4CEAA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
154
structure length
150
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 57
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ceaA00
1RTDA 1J54A 1RT5A 3QEVA 1IG9A 3ZSYA 3K58A 3PX6A 3KLEA 4CK2A 2YNGA 4W5TA 1YTAA 3ISNC 1RTHA 1NK4A 1NJYA 3RTVA 5J2MA 3LDSA 4CHPA 1BIUA 2ATQA 1WSHA 4OPJA 3O3FA 1NK6A 4CJPA 4J2BA 2PYLA 3QETA 3NF9A 4CJ3A 3MECA 3V9WA 3OYBA 2VG7A 4ICLA 3VQBA 4DSEA 4DTJA 4ELUA 2QKBA 1CXUA 1XHXA 1Z25A 1TKXA 1RDBA 4AILC 4B3OA 4HUFA 1JLBA 1WSEA 2WOMA 1W0HA 1WN7A 4AHUA 3BGRA 3AVNA 5J1EA 4DLEA 2JGUA 3L2RA 1X9SA 1SL0A 1LW2A 4DFKA 2KQ2A 1IKVA 2HHVA 1VK0A 2KW4A 3HM9A 3KK1A 4CF8A 3OYAA 2KZZA 1S1UA 3BDPA 3OYNA 2HW3A 1EETA 4QCLA 4KO0A 5KTQA 3AVFA 4Y1DA 2YKNA 1RT1A 3RMDA 5I3UA 2F8SA 3CM5A 4Z0UA 4CECA 4FXDA 3E01A 4BACA 4HUGA 5FDLA 4M41A 3OJSA 4M3RA 4DSFA 2XY7A 4KHQA 4KHNA 2DY4A 3NF8A 1VSIA 5DMRA 3SJJA 2FBYA 4CESA 4BDYA 4CJFA 1QSLA 1A5XA 3L3VA 2Y1IA 4AHTA 4F2RA 3DOKA 1TK8A 1YVUA 2RN2A 3K2PA 3QEWA 3VN5A 4KI4A 1LWCA 4CEOA 3QIPA 3EYZA 3SZ2A 4GW6A 4CEDA 3AVAA 3A2FA 1NKEA 1QHTA 2RKIA 3TI0A 1KFDA 1CXQA 1RT6A 4OPKA 2ZD1A 1LV5A 1C1BA 5T7BA 5HBMA 3MAQA 1ASUA 1EKEA 3KLGA 4FK4A 2I5JA 4CJWA 3D0PA 1KVCA 1WAJA 3LPTA 2A1RA 4PUOA 1C0MA 2XRIA 3MEEA 3F9KA 1TAUA 3LZJA 4FJLA 1RT7A 2D0AA 1T05A 4NYNA 2HVIA 3KK2A 2Q3SA 3S3MA 1B92A 2IAJA 3OYFA 4DTNA 3ZT2A 3TAPA 3HO1A 4LSLA 4OVLA 4HCBA 3LWMA 2DFHA 4KHWA 2P1JA 4CF0A 3F73A 4OLBA 4CJ5A 3HYFA 4JS4A 4CEBA 1KFSA 4RW8A 4ID5A 2G8KA 3DM2A 3ZSZA 3K5MA 4DTPA 3RR7A 2YNIA 2JLEA 3SUNA 3IG1A 4DSJA 2B6AA 1UA1A 1RBTA 3ZSXA 3NDKA 3CM6A 4CGGA 4FLYA 4N5SA 4QAGA 3K5NA 1C6VA 2AJQA 1JL1A 3LWLA 3V1QA 2QXFA 3SQ4A 4CHQA 3LP3A 1JXEA 2A1SA 1SKRA 4CGDA 4KV8A 3DLHA 3T1AA 5SZTA 4GMJB 3WNHA 3V9XA 3TAEA 1N6QA 2QKKA 3M8PA 4FM1A 5SWMA 5HLFA 4Q0BA 2O4IA 2O4GA 4KTZA 1NKBA 4DFMA 4LH4A 1BGXT 3I8DA 3ALYA 4FJIA 3NBPA 1IH7A 1HPZA 3AA4A 1BI4A 2RPIA 4C8KA 1Q9XA 4EZ6A 1RNHA 4C8NA 4HCCA 4Z4GA 3JSMA 1NK9A 5K14A 3O4QA 1FK9A 5EU7A 3ZSWA 3NE6A 1S1WA 1ZBUA 2Z1JA 4IKFA 4PWDA 3QEIA 1D9DA 3NGZA 1JLGA 3I0SA 3DRSA 4E0DA 3ASMA 3VA3A 4E19A 4DTUA 5CY4A 4DQIA 1HYSA 1XI1A 4DQPA 4CJEA 1BCMA 4H4OA 1QSSA 3LP2A 3PV8A 3RWUA 1FKPA 4DTSA 4Z4FA 4OGCA 1TKDA 1HNIA 1RT2A 4C8LA 3AVCA 3ITHA 2G8WA 4Z4HA 3OYDA 3TAFA 2KZMA 1VSMA 1S1XA 1T8EA 3KJVA 1B9DA 5HRPA 1IKYA 3AVJA 1XWLA 2PYJA 3AA3A 4M3XA 1RDAA 3QINA 2F96A 3K5OA 4IFYA 3AO3A 4CEZA 4HTUA 4XIUA 3NCIA 4CJLA 3LANA 3O3HA 4R5PA 4FM2A 3QNNA 3HK2A 3O3GA 4CHYA 3KK3A 1U4BA 4N76A 3O4NA 2BGGA 4FJ9A 4M3WA 4M42A 4CJTA 2HB5A 3HL8A 3HT3A 3OY9A 1KSPA 3KLHA 4CGHA 1J53A 4DU1A 3ZSQA 3THVA 3ZT4A 4LD0A 1VSEA 4FW1A 3KKSA 1R0AA 4AHVA 4ELTA 4B9TA 2VG5A 3P83D 3AV9A 3DLEA 4DTMA 4M3UA 1SUQA 2WONA 1I39A 1TL3A 4IFVA 5KI6A 4DQSA 3HSTB 1XC9A 3DLBA 2E6LA 2G8VA 4CK1A 3OYIA 1RT3A 3V81A 2B4JA 4CFAA 2OZMA 3I0RA 4RW6A 1RBVA 2GUIA 2YNFA 3P1GA 4RW4A 3SQ2A 4KB0A 4FJJA 4FK2A 4PQUA 2KFNA 4FM0A 2OPQA 4OGEA 4CIFA 4ZTJA 1BQNA 2NUBA 3S9HA 3LZIA 3VQ9A 1IO2A 3NGYA 4O0JA 3IS9A 4CE9A 4B9NA 4DF4A 5CZ2A 2BE2A 3NGIA 1VSDA 3DRRA 3SPZA 1J5OA 3OYGA 1BL3A 2W42A 4N41A 1RTIA 3KD1E 2XO7A 3AO5A 3L2VA 1D5AA 2P5GA 5DK5A 1LWFA 3HJFA 4QOZB 3KLFA 4C8OA 4F3OA 1D8YA 4OKKA 4Y1CA 3H08A 4BE2A 3AVMA 4FJMA 4CHNA 1U48A 2G8IA 3NF6A 4ID1A 4DF8A 3AO1A 4E7JA 2LSNA 2YNHA 3VQ7A 1NK5A 1NKCA 3VA0A 3AA2A 1RBSA 3QERA 2EHGA 1JLAA 1RTJA 3SPYA 3LAMA 4B9UA 1VSFA 3PUFA 2R7YA 4MQ3A 4DU4A 1JXBA 4LH5A 2G8HA 4M3TA 2DFEA 4F3TA 2ZQBA 4CEQA 5CYQA 4Q5VA 4NCAA 3TAGA 4FLZA 4PY5A 1TL1A 1S5JA 5KGXA 3TAQA 4CGIA 4AHSA 3AVLA 4B9MA 4DTOA 4O0IA 4KB1A 5HRNA 3QNOA 3K5LA 5KGWA 4JS5A 3MXIA 2KFZA 1JLQA 4RW7A 2OPPA 1S9GA 4W5RA 3D45A 4CEAA 4I7FA 2IOCA 3FFIA 1NOYA 3SCXA 4CERA 1WSGA 4E1NA 3AO2A 2ETJA 4AH9A 4CEEA 3DLRA 1C1AA 1G15A 1A5VA 3ZT1A 4FK0A 3ZSOA 3OVNA 2P51A 3ZCMA 3UIQA 1T03A 2YHAA 3M8SA 4E7LA 1TK0A 4O4GA 3NH1A 3SQ1A 3V1OA 3K59A 3QEXA 3G0ZA 4CHZA 4KHSA 1HQUA 1KRPA 2HHTA 1FKOA 2IDOA 1W9HA 3P5JA 3TAMA 2OYQA 2HNDA 3ZSRA 5HRSA 4DTRA 5CYMA 1RT4A 4E89A 3V9UA 4N56A 4JRPA 4CGFA 1Q8IA 3LP0A 1SL1A 2GV9A 2X6NA 4M3ZA 3TANA 1BHLA 1ASVA 3DYAA 5HROA 4DS5A 2HNZA 4CGJA 4CFDA 4F4KA 3CFRA 2X78A 1HJRA 2FC0A 1DLOA 4IG3A 3SV4A 4L8RB 4KTQA 3LP1A 4IBNA 4G1QA 1L3UA 1ZBHA 4EP4A 2G8FA 1ASWA 1L5UA 2PZSA 4E7HA 4O5BA 1BIZA 4RW9A 4J2EA 1L3TA 3QLHA 4DS4A 4LY7A 1TVRA 3OJUA 3OYEA 3EY1A 4TSXA 1LAWA 3AVKA 3C94A 3VQ5A 2Z1GA 3S3OA 4FZZA 2KTQA 4CFBA 4F2SA 2Y1JA 4Z4EA 3HVTA 2HMIA 1U04A 4KFBA 4I2QA 2PY5A 1JLEA 1BISA 1J9AA 3SQ0A 4CFCA 1EX4A 4FJXA 3B6PA 3OYLA 3OYJA 2Z1HA 3CFPA 3PX0A 2Z1IA 5E41A 2BANA 4IDKA 1ZYQA 4DSIA 3KLIA 3CFOA 3L2WA 2HHWA 3MXMA 1S6PA 3VQPA 4K8XA 4H8KA 1I3AA 1D9FA 1C0TA 3OYHA 4FZXC 3B6OA 4B9SA 4FLXA 3T3FA 3DLGA 1LW0A 1K6YA 1KVAA 2FBVA 3AVGA 4HUEA 3TWHA 4BDZA 1TK5A 4ELVA 3CQ8A 2G8UA 4B9VA 1QQCA 5CZ1A 4J2AA 1FXXA 4FVMA 3MXJA 4O44A 2XY5A 1X9MA 1BQMA 3RMAA 4B08A 1RBUA 1NJXA 2FBXA 1VSKA 4E3SA 3RR8A 4FLWA 1JL2A 4EZ9A 3LAKA 3OS1A 4CCHA 5D3GA 4KAZA 4W5OA 3TABA 4JRQA 4AHCA 2ZE2A 4JLHA 1C0UA 4CJVA 1VRUA 4DMNA 4UQGA 1CLQA 5JS1A 4DU3A 1REVA 4I9LA 4C8MA 3KIOA 1CZ9A 1UWBA 1SKSA 1EXQA 1KLMA 1ZBFA 1EP4A 5KRTA 5HP1A 2OZSA 2HHXA 5FROA 4NCBA 4NYFA 5FRMA 3VQ4A 1VSHA 3IRXA 4DQQA 2OPSA 5J2NA 3QESA 2BDPA 4KPYA 1BI4B 3NH2A 4BDPA 4Z4CA 4CJKA 1YTUA 1LAVA 4M3YA 2OA8A 1HQEA 3CYMA 5C42A 4FJ5A 4I9QA 4K8ZA 1BCOA 4FJ8A 1RCHA 1T7PA 4I2PA 1KVBA 3RMBA 4DLGA 4KREA 3NFAA 2VWJA 1VRTA 1DTTA 3HPOA 3MEDA 2YV0X 4FJKA 3AVBA 4O55A 4KTWA 1JLFA 3HVRA 4DTXA 2HHSA 4YNQA 2FBTA 3L2QA 4CF9A 1C1CA 1HYVA 4EP5A 3SYZA 4W5NA 4CJUA 1GOAA 3QO9A 4CJQA 1S1TA 4N47A 4CIGA 4BE0A 2YHBA 3VQQA 4F8RA 2OPRA 3RMCA 3ZT0A 5FRNA 1ZBIA 3ZT3A 3DLKA 3HP6A 3V6DA 4BWJA 4ZTFA 3MEGA 1KTQA 2X74A 3KKRA 4OKJA 1X1PA 3K57A 3V9SA 2EX3A 5J2PA 1IKXA 3SNNA 4B9LA 2VG6A 4DG1A 4OJRA 4CK3A 1TAQA 3HP9A 3L2UA 4IG0A 4FJNA 1TGOA 1TKTA 2VWKA 4H4MA 1XHZA 1KCFA 1Q9YA 4WE1A 1QS4A 4CF1A 3RRHA 4FJGA 1B9FA 1GOBA 4CEFA 2X6SA 3OYCA 1ITGA 3U6FA 3PO4A 1HNVA 3OS0A 3DRPA 3L3UA 4FJHA 4FLVA 4KRFA 2D0CA 1NJZA 1QSYA 1RILA 4DSKA 1UAXA 3U3GA 3HXMA 4E1MA 4KKOA 4KHUA 1VSJA 3PY8A 4HVJA 5J2QA 5I42A 3PX4A 5HRRA 1S6QA 1HMVA 2D0BA 4MFBA 3TR8A 4B8AB 4CJRA 3NAEA 1DTQA 3NH0A 3OYMA 3QIOA 4CJ4A 2DTUA 1IKWA 4E7KA 3VQAA 1A5WA 4YFUA 1N5YA 1U49A 3T19A 2HVHA 1GOCA 4FCYA 1WSIA 3CG7A 1RDCA 4PA1A 4CF2A 1RDDA 3DOLA 3AO4A 2IC3A 1JKHA 1WLJA 3C6TA 2E4LA 1SV5A 4DQRA 3AVHA 4J2DA 1O1WA 3SI6A 3AVIA 3VQCA 4OLAA 4DFPA 3AA5X 3DMJA 5C24A 1TKZA 5JS2A 3VQEA 3TARA 4RG8A 3G10A 3VQ8A 2RF2A 3NF7A 4FJ7A 5KRSA 4FYDA 2HNYA 3QEPA 3V1RA 2HHUA 1Z26A 4Z4IA 1HRHA 2DFFA 4E7IA 4NCGA 1WNSA 3SUQA 3L8BA 1WSJA 1NK7A 4OKEA 1QTMA 3LPUA 3M8QA 1UA0A 3ZSVA 3KTQA 1MU2A 1S9EA 3SUOA 3RRGA 1JLCA 1YT3A 2P5OA 3WNGA 4DWIA 3VQDA 4DSLA 2IGIA 3U3YA 1Y97A 1X9WA 1NK0A 4LSNA 2XHBA 1VSLA 3NHGA 3IAYA 4BWMA 4GVMA 4M45A 3V4IA 2XY8A 3EZ5A 4AHRA 3S3NA 1U45A 4FLTA 3OS2A 2F8TA 2D5RA 1WSFA 4ZHRA 3V9ZA 2XY6A 2YKMA 4DFJA 1NJWA 4KHYA 1U47A 3HPHA 4FW2A 4W5QA 1L3SA 1HYZA 2QK9A 3ULDA 2ITGA 4B8CA 4HHTA 2E6MA 1QE1A 1KLNA 3LALA 3C6UA 1NOZA 3HPGA 2B5JA 3M8RA 1CZBA 2IS3A 1LWEA 3PO5A 4FZYA 4CHOA 3DI6A 4CIEA 1TV6A 4BE1A 4FLUA 4CJSA 3JYTA 3SV3A 1SL2A 1S1VA 3VQ6A 1SKWA 1L3VA 3WNFA 3KD5E 1WAFA 4KI6A 1UOCA 2HHQA 3C95A 1F21A 2GBZA 3SUPA 1RBRA 1ZBLA 5C25A 1NK8A 3OYKA 3WNEA
chains in the Genus database with same CATH superfamily
1JJ2M 4FPAA 1RT5A 2D0PA 4A61A 3K58A 4CK2A 1YTAA 4AM6A 1NK4A 1NJYA 5F2RA 3ZEUA 4CHPA 4OPJA 3MMVA 1WSHA 4EAHD 1YF5L 3NF9A 1GLDG 4DSEA 2VG7A 3JS6A 2QKBA 1Z25A 2NRXA 1JLBA 2WOMA 5B8HA 1W0HA 2GX9A 5C12A 5J1EA 4DV7K 3L2RA 1ILYA 3AY9A 1LW2A 4CZHA 4DFKA 2HHVA 2KW4A 5EOYA 2CGLA 4QCLA 4KO0A 2P9SB 3AVFA 4Y1DA 4DR2K 3CM5A 4Z0UA 3E01A 1NMNA 4BACA 3OJSA 2XY7A 2DY4A 3NF8A 2FBYA 2W40A 4CESA 4CJFA 2Y1IA 3PSIA 4J8FA 4A62A 5TKYA 3WQTA 3NVKA 2RN2A 1JCFA 3VN5A 4CEOA 3O4WA 1NKEA 3TI0A 1ZBSA 1BO5O 1CXQA 1P8ZA 1D4XA 1ESVA 1C1BA 1VQLN 1EKEA 2A1RA 4PL8A 1C0MA 2KLAA 1NGEA 4BR0A 4FJLA 5BPNA 1RFQA 3IFRA 2Q3SA 3S3MA 2IAJA 4DV6K 4LSLA 4OVLA 2P1JA 4IEIA 4CF0A 4OLBA 3HYFA 4BROA 3CQXA 3DM2A 1KAXA 4ISEA 1GLCG 3L0QA 5GAEP 4DSJA 2B6AA 1UA1A 3ZSXA 3VGKA 4K25A 3V1QA 3LWLA 2QXFA 1HNZK 1IJJA 1JXEA 2D1KA 3T1AA 5SZTA 3V9XA 1N6QA 4FM1A 4Q0BA 1OH7A 3PIOL 2QXLA 4LH4A 2UXCK 3GBTA 1IH7A 3AA4A 2RPIA 4JKGA 3O4QA 5AQHA 4IKFA 2ASMA 2F9TA 1D9DA 4IOAL 1J6ZA 1YXQA 4E0DA 2CGJA 1RDUA 2E88A 4CZIA 1BCMA 3PV8A 3SMSA 5M1NA 4DTSA 4Z4FA 4OGCA 2D0OA 3AVCA 2G8WA 4Z4HA 3TTDA 4FWNA 2P9KA 1B9DA 2F9WA 4JKCA 4U7BA 4H5VA 2NRWA 3DXMA 4EHUA 3ZX3A 1RDAA 3J80O 3K5OA 4IFYA 4XIUA 3HK2A 2GEMA 4ILHA 4CHYA 3O3GA 3KK3A 1HNWK 2BGGA 4CJTA 3HT3A 3OY9A 3AGRA 1KSPA 4IXCA 1J53A 4ISFA 4GVEA 4JD2A 3ZSQA 3THVA 4AF1A 4AHVA 2P9UB 3P83D 1U6ZA 3DLEA 5KI6A 4IFVA 4DQSA 3HSTB 3DLBA 1BWFO 5EXWA 4LF8K 5E26A 1RT3A 3O1BA 4RW6A 5AQLA 2GUIA 3P1GA 4RW4A 4FM0A 4OGEA 4ZTJA 4K42A 4EIAA 4B9NA 3THYA 3BZKA 2BE2A 1VSDA 5C2DA 4OPAA 4BC2A 2W42A 4IOXA 3AO5A 1Z6RA 3LDOA 3CXCM 3VTIA 