4CEAA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
154
structure length
150
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 57
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ceaA00
1JXEA 1NK9A 1QSSA 4C8NA 3SUQA 1KVAA 2RN2A 4DQQA 1C1AA 4FJJA 3MXJA 2G8KA 2HHUA 4KO0A 3O4NA 1U47A 4EZ6A 1RBUA 4CK3A 1HYSA 3OYKA 2KW4A 2HHVA 4RW8A 1RTIA 1RDBA 4I9QA 4Z4EA 1WSFA 1XHXA 4F4KA 4M3YA 2IC3A 4Z4IA 1UOCA 2D0CA 2IDOA 1Z25A 3SZ2A 4RW6A 4DSFA 4DMNA 1QSYA 1XHZA 1I3AA 2X6NA 3P5JA 5J1EA 3HVRA 2OPQA 4KHUA 4L8RB 4DTMA 5CZ2A 4DQPA 2PY5A 3OYGA 4BWMA 4N41A 1VSMA 3KIOA 4DTJA 2B5JA 1REVA 3SQ4A 2D5RA 4M3WA 1C0UA 1KLMA 2E4LA 2HNDA 4Z4CA 3HP6A 3ULDA 4FM1A 4LY7A 3K5NA 2OPPA 3NCIA 1SKRA 3DLHA 4C8KA 3QERA 3RMAA 3DLGA 2VWKA 5HP1A 3QEIA 5HBMA 4LD0A 4DS4A 2YKMA 4B8CA 1CXQA 3PX0A 1ZBIA 4GW6A 2ZQBA 4KKOA 3CG7A 3T19A 4W5RA 2OPRA 4B08A 3MAQA 1UA0A 4AH9A 4E7JA 4GVMA 1J9AA 3ZSYA 1F21A 4CJLA 3OYEA 3ZSZA 1BQMA 3KLIA 3NE6A 2AJQA 1CLQA 1RT6A 3T3FA 2O4IA 4NCAA 2E6MA 3DRRA 3K57A 4DQIA 2GUIA 3ZT0A 2RKIA 4CK1A 4HUEA 4OJRA 5KRTA 4Z4HA 3WNEA 3ZT1A 4J2DA 1S9EA 3RMBA 3U6FA 4DTXA 4FLUA 1S1UA 1VSHA 2HHQA 5J2QA 1IH7A 2WONA 3CM5A 1NK5A 2G8IA 4CFDA 4E7KA 1L3SA 4KHYA 1SKSA 1BIUA 4KTQA 4JS4A 1RTJA 4HTUA 3K5MA 3WNHA 4QOZB 4R5PA 3KJVA 1A5VA 4DFJA 1KTQA 1NJZA 3BGRA 4EZ9A 4O4GA 4CHPA 4HCCA 4F3TA 1WNSA 2LSNA 1S1VA 4DTSA 4B9VA 4FCYA 1Z26A 4Q0BA 5FROA 3NH1A 1I39A 4I2QA 4Y1CA 2XY7A 2E6LA 3OYIA 2ZE2A 2JLEA 3AA4A 1JXBA 3L2VA 3RR7A 4KPYA 2Q3SA 2YHBA 3OS1A 4B8AB 3C95A 4RW4A 4O44A 3SQ0A 4KHWA 4DF8A 1D9FA 4FM0A 3HM9A 1FKPA 2FBXA 4ZTJA 3SPZA 5HRNA 1XC9A 3T1AA 1EX4A 3OYCA 3S9HA 4BE1A 3AVKA 4J2EA 1ZBFA 1S6PA 1NK6A 4KRFA 5KI6A 2FBTA 3G10A 5CYQA 1T7PA 3DYAA 4BACA 2BGGA 1O1WA 1RDCA 1HNIA 4CJ5A 5CYMA 4FM2A 1RT7A 3MEEA 5KGXA 2Y1JA 5HRPA 1N5YA 2OA8A 1BQNA 4KI4A 3M8QA 5HRRA 4NCBA 3HPGA 4W5OA 3LWLA 2P5GA 4CJWA 4FJMA 4H4MA 3RTVA 4M42A 1ASUA 4N5SA 5KRSA 4N76A 3V9SA 2YV0X 2KQ2A 1B9DA 4AHCA 4FJHA 4ICLA 4B9SA 3LAKA 3VQ5A 1SV5A 3WNFA 1RT2A 4CIGA 1BISA 1TAUA 3AVFA 4MFBA 1ITGA 3SNNA 4FJ8A 4G1QA 5FDLA 1S9GA 3ZT2A 4IDKA 3ZCMA 3NGZA 3L8BA 1X9MA 2B6AA 3MXIA 4M41A 4DSKA 1RBRA 3AA5X 4DG1A 4FJNA 3KLGA 4W5TA 2XY5A 3PX4A 2HHXA 4KB1A 4E1NA 2YNFA 1EETA 1YVUA 3QEPA 1U04A 1L3TA 4TSXA 5SZTA 4FZYA 2B4JA 3SJJA 1U4BA 1HYZA 4O0JA 1KCFA 5JS2A 1VRTA 2P1JA 4OLAA 3QEVA 2FBVA 2YHAA 4FJ9A 5FRMA 2OZSA 1NK4A 4UQGA 1DTTA 1TKXA 3DLBA 1QS4A 4DS5A 1WLJA 4AHSA 2G8FA 1LAVA 4N56A 4CEZA 3TAGA 2KZZA 4BDZA 4M45A 4F8RA 4GMJB 4NYFA 4CJ3A 1TAQA 1NJYA 4KFBA 4DFMA 2G8UA 3S3NA 1C1CA 5HLFA 4OPJA 2ATQA 1BCOA 4CJFA 1D5AA 2HHSA 2X6SA 3OS0A 4PWDA 1IKXA 1LWCA 4CGDA 4CEQA 4BE2A 1BCMA 1NOYA 4CE9A 3I0SA 1ZBHA 3KTQA 3K58A 1QTMA 4LSNA 4BWJA 2YNGA 3JSMA 1ZYQA 3BDPA 3AVLA 1JLAA 3L3VA 3L3UA 4FLZA 3HK2A 3MEDA 1JKHA 3ZSXA 3NH2A 4CJTA 3TAEA 1U48A 3OJSA 1TK8A 2YKNA 2VG5A 4FJXA 3SCXA 3VQCA 1S5JA 4FW2A 3V1OA 3O3FA 2Y1IA 1L3VA 2G8WA 3ZSQA 5J2PA 2OYQA 3KK1A 1TK5A 1KVCA 3OYHA 4DSJA 4DWIA 4DTRA 1J53A 3AO4A 1RTHA 3OYNA 4HUFA 4FK0A 1SUQA 4ZHRA 3VA3A 3MXMA 1X9WA 2G8HA 3V9WA 2BDPA 1BL3A 1IO2A 2I5JA 2YNIA 4I9LA 4B9LA 3LP0A 4JLHA 3DMJA 4IG0A 4CERA 4E7IA 3VQDA 4DU4A 1LW0A 3LP3A 1RDAA 4AHRA 4E19A 4FLVA 3SQ1A 5JS1A 1L3UA 4XIUA 4CJ4A 3AVHA 2ETJA 1FKOA 3QESA 2F8TA 3VQEA 5I3UA 2O4GA 1VRUA 4AHVA 3OYDA 4H4OA 1TVRA 4CGIA 4CGJA 4FJLA 4PY5A 3MEGA 1RILA 1ZBUA 1S1WA 2YNHA 1U49A 2VG6A 4FLXA 2GV9A 3IS9A 4RW7A 3TABA 1IKVA 1C0TA 1MU2A 4HHTA 4NYNA 3OYMA 3KLEA 1GOAA 3SQ2A 2HB5A 1Y97A 3L2WA 4E3SA 4CEEA 1NJXA 4C8LA 3OVNA 1K6YA 1LWEA 3ASMA 4OKJA 3CFRA 4JS5A 3U3YA 4FLTA 3SUOA 1SL2A 1L5UA 3HPOA 2KFZA 3KLHA 2X74A 3LALA 1UWBA 2DFEA 5HRSA 1BIZA 4Q5VA 3TWHA 4DSIA 4C8MA 4LH5A 3V1QA 2F8SA 1ASWA 4KV8A 3NF7A 3DLRA 3SI6A 1RT1A 1VSKA 1QHTA 3S3OA 4EP5A 4EP4A 3AO5A 1TK0A 1RNHA 1C0MA 4KTWA 3HJFA 4CHQA 3QNNA 4B9UA 2FBYA 3KKSA 3C94A 1Q8IA 3OYLA 3RRGA 4M3RA 2HHWA 3LP1A 1FXXA 3QEXA 1VSFA 1ASVA 3HVTA 4AILC 3VQBA 1HYVA 3V6DA 3CM6A 3LPTA 3PUFA 4Z0UA 4CK2A 3HYFA 4FXDA 1TL3A 1DLOA 5J2MA 2DFHA 3DLEA 2XO7A 4HUGA 4CHZA 4KHSA 4FZXC 2KFNA 3AVAA 2QKKA 4RG8A 4FVMA 3VQQA 2GBZA 3TARA 1XWLA 3QETA 1C6VA 2IGIA 3CFOA 3DOLA 5FRNA 4FYDA 4O55A 4ELVA 2QKBA 3KLFA 3TAQA 1JLCA 1KFDA 1UA1A 3AA3A 1WSJA 3SV3A 4DSLA 4BDYA 1U45A 3RWUA 4ID5A 2QXFA 1JLGA 3AVMA 1RBTA 1HRHA 1RBVA 3NHGA 4JRPA 3KK3A 3OYJA 2W42A 2Z1GA 3SV4A 3TAMA 3JYTA 1NKEA 4I2PA 3RRHA 1UAXA 1XI1A 2EHGA 1VSIA 4CF2A 3VA0A 3PO5A 4QCLA 3V9XA 4CFAA 1X1PA 1NK7A 4QAGA 1JLFA 3PY8A 3HL8A 4PA1A 3EY1A 1SKWA 4DU1A 1CXUA 4CEFA 3B6PA 3VQPA 4BE0A 3AVJA 3LAMA 3NF6A 3TAPA 3AVCA 3RR8A 3TANA 4CJKA 3K5LA 1Q9XA 4KHNA 1SL1A 2A1SA 4CFCA 1KLNA 4FW1A 2HHTA 3AA2A 4KTZA 1T05A 2DFFA 4CGHA 5EU7A 4DFKA 4J2BA 2DY4A 1B92A 3DOKA 1RDDA 4F2SA 3AO1A 1EP4A 4B9NA 2OPSA 3WNGA 5D3GA 5KGWA 1Q9YA 4IFVA 4LSLA 2PYJA 3RMCA 3VQAA 1B9FA 4W5NA 1HQEA 4Z4FA 1JL2A 2BE2A 1NK8A 4AHUA 3PX6A 3TI0A 4DQSA 3DRSA 3P1GA 3QNOA 1KFSA 5I42A 3IRXA 1WN7A 3QIOA 1TKDA 4C8OA 4B3OA 4OKKA 1QQCA 3EYZA 4DF4A 4CEBA 1LWFA 4K8XA 4KHQA 2OZMA 4CJSA 3LZJA 3CQ8A 3HSTB 1GOCA 3VN5A 3C6TA 3AO3A 3VQ8A 3KKRA 3TAFA 1IG9A 1WAFA 1NKCA 2FC0A 3UIQA 1VK0A 4MQ3A 4CHOA 4HCBA 1FK9A 1WSHA 4I7FA 3H08A 3KK2A 1S6QA 4JRQA 4F2RA 3DLKA 2BANA 4CJQA 3KD1E 3CFPA 2HNYA 3K5OA 2WOMA 1BGXT 1NOZA 2JGUA 4OGCA 3ZSRA 1KVBA 4FJ5A 2KZMA 3HPHA 4CHNA 2ITGA 3IAYA 3LZIA 2D0BA 3AVIA 4IBNA 4CJUA 1TL1A 1JLQA 4CEDA 1VSJA 1CZBA 4IG3A 3V81A 1JL1A 3S3MA 4ELTA 4DTUA 4E1MA 1KRPA 4M3TA 1CZ9A 3NF8A 3U3GA 3SUNA 2Z1HA 4DQRA 5KTQA 3ITHA 2IOCA 5K14A 4CFBA 5C25A 3L2RA 1J5OA 1RT3A 3FFIA 2HMIA 1LAWA 3LPUA 4CGFA 5T7BA 3O3HA 1W9HA 3A2FA 4K8ZA 3V9ZA 3AVBA 2QK9A 4KAZA 1IKWA 1KSPA 1BI4B 3I0RA 1A5WA 1BHLA 2DTUA 3C6UA 1N6QA 1R0AA 4J2AA 2A1RA 2P51A 1LW2A 4CF1A 3OYAA 4FJIA 4ZTFA 2EX3A 4Z4GA 4N47A 1YTUA 4B9MA 1VSLA 4M3UA 2HVHA 2X78A 4FK4A 4CJRA 1LV5A 3M8RA 4FJKA 4CHYA 3O3GA 3PO4A 4YFUA 3MECA 4NCGA 4KB0A 4CF8A 4E89A 