4CE7A

Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family gh105, involved in ulvan degradation
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
348
structure length
345
Chain Sequence
DVFNEDYIKTSMIKALEWQEAHPIFAIHPTDWTNGAYYTGVARAHHTTKNMMYMAALKNQAVANNWQPYTRLYHADDVAISYSYLYVAENEKRRNFSDLEPTKKFLDTHLYEDNAWKAGTNRSKEDKTILWWWCDALFMAPPVINLYAKQSEQPEYLDEMHKYYMETYNRLYDKEEKLFARDSRFVWDGDDEDKKEPNGEKVFWSRGNGWVIGGLALLLEDMPEDYKHRDFYVNLYKEMASRILEIQPEDGLWRTSLLSPESYDHGEVSGSAFHTFALAWGINKGLIDKKYTPAVKKAWKAMANCQHDDGRVGWVQNIPEPASKDSYQNFGTGAFLLAGSEILKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNSATURATED 3S-RHAMNOGLYCURONYL HYDROLASE
publication title A Novel Unsaturated Beta-Glucuronyl Hydrolase Involved in Ulvan Degradation Unveils the Versatility of Stereochemistry Requirements in Family Gh105.
pubmed doi rcsb
source organism Nonlabens ulvanivorans
molecule tags Hydrolase
total genus 134
structure length 345
sequence length 348
chains with identical sequence B, C
ec nomenclature ec 3.2.1.172: Unsaturated rhamnogalacturonyl hydrolase.
pdb deposition date 2013-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4ce7A00
1AYXA 3QXQA 1WU5A 4Z4LA 4AYQA 1LF9A 2ZBLA 1H13A 2JJBA 1XWTA 2GZ6A 4WVAA 2AFAA 5CA3A 1KFGA 1V7VA 2EADA 1GA2A 2YIKA 1G6IA 3S4DA 3RX5A 4CJ1A 2DROA 3WC3A 3T33A 5M7YA 1FMIA 1FO2A 1KSDA 3E73A 3W7XA 1KKTA 5E2JA 5CD2A 3E6UA 3W7SA 4FUSA 3WUXA 4WVBA 4CE7A 1GAHA 1FBOA 2GH4A 1GLMA 4TXTA 4L6XA 3QG0A 1KS8A 1V5CA 1WU4A 3QDEA 4KTRA 3VW5A 4DOEA 3ACTA 3W7WA 1L1YA 3QRYA 4Q2BA 1IS9A 2QNOA 3TF4A 3PMMA 1VD5A 3WIRA 2EAEA 1RQ5A 1H54A 3GZKA 1ULVA 2XFGA 4WU0A 1TF4A 3ANKA 1NC5A 2D5JA 4KTPA 3WIWA 4AYRA 2D8LA 3D3IA 3GLYA 3WKFA 2FV1A 3ANJA 2OKXA 5GY3A 2DRQA 1IA6A 1DOGA 1KSCA 1H12A 3QFZA 2B4FA 2DRRA 2FUZA 1DL2A 2JF4A 3H3KA 5DGRA 3H2WA 3ACSA 1V7XA 3QWTA 1V7WA 1NXCA 1XW2A 4TF4A 1G9GA 3RX8A 1FO3A 2CQTA 4L0GA 2VN4A 2WYNA 1G9JA 3P2CA 1KREA 2RI8A 3RRSA 3GT5A 3H7LA 5KKBA 2DRSA 2AHFA 3QT9A 2A8ZA 3QT3A 1LF6A 3W7UA 3VXDA 2RI9A 5MEHA 2FV0A 4WVCA 1KWFA 3RENA 3EQAA 3QXFA 3S4CA 2Z07A 3W5NA 5GW7A 3S4AA 4ZG8A 1F9OA 1UG9A 2ZZRA 4AYOA 5CZLA 1GAIA 1FCEA 5M7IA 1JS4A 1FAEA 3W5MA 2JG0A 1L2AA 1AGMA 4ZH5A 1FP3A 3AFJA 3CIHA 1KRFA 3ANIA 3X17A 1WZZA 1F9DA 1UT9A 2CQSA 3EZ8A 3RSYA 3WIQA 4J5TA 1G87A 2FBAA 3QSPA 3WKHA 1X9DA 2EACA 1FBWA 2VN7A 3QPFA 2EABA 4JJJA 1IA7A 1V5DA 4EL8A 1HCUA 4DODA 2NVPA 2RGKA 3ON6A 1K72A 4CJ0A 2P0VA 4AYPA 3RX7A 1XWQA 2F6DA 3WKIA 4XUVA 3S4BA 3K11A 3QFYA 1CLCA 2AHGA 5DGQA 3WKGA 3A3VA 1WU6A 4Z4JA 4Q88A 3W7TA 1CEMA 1H14A