4QOZB 4GV6A 3EO3A 3CJ9A 5CR4A 2UUAK 4ID1A 3F5TA 4R79A 1RBSA 2RE2A 4XH4A 5AQFA 1VSFA 3PUFA 4MQ3A 4DU4A 2G8HA 2DFEA 3TTCA 2P9KB 1GLLO 2OTJN 3UE5A 3OW2M 4CGIA 4IEEA 3AVLA 5EY4A 3QNOA 2DPNA 1JLQA 4CBWA 4PHTX 2OPPA 1SZ2A 4CEAA 4I7FA 4CERA 3AO2A 3ENHA 4CZKA 2YHWA 3UIQA 2CGKA 4E7LA 3LDNA 3NH1A 3K59A 3G25A 3G0ZA 2NRHA 3QB0A 2QWLA 1KRPA 2HHTA 3N4QA 2IDOA 3P5JA 3ZSRA 4DTRA 3O5BA 3CQYA 3ATVA 3M5RA 2A5XA 4E89A 3THWA 3FZLA 5KPRA 3P31A 1IV0A 3ENOA 2X6NA 4CZFA 2WC9A 4GNIA 3CFRA 2X78A 2FC0A 1DLOA 4IG3A 3BEXA 3LP1A 1L3UA 3T1YK 1ASWA 2PZSA 1X3MA 4J2EA 2WBNA 3KZBA 1L3TA 5BN8A 1K8KA 4FZZA 4CFBA 4PL7A 2Y1JA 3Q7BA 3C0BA 2F7TA 3B6PA 3CFPA 4JI4K 3PX0A 4DSIA 2I7NA 4O5FA 3HOSA 4KH4A 4BRCA 3FFKB 4C23A 1D9FA 3A8YA 1C0TA 4FZXC 4FWRA 4M63C 2FSNA 1K6YA 1KVAA 3TWHA 4BDZA 3CQ8A 3RSEA 4FVMA 2KHOA 4JI1K 4BRHA 3RMAA 4E3SA 4CCHA 4JRQA 3MN9A 1C0GA 4JN4A 4DMNA 5AQJA 4CZEA 4JKDA 1U2VA 4DCHA 4X64K 1UWBA 1ZBFA 1EP4A 5KRTA 4NCBA 5HL7L 4KPYA 1BI4B 2FSKA 4BDPA 3WXKA 2O8DB 1OVYA 5C42A 1NGDA 4FJ5A 3SBGA 4FJ8A 1T7PA 1KVBA 4DLGA 4OO1J 2YJFA 1K8KB 3JXUA 3HRGA 1JLFA 4DTXA 3T1HK 4YNQA 4YY3K 2UYTA 4CJQA 1GLJO 3QO9A 3FZMA 4N47A 2WTUA 4BE0A 1VQ8N 1KAZA 5FRNA 1ZBIA 5JICA 3ULEA 3DLKA 1E3MA 4BWJA 1K8AO 2X74A 1YITN 5J2PA 3K57A 2EX3A 4DG1A 4CK3A 1TAQA 2HF3A 5FLXO 4IG0A 4FJNA 4AM7A 1IG8A 1KCFA 1QS4A 3RVCA 5DM7L 1TYQA 3L3UA 3UB5A 3RSEB 4FJHA 5GIPA 1QSYA 2E2OA 1OH6A 2WUSA 1UAXA 4KKOA 3AGKA 5I42A 1XUPO 4CJRA 3NAEA 4NLBA 2UU9K 3QIOA 4E7KA 4YFUA 1N5YA 1U49A 1DT9A 2HVHA 2V52B 1GOCA 5AQOA 2P9PA 3CG7A 3CI5A 4PA1A 4CF2A 2GUPA 3DOLA 1HNXK 2NNWA 2EWSA 1SV5A 4DFPA 3AA5X 1TKZA 3VQEA 4RG8A 5KRSA 3IKMA 3CHWA 4Z4IA 1HRHA 3MCAB 4E7IA 4NCGA 1WNSA 1NK7A 4M3ZA 1WSJA 3M8QA 3EE8A 4JKBA 3RRGA 1JLCA 2P5OA 3MK6A 3WNGA 2IIRA 3A5LC 3L4IA 2XHBA 3IAYA 3VESA 2XY8A 3EZ5A 4AHRA 2D5RA 2YCHA 3VERA 2XY6A 1NJWA 3DJCA 4YOVA 1U47A 1C0FA 1HYZA 1WB9A 3IMXA 2ITGA 2ASPA 4B8CA 5GIOA 3SMPA 5F1XA 4CW7B 1LWEA 4CIEA 3J81O 1L3VA 3JYTA 1VQMN 3KD5E 3VEOA 3WNFA 2HHQA 3K0SA 3VPZA 4MLEA 4JK7A 1ZBLA 3OYKA 1RTDA 3ZLJA 3QEVA 3KLEA 1VQ9N 1RTHA 4JAXA 3O3FA 4CJPA 4DV2K 4CJ3A 3VQBA 4DTJA 4ELUA 3EZWA 1XHXA 4B3OA 4DQRA 1WN7A 4AHUA 3BGRA 3AVNA 3ZYYX 2BUPA 1N33K 2KQ2A 3QBWA 3HM9A 1S1UA 1N34K 1BUPA 2HW3A 1R59O 3MWTA 1N8RO 1JCEA 4BRGA 1W2BM 5I3UA 4WQ5C 2P9NA 4FXDA 3HI0A 5AQPA 1VSIA 4AHTA 2O8BB 4CJ7A 4DV1K 1TK8A 1YVUA 3K2PA 3P38A 3QEWA 1XMQK 3R9PA 1LWCA 3EYZA 5AQMA 3O8MA 4MLHA 3A2FA 1EO1A 2RKIA 2PBDA 1RT6A 4OPKA 1ASUA 4FK4A 1KVCA 1WAJA 3LPTA 4PUOA 2XRIA 1NGBA 3F9KA 4BRKA 1TAUA 2HF4A 2D0AA 1T05A 3QMLA 4GV3A 1Q7YO 2HVIA 1EQYA 3WQUA 3KK2A 2F4VK 4DV4K 4BRDA 3CJAA 3TAPA 5AR0A 5GINA 4MDBA 3LWMA 4WQ4A 4KHWA 3F73A 4CJ5A 1VQ7N 3RR7A 2O8CB 3IG1A 4HWIA 4M7YA 3NDKA 4CGGA 4N5SA 4QAGA 2V7ZA 1C6VA 1N32K 1SKRA 1M90O 4CGDA 3DLHA 4GMJB 3WNHA 3TAEA 4LF7K 3L6QA 2O4GA 4XH1A 1YAGA 2P9NB 3ALYA 3WT0A 3I8DA 3NBPA 4MDAA 1Q9XA 4C8NA 1S72N 4HCCA 1NK9A 3NE6A 2IVNA 1DEJA 3QEIA 2GELA 1JLGA 3I0SA 1RGIA 2E5LK 3ASMA 4E19A 4FWSA 3SAHA 5CY4A 4H4OA 1FKPA 2CH6A 2VGNA 2HHHK 4CZGA 3O9RA 3FE1A 4KH5A 1TKDA 3TAFA 1S1XA 1T8EA 5AFUH 5HRPA 4JKAA 1XWLA 4CZLA 4H0OA 3AA3A 2CH5A 2F96A 3TU5A 4M7XA 3NCIA 4DR3K 4K0KK 2QWPA 2NRZA 4M3WA 1CZAN 2A42A 2ZJPL 4BGAA 1HKBA 4B1YB 3P39A 2Q36A 4NO7A 4IO9L 4FW1A 3KKSA 4ELTA 2VG5A 4M3UA 1I39A 1TL3A 3N4PA 4BG9A 2G8VA 3OYIA 4B9QA 4K43A 2B4JA 4CBUA 5AZJA 2YNFA 4FK2A 2OPQA 3WUHA 2VQEK 3LZIA 1IO2A 3M6GA 4LF5K 5CZ2A 4JV5K 2QWRA 3OYGA 2A40A 2D4WA 4BREA 1HKGA 3TSQA 2P5GA 4X62K 3M3ZA 4DR7K 3KLFA 5BPLA 5LJWA 1QQOA 4BE2A 1KD1O 4FJMA 4DF8A 2LSNA 1NK5A 2VWBA 2EHGA 5FPMA 2VYPA 1XNRK 2R7YA 3H3OB 1OVQA 5CYQA 4NCAA 1ATNA 3SAGA 3TAGA 2OANA 4B1VA 4YHHK 5KGXA 3TAQA 2FLOA 4I6MA 5LY3A 3ZEUB 5AQVA 5KPZA 4CBXA 4A57A 1H1VA 3EKUA 2ETJA 4AH9A 3AAPA 4LC9B 3DLRA 3KHYA 1A5VA 3ZT1A 4FK0A 3OVNA 3I55N 1T03A 2YHAA 1TK0A 3DLLL 3K9KA 1YJWN 3SQ1A 3V1OA 4NLCA 5AZJB 1V4SA 1W9HA 4A5BA 2OYQA 4DR6K 2E2NA 5HRSA 2BH1A 3VOVA 4DUZK 4IWVA 3V9UA 4N56A 4CD1A 4JRPA 3FGUA 4BR9A 5CHIA 5HROA 2HNZA 4CGJA 4LFBK 1HJRA 4H5TA 3SV4A 4KTQA 4FO0A 1ZBHA 2G8FA 1XQSC 1L5UA 4RCHA 1BIZA 4RW9A 5M1QA 3ZX0A 5C0YA 4TSXA 3C94A 3VQ5A 4BVOA 3S3OA 2KTQA 3O9QA 1U04A 2PY5A 4LFAK 3CCSN 1JLEA 1BG3A 1P90A 3SQ0A 4EFHA 1EX4A 3OYLA 1QQMA 3VGMA 4DV5K 1ZYQA 1K9MO 4BR2A 3FZFA 3CJBA 3KWGA 4K8XA 4FL9A 4H8KA 1SAZA 3BP8A 4I6MB 4GY2B 4H03B 4FLXA 3DLGA 2QI2A 4ELVA 3H6EA 4J2AA 5AQIA 4O44A 3MN7A 1RBUA 1NJXA 4EZ9A 1JL2A 3LAKA 4JI5K 3CETA 1J5EK 4W5OA 2NLXA 4JLHA 4CJVA 4UQGA 1CLQA 4DU3A 1TUUA 3I33A 3LDLA 2AP1A 2HHXA 5H1SQ 2E1ZA 2OZSA 4FWPA 5J2NA 3D6RA 4FWMA 1HQEA 2YI1A 4JKGB 3CYMA 4I9QA 3R3LA 3ENBA 4I2PA 4YDUA 4DUYK 3H1QA 3NFAA 1VRTA 1DTTA 1VQ4N 4JI0K 3DWLA 3JAMO 1NNEA 4B1XB 5BRFA 5LMNK 1G99A 2H3GX 3T7ZA 3E9PA 2OPRA 3ZT0A 3ZT3A 3GDQA 3V6DA 3DXMB 4QS7A 4ZTFA 3MEGA 3O9TA 1V4TA 3V9SA 3MN5A 3VF6A 4B9LA 4B1ZA 1HUXA 3L2UA 1VAZA 4H4MA 3J7ZO 4CF1A 3RRHA 3TSUA 1DKGD 2X6SA 4JD2B 1HNVA 3WEEA 3CD6N 2D0CA 1Q18A 4FPBA 1NJZA 4DSKA 3H46O 1ATSA 5J2QA 5HRRA 1S6QA 1HMVA 2D0BA 4B8AB 4CJ4A 2DTUA 1IKWA 3ID6A 3T19A 4FCYA 1RDCA 5JLFA 3AO4A 3THYB 1O1WA 4DR4K 4OLAA 3DXKA 5C24A 3UKRA 4FYDA 3VQ8A 2RF2A 3V1RA 4NXNK 2AA4A 3E9OA 2DFFA 3GE1A 3HZ6A 4OKEA 3THXA 4DSLA 4DWIA 1T6CA 3D7EO 5AJ3K 3U3YA 1X9WA 3S3NA 4FLTA 4H5RA 4BC5A 4H0TB 4ZHRA 2E2QA 5I9EB 1BA0A 3OTOK 3CCVN 3HPHA 3L4QA 2QWOA 1NGIA 2E6MA 1QE1A 1KLNA 3C6UA 1NOZA 2B5JA 3PO5A 3DI6A 1TV6A 4FLUA 4CJSA 1SL2A 5KQ8A 1SKWA 3C7NA 1BA1A 1S3XA 3WEEB 1KC8O 1UOCA 4FSVA 3C95A 4JHDA 3LM9A 1J54A 1MDUB 3ZSYA 3PX6A 3CIPA 1QZ6A 3R8EA 3ISNC 4W5TA 1RDWX 4BY9C 3EN9A 5J2MA 2ATQA 5AQXA 3THWB 5BR8K 2PFUA 3MECA 3LM2A 3OYBA 3W3DA 1CXUA 1TKXA 4AILC 4BC3A 3U9DA 1ZXOA 1WSEA 3MX5A 3DXKB 1X9SA 1W97L 4CI6A 2I7PA 3UKRB 1SL0A 5AQKA 1IKVA 1VK0A 3HBTA 1WBBA 3KK1A 3OYAA 1QHAA 4LF4K 4CVNE 4BR7A 4KHPK 4YOYA 4DSFA 4M41A 4M3RA 1YJ9N 4KHQA 4BDYA 2HBMA 1A5XA 4F2RA 3PSFA 2OCEA 4RWTA 4H0VB 3J7AP 4GW6A 4CEDA 4IDHA 3PIPL 1KFDA 1LV5A 2ZGZA 3H45C 5T7BA 3M1FA 3KLGA 4CJWA 3D0PA 3C7NB 2ASOA 1RT7A 1VQON 2FSJA 2NZTA 3OYFA 4DTNA 3ZT2A 1KFSA 4CEBA 4RW8A 4ID5A 1U2VB 4YOTA 3ZSZA 3NVMA 2YNIA 2JLEA 1NG9A 3CMEN 1X3NA 5BR9A 1RBTA 2JWKA 3CM6A 4FLYA 2VGMA 3K5NA 1Q81O 2AJQA 4FWQA 3LP3A 2A1SA 4KV8A 2J4RA 2QKKA 2A3ZA 5BRDA 4H5NA 3M8PA 5EVZA 1IBKK 4GKKK 1Y64A 5HOOA 5GAHP 1NGGA 3WXJA 4IFEA 4KTZA 3F2KA 4UY8O 4DFMA 1BGXT 2A41A 3G4SN 1VQ5N 3KWIA 5FPEA 5EX5A 4C8KA 4A59A 5JVGL 1RNHA 4Z4GA 3JSMA 2YHXA 5AQNA 1FK9A 4JKEA 3ZSWA 1S1WA 2Z1JA 5AFUA 4EHTA 2E2PA 5C2FA 3ULEB 3NGZA 3DRSA 3VA3A 4DTUA 1NGHA 4DQIA 1XI1A 4DQPA 1QSSA 5M1FA 3CPWM 3LP2A 3RWUA 1HNIA 1RT2A 4C8LA 3OYDA 1TYQB 1NMDA 2KZMA 3EE9A 2ZJRL 3KJVA 1IKYA 3AVJA 1XNQK 3QINA 3AO3A 4CEZA 4HTUA 4Z94A 3O3HA 4R5PA 3KVGA 1U4BA 4N76A 4RTFD 4IJNA 3ZETA 4L3QA 2P9PB 4M42A 2HB5A 4CGHA 4DU1A 3W0LA 4JK8A 3I8BA 3ZT4A 4LD0A 1VSEA 3BF3A 3C65A 1SUQA 5IWAK 2W41A 4A5AA 4CFAA 2OZMA 3I0RA 5BRHA 2KFNA 4CIFA 4DV3K 1NGJA 3KK7A 3S9HA 1MWMA 3VQ9A 3C6HA 3NGYA 3IS9A 4MO4A 4LF6K 4DF4A 4FWLA 1FW6A 5AQUA 3NGIA 3A5MC 3UKUA 1J5OA 1BL3A 3CJ7A 2XO7A 5DK5A 1LWFA 1LOTB 3WXIA 4C8OA 4F3OA 3T69A 4Y1CA 4WYBA 5JLHA 4CHNA 3NF6A 2YNHA 5BPMA 3AA2A 3OBWA 4CZMA 3QERA 1JLAA 1RTJA 3LAMA 5LJVA 2Q0UA 4LH5A 5M1PA 4F3TA 2ZQBA 3A0IX 4PY5A 3CMAN 1T44A 5F0XA 2QWQA 3HTVA 2NRRA 2O8EA 1VQKN 4DTOA 4O0IA 4KB1A 4BVPA 2QWNA 4RW7A 1W7AA 4WF9L 4W5RA 2IOCA 1NOYA 3AARA 5AQWA 2Q1NA 5E84A 3U8XA 1C1AA 4IOCL 3NMUA 1HX1A 1LCUA 3ZCMA 4CHZA 5ADXA 1HQUA 3E66A 3VGLA 1SS6A 3TAMA 3OHRA 3WXMB 3CC7N 4ILJA 5CYMA 1OH5A 1RT4A 4JK9A 4H0YB 3LP0A 2GV9A 1IBLK 3TANA 1BHLA 1ASVA 3DYAA 4CFDA 3CF5L 3I56N 4BRAA 4IBNA 4G1QA 4JKFA 5AQSA 4EP4A 2KKZA 4E7HA 3PLAA 2ITMA 3OJUA 2P9SA 1XMOK 1NGAA 3OA9A 4KH6A 4F2SA 4Z4EA 4I2QA 1BISA 1J9AA 2JWLA 4FJXA 1EWQA 2VCPA 5A2QO 2Z1IA 4O8UA 3KLIA 3L2WA 2HHWA 1S6PA 3VQPA 1ATRA 1XC3A 4BRIA 1YIJN 2ZM6K 2IVOA 2FBVA 3AVGA 1OH8A 2G8UA 1FXXA 2Q97A 1YUWA 3MXJA 1X9MA 1BQMA 1MA9B 4B08A 4FLWA 3OS1A 5D3GA 4KAZA 4B1UB 3TABA 4AHCA 1C0UA 1VRUA 5JS1A 1REVA 3CCUN 3KIOA 1CZ9A 4B3TK 1SKSA 1EXQA 1KLMA 5HP1A 2HSTA 5FROA 1M1KO 3VQ4A 3EEQA 3CCQN 4DQQA 3QESA 3LL3A 3NH2A 1YTUA 4Z4CA 4CJKA 1LAVA 4M3YA 2OA8A 3VF2A 1BCOA 4KREA 1OKJA 2ZWHA 3VF4A 2YV0X 4FJKA 4O55A 2O8FA 3E1YA 3O6WA 3HVRA 2HHSA 2RHKA 4EP5A 4W5NA 4CJUA 4C1NI 4IJAA 1WUAA 3VQQA 4F8RA 4KBOA 3RMCA 1DGKN 5BN9A 3HP6A 4B3MK 1HR0K 1KTQA 3KKRA 4H5WA 4OKJA 1X1PA 3BZCA 4A2AA 2VG6A 4OJRA 4FVUA 1KXPA 4PKHA 1TKTA 4FJGA 1GOBA 1ITGA 3PO4A 3OS0A 4CD3A 2NRTA 2YJEA 1FJGK 4FLVA 4FOIA 4DHYA 3U3GA 3HXMA 4E1MA 3PY8A 3PX4A 4MFBA 4FM2A 3BF1A 4BRFA 1A5WA 1E4FT 5M1KA 1RDDA 4G9ZA 2IC3A 1JKHA 1WLJA 1VQPN 1BOTO 4PKGA 2E4LA 2W6KA 1SQKA 2FF3B 4OPHA 3AVHA 1I94K 2P9UA 4J2DA 3SI6A 3AVIA 1QQNA 1GLBG 4JEPA 3TARA 4N41A 3G10A 3NF7A 4FJ7A 2HNYA 5ADXH 3QEPA 5BREA 4BC4A 4C1NK 3SUQA 3ZX2A 1UA0A 1MU2A 2O8FB 4BR4A 3ATUA 1GLFO 3VQDA 4JI2K 2IGIA 3D2FA 4LSNA 1NK0A 5CE3A 1VSLA 3NHGA 3EL2A 4BWMA 4GVMA 4M45A 1U45A 3BY5A 1S22A 