1EKEA 4LH4A 3SPYA 3OY9A 3DRPA 1A5XA 2Z1IA 4B9TA 3QEWA 1IKYA 3PV8A 1VSDA 3ISNC 2P5OA 4FLYA 3V1RA 4IFYA 1EXQA 1WSGA 3EZ5A 1RT5A 2XHBA 4CIFA 4E7LA 3THVA 2HNZA 3NH0A 4CCHA 2PZSA 2IS3A 3QLHA 4CECA 4HVJA 3E01A 3IG1A 3ZSOA 3M8SA 3NGIA 1NK0A 4OLBA 2IAJA 2RF2A 4ID1A 3VQ9A 3AV9A 3NF9A 3CYMA 3SYZA 3K2PA 3QINA 3HXMA 1RTDA 1S1TA 5HROA 4PUOA 3ZSWA 3F73A 3NAEA 3OYBA 4OVLA 2NUBA 4YNQA 4M3XA 1G15A 4OKEA 4OPKA 4KI6A 4O5BA 1YT3A 3OYFA 1TKTA 1DTQA 4CJEA 3LDSA 3P83D 3D45A 4CJVA 1NJWA 5CY4A 1S1XA 3OS2A 3B6OA 5CZ1A 4FLWA 1T8EA 5SWMA 4CEOA 1TGOA 1JLEA 5E41A 3VQ4A 1QSLA 4OGEA 5J2NA 3LWMA 3L2UA 3RMDA 1WSIA 4CJPA 2VWJA 4DFPA 1JLBA 2D0AA 3NGYA 5DK5A 3TR8A 5C42A 1SL0A 4CESA 2G8VA 1HNVA 4AHTA 2XY8A 4F3OA 3O4QA 3HP9A 4E7HA 4CEAA 1WSEA 2ZD1A 2R7YA 3ZSVA 1RBSA 1QE1A 4FK2A 1TKZA 3AVGA 4CIEA 2PYLA 3QIPA 4DLEA 3LP2A 4KREA 4CF9A 2XY6A 1HMVA 4CGGA 3ZT4A 1D9DA 3LANA 3NBPA 4WE1A 4FJ7A 4IKFA 3V9UA 3ALYA 4DTOA 4DU3A 1T03A 2Z1JA 2HW3A 1HQUA 1J54A 4M3ZA 3M8PA 3ZT3A 3AVNA 4BDPA 5DMRA 1RT4A 1VSEA 4Y1DA 1HJRA 1HPZA 3NFAA 3QO9A 3VQ7A 1D8YA 3K59A 3AO2A 2KTQA 3HT3A 4PQUA 1W0HA 2F96A 2VG7A 4RW9A 1X9SA 2HVIA 3SUPA 1YTAA 3VQ6A 3KD5E 4CF0A 3HO1A 4E0DA 4W5QA 4DSEA 3I8DA 3DI6A 1WAJA 3L2QA 4DTNA 3G0ZA 4FJGA 2RPIA 4DLGA 4FZZA 4H8KA 1ZBLA 5C24A 3NDKA 1C1BA 4O0IA 1TV6A 4DTPA 4ELUA 3F9KA 3OJUA 3D0PA 3V4IA 2XRIA 1RCHA 1NKBA 3DM2A 1GOBA 1BI4A
chains in the Genus database with same CATH superfamily
1JXEA 1OH8A 2YCHA 1D4XA 3SUQA 2RN2A 2V52B 4FJJA 1KAXA 2A41A 3MWTA 4IZ9A 1SZ2A 3O6WA 1WUAA 5BPNA 4RW8A 1RTIA 4KH6A 4DV6K 2IC3A 4ISGA 4RW6A 3CCVN 2UUBK 4B9QA 3P5JA 5J1EA 1BG3A 2QI2A 4L3QA 3ULDA 3K5NA 3TSPA 2ZGZA 3QERA 3DLGA 4LD0A 4YY3K 5ELZA 4DS4A 1CXQA 5AZIA 4BC2A 1K8KA 3JXUA 4W5RA 2OPRA 1UA0A 2FLOA 1F21A 1TUUA 2E2OA 2HBMA 3KLIA 3NE6A 3ZX3A 5H1SQ 4NCAA 2E6MA 4JK8A 3VEVA 1VQNN 5KRTA 5AQXA 4DTXA 2QWRA 3LM2A 3RVCA 1VSHA 4BRDA 2G8IA 1IH7A 2WONA 4BG9A 4E7KA 4BR7A 4KHYA 4RTFD 4H5NA 3WT0A 1VQ7N 4R5PA 5AFUA 2Q1NA 4DFJA 1YVNA 1NJZA 4X66K 3IMXA 4FOEA 3DXMB 4OPHA 4Q0BA 1I39A 4JKGB 2JLEA 3AA4A 1JXBA 3HSCA 2Q3SA 4B8AB 3C95A 4RW4A 4KHWA 4DF8A 4FM0A 3EKSA 3VOVA 2FBXA 3HM9A 3SPZA 1XC9A 4JI0K 3QFPA 4BE1A 3JAMO 4BRGA 3UE5A 4J2EA 5AQOA 1WBDA 1S6PA 3G10A 4LFAK 3DYAA 1IJJA 4BACA 1O1WA 1RDCA 1HNIA 4FM2A 5CYMA 1N5YA 1RT7A 5KGXA 1DT9A 1K73O 4LC9B 3HPGA 4X64K 2P5GA 3RTVA 2Q2RA 3QFUA 1NNEA 4H0XB 3V9SA 2YV0X 3MCPA 4BRFA 4H5WA 4CIGA 3THWB 5C12A 4FJ8A 2O8DB 5FDLA 3ZCMA 3MXIA 4FJNA 2VGNA 4FSVA 3KLGA 2HHXA 1MA9B 4FOIA 1L3TA 4TSXA 1S3XA 5AR0A 5SZTA 3ZLJA 2B4JA 1U4BA 4O0JA 2FBVA 2YHAA 5EX5A 4UQGA 1TKXA 1QS4A 1WLJA 4IOXA 1NGDA 1NM1A 3H6EA 4F8RA 4NYFA 1RDUA 5AQHA 1NJYA 4JAXA 4V19S 2D4WA 3MX5A 4BRAA 3BY5A 3CJAA 4IDHA 2ATQA 5EVZA 2HHSA 5AQJA 4PWDA 1IKXA 1YJWN 1LWCA 4CGDA 4XH4A 2NRTA 1QTMA 4LSNA 3WXLA 4B1XB 2GX9A 5B8HA 3BDPA 3L3VA 3ZSXA 1U48A 4FJXA 4GY2B 4CJTA 3SCXA 3VQCA 1YJNN 5KPZA 3V1OA 2Y1IA 1VQ8N 3ZSQA 5J2PA 3KK1A 1TK5A 1KVCA 4B1WB 4DTRA 3J81O 1RTHA 3OYNA 2Q0RA 5JVGL 3MXMA 4AF1A 2G8HA 3ULEB 2QWQA 2BDPA 1NGHA 3DMJA 4CERA 4DU4A 4GV6A 1RDAA 3E9LA 4XIUA 2ETJA 2F8TA 5KQDA 4H4OA 1S1WA 4RW7A 3VGMA 5FPEA 1MU2A 4NYNA 3J80O 3AGKA 3KLEA 3R3LA 1HJOA 3ASMA 1SL2A 1L5UA 1CLQA 4FLTA 2KFZA 2X74A 4Q5VA 4WQ5A 3DLRA 3L4IA 5C15A 3S3OA 4EP4A 3AO5A 1RNHA 4KTWA 1OH5A 2NZTA 4M3RA 2HHWA 3O9SA 1VSFA 3HVTA 3O08A 2KLAA 3LPTA 3PUFA 4CK2A 3HYFA 3DLEA 2XO7A 5TKYA 2KFNA 3AVAA 2HBKA 1E4FT 4BROA 2P9NB 4FVMA 5HL7L 2GBZA 3TARA 4DR2K 3CD6N 2P9UB 4FYDA 4KHPK 4LF6K 1VHXA 1WSJA 2W6LA 3NHGA 3TSUA 4JRPA 3KK3A 2J4RA 2W42A 2Z1GA 2ZWHA 1XI1A 3VA0A 3V9XA 4CFAA 1JLFA 4PL8A 4PA1A 3EY1A 3N4QA 4DU1A 3AVJA 3LAMA 1KLNA 5FPNA 2HHTA 3A5OC 4DFKA 3DOKA 1GLEG 5AQGA 4YOTA 4AM6A 5E26A 1GLCG 3RMCA 1B9FA 3M5RA 4LF5K 3PX6A 3TI0A 4DQSA 3P1GA 3QNOA 1HNXK 2RHKA 3GG4A 1WN7A 4OKKA 1QQCA 3I33A 4HWIA 4FL9A 3HSTB 1GOCA 3VN5A 4FWPA 3VGLA 2O8BB 3KKRA 3TAFA 1NKCA 2FC0A 2P9PB 2W41A 4HCBA 5C10A 3H08A 5BREA 3DLKA 2BANA 4GKKK 3CFPA 2WOMA 1BGXT 3ZSRA 2KZMA 3IAYA 3LZIA 4CJUA 1JLQA 1VSJA 1X3MA 4IG3A 1JL1A 4E1MA 1KRPA 3U3GA 4H0PA 4FVUA 3ITHA 3HBTA 4ILGB 1YI2N 5T7BA 3O3HA 2D1KA 2QK9A 4IEEA 3ID8A 1KSPA 2CH5A 1Q81O 2A1RA 3OYAA 4Z4GA 4N47A 1HPMA 2Q97A 1GLJO 4CJRA 3A5MC 3PO4A 4YFUA 4KB0A 2UU9K 5EOYA 2P9LA 1S22A 2ZM6K 1IKYA 3ISNC 4FLYA 1VAZA 4IFYA 4WF9L 3THVA 2HNZA 1V4TA 3E01A 4OLBA 4JI3K 2GELA 5AQLA 3VEWA 3P31A 4DV1K 3QDKA 3QINA 5IWAK 4A62A 5HROA 3UKUB 3F73A 1BU6O 3RSEB 3VPZA 4BRKA 4YNQA 4M3XA 4OPKA 1YT3A 1DTQA 3UKRA 4KBOA 3ATVA 1NJWA 1NBWA 5CZ1A 4FLWA 1FW6A 2UXDK 3WUHA 5M1FA 3O8MA 4OGEA 4B1VA 3RMDA 3BEXA 3EZWA 4DUYK 4C23A 5C42A 5JMVA 3VTIA 2XY8A 3O4QA 1VQMN 4E7HA 1EQYA 1P90A 4BR4A 2O8EB 1RBSA 2XY6A 3HOSA 3LANA 4FJ7A 2HW3A 2Z1JA 2ZGYA 3M8PA 1MWKA 3A5LC 3TTCA 1VSEA 4ILJA 2I7NA 2KTQA 3VMFB 3HT3A 4M7YA 4RW9A 3SUPA 3CCQN 3VQ6A 3KD5E 4E0DA 1QVGM 4AQYK 4BR2A 4IEIA 1NGFA 4FJGA 1ZBLA 2Q31A 2H3GX 1TV6A 4YOVA 3F9KA 1QZ5A 3V4IA 4CBXA 3L2RA 1GOBA 1NK9A 1QSSA 1KVAA 4PKHA 3U8XA 3MWPA 4LF4K 4DCHA 4JKDA 3WXMB 1HNZK 3D2EB 4BGBA 1U47A 4EZ6A 3W3DA 4CK3A 2KW4A 1DKGD 2YHYA 3MDQA 4I9QA 1HKCA 3LDPA 4JHDA 1XMQK 4LF7K 4EHUA 3SZ2A 4OX9K 1I3AA 3ZETB 5I9EB 3HVRA 4B1UB 4JKCA 4N41A 5BR8K 1C0UA 4FM1A 4LY7A 2OPPA 1SKRA 3DLHA 2VWKA 5HP1A 4DKWA 3DXMA 3MK6A 4PHTX 1RDWX 4B1ZA 4JKGA 4KKOA 3CG7A 4AH9A 5GINA 3UB5A 4E7JA 3ZSYA 1VQLN 4IWVA 1RT6A 2GUIA 3ZT0A 4CK1A 4FWNA 1Q86O 4O8UA 4OJRA 4Z4HA 3ZT1A 4J2DA 2O8CA 1S9EA 5LJWA 3U6FA 1S1UA 2O8FB 3CCRN 1XQSC 1BIUA 4KTQA 1RTJA 3F5TA 3FFKB 2I7PA 1Q7YO 4PL7A 4BC5A 3BGRA 4O4GA 4FO0A 4CHPA 4F3TA 4DTSA 3THWA 3WXKA 5FROA 2O8DA 3NH1A 2XY7A 2E6LA 3RR7A 3L2VA 1E3MA 4H5RA 3U4LA 2FF3B 3SQ0A 4NXNK 5FPDA 1FKPA 4K0KK 3CI5A 2ZJRL 1IV0A 1EX4A 2PBDA 1NGBA 1ZBFA 3CCLN 3K0SA 3C6HA 4JI1K 3MN9A 1GLAG 1HYSA 3OTOK 4KI4A 5HRRA 1SAZA 4W5OA 3P39A 3LWLA 4NLBA 3THYA 4BRIA 4B3TK 1U2VB 4N76A 4N5SA 3G6EN 4DV2K 3IUCA 4ICLA 3OBYA 3BP8A 4B9SA 