chains in the Genus database with same CATH superfamily
3QXQA 2XQWA 2BRWA 2ONGA 4V1RA 2Q1FA 3G4DA 1O1RB 2BEDB 2JJBA 3VSNA 3DSUB 1V7VA 1G6IA 3S4DA 5JPMB 3WC3A 3M7LA 3SDUA 1W3YA 1FMIA 2G0DA 3EU5B 3LZ9A 3E6UA 1TN7B 4FUSA 4CE7A 3SFYB 4OZVA 5ILYA 1GXOA 4L6XA 3QG0A 4YCRA 1JCSB 1OJNA 3VW5A 1N95B 3ACTA 2XWJB 4D4DA 2NOJA 2QNOA 5IL3A 3TF4A 1VD5A 1O6RA 1F1SA 2H6IB 1ULVA 2H6HB 1NC5A 3A0OA 1H3BA 2D8LA 1SA5B 1HMUA 3GLYA 2B39A 3ANJA 3M00A 3WKFA 2OKXA 4YDOB 2DRQA 2PN5A 3Q7FB 2DRRA 1UMPA 1D8EB 3PZ1B 2I07B 1HX9A 2J5CA 3QWTA 1XW2A 1FPPB 2CQTA 3Q73B 1N7PA 1G9JA 4BOJA 3SDTA 3RRSA 3GT5A 2AHFA 5DHIA 3QT3A 1J0NA 3E7JA 5FOBB 5ILDA 3VXDA 1FT2B 3RENA 1C82A 3QXFA 1OJOA 3S4AA 4ZG8A 1UG9A 5CZLA 4F10A 1GAIA 1GXNA 2JG0A 1HN0A 4ZH5A 1FP3A 1N7RA 3HXDB 1KRFA 5EATA 3SQCA 3X17A 1WZZA 1H3AA 1UT9A 2GOXA 4J5TA 4D4BA 3M73A 1FBWA 1HXAA 1RWAA 1N22A 3QPFA 1FT1B 1V5DA 2A73B 1D8DB 2FUTA 4GAXA 2NVPA 4DODA 1N94B 2P0VA 4LNGB 3WKIA 3S4BA 3QFYA 4YDEB 3A3VA 5ILJA 4MBGB 2WCOA 1AYXA 5EAUA 1WU5A 2V8KA 1N4RB 5FO7B 4AYQA 4ZH1A 5ILKA 1XWTA 3G4FA 4WVAA 5CA3A 2EADA 1H36A 2BBCA 4CJ1A 1FO2A 1KSDA 1O1TB 3M71A 5E2JA 5CD2A 5JMFA 3WUXA 4WVBA 1GAHA 1GXMA 2GH4A 4C1SA 1KS8A 1HZFA 1WU4A 3PYBA 1S63B 2ZIRB 4DOEA 3AFLA 4L9PB 1OJMA 1L1YA 3QRYA 4Q2BA 5IM1A 3PMMA 5C05A 1RWCA 2EAEA 2V8IA 1C3DA 3M01A 1LTXB 3M72A 2WY8A 2WDAA 4V1SA 1NI1B 1F9GA 5IK0A 1EGUA 3K7XA 2B4FA 5GZKA 2FUZA 1DL2A 3H3KA 4NEIA 2V3PA 1V7WA 3RJ3A 3M77A 4L0GA 3Q7AB 3KQ4A 3C72B 4F13A 3M78A 4MMHA 4D4CA 3P2CA 1O6QA 3HXBB 5IKHA 3CU7A 5AGDA 1I8QA 1HM2A 1QSJA 2RI9A 5MEHA 2FV0A 1KWFA 3OXUA 4FJQA 3EQAA 3S4CA 4BOKA 5GW7A 3NFVA 4D4AA 1FCEA 5M7IA 1JS4A 1AGMA 2PMVA 3CIHA 1F9DA 2CQSA 1N1ZA 2FBAA 3G6JB 1X9DA 1KZOB 1RWHA 2EACA 5JMDA 5FO9B 1H37A 4JJJA 4EL8A 2FUQA 2RGKA 3ON6A 3M76A 1TNUB 3DSVB 1GSZA 1XWQA 4XUVA 5IL8A 3DSTB 2V3NA 4Q88A 3Q79B 3ANIA 3Q75B 1KZPB 2SQCA 1H3CA 1H13A 3M75A 1HM3A 3HXEB 2BB5A 2YIKA 2V8JA 3T33A 5M7YA 3E73A 1KKTA 4FXKB 2H6FB 5DHKA 2BB6A 1GLMA 4ZRQA 4TXTA 1H35A 1N21A 1RWGA 1V5CA 3QDEA 4KTRA 4MU9A 2WIIB 1SA4B 1O5MB 4DI5A 1N7QA 1RWFA 1N4SB 2F0YB 4M76A 1DCEB 3EU8A 1RQ5A 3P5RA 1N7OA 2XFGA 2R2LB 1TF4A 4WU0A 5IKAA 4KTPA 1N23A 2FV1A 5GY3A 1SQCA 3QFZA 1H12A 1QAZA 5DGRA 3H2WA 3ACSA 5IK6A 1NXCA 2X03A 3RX8A 5ILIA 1FO3A 2VN4A 3M74A 1J0MA 1N24A 3PZ3B 3KLSA 3S9VA 2RI8A 5KKBA 2DRSA 2WINB 3E37B 2ONHA 1QQFA 1TNZB 4WVCA 3D5RA 3DRAB 2Z07A 3W5NA 3HXFB 1QBQB 2ZZRA 1JCQB 4AYOA 1N4QB 1FAEA 1OJPA 1L2AA 4LIXA 3N0GA 3EZ8A 1G87A 4OZWA 3QSPA 4ONTA 3SDVA 4RNQA 2VN7A 1X81B 3M7BA 4GTMB 5IK9A 1IA7A 1HCUA 1MZCB 5FO8B 1TNBB 3SDRA 1LXMA 4AYPA 4ZRPA 2F6DA 