4CE7A

Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family gh105, involved in ulvan degradation
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
348
structure length
345
Chain Sequence
b'DVFNEDYIKTSMIKALEWQEAHPIFAIHPTDWTNGAYYTGVARAHHTTKNMMYMAALKNQAVANNWQPYTRLYHADDVAISYSYLYVAENEKRRNFSDLEPTKKFLDTHLYEDNAWKAGTNRSKEDKTILWWWCDALFMAPPVINLYAKQSEQPEYLDEMHKYYMETYNRLYDKEEKLFARDSRFVWDGDDEDKKEPNGEKVFWSRGNGWVIGGLALLLEDMPEDYKHRDFYVNLYKEMASRILEIQPEDGLWRTSLLSPESYDHGEVSGSAFHTFALAWGINKGLIDKKYTPAVKKAWKAMANCQHDDGRVGWVQNIPEPASKDSYQNFGTGAFLLAGSEILKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNSATURATED 3S-RHAMNOGLYCURONYL HYDROLASE
publication title A Novel Unsaturated Beta-Glucuronyl Hydrolase Involved in Ulvan Degradation Unveils the Versatility of Stereochemistry Requirements in Family Gh105.
pubmed doi rcsb
source organism Nonlabens ulvanivorans
molecule tags Hydrolase
total genus 134
structure length 345
sequence length 348
chains with identical sequence B, C
ec nomenclature ec 3.2.1.172: Unsaturated rhamnogalacturonyl hydrolase.
pdb deposition date 2013-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4ce7A00
3QT9A 3RX5A 4AYPA 1GLMA 1XWTA 5M7YA 2FV1A 1KKTA 4L6XA 1GA2A 1H13A 2CQSA 4WU0A 4L0GA 3GLYA 1IA6A 3QT3A 2CQTA 4Q88A 1FBOA 1FBWA 4EL8A 2B4FA 1LF6A 1V7XA 1HCUA 1VD5A 2F6DA 3QWTA 1G9JA 2ZBLA 1TF4A 2FUZA 2VN4A 2RI8A 3W7TA 3WC3A 1WU6A 1V5DA 5CA3A 2AHGA 2Z07A 2WYNA 2FBAA 3ACTA 1G6IA 2XFGA 4CJ1A 3QDEA 3TF4A 4ZG8A 1WZZA 3W5MA 3RENA 4WVCA 2AFAA 3W7WA 1DL2A 3WUXA 2GZ6A 2EABA 2P0VA 2YIKA 3QXFA 2DRRA 2JJBA 2A8ZA 1G87A 3ANJA 1V7VA 3GT5A 4J5TA 1UG9A 3H2WA 2GH4A 3PMMA 1UT9A 4TF4A 3VXDA 2JF4A 3QXQA 5GW7A 3ACSA 4XUVA 1AGMA 5CD2A 3P2CA 4DODA 1H14A 3S4CA 4AYRA 2JG0A 4WVBA 3QSPA 3D3IA 1RQ5A 4AYQA 3WKFA 1FCEA 1FAEA 3H7LA 3WKGA 4JJJA 1ULVA 1AYXA 3QG0A 4KTRA 5M7IA 2ZZRA 1FP3A 5MEHA 3CIHA 2D5JA 1IS9A 1FMIA 3W7UA 3ON6A 1IA7A 2RI9A 2OKXA 3QFZA 1KRFA 1KFGA 3W7XA 1X9DA 4ZH5A 2EADA 1FO3A 3AFJA 3T33A 1GAHA 1KSDA 5CZLA 3QPFA 1CLCA 5DGRA 4WVAA 2EACA 3E6UA 3RSYA 3W7SA 1H12A 1GAIA 2NVPA 3WKIA 3ANIA 1L2AA 1FO2A 3EQAA 3QRYA 4AYOA 1KSCA 3A3VA 1F9DA 3RRSA 1CEMA 3EZ8A 3WIQA 3X17A 3W5NA 2DRQA 2FV0A 1NXCA 3WIWA 2AHFA 4DOEA 2VN7A 1NC5A 1WU4A 3QFYA 1LF9A 1V5CA 3S4AA 2DROA 5GY3A 3GZKA 1KREA 4TXTA 3RX8A 4CE7A 4Q2BA 1F9OA 1DOGA 1KWFA 1G9GA 3S4DA 3VW5A 2D8LA 1K72A 5KKBA 3WKHA 3RX7A 1XW2A 3K11A 4Z4JA 4Z4LA 5DGQA 4FUSA 1L1YA 3WIRA 1V7WA 3S4BA 3H3KA 3E73A 4CJ0A 1H54A 2QNOA 4KTPA 2RGKA 1KS8A 1JS4A 1WU5A 5E2JA 1XWQA 3ANKA 2DRSA 2EAEA