1RT2A 1TAUA 4CZIA 4MFBA 3I8BA 4G1QA 1S9GA 3NGZA 3L8BA 1X9MA 1RBRA 3AA5X 5F1XA 4K42A 3H3NO 4KB1A 5GAGP 2YNFA 4BG8A 1EETA 1YVUA 3HM8A 4U7BA 5AQWA 5JVHL 3SJJA 4FZYA 1HYZA 5JS2A 5FRMA 2OZSA 5IT9O 5AQSA 4DS5A 4A61A 4AHSA 2G8FA 1LAVA 4BDZA 4M45A 3ULEA 4GMJB 4CJ3A 1TAQA 4DFMA 1HLUA 3VF2A 4ISFA 3CMEN 4OPJA 1YJ9N 1QQMA 1D5AA 1O13A 3NVKA 4BR9A 3O9UA 4A5AA 4CEQA 2ZJQL 3I0SA 1ZBHA 2E2NA 3K58A 4YHHK 3U9DA 4FLZA 1JKHA 3TAEA 1TK8A 2VGMA 4H03B 1JCFA 1S5JA 2G8WA 4WFBL 5EY4A 1YIJN 3OYHA 4DSJA 3C7NA 1J53A 3AO4A 3QBWA 5BPLA 4NLCA 3VA3A 2P9IA 3V9WA 3G4SN 3CC2N 1BL3A 4JI6K 2I5JA 4I9LA 3VQDA 2A3ZA 1LW0A 4FLVA 5JS1A 5FLXO 2OTJN 4CJ4A 1FKOA 3FZFA 1SS6A 1VRUA 3OYDA 2P9NA 4CGIA 3MEGA 1U49A 2E5LK 2HBLA 4JKFA 3WEEA 2GV9A 4FLXA 4HHTA 4YOUA 2F7TA 3HI0A 3SQ2A 1ZXOA 3CFRA 3U3YA 2DPNA 4A2AA 4ILHA 1SQKA 3LALA 5AQPA 2DFEA 5HRSA 1BIZA 3TWHA 4LH5A 4KV8A 3SI6A 3CETA 4YORA 1TK0A 2A42A 2FBYA 3KKSA 3C94A 1Q8IA 3OYLA 4DV7K 1ASVA 3VEZA 4Z0UA 4FXDA 4F9OA 1TL3A 4WQ4C 4CHZA 2QKKA 3PIPL 4RG8A 3ZEUB 3CFOA 5FRNA 4O55A 1IG8A 3KLFA 2VQFK 4WFNL 3RWUA 3O9RA 3AA3A 4OPAA 4BDYA 1TYQB 1ZC6A 1U45A 2GWJA 2QXFA 1RBVA 3L4QA 2WBNA 3SV4A 4F4KA 5ADXH 3CERA 3SAFA 2O8BA 1MDUB 1CXUA 3D7EO 4CEFA 2P9PA 4BE0A 5JICA 1HKBA 4CJKA 4KHNA 2A1SA 4CFCA 4FW1A 5BN9A 1QHAA 1YF5L 2DFFA 4CGHA 5EU7A 4Z94A 4J2BA 1RDDA 2FSNA 2NRVA 1S72N 1K8AO 2OPSA 4IO9L 5D3GA 5KGWA 4LSLA 4NB4A 3S41A 3VQAA 4W5NA 2BE2A 1NK8A 4I6MA 4IFEA 3DRSA 3SJHA 4C1NI 3IRXA 1TKDA 1Q18A 4CEBA 1LWFA 4FWLA 3VEOA 4G9ZA 3CXCM 4CZMA 1NU0A 3LL3A 3UIQA 3TTFA 1WSHA 4I7FA 4JRQA 4CJQA 3KD1E 2KKZA 1GLLO 1NOZA 2JGUA 1KVBA 1BA1A 2YI1A 3VF4A 4CHNA 2ITGA 4IBNA 2E1YA 1CZBA 4ELTA 3S3MA 4M3TA 3FE1A 3NF8A 1C0FA 2Z1HA 2A5XA 2E1ZA 5K14A 5C25A 1BO5O 2HMIA 3LPUA 4CGFA 1OH6A 4CZEA 4EFHA 4JI5K 1A5WA 4QS7A 2DTUA 3C6UA 2IVOA 1R0AA 1LW2A 4CF1A 4B3MK 4JI7K 3CCSN 4M3UA 4B3RK 2HBJA 4FK4A 3M8RA 3O3GA 4E89A 3G71N 4IOAL 2HF3A 2QM1A 4JN4A 2P5OA 3V1RA 1WSGA 1VQPN 1RT5A 4E7LA 3NH0A 4BRQA 2PZSA 4B1YB 4CECA 2KZZA 3NGIA 5DM7L 3IG1A 2QWNA 3ZSOA 4LF9K 2D0OA 3AV9A 2YJFA 3CYMA 3SYZA 3K2PA 1N8RO 1ZBSA 4DQ8A 4DUZK 2YX6A 1T3VA 4BQZA 1R59O 3WXJA 1G15A 3H45C 2F4VK 3OYFA 4CJEA 3EE8A 1NGCA 5AZIB 4CJVA 2P9SA 1S1XA 1T8EA 3CQYA 4JEPA 1CZAN 3J7YP 3LWMA 4CJPA 4X65K 4DFPA 1JLBA 3NGYA 4BC4A 1ATSA 2VYPA 4CESA 4R79A 3FZKA 2P9KB 4CEAA 3ZSVA 4EHTA 4FK2A 3AVGA 4KH5A 1WB9A 4DLEA 4KREA 4CF9A 3D2EA 1D9DA 4BY9C 4WE1A 3TPQA 3ALYA 4DTOA 1T03A 4H5TA 3AVNA 4CW7B 1YAGA 5DMRA 1RT4A 4Y1DA 1HJRA 3BZKA 3NFAA 3SMSA 4PKIA 2GEMA 1YXQA 4XH1A 1W0HA 2F96A 1NJIO 2HVIA 4DB3A 1YTAA 3HO1A 2V51B 4IJNA 4JI2K 3I8DA 3E66A 4H5VA 3G0ZA 2RPIA 4FZZA 4H8KA 5C24A 1ILYA 4O0IA 5FPMA 4DTPA 2XRIA 2UYTA 1BI4A 4JKEA 2AP1A 1HUXA 4DQQA 2VQEK 3MXJA 2G8KA 4JK9A 2HOEA 5M1NA 5GAEP 5AFUH 2HHUA 5BRDA 2QEXN 4J8FA 3CCMN 4CZHA 1RDBA 4RWTA 2VWBA 1XHXA 1J5EK 1T44A 2D0CA 2IDOA 1Z25A 5LJVA 4HTLA 4GV9A 4DSFA 4DMNA 1N34K 4KHUA 4L8RB 4DTMA 3O4WA 2PY5A 3SLCA 3KIOA 4Y0WA 2B5JA 1REVA 3SQ4A 4M3WA 1XNRK 1KLMA 4Z4CA 3GL1A 3RMAA 3HOTA 3QEIA 2ASPA 3DXKA 3E1YA 4B8CA 4DR5K 4BGAA 4KH4A 4U67L 4BC3A 4GW6A 2ZQBA 3CJ7A 3T19A 4WQ4A 4B08A 3MAQA 3R9PA 4GVMA 4CJLA 1GLDG 3OYEA 1BQMA 2AJQA 3AAPA 4DV5K 2HSTA 3DRRA 3K57A 4MLEA 3VF6A 2YHXA 4HUEA 3WNEA 3RMBA 4FLUA 2HHQA 5J2QA 1EWQA 5AQKA 3HRGA 3KK7A 1SKSA 4LF8K 3O5BA 3WNHA 4LFBK 1U2VA 1A5VA 3O1BA 1W97L 4JD2A 3CPWM 4EZ9A 3THXA 5AJ3K 1WNSA 2LSNA 4EAHD 4B9VA 5BN8A 4FCYA 3QICA 4I2QA 4Y1CA 3L0QA 3OYIA 2YHBA 2UUCK 1D9FA 4FWOA 2GUPA 5HRNA 3T1AA 1ESVA 1Z6RA 3OYCA 3K9KA 1Z05A 2WC9A 3AVKA 4YDUC 3H1VX 5M1OA 1NK6A 4KRFA 1BOTO 5CYQA 3GBTA 4CJ5A 4K25A 3MEEA 1P8ZA 2OA8A 3AARA 3M8QA 2ITMA 4FJMA 4H4MA 4M42A 1HNWK 5M1QA 1ASUA 1Q82O 4K43A 1GLFO 1B9DA 2KQ2A 4UY8O 4FJHA 3E9PA 3LAKA 3VQ5A 3WNFA 3SNNA 3EEQA 2QW9A 4IKFA 3ZT2A 2HMPA 2B6AA 4M41A 1X3NA 4E1NA 4BRHA 2D0PA 3QEPA 1KXPA 4DR7K 1J6ZA 3A8YA 4PKGA 3PSFA 1MWMA 3QMLA 3DLBA 4BVOA 1T6CA 4N56A 1EO1A 4DV0K 4KFBA 1XNQK 3F2KA 2G8UA 2KHOA 3S3NA 5HLFA 3FZHA 2NNWA 2QTDA 4JKAA 2BUPA 3LM9A 1N36K 2E2QA 5KPRA 1BCMA 1NGIA 1NOYA 4CE9A 1N33K 1H1VA 3H3OB 4BWJA 2YNGA 1ZYQA 3AVLA 4YOYA 3HK2A 1KQSM 3MEDA 3NH2A 3OJSA 1BWFO 1OKJA 3SAGA 2FF6A 3O3FA 1L3VA 2NLXA 1NGAA 4FK0A 4HUFA 3ENHA 4ZHRA 3CCUN 1X9WA 2F9TA 5ADXA 4CZLA 1IO2A 3LP0A 4E7IA 5JLHA 3FR0A 4E19A 3SQ1A 3DAWA 4CZKA 3QESA 4OO1J 3OHRA 4DR6K 2O4GA 2QXLA 4PY5A 1U6ZA 4AHVA 4CGJA 5GIOA 1ZBUA 2YNHA 3ZEUA 2WFBA 3TABA 5BR9A 1QZ6A 3OYMA 1GOAA 2HB5A 4E3SA 3ATUA 3OVNA 1K6YA 1LWEA 4OKJA 4JS5A 3SUOA 3KLHA 1UWBA 4DSIA 4C8MA 1ASWA 4CZFA 2RE2A 2Q0UA 1RT1A 1VSKA 4CI6A 2W40A 1QHTA 1G99A 4EP5A 1JCEA 1C0MA 1VQ9N 3HJFA 3QNNA 1KC8O 4B9UA 1NLVA 4FWSA 3RRGA 3JS6A 1FXXA 1HKGA 1HX1A 3QEXA 4BVPA 3WXIA 1Y64A 1LCUA 4DV4K 5AZJB 5AQTA 3VQQA 1NMNA 1C6VA 2IGIA 4ELVA 2AA4A 2QKBA 5BRHA 1JLCA 4DSLA 2WTUA 1UA1A 5LL6Z 2E20A 3D2FB 4ID5A 3J7AP 1BA0A 3AVMA 1HRHA 2P9LB 2E2PA 3CQXA 3I55N 3TAMA 1XUPO 1NKEA 4QCLA 1UAXA 2VCPA 1X1PA 4CD1A 3PY8A 3HL8A 1E4GT 1YHQN 2FSJA 3B6PA 1VQKN 3NF6A 3AVCA 3K5LA 4X62K 2V7ZA 4WQ5C 5AQIA 3AA2A 3VESA 3DLLL 1IBMK 4F2SA 4FPAA 5CE3A 3AO1A 1EP4A 3M1FA 4B9NA 3UKRB 3T7ZA 1M1KO 1Q9YA 2PYJA 4IFVA 4BRLA 1HQEA 4Z4FA 1JL2A 2F9WA 3EKUA 1KFSA 5I42A 3QIOA 4B3OA 3CJBA 4H0OA 4NO7A 3CQ8A 3Q7BA 3BF1A 1TUYA 2JWKA 1VQ5N 3AY9A 4MQ3A 3M6GA 4F2RA 3KK2A 3BUZB 3K5OA 4OGCA 4BQLA 3GOIA 4FJ5A 3WQTA 2D0BA 3AVIA 3R8EA 1TL1A 3VETA 3V81A 3SBTA 4DTUA 1CZ9A 3SUNA 4DQRA 2IOCA 2QWOA 1RT3A 5C2DA 1J5OA 1W9HA 3A2FA 4K8ZA 3AVBA 5F0XA 3I0RA 1BHLA 4FWKA 4YDUA 5GAHP 4J2AA 4FJIA 2P9UA 2EX3A 4ZTFA 1YTUA 2HVHA 2X78A 5BRFA 1LV5A 1RFQA 4CHYA 2GWKA 3MECA 4NCGA 3Q7CA 4MLHA 3CF5L 3SPYA 3OY9A 1A5XA 2P9KA 4B9TA 4M7XA 1X9JA 3PV8A 1VSDA 3HZ6A 4JHDB 5AQZA 3EZ5A 4CIFA 2CGJA 4HVJA 3M8SA 1NK0A 4CJ7A 5MLCQ 3W0LA 2RF2A 3I56N 4ID1A 5GADP 3MN7A 2ZF5O 3G25A 4WFAL 1RTDA 4PUOA 3ZSWA 1W2BM 3NAEA 4JNEA 4OVLA 2NUBA 4GNIA 4OKEA 4O5BA 3KWGA 3P83D 