2WY7A 5JPNB 3K11A 1CLCA 2AHGA 5DGQA 3WKGA 4Z4JA 4GTSB 4GTVB 4Z4LA 2XWBB 1LF9A 2ZBLA 3N0FA 1LOHA 2GZ6A 2AFAA 1KFGA 4GTOB 4MMIA 1GA2A 4LNBB 1N7NA 3RX5A 2E22A 1GHQA 2DROA 1X1HA 1RW9A 1TN8B 1X1JA 4OK2A 1O1SB 3W7XA 1O6HA 1LXKA 1LD8B 3W7SA 2BRPA 1TNYB 4GL3A 1H39A 3VSMA 1FBOA 1W6JA 1TNOB 4QT9A 1S64B 4EHMB 1R76A 3KSQB 1O79A 3W7WA 1N4PB 3DSWB 1IS9A 3PZ2B 3E30B 3WIRA 5ILZA 2E24A 1H54A 3DPYB 3GZKA 1N9AB 4KKJA 3ANKA 3E34B 3NNBA 3DSSB 2D5JA 2G02A 3KSLB 3WIWA 4AYRA 3Q78B 3D3IA 2ZISB 1IA6A 5EASA 1DOGA 1LD7B 1JCRB 1KSCA 4FXGB 1HXGA 2IEJB 5ILHA 2JF4A 3HXCB 1V7XA 4TF4A 1G9GA 1TN6B 4E1YA 3PZ4B 4GTRB 3SDQA 2WYNA 1HV6A 3E32B 1X1IA 1KREA 3PYAA 3H7LA 4KKIA 1CB8A 3QT9A 2A8ZA 4GTQB 1LF6A 3W7UA 3M7CA 3E80A 3M02A 1HXCA 3DSXB 1F9OA 4GTPB 4FNVA 3W5MA 3SAEA 1N1BA 1W6KA 3SFXB 3AFJA 2BRVX 3RSYA 3WIQA 3WKHA 1NL4B 4GTTB 4LNVA 4OJZA 4OK4A 4D94A 1HMWA 3EUVB 2EABA 3D5SA 3P5PA 4CJ0A 1K72A 1N20A 2H6GB 3RX7A 3W7TA 1WU6A 3E33B 3OEDA 3M7EA 1CEMA 1H14A
chains in the Genus database with same CATH topology
3QXQA 2XQWA 4V1RA 1O1RB 2BEDB 2JJBA 3DSUB 1V7VA 1G6IA 3S4DA 5JPMB 3WC3A 3M7LA 3SDUA 1FMIA 2G0DA 3EU5B 3E6UA 1TN7B 4FUSA 4CE7A 3SFYB 1GXOA 4L6XA 3QG0A 4YCRA 1JCSB 3VW5A 1N95B 3ACTA 2XWJB 4D4DA 2NOJA 2QNOA 3TF4A 1VD5A 1O6RA 2H6IB 1ULVA 2H6HB 1NC5A 1H3BA 2D8LA 1SA5B 3GLYA 2B39A 3ANJA 3WKFA 2OKXA 4YDOB 2DRQA 2PN5A 3Q7FB 2DRRA 1UMPA 1D8EB 3PZ1B 2I07B 3QWTA 1XW2A 1FPPB 2CQTA 3Q73B 1G9JA 4BOJA 3SDTA 3RRSA 3GT5A 2AHFA 3QT3A 5FOBB 3VXDA 1FT2B 3RENA 3QXFA 3S4AA 4ZG8A 1UG9A 5CZLA 1GAIA 1GXNA 2JG0A 4ZH5A 1FP3A 3HXDB 1KRFA 3SQCA 3X17A 1WZZA 1H3AA 1UT9A 2GOXA 4J5TA 4D4BA 3M73A 1FBWA 3QPFA 1FT1B 1V5DA 2A73B 1D8DB 2NVPA 4DODA 1N94B 2P0VA 4LNGB 3WKIA 3S4BA 3QFYA 4YDEB 3A3VA 4MBGB 1AYXA 1WU5A 2V8KA 1N4RB 5FO7B 4AYQA 4ZH1A 1XWTA 4WVAA 5CA3A 2EADA 1H36A 2BBCA 4CJ1A 1FO2A 1KSDA 1O1TB 3M71A 5E2JA 5CD2A 3WUXA 4WVBA 1GAHA 1GXMA 2GH4A 4C1SA 1KS8A 1HZFA 1WU4A 3PYBA 1S63B 2ZIRB 4DOEA 4L9PB 1L1YA 3QRYA 4Q2BA 3PMMA 2EAEA 2V8IA 1C3DA 1LTXB 3M72A 2WY8A 4V1SA 1NI1B 3K7XA 2B4FA 5GZKA 2FUZA 1DL2A 3H3KA 2V3PA 1V7WA 3RJ3A 3M77A 4L0GA 3Q7AB 3KQ4A 3C72B 3M78A 4D4CA 3P2CA 1O6QA 3HXBB 3CU7A 5AGDA 1QSJA 2RI9A 5MEHA 2FV0A 1KWFA 3OXUA 3EQAA 3S4CA 4BOKA 5GW7A 4D4AA 1FCEA 5M7IA 1JS4A 1AGMA 2PMVA 3CIHA 1F9DA 2CQSA 2FBAA 3G6JB 1X9DA 1KZOB 2EACA 5FO9B 1H37A 4JJJA 4EL8A 2RGKA 3ON6A 3M76A 1TNUB 3DSVB 1GSZA 1XWQA 4XUVA 3DSTB 2V3NA 4Q88A 3Q79B 3ANIA 3Q75B 1KZPB 2SQCA 1H3CA 1H13A 3M75A 3HXEB 2BB5A 2YIKA 2V8JA 3T33A 5M7YA 3E73A 1KKTA 4FXKB 2H6FB 2BB6A 1GLMA 4ZRQA 4TXTA 1H35A 1V5CA 3QDEA 4KTRA 4MU9A 