chains in the Genus database with same CATH superfamily
1CB8A 1GLMA 1XWTA 1O1SB 3E7JA 2SQCA 3E37B 1KKTA 1TN8B 5IKAA 1GA2A 4WU0A 3GLYA 3QT3A 1SA4B 2BRPA 1NL4B 4D4CA 1LF6A 5FOBB 1RWGA 4D94A 3SFXB 2ONHA 2ZBLA 2VN4A 4BOKA 1HMUA 3W7TA 1WU6A 2AHGA 2Z07A 2FBAA 1TNOB 5IK9A 4LNGB 2IEJB 3E33B 2AFAA 3W7WA 3CU7A 1W3YA 2DRRA 3DSSB 2NOJA 3SDTA 5EAUA 1N9AB 2JJBA 1G87A 3ANJA 1N1BA 4J5TA 3PMMA 5JMFA 4FXGB 4TF4A 4OZVA 1F1SA 2FUTA 1N4RB 5CD2A 3NFVA 1I8QA 3P2CA 1MZCB 1H14A 2WY7A 5DHKA 3S4CA 2JG0A 3PZ4B 3D5SA 1FAEA 2BB6A 4FJQA 3WKGA 2ZZRA 1FP3A 5MEHA 1LTXB 3E32B 2D5JA 1FMIA 5IK0A 4YCRA 1N7NA 1OJOA 2RI9A 2OKXA 2BBCA 3QFZA 1KRFA 4GTPB 1N20A 1JCSB 1KFGA 2X03A 1X9DA 4FNVA 2EADA 3AFJA 2J5CA 3QPFA 3SDVA 2R2LB 1JCQB 4WVAA 2EACA 3E6UA 1N24A 3ANIA 1FO2A 2WDAA 4ONTA 3Q7AB 1KSCA 3A3VA 1D8DB 1F9DA 1CEMA 1HXCA 3PZ3B 3W5NA 1KZPB 2ZISB 1NXCA 2ZIRB 2PMVA 1O6RA 4D4AA 3QFYA 3DSWB 3SAEA 3S4AA 2I07B 4MU9A 5EASA 4Q2BA 2BRVX 1KWFA 1G9GA 3S4DA 4F10A 2D8LA 1K72A 1LD8B 1NI1B 3S4BA 1H54A 1H3BA 4OK2A 1KS8A 2WY8A 1JS4A 1O6QA 4L9PB 2F0YB 1DCEB 3Q78B 3QT9A 3SDRA 4AYPA 5M7YA 1QQFA 1RWAA 1QSJA 3N0FA 4L0GA 2CQTA 5IKHA 1V7XA 3DSTB 1VD5A 2FUQA 3M78A 3HXCB 1GSZA 1RWFA 5ILJA 1RWHA 5CA3A 1RWCA 2XWBB 5IK6A 3G4FA 1O5MB 2WYNA 2Q1FA 1RW9A 1W6KA 1N7PA 3PYAA 3TF4A 4ZG8A 3W5MA 3RENA 2H6IB 1X1JA 1DL2A 3WUXA 1H36A 2EABA 2YIKA 3Q73B 4GTMB 5EATA 4GAXA 1O1RB 2BEDB 1V7VA 4RNQA 4GTTB 3H2WA 3G6JB 1UT9A 2WINB 3D5RA 1N94B 3M7EA 3A0OA 1OJMA 2JF4A 3QXQA 4GL3A 3QSPA 3D3IA 1RQ5A 1GHQA 3H7LA 1N4PB 1KZOB 3QG0A 5M7IA 2XWJB 3OXUA 3M77A 4EHMB 1W6JA 3VSNA 3W7XA 3T33A 3KQ4A 5ILDA 1KSDA 1R76A 1CLCA 5DGRA 3RSYA 3SQCA 1TNZB 2NVPA 1GAIA 1L2AA 3EQAA 4AYOA 4ZH1A 1TNYB 3KLSA 3RRSA 5FO9B 4KKIA 2B39A 3X17A 5IL3A 3RJ3A 4F13A 4DOEA 1LF9A 3GZKA 3M7CA 1HM2A 1H39A 4LNBB 3M00A 4E1YA 2PN5A 3VW5A 3HXEB 1LXMA 3SFYB 1S64B 1HMWA 4GTRB 4FUSA 1L1YA 1N7OA 2G02A 3H3KA 1N22A 2QNOA 3M71A 4YDOB 1XWQA 1GXNA 2V8KA 4L6XA 1FT2B 1H13A 5C05A 4Q88A 1FBOA 1LXKA 5FO8B 3AFLA 1O1TB 3KSQB 1C82A 3QWTA 5FO7B 1TF4A 1N95B 1QBQB 1OJPA 4LNVA 3WC3A 2XQWA 1TN7B 1C3DA 3EU8A 3KSLB 3LZ9A 3PZ1B 3ACTA 5JPMB 4QT9A 2XFGA 3DPYB 4D4DA 4WVCA 2ONGA 1X1HA 2H6HB 5JMDA 4OJZA 1HV6A 1QAZA 1UG9A 1J0MA 3M02A 3HXFB 1HN0A 4OK4A 4XUVA 1O6HA 1TNBB 1S63B 1N4QB 4AYRA 3G4DA 1FCEA 1N1ZA 3N0GA 4BOJA 3PZ2B 1ULVA 2GOXA 3S9VA 1IS9A 3W7UA 3DSUB 2BB5A 4V1RA 3ON6A 5IM1A 1GXMA 1HXAA 3DSVB 3HXBB 4ZH5A 1FO3A 2G0DA 3W7SA 3P5RA 5IL8A 2V8JA 3WIQA 1H3CA 3HXDB 3M75A 3E80A 3SDUA 3M76A 1WU4A 2H6GB 1X81B 5AGDA 4TXTA 1JCRB 4MMHA 1GXOA 4D4BA 4C1SA 1H37A 3M7BA 3WKHA 3RX7A 1XW2A 3K11A 1SA5B 