4CDYA

Spectroscopically-validated structure of cytochrome c prime from alcaligenes xylosoxidans, reduced by x-ray irradiation at 160k
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fingerprinting Redox and Ligand States in Haemprotein Crystal Structures Using Resonance Raman Spectroscopy.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 47
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2013-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cdyA00
2J8WA 1S05A 1E85A 4CX9A 1CGNA 3QVYA 4N6HA 1CPQA 3ZQYA 4JEAA 4JE9A 2YLGA 4ULVA 3M4CA 3C62A 2YL0A 4JEBA 1E84A 2XL8A 4WGYA 256BA 2YL1A 5JLIA 1QQ3A 5JP7A 4CJOA 3FOPA 2QLAA 1GQAA 1MQVA 1CGOA 5JS5A 4CDAA 3M15A 2YKZA 4U9EA 3L1MA 5JSLA 2XLOA 3NMIA 2YL7A 3TOLA 2BC5A 4D4XA 3FOOA 1YYXA 3VRCA 4U9DA 3TOMA 2J9BA 3M79A 1YZAA 1QPUA 3C63A 4CJGA 3U8PA 3HNKA 1NBBA 4L6RA 4IAQA 2XLEA 3NMJA 5B3IA 2XLMA 1YYJA 3ZTZA 4N4WA 4NC3A 2XM0A 4JKVA 4CIPA 3HNIA 2XL6A 4CDYA 4D4NA 2XLHA 1YZCA 1EKYA 1A7VA 5JT4A 2YLIA 4CDVA 1BBHA 1E83A 3ZQVA 5JRAA 1APCA 2XLWA 3QW1A 1E86A 2CCYA 1JAFA 1CPRA 3ZWIA 3M4BA 3HNJA 3NMKA 5AGFA 1LM3B 2XLDA 4EIYA 2XLVA 3DE9A 5JVEA 1M6TA 4ER9A 3IQ6A 3QW0A 3HNLA 3ZTMA 3DE8A 3IQ5A 4IARA 2YLDA 1RCPA 4WGZA 2XM4A 3QVZA 5JUAA 4IB4A 2YL3A
chains in the Genus database with same CATH superfamily
2J8WA 2MYSA 1BR2A 2J7PA 4KC9A 1E85A 1QLEC 4IWBA 2QUPA 1OW7A 2VB6A 2L6HA 3QVYA 3UMKA 2YEVA 4Q4ZF 3RH3A 1O3UA 2IYLD 4JEAA 2KK1A 1LI7A 1SYQA 2YLGA 1LS4A 4RBNA 3L8JA 4U5HA 3T4RA 3C62A 3K1HA 2R03A 5L3QA 3ASNC 2QTVA 2XL8A 2CGEA 3VM6A 1I5NA 3E9VA 3TJ6A 4BJ5C 3A9CA 3QZCA 2LD6A 2YL1A 4NY3A 4WGYA 5JLIA 3EGDA 3EHMA 2R7VA 1FNTc 3FVYA 4Z9JA 4CJOA 3S84A 3PDMP 4MTFA 4OIRF 1HMOA 1XZPA 1NFOA 3DAFA 4PJJA 2P7VA 5DS6A 2KGOA 2RSEB 3B71A 4LACB 3T6BA 4PFPA 2P6VA 3QTHA 4AE4B 5DVWA 4Q5SF 2Y3HA 3RVYA 2LFFA 2YKZA 4ANJA 4CS9A 1LKXA 2LQGA 2WZGA 4PJNA 5COGA 4CS8C 2HKVA 2O9XA 3NRHA 2L9JA 1QVXA 2KNHA 1C03A 3F47A 4MVMA 4P6IC 4OINF 3LUTB 3KKBA 3WG7C 2BC5A 1T5OA 4J7YA 2OOCA 2Q9CA 1WTYA 3K7DA 3AOUA 4O6YA 3FOOA 4D4XA 2KYHA 5HSWA 4LDKA 5BUOA 3LAYA 1EQ1A 3GM1A 3TOMA 1WWPA 1V55C 1ZW2A 1XZQA 2A6HF 2ZD9A 1BZ4A 2ZXPA 1NU9C 3GORA 3L34A 4W8KA 5FZTA 3UGOA 4CJGA 2LIGA 3JZ0A 4JJFA 3B9QA 3ZG1A 2PX0A 2Y69C 4YL0A 1NU7D 1SMYF 2IM8A 2OKUA 1MNEA 2JX0A 4K1OA 1J8MF 3GM3A 1RKEA 3ZVRA 2XLMA 4Q7CA 5D92A 2WVNA 3EGXA 5A6BD 4DBQA 2P61A 1Q0KA 3FMSA 4AE4A 1HE9A 4CDYA 1LE4A 1RKCA 3RVZA 2XLHA 1F1MA 3TQOA 4HE8D 4PR9A 1L3PA 1K40A 1VLSA 5B1AC 1DOVA 1YA9A 1KU2A 2Q3TA 4M63A 3U9JA 3WHNA 4U5BE 5T1DB 1SR2A 3FAJA 3KL4A 5JRAA 2V3CC 2XS8A 1OCZC 3EPVA 3FXHA 3DWWA 1ZW3A 3L0IA 5KYYB 1E86A 2J0WA 1HW1A 1CPRA 3ZWIA 3KPHA 3B0VC 1T01A 4O6MA 3U3BA 3HNJA 4OD4A 3ZSUA 2IXOA 4DBRA 1AUEA 1M2OA 1LM3B 4NCQA 3RKOF 3SXYA 3WODF 2EPMX 1HE1A 2XLDA 4MVOA 1LVKA 4G0HA 1L7CA 2XS1A 3JYHA 4BG0A 3U8VA 3POVA 3EFOA 1H7IA 2C04A 