2WIIB 1SA4B 1O5MB 1N4SB 2F0YB 4M76A 1DCEB 3EU8A 1RQ5A 3P5RA 2XFGA 2R2LB 1TF4A 4WU0A 4KTPA 2FV1A 5GY3A 1SQCA 3QFZA 1H12A 5DGRA 3H2WA 3ACSA 1NXCA 3RX8A 1FO3A 2VN4A 3M74A 3PZ3B 3S9VA 3KLSA 2RI8A 5KKBA 2DRSA 2WINB 3E37B 1QQFA 1TNZB 4WVCA 3D5RA 3DRAB 2Z07A 3W5NA 3HXFB 1QBQB 2ZZRA 1JCQB 4AYOA 1N4QB 1FAEA 1L2AA 4LIXA 3EZ8A 1G87A 3QSPA 4ONTA 3SDVA 2VN7A 1X81B 3M7BA 4GTMB 1IA7A 1HCUA 1MZCB 5FO8B 1TNBB 3SDRA 4AYPA 4ZRPA 2F6DA 2WY7A 5JPNB 3K11A 1CLCA 2AHGA 5DGQA 3WKGA 4Z4JA 4GTSB 4GTVB 4Z4LA 2XWBB 1LF9A 2ZBLA 2GZ6A 2AFAA 1KFGA 4GTOB 1GA2A 4LNBB 3RX5A 1GHQA 2DROA 1TN8B 3W7XA 1O1SB 1O6HA 1LD8B 3W7SA 1TNYB 4GL3A 1H39A 1FBOA 1W6JA 1TNOB 4QT9A 1S64B 4EHMB 1R76A 3KSQB 1O79A 3W7WA 1N4PB 3DSWB 1IS9A 3PZ2B 3E30B 3WIRA 1H54A 3DPYB 3GZKA 1N9AB 4KKJA 3ANKA 3E34B 3DSSB 2D5JA 2G02A 3KSLB 3WIWA 4AYRA 3Q78B 3D3IA 2ZISB 1IA6A 1DOGA 1LD7B 1JCRB 1KSCA 4FXGB 2IEJB 2JF4A 3HXCB 1V7XA 4TF4A 1G9GA 1TN6B 3PZ4B 4GTRB 3SDQA 2WYNA 3E32B 1KREA 3PYAA 3H7LA 4KKIA 3QT9A 2A8ZA 4GTQB 1LF6A 3W7UA 3M7CA 3DSXB 1F9OA 4GTPB 3W5MA 3SAEA 1W6KA 3SFXB 3AFJA 3RSYA 3WIQA 3WKHA 1NL4B 4GTTB 4LNVA 4D94A 3EUVB 2EABA 3D5SA 3P5PA 4CJ0A 1K72A 2H6GB 3RX7A 3W7TA 1WU6A 3E33B 3OEDA 3M7EA 1CEMA 1H14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYX A;  3QXQ A;  1WU5 A;  4Z4L A;  4AYQ A;  1LF9 A;  2ZBL A;  1H13 A;  2JJB A;  1XWT A;  2GZ6 A;  4WVA A;  2AFA A;  5CA3 A;  1KFG A;  1V7V A;  2EAD A;  1GA2 A;  2YIK A;  1G6I A;  3S4D A;  3RX5 A;  4CJ1 A;  2DRO A;  3WC3 A;  3T33 A;  5M7Y A;  1FMI A;  1FO2 A;  1KSD A;  3E73 A;  3W7X A;  1KKT A;  5E2J A;  5CD2 A;  3E6U A;  3W7S A;  4FUS A;  3WUX A;  4WVB A;  4CE7 A;  1GAH A;  1FBO A;  2GH4 A;  1GLM A;  4TXT A;  4L6X A;  3QG0 A;  1KS8 A;  1V5C A;  1WU4 A;  3QDE A;  4KTR A;  3VW5 A;  4DOE A;  3ACT A;  3W7W A;  1L1Y A;  3QRY A;  4Q2B A;  1IS9 A;  2QNO A;  3TF4 A;  3PMM A;  1VD5 A;  3WIR A;  2EAE A;  1RQ5 A;  1H54 A;  3GZK A;  1ULV A;  2XFG A;  4WU0 A;  1TF4 A;  3ANK A;  1NC5 A;  2D5J A;  4KTP A;  3WIW A;  4AYR A;  2D8L A;  3D3I A;  3GLY A;  3WKF A;  2FV1 A;  3ANJ A;  2OKX A;  5GY3 A;  2DRQ A;  1IA6 A;  1DOG A;  1KSC A;  1H12 A;  3QFZ A;  2B4F A;  2DRR A;  2FUZ A;  1DL2 A;  2JF4 A;  3H3K A;  5DGR A;  3H2W A;  3ACS A;  1V7X A;  3QWT A;  1V7W A;  1NXC A;  1XW2 A;  4TF4 A;  1G9G A;  3RX8 A;  1FO3 A;  2CQT A;  4L0G A;  2VN4 A;  2WYN A;  1G9J A;  3P2C A;  1KRE A;  2RI8 A;  3RRS A;  3GT5 A;  3H7L A;  5KKB A;  2DRS A;  2AHF A;  3QT9 A;  2A8Z A;  3QT3 A;  1LF6 A;  3W7U A;  3VXD A;  2RI9 A;  5MEH A;  2FV0 A;  4WVC A;  1KWF A;  3REN A;  3EQA