1GLBG 3D45A 2YJEA 5CY4A 3B6OA 1TGOA 1JLEA 5KPTA 3VQ4A 1QSLA 3U9ZA 5J2NA 3L2UA 1I94K 2DY4A 3TR8A 2D0AA 4JKBA 1SL0A 4AHTA 4K41A 1IBLK 4O5FA 2ZD1A 1V4SA 1QE1A 4CIEA 2O8CB 3D6RA 3ZT4A 3BZCA 1IBKK 4JKHA 4JK7A 5LMNK 1HQUA 3LDNA 3ZT3A 4CZGA 1D8YA 1HPZA 3QO9A 2UXBK 2YHWA 2PAVA 3ID6A 3O9TA 3E9OA 4W5QA 3DI6A 1WAJA 4DTNA 1ATNA 4DLGA 3D0PA 5GIPA 1WOQA 3VERA 1RCHA 3LZJA 3SK3A 4C8NA 5KQ8A 3A5NC 1W7AA 1C1AA 1XC3A 2E88A 1RGIA 4KO0A 3VGKA 3O4NA 1RBUA 3OYKA 2FXUA 2HHVA 2NRWA 3THYB 4Z4EA 3N4PA 1WSFA 4M3YA 3OBWA 4Z4IA 3SMPA 1UOCA 2QWLA 1QSYA 1XHZA 2X6NA 2A6AA 2OPQA 5CZ2A 4DQPA 3OYGA 4BWMA 1VSMA 4DTJA 2D5RA 3IFRA 2E4LA 2HNDA 3A0IX 4YOWA 2NRRA 3HP6A 3UKUA 4XEIA 3NCIA 4C8KA 3RSEA 5HBMA 1VQ6N 4MO5A 4FWRA 2YKMA 3PX0A 1ZBIA 1BUPA 1OVQA 5A2QO 5AQNA 3OA9A 1J9AA 5LY3A 3ZSZA 1JCGA 4H0YB 3T3FA 2O4IA 2QWPA 4BRMA 4DQIA 3CC4N 2O8EA 2RKIA 3VEXA 1KAYA 4DV3K 3CM5A 1NK5A 4CFDA 1L3SA 2E8AA 1VQ4N 4JS4A 4HTUA 3K5MA 2JWLA 4DR1K 4IXCA 5DM6L 4QOZB 3KJVA 1KTQA 4E1JA 4EIAA 3AGRA 4HCCA 2EWSA 3P38A 1S1VA 1Z26A 3M3ZA 3C6AA 4JI4K 3FLCO 3J8AA 4A57A 1K8KB 2ZE2A 1DGKN 4B3SK 4KPYA 3C7NB 3CHWA 3OS1A 2ASMA 2CGLA 2NRXA 4O44A 2P9IB 3H1QA 4ZTJA 3S9HA 5LMUK 4IOCL 3R1XA 1NMDA 5AQMA 3K9JA 5KI6A 2FBTA 3PSIA 1T7PA 2BGGA 2Y1JA 3FZLA 5HRPA 3B8AX 1BQNA 3WEEB 1ATRA 4NCBA 3F9MA 4CJWA 2IIRA 3ZX0A 5KRSA 2NRHA 3P4IA 4AHCA 3FZMA 1SV5A 5AQRA 3ZETA 1BISA 1BDGA 3AVFA 5AQFA 1ITGA 4IO8A 1YUWA 5AQYA 4IDKA 4DSKA 2IVNA 4DG1A 3CJ1A 4W5TA 2XY5A 3PX4A 4GKJK 2OTLN 1U04A 2HHHK 4ISEA 4RCHA 4OLAA 1KCFA 1VRTA 2P1JA 3MCAB 3QEVA 4FJ9A 1NK4A 1NGEA 1DTTA 5C2FA 3CJ9A 4BR0A 4CEZA 3TAGA 4DR4K 4JI8K 1EWRA 3CCEN 5M1PA 3AAQA 2W6KA 1C1CA 5EXWA 4QS8A 4MDBA 3ENOA 3QB0A 1BCOA 2O8FA 2X6SA 3OS0A 3GDQA 4BRPA 4BE2A 3EN9A 3KTQA 2BH1A 3JSMA 1JLAA 3L3UA 3O9QA 2YKNA 2VG5A 4FW2A 2OANA 1QQOA 3T69A 2OYQA 3H46O 3SAHA 3KWIA 4DWIA 3O1WA 1SUQA 3EL2A 3FGUA 1M90O 3NMUA 4CBWA 4BREA 1OH7A 2YNIA 4B9LA 4JLHA 4IG0A 3LP3A 4AHRA 4I6MB 1L3UA 3AVHA 3VQEA 5I3UA 3TTDA 4FJLA 1TVRA 3SBGA 5AZJA 1HR0K 1RILA 4A5BA 2QA4N 2VG6A 3IS9A 1NGJA 1QVFM 1IKVA 1C0TA 3L2WA 1Y97A 3GE1A 3C65A 4CEEA 3D2FA 1NJXA 4IJAA 1KD1O 3KZBA 4C8LA 2UXCK 3HPOA 4GVEA 4FPBA 3CCJN 3T1HK 2ASOA 5HOOA 2F8SA 3V1QA 2A40A 4NXMK 3NF7A 5M1KA 3ZX2A 4CBUA 3TU5A 3CMAN 4CHQA 1KAZA 3LP1A 4AILC 3VQBA 1HYVA 3V6DA 3CM6A 2CGKA 2QWMA 3ZYYX 5J2MA 1DLOA 2DFHA 4HUGA 4KHSA 4FZXC 3C0BA 3QBXA 1XWLA 3QETA 5C0YA 3DOLA 3J7ZO 3TAQA 3MN5A 1KFDA 3SV3A 5F2RA 1JLGA 1RBTA 3OYJA 4GV3A 1FJGK 3JYTA 4I2PA 3MN6A 3RRHA 2EHGA 1VSIA 4CZJA 4CF2A 3OW2M 3PO5A 3CC7N 1NK7A 3LDLA 4QAGA 5BPMA 1SKWA 1LOTB 3IKMA 3VQPA 4H0VB 3TAPA 3RR8A 3TANA 1Q9XA 1SL1A 2WUSA 2CH6A 2PFUA 1T05A 4KTZA 3NVMA 1B92A 3CIPA 4CVNE 4MDAA 3WNGA 2P9SB 4BRNA 4C1NK 4M63C 2OCEA 4AHUA 1VQON 1WBBA 4AM7A 4C8OA 2V7YA 3EYZA 4DHYA 4DF4A 4K8XA 4KHQA 2OZMA 4CJSA 3C6TA 3AO3A 3VQ8A 3T1YK 1JJ2M 4BR5A 1IG9A 1WAFA 3EE9A 1VK0A 3MX2A 4CHOA 4H0TB 1FK9A 1S6QA 1NWKA 2NRZA 2HNYA 1T6DA 3HPHA 3IDHA 4MO4A 4CEDA 3CJCA 5KTQA 4CFBA 3DJCA 3FFIA 1LAWA 1QQNA 3V9ZA 4KAZA 1IKWA 4FWQA 1BI4B 3KVGA 3WQUA 4DR3K 1N6QA 2P51A 5AQUA 2HF4A 4B9MA 1VSLA 4CD3A 3O80A 4FJKA 4A59A 1TYQA 4QS9A 4CF8A 1EKEA 4LH4A 3DRPA 2Z1IA 3R6MA 3QEWA 2GTDA 3BF3A 1EXQA 2XHBA 4CCHA 3PIOL 2IS3A 3QLHA 2IAJA 2Q36A 3VQ9A 3NF9A 3HTVA 3L6QA 3HXMA 4JV5K 1XMOK 1K9MO 1S1TA 1NGGA 3OYBA 4KI6A 1TKTA 3DXKB 5AQQA 3LDSA 1OVYA 3CPEA 4O8KA 5CR4A 5E84A 3OS2A 5SWMA 4CEOA 5E41A 4WCEL 3LDQA 1WSIA 3KHYA 2VWJA 2G8VA 5DK5A 3EO3A 1DEJA 4BRCA 1HNVA 4F3OA 3HP9A 1WSEA 2R7YA 1TKZA 2PYLA 3QIPA 5AQVA 3LP2A 3PLAA 1HMVA 4CGGA 3NBPA 3DWLA 3VENA 5CHIA 3VEYA 3V9UA 3VTHA 4DU3A 4XH5A 1J54A 4M3ZA 4WYBA 4BDPA 3LDOA 2UUAK 2FSKA 3VQ7A 4JD2B 3K59A 2IVPA 3AO2A 3THXB 4A2BA 1YITN 4PQUA 2VG7A 2BTFA 1X9SA 1C0GA 4CF0A 5TKWA 3TSQA 4DSEA 2ZJPL 3L2QA 4JYAK 4LFCK 1NG9A 4YOXA 4FWMA 1N32K 3MMVA 3NDKA 1C1BA 4ELUA 3OJUA 5JLFA 3ENBA 1NKBA 3DM2A 4CJFA
chains in the Genus database with same CATH topology
1JXEA 1NK9A 1QSSA 4C8NA 3SUQA 1KVAA 2RN2A 4DQQA 1C1AA 4FJJA 3MXJA 2G8KA 2HHUA 4KO0A 3O4NA 1U47A 4EZ6A 1RBUA 4CK3A 1HYSA 3OYKA 2KW4A 2HHVA 4RW8A 1RTIA 1RDBA 4I9QA 4Z4EA 1WSFA 1XHXA 4F4KA 4M3YA 2IC3A 4Z4IA 1UOCA 2D0CA 2IDOA 1Z25A 3SZ2A 4RW6A 4DSFA 4DMNA 1QSYA 1XHZA 1I3AA 2X6NA 3P5JA 5J1EA 3HVRA 2OPQA 4KHUA 4L8RB 4DTMA 5CZ2A 4DQPA 2PY5A 3OYGA 4BWMA 4N41A 1VSMA 3KIOA 4DTJA 2B5JA 1REVA 3SQ4A 2D5RA 4M3WA 1C0UA 1KLMA 2E4LA 2HNDA 4Z4CA 3HP6A 3ULDA 4FM1A 4LY7A 3K5NA 2OPPA 3NCIA 1SKRA 3DLHA 4C8KA 3QERA 3RMAA 3DLGA 2VWKA 5HP1A 3QEIA 5HBMA 4LD0A 4DS4A 2YKMA 4B8CA 1CXQA 3PX0A 1ZBIA 4GW6A 2ZQBA 4KKOA 3CG7A 3T19A 4W5RA 2OPRA 4B08A 3MAQA 1UA0A 4AH9A 4E7JA 4GVMA 1J9AA 3ZSYA 1F21A 4CJLA 3OYEA 3ZSZA 1BQMA 3KLIA 3NE6A 2AJQA 1CLQA 1RT6A 3T3FA 2O4IA 4NCAA 2E6MA 3DRRA 3K57A 4DQIA 2GUIA 3ZT0A 2RKIA 4CK1A 4HUEA 4OJRA 5KRTA 4Z4HA 3WNEA 3ZT1A 4J2DA 1S9EA 3RMBA 3U6FA 4DTXA 4FLUA 1S1UA 1VSHA 2HHQA 5J2QA 1IH7A 2WONA 3CM5A 1NK5A 2G8IA 4CFDA 4E7KA 1L3SA 4KHYA 1SKSA 1BIUA 4KTQA 4JS4A 1RTJA 4HTUA 3K5MA 3WNHA 4QOZB 4R5PA 3KJVA 1A5VA 4DFJA 1KTQA 1NJZA 3BGRA 4EZ9A 4O4GA 4CHPA 4HCCA 4F3TA 1WNSA 2LSNA 1S1VA 4DTSA 4B9VA 4FCYA 1Z26A 4Q0BA 5FROA 3NH1A 1I39A 4I2QA 4Y1CA 2XY7A 2E6LA 3OYIA 2ZE2A 2JLEA 3AA4A 1JXBA 3L2VA 3RR7A 4KPYA 2Q3SA 2YHBA 3OS1A 4B8AB 3C95A 4RW4A 4O44A 3SQ0A 4KHWA 4DF8A 1D9FA 4FM0A 3HM9A 1FKPA 2FBXA 4ZTJA 3SPZA 5HRNA 1XC9A 3T1AA 1EX4A 3OYCA 3S9HA 4BE1A 3AVKA 4J2EA 1ZBFA 1S6PA 1NK6A 4KRFA 5KI6A 2FBTA 3G10A 5CYQA 1T7PA 3DYAA 4BACA 2BGGA 1O1WA 1RDCA 1HNIA 4CJ5A 5CYMA 4FM2A 1RT7A 3MEEA 5KGXA 2Y1JA 5HRPA 1N5YA 2OA8A 1BQNA 4KI4A 3M8QA 5HRRA 4NCBA 3HPGA 4W5OA 3LWLA 2P5GA 4CJWA 4FJMA 4H4MA 3RTVA 4M42A 1ASUA 4N5SA 5KRSA 4N76A 3V9SA 2YV0X 2KQ2A 1B9DA 4AHCA 4FJHA 4ICLA 4B9SA 3LAKA 3VQ5A 1SV5A 3WNFA 1RT2A 4CIGA 1BISA 1TAUA 3AVFA 4MFBA 1ITGA 3SNNA 4FJ8A 4G1QA 5FDLA 1S9GA 3ZT2A 4IDKA 3ZCMA 3NGZA 3L8BA 1X9MA 2B6AA 3MXIA 4M41A 