3IQ6A 2KC3A 2R7QA 3QW0A 4DOZA 2JD3A 2ASRA 2W45A 5KYYA 4G7HF 1A0BA 2AP3A 3SXZA 4ULWA 4JIOA 3S27A 1AVOB 3EJNA 2HFIA 1MNDA 3FAPB 4WGZA 3DD7A 5F28E 3LJBA 3G50A 1YARO 1IW7F 1D1CA 3V7OA 4I1MA 1C02A 4X0RA 1M2VB 4IRUA 4PACA 1S05A 4CX9A 4BJ1A 1YAUO 4AK9A 4E0HA 2A69F 4YN0B 4XEFA 4YK5A 3RW0A 1KTMA 1CPQA 1K05A 3HJCA 3A11A 3IQCA 4EWCA 2XRHA 4EBJA 1D0XA 2D4UA 4MW8A 1O5HA 4E7SA 3AQBA 3SYNA 1E84A 4MVUA 4XEKA 3G4XA 1GGQA 2Y3GA 2H7OA 1T6QA 2IBFA 2B0JA 4KNWA 2PNOA 1M56C 5KYUB 3JTLO 1D0YA 1CGME 1R5ID 4OIOF 1NG1A 1GQAA 1EI7A 2AVKA 1CGOA 3UGPA 3SP1A 5FCLA 1B68A 1Q0GA 3AGTA 1G4US 2IXNA 5L0CA 1ZHYA 2EILC 2C03A 5B1BC 1TQGA 3DAGA 3IPMO 3MYFA 4LLEA 3CSKA 2HJMA 3Q6MA 4YT2A 5D91A 2XL4A 2R7TA 3B29A 2EINC 2HS5A 2NSFA 5JSLA 1ZHXA 1MMNA 2HMQA 4LDRA 2AU5A 2YQYA 3U2MA 3X1OA 2QE9A 1Q0FA 4EKWA 1KNYA 1SF8A 2G3KA 3RQFA 3LS1A 4MQ9F 1I4YA 1LI5A 2HUJA 4DVZA 3NKDA 1J8YF 3VRCA 1ZHWA 4U9DA 2HMZA 2J9BA 2DYSC 2YRFA 1JRAA 4IB4A 5CI9A 5EGYA 3RQGA 3I5QA 1VK5A 1W2WA 2A68F 1QPUA 3Q7GA 3K6BA 3C63A 5DQTA 3LNRA 4LDQA 1QZXA 5IY5C 3LEVA 2XXAB 2KQ9A 4IGGA 3U8PA 1NBBA 2DB4A 2P0NA 1PD1A 2ICWG 2W9YA 4I3MA 3S29A 2VCCA 1M57C 2EIKC 4JTDB 2ZXRA 3AQCA 4KBLA 2Y3BA 1LIHA 3RIPA 2DGJA 2WVOA 1Z6AA 4AL1A 2IOQA 3MYIA 1YYJA 4MNDA 2R05A 4ONSA 5F5HA 1Q0MA 2NPUA 3O6XA 4CIHA 1ORYA 1JMWA 3JYYA 4GYTA 4HFKB 4XPYA 3RF3A 1A7DA 1AEPA 3C8ZA 1BR1A 2KW3C 2OQMA 3HTKC 1YZCA 3EQLF 2R9RB 2E87A 4EUKB 3DJNB 2YLIA 3O55A 4OD5A 3TJ5A 4CDVA 1YVIA 2HV6A 1E83A 4XEVA 1TFKB 3ZQVA 3FDQA 1H9TA 3T6GB 2CCYA 4Z9IA 2NUTA 1OXKA 3LLIA 3V5YA 4PK4A 1I4ZA 1ZVZA 3T9OA 3M4BA 3NMKA 3SXKA 3H2VA 4J30B 2A6EF 3AJMA 3JCUQ 4B6IA 4CBEA 2VC9A 1TFOB 1Z63A 1TWHA 3DKAA 2XLVA 3DM9B 4EBKA 2I8BA 1YLMA 3W2VA 5T3TA 4CSAC 4ER9A 2EPLX 3U0CA 1RMVA 3ZTMA 4UDVA 2XSEA 5E3CA 2G3VA 3HKKA 3KYIA 3OWTA 4RDAA 1MMGA 3ZC4A 3DI5A 3LLKA 4DRIB 1YDIA 5AC5A 2H7VC 2RD9A 2WB7A 3C7JA 3US6A 3X2QC 4AX2A 3U9MA 4C7OA 2XM4A 5F5FA 1ZHTA 1NZEA 1Y4CA 2NUPA 2HJ3A 4PFOA 2OEXA 2IXPA 1VMAA 4FWVA 3ATPA 3UR3C 3M79A 1BR4A 1U0BB 4MW3A 5B3SC 1T9KA 1ZYRF 2QY9A 2CYDA 1CGNA 2EIMC 3OEOA 4NTAA 4E17A 4C3BA 3F46A 4XLPF 1G4WR 4YJWA 2BL2A 3N0TA 2PF4E 1TWCA 5DS4A 2OCCC 4YT4A 1E2XA 4JEBA 4CS8A 4C7OB 2Z15A 3RYLA 4MTOA 5A6JA 1VTMP 256BA 3W4YA 3IHUA 4R32A 3DXJF 1QQ3A 5JP7A 3GWNA 3FOPA 3MLGA 2OJQA 5K0IA 3CQZA 3WAQA 1RKEB 2HSBA 3PCVA 1OCOC 1R4TA 4QDLA 3W2WA 5A6BA 2MWQA 2PFDA 5JS5A 1DOWA 2KJGA 2ZPAA 3Q7LA 3ZDLA 3ABMC 2G62A 4JJGA 2OU6A 4U5FE 2AWCA 4EBBA 2ETSA 3K1IC 1ZHZA 4U9EA 2H7BA 2L6FA 3ZIBA 4DXWA 1YA7O 3L1MA 3SXMA 5DS5A 4I44A 3EGDB 1QSPA 5BQHA 2R7SA 2I15A 4YT8A 4DJ9A 2XLOA 3DJUB 5CI8A 2FGYA 4XTKA 2OEVA 4K0DA 4J7TA 3Q6NA 3H2UA 4CS7A 1WASA 3O39A 1YYXA 3U2LA 1G8XA 2FAPB 2HV7A 3C8GB 3ABLC 3AG4C 1YZAA 3JRMO 5COFA 5L3VA 1RJ9A 4BEJA 2Q9BA 4J32B 1NFNA 4NTBA 4GEHA 2NUTB 4LERA 1JOGA 3HNKA 2TMVP 2PBEA 3EH1A 3GANA 3GEEA 4L6RA 3N2ZB 4XLNF 