4CDYA

Spectroscopically-validated structure of cytochrome c prime from alcaligenes xylosoxidans, reduced by x-ray irradiation at 160k
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Fingerprinting Redox and Ligand States in Haemprotein Crystal Structures Using Resonance Raman Spectroscopy.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 47
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2013-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cdyA00
3C62A 3HNIA 3QW0A 1M6TA 5AGFA 3FOOA 3NMJA 3TOMA 1YYXA 3HNLA 1YZCA 1CGOA 4JEAA 4IB4A 2YKZA 4CDYA 2QLAA 1YZAA 1CGNA 2XLEA 3U8PA 2XM4A 2YL3A 1JAFA 2XLDA 1S05A 2YL7A 3ZQVA 1A7VA 2XLMA 1GQAA 1MQVA 3IQ5A 5JP7A 2CCYA 3M15A 2XLOA 4U9DA 3IQ6A 2YL1A 1RCPA 4CJGA 3ZWIA 1CPQA 1QPUA 3QVYA 3VRCA 3M4BA 4U9EA 3M79A 3HNKA 1NBBA 5JS5A 1E86A 1YYJA 3QVZA 2YL0A 3DE9A 1E84A 3DE8A 2YLDA 2XL8A 2XM0A 5JUAA 2BC5A 5JLIA 2J9BA 4WGYA 4N6HA 4EIYA 1LM3B 4D4XA 5JRAA 1QQ3A 1APCA 4CIPA 5JVEA 4CDAA 3FOPA 1E83A 4WGZA 3M4CA 4CX9A 4IAQA 5JT4A 2XLVA 5B3IA 3QW1A 3ZTZA 1EKYA 2XLHA 3TOLA 5JSLA 3NMKA 4JE9A 3ZTMA 4JEBA 4IARA 4D4NA 2XL6A 4L6RA 4JKVA 4NC3A 256BA 4ER9A 3ZQYA 2XLWA 4N4WA 4CJOA 3NMIA 2YLIA 3HNJA 4ULVA 4CDVA 3L1MA 1CPRA 1BBHA 2J8WA 1E85A 3C63A 2YLGA
chains in the Genus database with same CATH superfamily
3HNIA 1FNTc 3FVYA 3NDBB 1Z7Qc 4EKWA 2J46A 1WN0A 2J7PD 2HJ3A 2KJGA 3CAXA 3FOOA 3GEHA 3LLIA 1YDIA 2QUPA 1F1MA 4PACA 3FAJA 3RW0A 1YYXA 3SYNA 4E0IA 3HNLA 2IOQA 1FAPB 1Z6AA 2UUHA 2LCHA 3H2VA 1RKEB 2J0WA 4BJTA 2R05A 5FCLA 4CS8C 2VCCA 4DBQA 4KI2A 2OG2A 3KMIA 1V55C 4BEMJ 1C02A 3HLZA 4H54A 3U9MA 3C8GD 3UMHA 2R7RA 2LIGA 2QLAA 3MYIA 4JCZA 3T4RA 3MBGA 4FESA 3IHUA 3X1OA 1YLMA 4MVZA 4A2NB 2XRHA 2NUPB 2XLEA 2L6HA 4YL1A 2V26A 4HE8D 5COFA 2YL3A 4J32B 3RQFA 3TD7A 3RIPA 3AG4C 1S05A 3OWTA 2CW0F 3EFOA 2PP4A 1WATA 4PFOA 4RDAA 2G62A 2XLMA 3ZG1A 5JP7A 2PX3A 1UFBA 2CCYA 4XTKA 2XLOA 4E18A 1GGQA 2HV6A 1XZQA 3EGDA 3R2PA 5IY5C 2OJQA 4N6CA 1FMWA 2HV7A 3PMRA 3ZWIA 3ZVRA 3LS1A 3ABKC 2NG1A 2EINC 2E87A 2EPLX 2G3VA 3JZ0A 1HMDA 2ZXPA 4J7TA 2KQ9A 3CSKA 3SZRA 5KYUB 1VTMP 1VMAA 2WZFA 3M4BA 4EHPA 3DJNB 4XEFA 3WODF 4C3BA 1NBBA 1RKCA 2AWYA 3TK0A 1FFTC 4HEAJ 1RXQA 4MVSA 5A6JA 1YYJA 1SZIA 3S28A 1E84A 1VYKA 2YHSA 3JT1A 1JR8A 1N1CA 2OKUA 5EK0A 4LLCA 5TJ5E 3C18A 3LNRA 3NYLA 4GQHA 5A6AA 4O6MA 1TFKB 3N2ZB 2EIMC 4DBRA 1RKEA 4LDKA 4ONSA 2HSQA 1T6IA 3B71A 5A6BA 4CDAA 3FOPA 3O6XA 2Q7RA 4AX2A 3RF3A 1SR2A 2GA0A 3ECSA 4UDVA 2WVOA 1AEPA 4IJJA 4PK4A 5L3VA 4MVMA 3JSEO 4IAQA 1O3UA 2CGEA 2HKVA 2XLVA 3GM2A 4IWBA 3B29A 1L7CA 3WHNA 2DYRC 2LP4A 2A6EF 4G0HA 2P7VA 1FMVA 4W8KA 4Z9IA 3W8HA 4B6IA 3AQCA 5HV9A 3S0XA 3POVA 1LE4A 3US6A 2HZ8A 1ZHYA 3AG2C 3UGPA 3AOUA 4F4BA 2QE9A 3RKOF 1G4WR 3TOLA 1U6HA 5JSLA 2L6GA 3EPVA 1B68A 3ZTMA 1WOLA 1D1BA 4BJ5A 1LIHA 4PR9A 1ST6A 2YQYA 5BQHA 4C7OA 1HW1A 5DS4A 