3GL1A 4DR5K 1QVFM 2Q0RA 1WSFA 1GLAG 3TPQA 4DFJA 4KHYA 1VQ6N 4DQ8A 4FW2A 4W5QA 4JYAK 2E20A 2W6LA 1X9JA 3LDQA 3LALA 4FZYA 3C6AA 2IS3A 2P9LA 4CHOA 1HJOA 4BE1A 3SV3A 1S1VA 1VHXA 4BQZA 1WAFA 3AAQA 3CCEN 3CJ1A 5C25A 1NK8A 3SQ4A 3WNEA 4WQ5A 1IG9A 4ISGA 2YNGA 3MN6A 5AQZA 3DAWA 3RTVA 3P4IA 3LDSA 1BIUA 1E4GT 4ILGB 1NK6A 4J2BA 2PYLA 4U67L 3QETA 3V9WA 4ICLA 1HKCA 4YOWA 4DR1K 1RDBA 2IVPA 4HUFA 1Q9YA 4DLEA 2JGUA 4DB3A 3CCRN 4BRLA 3A5NC 1MWKA 3H1VX 4CF8A 2KZZA 1VQNN 4JI3K 3BDPA 3OYNA 1EETA 3OBYA 5KTQA 4NB4A 2YKNA 1RT1A 1HLUA 3RMDA 2F8SA 4CECA 4BRPA 4HUGA 5FDLA 1EWRA 3D2FB 4O8KA 4KHNA 1QSLA 5DMRA 3SJJA 2F8TA 3L3VA 1GLEG 3O08A 3U9ZA 3DOKA 4KI4A 3F9MA 5JVHL 4FWKA 4H0PA 3QIPA 3SZ2A 3AVAA 1QHTA 5AQTA 2ZD1A 2HBKA 2P9LB 5HBMA 3MAQA 2I5JA 3G6EN 4BRNA 5AQGA 3CJCA 3CCLN 3MEEA 3LZJA 4NYNA 4X66K 1B92A 1NLVA 2UXDK 3MWPA 3GG4A 1K73O 2HMPA 4DV0K 3HO1A 3IUCA 4HCBA 1NU0A 2DFHA 1IBMK 1YJNN 4JS4A 2G8KA 3CCJN 3K5MA 4FWOA 3ID8A 4DTPA 3SUNA 4JI6K 3O9SA 1KAYA 2ZJQL 1WBDA 1JL1A 4CHQA 5AQYA 5JMVA 5AQRA 3SBTA 5SWMA 5HLFA 1HPMA 2O4IA 1NKBA 4FJIA 4FOEA 4Y0WA 2YX6A 4QS9A 4WQ4C 1HPZA 4EZ6A 1BI4A 2O8DA 5K14A 5C15A 5EU7A 4PWDA 1ZBUA 2GTDA 2QA4N 5ELZA 4F9OA 1Z05A 4WFBL 2OTLN 1HYSA 1T3VA 3QBXA 4CJEA 5AZIA 2QEXN 5DM6L 1BU6O 3ITHA 4BG8A 1VSMA 4BRQA 3O9UA 3J7YP 2PYJA 4M3XA 2QTDA 4WFNL 4MO5A 3QNNA 4CJLA 3H3NO 3LANA 3O4NA 1Q82O 4FJ9A 3HL8A 3R6MA 5GADP 3QDKA 3KLHA 3FZKA 3HOTA 2GWJA 3CERA 1R0AA 4B9TA 3AV9A 4DTMA 4AQYK 2WONA 1XC9A 2E6LA 4CK1A 3V81A 1RBVA 4E1JA 4FJJA 3SQ2A 4KB0A 3TTFA 5LL6Z 4JI7K 3MDQA 1BQNA 5LMUK 2NUBA 3R1XA 4PKIA 1NWKA 3THXB 4O0JA 4CE9A 3MX2A 4A2BA 3DRRA 3SPZA 1RTIA 3KD1E 3L2VA 1D5AA 2HBLA 3HJFA 4YORA 1D8YA 4OKKA 3H08A 3AVMA 2G8IA 1U48A 3FLCO 3SLCA 3AO1A 4E7JA 3VQ7A 1NKCA 5AZIB 3VA0A 2E8AA 3SPYA 4B9UA 1BDGA 2V51B 3D2EA 4M3TA 4PQUA 1JXBA 4JHDB 4CEQA 4Q5VA 4FLZA 1TL1A 1S5JA 2WFBA 4AHSA 4B9MA 3VEYA 5HRNA 2ZF5O 3K5LA 5KGWA 4JS5A 3MXIA 3E9LA 1TUYA 4CZJA 3EKSA 2KFZA 4BGBA 1S9GA 3D45A 3FFIA 3SCXA 1WSGA 4E1NA 4IZ9A 4CEEA 2P9IA 3FZHA 1G15A 5IT9O 3ZSOA 2P51A 3M8SA 4O4GA 3QEXA 4KHSA 3K9JA 3IDHA 1NJIO 1FKOA 2HNDA 2QWMA 1O13A 3VEWA 4CGFA 1Q8IA 4WCEL 1SL1A 3VEZA 3VENA 2QM1A 4BR5A 4HTLA 4DS5A 2NRVA 4F4KA 4BQLA 4YOUA 4B1WB 4BRMA 4L8RB 1YI2N 4O5BA 1T6DA 3LDPA 3QLHA 4DS4A 4LY7A 1TVRA 3OYEA 4X65K 3EY1A 1JCGA 1LAWA 3AVKA 1YHQN 2Z1GA 3J8AA 3HVTA 2HMIA 4KFBA 2UXBK 3D2EB 4CFCA 2O8BA 3OYJA 2Z1HA 2E1YA 5E41A 2BANA 4IDKA 3CFOA 3MXMA 3HSCA 3VEVA 4K41A 3SAFA 4WFAL 1I3AA 3OYHA 3B8AX 3B6OA 3VTHA 4B9SA 3T3FA 4HUEA 1LW0A 3O1WA 1TK5A 4B9VA 3CCMN 1QQCA 5CZ1A 2FXUA 2XY5A 1WOQA 2P9IB 3RR8A 2FBXA 1VSKA 3CC2N 5GAGP 1NGFA 2ZE2A 1YVNA 4JI8K 4QS8A 1KQSM 4I9LA 4C8MA 5TKWA 2QW9A 2UUBK 2O8CA 4NYFA 5FRMA 1VSHA 3IRXA 2BDPA 2OPSA 3VMFB 3SJHA 4K8ZA 4B3SK 1RCHA 3RMBA 2VWJA 2VQFK 3HPOA 4B3RK 3MEDA 4YOXA 3QICA 3AVBA 3QFUA 4GKJK 2FF6A 4KTWA 3GOIA 2FBTA 3L2QA 4CF9A 1C1CA 1HYVA 3SYZA 1GOAA 2A6AA 5KQDA 1S1TA 4CIGA 2YHBA 3VEXA 4XEIA 2GWKA 3WXLA 1IKXA 3SNNA 3G71N 3CPEA 3BUZB 3HP9A 1TGOA 3ZETB 2VWKA 1XHZA 4WE1A 1B9FA 4CEFA 3OYCA 3U6FA 4YDUC 1Q86O 3DRPA 4KRFA 3VETA 1QVGM 1RILA 4KHUA 1VSJA 3U4LA 4HVJA 3CC4N 2PAVA 3TR8A 1ZC6A 1DTQA 3NH0A 3OYMA 3VQAA 1NM1A 3S41A 4LF9K 1WSIA 4NXMK 3C6TA 3HM8A 2UUCK 3VQCA 4V19S 1NGCA 3UKUB 3DMJA 5JS2A 4OX9K 4GV9A 3MCPA 4JNEA 4H0XB 5M1OA 3QFPA 2HHUA 4LFCK 1Z26A 3Q7CA 5KPTA 2BTFA 2ZGYA 1QTMA 5C10A 3L8BA 3LPUA 3A5OC 3ZSVA 3KTQA 1S9EA 5MLCQ 3SUOA 1YT3A 1Y97A 2HOEA 4IO8A 2YHYA 3V4IA 3OS2A 2HBJA 1NBWA 3V9ZA 2YKMA 1N36K 1L3SA 3TSPA 5AQQA 2QK9A 3ULDA 2Q31A 4HHTA 5FPNA 2O8EB 4JKHA 4XH5A 3O80A 4DKWA 3HPGA 3M8RA 1CZBA 3SK3A 3VQ6A 2V7YA 5FPDA 4KI6A 3SUPA 1F21A 2GBZA 2Q2RA 1RBRA 1QZ5A 3FR0A
chains in the Genus database with same CATH topology
1RTDA 1J54A 1RT5A 3QEVA 1IG9A 3ZSYA 3K58A 3PX6A 3KLEA 4CK2A 2YNGA 4W5TA 1YTAA 3ISNC 1RTHA 1NK4A 1NJYA 3RTVA 5J2MA 3LDSA 4CHPA 1BIUA 2ATQA 1WSHA 4OPJA 3O3FA 1NK6A 4CJPA 4J2BA 2PYLA 3QETA 3NF9A 4CJ3A 3MECA 3V9WA 3OYBA 2VG7A 4ICLA 3VQBA 4DSEA 4DTJA 4ELUA 2QKBA 1CXUA 1XHXA 1Z25A 1TKXA 1RDBA 4AILC 4B3OA 4HUFA 1JLBA 1WSEA 2WOMA 1W0HA 1WN7A 4AHUA 3BGRA 3AVNA 5J1EA 4DLEA 2JGUA 3L2RA 1X9SA 1SL0A 1LW2A 4DFKA 2KQ2A 1IKVA 2HHVA 1VK0A 2KW4A 3HM9A 3KK1A 4CF8A 3OYAA 2KZZA 1S1UA 3BDPA 3OYNA 2HW3A 1EETA 4QCLA 4KO0A 5KTQA 3AVFA 4Y1DA 2YKNA 1RT1A 3RMDA 5I3UA 2F8SA 3CM5A 4Z0UA 4CECA 4FXDA 3E01A 4BACA 4HUGA 5FDLA 4M41A 3OJSA 4M3RA 4DSFA 2XY7A 4KHQA 4KHNA 2DY4A 3NF8A 1VSIA 5DMRA 3SJJA 2FBYA 4CESA 4BDYA 4CJFA 1QSLA 1A5XA 3L3VA 2Y1IA 4AHTA 4F2RA 3DOKA 1TK8A 1YVUA 2RN2A 3K2PA 3QEWA 3VN5A 4KI4A 1LWCA 4CEOA 3QIPA 3EYZA 3SZ2A 4GW6A 4CEDA 3AVAA 3A2FA 1NKEA 1QHTA 2RKIA 3TI0A 1KFDA 1CXQA 1RT6A 4OPKA 2ZD1A 1LV5A 1C1BA 5T7BA 5HBMA 3MAQA 1ASUA 1EKEA 3KLGA 4FK4A 2I5JA 4CJWA 3D0PA 1KVCA 1WAJA 3LPTA 2A1RA 4PUOA 1C0MA 2XRIA 3MEEA 3F9KA 1TAUA 3LZJA 4FJLA 1RT7A 2D0AA 1T05A 4NYNA 2HVIA 3KK2A 2Q3SA 3S3MA 1B92A 2IAJA 3OYFA 4DTNA 3ZT2A 3TAPA 3HO1A 4LSLA 4OVLA 4HCBA 3LWMA 2DFHA 4KHWA 2P1JA 4CF0A 3F73A 4OLBA 4CJ5A 3HYFA 4JS4A 4CEBA 1KFSA 4RW8A 4ID5A 2G8KA 3DM2A 3ZSZA 3K5MA 4DTPA 3RR7A 2YNIA 2JLEA 3SUNA 3IG1A 4DSJA 2B6AA 1UA1A 1RBTA 3ZSXA 3NDKA 3CM6A 4CGGA 4FLYA 4N5SA 4QAGA 3K5NA 1C6VA 2AJQA 1JL1A 3LWLA 3V1QA 2QXFA 3SQ4A 4CHQA 3LP3A 1JXEA 2A1SA 1SKRA 4CGDA 4KV8A 3DLHA 3T1AA 5SZTA 4GMJB 3WNHA 3V9XA 3TAEA 1N6QA 2QKKA 3M8PA 4FM1A 5SWMA 5HLFA 4Q0BA 2O4IA 2O4GA 4KTZA 1NKBA 4DFMA 4LH4A 1BGXT 3I8DA 3ALYA 4FJIA 3NBPA 1IH7A 1HPZA 3AA4A 1BI4A 2RPIA 4C8KA 1Q9XA 4EZ6A 1RNHA 4C8NA 4HCCA 4Z4GA 3JSMA 1NK9A 5K14A 3O4QA 1FK9A 5EU7A 3ZSWA 3NE6A 1S1WA 1ZBUA 2Z1JA 4IKFA 4PWDA 3QEIA 1D9DA 3NGZA 1JLGA 3I0SA 3DRSA 4E0DA 3ASMA 3VA3A 4E19A 4DTUA 5CY4A 4DQIA 1HYSA 1XI1A 4DQPA 4CJEA 1BCMA 4H4OA 1QSSA 3LP2A 3PV8A 3RWUA 1FKPA 4DTSA 4Z4FA 4OGCA 1TKDA 1HNIA 1RT2A 4C8LA 3AVCA 3ITHA 2G8WA 4Z4HA 3OYDA 3TAFA 2KZMA 1VSMA 1S1XA 1T8EA 3KJVA 1B9DA 5HRPA 1IKYA 3AVJA 1XWLA 2PYJA 3AA3A 4M3XA 1RDAA 3QINA 2F96A 3K5OA 4IFYA 3AO3A 4CEZA 4HTUA 4XIUA 3NCIA 4CJLA 3LANA 3O3HA 4R5PA 4FM2A 3QNNA 3HK2A 3O3GA 4CHYA 3KK3A 1U4BA 4N76A 3O4NA 2BGGA 4FJ9A 4M3WA 4M42A 4CJTA 2HB5A 3HL8A 3HT3A 3OY9A 1KSPA 3KLHA 4CGHA 1J53A 4DU1A 3ZSQA 3THVA 3ZT4A 4LD0A 1VSEA 4FW1A 3KKSA 1R0AA 4AHVA 4ELTA 4B9TA 2VG5A 3P83D 3AV9A 3DLEA 4DTMA 4M3UA 1SUQA 2WONA 1I39A 1TL3A 4IFVA 5KI6A 4DQSA 3HSTB 1XC9A 3DLBA 2E6LA 2G8VA 4CK1A 3OYIA 1RT3A 3V81A 2B4JA 4CFAA 2OZMA 3I0RA 4RW6A 1RBVA 2GUIA 2YNFA 3P1GA 4RW4A 3SQ2A 4KB0A 4FJJA 4FK2A 4PQUA 2KFNA 4FM0A 2OPQA 4OGEA 4CIFA 4ZTJA 1BQNA 2NUBA 3S9HA 3LZIA 3VQ9A 1IO2A 3NGYA 4O0JA 3IS9A 4CE9A 4B9NA 4DF4A 5CZ2A 2BE2A 3NGIA 1VSDA 3DRRA 3SPZA 1J5OA 3OYGA 1BL3A 2W42A 4N41A 1RTIA 3KD1E 2XO7A 3AO5A 3L2VA 1D5AA 2P5GA 5DK5A 1LWFA 3HJFA 4QOZB 3KLFA 4C8OA 4F3OA 1D8YA 4OKKA 4Y1CA 3H08A 4BE2A 3AVMA 4FJMA 4CHNA 1U48A 2G8IA 3NF6A 4ID1A 4DF8A 3AO1A 4E7JA 2LSNA 2YNHA 3VQ7A 1NK5A 1NKCA 3VA0A 3AA2A 1RBSA 3QERA 2EHGA 1JLAA 1RTJA 3SPYA 3LAMA 4B9UA 1VSFA 3PUFA 2R7YA 4MQ3A 4DU4A 1JXBA 4LH5A 2G8HA 4M3TA 2DFEA 4F3TA 2ZQBA 4CEQA 5CYQA 4Q5VA 4NCAA 3TAGA 4FLZA 4PY5A 1TL1A 1S5JA 5KGXA 3TAQA 4CGIA 4AHSA 3AVLA 4B9MA 4DTOA 4O0IA 4KB1A 5HRNA 3QNOA 3K5LA 5KGWA 4JS5A 3MXIA 2KFZA 1JLQA 4RW7A 2OPPA 1S9GA 4W5RA 3D45A 4CEAA 4I7FA 2IOCA 3FFIA 1NOYA 3SCXA 4CERA 1WSGA 4E1NA 3AO2A 2ETJA 4AH9A 4CEEA 3DLRA 1C1AA 1G15A 1A5VA 3ZT1A 4FK0A 3ZSOA 3OVNA 2P51A 3ZCMA 3UIQA 1T03A 2YHAA 3M8SA 4E7LA 1TK0A 4O4GA 3NH1A 3SQ1A 3V1OA 3K59A 3QEXA 3G0ZA 4CHZA 4KHSA 1HQUA 1KRPA 2HHTA 1FKOA 2IDOA 1W9HA 3P5JA 3TAMA 2OYQA 2HNDA 3ZSRA 5HRSA 4DTRA 5CYMA 1RT4A 4E89A 3V9UA 4N56A 4JRPA 4CGFA 1Q8IA 3LP0A 1SL1A 2GV9A 2X6NA 4M3ZA 3TANA 1BHLA 1ASVA 3DYAA 5HROA 4DS5A 2HNZA 4CGJA 4CFDA 4F4KA 3CFRA 2X78A 1HJRA 2FC0A 1DLOA 4IG3A 3SV4A 4L8RB 4KTQA 3LP1A 4IBNA 4G1QA 1L3UA 1ZBHA 4EP4A 2G8FA 1ASWA 1L5UA 2PZSA 4E7HA 4O5BA 1BIZA 4RW9A 4J2EA 1L3TA 3QLHA 4DS4A 4LY7A 1TVRA 3OJUA 3OYEA 3EY1A 4TSXA 1LAWA 3AVKA 3C94A 3VQ5A 2Z1GA 3S3OA 4FZZA 2KTQA 4CFBA 4F2SA 2Y1JA 4Z4EA 3HVTA 2HMIA 1U04A 4KFBA 4I2QA 2PY5A 1JLEA 1BISA 1J9AA 3SQ0A 4CFCA 1EX4A 4FJXA 3B6PA 3OYLA 3OYJA 2Z1HA 3CFPA 3PX0A 2Z1IA 5E41A 2BANA 4IDKA 1ZYQA 4DSIA 3KLIA 3CFOA 3L2WA 2HHWA 3MXMA 1S6PA 3VQPA 4K8XA 4H8KA 1I3AA 1D9FA 1C0TA 3OYHA 4FZXC 3B6OA 4B9SA 4FLXA 3T3FA 3DLGA 1LW0A 1K6YA 1KVAA 2FBVA 3AVGA 4HUEA 3TWHA 4BDZA 1TK5A 4ELVA 3CQ8A 2G8UA 4B9VA 1QQCA 5CZ1A 4J2AA 1FXXA 4FVMA 3MXJA 4O44A 2XY5A 1X9MA 1BQMA 3RMAA 4B08A 1RBUA 1NJXA 2FBXA 1VSKA 4E3SA 3RR8A 4FLWA 1JL2A 4EZ9A 3LAKA 3OS1A 4CCHA 5D3GA 4KAZA 4W5OA 3TABA 4JRQA 4AHCA 2ZE2A 4JLHA 1C0UA 4CJVA 1VRUA 4DMNA 4UQGA 1CLQA 5JS1A 4DU3A 1REVA 4I9LA 4C8MA 3KIOA 1CZ9A 1UWBA 1SKSA 1EXQA 1KLMA 1ZBFA 1EP4A 5KRTA 5HP1A 2OZSA 2HHXA 5FROA 4NCBA 4NYFA 5FRMA 3VQ4A 1VSHA 3IRXA 4DQQA 2OPSA 5J2NA 3QESA 2BDPA 4KPYA 1BI4B 3NH2A 4BDPA 4Z4CA 4CJKA 1YTUA 1LAVA 4M3YA 2OA8A 1HQEA 3CYMA 5C42A 4FJ5A 4I9QA 4K8ZA 1BCOA 4FJ8A 1RCHA 1T7PA 4I2PA 1KVBA 3RMBA 4DLGA 