4W8PA 5HV9A 5AC4A 4E18A 3PHF2 2XLEA 1MMDA 4PJLA 2YVKA 3GODA 4O6NA 3T6JA 2HZ8A 1OW8A 1EA8A 4AL0A 1Z7Qc 2WZLA 4NC3A 2J45A 2L7AA 1H9GA 1XWJA 3JSZA 2XM0A 4JKVA 1D1BA 2BE5F 2F22A 2XL6A 3CZ6A 3E70C 2A0UA 1OR2A 1QKRA 4JURI 3ASOC 4WABA 5DQZA 4CS9C 2NG1A 3EHNA 4I1OB 2R7XA 1FAPB 1O87A 2D5RB 2EPKX 2PX3A 4XPXA 4DRJB 2H8AA 1U89A 1BBHA 2R7OA 4F4BA 1VLTA 4XPWA 1UFBA 3EFOB 1NSGB 1APCA 4PJMA 3M1CB 3VF0A 3S0XA 2GAQA 2XLWA 1YJGA 3QW1A 3S9OA 3GWLA 3GM2A 3W8HA 1JAFA 4DRHB 2YHSA 2YZSA 1D1AA 1FFTC 1TWAA 3ABKC 3NKEA 1LS1A 4BJ5A 1ORSC 2P1AA 4A4AA 5AGFA 1JPJA 2Q9AA 4ZLCA 4EHPA 1FTSA 3V5XA 2UUHA 1C17M 3DE9A 5JVEA 1M6TA 2HSQA 1Z5ZA 4JW1A 5EK0A 4MVZA 3AGUA 1FFHA 2J0XA 4P9FA 1PCXA 2J9VA 2ZXOA 4QI2A 3CAXA 2JPUA 2ZXWC 3DZAA 2LP4A 4IARA 3UNGC 3S28A 3V5ZA 2VCAA 2GWWA 3RQEA 2AWYA 2YLDA 3NYMA 4JZAA 1VB5A 3EGXB 1T6IA 5KYWB 3U3FA 2OG2A 1SZIA 3AG2C 3EZHA 2YWAA 3C8GA 2CDQA 4BJTA 3MBGA 3TD7A 1Z3IX 1WATA 2VASA 2YL3A 4YL1A 4BEMJ 2QNLA 1GM5A 5E2QA 5KYUA 3G4ZA 1FMWA 5E3AA 4C3EA 2EIJC 4NQFA 5KYXA 2L81A 4U5EE 3LESA 4Z9HA 4N6HA 4MS2A 1TR2A 1G5ZA 2LFDA 4O7GA 3ZQYA 1FMVA 4LLCA 1NLXA 4JE9A 5TJ5E 4ULVA 2M64A 3M4CA 1OCCC 1Y6DA 3VYWA 2R7WA 1OCRC 2KSFA 2YL0A 4MVQA 3TK0A 2XXAA 3K1IA 3IQTA 5L0IA 4H4KC 4KNVA 5E33A 2R7RA 5EHHA 4YL3A 1VYIA 3SEOA 3JRTA 3ECSA 4MVSA 1JPNA 4WJ0A 1ZU5A 2J7PD 1LE2A 1MMAA 2GFHA 4IJJA 4K7BA 4MVRA 4KI2A 4G7OF 1N1CA 5L0DA 2Q4FA 3U5SA 2DYRC 2QLAA 5BQIA 5DLJA 1MQVA 3B0UX 1Q0DA 4RD9A 3L8IA 4CDAA 3I5PA 2NUPB 3M15A 3MX3A 5CIVA 3TULA 1VOMA 3N24A 4JTAB 2A1DD 1OKKD 2CNWD 3DM5A 3GEIA 3OA1A 2VCBA 3R7CA 3UMIA 1RXQA 2J46A 1ZZPA 1S7ZA 2MHRA 2R25A 2R02A 1V74B 5GPGB 3JSEO 1WGWA 4BJ6A 4FAPB 4FX5A 5L0HA 3HLZA 3S90A 4U5GA 2VH3A 2R7UA 1PV3A 3C18A 3NMIA 2YL7A 3SNHA 1K04A 3TOLA 3EG9A 2GDCA 4NTFA 2J9WA 3LS0A 1H6GA 2A0BA 1A7EA 3J06A 3MFNA 3B0PA 2B0HA 3NDBB 3AG3C 5A6KA 3NYJA 1UG7A 5A6AA 2L6GA 2CW0F 1GS9A 2LK4A 4U5CE 3UMHA 1HW2A 3KMIA 4YT5A 3QMKA 2OJED 3EH2A 5KYWA 1WN0A 2WL8A 3GEHA 3H65A 1OXBA 1BDJB 1T6UA 3DMDA 4IAQA 1OW6A 1OKKA 2CNWA 4A2NB 1V54C 3FHDA 2Q7RA 5L0GA 3NMJA 3JT1A 2LCHA 3K66A 4E0IA 5B3IA 3C8GD 2X0CA 5KYXB 4CSAA 4OIQF 4MTGA 3ZTZA 4N4WA 1WOLA 1OQCA 3KYJA 4JCHA 4YWQA 4BPMA 3IEEA 4CIPA 4BJ6C 3HNIA 3BRJA 4JRZA 3LNMB 3NYLA 4D4NA 1ORJA 5KYNA 4DVYP 4G78A 3AG1C 5BQGA 1EKYA 2J9UA 1A7VA 5JT4A 3O10A 5T3WA 2EPNA 1LPEA 2X51A 4QI0A 1D0ZA 3VAYA 1OR3A 4FESA 2M4EA 4E7ZA 2Y39A 3EG9B 1M2VA 2W4BA 4JC7A 2UUIA 5L0JA 4XWJA 3R2PA 4G7ZF 1PD0A 1TKNA 2EPOA 4N06A 3RFYA 1HY5A 1ZU4A 4U5DE 4XQ1A 5COMA 3BEHA 3W8IA 1Z23A 4C3DA 2DI3A 4N6CA 2V26A 2IXMA 3SZRA 2LSEA 3NG1A 4EIYA 3CEXA 4OIPF 2Q00A 4O79A 1FR0A 2W4MA 1IZMA 5L0FA 4H54A 4GQHA 4ZLDA 5A69A 3LEOA 4JTCB 3K33A 3HNLA 1JR8A 2Y3DA 3DE8A 3IQ5A 4JVSA 1RJ9B 4JCZA 1VYKA 4IAOA 1ST6A 2WVQA 3PMRA 2FFHA 4HFFB 3KH2A 1RCPA 3EZIA 4P9TA 3I4UA 1A41A 1U6HA 3QVZA 4HEAJ 5JUAA 1HMDA 1TWGA 1V4AA 2GA0A 3ITFA 2WZFA 2NSGA 2PP4A