4JEBA 2XSEA 2MHRA 2W45A 4J30B 2NPUA 1KNYA 1ZHXA 2OQMA 2XL6A 4NC3A 3T6JA 3GORA 5DLJA 4BJ5C 2J7PA 3ATPA 3ZQYA 3J06A 3GM3A 1O5HA 3UNGC 5L0JA 4AE4A 4CIHA 2GWWA 2Y3DA 5CI9A 1MNEA 1OXKA 3Q6NA 4LDQA 4ULVA 3DXJF 3B9QA 5DQTA 3L1MA 3IQCA 1WASA 3LEOA 2G3KA 2ZXOA 3ASOC 4I1MA 3C63A 5A6BD 1T6QA 4AK9A 1M6TA 1HY5A 2FAPB 5T1DB 3EJNA 3X2QC 4YT5A 4CS9A 1Q0GA 2Y69C 1TR2A 4RBNA 4G7HF 4ZLDA 2Q4FA 5T3WA 2R7QA 3AJMA 4NCQA 2AWCA 4YL0A 4YT8A 3GANA 3K1HA 3N24A 2HSBA 4CS9C 3ZIBA 3DAFA 3UGOA 1YZCA 1QSPA 3EGDB 1M57C 2AP3A 3GM1A 1CGOA 3KPHA 1KTMA 2MYSA 4JEAA 2YVKA 4RD9A 3BEHA 1OXBA 5DVWA 3W2WA 3VAYA 5AC5A 2Q9AA 1R4TA 1MMDA 3WAQA 3FAPB 3Q7LA 1CGNA 2A1DD 2EPMX 3T6BA 1V54C 3QZCA 4MNDA 4OIRF 3L34A 3VM6A 3U8PA 5F5FA 4BJ6A 1Q0FA 1T9KA 2WZLA 4EUKB 3LEVA 1QZXA 2XLDA 1TWCA 2Y3HA 1OCCC 4MVOA 4EBBA 1NU9C 3LS0A 2HMQA 4FX5A 4IGGA 2HFIA 3LLKA 3SXZA 3ASNC 3IQ5A 5KYXA 3TJ6A 2M64A 1TWAA 1Q0MA 3M15A 3WG7C 4CS8A 3IQ6A 3G4ZA 1RMVA 1ZU5A 4Z9HA 4FAPB 2YL1A 2A68F 2M4EA 3JRMO 3EG9A 1U0BB 1W2WA 1D1CA 2H8AA 3NRHA 4N06A 5FZTA 1NU7D 2CYDA 4MTOA 2IXMA 3JSZA 1HW2A 1Z5ZA 2W4MA 3B0UX 1NFNA 4OIOF 2R02A 3V5YA 2OU6A 3K66A 2OCCC 3DD7A 4DVYP 1E86A 2IXOA 2WVNA 4E17A 2OEVA 3QVZA 3V7OA 3DE9A 2A0UA 3IPMO 2VCAA 2Q9BA 5JUAA 1OCRC 2O9XA 3H65A 3JYYA 4BG0A 2LD6A 3S84A 3U0CA 3DJUB 4N6HA 1LM3B 1PCXA 2XXAA 1SYQA 4I3MA 3JRTA 4YJWA 3O39A 4MVRA 4PJMA 1APCA 4YL3A 4CIPA 1Z3IX 4JTDB 4O79A 4C7OB 4MW3A 5F5HA 5JVEA 3O10A 1D0YA 2R7WA 2AVKA 3KYIA 1WGWA 4X0RA 3S27A 3M4CA 3I4UA 2C03A 3S9OA 4AL0A 5JT4A 4XPXA 2IM8A 1D0ZA 3SXYA 1LS1A 1GS9A 4JVSA 5K0IA 4P6IC 4AE4B 4PJLA 3PHF2 3EZIA 1S7ZA 4HFFB 2Q00A 4K1OA 1C03A 1G8XA 3QW1A 3ZTZA 5T3TA 1QVXA 4O6YA 5L0CA 1H9GA 3MYFA 3EQLF 4ANJA 2EPOA 3TQOA 3MX3A 1VOMA 5B1BC 4JE9A 5HSWA 3EHNA 3F47A 2EIJC 1T6UA 4HFKB 1ORSC 4JRZA 1LI7A 3U8VA 4EBJA 1M2OA 2KSFA 4IARA 3O55A 3NYJA 4JURI 2X51A 4L6RA 3LUTB 1DOWA 1ZHWA 3A9CA 3MFNA 4BPMA 4ER9A 3TULA 4XLPF 1XWJA 1R5ID 2P6VA 4N4WA 4KC9A 3NMIA 4U5CE 2YLIA 1OR2A 3EGXB 2ICWG 5DS5A 1K04A 1M2VB 2VASA 4NTBA 2FGYA 4H4KC 2IYLD 4IAOA 2PF4E 1E2XA 4XPYA 1YJGA 3U3FA 2UUIA 1BBHA 3AGUA 2WVQA 1YA9A 2H7OA 3DM9B 4JTAB 3GEIA 1YARO 4PJJA 3S29A 4YT4A 1FR0A 3C62A 1LE2A 1WWPA 2OOCA 1XZPA 2VB6A 2WL8A 3I5PA 3TOMA 1L3PA 3U5SA 2JX0A 2R7OA 3L8JA 3RFYA 1A41A 3DWWA 3U9JA 4KNVA 2NSFA 3C7JA 3HJCA 3C8ZA 4BJ1A 4NY3A 2CNWA 1ZW2A 2L9JA 5KYXB 2KK1A 4DXWA 2XS1A 4XWJA 1ZZPA 1LKXA 2BL2A 4DRIB 3V5XA 1D0XA 3DAGA 4P9FA 3EG9B 1I4ZA 4IB4A 1JOGA 5GPGB 2XS8A 3ZDLA 3N0TA 1H9TA 1VLSA 4Q7CA 4CDYA 2KGOA 2W4BA 1J8MF 3NG1A 3AGTA 5B1AC 1OW6A 2Y39A 2R25A 3F46A 4FWVA 4XPWA 5E3AA 2P61A 3TJ5A 5DS6A 1JAFA 1IW7F 2QTVA 5BQIA 4IRUA 2AU5A 3DI5A 3DZAA 4JC7A 1BR1A 1M56C 2YL7A 1SF8A 4U5HA 4PFPA 2NUTA 4NQFA 3ZQVA 3KH2A 2ASRA 1GQAA 1HE1A 1MQVA 2ZPAA 1LPEA 4W8PA 3ABMC 3LNMB 3LESA 1DOVA 2P0NA 2WB7A 3DM5A 3SNHA 5L3QA 2EPNA 3JTLO 2XXAB 1O87A 