4DSKA 1RBRA 3AA5X 4DG1A 4FJNA 3KLGA 4W5TA 2XY5A 3PX4A 2HHXA 4KB1A 4E1NA 2YNFA 1EETA 1YVUA 3QEPA 1U04A 1L3TA 4TSXA 5SZTA 4FZYA 2B4JA 3SJJA 1U4BA 1HYZA 4O0JA 1KCFA 5JS2A 1VRTA 2P1JA 4OLAA 3QEVA 2FBVA 2YHAA 4FJ9A 5FRMA 2OZSA 1NK4A 4UQGA 1DTTA 1TKXA 3DLBA 1QS4A 4DS5A 1WLJA 4AHSA 2G8FA 1LAVA 4N56A 4CEZA 3TAGA 2KZZA 4BDZA 4M45A 4F8RA 4GMJB 4NYFA 4CJ3A 1TAQA 1NJYA 4KFBA 4DFMA 2G8UA 3S3NA 1C1CA 5HLFA 4OPJA 2ATQA 1BCOA 4CJFA 1D5AA 2HHSA 2X6SA 3OS0A 4PWDA 1IKXA 1LWCA 4CGDA 4CEQA 4BE2A 1BCMA 1NOYA 4CE9A 3I0SA 1ZBHA 3KTQA 3K58A 1QTMA 4LSNA 4BWJA 2YNGA 3JSMA 1ZYQA 3BDPA 3AVLA 1JLAA 3L3VA 3L3UA 4FLZA 3HK2A 3MEDA 1JKHA 3ZSXA 3NH2A 4CJTA 3TAEA 1U48A 3OJSA 1TK8A 2YKNA 2VG5A 4FJXA 3SCXA 3VQCA 1S5JA 4FW2A 3V1OA 3O3FA 2Y1IA 1L3VA 2G8WA 3ZSQA 5J2PA 2OYQA 3KK1A 1TK5A 1KVCA 3OYHA 4DSJA 4DWIA 4DTRA 1J53A 3AO4A 1RTHA 3OYNA 4HUFA 4FK0A 1SUQA 4ZHRA 3VA3A 3MXMA 1X9WA 2G8HA 3V9WA 2BDPA 1BL3A 1IO2A 2I5JA 2YNIA 4I9LA 4B9LA 3LP0A 4JLHA 3DMJA 4IG0A 4CERA 4E7IA 3VQDA 4DU4A 1LW0A 3LP3A 1RDAA 4AHRA 4E19A 4FLVA 3SQ1A 5JS1A 1L3UA 4XIUA 4CJ4A 3AVHA 2ETJA 1FKOA 3QESA 2F8TA 3VQEA 5I3UA 2O4GA 1VRUA 4AHVA 3OYDA 4H4OA 1TVRA 4CGIA 4CGJA 4FJLA 4PY5A 3MEGA 1RILA 1ZBUA 1S1WA 2YNHA 1U49A 2VG6A 4FLXA 2GV9A 3IS9A 4RW7A 3TABA 1IKVA 1C0TA 1MU2A 4HHTA 4NYNA 3OYMA 3KLEA 1GOAA 3SQ2A 2HB5A 1Y97A 3L2WA 4E3SA 4CEEA 1NJXA 4C8LA 3OVNA 1K6YA 1LWEA 3ASMA 4OKJA 3CFRA 4JS5A 3U3YA 4FLTA 3SUOA 1SL2A 1L5UA 3HPOA 2KFZA 3KLHA 2X74A 3LALA 1UWBA 2DFEA 5HRSA 1BIZA 4Q5VA 3TWHA 4DSIA 4C8MA 4LH5A 3V1QA 2F8SA 1ASWA 4KV8A 3NF7A 3DLRA 3SI6A 1RT1A 1VSKA 1QHTA 3S3OA 4EP5A 4EP4A 3AO5A 1TK0A 1RNHA 1C0MA 4KTWA 3HJFA 4CHQA 3QNNA 4B9UA 2FBYA 3KKSA 3C94A 1Q8IA 3OYLA 3RRGA 4M3RA 2HHWA 3LP1A 1FXXA 3QEXA 1VSFA 1ASVA 3HVTA 4AILC 3VQBA 1HYVA 3V6DA 3CM6A 3LPTA 3PUFA 4Z0UA 4CK2A 3HYFA 4FXDA 1TL3A 1DLOA 5J2MA 2DFHA 3DLEA 2XO7A 4HUGA 4CHZA 4KHSA 4FZXC 2KFNA 3AVAA 2QKKA 4RG8A 4FVMA 3VQQA 2GBZA 3TARA 1XWLA 3QETA 1C6VA 2IGIA 3CFOA 3DOLA 5FRNA 4FYDA 4O55A 4ELVA 2QKBA 3KLFA 3TAQA 1JLCA 1KFDA 1UA1A 3AA3A 1WSJA 3SV3A 4DSLA 4BDYA 1U45A 3RWUA 4ID5A 2QXFA 1JLGA 3AVMA 1RBTA 1HRHA 1RBVA 3NHGA 4JRPA 3KK3A 3OYJA 2W42A 2Z1GA 3SV4A 3TAMA 3JYTA 1NKEA 4I2PA 3RRHA 1UAXA 1XI1A 2EHGA 1VSIA 4CF2A 3VA0A 3PO5A 4QCLA 3V9XA 4CFAA 1X1PA 1NK7A 4QAGA 1JLFA 3PY8A 3HL8A 4PA1A 3EY1A 1SKWA 4DU1A 1CXUA 4CEFA 3B6PA 3VQPA 4BE0A 3AVJA 3LAMA 3NF6A 3TAPA 3AVCA 3RR8A 3TANA 4CJKA 3K5LA 1Q9XA 4KHNA 1SL1A 2A1SA 4CFCA 1KLNA 4FW1A 2HHTA 3AA2A 4KTZA 1T05A 2DFFA 4CGHA 5EU7A 4DFKA 4J2BA 2DY4A 1B92A 3DOKA 1RDDA 4F2SA 3AO1A 1EP4A 4B9NA 2OPSA 3WNGA 5D3GA 5KGWA 1Q9YA 4IFVA 4LSLA 2PYJA 3RMCA 3VQAA 1B9FA 4W5NA 1HQEA 4Z4FA 1JL2A 2BE2A 1NK8A 4AHUA 3PX6A 3TI0A 4DQSA 3DRSA 3P1GA 3QNOA 1KFSA 5I42A 3IRXA 1WN7A 3QIOA 1TKDA 4C8OA 4B3OA 4OKKA 1QQCA 3EYZA 4DF4A 4CEBA 1LWFA 4K8XA 4KHQA 2OZMA 4CJSA 3LZJA 3CQ8A 3HSTB 1GOCA 3VN5A 3C6TA 3AO3A 3VQ8A 3KKRA 3TAFA 1IG9A 1WAFA 1NKCA 2FC0A 3UIQA 1VK0A 4MQ3A 4CHOA 4HCBA 1FK9A 1WSHA 4I7FA 3H08A 3KK2A 1S6QA 4JRQA 4F2RA 3DLKA 2BANA 4CJQA 3KD1E 3CFPA 2HNYA 3K5OA 2WOMA 1BGXT 1NOZA 2JGUA 4OGCA 3ZSRA 1KVBA 4FJ5A 2KZMA 3HPHA 4CHNA 2ITGA 3IAYA 3LZIA 2D0BA 3AVIA 4IBNA 4CJUA 1TL1A 1JLQA 4CEDA 1VSJA 1CZBA 4IG3A 3V81A 1JL1A 3S3MA 4ELTA 4DTUA 4E1MA 1KRPA 4M3TA 1CZ9A 3NF8A 3U3GA 3SUNA 2Z1HA 4DQRA 5KTQA 3ITHA 2IOCA 5K14A 4CFBA 5C25A 3L2RA 1J5OA 1RT3A 3FFIA 2HMIA 1LAWA 3LPUA 4CGFA 5T7BA 3O3HA 1W9HA 3A2FA 4K8ZA 3V9ZA 3AVBA 2QK9A 4KAZA 1IKWA 1KSPA 1BI4B 3I0RA 1A5WA 1BHLA 2DTUA 3C6UA 1N6QA 1R0AA 4J2AA 2A1RA 2P51A 1LW2A 4CF1A 3OYAA 4FJIA 4ZTFA 2EX3A 4Z4GA 4N47A 1YTUA 4B9MA 1VSLA 4M3UA 2HVHA 2X78A 4FK4A 4CJRA 1LV5A 3M8RA 4FJKA 4CHYA 3O3GA 3PO4A 4YFUA 3MECA 4NCGA 4KB0A 4CF8A 4E89A 1EKEA 4LH4A 3SPYA 3OY9A 3DRPA 1A5XA 2Z1IA 4B9TA 3QEWA 1IKYA 3PV8A 1VSDA 3ISNC 2P5OA 4FLYA 3V1RA 4IFYA 1EXQA 1WSGA 3EZ5A 1RT5A 2XHBA 4CIFA 4E7LA 3THVA 2HNZA 3NH0A 4CCHA 2PZSA 2IS3A 3QLHA 4CECA 4HVJA 3E01A 3IG1A 3ZSOA 3M8SA 3NGIA 1NK0A 4OLBA 2IAJA 2RF2A 4ID1A 3VQ9A 3AV9A 3NF9A 3CYMA 3SYZA 3K2PA 3QINA 3HXMA 1RTDA 1S1TA 5HROA 4PUOA 3ZSWA 3F73A 3NAEA 3OYBA 4OVLA 2NUBA 4YNQA 4M3XA 1G15A 4OKEA 4OPKA 4KI6A 4O5BA 1YT3A 3OYFA 1TKTA 1DTQA 4CJEA 3LDSA 3P83D 3D45A 4CJVA 1NJWA 5CY4A 1S1XA 3OS2A 3B6OA 5CZ1A 4FLWA 1T8EA 5SWMA 4CEOA 1TGOA 1JLEA 5E41A 3VQ4A 1QSLA 4OGEA 5J2NA 3LWMA 3L2UA 3RMDA 1WSIA 4CJPA 2VWJA 4DFPA 1JLBA 2D0AA 3NGYA 5DK5A 3TR8A 5C42A 1SL0A 4CESA 2G8VA 1HNVA 4AHTA 2XY8A 4F3OA 3O4QA 3HP9A 4E7HA 4CEAA 1WSEA 2ZD1A 2R7YA 3ZSVA 1RBSA 1QE1A 4FK2A 1TKZA 3AVGA 4CIEA 2PYLA 3QIPA 4DLEA 3LP2A 4KREA 4CF9A 2XY6A 1HMVA 4CGGA 3ZT4A 1D9DA 3LANA 3NBPA 4WE1A 4FJ7A 4IKFA 3V9UA 3ALYA 4DTOA 4DU3A 1T03A 2Z1JA 2HW3A 1HQUA 1J54A 4M3ZA 3M8PA 3ZT3A 3AVNA 4BDPA 5DMRA 1RT4A 1VSEA 4Y1DA 1HJRA 1HPZA 3NFAA 3QO9A 3VQ7A 1D8YA 3K59A 3AO2A 2KTQA 3HT3A 4PQUA 1W0HA 2F96A 2VG7A 4RW9A 1X9SA 2HVIA 3SUPA 1YTAA 3VQ6A 3KD5E 4CF0A 3HO1A 4E0DA 4W5QA 4DSEA 3I8DA 3DI6A 1WAJA 3L2QA 4DTNA 3G0ZA 4FJGA 2RPIA 4DLGA 4FZZA 4H8KA 1ZBLA 5C24A 3NDKA 1C1BA 4O0IA 1TV6A 4DTPA 4ELUA 3F9KA 3OJUA 3D0PA 3V4IA 2XRIA 1RCHA 1NKBA 3DM2A 1GOBA 1BI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JXE A;  1NK9 A;  1QSS A;  4C8N A;  3SUQ A;  1KVA A;  2RN2 A;  4DQQ A;  1C1A A;  4FJJ A;  3MXJ A;  2G8K A;  2HHU A;  4KO0 A;  3O4N A;  1U47 A;  4EZ6 A;  1RBU A;  4CK3 A;  1HYS A;  3OYK A;  2KW4 A;  2HHV A;  4RW8 A;  1RTI A;  1RDB A;  4I9Q A;  4Z4E A;  1WSF A;  1XHX A;  4F4K A;  4M3Y A;  2IC3 A;  4Z4I A;  1UOC A;  2D0C A;  2IDO A;  1Z25 A;  3SZ2 A;  4RW6 A;  4DSF A;  4DMN A;  1QSY A;  1XHZ A;  1I3A A;  2X6N A;  3P5J A;  5J1E A;  3HVR A;  2OPQ A;  4KHU A;  4L8R B;  4DTM A;  5CZ2 A;  4DQP A;  2PY5 A;  3OYG A;  4BWM A;  4N41 A;  1VSM A;  3KIO A;  4DTJ A;  2B5J A;  1REV A;  3SQ4 A;  2D5R A;  4M3W A;  1C0U A;  1KLM A;  2E4L A;  2HND A;  4Z4C A;  3HP6 A;  3ULD A;  4FM1 