4KREA 3NFAA 2VWJA 1VRTA 1DTTA 3HPOA 3MEDA 2YV0X 4FJKA 3AVBA 4O55A 4KTWA 1JLFA 3HVRA 4DTXA 2HHSA 4YNQA 2FBTA 3L2QA 4CF9A 1C1CA 1HYVA 4EP5A 3SYZA 4W5NA 4CJUA 1GOAA 3QO9A 4CJQA 1S1TA 4N47A 4CIGA 4BE0A 2YHBA 3VQQA 4F8RA 2OPRA 3RMCA 3ZT0A 5FRNA 1ZBIA 3ZT3A 3DLKA 3HP6A 3V6DA 4BWJA 4ZTFA 3MEGA 1KTQA 2X74A 3KKRA 4OKJA 1X1PA 3K57A 3V9SA 2EX3A 5J2PA 1IKXA 3SNNA 4B9LA 2VG6A 4DG1A 4OJRA 4CK3A 1TAQA 3HP9A 3L2UA 4IG0A 4FJNA 1TGOA 1TKTA 2VWKA 4H4MA 1XHZA 1KCFA 1Q9YA 4WE1A 1QS4A 4CF1A 3RRHA 4FJGA 1B9FA 1GOBA 4CEFA 2X6SA 3OYCA 1ITGA 3U6FA 3PO4A 1HNVA 3OS0A 3DRPA 3L3UA 4FJHA 4FLVA 4KRFA 2D0CA 1NJZA 1QSYA 1RILA 4DSKA 1UAXA 3U3GA 3HXMA 4E1MA 4KKOA 4KHUA 1VSJA 3PY8A 4HVJA 5J2QA 5I42A 3PX4A 5HRRA 1S6QA 1HMVA 2D0BA 4MFBA 3TR8A 4B8AB 4CJRA 3NAEA 1DTQA 3NH0A 3OYMA 3QIOA 4CJ4A 2DTUA 1IKWA 4E7KA 3VQAA 1A5WA 4YFUA 1N5YA 1U49A 3T19A 2HVHA 1GOCA 4FCYA 1WSIA 3CG7A 1RDCA 4PA1A 4CF2A 1RDDA 3DOLA 3AO4A 2IC3A 1JKHA 1WLJA 3C6TA 2E4LA 1SV5A 4DQRA 3AVHA 4J2DA 1O1WA 3SI6A 3AVIA 3VQCA 4OLAA 4DFPA 3AA5X 3DMJA 5C24A 1TKZA 5JS2A 3VQEA 3TARA 4RG8A 3G10A 3VQ8A 2RF2A 3NF7A 4FJ7A 5KRSA 4FYDA 2HNYA 3QEPA 3V1RA 2HHUA 1Z26A 4Z4IA 1HRHA 2DFFA 4E7IA 4NCGA 1WNSA 3SUQA 3L8BA 1WSJA 1NK7A 4OKEA 1QTMA 3LPUA 3M8QA 1UA0A 3ZSVA 3KTQA 1MU2A 1S9EA 3SUOA 3RRGA 1JLCA 1YT3A 2P5OA 3WNGA 4DWIA 3VQDA 4DSLA 2IGIA 3U3YA 1Y97A 1X9WA 1NK0A 4LSNA 2XHBA 1VSLA 3NHGA 3IAYA 4BWMA 4GVMA 4M45A 3V4IA 2XY8A 3EZ5A 4AHRA 3S3NA 1U45A 4FLTA 3OS2A 2F8TA 2D5RA 1WSFA 4ZHRA 3V9ZA 2XY6A 2YKMA 4DFJA 1NJWA 4KHYA 1U47A 3HPHA 4FW2A 4W5QA 1L3SA 1HYZA 2QK9A 3ULDA 2ITGA 4B8CA 4HHTA 2E6MA 1QE1A 1KLNA 3LALA 3C6UA 1NOZA 3HPGA 2B5JA 3M8RA 1CZBA 2IS3A 1LWEA 3PO5A 4FZYA 4CHOA 3DI6A 4CIEA 1TV6A 4BE1A 4FLUA 4CJSA 3JYTA 3SV3A 1SL2A 1S1VA 3VQ6A 1SKWA 1L3VA 3WNFA 3KD5E 1WAFA 4KI6A 1UOCA 2HHQA 3C95A 1F21A 2GBZA 3SUPA 1RBRA 1ZBLA 5C25A 1NK8A 3OYKA 3WNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTD A;  1J54 A;  1RT5 A;  3QEV A;  1IG9 A;  3ZSY A;  3K58 A;  3PX6 A;  3KLE A;  4CK2 A;  2YNG A;  4W5T A;  1YTA A;  3ISN C;  1RTH A;  1NK4 A;  1NJY A;  3RTV A;  5J2M A;  3LDS A;  4CHP A;  1BIU A;  2ATQ A;  1WSH A;  4OPJ A;  3O3F A;  1NK6 A;  4CJP A;  4J2B A;  2PYL A;  3QET A;  3NF9 A;  4CJ3 A;  3MEC A;  3V9W A;  3OYB A;  2VG7 A;  4ICL A;  3VQB A;  4DSE A;  4DTJ A;  4ELU A;  2QKB A;  1CXU A;  1XHX A;  1Z25 A;  1TKX A;  1RDB A;  4AIL C;  4B3O A;  4HUF A;  1JLB A;  1WSE A;  2WOM A;  1W0H A;  1WN7 A;  4AHU A;  3BGR A;  3AVN A;  5J1E A;  4DLE A;  2JGU A;  3L2R A;  1X9S A;  1SL0 A;  1LW2 A;  4DFK A;  2KQ2 A;  1IKV A;  2HHV A;  1VK0 A;  2KW4 A;  3HM9 A;  3KK1 A;  4CF8 A;  3OYA A;  2KZZ A;  1S1U A;  3BDP A;  3OYN A;  2HW3 A;  1EET A;  4QCL A;  4KO0 A;  5KTQ A;  3AVF A;  4Y1D A;  2YKN A;  1RT1 A;  3RMD A;  5I3U A;  2F8S A;  3CM5 A;  4Z0U A;  4CEC A;  4FXD A;  3E01 A;  4BAC A;  4HUG A;  5FDL A;  4M41 A;  3OJS A;  4M3R A;  4DSF A;  2XY7 A;  4KHQ A;  4KHN A;  2DY4 A;  3NF8 A;  1VSI A;  5DMR A;  3SJJ A;  2FBY A;  4CES A;  4BDY A;  4CJF A;  1QSL A;  1A5X A;  3L3V A;  2Y1I A;  4AHT A;  4F2R A;  3DOK A;  1TK8 A;  1YVU A;  2RN2 A;  3K2P A;  3QEW A;  3VN5 A;  4KI4 A;  1LWC A;  4CEO A;  3QIP A;  3EYZ A;  3SZ2 A;  4GW6 A;  4CED A;  3AVA A;  3A2F A;  1NKE A;  1QHT A;  2RKI A;  3TI0 A;  1KFD A;  1CXQ A;  1RT6 A;  4OPK A;  2ZD1 A;  1LV5 A;  1C1B A;  5T7B A;  5HBM A;  3MAQ A;  1ASU A;  1EKE A;  3KLG A;  4FK4 A;  2I5J A;  4CJW A;  3D0P A;  1KVC A;  1WAJ A;  3LPT A;  2A1R A;  4PUO A;  1C0M A;  2XRI A;  3MEE A;  3F9K A;  1TAU A;  3LZJ A;  4FJL A;  1RT7 A;  2D0A A;  1T05 A;  4NYN A;  2HVI A;  3KK2 A;  2Q3S A;  3S3M A;  1B92 A;  2IAJ A;  3OYF A;  4DTN A;  3ZT2 A;  3TAP A;  3HO1 A;  4LSL A;  4OVL A;  4HCB A;  3LWM A;  2DFH A;  4KHW A;  2P1J A;  4CF0 A;  3F73 A;  4OLB A;  4CJ5 A;  3HYF A;  4JS4 A;  4CEB A;  1KFS A;  4RW8 A;  4ID5 A;  2G8K A;  3DM2 A;  3ZSZ A;  3K5M A;  4DTP A;  3RR7 A;  2YNI A;  2JLE A;  3SUN A;  3IG1 A;  4DSJ A;  2B6A A;  1UA1 A;  1RBT A;  3ZSX A;  3NDK A;  3CM6 A;  4CGG A;  4FLY A;  4N5S A;  4QAG A;  3K5N A;  1C6V A;  2AJQ A;  1JL1 A;  3LWL A;  3V1Q A;  2QXF A;  3SQ4 A;  4CHQ A;  3LP3 A;  1JXE A;  2A1S A;  1SKR A;  4CGD A;  4KV8 A;  3DLH A;  3T1A A;  5SZT A;  4GMJ B;  3WNH A;  3V9X A;  3TAE A;  1N6Q A;  2QKK A;  3M8P A;  4FM1 A;  5SWM A;  5HLF A;  4Q0B A;  2O4I A;  2O4G A;  4KTZ A;  1NKB A;  4DFM A;  4LH4 A;  1BGX T;  3I8D A;  3ALY A;  4FJI A;  3NBP A;  1IH7 A;  1HPZ A;  3AA4 A;  1BI4 A;  2RPI A;  4C8K A;  1Q9X A;  4EZ6 A;  1RNH A;  4C8N A;  4HCC A;  4Z4G A;  3JSM A;  1NK9 A;  5K14 A;  3O4Q A;  1FK9 A;  5EU7 A;  3ZSW A;  3NE6 A;  1S1W A;  1ZBU A;  2Z1J A;  4IKF A;  4PWD A;  3QEI A;  1D9D A;  3NGZ A;  1JLG A;  3I0S A;  3DRS A;  4E0D A;  3ASM A;  3VA3 A;  4E19 A;  4DTU A;  5CY4 A;  4DQI A;  1HYS A;  1XI1 A;  4DQP A;  4CJE A;  1BCM A;  4H4O A;  1QSS A;  3LP2 A;  3PV8 A;  3RWU A;  1FKP A;  4DTS A;  4Z4F A;  4OGC A;  1TKD A;  1HNI A;  1RT2 A;  4C8L A;  3AVC A;  3ITH A;  2G8W A;  4Z4H A;  3OYD A;  3TAF A;  2KZM A;  1VSM A;  1S1X A;  1T8E A;  3KJV A;  1B9D A;  5HRP A;  1IKY A;  3AVJ A;  1XWL A;  2PYJ A;  3AA3 A;  4M3X A;  1RDA A;  3QIN A;  2F96 A;  3K5O A;  4IFY A;  3AO3 A;  4CEZ A;  4HTU A;  4XIU A;  3NCI A;  4CJL A;  3LAN A;  3O3H A;  4R5P A;  4FM2 A;  3QNN A;  3HK2 A;  3O3G A;  4CHY A;  3KK3 A;  1U4B A;  4N76 A;  3O4N A;  2BGG A;  4FJ9 A;  4M3W A;  4M42 A;  4CJT A;  2HB5 A;  3HL8 A;  3HT3 A;  3OY9 A;  1KSP A;  3KLH A;  4CGH A;  1J53 A;  4DU1 A;  3ZSQ A;  3THV A;  3ZT4 A;  4LD0 A;  1VSE A;  4FW1 A;  3KKS A;  1R0A A;  4AHV A;  4ELT A;  4B9T A;  2VG5 A;  3P83 D;  3AV9 A;  3DLE A;  4DTM A;  4M3U A;  1SUQ A;  2WON A;  1I39 A;  1TL3 A;  4IFV A;  5KI6 A;  4DQS A;  3HST B;  1XC9 A;  3DLB A;  2E6L A;  2G8V A;  4CK1 A;  3OYI A;  1RT3 A;  3V81 A;  2B4J A;  4CFA A;  2OZM A;  3I0R A;  4RW6 A;  1RBV A;  2GUI A;  2YNF A;  3P1G A;  4RW4 A;  3SQ2 A;  4KB0 A;  4FJJ A;  4FK2 A;  4PQU A;  2KFN A;  4FM0 A;  2OPQ A;  4OGE A;  4CIF A;  4ZTJ A;  1BQN A;  2NUB A;  3S9H A;  3LZI A;  3VQ9 A;  1IO2 A;  3NGY A;  4O0J A;  3IS9 A;  4CE9 A;  4B9N A;  4DF4 A;  5CZ2 A;  2BE2 A;  3NGI A;  1VSD A;  3DRR A;  3SPZ A;  1J5O A;  3OYG A;  1BL3 A;  2W42 A;  4N41 A;  1RTI A;  3KD1 E;  2XO7 A;  3AO5 A;  3L2V A;  1D5A A;  2P5G A;  5DK5 A;  1LWF A;  3HJF A;  4QOZ B;  3KLF A;  4C8O A;  4F3O A;  1D8Y A;  4OKK A;  4Y1C A;  3H08 A;  4BE2 A;  3AVM A;  4FJM A;  4CHN A;  1U48 A;  2G8I A;  3NF6 A;  4ID1 A;  4DF8 A;  3AO1 A;  4E7J A;  2LSN A;  2YNH A;  3VQ7 A;  1NK5 A;  1NKC A;  3VA0 A;  3AA2 A;  1RBS A;  3QER A;  2EHG A;  1JLA A;  1RTJ A;  3SPY A;  3LAM A;  4B9U A;  1VSF A;  3PUF A;  2R7Y A;  4MQ3 A;  4DU4 A;  1JXB A;  4LH5 A;  2G8H A;  4M3T A;  2DFE A;  4F3T A;  2ZQB A;  4CEQ A;  5CYQ A;  4Q5V A;  4NCA A;  3TAG A;  4FLZ A;  4PY5 A;  1TL1 A;  1S5J A;  5KGX A;  3TAQ A;  4CGI A;  4AHS A;  3AVL A;  4B9M A;  4DTO A;  4O0I A;  4KB1 A;  5HRN A;  3QNO A;  3K5L A;  5KGW A;  4JS5 A;  3MXI A;  2KFZ A;  1JLQ A;  4RW7 A;  2OPP A;  1S9G A;  4W5R A;  3D45 A;  4CEA A;  4I7F A;  2IOC A;  3FFI A;  1NOY A;  3SCX A;  4CER A;  1WSG A;  4E1N A;  3AO2 A;  2ETJ A;  4AH9 A;  4CEE A;  3DLR A;  1C1A A;  1G15 A;  1A5V A;  3ZT1 A;  4FK0 A;  3ZSO A;  3OVN A;  2P51 A;  3ZCM A;  3UIQ A;  1T03 A;  2YHA A;  3M8S A;  4E7L A;  1TK0 A;  4O4G A;  3NH1 A;  3SQ1 A;  3V1O A;  3K59 A;  3QEX A;  3G0Z A;  4CHZ A;  4KHS A;  1HQU A;  1KRP A;  2HHT A;  1FKO A;  2IDO A;  1W9H A;  3P5J A;  3TAM A;  2OYQ A;  2HND A;  3ZSR A;  5HRS A;  4DTR A;  5CYM A;  1RT4 A;  4E89 A;  3V9U A;  4N56 A;  4JRP A;  4CGF A;  1Q8I A;  3LP0 A;  1SL1 A;  2GV9 A;  2X6N A;  4M3Z A;  3TAN A;  1BHL A;  1ASV A;  3DYA A;  5HRO A;  4DS5 A;  2HNZ A;  4CGJ A;  4CFD A;  4F4K A;  3CFR A;  2X78 A;  1HJR A;  2FC0 A;  1DLO A;  4IG3 A;  3SV4 A;  4L8R B;  4KTQ A;  3LP1 A;  4IBN A;  4G1Q A;  1L3U A;  1ZBH A;  4EP4 A;  2G8F A;  1ASW A;  1L5U A;  2PZS A;  4E7H A;  4O5B A;  1BIZ A;  4RW9 A;  4J2E A;  1L3T A;  3QLH A;  4DS4 A;  4LY7 A;  1TVR A;  3OJU A;  3OYE A;  3EY1 A;  4TSX A;  1LAW A;  3AVK A;  3C94 A;  3VQ5 A;  2Z1G A;  3S3O A;  4FZZ A;  2KTQ A;  4CFB A;  4F2S A;  2Y1J A;  4Z4E A;  3HVT A;  2HMI A;  1U04 A;  4KFB A;  4I2Q A;  2PY5 A;  1JLE A;  1BIS A;  1J9A A;  3SQ0 A;  4CFC A;  1EX4 A;  4FJX A;  3B6P A;  3OYL A;  3OYJ A;  2Z1H A;  3CFP A;  3PX0 A;  2Z1I A;  5E41 A;  2BAN A;  4IDK A;  1ZYQ A;  4DSI A;  3KLI A;  3CFO A;  3L2W A;  2HHW A;  3MXM A;  1S6P A;  3VQP A;  4K8X A;  4H8K A;  1I3A A;  1D9F A;  1C0T A;  3OYH A;  4FZX C;  3B6O A;  4B9S A;  4FLX A;  3T3F A;  3DLG A;  1LW0 A;  1K6Y A;  1KVA A;  2FBV A;  3AVG A;  4HUE A;  3TWH A;  4BDZ A;  1TK5 A;  4ELV A;  3CQ8 A;  2G8U A;  4B9V A;  1QQC A;  5CZ1 A;  4J2A A;  1FXX A;  4FVM A;  3MXJ A;  4O44 A;  2XY5 A;  1X9M A;  1BQM A;  3RMA