A;  3QXF A;  3S4C A;  2Z07 A;  3W5N A;  5GW7 A;  3S4A A;  4ZG8 A;  1F9O A;  1UG9 A;  2ZZR A;  4AYO A;  5CZL A;  1GAI A;  1FCE A;  5M7I A;  1JS4 A;  1FAE A;  3W5M A;  2JG0 A;  1L2A A;  1AGM A;  4ZH5 A;  1FP3 A;  3AFJ A;  3CIH A;  1KRF A;  3ANI A;  3X17 A;  1WZZ A;  1F9D A;  1UT9 A;  2CQS A;  3EZ8 A;  3RSY A;  3WIQ A;  4J5T A;  1G87 A;  2FBA A;  3QSP A;  3WKH A;  1X9D A;  2EAC A;  1FBW A;  2VN7 A;  3QPF A;  2EAB A;  4JJJ A;  1IA7 A;  1V5D A;  4EL8 A;  1HCU A;  4DOD A;  2NVP A;  2RGK A;  3ON6 A;  1K72 A;  4CJ0 A;  2P0V A;  4AYP A;  3RX7 A;  1XWQ A;  2F6D A;  3WKI A;  4XUV A;  3S4B A;  3K11 A;  3QFY A;  1CLC A;  2AHG A;  5DGQ A;  3WKG A;  3A3V A;  1WU6 A;  4Z4J A;  4Q88 A;  3W7T A;  1CEM A;  1H14 A; 
#chains in the Genus database with same CATH topology
 3QXQ A;  2XQW A;  2BRW A;  2ONG A;  4V1R A;  2Q1F A;  3G4D A;  1O1R B;  2BED B;  2JJB A;  3VSN A;  3DSU B;  1V7V A;  1G6I A;  3S4D A;  5JPM B;  3WC3 A;  3M7L A;  3SDU A;  1W3Y A;  1FMI A;  2G0D A;  3EU5 B;  3LZ9 A;  3E6U A;  1TN7 B;  4FUS A;  4CE7 A;  3SFY B;  4OZV A;  5ILY A;  1GXO A;  4L6X A;  3QG0 A;  4YCR A;  1JCS B;  1OJN A;  3VW5 A;  1N95 B;  3ACT A;  2XWJ B;  4D4D A;  2NOJ A;  2QNO A;  5IL3 A;  3TF4 A;  1VD5 A;  1O6R A;  1F1S A;  2H6I B;  1ULV A;  2H6H B;  1NC5 A;  3A0O A;  1H3B A;  2D8L A;  1SA5 B;  1HMU A;  3GLY A;  2B39 A;  3ANJ A;  3M00 A;  3WKF A;  2OKX A;  4YDO B;  2DRQ A;  2PN5 A;  3Q7F B;  2DRR A;  1UMP A;  1D8E B;  3PZ1 B;  2I07 B;  1HX9 A;  2J5C A;  3QWT A;  1XW2 A;  1FPP B;  2CQT A;  3Q73 B;  1N7P A;  1G9J A;  4BOJ A;  3SDT A;  3RRS A;  3GT5 A;  2AHF A;  5DHI A;  3QT3 A;  1J0N A;  3E7J A;  5FOB B;  5ILD A;  3VXD A;  1FT2 B;  3REN A;  1C82 A;  3QXF A;  1OJO A;  3S4A A;  4ZG8 A;  1UG9 A;  5CZL A;  4F10 A;  1GAI A;  1GXN A;  2JG0 A;  1HN0 A;  4ZH5 A;  1FP3 A;  1N7R A;  3HXD B;  1KRF A;  5EAT A;  3SQC A;  3X17 A;  1WZZ A;  1H3A A;  1UT9 A;  2GOX A;  4J5T A;  4D4B A;  3M73 A;  1FBW A;  1HXA A;  1RWA A;  1N22 A;  3QPF A;  1FT1 B;  1V5D A;  2A73 B;  1D8D B;  2FUT A;  4GAX A;  2NVP A;  4DOD A;  1N94 B;  2P0V A;  4LNG B;  3WKI A;  3S4B A;  3QFY A;  4YDE B;  3A3V A;  5ILJ A;  4MBG B;  2WCO A;  1AYX A;  5EAU A;  1WU5 A;  2V8K A;  1N4R B;  5FO7 B;  4AYQ A;  4ZH1 A;  5ILK A;  1XWT A;  3G4F A;  4WVA A;  5CA3 A;  2EAD A;  1H36 A;  2BBC A;  4CJ1 A;  1FO2 A;  1KSD A;  1O1T B;  3M71 A;  5E2J A;  5CD2 A;  5JMF A;  3WUX A;  4WVB A;  1GAH A;  1GXM A;  2GH4 A;  4C1S A;  1KS8 A;  1HZF A;  1WU4 A;  3PYB A;  1S63 B;  2ZIR B;  4DOE A;  3AFL A;  4L9P B;  1OJM A;  