A;  4LY7 A;  3K5N A;  2OPP A;  3NCI A;  1SKR A;  3DLH A;  4C8K A;  3QER A;  3RMA A;  3DLG A;  2VWK A;  5HP1 A;  3QEI A;  5HBM A;  4LD0 A;  4DS4 A;  2YKM A;  4B8C A;  1CXQ A;  3PX0 A;  1ZBI A;  4GW6 A;  2ZQB A;  4KKO A;  3CG7 A;  3T19 A;  4W5R A;  2OPR A;  4B08 A;  3MAQ A;  1UA0 A;  4AH9 A;  4E7J A;  4GVM A;  1J9A A;  3ZSY A;  1F21 A;  4CJL A;  3OYE A;  3ZSZ A;  1BQM A;  3KLI A;  3NE6 A;  2AJQ A;  1CLQ A;  1RT6 A;  3T3F A;  2O4I A;  4NCA A;  2E6M A;  3DRR A;  3K57 A;  4DQI A;  2GUI A;  3ZT0 A;  2RKI A;  4CK1 A;  4HUE A;  4OJR A;  5KRT A;  4Z4H A;  3WNE A;  3ZT1 A;  4J2D A;  1S9E A;  3RMB A;  3U6F A;  4DTX A;  4FLU A;  1S1U A;  1VSH A;  2HHQ A;  5J2Q A;  1IH7 A;  2WON A;  3CM5 A;  1NK5 A;  2G8I A;  4CFD A;  4E7K A;  1L3S A;  4KHY A;  1SKS A;  1BIU A;  4KTQ A;  4JS4 A;  1RTJ A;  4HTU A;  3K5M A;  3WNH A;  4QOZ B;  4R5P A;  3KJV A;  1A5V A;  4DFJ A;  1KTQ A;  1NJZ A;  3BGR A;  4EZ9 A;  4O4G A;  4CHP A;  4HCC A;  4F3T A;  1WNS A;  2LSN A;  1S1V A;  4DTS A;  4B9V A;  4FCY A;  1Z26 A;  4Q0B A;  5FRO A;  3NH1 A;  1I39 A;  4I2Q A;  4Y1C A;  2XY7 A;  2E6L A;  3OYI A;  2ZE2 A;  2JLE A;  3AA4 A;  1JXB A;  3L2V A;  3RR7 A;  4KPY A;  2Q3S A;  2YHB A;  3OS1 A;  4B8A B;  3C95 A;  4RW4 A;  4O44 A;  3SQ0 A;  4KHW A;  4DF8 A;  1D9F A;  4FM0 A;  3HM9 A;  1FKP A;  2FBX A;  4ZTJ A;  3SPZ A;  5HRN A;  1XC9 A;  3T1A A;  1EX4 A;  3OYC A;  3S9H A;  4BE1 A;  3AVK A;  4J2E A;  1ZBF A;  1S6P A;  1NK6 A;  4KRF A;  5KI6 A;  2FBT A;  3G10 A;  5CYQ A;  1T7P A;  3DYA A;  4BAC A;  2BGG A;  1O1W A;  1RDC A;  1HNI A;  4CJ5 A;  5CYM A;  4FM2 A;  1RT7 A;  3MEE A;  5KGX A;  2Y1J A;  5HRP A;  1N5Y A;  2OA8 A;  1BQN A;  4KI4 A;  3M8Q A;  5HRR A;  4NCB A;  3HPG A;  4W5O A;  3LWL A;  2P5G A;  4CJW A;  4FJM A;  4H4M A;  3RTV A;  4M42 A;  1ASU A;  4N5S A;  5KRS A;  4N76 A;  3V9S A;  2YV0 X;  2KQ2 A;  1B9D A;  4AHC A;  4FJH A;  4ICL A;  4B9S A;  3LAK A;  3VQ5 A;  1SV5 A;  3WNF A;  1RT2 A;  4CIG A;  1BIS A;  1TAU A;  3AVF A;  4MFB A;  1ITG A;  3SNN A;  4FJ8 A;  4G1Q A;  5FDL A;  1S9G A;  3ZT2 A;  4IDK A;  3ZCM A;  3NGZ A;  3L8B A;  1X9M A;  2B6A A;  3MXI A;  4M41 A;  4DSK A;  1RBR A;  3AA5 X;  4DG1 A;  4FJN A;  3KLG A;  4W5T A;  2XY5 A;  3PX4 A;  2HHX A;  4KB1 A;  4E1N A;  2YNF A;  1EET A;  1YVU A;  3QEP A;  1U04 A;  1L3T A;  4TSX A;  5SZT A;  4FZY A;  2B4J A;  3SJJ A;  1U4B A;  1HYZ A;  4O0J A;  1KCF A;  5JS2 A;  1VRT A;  2P1J A;  4OLA A;  3QEV A;  2FBV A;  2YHA A;  4FJ9 A;  5FRM A;  2OZS A;  1NK4 A;  4UQG A;  1DTT A;  1TKX A;  3DLB A;  1QS4 A;  4DS5 A;  1WLJ A;  4AHS A;  2G8F A;  1LAV A;  4N56 A;  4CEZ A;  3TAG A;  2KZZ A;  4BDZ A;  4M45 A;  4F8R A;  4GMJ B;  4NYF A;  4CJ3 A;  1TAQ A;  1NJY A;  4KFB A;  4DFM A;  2G8U A;  3S3N A;  1C1C A;  5HLF A;  4OPJ A;  2ATQ A;  1BCO A;  4CJF A;  1D5A A;  2HHS A;  2X6S A;  3OS0 A;  4PWD A;  1IKX A;  1LWC A;  4CGD A;  4CEQ A;  4BE2 A;  1BCM A;  1NOY A;  4CE9 A;  3I0S A;  1ZBH A;  3KTQ A;  3K58 A;  1QTM A;  4LSN A;  4BWJ A;  2YNG A;  3JSM A;  1ZYQ A;  3BDP A;  3AVL A;  1JLA A;  3L3V A;  3L3U A;  4FLZ A;  3HK2 A;  3MED A;  1JKH A;  3ZSX A;  3NH2 A;  4CJT A;  3TAE A;  1U48 A;  3OJS A;  1TK8 A;  2YKN A;  2VG5 A;  4FJX A;  3SCX A;  3VQC A;  1S5J A;  4FW2 A;  3V1O A;  3O3F A;  2Y1I A;  1L3V A;  2G8W A;  3ZSQ A;  5J2P A;  2OYQ A;  3KK1 A;  1TK5 A;  1KVC A;  3OYH A;  4DSJ A;  4DWI A;  4DTR A;  1J53 A;  3AO4 A;  1RTH A;  3OYN A;  4HUF A;  4FK0 A;  1SUQ A;  4ZHR A;  3VA3 A;  3MXM A;  1X9W A;  2G8H A;  3V9W A;  2BDP A;  1BL3 A;  1IO2 A;  2I5J A;  2YNI A;  4I9L A;  4B9L A;  3LP0 A;  4JLH A;  3DMJ A;  4IG0 A;  4CER A;  4E7I A;  3VQD A;  4DU4 A;  1LW0 A;  3LP3 A;  1RDA A;  4AHR A;  4E19 A;  4FLV A;  3SQ1 A;  5JS1 A;  1L3U A;  4XIU A;  4CJ4 A;  3AVH A;  2ETJ A;  1FKO A;  3QES A;  2F8T A;  3VQE A;  5I3U A;  2O4G A;  1VRU A;  4AHV A;  3OYD A;  4H4O A;  1TVR A;  4CGI A;  4CGJ A;  4FJL A;  4PY5 A;  3MEG A;  1RIL A;  1ZBU A;  1S1W A;  2YNH A;  1U49 A;  2VG6 A;  4FLX A;  2GV9 A;  3IS9 A;  4RW7 A;  3TAB A;  1IKV A;  1C0T A;  1MU2 A;  4HHT A;  4NYN A;  3OYM A;  3KLE A;  1GOA A;  3SQ2 A;  2HB5 A;  1Y97 A;  3L2W A;  4E3S A;  4CEE A;  1NJX A;  4C8L A;  3OVN A;  1K6Y A;  1LWE A;  3ASM A;  4OKJ A;  3CFR A;  4JS5 A;  3U3Y A;  4FLT A;  3SUO A;  1SL2 A;  1L5U A;  3HPO A;  2KFZ A;  3KLH A;  2X74 A;  3LAL A;  1UWB A;  2DFE A;  5HRS A;  1BIZ A;  4Q5V A;  3TWH A;  4DSI A;  4C8M A;  4LH5 A;  3V1Q A;  2F8S A;  1ASW A;  4KV8 A;  3NF7 A;  3DLR A;  3SI6 A;  1RT1 A;  1VSK A;  1QHT A;  3S3O A;  4EP5 A;  4EP4 A;  3AO5 A;  1TK0 A;  1RNH A;  1C0M A;  4KTW A;  3HJF A;  4CHQ A;  3QNN A;  4B9U A;  2FBY A;  3KKS A;  3C94 A;  1Q8I A;  3OYL A;  3RRG A;  4M3R A;  2HHW A;  3LP1 A;  1FXX A;  3QEX A;  1VSF A;  1ASV A;  3HVT A;  4AIL C;  3VQB A;  1HYV A;  3V6D A;  3CM6 A;  3LPT A;  3PUF A;  4Z0U A;  4CK2 A;  3HYF A;  4FXD A;  1TL3 A;  1DLO A;  5J2M A;  2DFH A;  3DLE A;  2XO7 A;  4HUG A;  4CHZ A;  4KHS A;  4FZX C;  2KFN A;  3AVA A;  2QKK A;  4RG8 A;  4FVM A;  3VQQ A;  2GBZ A;  3TAR A;  1XWL A;  3QET A;  1C6V A;  2IGI A;  3CFO A;  3DOL A;  5FRN A;  4FYD A;  4O55 A;  4ELV A;  2QKB A;  3KLF A;  3TAQ A;  1JLC A;  1KFD A;  1UA1 A;  3AA3 A;  1WSJ A;  3SV3 A;  4DSL A;  4BDY A;  1U45 A;  3RWU A;  4ID5 A;  2QXF A;  1JLG A;  3AVM A;  1RBT A;  1HRH A;  1RBV A;  3NHG A;  4JRP A;  3KK3 A;  3OYJ A;  2W42 A;  2Z1G A;  3SV4 A;  3TAM A;  3JYT A;  1NKE A;  4I2P A;  3RRH A;  1UAX A;  1XI1 A;  2EHG A;  1VSI A;  4CF2 A;  3VA0 A;  3PO5 A;  4QCL A;  3V9X A;  4CFA A;  1X1P A;  1NK7 A;  4QAG A;  1JLF A;  3PY8 A;  3HL8 A;  4PA1 A;  3EY1 A;  1SKW A;  4DU1 A;  1CXU A;  4CEF A;  3B6P A;  3VQP A;  4BE0 A;  3AVJ A;  3LAM A;  3NF6 A;  3TAP A;  3AVC A;  3RR8 A;  3TAN A;  4CJK A;  3K5L A;  1Q9X A;  4KHN A;  1SL1 A;  2A1S