1RCPA 4U5DE 1K05A 1HMOA 2VH3A 1CPQA 3QVYA 4Q4ZF 2GDCA 3RVYA 4XLNF 3VRCA 3EGXA 1TKNA 2R7TA 1V4AA 1M2VA 3L0IA 3BRJA 4XQ1A 3M79A 5F28E 1OCOC 4EBKA 2Q9CA 3VF0A 4MS2A 2V3CC 2ZD9A 3SXMA 4EWCA 1TWGA 1PD0A 2BE5F 2QNLA 1Z23A 4QI2A 2CNWD 4DJ9A 5BUOA 2XL8A 2XM0A 4G7ZF 2P1AA 4K0DA 1PD1A 4BEJA 3SP1A 1QKRA 4CBEA 1RJ9A 2OEXA 4EIYA 1MMNA 1OW7A 4OD5A 1OQCA 4U5EE 5JRAA 3EHMA 2B0HA 3AG1C 1NFOA 3M1CB 5D91A 1SMYF 1T5OA 3QTHA 3UR3C 1ZU4A 4I1OB 3KYJA 2D5RB 1E83A 4WGZA 1ZW3A 2KYHA 3W8IA 1Q0KA 1ZHZA 2JPUA 1IZMA 1BR2A 1AVOB 5KYWB 3R7CA 4LACB 4QDLA 1YVIA 1K40A 2Q3TA 3Q7GA 4YN0B 2PBEA 3FMSA 3K1IA 3OEOA 1BR4A 2Z15A 1NLXA 4LERA 3NMKA 5L0GA 1I4YA 1VYIA 2I8BA 3JCUQ 4JCHA 3GEEA 1A7EA 1H6GA 1OKKA 2LSEA 3K1IC 2XL4A 5B3SC 4JTCB 3UMKA 2VCBA 5KYYB 4E7ZA 1I5NA 2R7UA 4C3EA 2X0CA 4P9TA 1ORYA 4JKVA 4JW1A 2GFHA 2R03A 1G4US 2HJMA 1Z63A 3K33A 4NTFA 2A6HF 4Z9JA 4CJOA 3AQBA 1TFOB 5COMA 4DRJB 2CDQA 1H7IA 1LS4A 3H2UA 4PJNA 3E70C 3GWLA 4CDVA 4BJ6C 2DGJA 3A11A 4JIOA 1VB5A 3L8IA 3E9VA 2LFDA 3PDMP 4K7BA 2YLGA 3QW0A 3VYWA 4Q5SF 5AGFA 3HTKC 3EH1A 1Q0DA 3NMJA 2RSEB 3CEXA 1JPNA 2R7VA 2NUTB 2RD9A 3V5ZA 5DQZA 3FXHA 1TQGA 3W4YA 4OD4A 4QI0A 3W2VA 3S90A 2I15A 3FHDA 4M63A 1OCZC 1T01A 3LJBA 2FFHA 4XEKA 5BQGA 4R32A 5EHHA 1ZYRF 2J9VA 4DVZA 4DRHB 2YKZA 2KC3A 1G5ZA 1JRAA 4LDRA 4O6NA 5E3CA 4J7YA 3G4XA 4OIPF 1YZAA 5B3IA 3NYMA 5KYWA 2HS5A 2KNHA 2F22A 2L7AA 1OKKD 3GODA 2HUJA 4KBLA 2XM4A 4CS7A 2DB4A 2EIKC 1U89A 4A4AA 2H7VC 4GYTA 3ZSUA 3ABLC 2IXNA 2J9WA 1D1AA 4NTAA 2J9UA 1NZEA 4G7OF 1ORJA 1WTYA 2KW3C 3C8GB 1A7VA 3U3BA 4XEVA 3GWNA 1RJ9B 3RQGA 5KYYA 3AG3C 4YK5A 1Y6DA 1ZVZA 2ETSA 1TWHA 4U9DA 4OINF 4CSAA 2J0XA 2L6FA 2NSGA 2YWAA 3CZ6A 4CJGA 5CI8A 1MMAA 1VK5A 2PNOA 3DMDA 3U2LA 1QPUA 4MW8A 2Y3BA 3RYLA 2C04A 5A6KA 4CSAC 2EPKX 1A0BA 3K7DA 4C3DA 2NUPA 4WJ0A 3IEEA 3KL4A 1PV3A 2LFFA 2MWQA 4U9EA 4E0HA 3HNKA 1NG1A 5JS5A 1J8YF 1V74B 3B0PA 3I5QA 1BDJB 1JPJA 4I44A 5CIVA 3IQTA 2YL0A 2JD3A 2LK4A 3DE8A 2YLDA 4G78A 2IBFA 2R7SA 5L0IA 1FFHA 1VLTA 2BC5A 3MLGA 2J9BA 4WGYA 5D92A 4ZLCA 5JLIA 1YAUO 4ULWA 3B0VC 1MMGA 4U5GA 3CQZA 4D4XA 1JMWA 2J45A 3SXKA 2ZXWC 3U2MA 1EI7A 1QQ3A 3RQEA 5COGA 1CGME 3RVZA 1UG7A 1EQ1A 2GAQA 4LLEA 2VC9A 1HE9A 2TMVP 1NSGB 3T9OA 5KYUA 2R9RB 1KU2A 2PX0A 2YRFA 3G50A 4CX9A 1GM5A 2PFDA 4YT2A 5AC4A 2R7XA 2OJED 2YZSA 3K6BA 4OIQF 3DKAA 3KKBA 2QY9A 4JZAA 1Y4CA 5L0DA 3PCVA 2L81A 3EH2A 3NKDA 2DYSC 1C17M 3FDQA 3EZHA 2IXPA 4GEHA 3JYHA 4JJGA 2XLHA 1EKYA 3ITFA 3C8GA 4WABA 3LAYA 1FTSA 3EFOB 4AL1A 3SEOA 2LQGA 2D4UA 3HKKA 4JJFA 3T6GB 3QMKA 2W9YA 1ZHTA 4D4NA 2YEVA 4KNWA 5A69A 3UMIA 2H7BA 3OA1A 1OR3A 256BA 5EGYA 3NKEA 4MQ9F 4MVUA 2XLWA 1AUEA 5E2QA 1LI5A 4MVQA 5KYNA 5E33A 2WZGA 1OW8A 3ZC4A 1YA7O 4E7SA 4YWQA 1QLEC 2B0JA 3HNJA 4U5BE 4MTGA 4DOZA 2A69F 1LVKA 5L0HA 4U5FE 1EA8A 2DI3A 2ZXRA 1MNDA 2HMZA 1CPRA 3RH3A 3Q6MA 5L0FA 2J8WA 1E85A 4MTFA 2Y3GA 2EILC 2A0BA 4O7GA 1BZ4A 1A7DA