1L1Y A;  3QRY A;  4Q2B A;  5IM1 A;  3PMM A;  5C05 A;  1RWC A;  2EAE A;  2V8I A;  1C3D A;  3M01 A;  1LTX B;  3M72 A;  2WY8 A;  2WDA A;  4V1S A;  1NI1 B;  1F9G A;  5IK0 A;  1EGU A;  3K7X A;  2B4F A;  5GZK A;  2FUZ A;  1DL2 A;  3H3K A;  4NEI A;  2V3P A;  1V7W A;  3RJ3 A;  3M77 A;  4L0G A;  3Q7A B;  3KQ4 A;  3C72 B;  4F13 A;  3M78 A;  4MMH A;  4D4C A;  3P2C A;  1O6Q A;  3HXB B;  5IKH A;  3CU7 A;  5AGD A;  1I8Q A;  1HM2 A;  1QSJ A;  2RI9 A;  5MEH A;  2FV0 A;  1KWF A;  3OXU A;  4FJQ A;  3EQA A;  3S4C A;  4BOK A;  5GW7 A;  3NFV A;  4D4A A;  1FCE A;  5M7I A;  1JS4 A;  1AGM A;  2PMV A;  3CIH A;  1F9D A;  2CQS A;  1N1Z A;  2FBA A;  3G6J B;  1X9D A;  1KZO B;  1RWH A;  2EAC A;  5JMD A;  5FO9 B;  1H37 A;  4JJJ A;  4EL8 A;  2FUQ A;  2RGK A;  3ON6 A;  3M76 A;  1TNU B;  3DSV B;  1GSZ A;  1XWQ A;  4XUV A;  5IL8 A;  3DST B;  2V3N A;  4Q88 A;  3Q79 B;  3ANI A;  3Q75 B;  1KZP B;  2SQC A;  1H3C A;  1H13 A;  3M75 A;  1HM3 A;  3HXE B;  2BB5 A;  2YIK A;  2V8J A;  3T33 A;  5M7Y A;  3E73 A;  1KKT A;  4FXK B;  2H6F B;  5DHK A;  2BB6 A;  1GLM A;  4ZRQ A;  4TXT A;  1H35 A;  1N21 A;  1RWG A;  1V5C A;  3QDE A;  4KTR A;  4MU9 A;  2WII B;  1SA4 B;  1O5M B;  4DI5 A;  1N7Q A;  1RWF A;  1N4S B;  2F0Y B;  4M76 A;  1DCE B;  3EU8 A;  1RQ5 A;  3P5R A;  1N7O A;  2XFG A;  2R2L B;  1TF4 A;  4WU0 A;  5IKA A;  4KTP A;  1N23 A;  2FV1 A;  5GY3 A;  1SQC A;  3QFZ A;  1H12 A;  1QAZ A;  5DGR A;  3H2W A;  3ACS A;  5IK6 A;  1NXC A;  2X03 A;  3RX8 A;  5ILI A;  1FO3 A;  2VN4 A;  3M74 A;  1J0M A;  1N24 A;  3PZ3 B;  3KLS A;  3S9V A;  2RI8 A;  5KKB A;  2DRS A;  2WIN B;  3E37 B;  2ONH A;  1QQF A;  1TNZ B;  4WVC A;  3D5R A;  3DRA B;  2Z07 A;  3W5N A;  3HXF B;  1QBQ B;  2ZZR A;  1JCQ B;  4AYO A;  1N4Q B;  1FAE A;  1OJP A;  1L2A A;  4LIX A;  3N0G A;  3EZ8 A;  1G87 A;  4OZW A;  3QSP A;  4ONT A;  3SDV A;  4RNQ A;  2VN7 A;  1X81 B;  3M7B A;  4GTM B;  5IK9 A;  1IA7 A;  1HCU A;  1MZC B;  5FO8 B;  1TNB B;  3SDR A;  1LXM A;  4AYP A;  4ZRP A;  2F6D A;  2WY7 A;  5JPN B;  3K11 A;  1CLC A;  2AHG A;  5DGQ A;  3WKG A;  4Z4J A;  4GTS B;  4GTV B;  4Z4L A;  2XWB B;  1LF9 A;  2ZBL A;  3N0F A;  1LOH A;  2GZ6 A;  2AFA A;  1KFG A;  4GTO B;  4MMI A;  1GA2 A;  4LNB B;  1N7N A;  3RX5 A;  2E22 A;  1GHQ A;  2DRO A;  1X1H A;  1RW9 A;  1TN8 B;  1X1J A;  4OK2 A;  1O1S B;  3W7X A;  1O6H A;  1LXK A;  1LD8 B;  3W7S A;  2BRP A;  1TNY B;  4GL3 A;  1H39 A;  3VSM A;  1FBO A;  1W6J A;  1TNO B;  4QT9 A;  1S64 B;  4EHM B;  1R76 A;  3KSQ B;  1O79 A;  3W7W A;  1N4P B;  3DSW B;  1IS9 A;  3PZ2 B;  3E30 B;  