5DGQA 2V3PA 1V7WA 1H35A 3M7LA 3Q75B 3ANKA 2EAEA 3EU5B 3RX5A 2FV1A 2E24A 1HM3A 2CQSA 2WIIB 1IA6A 1FT1B 2H6FB 3P5PA 1FBWA 4EL8A 2B4FA 3VSMA 1HCUA 4MBGB 2F6DA 1X1IA 1G9JA 2FUZA 2RI8A 4M76A 1D8EB 3PYBA 1V5DA 3Q7FB 1G6IA 1UMPA 3OEDA 4CJ1A 3QDEA 3DRAB 1WZZA 1N21A 1FPPB 2GZ6A 3QXFA 2P0VA 2V8IA 4KKJA 1H3AA 1O79A 5DHIA 2A8ZA 4GTQB 3GT5A 2WCOA 3C72B 2GH4A 3M72A 3VXDA 1N7RA 5ILYA 5GW7A 3ACSA 5JPNB 1AGMA 3E34B 3DSXB 4DODA 1SQCA 3M01A 4GTVB 1LD7B 4WVBA 3M74A 2E22A 4AYQA 3WKFA 3K7XA 4GTOB 4YDEB 4JJJA 1AYXA 4KTRA 5GZKA 4V1SA 3M73A 3CIHA 2V3NA 1IA7A 4ZRPA 5ILIA 3EUVB 4OZWA 4DI5A 1TN6B 1GAHA 5CZLA 1HZFA 1LOHA 4NEIA 1N23A 3Q79B 4MMIA 1F9GA 1H12A 3WKIA 1HXGA 3QRYA 2BRWA 2A73B 3EZ8A 2DRQA 2FV0A 3WIWA 2AHFA 4GTSB 5ILKA 2VN7A 1HX9A 1NC5A 4FXKB 1V5CA 4LIXA 2DROA 5GY3A 1KREA 3RX8A 4CE7A 1F9OA 1DOGA 5KKBA 5ILHA 4Z4JA 4Z4LA 1OJNA 4ZRQA 5ILZA 1TNUB 3WIRA 1N7QA 1EGUA 3E30B 3E73A 4CJ0A 4KTPA 1J0NA 2RGKA 3NNBA 1WU5A 1N4SB 5E2JA 2DRSA 3SDQA
chains in the Genus database with same CATH topology
1GLMA 1XWTA 1O1SB 2SQCA 3E37B 1KKTA 1TN8B 1GA2A 4WU0A 3GLYA 3QT3A 1SA4B 1NL4B 4D4CA 1LF6A 5FOBB 4D94A 3SFXB 2ZBLA 2VN4A 4BOKA 3W7TA 1WU6A 2AHGA 2Z07A 2FBAA 1TNOB 4LNGB 2IEJB 3E33B 2AFAA 3W7WA 3CU7A 3DSSB 2DRRA 2NOJA 3SDTA 1N9AB 2JJBA 1G87A 3ANJA 4J5TA 3PMMA 4FXGB 4TF4A 1N4RB 5CD2A 3P2CA 1MZCB 1H14A 2WY7A 3S4CA 2JG0A 3PZ4B 3D5SA 1FAEA 2BB6A 3WKGA 2ZZRA 1FP3A 5MEHA 1LTXB 3E32B 2D5JA 1FMIA 4YCRA 2RI9A 2OKXA 2BBCA 3QFZA 1KRFA 4GTPB 1JCSB 1KFGA 1X9DA 2EADA 3AFJA 3QPFA 3SDVA 2R2LB 1JCQB 4WVAA 2EACA 3E6UA 3ANIA 1FO2A 4ONTA 3Q7AB 1KSCA 3A3VA 1D8DB 1F9DA 1CEMA 3PZ3B 3W5NA 1KZPB 2ZISB 1NXCA 2ZIRB 2PMVA 1O6RA 4D4AA 3QFYA 3DSWB 3SAEA 3S4AA 2I07B 4MU9A 4Q2BA 1KWFA 1G9GA 3S4DA 2D8LA 1K72A 1LD8B 1NI1B 3S4BA 1H54A 1H3BA 1KS8A 2WY8A 1JS4A 1O6QA 4L9PB 2F0YB 3Q78B 3QT9A 1DCEB 3SDRA 4AYPA 5M7YA 1QQFA 1QSJA 4L0GA 2CQTA 1V7XA 3DSTB 1VD5A 3M78A 3HXCB 1GSZA 5CA3A 2XWBB 1O5MB 2WYNA 1W6KA 3PYAA 3TF4A 4ZG8A 3W5MA 3RENA 2H6IB 1DL2A 3WUXA 1H36A 2EABA 2YIKA 3Q73B 4GTMB 1O1RB 2BEDB 1V7VA 4GTTB 3H2WA 3G6JB 1UT9A 2WINB 3D5RA 1N94B 3M7EA 2JF4A 3QXQA 4GL3A 3QSPA 3D3IA 1RQ5A 1GHQA 3H7LA 1N4PB 1KZOB 3QG0A 5M7IA 2XWJB 3OXUA 3M77A 4EHMB 1W6JA 3W7XA 3T33A 3KQ4A 1KSDA 1R76A 1CLCA 5DGRA 3RSYA 3SQCA 1TNZB 2NVPA 1GAIA 1L2AA 3EQAA 4AYOA 4ZH1A 1TNYB 3KLSA 3RRSA 5FO9B 4KKIA 2B39A 3X17A 3RJ3A 4DOEA 1LF9A 3GZKA 3M7CA 1H39A 4LNBB 2PN5A 3VW5A 3HXEB 3SFYB 1S64B 4GTRB 4FUSA 1L1YA 2G02A 3H3KA 2QNOA 3M71A 4YDOB 1XWQA 1GXNA 2V8KA 4L6XA 1FT2B 1H13A 4Q88A 1FBOA 5FO8B 1O1TB 3KSQB 3QWTA 5FO7B 1TF4A 1N95B 