chains in the Genus database with same CATH topology
3C62A 3HNIA 3QW0A 1M6TA 5AGFA 3FOOA 3NMJA 3TOMA 1YYXA 3HNLA 1YZCA 1CGOA 4JEAA 4IB4A 2YKZA 4CDYA 2QLAA 1YZAA 1CGNA 2XLEA 3U8PA 2XM4A 2YL3A 1JAFA 2XLDA 1S05A 2YL7A 3ZQVA 1A7VA 2XLMA 1GQAA 1MQVA 3IQ5A 5JP7A 2CCYA 3M15A 2XLOA 4U9DA 3IQ6A 2YL1A 1RCPA 4CJGA 3ZWIA 1CPQA 1QPUA 3QVYA 3VRCA 3M4BA 4U9EA 3M79A 3HNKA 1NBBA 5JS5A 1E86A 1YYJA 3QVZA 2YL0A 3DE9A 1E84A 3DE8A 2YLDA 2XL8A 2XM0A 5JUAA 2BC5A 5JLIA 2J9BA 4WGYA 4N6HA 4EIYA 1LM3B 4D4XA 5JRAA 1QQ3A 1APCA 4CIPA 5JVEA 4CDAA 3FOPA 1E83A 4WGZA 3M4CA 4CX9A 4IAQA 5JT4A 2XLVA 5B3IA 3QW1A 3ZTZA 1EKYA 2XLHA 3TOLA 5JSLA 3NMKA 4JE9A 3ZTMA 4JEBA 4IARA 4D4NA 2XL6A 4L6RA 4JKVA 4NC3A 256BA 4ER9A 3ZQYA 2XLWA 4N4WA 4CJOA 3NMIA 2YLIA 3HNJA 4ULVA 4CDVA 3L1MA 1CPRA 1BBHA 2J8WA 1E85A 3C63A 2YLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C62 A;  3HNI A;  3QW0 A;  1M6T A;  5AGF A;  3FOO A;  3NMJ A;  3TOM A;  1YYX A;  3HNL A;  1YZC A;  1CGO A;  4JEA A;  4IB4 A;  2YKZ A;  4CDY A;  2QLA A;  1YZA A;  1CGN A;  2XLE A;  3U8P A;  2XM4 A;  2YL3 A;  1JAF A;  2XLD A;  1S05 A;  2YL7 A;  3ZQV A;  1A7V A;  2XLM A;  1GQA A;  1MQV A;  3IQ5 A;  5JP7 A;  2CCY A;  3M15 A;  2XLO A;  4U9D A;  3IQ6 A;  2YL1 A;  1RCP A;  4CJG A;  3ZWI A;  1CPQ A;  1QPU A;  3QVY A;  3VRC A;  3M4B A;  4U9E A;  3M79 A;  3HNK A;  1NBB A;  5JS5 A;  1E86 A;  1YYJ A;  3QVZ A;  2YL0 A;  3DE9 A;  1E84 A;  3DE8 A;  2YLD A;  2XL8 A;  2XM0 A;  5JUA A;  2BC5 A;  5JLI A;  2J9B A;  4WGY A;  4N6H A;  4EIY A;  1LM3 B;  4D4X A;  5JRA A;  1QQ3 A;  1APC A;  4CIP A;  5JVE A;  4CDA A;  3FOP A;  1E83 A;  4WGZ A;  3M4C A;  4CX9 A;  4IAQ A;  5JT4 A;  2XLV A;  5B3I A;  3QW1 A;  3ZTZ A;  1EKY A;  2XLH A;  3TOL A;  5JSL A;  3NMK A;  4JE9 A;  3ZTM A;  4JEB A;  4IAR A;  4D4N A;  2XL6 A;  4L6R A;  4JKV A;  4NC3 A;  256B A;  4ER9 A;  3ZQY A;  2XLW A;  4N4W A;  4CJO A;  3NMI A;  2YLI A;  3HNJ A;  4ULV A;  4CDV A;  3L1M A;  1CPR A;  1BBH A;  2J8W A;  1E85 A;  3C63 A;  2YLG A; 
#chains in the Genus database with same CATH topology
 3HNI A;  1FNT c;  3FVY A;  3NDB B;  1Z7Q c;  4EKW A;  2J46 A;  1WN0 A;  2J7P D;  2HJ3 A;  2KJG A;  3CAX A;  3FOO A;  3GEH A;  3LLI A;  1YDI A;  2QUP A;  1F1M A;  4PAC A;  3FAJ A;  3RW0 A;  1YYX A;  3SYN A;  4E0I A;  3HNL A;  2IOQ A;  1FAP B;  1Z6A A;  2UUH A;  2LCH A;  3H2V A;  1RKE B;  2J0W A;  4BJT A;  2R05 A;  5FCL A;  4CS8 C;  2VCC A;  4DBQ A;  4KI2 A;  2OG2 A;  3KMI A;  1V55 C;  4BEM J;  1C02 A;  3HLZ A;  4H54 A;  3U9M A;  3C8G D;  3UMH A;  2R7R A;  2LIG A;  2QLA A;  3MYI A;  4JCZ A;  3T4R A;  3MBG A;  4FES A;  3IHU A;  3X1O A;  1YLM A;  4MVZ A;  4A2N B;  2XRH A;  2NUP B;  2XLE A;  2L6H A;  4YL1 A;  2V26 A;  4HE8 D;  5COF A;  2YL3 A;  4J32 B;  3RQF A;  3TD7 A;  3RIP A;  3AG4 C;  1S05 A;  