3WIR A;  5ILZ A;  2E24 A;  1H54 A;  3DPY B;  3GZK A;  1N9A B;  4KKJ A;  3ANK A;  3E34 B;  3NNB A;  3DSS B;  2D5J A;  2G02 A;  3KSL B;  3WIW A;  4AYR A;  3Q78 B;  3D3I A;  2ZIS B;  1IA6 A;  5EAS A;  1DOG A;  1LD7 B;  1JCR B;  1KSC A;  4FXG B;  1HXG A;  2IEJ B;  5ILH A;  2JF4 A;  3HXC B;  1V7X A;  4TF4 A;  1G9G A;  1TN6 B;  4E1Y A;  3PZ4 B;  4GTR B;  3SDQ A;  2WYN A;  1HV6 A;  3E32 B;  1X1I A;  1KRE A;  3PYA A;  3H7L A;  4KKI A;  1CB8 A;  3QT9 A;  2A8Z A;  4GTQ B;  1LF6 A;  3W7U A;  3M7C A;  3E80 A;  3M02 A;  1HXC A;  3DSX B;  1F9O A;  4GTP B;  4FNV A;  3W5M A;  3SAE A;  1N1B A;  1W6K A;  3SFX B;  3AFJ A;  2BRV X;  3RSY A;  3WIQ A;  3WKH A;  1NL4 B;  4GTT B;  4LNV A;  4OJZ A;  4OK4 A;  4D94 A;  1HMW A;  3EUV B;  2EAB A;  3D5S A;  3P5P A;  4CJ0 A;  1K72 A;  1N20 A;  2H6G B;  3RX7 A;  3W7T A;  1WU6 A;  3E33 B;  3OED A;  3M7E A;  1CEM A;  1H14 A; 
#chains in the Genus database with same CATH homology
 3QXQ A;  2XQW A;  4V1R A;  1O1R B;  2BED B;  2JJB A;  3DSU B;  1V7V A;  1G6I A;  3S4D A;  5JPM B;  3WC3 A;  3M7L A;  3SDU A;  1FMI A;  2G0D A;  3EU5 B;  3E6U A;  1TN7 B;  4FUS A;  4CE7 A;  3SFY B;  1GXO A;  4L6X A;  3QG0 A;  4YCR A;  1JCS B;  3VW5 A;  1N95 B;  3ACT A;  2XWJ B;  4D4D A;  2NOJ A;  2QNO A;  3TF4 A;  1VD5 A;  1O6R A;  2H6I B;  1ULV A;  2H6H B;  1NC5 A;  1H3B A;  2D8L A;  1SA5 B;  3GLY A;  2B39 A;  3ANJ A;  3WKF A;  2OKX A;  4YDO B;  2DRQ A;  2PN5 A;  3Q7F B;  2DRR A;  1UMP A;  1D8E B;  3PZ1 B;  2I07 B;  3QWT A;  1XW2 A;  1FPP B;  2CQT A;  3Q73 B;  1G9J A;  4BOJ A;  3SDT A;  3RRS A;  3GT5 A;  2AHF A;  3QT3 A;  5FOB B;  3VXD A;  1FT2 B;  3REN A;  3QXF A;  3S4A A;  4ZG8 A;  1UG9 A;  5CZL A;  1GAI A;  1GXN A;  2JG0 A;  4ZH5 A;  1FP3 A;  3HXD B;  1KRF A;  3SQC A;  3X17 A;  1WZZ A;  1H3A A;  1UT9 A;  2GOX A;  4J5T A;  4D4B A;  3M73 A;  1FBW A;  3QPF A;  1FT1 B;  1V5D A;  2A73 B;  1D8D B;  2NVP A;  4DOD A;  1N94 B;  2P0V A;  4LNG B;  3WKI A;  3S4B A;  3QFY A;  4YDE B;  3A3V A;  4MBG B;  1AYX A;  1WU5 A;  2V8K A;  1N4R B;  5FO7 B;  4AYQ A;  4ZH1 A;  1XWT A;  4WVA A;  5CA3 A;  2EAD A;  1H36 A;  2BBC A;  4CJ1 A;  1FO2 A;  1KSD A;  1O1T B;  3M71 A;  5E2J A;  5CD2 A;  3WUX A;  4WVB A;  1GAH A;  1GXM A;  2GH4 A;  4C1S A;  1KS8 A;  1HZF A;  1WU4 A;  3PYB A;  1S63 B;  2ZIR B;  4DOE A;  4L9P B;  1L1Y A;  3QRY A;  4Q2B A;  3PMM A;  2EAE A;  2V8I A;  1C3D A;  1LTX B;  3M72 A;  2WY8 A;  4V1S A;  1NI1 B;  3K7X A;  2B4F A;  5GZK A;  2FUZ A;  1DL2 A;  3H3K A;  2V3P A;  1V7W A;  3RJ3 A;  3M77 A;  4L0G A;  3Q7A B;  3KQ4 A;  