR4A 1D0ZA 3LLKA 3ZWIA 4A2NB 2EILC 4A4AA 1V74B 1TWAA 2E87A 3O55A 3RH3A 3RIPA 3V5XA 2KJGA 1TQGA 2VCAA 4JE9A 4O6MA 3RQEA 3U3BA 1ZYRF 3Q7LA 1O87A 1YA7O 3DJUB 2XS8A 4EUKB 1BR1A 3L8IA 2QUPA 4IGGA 2A6HF 4LDRA 1T01A 3WHNA 1VYIA 3W2VA 4YT4A 4P9FA 2D4UA 4LDQA 4BJ5C 5KYUB 4LLCA 2QE9A 4D4XA 3FOPA 5JRAA 4E0HA 1MMAA 1WWPA 2PBEA 1ZZPA 2H7OA 2YQYA 3VF0A 3DM9B 3QTHA 3S90A 2P1AA 2V26A 1FMVA 3DI5A 2W45A 4M63A 3SXYA 2ZD9A 4W8KA 3IHUA 3AG2C 3B0VC 4QI0A 1OXBA 3N24A 1Q0FA 5JP7A 4CIHA 1ZU5A 3RKOF 2L9JA 3EPVA 2KW3C 4YT5A 2L6FA 2P7VA 3U0CA 4N4WA 2HMZA 2YLIA 3IQ5A 1TWCA 3N0TA 3VRCA 4G7ZF 1O5HA 3B0PA 3JT1A 2R9RB 4LERA 4RBNA 5DVWA 4Q7CA 5GPGB 1CGNA 3NYMA 5CI9A 4CDVA 4OD5A 5F5HA 3M1CB 1ZHYA 2J7PA 3X2QC 4AL0A 2IYLD 4EWCA 4ULWA 2GDCA 3CAXA 2PF4E 3RQFA 2IOQA 1EI7A 1VYKA 5L3VA 1Q0GA 1NZEA 1ZHTA 5JLIA 1WASA 2J9WA 3GEHA 1D0YA 2UUHA 3MFNA 4MVZA 3ASOC 5EGYA 3IQCA 2ZXRA 4PR9A 2J9VA 5KYUA 2XLOA 4FX5A 1TFKB 4DRJB 3HLZA 4F4BA 5L0IA 2NSGA 1ST6A 2HS5A 4XLPF 2R7OA 3C18A 3T6JA 1H9TA 1QPUA 1YYXA 3ZTMA 1B68A 5IY5C 4K7BA 2M64A 1Z3IX 4N06A 4EBKA 1YAUO 4GQHA 4CX9A 1JPNA 4DVZA 5JS5A 1KU2A 1FAPB 3SZRA 3HNIA 4JURI 3T6GB 2NUPA 2JPUA 3F46A 1OKKA 1YA9A 4I3MA 2R7TA 3H65A 2W9YA 2R7VA 2HJMA 2HKVA 1Z7Qc 3U2LA 4BPMA 5F28E 2FAPB 4MQ9F 3JSZA 1QSPA 4HFKB 3LESA 3LEVA 3SXMA 4BG0A 2R7UA 4KNVA 1MMGA 4DJ9A 3C63A 3KL4A 4MTGA 256BA 1C17M 3S9OA 3NRHA 2C04A 5E3AA 1OW6A 2PP4A 1AVOB 2WVNA 5D91A 4CSAA 2I15A 3LS1A 5E3CA 2R7XA 4XPYA 4GYTA 4FWVA 1LVKA 4MVMA 1L3PA 3EFOA 1SZIA 1HW2A
chains in the Genus database with same CATH topology
1YYJA 2XLVA 3ZQYA 1E84A 1CPRA 3QW1A 2XM4A 4JEAA 4ER9A 3M15A 4U9EA 4CDYA 2XLWA 2XLDA 4NC3A 3TOMA 5JSLA 3L1MA 1BBHA 1MQVA 4IAQA 3ZWIA 3M4CA 2QLAA 5JT4A 1LM3B 1APCA 4JE9A 4WGYA 2J8WA 4JKVA 1QQ3A 3NMKA 1E85A 1EKYA 2YLGA 4D4XA 5JRAA 2YLDA 3FOPA 2BC5A 1GQAA 3QVYA 3HNKA 3M4BA 3FOOA 4JEBA 1E86A 1NBBA 2J9BA 1JAFA 4WGZA 3C62A 2YL7A 3HNLA 5JP7A 4N4WA 3IQ5A 2YLIA 2YL1A 3VRCA 2YKZA 3QW0A 1CGNA 