1QBQB 4LNVA 3WC3A 2XQWA 1TN7B 1C3DA 3EU8A 3KSLB 3PZ1B 3ACTA 5JPMB 4QT9A 2XFGA 3DPYB 4D4DA 4WVCA 2H6HB 1UG9A 3HXFB 4XUVA 1O6HA 1TNBB 1S63B 1N4QB 4AYRA 1FCEA 4BOJA 3PZ2B 1ULVA 2GOXA 3S9VA 1IS9A 3W7UA 3DSUB 2BB5A 4V1RA 3ON6A 1GXMA 3DSVB 3HXBB 4ZH5A 1FO3A 2G0DA 3W7SA 3P5RA 2V8JA 3WIQA 1H3CA 3HXDB 3M75A 3SDUA 3M76A 1WU4A 2H6GB 1X81B 5AGDA 4TXTA 1JCRB 1GXOA 4D4BA 4C1SA 1H37A 3M7BA 3WKHA 3RX7A 1XW2A 3K11A 1SA5B 5DGQA 2V3PA 1V7WA 1H35A 3M7LA 3Q75B 3ANKA 2EAEA 3EU5B 3RX5A 2FV1A 2CQSA 2WIIB 1IA6A 1FT1B 2H6FB 3P5PA 1FBWA 4EL8A 2B4FA 1HCUA 4MBGB 2F6DA 1G9JA 2FUZA 2RI8A 4M76A 1D8EB 3PYBA 1V5DA 3Q7FB 1G6IA 1UMPA 3OEDA 4CJ1A 3QDEA 3DRAB 1WZZA 1FPPB 2GZ6A 3QXFA 2P0VA 2V8IA 4KKJA 1H3AA 1O79A 2A8ZA 4GTQB 3GT5A 3C72B 2GH4A 3M72A 3VXDA 5GW7A 3ACSA 5JPNB 1AGMA 3E34B 3DSXB 4DODA 1SQCA 4GTVB 1LD7B 4WVBA 3M74A 4AYQA 3WKFA 3K7XA 4GTOB 4YDEB 4JJJA 1AYXA 4KTRA 5GZKA 4V1SA 3M73A 3CIHA 2V3NA 1IA7A 4ZRPA 3EUVB 1TN6B 1GAHA 5CZLA 1HZFA 3Q79B 1H12A 3WKIA 3QRYA 2A73B 3EZ8A 2DRQA 2FV0A 3WIWA 2AHFA 4GTSB 2VN7A 1NC5A 4FXKB 1V5CA 4LIXA 2DROA 5GY3A 1KREA 3RX8A 4CE7A 1F9OA 1DOGA 5KKBA 4Z4JA 4Z4LA 4ZRQA 1TNUB 3WIRA 3E30B 3E73A 4CJ0A 4KTPA 2RGKA 5E2JA 1WU5A 1N4SB 2DRSA 3SDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT9 A;  3RX5 A;  4AYP A;  1GLM A;  1XWT A;  5M7Y A;  2FV1 A;  1KKT A;  4L6X A;  1GA2 A;  1H13 A;  2CQS A;  4WU0 A;  4L0G A;  3GLY A;  1IA6 A;  3QT3 A;  2CQT A;  4Q88 A;  1FBO A;  1FBW A;  4EL8 A;  2B4F A;  1LF6 A;  1V7X A;  1HCU A;  1VD5 A;  2F6D A;  3QWT A;  1G9J A;  2ZBL A;  1TF4 A;  2FUZ A;  2VN4 A;  2RI8 A;  3W7T A;  3WC3 A;  1WU6 A;  1V5D A;  5CA3 A;  2AHG A;  2Z07 A;  2WYN A;  2FBA A;  3ACT A;  1G6I A;  2XFG A;  4CJ1 A;  3QDE A;  3TF4 A;  4ZG8 A;  1WZZ A;  3W5M A;  3REN A;  4WVC A;  2AFA A;  3W7W A;  1DL2 A;  3WUX A;  2GZ6 A;  2EAB A;  2P0V A;  2YIK A;  3QXF A;  2DRR A;  2JJB A;  2A8Z A;  1G87 A;  3ANJ A;  1V7V A;  3GT5 A;  4J5T A;  1UG9 A;  3H2W A;  2GH4 A;  3PMM A;  1UT9 A;  4TF4 A;  3VXD A;  2JF4 A;  3QXQ A;  5GW7 A;  3ACS A;  4XUV A;  1AGM A;  5CD2 A;  3P2C A;  4DOD A;  1H14 A;  3S4C A;  4AYR A;  2JG0 A;  4WVB A;  3QSP A;  3D3I A;  1RQ5 A;  4AYQ A;  3WKF A;  1FCE A;  1FAE A;  3H7L A;  3WKG A;  4JJJ A;  1ULV A;  1AYX A;  3QG0 A;  4KTR A;  5M7I A;  2ZZR A;  1FP3 A;  5MEH A;  3CIH A;  2D5J A;  1IS9 A;  1FMI A;  3W7U A;  3ON6 A;  1IA7 A;  2RI9 A;  2OKX A;  3QFZ A;  1KRF A;  1KFG A;  3W7X A;  1X9D A;  4ZH5 A;  2EAD A;  1FO3 A;  3AFJ A;  3T33 A;  1GAH A;  1KSD A;  5CZL A;  3QPF A;  1CLC A;  5DGR A;  4WVA A;  2EAC A;  3E6U