A;  4B08 A;  1RBU A;  1NJX A;  2FBX A;  1VSK A;  4E3S A;  3RR8 A;  4FLW A;  1JL2 A;  4EZ9 A;  3LAK A;  3OS1 A;  4CCH A;  5D3G A;  4KAZ A;  4W5O A;  3TAB A;  4JRQ A;  4AHC A;  2ZE2 A;  4JLH A;  1C0U A;  4CJV A;  1VRU A;  4DMN A;  4UQG A;  1CLQ A;  5JS1 A;  4DU3 A;  1REV A;  4I9L A;  4C8M A;  3KIO A;  1CZ9 A;  1UWB A;  1SKS A;  1EXQ A;  1KLM A;  1ZBF A;  1EP4 A;  5KRT A;  5HP1 A;  2OZS A;  2HHX A;  5FRO A;  4NCB A;  4NYF A;  5FRM A;  3VQ4 A;  1VSH A;  3IRX A;  4DQQ A;  2OPS A;  5J2N A;  3QES A;  2BDP A;  4KPY A;  1BI4 B;  3NH2 A;  4BDP A;  4Z4C A;  4CJK A;  1YTU A;  1LAV A;  4M3Y A;  2OA8 A;  1HQE A;  3CYM A;  5C42 A;  4FJ5 A;  4I9Q A;  4K8Z A;  1BCO A;  4FJ8 A;  1RCH A;  1T7P A;  4I2P A;  1KVB A;  3RMB A;  4DLG A;  4KRE A;  3NFA A;  2VWJ A;  1VRT A;  1DTT A;  3HPO A;  3MED A;  2YV0 X;  4FJK A;  3AVB A;  4O55 A;  4KTW A;  1JLF A;  3HVR A;  4DTX A;  2HHS A;  4YNQ A;  2FBT A;  3L2Q A;  4CF9 A;  1C1C A;  1HYV A;  4EP5 A;  3SYZ A;  4W5N A;  4CJU A;  1GOA A;  3QO9 A;  4CJQ A;  1S1T A;  4N47 A;  4CIG A;  4BE0 A;  2YHB A;  3VQQ A;  4F8R A;  2OPR A;  3RMC A;  3ZT0 A;  5FRN A;  1ZBI A;  3ZT3 A;  3DLK A;  3HP6 A;  3V6D A;  4BWJ A;  4ZTF A;  3MEG A;  1KTQ A;  2X74 A;  3KKR A;  4OKJ A;  1X1P A;  3K57 A;  3V9S A;  2EX3 A;  5J2P A;  1IKX A;  3SNN A;  4B9L A;  2VG6 A;  4DG1 A;  4OJR A;  4CK3 A;  1TAQ A;  3HP9 A;  3L2U A;  4IG0 A;  4FJN A;  1TGO A;  1TKT A;  2VWK A;  4H4M A;  1XHZ A;  1KCF A;  1Q9Y A;  4WE1 A;  1QS4 A;  4CF1 A;  3RRH A;  4FJG A;  1B9F A;  1GOB A;  4CEF A;  2X6S A;  3OYC A;  1ITG A;  3U6F A;  3PO4 A;  1HNV A;  3OS0 A;  3DRP A;  3L3U A;  4FJH A;  4FLV A;  4KRF A;  2D0C A;  1NJZ A;  1QSY A;  1RIL A;  4DSK A;  1UAX A;  3U3G A;  3HXM A;  4E1M A;  4KKO A;  4KHU A;  1VSJ A;  3PY8 A;  4HVJ A;  5J2Q A;  5I42 A;  3PX4 A;  5HRR A;  1S6Q A;  1HMV A;  2D0B A;  4MFB A;  3TR8 A;  4B8A B;  4CJR A;  3NAE A;  1DTQ A;  3NH0 A;  3OYM A;  3QIO A;  4CJ4 A;  2DTU A;  1IKW A;  4E7K A;  3VQA A;  1A5W A;  4YFU A;  1N5Y A;  1U49 A;  3T19 A;  2HVH A;  1GOC A;  4FCY A;  1WSI A;  3CG7 A;  1RDC A;  4PA1 A;  4CF2 A;  1RDD A;  3DOL A;  3AO4 A;  2IC3 A;  1JKH A;  1WLJ A;  3C6T A;  2E4L A;  1SV5 A;  4DQR A;  3AVH A;  4J2D A;  1O1W A;  3SI6 A;  3AVI A;  3VQC A;  4OLA A;  4DFP A;  3AA5 X;  3DMJ A;  5C24 A;  1TKZ A;  5JS2 A;  3VQE A;  3TAR A;  4RG8 A;  3G10 A;  3VQ8 A;  2RF2 A;  3NF7 A;  4FJ7 A;  5KRS A;  4FYD A;  2HNY A;  3QEP A;  3V1R A;  2HHU A;  1Z26 A;  4Z4I A;  1HRH A;  2DFF A;  4E7I A;  4NCG A;  1WNS A;  3SUQ A;  3L8B A;  1WSJ A;  1NK7 A;  4OKE A;  1QTM A;  3LPU A;  3M8Q A;  1UA0 A;  3ZSV A;  3KTQ A;  1MU2 A;  1S9E A;  3SUO A;  3RRG A;  1JLC A;  1YT3 A;  2P5O A;  3WNG A;  4DWI A;  3VQD A;  4DSL A;  2IGI A;  3U3Y A;  1Y97 A;  1X9W A;  1NK0 A;  4LSN A;  2XHB A;  1VSL A;  3NHG A;  3IAY A;  4BWM A;  4GVM A;  4M45 A;  3V4I A;  2XY8 A;  3EZ5 A;  4AHR A;  3S3N A;  1U45 A;  4FLT A;  3OS2 A;  2F8T A;  2D5R A;  1WSF A;  4ZHR A;  3V9Z A;  2XY6 A;  2YKM A;  4DFJ A;  1NJW A;  4KHY A;  1U47 A;  3HPH A;  4FW2 A;  4W5Q A;  1L3S A;  1HYZ A;  2QK9 A;  3ULD A;  2ITG A;  4B8C A;  4HHT A;  2E6M A;  1QE1 A;  1KLN A;  3LAL A;  3C6U A;  1NOZ A;  3HPG A;  2B5J A;  3M8R A;  1CZB A;  2IS3 A;  1LWE A;  3PO5 A;  4FZY A;  4CHO A;  3DI6 A;  4CIE A;  1TV6 A;  4BE1 A;  4FLU A;  4CJS A;  3JYT A;  3SV3 A;  1SL2 A;  1S1V A;  3VQ6 A;  1SKW A;  1L3V A;  3WNF A;  3KD5 E;  1WAF A;  4KI6 A;  1UOC A;  2HHQ A;  3C95 A;  1F21 A;  2GBZ A;  3SUP A;  1RBR A;  1ZBL A;  5C25 A;  1NK8 A;  3OYK A;  3WNE A; 
#chains in the Genus database with same CATH topology
 1JJ2 M;  4FPA A;  1RT5 A;  2D0P A;  4A61 A;  3K58 A;  4CK2 A;  1YTA A;  4AM6 A;  1NK4 A;  1NJY A;  5F2R A;  3ZEU A;  4CHP A;  4OPJ A;  3MMV A;  1WSH A;  4EAH D;  1YF5 L;  3NF9 A;  1GLD G;  4DSE A;  2VG7 A;  3JS6 A;  2QKB A;  1Z25 A;  2NRX A;  1JLB A;  2WOM A;  5B8H A;  1W0H A;  2GX9 A;  5C12 A;  5J1E A;  4DV7 K;  3L2R A;  1ILY A;  3AY9 A;  1LW2 A;  4CZH A;  4DFK A;  2HHV A;  2KW4 A;  5EOY A;  2CGL A;  4QCL A;  4KO0 A;  2P9S B;  3AVF A;  4Y1D A;  4DR2 K;  3CM5 A;  4Z0U A;  3E01 A;  1NMN A;  4BAC A;  3OJS A;  2XY7 A;  2DY4 A;  3NF8 A;  2FBY A;  2W40 A;  4CES A;  4CJF A;  2Y1I A;  3PSI A;  4J8F A;  4A62 A;  5TKY A;  3WQT A;  3NVK A;  2RN2 A;  1JCF A;  3VN5 A;  4CEO A;  3O4W A;  1NKE A;  3TI0 A;  1ZBS A;  1BO5 O;  1CXQ A;  1P8Z A;  1D4X A;  1ESV A;  1C1B A;  1VQL N;  1EKE A;  2A1R A;  4PL8 A;  1C0M A;  2KLA A;  1NGE A;  4BR0 A;  4FJL A;  5BPN A;  1RFQ A;  3IFR A;  2Q3S A;  3S3M A;  2IAJ A;  4DV6 K;  4LSL A;  4OVL A;  2P1J A;  4IEI A;  4CF0 A;  4OLB A;  3HYF A;  4BRO A;  3CQX A;  3DM2 A;  1KAX A;  4ISE A;  1GLC G;  3L0Q A;  5GAE P;  4DSJ A;  2B6A A;  1UA1 A;  3ZSX A;  3VGK A;  4K25 A;  3V1Q A;  3LWL A;  2QXF A;  1HNZ K;  1IJJ A;  1JXE A;  2D1K A;  3T1A A;  5SZT A;  3V9X A;  1N6Q A;  4FM1 A;  4Q0B A;  1OH7 A;  3PIO L;  2QXL A;  4LH4 A;  2UXC K;  3GBT A;  1IH7 A;  3AA4 A;  2RPI A;  4JKG A;  3O4Q A;  5AQH A;  4IKF A;  2ASM A;  2F9T A;  1D9D A;  4IOA L;  1J6Z A;  1YXQ A;  4E0D A;  2CGJ A;  1RDU A;  2E88 A;  4CZI A;  1BCM A;  3PV8 A;  3SMS A;  5M1N A;  4DTS A;  4Z4F A;  4OGC A;  2D0O A;  3AVC A;  2G8W A;  4Z4H A;  3TTD A;  4FWN A;  2P9K A;  1B9D A;  2F9W A;  4JKC A;  4U7B A;  4H5V A;  2NRW A;  3DXM A;  4EHU A;  3ZX3 A;  1RDA A;  3J80 O;  3K5O A;  4IFY A;  4XIU A;  3HK2 A;  2GEM A;  4ILH A;  4CHY A;  3O3G A;  3KK3 A;  1HNW K;  2BGG A;  4CJT A;  3HT3 A;  3OY9 A;  3AGR A;  1KSP A;  4IXC A;  1J53 A;  4ISF A;  4GVE A;  4JD2 A;  3ZSQ A;  3THV A;  4AF1 A;  4AHV A;  2P9U B;  3P83 D;  1U6Z A;  3DLE A;  5KI6 A;  4IFV A;  4DQS A;  3HST B;  3DLB A;  1BWF O;  5EXW A;  4LF8 K;  5E26 A;  1RT3 A;  3O1B A;  4RW6 A;  5AQL A;  2GUI A;  3P1G A;  4RW4 A;  4FM0 A;  4OGE A;  4ZTJ A;  4K42 A;  4EIA A;  4B9N A;  3THY A;  3BZK A;  2BE2 A;  1VSD A;  5C2D A;  4OPA A;  4BC2 A;  2W42 A;  4IOX A;  3AO5 A;  1Z6R A;  3LDO A;  3CXC M;  3VTI A;  4QOZ B;  4GV6 A;  3EO3 A;  3CJ9 A;  5CR4 A;  2UUA K;  4ID1 A;  3F5T A;  4R79 A;  1RBS A;  2RE2 A;  4XH4 A;  5AQF A;  1VSF A;  3PUF A;  4MQ3 A;  4DU4 A;  2G8H A;  2DFE A;  3TTC A;  2P9K B;  1GLL O;  2OTJ N;  3UE5 A;  3OW2 M;  4CGI A;  4IEE A;  3AVL A;  5EY4 A;  3QNO A;  2DPN A;  1JLQ A;  4CBW A;  4PHT X;  2OPP A;  1SZ2 A;  4CEA A;  4I7F A;  4CER A;  3AO2 A;  3ENH A;  4CZK A;  2YHW A;  3UIQ A;  2CGK A;  4E7L A;  3LDN A;  3NH1 A;  3K59 A;  3G25 A;  3G0Z A;  2NRH A;  3QB0 A;  2QWL A;  1KRP A;  2HHT A;  3N4Q A;  2IDO A;  3P5J A;  3ZSR A;  4DTR A;  3O5B A;  3CQY A;  3ATV A;  3M5R A;  2A5X A;  4E89 A;  3THW A;  3FZL A;  5KPR A;  3P31 A;  1IV0 A;  3ENO A;  2X6N A;  4CZF A;  2WC9 A;  4GNI A;  3CFR A;  2X78 A;  2FC0 A;  1DLO A;  4IG3 A;  3BEX A;  3LP1 A;  1L3U A;  3T1Y K;  1ASW A;  2PZS A;  1X3M A;  4J2E A;  2WBN A;  3KZB A;  1L3T A;  5BN8 A;  1K8K A;  4FZZ A;  4CFB A;  4PL7 A;  2Y1J A;  3Q7B A;  3C0B A;  2F7T A;  3B6P A;  3CFP A;  4JI4 K;  3PX0 A;  4DSI A;  2I7N A;  4O5F A;  3HOS A;  4KH4 A;  4BRC A;  3FFK B;  4C23 A;  1D9F A;  3A8Y A;  1C0T A;  4FZX C;  4FWR A;  4M63 C;  2FSN A;  1K6Y A;  1KVA A;  3TWH A;  4BDZ A;  3CQ8 A;  3RSE A;  4FVM A;  2KHO A;  4JI1 K;  4BRH A;  3RMA A;  4E3S A;  4CCH A;  4JRQ A;  3MN9 A;  1C0G A;  4JN4 A;  4DMN A;  5AQJ A;  4CZE A;  4JKD A;  1U2V A;  4DCH A;  4X64 K;  1UWB A;  1ZBF A;  1EP4 A;  5KRT A;  4NCB A;  5HL7 L;  4KPY A;  1BI4 B;  2FSK A;  4BDP A;  3WXK A;  2O8D B;  1OVY A;  5C42 A;  1NGD A;  4FJ5 A;  3SBG A;  4FJ8 A;  1T7P A;  1KVB A;  4DLG A;  4OO1 J;  2YJF A;  1K8K B;  3JXU A;  3HRG A;  1JLF A;  4DTX A;  3T1H K;  4YNQ A;  4YY3 K;  2UYT A;  4CJQ A;  1GLJ O;  3QO9 A;  3FZM A;  4N47 A;  2WTU A;  4BE0 A;  1VQ8 N;  1KAZ A;  5FRN A;  1ZBI A;  5JIC A;  3ULE A;  3DLK A;  1E3M A;  4BWJ A;  1K8A O;  2X74 A;  1YIT N;  5J2P A;  3K57 A;  2EX3 A;  4DG1 A;  4CK3 A;  1TAQ A;  2HF3 A;  5FLX O;  4IG0 A;  4FJN A;  4AM7 A;  1IG8 A;  1KCF A;  1QS4 A;  3RVC A;  5DM7 L;  1TYQ A;  3L3U A;  3UB5 A;  3RSE B;  4FJH A;  5GIP A;  1QSY A;  2E2O A;  1OH6 A;  2WUS A;  1UAX A;  4KKO A;  3AGK A;  5I42 A;  1XUP O;  4CJR A;  3NAE A;  4NLB A;  2UU9 K;  3QIO A;  4E7K A;  4YFU A;  1N5Y A;  1U49 A;  1DT9 A;  2HVH A;  2V52 B;  1GOC A;  5AQO A;  2P9P A;  3CG7 A;  3CI5 A;  4PA1 A;  4CF2 A;  2GUP A;  3DOL A;  1HNX K;  2NNW A;  2EWS A;  1SV5 A;  4DFP A;  3AA5 X;  1TKZ A;  3VQE A;  4RG8 A;  5KRS A;  3IKM A;  3CHW A;  4Z4I A;  1HRH A;  3MCA B;  4E7I A;  4NCG A;  1WNS A;  1NK7 A;  4M3Z A;  1WSJ A;  3M8Q A;  3EE8 A;  4JKB A;  3RRG A;  1JLC A;  2P5O A;  3MK6 A;  3WNG A;  2IIR A;  3A5L C;  3L4I A;  2XHB A;  3IAY A;  3VES A;  2XY8 A;  3EZ5 A;  4AHR A;  2D5R A;  2YCH A;  3VER A;  2XY6 A;  1NJW A;  3DJC A;  4YOV A;  1U47 A;  1C0F A;  1HYZ A;  1WB9 A;  3IMX A;  2ITG A;  