A;  4CFC A;  1KLN A;  4FW1 A;  2HHT A;  3AA2 A;  4KTZ A;  1T05 A;  2DFF A;  4CGH A;  5EU7 A;  4DFK A;  4J2B A;  2DY4 A;  1B92 A;  3DOK A;  1RDD A;  4F2S A;  3AO1 A;  1EP4 A;  4B9N A;  2OPS A;  3WNG A;  5D3G A;  5KGW A;  1Q9Y A;  4IFV A;  4LSL A;  2PYJ A;  3RMC A;  3VQA A;  1B9F A;  4W5N A;  1HQE A;  4Z4F A;  1JL2 A;  2BE2 A;  1NK8 A;  4AHU A;  3PX6 A;  3TI0 A;  4DQS A;  3DRS A;  3P1G A;  3QNO A;  1KFS A;  5I42 A;  3IRX A;  1WN7 A;  3QIO A;  1TKD A;  4C8O A;  4B3O A;  4OKK A;  1QQC A;  3EYZ A;  4DF4 A;  4CEB A;  1LWF A;  4K8X A;  4KHQ A;  2OZM A;  4CJS A;  3LZJ A;  3CQ8 A;  3HST B;  1GOC A;  3VN5 A;  3C6T A;  3AO3 A;  3VQ8 A;  3KKR A;  3TAF A;  1IG9 A;  1WAF A;  1NKC A;  2FC0 A;  3UIQ A;  1VK0 A;  4MQ3 A;  4CHO A;  4HCB A;  1FK9 A;  1WSH A;  4I7F A;  3H08 A;  3KK2 A;  1S6Q A;  4JRQ A;  4F2R A;  3DLK A;  2BAN A;  4CJQ A;  3KD1 E;  3CFP A;  2HNY A;  3K5O A;  2WOM A;  1BGX T;  1NOZ A;  2JGU A;  4OGC A;  3ZSR A;  1KVB A;  4FJ5 A;  2KZM A;  3HPH A;  4CHN A;  2ITG A;  3IAY A;  3LZI A;  2D0B A;  3AVI A;  4IBN A;  4CJU A;  1TL1 A;  1JLQ A;  4CED A;  1VSJ A;  1CZB A;  4IG3 A;  3V81 A;  1JL1 A;  3S3M A;  4ELT A;  4DTU A;  4E1M A;  1KRP A;  4M3T A;  1CZ9 A;  3NF8 A;  3U3G A;  3SUN A;  2Z1H A;  4DQR A;  5KTQ A;  3ITH A;  2IOC A;  5K14 A;  4CFB A;  5C25 A;  3L2R A;  1J5O A;  1RT3 A;  3FFI A;  2HMI A;  1LAW A;  3LPU A;  4CGF A;  5T7B A;  3O3H A;  1W9H A;  3A2F A;  4K8Z A;  3V9Z A;  3AVB A;  2QK9 A;  4KAZ A;  1IKW A;  1KSP A;  1BI4 B;  3I0R A;  1A5W A;  1BHL A;  2DTU A;  3C6U A;  1N6Q A;  1R0A A;  4J2A A;  2A1R A;  2P51 A;  1LW2 A;  4CF1 A;  3OYA A;  4FJI A;  4ZTF A;  2EX3 A;  4Z4G A;  4N47 A;  1YTU A;  4B9M A;  1VSL A;  4M3U A;  2HVH A;  2X78 A;  4FK4 A;  4CJR A;  1LV5 A;  3M8R A;  4FJK A;  4CHY A;  3O3G A;  3PO4 A;  4YFU A;  3MEC A;  4NCG A;  4KB0 A;  4CF8 A;  4E89 A;  1EKE A;  4LH4 A;  3SPY A;  3OY9 A;  3DRP A;  1A5X A;  2Z1I A;  4B9T A;  3QEW A;  1IKY A;  3PV8 A;  1VSD A;  3ISN C;  2P5O A;  4FLY A;  3V1R A;  4IFY A;  1EXQ A;  1WSG A;  3EZ5 A;  1RT5 A;  2XHB A;  4CIF A;  4E7L A;  3THV A;  2HNZ A;  3NH0 A;  4CCH A;  2PZS A;  2IS3 A;  3QLH A;  4CEC A;  4HVJ A;  3E01 A;  3IG1 A;  3ZSO A;  3M8S A;  3NGI A;  1NK0 A;  4OLB A;  2IAJ A;  2RF2 A;  4ID1 A;  3VQ9 A;  3AV9 A;  3NF9 A;  3CYM A;  3SYZ A;  3K2P A;  3QIN A;  3HXM A;  1RTD A;  1S1T A;  5HRO A;  4PUO A;  3ZSW A;  3F73 A;  3NAE A;  3OYB A;  4OVL A;  2NUB A;  4YNQ A;  4M3X A;  1G15 A;  4OKE A;  4OPK A;  4KI6 A;  4O5B A;  1YT3 A;  3OYF A;  1TKT A;  1DTQ A;  4CJE A;  3LDS A;  3P83 D;  3D45 A;  4CJV A;  1NJW A;  5CY4 A;  1S1X A;  3OS2 A;  3B6O A;  5CZ1 A;  4FLW A;  1T8E A;  5SWM A;  4CEO A;  1TGO A;  1JLE A;  5E41 A;  3VQ4 A;  1QSL A;  4OGE A;  5J2N A;  3LWM A;  3L2U A;  3RMD A;  1WSI A;  4CJP A;  2VWJ A;  4DFP A;  1JLB A;  2D0A A;  3NGY A;  5DK5 A;  3TR8 A;  5C42 A;  1SL0 A;  4CES A;  2G8V A;  1HNV A;  4AHT A;  2XY8 A;  4F3O A;  3O4Q A;  3HP9 A;  4E7H A;  4CEA A;  1WSE A;  2ZD1 A;  2R7Y A;  3ZSV A;  1RBS A;  1QE1 A;  4FK2 A;  1TKZ A;  3AVG A;  4CIE A;  2PYL A;  3QIP A;  4DLE A;  3LP2 A;  4KRE A;  4CF9 A;  2XY6 A;  1HMV A;  4CGG A;  3ZT4 A;  1D9D A;  3LAN A;  3NBP A;  4WE1 A;  4FJ7 A;  4IKF A;  3V9U A;  3ALY A;  4DTO A;  4DU3 A;  1T03 A;  2Z1J A;  2HW3 A;  1HQU A;  1J54 A;  4M3Z A;  3M8P A;  3ZT3 A;  3AVN A;  4BDP A;  5DMR A;  1RT4 A;  1VSE A;  4Y1D A;  1HJR A;  1HPZ A;  3NFA A;  3QO9 A;  3VQ7 A;  1D8Y A;  3K59 A;  3AO2 A;  2KTQ A;  3HT3 A;  4PQU A;  1W0H A;  2F96 A;  2VG7 A;  4RW9 A;  1X9S A;  2HVI A;  3SUP A;  1YTA A;  3VQ6 A;  3KD5 E;  4CF0 A;  3HO1 A;  4E0D A;  4W5Q A;  4DSE A;  3I8D A;  3DI6 A;  1WAJ A;  3L2Q A;  4DTN A;  3G0Z A;  4FJG A;  2RPI A;  4DLG A;  4FZZ A;  4H8K A;  1ZBL A;  5C24 A;  3NDK A;  1C1B A;  4O0I A;  1TV6 A;  4DTP A;  4ELU A;  3F9K A;  3OJU A;  3D0P A;  3V4I A;  2XRI A;  1RCH A;  1NKB A;  3DM2 A;  1GOB A;  1BI4 A; 
#chains in the Genus database with same CATH topology
 1JXE A;  1OH8 A;  2YCH A;  1D4X A;  3SUQ A;  2RN2 A;  2V52 B;  4FJJ A;  1KAX A;  2A41 A;  3MWT A;  4IZ9 A;  1SZ2 A;  3O6W A;  1WUA A;  5BPN A;  4RW8 A;  1RTI A;  4KH6 A;  4DV6 K;  2IC3 A;  4ISG A;  4RW6 A;  3CCV N;  2UUB K;  4B9Q A;  3P5J A;  5J1E A;  1BG3 A;  2QI2 A;  4L3Q A;  3ULD A;  3K5N A;  3TSP A;  2ZGZ A;  3QER A;  3DLG A;  4LD0 A;  4YY3 K;  5ELZ A;  4DS4 A;  1CXQ A;  5AZI A;  4BC2 A;  1K8K A;  3JXU A;  4W5R A;  2OPR A;  1UA0 A;  2FLO A;  1F21 A;  1TUU A;  2E2O A;  2HBM A;  3KLI A;  3NE6 A;  3ZX3 A;  5H1S Q;  4NCA A;  2E6M A;  4JK8 A;  3VEV A;  1VQN N;  5KRT A;  5AQX A;  4DTX A;  2QWR A;  3LM2 A;  3RVC A;  1VSH A;  4BRD A;  2G8I A;  1IH7 A;  2WON A;  4BG9 A;  4E7K A;  4BR7 A;  4KHY A;  4RTF D;  4H5N A;  3WT0 A;  1VQ7 N;  4R5P A;  5AFU A;  2Q1N A;  4DFJ A;  1YVN A;  1NJZ A;  4X66 K;  3IMX A;  4FOE A;  3DXM B;  4OPH A;  4Q0B A;  1I39 A;  4JKG B;  2JLE A;  3AA4 A;  1JXB A;  3HSC A;  2Q3S A;  4B8A B;  3C95 A;  4RW4 A;  4KHW A;  4DF8 A;  4FM0 A;  3EKS A;  3VOV A;  2FBX A;  3HM9 A;  3SPZ A;  1XC9 A;  4JI0 K;  3QFP A;  4BE1 A;  3JAM O;  4BRG A;  3UE5 A;  4J2E A;  5AQO A;  1WBD A;  1S6P A;  3G10 A;  4LFA K;  3DYA A;  1IJJ A;  4BAC A;  1O1W A;  1RDC A;  1HNI A;  4FM2 A;  5CYM A;  1N5Y A;  1RT7 A;  5KGX A;  1DT9 A;  1K73 O;  4LC9 B;  3HPG A;  4X64 K;  2P5G A;  3RTV A;  2Q2R A;  3QFU A;  1NNE A;  4H0X B;  3V9S A;  2YV0 X;  3MCP A;  4BRF A;  4H5W A;  4CIG A;  3THW B;  5C12 A;  4FJ8 A;  2O8D B;  5FDL A;  3ZCM A;  3MXI A;  4FJN A;  2VGN A;  4FSV A;  3KLG A;  2HHX A;  1MA9 B;  4FOI A;  1L3T A;  4TSX A;  1S3X A;  5AR0 A;  5SZT A;  3ZLJ A;  2B4J A;  1U4B A;  4O0J A;  2FBV A;  2YHA A;  5EX5 A;  4UQG A;  1TKX A;  1QS4 A;  1WLJ A;  4IOX A;  1NGD A;  1NM1 A;  3H6E A;  4F8R A;  4NYF A;  1RDU A;  5AQH A;  1NJY A;  