A;  3RSY A;  3W7S A;  1H12 A;  1GAI A;  2NVP A;  3WKI A;  3ANI A;  1L2A A;  1FO2 A;  3EQA A;  3QRY A;  4AYO A;  1KSC A;  3A3V A;  1F9D A;  3RRS A;  1CEM A;  3EZ8 A;  3WIQ A;  3X17 A;  3W5N A;  2DRQ A;  2FV0 A;  1NXC A;  3WIW A;  2AHF A;  4DOE A;  2VN7 A;  1NC5 A;  1WU4 A;  3QFY A;  1LF9 A;  1V5C A;  3S4A A;  2DRO A;  5GY3 A;  3GZK A;  1KRE A;  4TXT A;  3RX8 A;  4CE7 A;  4Q2B A;  1F9O A;  1DOG A;  1KWF A;  1G9G A;  3S4D A;  3VW5 A;  2D8L A;  1K72 A;  5KKB A;  3WKH A;  3RX7 A;  1XW2 A;  3K11 A;  4Z4J A;  4Z4L A;  5DGQ A;  4FUS A;  1L1Y A;  3WIR A;  1V7W A;  3S4B A;  3H3K A;  3E73 A;  4CJ0 A;  1H54 A;  2QNO A;  4KTP A;  2RGK A;  1KS8 A;  1JS4 A;  1WU5 A;  5E2J A;  1XWQ A;  3ANK A;  2DRS A;  2EAE A; 
#chains in the Genus database with same CATH topology
 1CB8 A;  1GLM A;  1XWT A;  1O1S B;  3E7J A;  2SQC A;  3E37 B;  1KKT A;  1TN8 B;  5IKA A;  1GA2 A;  4WU0 A;  3GLY A;  3QT3 A;  1SA4 B;  2BRP A;  1NL4 B;  4D4C A;  1LF6 A;  5FOB B;  1RWG A;  4D94 A;  3SFX B;  2ONH A;  2ZBL A;  2VN4 A;  4BOK A;  1HMU A;  3W7T A;  1WU6 A;  2AHG A;  2Z07 A;  2FBA A;  1TNO B;  5IK9 A;  4LNG B;  2IEJ B;  3E33 B;  2AFA A;  3W7W A;  3CU7 A;  1W3Y A;  2DRR A;  3DSS B;  2NOJ A;  3SDT A;  5EAU A;  1N9A B;  2JJB A;  1G87 A;  3ANJ A;  1N1B A;  4J5T A;  3PMM A;  5JMF A;  4FXG B;  4TF4 A;  4OZV A;  1F1S A;  2FUT A;  1N4R B;  5CD2 A;  3NFV A;  1I8Q A;  3P2C A;  1MZC B;  1H14 A;  2WY7 A;  5DHK A;  3S4C A;  2JG0 A;  3PZ4 B;  3D5S A;  1FAE A;  2BB6 A;  4FJQ A;  3WKG A;  2ZZR A;  1FP3 A;  5MEH A;  1LTX B;  3E32 B;  2D5J A;  1FMI A;  5IK0 A;  4YCR A;  1N7N A;  1OJO A;  2RI9 A;  2OKX A;  2BBC A;  3QFZ A;  1KRF A;  4GTP B;  1N20 A;  1JCS B;  1KFG A;  2X03 A;  1X9D A;  4FNV A;  2EAD A;  3AFJ A;  2J5C A;  3QPF A;  3SDV A;  2R2L B;  1JCQ B;  4WVA A;  2EAC A;  3E6U A;  1N24 A;  3ANI A;  1FO2 A;  2WDA A;  4ONT A;  3Q7A B;  1KSC A;  3A3V A;  1D8D B;  1F9D A;  1CEM A;  1HXC A;  3PZ3 B;  3W5N A;  1KZP B;  2ZIS B;  1NXC A;  2ZIR B;  2PMV A;  1O6R A;  4D4A A;  3QFY A;  3DSW B;  3SAE A;  3S4A A;  2I07 B;  4MU9 A;  5EAS A;  4Q2B A;  2BRV X;  1KWF A;  1G9G A;  3S4D A;  4F10 A;  2D8L A;  1K72 A;  1LD8 B;  1NI1 B;  3S4B A;  1H54 A;  1H3B A;  4OK2 A;  1KS8 A;  2WY8 A;  1JS4 A;  1O6Q A;  4L9P B;  2F0Y B;  1DCE B;  3Q78 B;  3QT9 A;  3SDR A;  4AYP A;  5M7Y A;  1QQF A;  1RWA A;  1QSJ A;  3N0F A;  4L0G A;  2CQT A;  5IKH A;  1V7X A;  3DST B;  1VD5 A;  2FUQ A;  3M78 A;  3HXC B;  1GSZ A;  1RWF A;  5ILJ A;  1RWH A;  5CA3 A;  1RWC A;  2XWB B;  5IK6 A;  3G4F A;  1O5M B;  