3OWT A;  2CW0 F;  3EFO A;  2PP4 A;  1WAT A;  4PFO A;  4RDA A;  2G62 A;  2XLM A;  3ZG1 A;  5JP7 A;  2PX3 A;  1UFB A;  2CCY A;  4XTK A;  2XLO A;  4E18 A;  1GGQ A;  2HV6 A;  1XZQ A;  3EGD A;  3R2P A;  5IY5 C;  2OJQ A;  4N6C A;  1FMW A;  2HV7 A;  3PMR A;  3ZWI A;  3ZVR A;  3LS1 A;  3ABK C;  2NG1 A;  2EIN C;  2E87 A;  2EPL X;  2G3V A;  3JZ0 A;  1HMD A;  2ZXP A;  4J7T A;  2KQ9 A;  3CSK A;  3SZR A;  5KYU B;  1VTM P;  1VMA A;  2WZF A;  3M4B A;  4EHP A;  3DJN B;  4XEF A;  3WOD F;  4C3B A;  1NBB A;  1RKC A;  2AWY A;  3TK0 A;  1FFT C;  4HEA J;  1RXQ A;  4MVS A;  5A6J A;  1YYJ A;  1SZI A;  3S28 A;  1E84 A;  1VYK A;  2YHS A;  3JT1 A;  1JR8 A;  1N1C A;  2OKU A;  5EK0 A;  4LLC A;  5TJ5 E;  3C18 A;  3LNR A;  3NYL A;  4GQH A;  5A6A A;  4O6M A;  1TFK B;  3N2Z B;  2EIM C;  4DBR A;  1RKE A;  4LDK A;  4ONS A;  2HSQ A;  1T6I A;  3B71 A;  5A6B A;  4CDA A;  3FOP A;  3O6X A;  2Q7R A;  4AX2 A;  3RF3 A;  1SR2 A;  2GA0 A;  3ECS A;  4UDV A;  2WVO A;  1AEP A;  4IJJ A;  4PK4 A;  5L3V A;  4MVM A;  3JSE O;  4IAQ A;  1O3U A;  2CGE A;  2HKV A;  2XLV A;  3GM2 A;  4IWB A;  3B29 A;  1L7C A;  3WHN A;  2DYR C;  2LP4 A;  2A6E F;  4G0H A;  2P7V A;  1FMV A;  4W8K A;  4Z9I A;  3W8H A;  4B6I A;  3AQC A;  5HV9 A;  3S0X A;  3POV A;  1LE4 A;  3US6 A;  2HZ8 A;  1ZHY A;  3AG2 C;  3UGP A;  3AOU A;  4F4B A;  2QE9 A;  3RKO F;  1G4W R;  3TOL A;  1U6H A;  5JSL A;  2L6G A;  3EPV A;  1B68 A;  3ZTM A;  1WOL A;  1D1B A;  4BJ5 A;  1LIH A;  4PR9 A;  1ST6 A;  2YQY A;  5BQH A;  4C7O A;  1HW1 A;  5DS4 A;  4JEB A;  2XSE A;  2MHR A;  2W45 A;  4J30 B;  2NPU A;  1KNY A;  1ZHX A;  2OQM A;  2XL6 A;  4NC3 A;  3T6J A;  3GOR A;  5DLJ A;  4BJ5 C;  2J7P A;  3ATP A;  3ZQY A;  3J06 A;  3GM3 A;  1O5H A;  3UNG C;  5L0J A;  4AE4 A;  4CIH A;  2GWW A;  2Y3D A;  5CI9 A;  1MNE A;  1OXK A;  3Q6N A;  4LDQ A;  4ULV A;  3DXJ F;  3B9Q A;  5DQT A;  3L1M A;  3IQC A;  1WAS A;  3LEO A;  2G3K A;  2ZXO A;  3ASO C;  4I1M A;  3C63 A;  5A6B D;  1T6Q A;  4AK9 A;  1M6T A;  1HY5 A;  2FAP B;  5T1D B;  3EJN A;  3X2Q C;  4YT5 A;  4CS9 A;  1Q0G A;  2Y69 C;  1TR2 A;  4RBN A;  4G7H F;  4ZLD A;  2Q4F A;  5T3W A;  2R7Q A;  3AJM A;  4NCQ A;  2AWC A;  4YL0 A;  4YT8 A;  3GAN A;  3K1H A;  3N24 A;  2HSB A;  4CS9 C;  3ZIB A;  3DAF A;  3UGO A;  1YZC A;  1QSP A;  3EGD B;  1M57 C;  2AP3 A;  3GM1 A;  1CGO A;  3KPH A;  1KTM A;  2MYS A;  4JEA A;  2YVK A;  4RD9 A;  3BEH A;  1OXB A;  5DVW A;  3W2W A;  3VAY A;  5AC5 A;  2Q9A A;  1R4T A;  1MMD A;  3WAQ A;  3FAP B;  3Q7L A;  1CGN A;  2A1D D;  2EPM X;  3T6B A;  1V54 C;  3QZC A;  4MND A;  4OIR F;  3L34 A;  3VM6 A;  3U8P A;  5F5F A;  4BJ6 A;  1Q0F A;  1T9K A;  2WZL A;  4EUK B;  3LEV A;  1QZX A;  2XLD A;  1TWC A;  2Y3H A;  1OCC C;  4MVO A;  4EBB A;  1NU9 C;  3LS0 A;  2HMQ A;  4FX5 A;  4IGG A;  2HFI A;  3LLK A;  3SXZ A;  3ASN