chains in the Genus database with same CATH topology
2J8WA 1S05A 1E85A 4CX9A 1CGNA 3QVYA 4N6HA 1CPQA 3ZQYA 4JEAA 4JE9A 2YLGA 4ULVA 3M4CA 3C62A 2YL0A 4JEBA 1E84A 2XL8A 4WGYA 256BA 2YL1A 5JLIA 1QQ3A 5JP7A 4CJOA 3FOPA 2QLAA 1GQAA 1MQVA 1CGOA 5JS5A 4CDAA 3M15A 2YKZA 4U9EA 3L1MA 5JSLA 2XLOA 3NMIA 2YL7A 3TOLA 2BC5A 4D4XA 3FOOA 1YYXA 3VRCA 4U9DA 3TOMA 2J9BA 3M79A 1YZAA 1QPUA 3C63A 4CJGA 3U8PA 3HNKA 1NBBA 4L6RA 4IAQA 2XLEA 3NMJA 5B3IA 2XLMA 1YYJA 3ZTZA 4N4WA 4NC3A 2XM0A 4JKVA 4CIPA 3HNIA 2XL6A 4CDYA 4D4NA 2XLHA 1YZCA 1EKYA 1A7VA 5JT4A 2YLIA 4CDVA 1BBHA 1E83A 3ZQVA 5JRAA 1APCA 2XLWA 3QW1A 1E86A 2CCYA 1JAFA 1CPRA 3ZWIA 3M4BA 3HNJA 3NMKA 5AGFA 1LM3B 2XLDA 4EIYA 2XLVA 3DE9A 5JVEA 1M6TA 4ER9A 3IQ6A 3QW0A 3HNLA 3ZTMA 3DE8A 3IQ5A 4IARA 2YLDA 1RCPA 4WGZA 2XM4A 3QVZA 5JUAA 4IB4A 2YL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8W A;  1S05 A;  1E85 A;  4CX9 A;  1CGN A;  3QVY A;  4N6H A;  1CPQ A;  3ZQY A;  4JEA A;  4JE9 A;  2YLG A;  4ULV A;  3M4C A;  3C62 A;  2YL0 A;  4JEB A;  1E84 A;  2XL8 A;  4WGY A;  256B A;  2YL1 A;  5JLI A;  1QQ3 A;  5JP7 A;  4CJO A;  3FOP A;  2QLA A;  1GQA A;  1MQV A;  1CGO A;  5JS5 A;  4CDA A;  3M15 A;  2YKZ A;  4U9E A;  3L1M A;  5JSL A;  2XLO A;  3NMI A;  2YL7 A;  3TOL A;  2BC5 A;  4D4X A;  3FOO A;  1YYX A;  3VRC A;  4U9D A;  3TOM A;  2J9B A;  3M79 A;  1YZA A;  1QPU A;  3C63 A;  4CJG A;  3U8P A;  3HNK A;  1NBB A;  4L6R A;  4IAQ A;  2XLE A;  3NMJ A;  5B3I A;  2XLM A;  1YYJ A;  3ZTZ A;  4N4W A;  4NC3 A;  2XM0 A;  4JKV A;  4CIP A;  3HNI A;  2XL6 A;  4CDY A;  4D4N A;  2XLH A;  1YZC A;  1EKY A;  1A7V A;  5JT4 A;  2YLI A;  4CDV A;  1BBH A;  1E83 A;  3ZQV A;  5JRA A;  1APC A;  2XLW A;  3QW1 A;  1E86 A;  2CCY A;  1JAF A;  1CPR A;  3ZWI A;  3M4B A;  3HNJ A;  3NMK A;  5AGF A;  1LM3 B;  2XLD A;  4EIY A;  2XLV A;  3DE9 A;  5JVE A;  1M6T A;  4ER9 A;  3IQ6 A;  3QW0 A;  3HNL A;  3ZTM A;  3DE8 A;  3IQ5 A;  4IAR A;  2YLD A;  1RCP A;  4WGZ A;  2XM4 A;  3QVZ A;  5JUA A;  4IB4 A;  2YL3 A; 
#chains in the Genus database with same CATH topology
 2J8W A;  2MYS A;  1BR2 A;  2J7P A;  4KC9 A;  1E85 A;  1QLE C;  4IWB A;  2QUP A;  1OW7 A;  2VB6 A;  2L6H A;  3QVY A;  3UMK A;  2YEV A;  4Q4Z F;  3RH3 A;  1O3U A;  2IYL D;  4JEA A;  2KK1 A;  1LI7 A;  1SYQ A;  2YLG A;  1LS4 A;  4RBN A;  3L8J A;  4U5H A;  3T4R A;  3C62 A;  3K1H A;  2R03 A;  5L3Q A;  3ASN C;  2QTV A;  2XL8 A;  2CGE A;  3VM6 A;  1I5N A;  3E9V A;  3TJ6 A;  4BJ5 C;  3A9C A;  3QZC A;  2LD6 A;  2YL1 A;  4NY3 A;  4WGY A;  5JLI A;  3EGD A;  3EHM A;  2R7V A;  1FNT c;  3FVY A;  4Z9J A;  4CJO A;  3S84 A;  3PDM P;  4MTF A;  4OIR F;  1HMO A;  1XZP A;  1NFO A;  3DAF A;  4PJJ A;  2P7V A;  5DS6 A;  2KGO A;  2RSE B;  3B71 A;  4LAC B;  3T6B A;  4PFP A;  2P6V A;  3QTH A;  4AE4 B;  5DVW A;  4Q5S F;  