4CDVA 4CJOA 5AGFA 2CCYA 3DE8A 4CJGA 4CDAA 1YZCA 5JUAA 1A7VA 2XLMA 4D4NA 5B3IA 5JLIA 2YL0A 4EIYA 2XM0A 3IQ6A 1S05A 2XLOA 1YZAA 4N6HA 3U8PA 4ULVA 5JVEA 2XL8A 1QPUA 1YYXA 3ZTMA 3QVZA 4CX9A 1CPQA 5JS5A 3HNIA 1CGOA 3M79A 2XLHA 2YL3A 3NMJA 4IB4A 4CIPA 2XLEA 2XL6A 3DE9A 1RCPA 3C63A 4IARA 3TOLA 256BA 3ZTZA 4U9DA 1E83A 3ZQVA 3HNJA 1M6TA 3NMIA 4L6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYJ A;  2XLV A;  3ZQY A;  1E84 A;  1CPR A;  3QW1 A;  2XM4 A;  4JEA A;  4ER9 A;  3M15 A;  4U9E A;  4CDY A;  2XLW A;  2XLD A;  4NC3 A;  3TOM A;  5JSL A;  3L1M A;  1BBH A;  1MQV A;  4IAQ A;  3ZWI A;  3M4C A;  2QLA A;  5JT4 A;  1LM3 B;  1APC A;  4JE9 A;  4WGY A;  2J8W A;  4JKV A;  1QQ3 A;  3NMK A;  1E85 A;  1EKY A;  2YLG A;  4D4X A;  5JRA A;  2YLD A;  3FOP A;  2BC5 A;  1GQA A;  3QVY A;  3HNK A;  3M4B A;  3FOO A;  4JEB A;  1E86 A;  1NBB A;  2J9B A;  1JAF A;  4WGZ A;  3C62 A;  2YL7 A;  3HNL A;  5JP7 A;  4N4W A;  3IQ5 A;  2YLI A;  2YL1 A;  3VRC A;  2YKZ A;  3QW0 A;  1CGN A;  4CDV A;  4CJO A;  5AGF A;  2CCY A;  3DE8 A;  4CJG A;  4CDA A;  1YZC A;  5JUA A;  1A7V A;  2XLM A;  4D4N A;  5B3I A;  5JLI A;  2YL0 A;  4EIY A;  2XM0 A;  3IQ6 A;  1S05 A;  2XLO A;  1YZA A;  4N6H A;  3U8P A;  4ULV A;  5JVE A;  2XL8 A;  1QPU A;  1YYX A;  3ZTM A;  3QVZ A;  4CX9 A;  1CPQ A;  5JS5 A;  3HNI A;  1CGO A;  3M79 A;  2XLH A;  2YL3 A;  3NMJ A;  4IB4 A;  4CIP A;  2XLE A;  2XL6 A;  3DE9 A;  1RCP A;  3C63 A;  4IAR A;  3TOL A;  256B A;  3ZTZ A;  4U9D A;  1E83 A;  3ZQV A;  3HNJ A;  1M6T A;  3NMI A;  4L6R A; 
#chains in the Genus database with same CATH topology
 1Y6D A;  4PK4 A;  3S0X A;  2XLV A;  1EA8 A;  3JCU Q;  4YN0 B;  3ZQY A;  1E84 A;  4OIP F;  4PJL A;  3U9J A;  1ZHZ A;  1CPR A;  2XM4 A;  1Q0M A;  4ER9 A;  3C8G B;  3M15 A;  4DRI B;  1QVX A;  4GEH A;  4U5H A;  1W2W A;  2OQM A;  3FHD A;  3K6B A;  4U5C E;  2GA0 A;  3VM6 A;  2XLD A;  5BQH A;  1FNT c;  2DI3 A;  3E70 C;  4DOZ A;  