2ASP A;  4B8C A;  5GIO A;  3SMP A;  5F1X A;  4CW7 B;  1LWE A;  4CIE A;  3J81 O;  1L3V A;  3JYT A;  1VQM N;  3KD5 E;  3VEO A;  3WNF A;  2HHQ A;  3K0S A;  3VPZ A;  4MLE A;  4JK7 A;  1ZBL A;  3OYK A;  1RTD A;  3ZLJ A;  3QEV A;  3KLE A;  1VQ9 N;  1RTH A;  4JAX A;  3O3F A;  4CJP A;  4DV2 K;  4CJ3 A;  3VQB A;  4DTJ A;  4ELU A;  3EZW A;  1XHX A;  4B3O A;  4DQR A;  1WN7 A;  4AHU A;  3BGR A;  3AVN A;  3ZYY X;  2BUP A;  1N33 K;  2KQ2 A;  3QBW A;  3HM9 A;  1S1U A;  1N34 K;  1BUP A;  2HW3 A;  1R59 O;  3MWT A;  1N8R O;  1JCE A;  4BRG A;  1W2B M;  5I3U A;  4WQ5 C;  2P9N A;  4FXD A;  3HI0 A;  5AQP A;  1VSI A;  4AHT A;  2O8B B;  4CJ7 A;  4DV1 K;  1TK8 A;  1YVU A;  3K2P A;  3P38 A;  3QEW A;  1XMQ K;  3R9P A;  1LWC A;  3EYZ A;  5AQM A;  3O8M A;  4MLH A;  3A2F A;  1EO1 A;  2RKI A;  2PBD A;  1RT6 A;  4OPK A;  1ASU A;  4FK4 A;  1KVC A;  1WAJ A;  3LPT A;  4PUO A;  2XRI A;  1NGB A;  3F9K A;  4BRK A;  1TAU A;  2HF4 A;  2D0A A;  1T05 A;  3QML A;  4GV3 A;  1Q7Y O;  2HVI A;  1EQY A;  3WQU A;  3KK2 A;  2F4V K;  4DV4 K;  4BRD A;  3CJA A;  3TAP A;  5AR0 A;  5GIN A;  4MDB A;  3LWM A;  4WQ4 A;  4KHW A;  3F73 A;  4CJ5 A;  1VQ7 N;  3RR7 A;  2O8C B;  3IG1 A;  4HWI A;  4M7Y A;  3NDK A;  4CGG A;  4N5S A;  4QAG A;  2V7Z A;  1C6V A;  1N32 K;  1SKR A;  1M90 O;  4CGD A;  3DLH A;  4GMJ B;  3WNH A;  3TAE A;  4LF7 K;  3L6Q A;  2O4G A;  4XH1 A;  1YAG A;  2P9N B;  3ALY A;  3WT0 A;  3I8D A;  3NBP A;  4MDA A;  1Q9X A;  4C8N A;  1S72 N;  4HCC A;  1NK9 A;  3NE6 A;  2IVN A;  1DEJ A;  3QEI A;  2GEL A;  1JLG A;  3I0S A;  1RGI A;  2E5L K;  3ASM A;  4E19 A;  4FWS A;  3SAH A;  5CY4 A;  4H4O A;  1FKP A;  2CH6 A;  2VGN A;  2HHH K;  4CZG A;  3O9R A;  3FE1 A;  4KH5 A;  1TKD A;  3TAF A;  1S1X A;  1T8E A;  5AFU H;  5HRP A;  4JKA A;  1XWL A;  4CZL A;  4H0O A;  3AA3 A;  2CH5 A;  2F96 A;  3TU5 A;  4M7X A;  3NCI A;  4DR3 K;  4K0K K;  2QWP A;  2NRZ A;  4M3W A;  1CZA N;  2A42 A;  2ZJP L;  4BGA A;  1HKB A;  4B1Y B;  3P39 A;  2Q36 A;  4NO7 A;  4IO9 L;  4FW1 A;  3KKS A;  4ELT A;  2VG5 A;  4M3U A;  1I39 A;  1TL3 A;  3N4P A;  4BG9 A;  2G8V A;  3OYI A;  4B9Q A;  4K43 A;  2B4J A;  4CBU A;  5AZJ A;  2YNF A;  4FK2 A;  2OPQ A;  3WUH A;  2VQE K;  3LZI A;  1IO2 A;  3M6G A;  4LF5 K;  5CZ2 A;  4JV5 K;  2QWR A;  3OYG A;  2A40 A;  2D4W A;  4BRE A;  1HKG A;  3TSQ A;  2P5G A;  4X62 K;  3M3Z A;  4DR7 K;  3KLF A;  5BPL A;  5LJW A;  1QQO A;  4BE2 A;  1KD1 O;  4FJM A;  4DF8 A;  2LSN A;  1NK5 A;  2VWB A;  2EHG A;  5FPM A;  2VYP A;  1XNR K;  2R7Y A;  3H3O B;  1OVQ A;  5CYQ A;  4NCA A;  1ATN A;  3SAG A;  3TAG A;  2OAN A;  4B1V A;  4YHH K;  5KGX A;  3TAQ A;  2FLO A;  4I6M A;  5LY3 A;  3ZEU B;  5AQV A;  5KPZ A;  4CBX A;  4A57 A;  1H1V A;  3EKU A;  2ETJ A;  4AH9 A;  3AAP A;  4LC9 B;  3DLR A;  3KHY A;  1A5V A;  3ZT1 A;  4FK0 A;  3OVN A;  3I55 N;  1T03 A;  2YHA A;  1TK0 A;  3DLL L;  3K9K A;  1YJW N;  3SQ1 A;  3V1O A;  4NLC A;  5AZJ B;  1V4S A;  1W9H A;  4A5B A;  2OYQ A;  4DR6 K;  2E2N A;  5HRS A;  2BH1 A;  3VOV A;  4DUZ K;  4IWV A;  3V9U A;  4N56 A;  4CD1 A;  4JRP A;  3FGU A;  4BR9 A;  5CHI A;  5HRO A;  2HNZ A;  4CGJ A;  4LFB K;  1HJR A;  4H5T A;  3SV4 A;  4KTQ A;  4FO0 A;  1ZBH A;  2G8F A;  1XQS C;  1L5U A;  4RCH A;  1BIZ A;  4RW9 A;  5M1Q A;  3ZX0 A;  5C0Y A;  4TSX A;  3C94 A;  3VQ5 A;  4BVO A;  3S3O A;  2KTQ A;  3O9Q A;  1U04 A;  2PY5 A;  4LFA K;  3CCS N;  1JLE A;  1BG3 A;  1P90 A;  3SQ0 A;  4EFH A;  1EX4 A;  3OYL A;  1QQM A;  3VGM A;  4DV5 K;  1ZYQ A;  1K9M O;  4BR2 A;  3FZF A;  3CJB A;  3KWG A;  4K8X A;  4FL9 A;  4H8K A;  1SAZ A;  3BP8 A;  4I6M B;  4GY2 B;  4H03 B;  4FLX A;  3DLG A;  2QI2 A;  4ELV A;  3H6E A;  4J2A A;  5AQI A;  4O44 A;  3MN7 A;  1RBU A;  1NJX A;  4EZ9 A;  1JL2 A;  3LAK A;  4JI5 K;  3CET A;  1J5E K;  4W5O A;  2NLX A;  4JLH A;  4CJV A;  4UQG A;  1CLQ A;  4DU3 A;  1TUU A;  3I33 A;  3LDL A;  2AP1 A;  2HHX A;  5H1S Q;  2E1Z A;  2OZS A;  4FWP A;  5J2N A;  3D6R A;  4FWM A;  1HQE A;  2YI1 A;  4JKG B;  3CYM A;  4I9Q A;  3R3L A;  3ENB A;  4I2P A;  4YDU A;  4DUY K;  3H1Q A;  3NFA A;  1VRT A;  1DTT A;  1VQ4 N;  4JI0 K;  3DWL A;  3JAM O;  1NNE A;  4B1X B;  5BRF A;  5LMN K;  1G99 A;  2H3G X;  3T7Z A;  3E9P A;  2OPR A;  3ZT0 A;  3ZT3 A;  3GDQ A;  3V6D A;  3DXM B;  4QS7 A;  4ZTF A;  3MEG A;  3O9T A;  1V4T A;  3V9S A;  3MN5 A;  3VF6 A;  4B9L A;  4B1Z A;  1HUX A;  3L2U A;  1VAZ A;  4H4M A;  3J7Z O;  4CF1 A;  3RRH A;  3TSU A;  1DKG D;  2X6S A;  4JD2 B;  1HNV A;  3WEE A;  3CD6 N;  2D0C A;  1Q18 A;  4FPB A;  1NJZ A;  4DSK A;  3H46 O;  1ATS A;  5J2Q A;  5HRR A;  1S6Q A;  1HMV A;  2D0B A;  4B8A B;  4CJ4 A;  2DTU A;  1IKW A;  3ID6 A;  3T19 A;  4FCY A;  1RDC A;  5JLF A;  3AO4 A;  3THY B;  1O1W A;  4DR4 K;  4OLA A;  3DXK A;  5C24 A;  3UKR A;  4FYD A;  3VQ8 A;  2RF2 A;  3V1R A;  4NXN K;  2AA4 A;  3E9O A;  2DFF A;  3GE1 A;  3HZ6 A;  4OKE A;  3THX A;  4DSL A;  4DWI A;  1T6C A;  3D7E O;  5AJ3 K;  3U3Y A;  1X9W A;  3S3N A;  4FLT A;  4H5R A;  4BC5 A;  4H0T B;  4ZHR A;  2E2Q A;  5I9E B;  1BA0 A;  3OTO K;  3CCV N;  3HPH A;  3L4Q A;  2QWO A;  1NGI A;  2E6M A;  1QE1 A;  1KLN A;  3C6U A;  1NOZ A;  2B5J A;  3PO5 A;  3DI6 A;  1TV6 A;  4FLU A;  4CJS A;  1SL2 A;  5KQ8 A;  1SKW A;  3C7N A;  1BA1 A;  1S3X A;  3WEE B;  1KC8 O;  1UOC A;  4FSV A;  3C95 A;  4JHD A;  3LM9 A;  1J54 A;  1MDU B;  3ZSY A;  3PX6 A;  3CIP A;  1QZ6 A;  3R8E A;  3ISN C;  4W5T A;  1RDW X;  4BY9 C;  3EN9 A;  5J2M A;  2ATQ A;  5AQX A;  3THW B;  5BR8 K;  2PFU A;  3MEC A;  3LM2 A;  3OYB A;  3W3D A;  1CXU A;  1TKX A;  4AIL C;  4BC3 A;  3U9D A;  1ZXO A;  1WSE A;  3MX5 A;  3DXK B;  1X9S A;  1W97 L;  4CI6 A;  2I7P A;  3UKR B;  1SL0 A;  5AQK A;  1IKV A;  1VK0 A;  3HBT A;  1WBB A;  3KK1 A;  3OYA A;  1QHA A;  4LF4 K;  4CVN E;  4BR7 A;  4KHP K;  4YOY A;  4DSF A;  4M41 A;  4M3R A;  1YJ9 N;  4KHQ A;  4BDY A;  2HBM A;  1A5X A;  4F2R A;  3PSF A;  2OCE A;  4RWT A;  4H0V B;  3J7A P;  4GW6 A;  4CED A;  4IDH A;  3PIP L;  1KFD A;  1LV5 A;  2ZGZ A;  3H45 C;  5T7B A;  3M1F A;  3KLG A;  4CJW A;  3D0P A;  3C7N B;  2ASO A;  1RT7 A;  1VQO N;  2FSJ A;  2NZT A;  3OYF A;  4DTN A;  3ZT2 A;  1KFS A;  4CEB A;  4RW8 A;  4ID5 A;  1U2V B;  4YOT A;  3ZSZ A;  3NVM A;  2YNI A;  2JLE A;  1NG9 A;  3CME N;  1X3N A;  5BR9 A;  1RBT A;  2JWK A;  3CM6 A;  4FLY A;  2VGM A;  3K5N A;  1Q81 O;  2AJQ A;  4FWQ A;  3LP3 A;  2A1S A;  4KV8 A;  2J4R A;  2QKK A;  2A3Z A;  5BRD A;  4H5N A;  3M8P A;  5EVZ A;  1IBK K;  4GKK K;  1Y64 A;  5HOO A;  5GAH P;  1NGG A;  3WXJ A;  4IFE A;  4KTZ A;  3F2K A;  4UY8 O;  4DFM A;  1BGX T;  2A41 A;  3G4S N;  1VQ5 N;  3KWI A;  5FPE A;  5EX5 A;  4C8K A;  4A59 A;  5JVG L;  1RNH A;  4Z4G A;  3JSM A;  2YHX A;  5AQN A;  1FK9 A;  4JKE A;  3ZSW A;  1S1W A;  2Z1J A;  5AFU A;  4EHT A;  2E2P A;  5C2F A;  3ULE B;  3NGZ A;  3DRS A;  3VA3 A;  4DTU A;  1NGH A;  4DQI A;  1XI1 A;  4DQP A;  1QSS A;  5M1F A;  3CPW M;  3LP2 A;  3RWU A;  1HNI A;  1RT2 A;  4C8L A;  3OYD A;  1TYQ B;  1NMD A;  2KZM A;  3EE9 A;  2ZJR L;  3KJV A;  1IKY A;  3AVJ A;  1XNQ K;  3QIN A;  3AO3 A;  4CEZ A;  4HTU A;  4Z94 A;  3O3H A;  4R5P A;  3KVG A;  1U4B A;  4N76 A;  4RTF D;  4IJN A;  3ZET A;  4L3Q A;  2P9P B;  4M42 A;  2HB5 A;  4CGH A;  4DU1 A;  3W0L A;  4JK8 A;  3I8B A;  3ZT4 A;  4LD0 A;  1VSE A;  3BF3 A;  3C65 A;  1SUQ A;  5IWA K;  2W41 A;  4A5A A;  4CFA A;  2OZM A;  3I0R A;  5BRH A;  2KFN A;  4CIF A;  4DV3 K;  1NGJ A;  3KK7 A;  3S9H A;  1MWM A;  3VQ9 A;  3C6H A;  3NGY A;  3IS9 A;  4MO4 A;  4LF6 K;  4DF4 A;  4FWL A;  1FW6 A;  5AQU A;  3NGI A;  3A5M C;  3UKU A;  1J5O A;  1BL3 A;  3CJ7 A;  2XO7 A;  5DK5 A;  1LWF A;  1LOT B;  3WXI A;  4C8O A;  4F3O A;  3T69 A;  4Y1C A;  4WYB A;  5JLH A;  4CHN A;  3NF6 A;  2YNH A;  5BPM A;  3AA2 A;  3OBW A;  4CZM A;  3QER A;  1JLA A;  1RTJ A;  3LAM A;  5LJV A;  2Q0U A;  4LH5 A;  5M1P A;  4F3T A;  2ZQB A;  3A0I X;  4PY5 A;  3CMA N;  1T44 A;  5F0X A;  2QWQ A;  3HTV A;  2NRR A;  2O8E A;  1VQK N;  4DTO A;  4O0I A;  4KB1 A;  4BVP A;  2QWN A;  4RW7 A;  1W7A A;  4WF9 L;  4W5R A;  2IOC A;  1NOY A;  3AAR A;  5AQW A;  2Q1N A;  5E84 A;  3U8X A;  1C1A A;  4IOC L;  3NMU A;  1HX1 A;  1LCU A;  3ZCM A;  4CHZ A;  5ADX A;  1HQU A;  3E66 A;  3VGL A;  1SS6 A;  3TAM A;  3OHR A;  3WXM B;  3CC7 N;  4ILJ A;  5CYM A;  1OH5 A;  1RT4 A;  4JK9 A;  4H0Y B;  3LP0 A;  2GV9 A;  1IBL K;  3TAN A;  1BHL A;  1ASV A;  3DYA A;  4CFD A;  3CF5 L;  3I56 N;  4BRA A;  4IBN A;  4G1Q A;  4JKF A;  5AQS A;  4EP4 A;  2KKZ A;  4E7H A;  3PLA A;  2ITM A;  3OJU A;  2P9S A;  1XMO K;  1NGA A;  3OA9 A;  4KH6 A;  4F2S A;  4Z4E A;  4I2Q A;  1BIS A;  1J9A A;  2JWL A;  4FJX A;  1EWQ A;  2VCP A;  5A2Q O;  2Z1I A;  4O8U A;  3KLI A;  3L2W A;  2HHW A;  1S6P A;  3VQP A;  1ATR A;  1XC3 A;  4BRI A;  1YIJ N;  2ZM6 K;  2IVO A;  2FBV A;  3AVG A;  1OH8 A;  2G8U A;  1FXX