2WYN A;  2Q1F A;  1RW9 A;  1W6K A;  1N7P A;  3PYA A;  3TF4 A;  4ZG8 A;  3W5M A;  3REN A;  2H6I B;  1X1J A;  1DL2 A;  3WUX A;  1H36 A;  2EAB A;  2YIK A;  3Q73 B;  4GTM B;  5EAT A;  4GAX A;  1O1R B;  2BED B;  1V7V A;  4RNQ A;  4GTT B;  3H2W A;  3G6J B;  1UT9 A;  2WIN B;  3D5R A;  1N94 B;  3M7E A;  3A0O A;  1OJM A;  2JF4 A;  3QXQ A;  4GL3 A;  3QSP A;  3D3I A;  1RQ5 A;  1GHQ A;  3H7L A;  1N4P B;  1KZO B;  3QG0 A;  5M7I A;  2XWJ B;  3OXU A;  3M77 A;  4EHM B;  1W6J A;  3VSN A;  3W7X A;  3T33 A;  3KQ4 A;  5ILD A;  1KSD A;  1R76 A;  1CLC A;  5DGR A;  3RSY A;  3SQC A;  1TNZ B;  2NVP A;  1GAI A;  1L2A A;  3EQA A;  4AYO A;  4ZH1 A;  1TNY B;  3KLS A;  3RRS A;  5FO9 B;  4KKI A;  2B39 A;  3X17 A;  5IL3 A;  3RJ3 A;  4F13 A;  4DOE A;  1LF9 A;  3GZK A;  3M7C A;  1HM2 A;  1H39 A;  4LNB B;  3M00 A;  4E1Y A;  2PN5 A;  3VW5 A;  3HXE B;  1LXM A;  3SFY B;  1S64 B;  1HMW A;  4GTR B;  4FUS A;  1L1Y A;  1N7O A;  2G02 A;  3H3K A;  1N22 A;  2QNO A;  3M71 A;  4YDO B;  1XWQ A;  1GXN A;  2V8K A;  4L6X A;  1FT2 B;  1H13 A;  5C05 A;  4Q88 A;  1FBO A;  1LXK A;  5FO8 B;  3AFL A;  1O1T B;  3KSQ B;  1C82 A;  3QWT A;  5FO7 B;  1TF4 A;  1N95 B;  1QBQ B;  1OJP A;  4LNV A;  3WC3 A;  2XQW A;  1TN7 B;  1C3D A;  3EU8 A;  3KSL B;  3LZ9 A;  3PZ1 B;  3ACT A;  5JPM B;  4QT9 A;  2XFG A;  3DPY B;  4D4D A;  4WVC A;  2ONG A;  1X1H A;  2H6H B;  5JMD A;  4OJZ A;  1HV6 A;  1QAZ A;  1UG9 A;  1J0M A;  3M02 A;  3HXF B;  1HN0 A;  4OK4 A;  4XUV A;  1O6H A;  1TNB B;  1S63 B;  1N4Q B;  4AYR A;  3G4D A;  1FCE A;  1N1Z A;  3N0G A;  4BOJ A;  3PZ2 B;  1ULV A;  2GOX A;  3S9V A;  1IS9 A;  3W7U A;  3DSU B;  2BB5 A;  4V1R A;  3ON6 A;  5IM1 A;  1GXM A;  1HXA A;  3DSV B;  3HXB B;  4ZH5 A;  1FO3 A;  2G0D A;  3W7S A;  3P5R A;  5IL8 A;  2V8J A;  3WIQ A;  1H3C A;  3HXD B;  3M75 A;  3E80 A;  3SDU A;  3M76 A;  1WU4 A;  2H6G B;  1X81 B;  5AGD A;  4TXT A;  1JCR B;  4MMH A;  1GXO A;  4D4B A;  4C1S A;  1H37 A;  3M7B A;  3WKH A;  3RX7 A;  1XW2 A;  3K11 A;  1SA5 B;  5DGQ A;  2V3P A;  1V7W A;  1H35 A;  3M7L A;  3Q75 B;  3ANK A;  2EAE A;  3EU5 B;  3RX5 A;  2FV1 A;  2E24 A;  1HM3 A;  2CQS A;  2WII B;  1IA6 A;  1FT1 B;  2H6F B;  3P5P A;  1FBW A;  4EL8 A;  2B4F A;  3VSM A;  1HCU A;  4MBG B;  2F6D A;  1X1I A;  1G9J A;  2FUZ A;  2RI8 A;  4M76 A;  1D8E B;  3PYB A;  1V5D A;  3Q7F B;  1G6I A;  1UMP A;  3OED A;  4CJ1 A;  3QDE A;  3DRA B;  1WZZ A;  1N21 A;  1FPP B;  2GZ6 A;  3QXF A;  2P0V A;  2V8I A;  4KKJ A;  1H3A A;  1O79 A;  5DHI A;  2A8Z A;  4GTQ B;  3GT5 A;  2WCO A;  3C72 B;  2GH4 A;  3M72 A;  