4Q5S F;  1GM5 A;  1OCR C;  1Z6A A;  4QDL A;  4MVR A;  3IPM O;  4IAQ A;  3M4C A;  4G7O F;  3EHN A;  2QLA A;  3C8G A;  2A6E F;  2Q7R A;  1LM3 B;  1APC A;  2ZXP A;  1FMW A;  2Y3B A;  2NUT B;  5A69 A;  2YHS A;  3NKD A;  4RDA A;  5DQT A;  2J8W A;  1ORJ A;  1SYQ A;  4JKV A;  1QQ3 A;  4MVU A;  2QNL A;  4JCZ A;  3F47 A;  3UMH A;  4MVS A;  4PFO A;  3DJN B;  1D1A A;  5L0J A;  1E85 A;  2MWQ A;  2R03 A;  1HY5 A;  1NU7 D;  1BDJ B;  2LIG A;  3IQT A;  1L7C A;  1LPE A;  1T9K A;  2A0B A;  3DXJ F;  3I4U A;  1SF8 A;  1M2V B;  2DYS C;  1G5Z A;  1ZHX A;  2YLD A;  3V5Y A;  4C7O A;  3DWW A;  3WG7 C;  3U9M A;  2CDQ A;  4IRU A;  3FOO A;  4JEB A;  4MND A;  1NBB A;  1RKE A;  2J46 A;  3H2U A;  2Q9B A;  4PJM A;  3QZC A;  3K1I C;  1JAF A;  1OQC A;  2MYS A;  4JRZ A;  4IAO A;  5KYW A;  3SP1 A;  4U5E E;  2EPL X;  1FFH A;  2O9X A;  2AVK A;  5KYY A;  3ABL C;  4PAC A;  1XZP A;  3LUT B;  1TKN A;  4B6I A;  4NY3 A;  5L0D A;  1RJ9 A;  1AUE A;  1LI7 A;  5A6B D;  2VH3 A;  3CSK A;  4BJ6 A;  4E0I A;  3AG4 C;  2YKZ A;  2CGE A;  3S84 A;  5F5F A;  3MLG A;  1PD0 A;  2Y39 A;  5AC5 A;  1U0B B;  4CJO A;  4XQ1 A;  4EKW A;  2HFI A;  4NTA A;  4NTB A;  3RQG A;  4DBR A;  2CCY A;  2CNW D;  1A7D A;  4BJ1 A;  3S29 A;  4CS9 C;  1A7V A;  2DB4 A;  2EIM C;  1WAT A;  1D1B A;  2XLM A;  2OJE D;  3ABM C;  1OCO C;  3L34 A;  3L8J A;  3RF3 A;  4C3B A;  2YL0 A;  4D4N A;  2HZ8 A;  3LNR A;  3JTL O;  4IJJ A;  2QTV A;  1N1C A;  3ZDL A;  5A6K A;  3FDQ A;  1HE1 A;  1V4A A;  3EJN A;  2R7R A;  1RXQ A;  2PX3 A;  1OCZ C;  2TMV P;  1DOW A;  1YJG A;  4LAC B;  3GAN A;  2KQ9 A;  1MMN A;  3EGX A;  2ETS A;  4N6C A;  5BQG A;  3GWN A;  4EBB A;  1U6H A;  2CYD A;  2Y3D A;  4P9T A;  3OEO A;  3I5P A;  5A6B A;  1YZA A;  4KI2 A;  1LIH A;  4BJ5 A;  1PV3 A;  1H7I A;  2CW0 F;  2EIK C;  4XEV A;  3AJM A;  2OEX A;  1YVI A;  5HV9 A;  3LEO A;  3WOD F;  1ZHW A;  2EIN C;  3V5Z A;  1M2V A;  1T6I A;  1CPQ A;  3U2M A;  1JRA A;  3KKB A;  5T1D B;  4E18 A;  4JJF A;  3M79 A;  2AP3 A;  3A9C A;  2VC9 A;  3UR3 C;  1M56 C;  3ZC4 A;  4AK9 A;  1BR2 A;  1I4Y A;  4CIP A;  4Q4Z F;  1KNY A;  3TOL A;  2R02 A;  3TD7 A;  2IXP A;  3EGD B;  4U9D A;  3TQO A;  4BJ6 C;  3HTK C;  3EGD A;  1NU9 C;  3JYH A;  2W4M A;  2EPN A;  5A6J A;  3GEI A;  2PX0 A;  3OA1 A;  3LS0 A;  2XXA B;  1M6T A;  1LS4 A;  1VOM A;  2HJ3 A;  1OKK D;  2P0N A;  3NMI A;  3L1M A;  4NQF A;  1SMY F;  2WZF A;  1WN0 A;  3AGU A;  4O7G A;  4U5G A;  1WOL A;  3US6 A;  1D0X A;  3IEE A;  1A0B A;  3GEE A;  2LCH A;  3BEH A;  3MBG A;  1EQ1 A;  3AQB A;  3SXZ A;  4OD4 A;  4U9E A;  4HFF B;  2FGY A;  1HMD A;  3R2P A;  2Y3H A;  4JW1 A;  3RYL A;  2XSE A;  2XRH A;  2HMQ A;  2OCC C;  4MW8 A;  3TOM A;  5K0I A;  5COF A;  1C02 A;  4DRH B;  2R7W A;  1ZW2 A;  1NLX A;  2DGJ A;  1ZU4 A;  2LD6 A;  3W8I A;  3ABK C;  1NFN A;  1MQV A;  2IXM A;  4CS8 A;  3U5S A;  5E2Q A;  1NG1 A;  3KPH A;  4PJN A;  1V55 C;  2ZPA A;  4HE8 D;  3CEX A;  2LSE A;  5A6A A;  5JT4 A;  3ECS A;  5EK0 A;  1K04 A;  4J30 B;  3DM5 A;  2P61 A;  3SEO A;  3MYI A;  3ATP A;  4E7Z A;  4W8P A;  2OEV A;  3EG9 B;  2J0W A;  5B3I A;  4YL3 A;  4ANJ A;  3NMK A;  1EKY A;  4OIR F;  2IXO A;  5KYX B;  4H4K C;  2YLG A;  3JRT A;  2H8A A;  3I5Q A;  1UFB A;  4XPW A;  3T6B A;  4DVY P;  3H2V A;  4MTO A;  5L0F A;  3PDM P;  1JR8 A;  4BEJ A;  5CIV A;  3CZ6 A;  3DD7 A;  3MX3 A;  3HNK A;  3L0I A;  1YAR O;  3QVY A;  3O6X A;  3EH1 A;  3KH2 A;  3M4B A;  4YK5 A;  4XEK A;  3WAQ A;  3FVY A;  5KYX A;  3DMD A;  4U5F E;  4WGZ A;  3C62 A;  4YWQ A;  2GAQ A;  2YL7 A;  3DAF A;  3K1I A;  4P6I C;  3TJ5 A;  2JD3 A;  1K40 A;  2LP4 A;  1Y4C A;  1JPJ A;  2C03 A;  3GOD A;  4XLN F;  1V54 C;  4XPX A;  4BEM J;  2HSB A;  4J7T A;  2WVO A;  1G4W R;  3PMR A;  2PNO A;  2DYR C;  3EZI A;  4AX2 A;  2QY9 A;  3EZH A;  4JIO A;  5DS4 A;  3RFY A;  1RMV A;  1Z5Z A;  3K33 A;  5KYY B;  3FAP B;  1R5I D;  1MND A;  3JZ0 A;  2YVK A;  4FES A;  5L0H