2Y3H A;  3RVY A;  2LFF A;  2YKZ A;  4ANJ A;  4CS9 A;  1LKX A;  2LQG A;  2WZG A;  4PJN A;  5COG A;  4CS8 C;  2HKV A;  2O9X A;  3NRH A;  2L9J A;  1QVX A;  2KNH A;  1C03 A;  3F47 A;  4MVM A;  4P6I C;  4OIN F;  3LUT B;  3KKB A;  3WG7 C;  2BC5 A;  1T5O A;  4J7Y A;  2OOC A;  2Q9C A;  1WTY A;  3K7D A;  3AOU A;  4O6Y A;  3FOO A;  4D4X A;  2KYH A;  5HSW A;  4LDK A;  5BUO A;  3LAY A;  1EQ1 A;  3GM1 A;  3TOM A;  1WWP A;  1V55 C;  1ZW2 A;  1XZQ A;  2A6H F;  2ZD9 A;  1BZ4 A;  2ZXP A;  1NU9 C;  3GOR A;  3L34 A;  4W8K A;  5FZT A;  3UGO A;  4CJG A;  2LIG A;  3JZ0 A;  4JJF A;  3B9Q A;  3ZG1 A;  2PX0 A;  2Y69 C;  4YL0 A;  1NU7 D;  1SMY F;  2IM8 A;  2OKU A;  1MNE A;  2JX0 A;  4K1O A;  1J8M F;  3GM3 A;  1RKE A;  3ZVR A;  2XLM A;  4Q7C A;  5D92 A;  2WVN A;  3EGX A;  5A6B D;  4DBQ A;  2P61 A;  1Q0K A;  3FMS A;  4AE4 A;  1HE9 A;  4CDY A;  1LE4 A;  1RKC A;  3RVZ A;  2XLH A;  1F1M A;  3TQO A;  4HE8 D;  4PR9 A;  1L3P A;  1K40 A;  1VLS A;  5B1A C;  1DOV A;  1YA9 A;  1KU2 A;  2Q3T A;  4M63 A;  3U9J A;  3WHN A;  4U5B E;  5T1D B;  1SR2 A;  3FAJ A;  3KL4 A;  5JRA A;  2V3C C;  2XS8 A;  1OCZ C;  3EPV A;  3FXH A;  3DWW A;  1ZW3 A;  3L0I A;  5KYY B;  1E86 A;  2J0W A;  1HW1 A;  1CPR A;  3ZWI A;  3KPH A;  3B0V C;  1T01 A;  4O6M A;  3U3B A;  3HNJ A;  4OD4 A;  3ZSU A;  2IXO A;  4DBR A;  1AUE A;  1M2O A;  1LM3 B;  4NCQ A;  3RKO F;  3SXY A;  3WOD F;  2EPM X;  1HE1 A;  2XLD A;  4MVO A;  1LVK A;  4G0H A;  1L7C A;  2XS1 A;  3JYH A;  4BG0 A;  3U8V A;  3POV A;  3EFO A;  1H7I A;  2C04 A;  3IQ6 A;  2KC3 A;  2R7Q A;  3QW0 A;  4DOZ A;  2JD3 A;  2ASR A;  2W45 A;  5KYY A;  4G7H F;  1A0B A;  2AP3 A;  3SXZ A;  4ULW A;  4JIO A;  3S27 A;  1AVO B;  3EJN A;  2HFI A;  1MND A;  3FAP B;  4WGZ A;  3DD7 A;  5F28 E;  3LJB A;  3G50 A;  1YAR O;  1IW7 F;  1D1C A;  3V7O A;  4I1M A;  1C02 A;  4X0R A;  1M2V B;  4IRU A;  4PAC A;  1S05 A;  4CX9 A;  4BJ1 A;  1YAU O;  4AK9 A;  4E0H A;  2A69 F;  4YN0 B;  4XEF A;  4YK5 A;  3RW0 A;  1KTM A;  1CPQ A;  1K05 A;  3HJC A;  3A11 A;  3IQC A;  4EWC A;  2XRH A;  4EBJ A;  1D0X A;  2D4U A;  4MW8 A;  1O5H A;  4E7S A;  3AQB A;  3SYN A;  1E84 A;  4MVU A;  4XEK A;  3G4X A;  1GGQ A;  2Y3G A;  2H7O A;  1T6Q A;  2IBF A;  2B0J A;  4KNW A;  2PNO A;  1M56 C;  5KYU B;  3JTL O;  1D0Y A;  1CGM E;  1R5I D;  4OIO F;  1NG1 A;  1GQA A;  1EI7 A;  2AVK A;  1CGO A;  3UGP A;  3SP1 A;  5FCL A;  1B68 A;  1Q0G A;  3AGT A;  1G4U S;  2IXN A;  5L0C A;  1ZHY A;  2EIL C;  2C03 A;  5B1B C;  1TQG A;  3DAG A;  3IPM O;  3MYF A;  4LLE A;  3CSK A;  2HJM A;  3Q6M A;  4YT2 A;  5D91 A;  2XL4 A;  2R7T A;  3B29 A;  2EIN C;  2HS5 A;  2NSF A;  5JSL A;  1ZHX A;  1MMN A;  2HMQ A;  4LDR A;  2AU5 A;  2YQY A;  3U2M A;  3X1O A;  2QE9 A;  1Q0F A;  4EKW A;  1KNY A;  1SF8 A;  2G3K A;  3RQF A;  3LS1 A;  4MQ9 F;  1I4Y A;  1LI5 A;  2HUJ A;  4DVZ A;  3NKD A;  1J8Y F;  3VRC A;  1ZHW A;  4U9D A;  2HMZ A;  2J9B A;  2DYS C;  2YRF A;  1JRA A;  4IB4 A;  5CI9 A;  5EGY A;  3RQG A;  3I5Q A;  1VK5 A;  1W2W A;  2A68 F;  1QPU A;  3Q7G A;  3K6B A;  3C63 A;  5DQT A;  3LNR A;  4LDQ A;  1QZX A;  5IY5 C;  3LEV A;  2XXA B;  2KQ9 A;  4IGG A;  3U8P A;  1NBB A;  2DB4 A;  2P0N A;  1PD1 A;  2ICW G;  2W9Y A;  4I3M A;  3S29 A;  2VCC A;  1M57 C;  2EIK C;  4JTD B;  2ZXR A;  3AQC A;  4KBL A;  2Y3B A;  1LIH A;  3RIP A;  2DGJ A;  2WVO A;  1Z6A A;  4AL1 A;  2IOQ A;  3MYI A;  1YYJ A;  4MND A;  2R05 A;  4ONS A;  5F5H A;  1Q0M A;  2NPU A;  3O6X A;  4CIH A;  1ORY A;  1JMW A;  3JYY A;  4GYT A;  4HFK B;  4XPY A;  3RF3 A;  1A7D A;  1AEP A;  3C8Z A;  1BR1 A;  2KW3 C;  2OQM A;  3HTK C;  1YZC A;  3EQL F;  2R9R B;  2E87 A;  4EUK B;  3DJN B;  2YLI A;  3O55 A;  4OD5 A;  3TJ5 A;  4CDV A;  1YVI A;  2HV6 A;  1E83 A;  4XEV A;  1TFK B;  3ZQV A;  3FDQ A;  1H9T A;  3T6G B;  2CCY A;  4Z9I A;  2NUT A;  1OXK A;  3LLI A;  3V5Y A;  4PK4 A;  1I4Z A;  1ZVZ A;  3T9O A;  3M4B A;  3NMK A;  3SXK A;  3H2V A;  4J30 B;  2A6E F;  3AJM A;  3JCU Q;  4B6I A;  4CBE A;  2VC9 A;  1TFO B;  1Z63 A;  1TWH A;  3DKA A;  2XLV A;  3DM9 B;  4EBK A;  2I8B A;  1YLM A;  3W2V A;  5T3T A;  4CSA C;  4ER9 A;  2EPL X;  3U0C A;  1RMV A;  3ZTM A;  4UDV A;  2XSE A;  5E3C A;  2G3V A;  3HKK A;  3KYI A;  3OWT A;  4RDA A;  1MMG A;  3ZC4 A;  3DI5 A;  3LLK A;  4DRI B;  1YDI A;  5AC5 A;  2H7V C;  2RD9 A;  2WB7 A;  3C7J A;  3US6 A;  3X2Q C;  4AX2 A;  3U9M A;  4C7O A;  2XM4 A;  5F5F A;  1ZHT A;  1NZE A;  1Y4C A;  2NUP A;  2HJ3 A;  4PFO A;  2OEX A;  2IXP A;  1VMA A;  4FWV A;  3ATP A;  3UR3 C;  3M79 A;  1BR4 A;  1U0B B;  4MW3 A;  5B3S C;  1T9K A;  1ZYR F;  2QY9 A;  2CYD A;  1CGN A;  2EIM C;  3OEO A;  4NTA A;  4E17 A;  4C3B A;  3F46 A;  4XLP F;  1G4W R;  4YJW A;  2BL2 A;  3N0T A;  2PF4 E;  1TWC A;  5DS4 A;  2OCC C;  4YT4 A;  1E2X A;  4JEB A;  4CS8 A;  4C7O B;  2Z15 A;  3RYL A;  4MTO A;  5A6J A;  1VTM P;  256B A;  3W4Y A;  3IHU A;  4R32 A;  3DXJ F;  1QQ3 A;  5JP7 A;  3GWN A;  3FOP A;  3MLG A;  2OJQ A;  5K0I A;  3CQZ A;  3WAQ A;  1RKE B;  2HSB A;  3PCV A;  1OCO C;  1R4T A;  4QDL A;  3W2W A;  5A6B A;  2MWQ A;  2PFD A;  5JS5 A;  1DOW A;  2KJG A;  2ZPA A;  3Q7L A;  3ZDL A;  3ABM C;  2G62 A;  4JJG A;  2OU6 A;  4U5F E;  2AWC A;  4EBB A;  2ETS A;  3K1I C;  1ZHZ A;  4U9E A;  2H7B A;  2L6F A;  3ZIB A;  4DXW A;  1YA7 O;  3L1M A;  3SXM A;  5DS5 A;  4I44 A;  3EGD B;  1QSP A;  5BQH A;  2R7S A;  2I15 A;  4YT8 A;  4DJ9 A;  2XLO A;  3DJU B;  5CI8 A;  2FGY A;  4XTK A;  2OEV A;  4K0D A;  4J7T A;  3Q6N A;  3H2U A;  4CS7 A;  1WAS A;  3O39 A;  1YYX A;  3U2L A;  1G8X A;  2FAP B;  2HV7 A;  3C8G B;  3ABL C;  3AG4 C;  1YZA A;  3JRM O;  5COF A;  5L3V A;  1RJ9 A;  4BEJ A;  2Q9B A;  4J32 B;  1NFN A;  4NTB A;  