C;  3IQ5 A;  5KYX A;  3TJ6 A;  2M64 A;  1TWA A;  1Q0M A;  3M15 A;  3WG7 C;  4CS8 A;  3IQ6 A;  3G4Z A;  1RMV A;  1ZU5 A;  4Z9H A;  4FAP B;  2YL1 A;  2A68 F;  2M4E A;  3JRM O;  3EG9 A;  1U0B B;  1W2W A;  1D1C A;  2H8A A;  3NRH A;  4N06 A;  5FZT A;  1NU7 D;  2CYD A;  4MTO A;  2IXM A;  3JSZ A;  1HW2 A;  1Z5Z A;  2W4M A;  3B0U X;  1NFN A;  4OIO F;  2R02 A;  3V5Y A;  2OU6 A;  3K66 A;  2OCC C;  3DD7 A;  4DVY P;  1E86 A;  2IXO A;  2WVN A;  4E17 A;  2OEV A;  3QVZ A;  3V7O A;  3DE9 A;  2A0U A;  3IPM O;  2VCA A;  2Q9B A;  5JUA A;  1OCR C;  2O9X A;  3H65 A;  3JYY A;  4BG0 A;  2LD6 A;  3S84 A;  3U0C A;  3DJU B;  4N6H A;  1LM3 B;  1PCX A;  2XXA A;  1SYQ A;  4I3M A;  3JRT A;  4YJW A;  3O39 A;  4MVR A;  4PJM A;  1APC A;  4YL3 A;  4CIP A;  1Z3I X;  4JTD B;  4O79 A;  4C7O B;  4MW3 A;  5F5H A;  5JVE A;  3O10 A;  1D0Y A;  2R7W A;  2AVK A;  3KYI A;  1WGW A;  4X0R A;  3S27 A;  3M4C A;  3I4U A;  2C03 A;  3S9O A;  4AL0 A;  5JT4 A;  4XPX A;  2IM8 A;  1D0Z A;  3SXY A;  1LS1 A;  1GS9 A;  4JVS A;  5K0I A;  4P6I C;  4AE4 B;  4PJL A;  3PHF 2;  3EZI A;  1S7Z A;  4HFF B;  2Q00 A;  4K1O A;  1C03 A;  1G8X A;  3QW1 A;  3ZTZ A;  5T3T A;  1QVX A;  4O6Y A;  5L0C A;  1H9G A;  3MYF A;  3EQL F;  4ANJ A;  2EPO A;  3TQO A;  3MX3 A;  1VOM A;  5B1B C;  4JE9 A;  5HSW A;  3EHN A;  3F47 A;  2EIJ C;  1T6U A;  4HFK B;  1ORS C;  4JRZ A;  1LI7 A;  3U8V A;  4EBJ A;  1M2O A;  2KSF A;  4IAR A;  3O55 A;  3NYJ A;  4JUR I;  2X51 A;  4L6R A;  3LUT B;  1DOW A;  1ZHW A;  3A9C A;  3MFN A;  4BPM A;  4ER9 A;  3TUL A;  4XLP F;  1XWJ A;  1R5I D;  2P6V A;  4N4W A;  4KC9 A;  3NMI A;  4U5C E;  2YLI A;  1OR2 A;  3EGX B;  2ICW G;  5DS5 A;  1K04 A;  1M2V B;  2VAS A;  4NTB A;  2FGY A;  4H4K C;  2IYL D;  4IAO A;  2PF4 E;  1E2X A;  4XPY A;  1YJG A;  3U3F A;  2UUI A;  1BBH A;  3AGU A;  2WVQ A;  1YA9 A;  2H7O A;  3DM9 B;  4JTA B;  3GEI A;  1YAR O;  4PJJ A;  3S29 A;  4YT4 A;  1FR0 A;  3C62 A;  1LE2 A;  1WWP A;  2OOC A;  1XZP A;  2VB6 A;  2WL8 A;  3I5P A;  3TOM A;  1L3P A;  3U5S A;  2JX0 A;  2R7O A;  3L8J A;  3RFY A;  1A41 A;  3DWW A;  3U9J A;  4KNV A;  2NSF A;  3C7J A;  3HJC A;  3C8Z A;  4BJ1 A;  4NY3 A;  2CNW A;  1ZW2 A;  2L9J A;  5KYX B;  2KK1 A;  4DXW A;  2XS1 A;  4XWJ A;  1ZZP A;  1LKX A;  2BL2 A;  4DRI B;  3V5X A;  1D0X A;  3DAG A;  4P9F A;  3EG9 B;  1I4Z A;  4IB4 A;  1JOG A;  5GPG B;  2XS8 A;  3ZDL A;  3N0T A;  1H9T A;  1VLS A;  4Q7C A;  4CDY A;  2KGO A;  2W4B A;  1J8M F;  3NG1 A;  3AGT A;  5B1A C;  1OW6 A;  2Y39 A;  2R25 A;  3F46 A;  4FWV A;  4XPW A;  5E3A A;  2P61 A;  3TJ5 A;  5DS6 A;  1JAF A;  1IW7 F;  2QTV A;  5BQI A;  4IRU A;  2AU5 A;  3DI5 A;  3DZA A;  4JC7 A;  1BR1 A;  1M56 C;  2YL7 A;  1SF8 A;  4U5H A;  4PFP A;  2NUT A;  4NQF A;  3ZQV A;  3KH2 A;  2ASR A;  1GQA A;  1HE1 A;  1MQV A;  2ZPA A;  1LPE A;  4W8P A;  