A;  4WAB A;  2LFF A;  3W4Y A;  4XEF A;  2B0H A;  3AOU A;  1AEP A;  3DE8 A;  3NYJ A;  3SYN A;  4CJG A;  4CDA A;  3EGX B;  3VAY A;  5EHH A;  3RVZ A;  1DOV A;  3E9V A;  3DZA A;  2HUJ A;  3G50 A;  5HSW A;  1LE4 A;  4CSA C;  2L81 A;  2OOC A;  4HEA J;  1Q0K A;  4CS8 C;  5DS5 A;  1I5N A;  2VAS A;  2L6G A;  1O3U A;  5B1A C;  3W2W A;  3IQ6 A;  2WL8 A;  1S05 A;  1SR2 A;  2AWY A;  1NSG B;  4I1O B;  2Q4F A;  3O10 A;  5DS6 A;  1LI5 A;  4N6H A;  1OW7 A;  4ULV A;  1TWH A;  4O6Y A;  5E33 A;  4EBJ A;  5JVE A;  4NCQ A;  2XL8 A;  2H7B A;  4AL1 A;  1BZ4 A;  5FZT A;  4C3D A;  3Q7G A;  3KYJ A;  1OW8 A;  2PFD A;  3QVZ A;  5L3Q A;  4R32 A;  3LNM B;  3EH2 A;  1PD1 A;  3UMI A;  3Q6N A;  3UGP A;  3U8V A;  4CBE A;  1GS9 A;  5L0G A;  1MMD A;  2D5R B;  2VCB A;  2YL3 A;  3NMJ A;  4WJ0 A;  4YT8 A;  5BQI A;  4IB4 A;  4OIO F;  2XLE A;  2XL6 A;  3BRJ A;  1RCP A;  3DE9 A;  2OU6 A;  4YL1 A;  1E2X A;  4IAR A;  3W8H A;  3ZVR A;  2ZXO A;  1M2O A;  2G3K A;  1TWG A;  4ONS A;  1TR2 A;  3C8Z A;  4XTK A;  2Y69 C;  4CS9 A;  3PHF 2;  3ZQV A;  4BJT A;  2WVQ A;  3EHM A;  2V3C C;  1RKE B;  4YJW A;  1GGQ A;  1D1C A;  3HNJ A;  2J45 A;  3JSE O;  1XWJ A;  2YWA A;  3FAJ A;  1Z63 A;  2YZS A;  2ASR A;  4PFP A;  4L6R A;  4UDV A;  4G7H F;  3J06 A;  5KYN A;  2BL2 A;  1F1M A;  1ORS C;  2A68 F;  4K0D A;  4PJJ A;  1ZVZ A;  4ZLD A;  2XXA A;  4KC9 A;  2H7V C;  2L6H A;  4J32 B;  2P6V A;  4JEA A;  5D92 A;  1YLM A;  3K66 A;  2ZXW C;  4XWJ A;  1QZX A;  4CDY A;  1FR0 A;  3AG1 C;  3TJ6 A;  3ZSU A;  4NC3 A;  2UUI A;  3N2Z B;  2ICW G;  3GM3 A;  4U5D E;  2NUT A;  1U89 A;  1BBH A;  3A11 A;  1OR2 A;  1I4Z A;  1PCX A;  3DKA A;  3JYY A;  4Z9J A;  2L7A A;  3LJB A;  2J0X A;  4O79 A;  1S7Z A;  3SNH A;  3C8G D;  2KYH A;  4NTF A;  3QMK A;  4K1O A;  1JOG A;  4Z9I A;  1OXK A;  1M57 C;  4WGY A;  2I8B A;  3GM1 A;  1ORY A;  1CGM E;  2HSQ A;  2A69 F;  2OJQ A;  1LS1 A;  2WB7 A;  2MHR A;  3G4Z A;  2Q00 A;  2KNH A;  4MTF