A;  2Q97 A;  1YUW A;  3MXJ A;  1X9M A;  1BQM A;  1MA9 B;  4B08 A;  4FLW A;  3OS1 A;  5D3G A;  4KAZ A;  4B1U B;  3TAB A;  4AHC A;  1C0U A;  1VRU A;  5JS1 A;  1REV A;  3CCU N;  3KIO A;  1CZ9 A;  4B3T K;  1SKS A;  1EXQ A;  1KLM A;  5HP1 A;  2HST A;  5FRO A;  1M1K O;  3VQ4 A;  3EEQ A;  3CCQ N;  4DQQ A;  3QES A;  3LL3 A;  3NH2 A;  1YTU A;  4Z4C A;  4CJK A;  1LAV A;  4M3Y A;  2OA8 A;  3VF2 A;  1BCO A;  4KRE A;  1OKJ A;  2ZWH A;  3VF4 A;  2YV0 X;  4FJK A;  4O55 A;  2O8F A;  3E1Y A;  3O6W A;  3HVR A;  2HHS A;  2RHK A;  4EP5 A;  4W5N A;  4CJU A;  4C1N I;  4IJA A;  1WUA A;  3VQQ A;  4F8R A;  4KBO A;  3RMC A;  1DGK N;  5BN9 A;  3HP6 A;  4B3M K;  1HR0 K;  1KTQ A;  3KKR A;  4H5W A;  4OKJ A;  1X1P A;  3BZC A;  4A2A A;  2VG6 A;  4OJR A;  4FVU A;  1KXP A;  4PKH A;  1TKT A;  4FJG A;  1GOB A;  1ITG A;  3PO4 A;  3OS0 A;  4CD3 A;  2NRT A;  2YJE A;  1FJG K;  4FLV A;  4FOI A;  4DHY A;  3U3G A;  3HXM A;  4E1M A;  3PY8 A;  3PX4 A;  4MFB A;  4FM2 A;  3BF1 A;  4BRF A;  1A5W A;  1E4F T;  5M1K A;  1RDD A;  4G9Z A;  2IC3 A;  1JKH A;  1WLJ A;  1VQP N;  1BOT O;  4PKG A;  2E4L A;  2W6K A;  1SQK A;  2FF3 B;  4OPH A;  3AVH A;  1I94 K;  2P9U A;  4J2D A;  3SI6 A;  3AVI A;  1QQN A;  1GLB G;  4JEP A;  3TAR A;  4N41 A;  3G10 A;  3NF7 A;  4FJ7 A;  2HNY A;  5ADX H;  3QEP A;  5BRE A;  4BC4 A;  4C1N K;  3SUQ A;  3ZX2 A;  1UA0 A;  1MU2 A;  2O8F B;  4BR4 A;  3ATU A;  1GLF O;  3VQD A;  4JI2 K;  2IGI A;  3D2F A;  4LSN A;  1NK0 A;  5CE3 A;  1VSL A;  3NHG A;  3EL2 A;  4BWM A;  4GVM A;  4M45 A;  1U45 A;  3BY5 A;  1S22 A;  3GL1 A;  4DR5 K;  1QVF M;  2Q0R A;  1WSF A;  1GLA G;  3TPQ A;  4DFJ A;  4KHY A;  1VQ6 N;  4DQ8 A;  4FW2 A;  4W5Q A;  4JYA K;  2E20 A;  2W6L A;  1X9J A;  3LDQ A;  3LAL A;  4FZY A;  3C6A A;  2IS3 A;  2P9L A;  4CHO A;  1HJO A;  4BE1 A;  3SV3 A;  1S1V A;  1VHX A;  4BQZ A;  1WAF A;  3AAQ A;  3CCE N;  3CJ1 A;  5C25 A;  1NK8 A;  3SQ4 A;  3WNE A;  4WQ5 A;  1IG9 A;  4ISG A;  2YNG A;  3MN6 A;  5AQZ A;  3DAW A;  3RTV A;  3P4I A;  3LDS A;  1BIU A;  1E4G T;  4ILG B;  1NK6 A;  4J2B A;  2PYL A;  4U67 L;  3QET A;  3V9W A;  4ICL A;  1HKC A;  4YOW A;  4DR1 K;  1RDB A;  2IVP A;  4HUF A;  1Q9Y A;  4DLE A;  2JGU A;  4DB3 A;  3CCR N;  4BRL A;  3A5N C;  1MWK A;  3H1V X;  4CF8 A;  2KZZ A;  1VQN N;  4JI3 K;  3BDP A;  3OYN A;  1EET A;  3OBY A;  5KTQ A;  4NB4 A;  2YKN A;  1RT1 A;  1HLU A;  3RMD A;  2F8S A;  4CEC A;  4BRP A;  4HUG A;  5FDL A;  1EWR A;  3D2F B;  4O8K A;  4KHN A;  1QSL A;  5DMR A;  3SJJ A;  2F8T A;  3L3V A;  1GLE G;  3O08 A;  3U9Z A;  3DOK A;  4KI4 A;  3F9M A;  5JVH L;  4FWK A;  4H0P A;  3QIP A;  3SZ2 A;  3AVA A;  1QHT A;  5AQT A;  2ZD1 A;  2HBK A;  2P9L B;  5HBM A;  3MAQ A;  2I5J A;  3G6E N;  4BRN A;  5AQG A;  3CJC A;  3CCL N;  3MEE A;  3LZJ A;  4NYN A;  4X66 K;  1B92 A;  1NLV A;  2UXD K;  3MWP A;  3GG4 A;  1K73 O;  2HMP A;  4DV0 K;  3HO1 A;  3IUC A;  4HCB A;  1NU0 A;  2DFH A;  1IBM K;  1YJN N;  4JS4 A;  2G8K A;  3CCJ N;  3K5M A;  4FWO A;  3ID8 A;  4DTP A;  3SUN A;  4JI6 K;  3O9S A;  1KAY A;  2ZJQ L;  1WBD A;  1JL1 A;  4CHQ A;  5AQY A;  5JMV A;  5AQR A;  3SBT A;  5SWM A;  5HLF A;  1HPM A;  2O4I A;  1NKB A;  4FJI A;  4FOE A;  4Y0W A;  2YX6 A;  4QS9 A;  4WQ4 C;  1HPZ A;  4EZ6 A;  1BI4 A;  2O8D A;  5K14 A;  5C15 A;  5EU7 A;  4PWD A;  1ZBU A;  2GTD A;  2QA4 N;  5ELZ A;  4F9O A;  1Z05 A;  4WFB L;  2OTL N;  1HYS A;  1T3V A;  3QBX A;  4CJE A;  5AZI A;  2QEX N;  5DM6 L;  1BU6 O;  3ITH A;  4BG8 A;  1VSM A;  4BRQ A;  3O9U A;  3J7Y P;  2PYJ A;  4M3X A;  2QTD A;  4WFN L;  4MO5 A;  3QNN A;  4CJL A;  3H3N O;  3LAN A;  3O4N A;  1Q82 O;  4FJ9 A;  3HL8 A;  3R6M A;  5GAD P;  3QDK A;  3KLH A;  3FZK A;  3HOT A;  2GWJ A;  3CER A;  1R0A A;  4B9T A;  3AV9 A;  4DTM A;  4AQY K;  2WON A;  1XC9 A;  2E6L A;  4CK1 A;  3V81 A;  1RBV A;  4E1J A;  4FJJ A;  3SQ2 A;  4KB0 A;  3TTF A;  5LL6 Z;  4JI7 K;  3MDQ A;  1BQN A;  5LMU K;  2NUB A;  3R1X A;  4PKI A;  1NWK A;  3THX B;  4O0J A;  4CE9 A;  3MX2 A;  4A2B A;  3DRR A;  3SPZ A;  1RTI A;  3KD1 E;  3L2V A;  1D5A A;  2HBL A;  3HJF A;  4YOR A;  1D8Y A;  4OKK A;  3H08 A;  3AVM A;  2G8I A;  1U48 A;  3FLC O;  3SLC A;  3AO1 A;  4E7J A;  3VQ7 A;  1NKC A;  5AZI B;  3VA0 A;  2E8A A;  3SPY A;  4B9U A;  1BDG A;  2V51 B;  3D2E A;  4M3T A;  4PQU A;  1JXB A;  4JHD B;  4CEQ A;  4Q5V A;  4FLZ A;  1TL1 A;  1S5J A;  2WFB A;  4AHS A;  4B9M A;  3VEY A;  5HRN A;  2ZF5 O;  3K5L A;  5KGW A;  4JS5 A;  3MXI A;  3E9L A;  1TUY A;  4CZJ A;  3EKS A;  2KFZ A;  4BGB A;  1S9G A;  3D45 A;  3FFI A;  3SCX A;  1WSG A;  4E1N A;  4IZ9 A;  4CEE A;  2P9I A;  3FZH A;  1G15 A;  5IT9 O;  3ZSO A;  2P51 A;  3M8S A;  4O4G A;  3QEX A;  4KHS A;  3K9J A;  3IDH A;  1NJI O;  1FKO A;  2HND A;  2QWM A;  1O13 A;  3VEW A;  4CGF A;  1Q8I A;  4WCE L;  1SL1 A;  3VEZ A;  3VEN A;  2QM1 A;  4BR5 A;  4HTL A;  4DS5 A;  2NRV A;  4F4K A;  4BQL A;  4YOU A;  4B1W B;  4BRM A;  4L8R B;  1YI2 N;  4O5B A;  1T6D A;  3LDP A;  3QLH A;  4DS4 A;  4LY7 A;  1TVR A;  3OYE A;  4X65 K;  3EY1 A;  1JCG A;  1LAW A;  3AVK A;  1YHQ N;  2Z1G A;  3J8A A;  3HVT A;  2HMI A;  4KFB A;  2UXB K;  3D2E B;  4CFC A;  2O8B A;  3OYJ A;  2Z1H A;  2E1Y A;  5E41 A;  2BAN A;  4IDK A;  3CFO A;  3MXM A;  3HSC A;  3VEV A;  4K41 A;  3SAF A;  4WFA L;  1I3A A;  3OYH A;  3B8A X;  3B6O A;  3VTH A;  4B9S A;  3T3F A;  4HUE A;  1LW0 A;  3O1W A;  1TK5 A;  4B9V A;  3CCM N;  1QQC A;  5CZ1 A;  2FXU A;  2XY5 A;  1WOQ A;  2P9I B;  3RR8 A;  2FBX A;  1VSK A;  3CC2 N;  5GAG P;  1NGF A;  2ZE2 A;  1YVN A;  4JI8 K;  4QS8 A;  1KQS M;  4I9L A;  4C8M A;  5TKW A;  2QW9 A;  2UUB K;  2O8C A;  4NYF A;  5FRM A;  1VSH A;  3IRX A;  2BDP A;  2OPS A;  3VMF B;  3SJH A;  4K8Z A;  4B3S K;  1RCH A;  3RMB A;  2VWJ A;  2VQF K;  3HPO A;  4B3R K;  3MED A;  4YOX A;  3QIC A;  3AVB A;  3QFU A;  4GKJ K;  2FF6 A;  4KTW A;  3GOI A;  2FBT A;  3L2Q A;  4CF9 A;  1C1C A;  1HYV A;  3SYZ A;  1GOA A;  2A6A A;  5KQD A;  1S1T A;  4CIG A;  2YHB A;  3VEX A;  4XEI A;  2GWK A;  3WXL A;  1IKX A;  3SNN A;  3G71 N;  3CPE A;  3BUZ B;  3HP9 A;  1TGO A;  3ZET B;  2VWK A;  1XHZ A;  4WE1 A;  1B9F A;  4CEF A;  3OYC A;  3U6F A;  4YDU C;  1Q86 O;  3DRP A;  4KRF A;  3VET A;  1QVG M;  1RIL A;  4KHU A;  1VSJ A;  3U4L A;  4HVJ A;  3CC4 N;  2PAV A;  3TR8 A;  1ZC6 A;  1DTQ A;  3NH0 A;  3OYM A;  3VQA A;  1NM1 A;  3S41 A;  4LF9 K;  1WSI A;  4NXM K;  3C6T A;  3HM8 A;  2UUC K;  3VQC A;  4V19 S;  1NGC A;  3UKU B;  3DMJ A;  5JS2 A;  4OX9 K;  4GV9 A;  3MCP A;  4JNE A;  4H0X B;  5M1O A;  3QFP A;  2HHU A;  4LFC K;  1Z26 A;  3Q7C A;  5KPT A;  2BTF A;  2ZGY A;  1QTM A;  5C10 A;  3L8B A;  3LPU A;  3A5O C;  3ZSV A;  3KTQ A;  1S9E A;  5MLC Q;  3SUO A;  1YT3 A;  1Y97 A;  2HOE A;  4IO8 A;  2YHY A;  3V4I A;  3OS2 A;  2HBJ A;  1NBW A;  3V9Z A;  2YKM A;  1N36 K;  1L3S A;  3TSP A;  5AQQ A;  2QK9 A;  3ULD A;  2Q31 A;  4HHT A;  5FPN A;  2O8E B;  4JKH A;  4XH5 A;  3O80 A;  4DKW A;  3HPG A;  3M8R A;  1CZB A;  3SK3 A;  3VQ6 A;  2V7Y A;  5FPD A;  4KI6 A;  3SUP A;  1F21 A;  2GBZ A;  2Q2R A;  1RBR A;  1QZ5 A;  3FR0 A; 
#chains in the Genus database with same CATH homology
 1RTD A;  1J54 A;  1RT5 A;  3QEV A;  1IG9 A;  3ZSY A;  3K58 A;  3PX6 A;  3KLE A;  4CK2 A;  2YNG A;  4W5T A;  1YTA A;  3ISN C;  1RTH A;  1NK4 A;  1NJY A;  3RTV A;  5J2M A;  3LDS A;  4CHP A;  1BIU A;  2ATQ A;  1WSH A;  4OPJ A;  3O3F A;  1NK6 A;  4CJP A;  4J2B A;  2PYL A;  3QET A;  3NF9 A;  4CJ3 A;  3MEC A;  3V9W A;  3OYB A;  2VG7 A;  4ICL A;  3VQB A;  4DSE A;  4DTJ A;  4ELU A;  2QKB A;  1CXU A;  1XHX A;  1Z25 A;  1TKX A;  1RDB A;  4AIL C;  4B3O A;  4HUF A;  1JLB A;  1WSE A;  2WOM A;  1W0H A;  1WN7 A;  4AHU A;  3BGR A;  3AVN A;  5J1E A;  4DLE A;  2JGU A;  3L2R A;  1X9S A;  1SL0 A;  1LW2 A;  4DFK A;  2KQ2 A;  1IKV A;  2HHV A;  1VK0 A;  2KW4 A;  3HM9 A;  3KK1 A;  4CF8 A;  3OYA A;  2KZZ A;  1S1U A;  3BDP A;  3OYN A;  2HW3 A;  1EET A;  4QCL A;  4KO0 A;  5KTQ A;  3AVF A;  4Y1D A;  2YKN A;  1RT1 A;  3RMD A;  5I3U A;  2F8S A;  3CM5 A;  4Z0U A;  4CEC A;  4FXD A;  3E01 A;  4BAC A;  4HUG A;  5FDL A;  4M41 A;  3OJS A;  4M3R A;  4DSF A;  2XY7 A;  4KHQ A;  4KHN A;  2DY4 A;  3NF8 A;  1VSI A;  5DMR A;  3SJJ A;  2FBY A;  4CES A;  4BDY A;  4CJF A;  1QSL A;  1A5X A;  3L3V A;  2Y1I A;  4AHT A;  4F2R A;  3DOK A;  1TK8 A;  1YVU A;  2RN2 A;  3K2P A;  3QEW A;  3VN5 A;  4KI4 A;  1LWC A;  4CEO A;  3QIP A;  3EYZ A;  3SZ2 A;  4GW6 A;  4CED A;  3AVA A;  3A2F A;  1NKE A;  1QHT A;  2RKI A;  3TI0 A;  1KFD A;  1CXQ A;  1RT6 A;  4OPK A;  2ZD1 A;  1LV5 A;  1C1B A;  5T7B A;  5HBM A;  3MAQ A;  1ASU A;  1EKE A;  3KLG A;  4FK4 A;  2I5J A;  4CJW A;  3D0P A;  1KVC A;  1WAJ A;  3LPT A;  2A1R A;  4PUO A;  1C0M A;  2XRI A;  3MEE A;  3F9K A;  1TAU A;  3LZJ A;  4FJL A;  1RT7 A;  2D0A A;  1T05 A;  4NYN A;  2HVI A;  3KK2 A;  2Q3S A;  