3ABM C;  3LNM B;  3LES A;  1DOV A;  2P0N A;  2WB7 A;  3DM5 A;  3SNH A;  5L3Q A;  2EPN A;  3JTL O;  2XXA B;  1O87 A;  1RCP A;  4U5D E;  1K05 A;  1HMO A;  2VH3 A;  1CPQ A;  3QVY A;  4Q4Z F;  2GDC A;  3RVY A;  4XLN F;  3VRC A;  3EGX A;  1TKN A;  2R7T A;  1V4A A;  1M2V A;  3L0I A;  3BRJ A;  4XQ1 A;  3M79 A;  5F28 E;  1OCO C;  4EBK A;  2Q9C A;  3VF0 A;  4MS2 A;  2V3C C;  2ZD9 A;  3SXM A;  4EWC A;  1TWG A;  1PD0 A;  2BE5 F;  2QNL A;  1Z23 A;  4QI2 A;  2CNW D;  4DJ9 A;  5BUO A;  2XL8 A;  2XM0 A;  4G7Z F;  2P1A A;  4K0D A;  1PD1 A;  4BEJ A;  3SP1 A;  1QKR A;  4CBE A;  1RJ9 A;  2OEX A;  4EIY A;  1MMN A;  1OW7 A;  4OD5 A;  1OQC A;  4U5E E;  5JRA A;  3EHM A;  2B0H A;  3AG1 C;  1NFO A;  3M1C B;  5D91 A;  1SMY F;  1T5O A;  3QTH A;  3UR3 C;  1ZU4 A;  4I1O B;  3KYJ A;  2D5R B;  1E83 A;  4WGZ A;  1ZW3 A;  2KYH A;  3W8I A;  1Q0K A;  1ZHZ A;  2JPU A;  1IZM A;  1BR2 A;  1AVO B;  5KYW B;  3R7C A;  4LAC B;  4QDL A;  1YVI A;  1K40 A;  2Q3T A;  3Q7G A;  4YN0 B;  2PBE A;  3FMS A;  3K1I A;  3OEO A;  1BR4 A;  2Z15 A;  1NLX A;  4LER A;  3NMK A;  5L0G A;  1I4Y A;  1VYI A;  2I8B A;  3JCU Q;  4JCH A;  3GEE A;  1A7E A;  1H6G A;  1OKK A;  2LSE A;  3K1I C;  2XL4 A;  5B3S C;  4JTC B;  3UMK A;  2VCB A;  5KYY B;  4E7Z A;  1I5N A;  2R7U A;  4C3E A;  2X0C A;  4P9T A;  1ORY A;  4JKV A;  4JW1 A;  2GFH A;  2R03 A;  1G4U S;  2HJM A;  1Z63 A;  3K33 A;  4NTF A;  2A6H F;  4Z9J A;  4CJO A;  3AQB A;  1TFO B;  5COM A;  4DRJ B;  2CDQ A;  1H7I A;  1LS4 A;  3H2U A;  4PJN A;  3E70 C;  3GWL A;  4CDV A;  4BJ6 C;  2DGJ A;  3A11 A;  4JIO A;  1VB5 A;  3L8I A;  3E9V A;  2LFD A;  3PDM P;  4K7B A;  2YLG A;  3QW0 A;  3VYW A;  4Q5S F;  5AGF A;  3HTK C;  3EH1 A;  1Q0D A;  3NMJ A;  2RSE B;  3CEX A;  1JPN A;  2R7V A;  2NUT B;  2RD9 A;  3V5Z A;  5DQZ A;  3FXH A;  1TQG A;  3W4Y A;  4OD4 A;  4QI0 A;  3W2V A;  3S90 A;  2I15 A;  3FHD A;  4M63 A;  1OCZ C;  1T01 A;  3LJB A;  2FFH A;  4XEK A;  5BQG A;  4R32 A;  5EHH A;  1ZYR F;  2J9V A;  4DVZ A;  4DRH B;  2YKZ A;  2KC3 A;  1G5Z A;  1JRA A;  4LDR A;  4O6N A;  5E3C A;  4J7Y A;  3G4X A;  4OIP F;  1YZA A;  5B3I A;  3NYM A;  5KYW A;  2HS5 A;  2KNH A;  2F22 A;  2L7A A;  1OKK D;  3GOD A;  2HUJ A;  4KBL A;  2XM4 A;  4CS7 A;  2DB4 A;  2EIK C;  1U89 A;  4A4A A;  2H7V C;  4GYT A;  3ZSU A;  3ABL C;  2IXN A;  2J9W A;  1D1A A;  4NTA A;  2J9U A;  1NZE A;  4G7O F;  1ORJ A;  1WTY A;  2KW3 C;  3C8G B;  1A7V A;  3U3B A;  4XEV A;  3GWN A;  1RJ9 B;  3RQG A;  5KYY A;  3AG3 C;  4YK5 A;  1Y6D A;  1ZVZ A;  2ETS A;  1TWH A;  4U9D A;  4OIN F;  4CSA A;  2J0X A;  2L6F A;  2NSG A;  2YWA A;  3CZ6 A;  4CJG A;  5CI8 A;  1MMA A;  1VK5 A;  2PNO A;  3DMD A;  3U2L A;  1QPU A;  4MW8 A;  2Y3B A;  3RYL A;  2C04 A;  5A6K A;  4CSA C;  2EPK X;  1A0B A;  3K7D A;  4C3D A;  2NUP A;  4WJ0 A;  3IEE A;  3KL4 A;  1PV3 A;  