A;  3RW0 A;  4G78 A;  3B71 A;  4JJG A;  1A41 A;  2Q9C A;  4RD9 A;  3U3F A;  2EPO A;  3EFO B;  2FFH A;  3FMS A;  2VB6 A;  1LKX A;  4C3E A;  2KSF A;  3AQC A;  2YRF A;  4X0R A;  3UMK A;  1VLT A;  3NG1 A;  2BC5 A;  1GQA A;  3POV A;  3NDB B;  1QKR A;  2XS1 A;  2LQG A;  4DXW A;  3ITF A;  4U5B E;  1E86 A;  4QI2 A;  1OCC C;  2R05 A;  2J9B A;  1JMW A;  2WZL A;  3VYW A;  4LLE A;  3TUL A;  2RD9 A;  4ZLC A;  3LLI A;  1LE2 A;  2GFH A;  3HNL A;  2Y3G A;  1FFT C;  2CNW A;  2VCC A;  3B0U X;  5CI8 A;  4OIN F;  4MVQ A;  3X1O A;  4E7S A;  3K7D A;  4I1M A;  2EPM X;  1VK5 A;  5DLJ A;  1ZW3 A;  3T4R A;  3ZIB A;  2J9U A;  3KMI A;  4CS7 A;  4JZA A;  2XL4 A;  4LDK A;  4KBL A;  2JX0 A;  3NKE A;  3JRM O;  2YL1 A;  3DAG A;  3QW0 A;  1QLE C;  1T5O A;  2AWC A;  3Q6M A;  4JTD B;  2A1D D;  2G3V A;  2G62 A;  3NYL A;  4MW3 A;  5AGF A;  4JCH A;  1Z23 A;  3AGT A;  5JUA A;  2IM8 A;  1YZC A;  3GM2 A;  4J7Y A;  3UGO A;  3GWL A;  2LFD A;  3K1H A;  5T3W A;  2KGO A;  3PCV A;  3GOR A;  1G8X A;  2HV6 A;  3UNG C;  1VMA A;  2OKU A;  5COM A;  3EG9 A;  4EIY A;  2NPU A;  2XM0 A;  4OIQ F;  2X0C A;  1J8Y F;  2KK1 A;  4IWB A;  3AG3 C;  4G0H A;  5COG A;  3R7C A;  2Q3T A;  2IBF A;  1A7E A;  1WGW A;  1HE9 A;  5FCL A;  1Q0D A;  2A0U A;  2RSE B;  4I44 A;  2KC3 A;  4DBQ A;  3B29 A;  3U8P A;  2EIJ C;  2R25 A;  1T6U A;  4Z9H A;  3OWT A;  4C7O B;  4H54 A;  1NFO A;  2BE5 F;  2HV7 A;  2W4B A;  3G4X A;  1H9G A;  2NSF A;  3CQZ A;  4MS2 A;  3S27 A;  1VB5 A;  3O39 A;  5T3T A;  4KNW A;  1UG7 A;  2WZG A;  4JTC B;  1OR3 A;  1CGO A;  1T6Q A;  2NUP B;  4FAP B;  4JC7 A;  2AU5 A;  1FTS A;  1KTM A;  2Q9A A;  2XLH A;  3HJC A;  2OG2 A;  1RKC A;  3FXH A;  3TK0 A;  1IZM A;  3ZG1 A;  2X51 A;  2R7S A;  1IW7 F;  3EQL F;  3LAY A;  2M4E A;  5DQZ A;  2IXN A;  2F22 A;  4JVS A;  4YT2 A;  1HW1 A;  3ZTZ A;  4AE4 A;  1G4U S;  5B1B C;  2EPK X;  4AE4 B;  1TFO B;  1E83 A;  1RJ9 B;  5BUO A;  1YDI A;  3SXK A;  1H6G A;  