4GEH A;  2NUT B;  4LER A;  1JOG A;  3HNK A;  2TMV P;  2PBE A;  3EH1 A;  3GAN A;  3GEE A;  4L6R A;  3N2Z B;  4XLN F;  4W8P A;  5HV9 A;  5AC4 A;  4E18 A;  3PHF 2;  2XLE A;  1MMD A;  4PJL A;  2YVK A;  3GOD A;  4O6N A;  3T6J A;  2HZ8 A;  1OW8 A;  1EA8 A;  4AL0 A;  1Z7Q c;  2WZL A;  4NC3 A;  2J45 A;  2L7A A;  1H9G A;  1XWJ A;  3JSZ A;  2XM0 A;  4JKV A;  1D1B A;  2BE5 F;  2F22 A;  2XL6 A;  3CZ6 A;  3E70 C;  2A0U A;  1OR2 A;  1QKR A;  4JUR I;  3ASO C;  4WAB A;  5DQZ A;  4CS9 C;  2NG1 A;  3EHN A;  4I1O B;  2R7X A;  1FAP B;  1O87 A;  2D5R B;  2EPK X;  2PX3 A;  4XPX A;  4DRJ B;  2H8A A;  1U89 A;  1BBH A;  2R7O A;  4F4B A;  1VLT A;  4XPW A;  1UFB A;  3EFO B;  1NSG B;  1APC A;  4PJM A;  3M1C B;  3VF0 A;  3S0X A;  2GAQ A;  2XLW A;  1YJG A;  3QW1 A;  3S9O A;  3GWL A;  3GM2 A;  3W8H A;  1JAF A;  4DRH B;  2YHS A;  2YZS A;  1D1A A;  1FFT C;  1TWA A;  3ABK C;  3NKE A;  1LS1 A;  4BJ5 A;  1ORS C;  2P1A A;  4A4A A;  5AGF A;  1JPJ A;  2Q9A A;  4ZLC A;  4EHP A;  1FTS A;  3V5X A;  2UUH A;  1C17 M;  3DE9 A;  5JVE A;  1M6T A;  2HSQ A;  1Z5Z A;  4JW1 A;  5EK0 A;  4MVZ A;  3AGU A;  1FFH A;  2J0X A;  4P9F A;  1PCX A;  2J9V A;  2ZXO A;  4QI2 A;  3CAX A;  2JPU A;  2ZXW C;  3DZA A;  2LP4 A;  4IAR A;  3UNG C;  3S28 A;  3V5Z A;  2VCA A;  2GWW A;  3RQE A;  2AWY A;  2YLD A;  3NYM A;  4JZA A;  1VB5 A;  3EGX B;  1T6I A;  5KYW B;  3U3F A;  2OG2 A;  1SZI A;  3AG2 C;  3EZH A;  2YWA A;  3C8G A;  2CDQ A;  4BJT A;  3MBG A;  3TD7 A;  1Z3I X;  1WAT A;  2VAS A;  2YL3 A;  4YL1 A;  4BEM J;  2QNL A;  1GM5 A;  5E2Q A;  5KYU A;  3G4Z A;  1FMW A;  5E3A A;  4C3E A;  2EIJ C;  4NQF A;  5KYX A;  2L81 A;  4U5E E;  3LES A;  4Z9H A;  4N6H A;  4MS2 A;  1TR2 A;  1G5Z A;  2LFD A;  4O7G A;  3ZQY A;  1FMV A;  4LLC A;  1NLX A;  4JE9 A;  5TJ5 E;  4ULV A;  2M64 A;  3M4C A;  1OCC C;  1Y6D A;  3VYW A;  2R7W A;  1OCR C;  2KSF A;  2YL0 A;  4MVQ A;  3TK0 A;  2XXA A;  3K1I A;  3IQT A;  5L0I A;  4H4K C;  4KNV A;  5E33 A;  2R7R A;  5EHH A;  4YL3 A;  1VYI A;  3SEO A;  3JRT A;  3ECS A;  4MVS A;  1JPN A;  4WJ0 A;  1ZU5 A;  2J7P D;  1LE2 A;  1MMA A;  2GFH A;  4IJJ A;  4K7B A;  4MVR A;  4KI2 A;  4G7O F;  1N1C A;  5L0D A;  2Q4F A;  3U5S A;  2DYR C;  2QLA A;  5BQI A;  5DLJ A;  1MQV A;  3B0U X;  1Q0D A;  4RD9 A;  3L8I A;  4CDA A;  3I5P A;  2NUP B;  3M15 A;  3MX3 A;  5CIV A;  3TUL A;  1VOM A;  3N24 A;  4JTA B;  2A1D D;  1OKK D;  2CNW D;  3DM5 A;  3GEI A;  3OA1 A;  2VCB A;  3R7C A;  3UMI A;  1RXQ A;  2J46 A;  1ZZP A;  1S7Z A;  2MHR A;  2R25 A;  2R02 A;  1V74 B;  5GPG B;  3JSE O;  1WGW A;  4BJ6 A;  4FAP B;  4FX5 A;  5L0H A;  3HLZ A;  3S90 A;  4U5G A;  2VH3 A;  2R7U A;  1PV3 A;  3C18 A;  3NMI A;  2YL7 A;  3SNH A;  1K04 A;  3TOL A;  3EG9 A;  2GDC A;  4NTF A;  2J9W A;  3LS0 A;  1H6G A;  2A0B A;  1A7E A;  3J06 A;  3MFN A;  3B0P A;  2B0H A;  