2LFF A;  2MWQ A;  4U9E A;  4E0H A;  3HNK A;  1NG1 A;  5JS5 A;  1J8Y F;  1V74 B;  3B0P A;  3I5Q A;  1BDJ B;  1JPJ A;  4I44 A;  5CIV A;  3IQT A;  2YL0 A;  2JD3 A;  2LK4 A;  3DE8 A;  2YLD A;  4G78 A;  2IBF A;  2R7S A;  5L0I A;  1FFH A;  1VLT A;  2BC5 A;  3MLG A;  2J9B A;  4WGY A;  5D92 A;  4ZLC A;  5JLI A;  1YAU O;  4ULW A;  3B0V C;  1MMG A;  4U5G A;  3CQZ A;  4D4X A;  1JMW A;  2J45 A;  3SXK A;  2ZXW C;  3U2M A;  1EI7 A;  1QQ3 A;  3RQE A;  5COG A;  1CGM E;  3RVZ A;  1UG7 A;  1EQ1 A;  2GAQ A;  4LLE A;  2VC9 A;  1HE9 A;  2TMV P;  1NSG B;  3T9O A;  5KYU A;  2R9R B;  1KU2 A;  2PX0 A;  2YRF A;  3G50 A;  4CX9 A;  1GM5 A;  2PFD A;  4YT2 A;  5AC4 A;  2R7X A;  2OJE D;  2YZS A;  3K6B A;  4OIQ F;  3DKA A;  3KKB A;  2QY9 A;  4JZA A;  1Y4C A;  5L0D A;  3PCV A;  2L81 A;  3EH2 A;  3NKD A;  2DYS C;  1C17 M;  3FDQ A;  3EZH A;  2IXP A;  4GEH A;  3JYH A;  4JJG A;  2XLH A;  1EKY A;  3ITF A;  3C8G A;  4WAB A;  3LAY A;  1FTS A;  3EFO B;  4AL1 A;  3SEO A;  2LQG A;  2D4U A;  3HKK A;  4JJF A;  3T6G B;  3QMK A;  2W9Y A;  1ZHT A;  4D4N A;  2YEV A;  4KNW A;  5A69 A;  3UMI A;  2H7B A;  3OA1 A;  1OR3 A;  256B A;  5EGY A;  3NKE A;  4MQ9 F;  4MVU A;  2XLW A;  1AUE A;  5E2Q A;  1LI5 A;  4MVQ A;  5KYN A;  5E33 A;  2WZG A;  1OW8 A;  3ZC4 A;  1YA7 O;  4E7S A;  4YWQ A;  1QLE C;  2B0J A;  3HNJ A;  4U5B E;  4MTG A;  4DOZ A;  2A69 F;  1LVK A;  5L0H A;  4U5F E;  1EA8 A;  2DI3 A;  2ZXR A;  1MND A;  2HMZ A;  1CPR A;  3RH3 A;  3Q6M A;  5L0F A;  2J8W A;  1E85 A;  4MTF A;  2Y3G A;  2EIL C;  2A0B A;  4O7G A;  1BZ4 A;  1A7D A; 
#chains in the Genus database with same CATH homology
 3C62 A;  3HNI A;  3QW0 A;  1M6T A;  5AGF A;  3FOO A;  3NMJ A;  3TOM A;  1YYX A;  3HNL A;  1YZC A;  1CGO A;  4JEA A;  4IB4 A;  2YKZ A;  4CDY A;  2QLA A;  1YZA A;  1CGN A;  2XLE A;  3U8P A;  2XM4 A;  2YL3 A;  1JAF A;  2XLD A;  1S05 A;  2YL7 A;  3ZQV A;  1A7V A;  2XLM A;  1GQA A;  1MQV A;  3IQ5 A;  5JP7 A;  2CCY A;  3M15 A;  2XLO A;  4U9D A;  3IQ6 A;  2YL1 A;  1RCP A;  4CJG A;  3ZWI A;  1CPQ A;  1QPU A;  3QVY A;  3VRC A;  3M4B A;  4U9E A;  3M79 A;  3HNK A;  1NBB A;  5JS5 A;  1E86 A;  1YYJ A;  3QVZ A;  2YL0 A;  3DE9 A;  1E84 A;  3DE8 A;  2YLD A;  2XL8 A;  2XM0 A;  5JUA A;  2BC5 A;  5JLI A;  2J9B A;  4WGY A;  4N6H A;  4EIY A;  1LM3 B;  4D4X A;  5JRA A;  1QQ3 A;  1APC A;  4CIP A;  5JVE A;  4CDA A;  3FOP A;  1E83 A;  4WGZ A;  3M4C A;  4CX9 A;  4IAQ A;  5JT4 A;  2XLV A;  5B3I A;  3QW1 A;  3ZTZ A;  1EKY A;  2XLH A;  3TOL A;  5JSL A;  3NMK A;  4JE9 A;  3ZTM A;  4JEB A;  4IAR A;  4D4N A;  2XL6 A;  4L6R A;  4JKV A;  4NC3 A;  256B A;  4ER9 A;  3ZQY A;  2XLW A;  4N4W A;  4CJO A;  3NMI A;  2YLI A;  3HNJ A;  4ULV A;  4CDV A;  3L1M A;  1CPR A;  1BBH A;  2J8W A;  1E85 A;  3C63 A;  2YLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...