3VXD A;  1N7R A;  5ILY A;  5GW7 A;  3ACS A;  5JPN B;  1AGM A;  3E34 B;  3DSX B;  4DOD A;  1SQC A;  3M01 A;  4GTV B;  1LD7 B;  4WVB A;  3M74 A;  2E22 A;  4AYQ A;  3WKF A;  3K7X A;  4GTO B;  4YDE B;  4JJJ A;  1AYX A;  4KTR A;  5GZK A;  4V1S A;  3M73 A;  3CIH A;  2V3N A;  1IA7 A;  4ZRP A;  5ILI A;  3EUV B;  4OZW A;  4DI5 A;  1TN6 B;  1GAH A;  5CZL A;  1HZF A;  1LOH A;  4NEI A;  1N23 A;  3Q79 B;  4MMI A;  1F9G A;  1H12 A;  3WKI A;  1HXG A;  3QRY A;  2BRW A;  2A73 B;  3EZ8 A;  2DRQ A;  2FV0 A;  3WIW A;  2AHF A;  4GTS B;  5ILK A;  2VN7 A;  1HX9 A;  1NC5 A;  4FXK B;  1V5C A;  4LIX A;  2DRO A;  5GY3 A;  1KRE A;  3RX8 A;  4CE7 A;  1F9O A;  1DOG A;  5KKB A;  5ILH A;  4Z4J A;  4Z4L A;  1OJN A;  4ZRQ A;  5ILZ A;  1TNU B;  3WIR A;  1N7Q A;  1EGU A;  3E30 B;  3E73 A;  4CJ0 A;  4KTP A;  1J0N A;  2RGK A;  3NNB A;  1WU5 A;  1N4S B;  5E2J A;  2DRS A;  3SDQ A; 
#chains in the Genus database with same CATH homology
 1GLM A;  1XWT A;  1O1S B;  2SQC A;  3E37 B;  1KKT A;  1TN8 B;  1GA2 A;  4WU0 A;  3GLY A;  3QT3 A;  1SA4 B;  1NL4 B;  4D4C A;  1LF6 A;  5FOB B;  4D94 A;  3SFX B;  2ZBL A;  2VN4 A;  4BOK A;  3W7T A;  1WU6 A;  2AHG A;  2Z07 A;  2FBA A;  1TNO B;  4LNG B;  2IEJ B;  3E33 B;  2AFA A;  3W7W A;  3CU7 A;  3DSS B;  2DRR A;  2NOJ A;  3SDT A;  1N9A B;  2JJB A;  1G87 A;  3ANJ A;  4J5T A;  3PMM A;  4FXG B;  4TF4 A;  1N4R B;  5CD2 A;  3P2C A;  1MZC B;  1H14 A;  2WY7 A;  3S4C A;  2JG0 A;  3PZ4 B;  3D5S A;  1FAE A;  2BB6 A;  3WKG A;  2ZZR A;  1FP3 A;  5MEH A;  1LTX B;  3E32 B;  2D5J A;  1FMI A;  4YCR A;  2RI9 A;  2OKX A;  2BBC A;  3QFZ A;  1KRF A;  4GTP B;  1JCS B;  1KFG A;  1X9D A;  2EAD A;  3AFJ A;  3QPF A;  3SDV A;  2R2L B;  1JCQ B;  4WVA A;  2EAC A;  3E6U A;  3ANI A;  1FO2 A;  4ONT A;  3Q7A B;  1KSC A;  3A3V A;  1D8D B;  1F9D A;  1CEM A;  3PZ3 B;  3W5N A;  1KZP B;  2ZIS B;  1NXC A;  2ZIR B;  2PMV A;  1O6R A;  4D4A A;  3QFY A;  3DSW B;  3SAE A;  3S4A A;  2I07 B;  4MU9 A;  4Q2B A;  1KWF A;  1G9G A;  3S4D A;  2D8L A;  1K72 A;  1LD8 B;  1NI1 B;  3S4B A;  1H54 A;  1H3B A;  1KS8 A;  2WY8 A;  1JS4 A;  1O6Q A;  4L9P B;  2F0Y B;  3Q78 B;  3QT9 A;  1DCE B;  3SDR A;  4AYP A;  5M7Y A;  1QQF A;  1QSJ A;  4L0G A;  2CQT A;  1V7X A;  3DST B;  1VD5 A;  3M78 A;  3HXC B;  1GSZ A;  5CA3 A;  2XWB B;  1O5M B;  2WYN A;  1W6K A;  3PYA A;  3TF4 A;  4ZG8 A;  3W5M A;  3REN A;  2H6I B;  1DL2 A;  3WUX A;  1H36 A;  2EAB A;  2YIK A;  3Q73 B;  4GTM B;  1O1R B;  2BED B;  1V7V A;  4GTT B;  3H2W A;  3G6J B;  1UT9 A;  2WIN B;  3D5R A;  1N94 B;  3M7E A;  2JF4 