3NDB B;  3AG3 C;  5A6K A;  3NYJ A;  1UG7 A;  5A6A A;  2L6G A;  2CW0 F;  1GS9 A;  2LK4 A;  4U5C E;  3UMH A;  1HW2 A;  3KMI A;  4YT5 A;  3QMK A;  2OJE D;  3EH2 A;  5KYW A;  1WN0 A;  2WL8 A;  3GEH A;  3H65 A;  1OXB A;  1BDJ B;  1T6U A;  3DMD A;  4IAQ A;  1OW6 A;  1OKK A;  2CNW A;  4A2N B;  1V54 C;  3FHD A;  2Q7R A;  5L0G A;  3NMJ A;  3JT1 A;  2LCH A;  3K66 A;  4E0I A;  5B3I A;  3C8G D;  2X0C A;  5KYX B;  4CSA A;  4OIQ F;  4MTG A;  3ZTZ A;  4N4W A;  1WOL A;  1OQC A;  3KYJ A;  4JCH A;  4YWQ A;  4BPM A;  3IEE A;  4CIP A;  4BJ6 C;  3HNI A;  3BRJ A;  4JRZ A;  3LNM B;  3NYL A;  4D4N A;  1ORJ A;  5KYN A;  4DVY P;  4G78 A;  3AG1 C;  5BQG A;  1EKY A;  2J9U A;  1A7V A;  5JT4 A;  3O10 A;  5T3W A;  2EPN A;  1LPE A;  2X51 A;  4QI0 A;  1D0Z A;  3VAY A;  1OR3 A;  4FES A;  2M4E A;  4E7Z A;  2Y39 A;  3EG9 B;  1M2V A;  2W4B A;  4JC7 A;  2UUI A;  5L0J A;  4XWJ A;  3R2P A;  4G7Z F;  1PD0 A;  1TKN A;  2EPO A;  4N06 A;  3RFY A;  1HY5 A;  1ZU4 A;  4U5D E;  4XQ1 A;  5COM A;  3BEH A;  3W8I A;  1Z23 A;  4C3D A;  2DI3 A;  4N6C A;  2V26 A;  2IXM A;  3SZR A;  2LSE A;  3NG1 A;  4EIY A;  3CEX A;  4OIP F;  2Q00 A;  4O79 A;  1FR0 A;  2W4M A;  1IZM A;  5L0F A;  4H54 A;  4GQH A;  4ZLD A;  5A69 A;  3LEO A;  4JTC B;  3K33 A;  3HNL A;  1JR8 A;  2Y3D A;  3DE8 A;  3IQ5 A;  4JVS A;  1RJ9 B;  4JCZ A;  1VYK A;  4IAO A;  1ST6 A;  2WVQ A;  3PMR A;  2FFH A;  4HFF B;  3KH2 A;  1RCP A;  3EZI A;  4P9T A;  3I4U A;  1A41 A;  1U6H A;  3QVZ A;  4HEA J;  5JUA A;  1HMD A;  1TWG A;  1V4A A;  2GA0 A;  3ITF A;  2WZF A;  2NSG A;  2PP4 A; 
#chains in the Genus database with same CATH homology
 2J8W A;  1S05 A;  1E85 A;  4CX9 A;  1CGN A;  3QVY A;  4N6H A;  1CPQ A;  3ZQY A;  4JEA A;  4JE9 A;  2YLG A;  4ULV A;  3M4C A;  3C62 A;  2YL0 A;  4JEB A;  1E84 A;  2XL8 A;  4WGY A;  256B A;  2YL1 A;  5JLI A;  1QQ3 A;  5JP7 A;  4CJO A;  3FOP A;  2QLA A;  1GQA A;  1MQV A;  1CGO A;  5JS5 A;  4CDA A;  3M15 A;  2YKZ A;  4U9E A;  3L1M A;  5JSL A;  2XLO A;  3NMI A;  2YL7 A;  3TOL A;  2BC5 A;  4D4X A;  3FOO A;  1YYX A;  3VRC A;  4U9D A;  3TOM A;  2J9B A;  3M79 A;  1YZA A;  1QPU A;  3C63 A;  4CJG A;  3U8P A;  3HNK A;  1NBB A;  4L6R A;  4IAQ A;  2XLE A;  3NMJ A;  5B3I A;  2XLM A;  1YYJ A;  3ZTZ A;  4N4W A;  4NC3 A;  2XM0 A;  4JKV A;  4CIP A;  3HNI A;  2XL6 A;  4CDY A;  4D4N A;  2XLH A;  1YZC A;  1EKY A;  1A7V A;  5JT4 A;  2YLI A;  4CDV A;  1BBH A;  1E83 A;  3ZQV A;  5JRA A;  1APC A;  2XLW A;  3QW1 A;  1E86 A;  2CCY A;  1JAF A;  1CPR A;  3ZWI A;  3M4B A;  3HNJ A;  3NMK A;  5AGF A;  1LM3 B;  2XLD A;  4EIY A;  2XLV A;  3DE9 A;  5JVE A;  1M6T A;  4ER9 A;  3IQ6 A;  3QW0 A;  3HNL A;  3ZTM A;  3DE8 A;  3IQ5 A;  4IAR A;  2YLD A;  1RCP A;  4WGZ A;  2XM4 A;  3QVZ A;  5JUA A;  4IB4 A;  2YL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...