3C72 B;  3M78 A;  4D4C A;  3P2C A;  1O6Q A;  3HXB B;  3CU7 A;  5AGD A;  1QSJ A;  2RI9 A;  5MEH A;  2FV0 A;  1KWF A;  3OXU A;  3EQA A;  3S4C A;  4BOK A;  5GW7 A;  4D4A A;  1FCE A;  5M7I A;  1JS4 A;  1AGM A;  2PMV A;  3CIH A;  1F9D A;  2CQS A;  2FBA A;  3G6J B;  1X9D A;  1KZO B;  2EAC A;  5FO9 B;  1H37 A;  4JJJ A;  4EL8 A;  2RGK A;  3ON6 A;  3M76 A;  1TNU B;  3DSV B;  1GSZ A;  1XWQ A;  4XUV A;  3DST B;  2V3N A;  4Q88 A;  3Q79 B;  3ANI A;  3Q75 B;  1KZP B;  2SQC A;  1H3C A;  1H13 A;  3M75 A;  3HXE B;  2BB5 A;  2YIK A;  2V8J A;  3T33 A;  5M7Y A;  3E73 A;  1KKT A;  4FXK B;  2H6F B;  2BB6 A;  1GLM A;  4ZRQ A;  4TXT A;  1H35 A;  1V5C A;  3QDE A;  4KTR A;  4MU9 A;  2WII B;  1SA4 B;  1O5M B;  1N4S B;  2F0Y B;  4M76 A;  1DCE B;  3EU8 A;  1RQ5 A;  3P5R A;  2XFG A;  2R2L B;  1TF4 A;  4WU0 A;  4KTP A;  2FV1 A;  5GY3 A;  1SQC A;  3QFZ A;  1H12 A;  5DGR A;  3H2W A;  3ACS A;  1NXC A;  3RX8 A;  1FO3 A;  2VN4 A;  3M74 A;  3PZ3 B;  3S9V A;  3KLS A;  2RI8 A;  5KKB A;  2DRS A;  2WIN B;  3E37 B;  1QQF A;  1TNZ B;  4WVC A;  3D5R A;  3DRA B;  2Z07 A;  3W5N A;  3HXF B;  1QBQ B;  2ZZR A;  1JCQ B;  4AYO A;  1N4Q B;  1FAE A;  1L2A A;  4LIX A;  3EZ8 A;  1G87 A;  3QSP A;  4ONT A;  3SDV A;  2VN7 A;  1X81 B;  3M7B A;  4GTM B;  1IA7 A;  1HCU A;  1MZC B;  5FO8 B;  1TNB B;  3SDR A;  4AYP A;  4ZRP A;  2F6D A;  2WY7 A;  5JPN B;  3K11 A;  1CLC A;  2AHG A;  5DGQ A;  3WKG A;  4Z4J A;  4GTS B;  4GTV B;  4Z4L A;  2XWB B;  1LF9 A;  2ZBL A;  2GZ6 A;  2AFA A;  1KFG A;  4GTO B;  1GA2 A;  4LNB B;  3RX5 A;  1GHQ A;  2DRO A;  1TN8 B;  3W7X A;  1O1S B;  1O6H A;  1LD8 B;  3W7S A;  1TNY B;  4GL3 A;  1H39 A;  1FBO A;  1W6J A;  1TNO B;  4QT9 A;  1S64 B;  4EHM B;  1R76 A;  3KSQ B;  1O79 A;  3W7W A;  1N4P B;  3DSW B;  1IS9 A;  3PZ2 B;  3E30 B;  3WIR A;  1H54 A;  3DPY B;  3GZK A;  1N9A B;  4KKJ A;  3ANK A;  3E34 B;  3DSS B;  2D5J A;  2G02 A;  3KSL B;  3WIW A;  4AYR A;  3Q78 B;  3D3I A;  2ZIS B;  1IA6 A;  1DOG A;  1LD7 B;  1JCR B;  1KSC A;  4FXG B;  2IEJ B;  2JF4 A;  3HXC B;  1V7X A;  4TF4 A;  1G9G A;  1TN6 B;  3PZ4 B;  4GTR B;  3SDQ A;  2WYN A;  3E32 B;  1KRE A;  3PYA A;  3H7L A;  4KKI A;  3QT9 A;  2A8Z A;  4GTQ B;  1LF6 A;  3W7U A;  3M7C A;  3DSX B;  1F9O A;  4GTP B;  3W5M A;  3SAE A;  1W6K A;  3SFX B;  3AFJ A;  3RSY A;  3WIQ A;  3WKH A;  1NL4 B;  4GTT B;  4LNV A;  4D94 A;  3EUV B;  2EAB A;  3D5S A;  3P5P A;  4CJ0 A;  1K72 A;  2H6G B;  3RX7 A;  3W7T A;  1WU6 A;  3E33 B;  3OED A;  3M7E A;  1CEM A;  1H14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...