A;  3QXQ A;  4GL3 A;  3QSP A;  3D3I A;  1RQ5 A;  1GHQ A;  3H7L A;  1N4P B;  1KZO B;  3QG0 A;  5M7I A;  2XWJ B;  3OXU A;  3M77 A;  4EHM B;  1W6J A;  3W7X A;  3T33 A;  3KQ4 A;  1KSD A;  1R76 A;  1CLC A;  5DGR A;  3RSY A;  3SQC A;  1TNZ B;  2NVP A;  1GAI A;  1L2A A;  3EQA A;  4AYO A;  4ZH1 A;  1TNY B;  3KLS A;  3RRS A;  5FO9 B;  4KKI A;  2B39 A;  3X17 A;  3RJ3 A;  4DOE A;  1LF9 A;  3GZK A;  3M7C A;  1H39 A;  4LNB B;  2PN5 A;  3VW5 A;  3HXE B;  3SFY B;  1S64 B;  4GTR B;  4FUS A;  1L1Y A;  2G02 A;  3H3K A;  2QNO A;  3M71 A;  4YDO B;  1XWQ A;  1GXN A;  2V8K A;  4L6X A;  1FT2 B;  1H13 A;  4Q88 A;  1FBO A;  5FO8 B;  1O1T B;  3KSQ B;  3QWT A;  5FO7 B;  1TF4 A;  1N95 B;  1QBQ B;  4LNV A;  3WC3 A;  2XQW A;  1TN7 B;  1C3D A;  3EU8 A;  3KSL B;  3PZ1 B;  3ACT A;  5JPM B;  4QT9 A;  2XFG A;  3DPY B;  4D4D A;  4WVC A;  2H6H B;  1UG9 A;  3HXF B;  4XUV A;  1O6H A;  1TNB B;  1S63 B;  1N4Q B;  4AYR A;  1FCE A;  4BOJ A;  3PZ2 B;  1ULV A;  2GOX A;  3S9V A;  1IS9 A;  3W7U A;  3DSU B;  2BB5 A;  4V1R A;  3ON6 A;  1GXM A;  3DSV B;  3HXB B;  4ZH5 A;  1FO3 A;  2G0D A;  3W7S A;  3P5R A;  2V8J A;  3WIQ A;  1H3C A;  3HXD B;  3M75 A;  3SDU A;  3M76 A;  1WU4 A;  2H6G B;  1X81 B;  5AGD A;  4TXT A;  1JCR B;  1GXO A;  4D4B A;  4C1S A;  1H37 A;  3M7B A;  3WKH A;  3RX7 A;  1XW2 A;  3K11 A;  1SA5 B;  5DGQ A;  2V3P A;  1V7W A;  1H35 A;  3M7L A;  3Q75 B;  3ANK A;  2EAE A;  3EU5 B;  3RX5 A;  2FV1 A;  2CQS A;  2WII B;  1IA6 A;  1FT1 B;  2H6F B;  3P5P A;  1FBW A;  4EL8 A;  2B4F A;  1HCU A;  4MBG B;  2F6D A;  1G9J A;  2FUZ A;  2RI8 A;  4M76 A;  1D8E B;  3PYB A;  1V5D A;  3Q7F B;  1G6I A;  1UMP A;  3OED A;  4CJ1 A;  3QDE A;  3DRA B;  1WZZ A;  1FPP B;  2GZ6 A;  3QXF A;  2P0V A;  2V8I A;  4KKJ A;  1H3A A;  1O79 A;  2A8Z A;  4GTQ B;  3GT5 A;  3C72 B;  2GH4 A;  3M72 A;  3VXD A;  5GW7 A;  3ACS A;  5JPN B;  1AGM A;  3E34 B;  3DSX B;  4DOD A;  1SQC A;  4GTV B;  1LD7 B;  4WVB A;  3M74 A;  4AYQ A;  3WKF A;  3K7X A;  4GTO B;  4YDE B;  4JJJ A;  1AYX A;  4KTR A;  5GZK A;  4V1S A;  3M73 A;  3CIH A;  2V3N A;  1IA7 A;  4ZRP A;  3EUV B;  1TN6 B;  1GAH A;  5CZL A;  1HZF A;  3Q79 B;  1H12 A;  3WKI A;  3QRY A;  2A73 B;  3EZ8 A;  2DRQ A;  2FV0 A;  3WIW A;  2AHF A;  4GTS B;  2VN7 A;  1NC5 A;  4FXK B;  1V5C A;  4LIX A;  2DRO A;  5GY3 A;  1KRE A;  3RX8 A;  4CE7 A;  1F9O A;  1DOG A;  5KKB A;  4Z4J A;  4Z4L A;  4ZRQ A;  1TNU B;  3WIR A;  3E30 B;  3E73 A;  4CJ0 A;  4KTP A;  2RGK A;  5E2J A;  1WU5 A;  1N4S B;  2DRS A;  3SDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...