1XZQ A;  3HKK A;  4O6N A;  1R4T A;  3MYF A;  5B3S C;  5TJ5 E;  3V7O A;  1HMO A;  2GWW A;  1YYJ A;  3ASN C;  4MVO A;  4E17 A;  4YL0 A;  3S28 A;  3C7J A;  3QW1 A;  1MNE A;  1WTY A;  2J7P D;  2NG1 A;  2B0J A;  1K05 A;  3RVY A;  5AC4 A;  5KYW B;  2XLW A;  2LK4 A;  2Z15 A;  3B9Q A;  3T9O A;  5L0C A;  1C03 A;  2R7Q A;  5JSL A;  1VTM P;  4JTA B;  2YEV A;  1J8M F;  1VLS A;  4EHP A;  3KYI A;  1BR4 A;  1D0Z A;  3LLK A;  3ZWI A;  4A2N B;  2EIL C;  4A4A A;  1V74 B;  1TWA A;  2E87 A;  3O55 A;  3RH3 A;  3RIP A;  3V5X A;  2KJG A;  1TQG A;  2VCA A;  4JE9 A;  4O6M A;  3RQE A;  3U3B A;  1ZYR F;  3Q7L A;  1O87 A;  1YA7 O;  3DJU B;  2XS8 A;  4EUK B;  1BR1 A;  3L8I A;  2QUP A;  4IGG A;  2A6H F;  4LDR A;  1T01 A;  3WHN A;  1VYI A;  3W2V A;  4YT4 A;  4P9F A;  2D4U A;  4LDQ A;  4BJ5 C;  5KYU B;  4LLC A;  2QE9 A;  4D4X A;  3FOP A;  5JRA A;  4E0H A;  1MMA A;  1WWP A;  2PBE A;  1ZZP A;  2H7O A;  2YQY A;  3VF0 A;  3DM9 B;  3QTH A;  3S90 A;  2P1A A;  2V26 A;  1FMV A;  3DI5 A;  2W45 A;  4M63 A;  3SXY A;  2ZD9 A;  4W8K A;  3IHU A;  3AG2 C;  3B0V C;  4QI0 A;  1OXB A;  3N24 A;  1Q0F A;  5JP7 A;  4CIH A;  1ZU5 A;  3RKO F;  2L9J A;  3EPV A;  2KW3 C;  4YT5 A;  2L6F A;  2P7V A;  3U0C A;  4N4W A;  2HMZ A;  2YLI A;  3IQ5 A;  1TWC A;  3N0T A;  3VRC A;  4G7Z F;  1O5H A;  3B0P A;  3JT1 A;  2R9R B;  4LER A;  4RBN A;  5DVW A;  4Q7C A;  5GPG B;  1CGN A;  3NYM A;  5CI9 A;  4CDV A;  4OD5 A;  5F5H A;  3M1C B;  1ZHY A;  2J7P A;  3X2Q C;  4AL0 A;  2IYL D;  4EWC A;  4ULW A;  2GDC A;  3CAX A;  2PF4 E;  3RQF A;  2IOQ A;  1EI7 A;  1VYK A;  5L3V A;  1Q0G A;  1NZE A;  1ZHT A;  5JLI A;  1WAS A;  2J9W A;  3GEH A;  1D0Y A;  2UUH A;  3MFN A;  4MVZ A;  3ASO C;  5EGY A;  3IQC A;  2ZXR A;  4PR9 A;  2J9V A;  5KYU A;  2XLO A;  4FX5 A;  1TFK B;  4DRJ B;  3HLZ A;  4F4B A;  5L0I A;  2NSG A;  1ST6 A;  2HS5 A;  4XLP F;  2R7O A;  3C18 A;  3T6J A;  1H9T A;  1QPU A;  1YYX A;  3ZTM A;  1B68 A;  5IY5 C;  