3S3M A;  1B92 A;  2IAJ A;  3OYF A;  4DTN A;  3ZT2 A;  3TAP A;  3HO1 A;  4LSL A;  4OVL A;  4HCB A;  3LWM A;  2DFH A;  4KHW A;  2P1J A;  4CF0 A;  3F73 A;  4OLB A;  4CJ5 A;  3HYF A;  4JS4 A;  4CEB A;  1KFS A;  4RW8 A;  4ID5 A;  2G8K A;  3DM2 A;  3ZSZ A;  3K5M A;  4DTP A;  3RR7 A;  2YNI A;  2JLE A;  3SUN A;  3IG1 A;  4DSJ A;  2B6A A;  1UA1 A;  1RBT A;  3ZSX A;  3NDK A;  3CM6 A;  4CGG A;  4FLY A;  4N5S A;  4QAG A;  3K5N A;  1C6V A;  2AJQ A;  1JL1 A;  3LWL A;  3V1Q A;  2QXF A;  3SQ4 A;  4CHQ A;  3LP3 A;  1JXE A;  2A1S A;  1SKR A;  4CGD A;  4KV8 A;  3DLH A;  3T1A A;  5SZT A;  4GMJ B;  3WNH A;  3V9X A;  3TAE A;  1N6Q A;  2QKK A;  3M8P A;  4FM1 A;  5SWM A;  5HLF A;  4Q0B A;  2O4I A;  2O4G A;  4KTZ A;  1NKB A;  4DFM A;  4LH4 A;  1BGX T;  3I8D A;  3ALY A;  4FJI A;  3NBP A;  1IH7 A;  1HPZ A;  3AA4 A;  1BI4 A;  2RPI A;  4C8K A;  1Q9X A;  4EZ6 A;  1RNH A;  4C8N A;  4HCC A;  4Z4G A;  3JSM A;  1NK9 A;  5K14 A;  3O4Q A;  1FK9 A;  5EU7 A;  3ZSW A;  3NE6 A;  1S1W A;  1ZBU A;  2Z1J A;  4IKF A;  4PWD A;  3QEI A;  1D9D A;  3NGZ A;  1JLG A;  3I0S A;  3DRS A;  4E0D A;  3ASM A;  3VA3 A;  4E19 A;  4DTU A;  5CY4 A;  4DQI A;  1HYS A;  1XI1 A;  4DQP A;  4CJE A;  1BCM A;  4H4O A;  1QSS A;  3LP2 A;  3PV8 A;  3RWU A;  1FKP A;  4DTS A;  4Z4F A;  4OGC A;  1TKD A;  1HNI A;  1RT2 A;  4C8L A;  3AVC A;  3ITH A;  2G8W A;  4Z4H A;  3OYD A;  3TAF A;  2KZM A;  1VSM A;  1S1X A;  1T8E A;  3KJV A;  1B9D A;  5HRP A;  1IKY A;  3AVJ A;  1XWL A;  2PYJ A;  3AA3 A;  4M3X A;  1RDA A;  3QIN A;  2F96 A;  3K5O A;  4IFY A;  3AO3 A;  4CEZ A;  4HTU A;  4XIU A;  3NCI A;  4CJL A;  3LAN A;  3O3H A;  4R5P A;  4FM2 A;  3QNN A;  3HK2 A;  3O3G A;  4CHY A;  3KK3 A;  1U4B A;  4N76 A;  3O4N A;  2BGG A;  4FJ9 A;  4M3W A;  4M42 A;  4CJT A;  2HB5 A;  3HL8 A;  3HT3 A;  3OY9 A;  1KSP A;  3KLH A;  4CGH A;  1J53 A;  4DU1 A;  3ZSQ A;  3THV A;  3ZT4 A;  4LD0 A;  1VSE A;  4FW1 A;  3KKS A;  1R0A A;  4AHV A;  4ELT A;  4B9T A;  2VG5 A;  3P83 D;  3AV9 A;  3DLE A;  4DTM A;  4M3U A;  1SUQ A;  2WON A;  1I39 A;  1TL3 A;  4IFV A;  5KI6 A;  4DQS A;  3HST B;  1XC9 A;  3DLB A;  2E6L A;  2G8V A;  4CK1 A;  3OYI A;  1RT3 A;  3V81 A;  2B4J A;  4CFA A;  2OZM A;  3I0R A;  4RW6 A;  1RBV A;  2GUI A;  2YNF A;  3P1G A;  4RW4 A;  3SQ2 A;  4KB0 A;  4FJJ A;  4FK2 A;  4PQU A;  2KFN A;  4FM0 A;  2OPQ A;  4OGE A;  4CIF A;  4ZTJ A;  1BQN A;  2NUB A;  3S9H A;  3LZI A;  3VQ9 A;  1IO2 A;  3NGY A;  4O0J A;  3IS9 A;  4CE9 A;  4B9N A;  4DF4 A;  5CZ2 A;  2BE2 A;  3NGI A;  1VSD A;  3DRR A;  3SPZ A;  1J5O A;  3OYG A;  1BL3 A;  2W42 A;  4N41 A;  1RTI A;  3KD1 E;  2XO7 A;  3AO5 A;  3L2V A;  1D5A A;  2P5G A;  5DK5 A;  1LWF A;  3HJF A;  4QOZ B;  3KLF A;  4C8O A;  4F3O A;  1D8Y A;  4OKK A;  4Y1C A;  3H08 A;  4BE2 A;  3AVM A;  4FJM A;  4CHN A;  1U48 A;  2G8I A;  3NF6 A;  4ID1 A;  4DF8 A;  3AO1 A;  4E7J A;  2LSN A;  2YNH A;  3VQ7 A;  1NK5 A;  1NKC A;  3VA0 A;  3AA2 A;  1RBS A;  3QER A;  2EHG A;  1JLA A;  1RTJ A;  3SPY A;  3LAM A;  4B9U A;  1VSF A;  3PUF A;  2R7Y A;  4MQ3 A;  4DU4 A;  1JXB A;  4LH5 A;  2G8H A;  4M3T A;  2DFE A;  4F3T A;  2ZQB A;  4CEQ A;  5CYQ A;  4Q5V A;  4NCA A;  3TAG A;  4FLZ A;  4PY5 A;  1TL1 A;  1S5J A;  5KGX A;  3TAQ A;  4CGI A;  4AHS A;  3AVL A;  4B9M A;  4DTO A;  4O0I A;  4KB1 A;  5HRN A;  3QNO A;  3K5L A;  5KGW A;  4JS5 A;  3MXI A;  2KFZ A;  1JLQ A;  4RW7 A;  2OPP A;  1S9G A;  4W5R A;  3D45 A;  4CEA A;  4I7F A;  2IOC A;  3FFI A;  1NOY A;  3SCX A;  4CER A;  1WSG A;  4E1N A;  3AO2 A;  2ETJ A;  4AH9 A;  4CEE A;  3DLR A;  1C1A A;  1G15 A;  1A5V A;  3ZT1 A;  4FK0 A;  3ZSO A;  3OVN A;  2P51 A;  3ZCM A;  3UIQ A;  1T03 A;  2YHA A;  3M8S A;  4E7L A;  1TK0 A;  4O4G A;  3NH1 A;  3SQ1 A;  3V1O A;  3K59 A;  3QEX A;  3G0Z A;  4CHZ A;  4KHS A;  1HQU A;  1KRP A;  2HHT A;  1FKO A;  2IDO A;  1W9H A;  3P5J A;  3TAM A;  2OYQ A;  2HND A;  3ZSR A;  5HRS A;  4DTR A;  5CYM A;  1RT4 A;  4E89 A;  3V9U A;  4N56 A;  4JRP A;  4CGF A;  1Q8I A;  3LP0 A;  1SL1 A;  2GV9 A;  2X6N A;  4M3Z A;  3TAN A;  1BHL A;  1ASV A;  3DYA A;  5HRO A;  4DS5 A;  2HNZ A;  4CGJ A;  4CFD A;  4F4K A;  3CFR A;  2X78 A;  1HJR A;  2FC0 A;  1DLO A;  4IG3 A;  3SV4 A;  4L8R B;  4KTQ A;  3LP1 A;  4IBN A;  4G1Q A;  1L3U A;  1ZBH A;  4EP4 A;  2G8F A;  1ASW A;  1L5U A;  2PZS A;  4E7H A;  4O5B A;  1BIZ A;  4RW9 A;  4J2E A;  1L3T A;  3QLH A;  4DS4 A;  4LY7 A;  1TVR A;  3OJU A;  3OYE A;  3EY1 A;  4TSX A;  1LAW A;  3AVK A;  3C94 A;  3VQ5 A;  2Z1G A;  3S3O A;  4FZZ A;  2KTQ A;  4CFB A;  4F2S A;  2Y1J A;  4Z4E A;  3HVT A;  2HMI A;  1U04 A;  4KFB A;  4I2Q A;  2PY5 A;  1JLE A;  1BIS A;  1J9A A;  3SQ0 A;  4CFC A;  1EX4 A;  4FJX A;  3B6P A;  3OYL A;  3OYJ A;  2Z1H A;  3CFP A;  3PX0 A;  2Z1I A;  5E41 A;  2BAN A;  4IDK A;  1ZYQ A;  4DSI A;  3KLI A;  3CFO A;  3L2W A;  2HHW A;  3MXM A;  1S6P A;  3VQP A;  4K8X A;  4H8K A;  1I3A A;  1D9F A;  1C0T A;  3OYH A;  4FZX C;  3B6O A;  4B9S A;  4FLX A;  3T3F A;  3DLG A;  1LW0 A;  1K6Y A;  1KVA A;  2FBV A;  3AVG A;  4HUE A;  3TWH A;  4BDZ A;  1TK5 A;  4ELV A;  3CQ8 A;  2G8U A;  4B9V A;  1QQC A;  5CZ1 A;  4J2A A;  1FXX A;  4FVM A;  3MXJ A;  4O44 A;  2XY5 A;  1X9M A;  1BQM A;  3RMA A;  4B08 A;  1RBU A;  1NJX A;  2FBX A;  1VSK A;  4E3S A;  3RR8 A;  4FLW A;  1JL2 A;  4EZ9 A;  3LAK A;  3OS1 A;  4CCH A;  5D3G A;  4KAZ A;  4W5O A;  3TAB A;  4JRQ A;  4AHC A;  2ZE2 A;  4JLH A;  1C0U A;  4CJV A;  1VRU A;  4DMN A;  4UQG A;  1CLQ A;  5JS1 A;  4DU3 A;  1REV A;  4I9L A;  4C8M A;  3KIO A;  1CZ9 A;  1UWB A;  1SKS A;  1EXQ A;  1KLM A;  1ZBF A;  1EP4 A;  5KRT A;  5HP1 A;  2OZS A;  2HHX A;  5FRO A;  4NCB A;  4NYF A;  5FRM A;  3VQ4 A;  1VSH A;  3IRX A;  4DQQ A;  2OPS A;  5J2N A;  3QES A;  2BDP A;  4KPY A;  1BI4 B;  3NH2 A;  4BDP A;  4Z4C A;  4CJK A;  1YTU A;  1LAV A;  4M3Y A;  2OA8 A;  1HQE A;  3CYM A;  5C42 A;  4FJ5 A;  4I9Q A;  4K8Z A;  1BCO A;  4FJ8 A;  1RCH A;  1T7P A;  4I2P A;  1KVB A;  3RMB A;  4DLG A;  4KRE A;  3NFA A;  2VWJ A;  1VRT A;  1DTT A;  3HPO A;  3MED A;  2YV0 X;  4FJK A;  3AVB A;  4O55 A;  4KTW A;  1JLF A;  3HVR A;  4DTX A;  2HHS A;  4YNQ A;  2FBT A;  3L2Q A;  4CF9 A;  1C1C A;  1HYV A;  4EP5 A;  3SYZ A;  4W5N A;  4CJU A;  1GOA A;  3QO9 A;  4CJQ A;  1S1T A;  4N47 A;  4CIG A;  4BE0 A;  2YHB A;  3VQQ A;  4F8R A;  2OPR A;  3RMC A;  3ZT0 A;  5FRN A;  1ZBI A;  3ZT3 A;  3DLK A;  3HP6 A;  3V6D A;  4BWJ A;  4ZTF A;  3MEG A;  1KTQ A;  2X74 A;  3KKR A;  4OKJ A;  1X1P A;  3K57 A;  3V9S A;  2EX3 A;  5J2P A;  1IKX A;  3SNN A;  4B9L A;  2VG6 A;  4DG1 A;  4OJR A;  4CK3 A;  1TAQ A;  3HP9 A;  3L2U A;  4IG0 A;  4FJN A;  1TGO A;  1TKT A;  2VWK A;  4H4M A;  1XHZ A;  1KCF A;  1Q9Y A;  4WE1 A;  1QS4 A;  4CF1 A;  3RRH A;  4FJG A;  1B9F A;  1GOB A;  4CEF A;  2X6S A;  3OYC A;  1ITG A;  3U6F A;  3PO4 A;  1HNV A;  3OS0 A;  3DRP A;  3L3U A;  4FJH A;  4FLV A;  4KRF A;  2D0C A;  1NJZ A;  1QSY A;  1RIL A;  4DSK A;  1UAX A;  3U3G A;  3HXM A;  4E1M A;  4KKO A;  4KHU A;  1VSJ A;  3PY8 A;  4HVJ A;  5J2Q A;  5I42 A;  3PX4 A;  5HRR A;  1S6Q A;  1HMV A;  2D0B A;  4MFB A;  3TR8 A;  4B8A B;  4CJR A;  3NAE A;  1DTQ A;  3NH0 A;  3OYM A;  3QIO A;  4CJ4 A;  2DTU A;  1IKW A;  4E7K A;  3VQA A;  1A5W A;  4YFU A;  1N5Y A;  1U49 A;  3T19 A;  2HVH A;  1GOC A;  4FCY A;  1WSI A;  3CG7 A;  1RDC A;  4PA1 A;  4CF2 A;  1RDD A;  3DOL A;  3AO4 A;  2IC3 A;  1JKH A;  1WLJ A;  3C6T A;  2E4L A;  1SV5 A;  4DQR A;  3AVH A;  4J2D A;  1O1W A;  3SI6 A;  3AVI A;  3VQC A;  4OLA A;  4DFP A;  3AA5 X;  3DMJ A;  5C24 A;  1TKZ A;  5JS2 A;  3VQE A;  3TAR A;  4RG8 A;  3G10 A;  3VQ8 A;  2RF2 A;  3NF7 A;  4FJ7 A;  5KRS A;  4FYD A;  2HNY A;  3QEP A;  3V1R A;  2HHU A;  1Z26 A;  4Z4I A;  1HRH A;  2DFF A;  4E7I A;  4NCG A;  1WNS A;  3SUQ A;  3L8B A;  1WSJ A;  1NK7 A;  4OKE A;  1QTM A;  3LPU A;  3M8Q A;  1UA0 A;  3ZSV A;  3KTQ A;  1MU2 A;  1S9E A;  3SUO A;  3RRG A;  1JLC A;  1YT3 A;  2P5O A;  3WNG A;  4DWI A;  3VQD A;  4DSL A;  2IGI A;  3U3Y A;  1Y97 A;  1X9W A;  1NK0 A;  4LSN A;  2XHB A;  1VSL A;  3NHG A;  3IAY A;  4BWM A;  4GVM A;  4M45 A;  3V4I A;  2XY8 A;  3EZ5 A;  4AHR A;  3S3N A;  1U45 A;  4FLT A;  3OS2 A;  2F8T A;  2D5R A;  1WSF A;  4ZHR A;  3V9Z A;  2XY6 A;  2YKM A;  4DFJ A;  1NJW A;  4KHY A;  1U47 A;  3HPH A;  4FW2 A;  4W5Q A;  1L3S A;  1HYZ A;  2QK9 A;  3ULD A;  2ITG A;  4B8C A;  4HHT A;  2E6M A;  1QE1 A;  1KLN A;  3LAL A;  3C6U A;  1NOZ A;  3HPG A;  2B5J A;  3M8R A;  1CZB A;  2IS3 A;  1LWE A;  3PO5 A;  4FZY A;  4CHO A;  3DI6 A;  4CIE A;  1TV6 A;  4BE1 A;  4FLU A;  4CJS A;  3JYT A;  3SV3 A;  1SL2 A;  1S1V A;  3VQ6 A;  1SKW A;  1L3V A;  3WNF A;  3KD5 E;  1WAF A;  4KI6 A;  1UOC A;  2HHQ A;  3C95 A;  1F21 A;  2GBZ A;  3SUP A;  1RBR A;  1ZBL A;  5C25 A;  1NK8 A;  3OYK A;  3WNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...