4K7B A;  2M64 A;  1Z3I X;  4N06 A;  4EBK A;  1YAU O;  4GQH A;  4CX9 A;  1JPN A;  4DVZ A;  5JS5 A;  1KU2 A;  1FAP B;  3SZR A;  3HNI A;  4JUR I;  3T6G B;  2NUP A;  2JPU A;  3F46 A;  1OKK A;  1YA9 A;  4I3M A;  2R7T A;  3H65 A;  2W9Y A;  2R7V A;  2HJM A;  2HKV A;  1Z7Q c;  3U2L A;  4BPM A;  5F28 E;  2FAP B;  4MQ9 F;  3JSZ A;  1QSP A;  4HFK B;  3LES A;  3LEV A;  3SXM A;  4BG0 A;  2R7U A;  4KNV A;  1MMG A;  4DJ9 A;  3C63 A;  3KL4 A;  4MTG A;  256B A;  1C17 M;  3S9O A;  3NRH A;  2C04 A;  5E3A A;  1OW6 A;  2PP4 A;  1AVO B;  2WVN A;  5D91 A;  4CSA A;  2I15 A;  3LS1 A;  5E3C A;  2R7X A;  4XPY A;  4GYT A;  4FWV A;  1LVK A;  4MVM A;  1L3P A;  3EFO A;  1SZI A;  1HW2 A; 
#chains in the Genus database with same CATH homology
 1YYJ A;  2XLV A;  3ZQY A;  1E84 A;  1CPR A;  3QW1 A;  2XM4 A;  4JEA A;  4ER9 A;  3M15 A;  4U9E A;  4CDY A;  2XLW A;  2XLD A;  4NC3 A;  3TOM A;  5JSL A;  3L1M A;  1BBH A;  1MQV A;  4IAQ A;  3ZWI A;  3M4C A;  2QLA A;  5JT4 A;  1LM3 B;  1APC A;  4JE9 A;  4WGY A;  2J8W A;  4JKV A;  1QQ3 A;  3NMK A;  1E85 A;  1EKY A;  2YLG A;  4D4X A;  5JRA A;  2YLD A;  3FOP A;  2BC5 A;  1GQA A;  3QVY A;  3HNK A;  3M4B A;  3FOO A;  4JEB A;  1E86 A;  1NBB A;  2J9B A;  1JAF A;  4WGZ A;  3C62 A;  2YL7 A;  3HNL A;  5JP7 A;  4N4W A;  3IQ5 A;  2YLI A;  2YL1 A;  3VRC A;  2YKZ A;  3QW0 A;  1CGN A;  4CDV A;  4CJO A;  5AGF A;  2CCY A;  3DE8 A;  4CJG A;  4CDA A;  1YZC A;  5JUA A;  1A7V A;  2XLM A;  4D4N A;  5B3I A;  5JLI A;  2YL0 A;  4EIY A;  2XM0 A;  3IQ6 A;  1S05 A;  2XLO A;  1YZA A;  4N6H A;  3U8P A;  4ULV A;  5JVE A;  2XL8 A;  1QPU A;  1YYX A;  3ZTM A;  3QVZ A;  4CX9 A;  1CPQ A;  5JS5 A;  3HNI A;  1CGO A;  3M79 A;  2XLH A;  2YL3 A;  3NMJ A;  4IB4 A;  4CIP A;  2XLE A;  2XL6 A;  3DE9 A;  1RCP A;  3C63 A;  4IAR A;  3TOL A;  256B A;  3ZTZ A;  4U9D A;  1E83 A;  3ZQV A;  3HNJ A;  1M6T A;  3NMI A;  4L6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...