4JAX A;  4V19 S;  2D4W A;  3MX5 A;  4BRA A;  3BY5 A;  3CJA A;  4IDH A;  2ATQ A;  5EVZ A;  2HHS A;  5AQJ A;  4PWD A;  1IKX A;  1YJW N;  1LWC A;  4CGD A;  4XH4 A;  2NRT A;  1QTM A;  4LSN A;  3WXL A;  4B1X B;  2GX9 A;  5B8H A;  3BDP A;  3L3V A;  3ZSX A;  1U48 A;  4FJX A;  4GY2 B;  4CJT A;  3SCX A;  3VQC A;  1YJN N;  5KPZ A;  3V1O A;  2Y1I A;  1VQ8 N;  3ZSQ A;  5J2P A;  3KK1 A;  1TK5 A;  1KVC A;  4B1W B;  4DTR A;  3J81 O;  1RTH A;  3OYN A;  2Q0R A;  5JVG L;  3MXM A;  4AF1 A;  2G8H A;  3ULE B;  2QWQ A;  2BDP A;  1NGH A;  3DMJ A;  4CER A;  4DU4 A;  4GV6 A;  1RDA A;  3E9L A;  4XIU A;  2ETJ A;  2F8T A;  5KQD A;  4H4O A;  1S1W A;  4RW7 A;  3VGM A;  5FPE A;  1MU2 A;  4NYN A;  3J80 O;  3AGK A;  3KLE A;  3R3L A;  1HJO A;  3ASM A;  1SL2 A;  1L5U A;  1CLQ A;  4FLT A;  2KFZ A;  2X74 A;  4Q5V A;  4WQ5 A;  3DLR A;  3L4I A;  5C15 A;  3S3O A;  4EP4 A;  3AO5 A;  1RNH A;  4KTW A;  1OH5 A;  2NZT A;  4M3R A;  2HHW A;  3O9S A;  1VSF A;  3HVT A;  3O08 A;  2KLA A;  3LPT A;  3PUF A;  4CK2 A;  3HYF A;  3DLE A;  2XO7 A;  5TKY A;  2KFN A;  3AVA A;  2HBK A;  1E4F T;  4BRO A;  2P9N B;  4FVM A;  5HL7 L;  2GBZ A;  3TAR A;  4DR2 K;  3CD6 N;  2P9U B;  4FYD A;  4KHP K;  4LF6 K;  1VHX A;  1WSJ A;  2W6L A;  3NHG A;  3TSU A;  4JRP A;  3KK3 A;  2J4R A;  2W42 A;  2Z1G A;  2ZWH A;  1XI1 A;  3VA0 A;  3V9X A;  4CFA A;  1JLF A;  4PL8 A;  4PA1 A;  3EY1 A;  3N4Q A;  4DU1 A;  3AVJ A;  3LAM A;  1KLN A;  5FPN A;  2HHT A;  3A5O C;  4DFK A;  3DOK A;  1GLE G;  5AQG A;  4YOT A;  4AM6 A;  5E26 A;  1GLC G;  3RMC A;  1B9F A;  3M5R A;  4LF5 K;  3PX6 A;  3TI0 A;  4DQS A;  3P1G A;  3QNO A;  1HNX K;  2RHK A;  3GG4 A;  1WN7 A;  4OKK A;  1QQC A;  3I33 A;  4HWI A;  4FL9 A;  3HST B;  1GOC A;  3VN5 A;  4FWP A;  3VGL A;  2O8B B;  3KKR A;  3TAF A;  1NKC A;  2FC0 A;  2P9P B;  2W41 A;  4HCB A;  5C10 A;  3H08 A;  5BRE A;  3DLK A;  2BAN A;  4GKK K;  3CFP A;  2WOM A;  1BGX T;  3ZSR A;  2KZM A;  3IAY A;  3LZI A;  4CJU A;  1JLQ A;  1VSJ A;  1X3M A;  4IG3 A;  1JL1 A;  4E1M A;  1KRP A;  3U3G A;  4H0P A;  4FVU A;  3ITH A;  3HBT A;  4ILG B;  1YI2 N;  5T7B A;  3O3H A;  2D1K A;  2QK9 A;  4IEE A;  3ID8 A;  1KSP A;  2CH5 A;  1Q81 O;  2A1R A;  3OYA A;  4Z4G A;  4N47 A;  1HPM A;  2Q97 A;  1GLJ O;  4CJR A;  3A5M C;  3PO4 A;  4YFU A;  4KB0 A;  2UU9 K;  5EOY A;  2P9L A;  1S22 A;  2ZM6 K;  1IKY A;  3ISN C;  4FLY A;  1VAZ A;  4IFY A;  4WF9 L;  3THV A;  2HNZ A;  1V4T A;  3E01 A;  4OLB A;  4JI3 K;  2GEL A;  5AQL A;  3VEW A;  3P31 A;  4DV1 K;  3QDK A;  3QIN A;  5IWA K;  4A62 A;  5HRO A;  3UKU B;  3F73 A;  1BU6 O;  3RSE B;  3VPZ A;  4BRK A;  4YNQ A;  4M3X A;  4OPK A;  1YT3 A;  1DTQ A;  3UKR A;  4KBO A;  3ATV A;  1NJW A;  1NBW A;  5CZ1 A;  4FLW A;  1FW6 A;  2UXD K;  3WUH A;  5M1F A;  3O8M A;  4OGE A;  4B1V A;  3RMD A;  3BEX A;  3EZW A;  4DUY K;  4C23 A;  5C42 A;  5JMV A;  3VTI A;  2XY8 A;  3O4Q A;  1VQM N;  4E7H A;  1EQY A;  1P90 A;  4BR4 A;  2O8E B;  1RBS A;  2XY6 A;  3HOS A;  3LAN A;  4FJ7 A;  2HW3 A;  2Z1J A;  2ZGY A;  3M8P A;  1MWK A;  3A5L C;  3TTC A;  1VSE A;  4ILJ A;  2I7N A;  2KTQ A;  3VMF B;  3HT3 A;  4M7Y A;  4RW9 A;  3SUP A;  3CCQ N;  3VQ6 A;  3KD5 E;  4E0D A;  1QVG M;  4AQY K;  4BR2 A;  4IEI A;  1NGF A;  4FJG A;  1ZBL A;  2Q31 A;  2H3G X;  1TV6 A;  4YOV A;  3F9K A;  1QZ5 A;  3V4I A;  4CBX A;  3L2R A;  1GOB A;  1NK9 A;  1QSS A;  1KVA A;  4PKH A;  3U8X A;  3MWP A;  4LF4 K;  4DCH A;  4JKD A;  3WXM B;  1HNZ K;  3D2E B;  4BGB A;  1U47 A;  4EZ6 A;  3W3D A;  4CK3 A;  2KW4 A;  1DKG D;  2YHY A;  3MDQ A;  4I9Q A;  1HKC A;  3LDP A;  4JHD A;  1XMQ K;  4LF7 K;  4EHU A;  3SZ2 A;  4OX9 K;  1I3A A;  3ZET B;  5I9E B;  3HVR A;  4B1U B;  4JKC A;  4N41 A;  5BR8 K;  1C0U A;  4FM1 A;  4LY7 A;  2OPP A;  1SKR A;  3DLH A;  2VWK A;  5HP1 A;  4DKW A;  3DXM A;  3MK6 A;  4PHT X;  1RDW X;  4B1Z A;  4JKG A;  4KKO A;  3CG7 A;  4AH9 A;  5GIN A;  3UB5 A;  4E7J A;  3ZSY A;  1VQL N;  4IWV A;  1RT6 A;  2GUI A;  3ZT0 A;  4CK1 A;  4FWN A;  1Q86 O;  4O8U A;  4OJR A;  4Z4H A;  3ZT1 A;  4J2D A;  2O8C A;  1S9E A;  5LJW A;  3U6F A;  1S1U A;  2O8F B;  3CCR N;  1XQS C;  1BIU A;  4KTQ A;  1RTJ A;  3F5T A;  3FFK B;  2I7P A;  1Q7Y O;  4PL7 A;  4BC5 A;  3BGR A;  4O4G A;  4FO0 A;  4CHP A;  4F3T A;  4DTS A;  3THW A;  3WXK A;  5FRO A;  2O8D A;  3NH1 A;  2XY7 A;  2E6L A;  3RR7 A;  3L2V A;  1E3M A;  4H5R A;  3U4L A;  2FF3 B;  3SQ0 A;  4NXN K;  5FPD A;  1FKP A;  4K0K K;  3CI5 A;  2ZJR L;  1IV0 A;  1EX4 A;  2PBD A;  1NGB A;  1ZBF A;  3CCL N;  3K0S A;  3C6H A;  4JI1 K;  3MN9 A;  1GLA G;  1HYS A;  3OTO K;  4KI4 A;  5HRR A;  1SAZ A;  4W5O A;  3P39 A;  3LWL A;  4NLB A;  3THY A;  4BRI A;  4B3T K;  1U2V B;  4N76 A;  4N5S A;  3G6E N;  4DV2 K;  3IUC A;  4ICL A;  3OBY A;  3BP8 A;  4B9S A;  1RT2 A;  1TAU A;  4CZI A;  4MFB A;  3I8B A;  4G1Q A;  1S9G A;  3NGZ A;  3L8B A;  1X9M A;  1RBR A;  3AA5 X;  5F1X A;  4K42 A;  3H3N O;  4KB1 A;  5GAG P;  2YNF A;  4BG8 A;  1EET A;  1YVU A;  3HM8 A;  4U7B A;  5AQW A;  5JVH L;  3SJJ A;  4FZY A;  1HYZ A;  5JS2 A;  5FRM A;  2OZS A;  5IT9 O;  5AQS A;  4DS5 A;  4A61 A;  4AHS A;  2G8F A;  1LAV A;  4BDZ A;  4M45 A;  3ULE A;  4GMJ B;  4CJ3 A;  1TAQ A;  4DFM A;  1HLU A;  3VF2 A;  4ISF A;  3CME N;  4OPJ A;  1YJ9 N;  1QQM A;  1D5A A;  1O13 A;  3NVK A;  4BR9 A;  3O9U A;  4A5A A;  4CEQ A;  2ZJQ L;  3I0S A;  1ZBH A;  2E2N A;  3K58 A;  4YHH K;  3U9D A;  4FLZ A;  1JKH A;  3TAE A;  1TK8 A;  2VGM A;  4H03 B;  1JCF A;  1S5J A;  2G8W A;  4WFB L;  5EY4 A;  1YIJ N;  3OYH A;  4DSJ A;  3C7N A;  1J53 A;  3AO4 A;  3QBW A;  5BPL A;  4NLC A;  3VA3 A;  2P9I A;  3V9W A;  3G4S N;  3CC2 N;  1BL3 A;  4JI6 K;  2I5J A;  4I9L A;  3VQD A;  2A3Z A;  1LW0 A;  4FLV A;  5JS1 A;  5FLX O;  2OTJ N;  4CJ4 A;  1FKO A;  3FZF A;  1SS6 A;  1VRU A;  3OYD A;  2P9N A;  4CGI A;  3MEG A;  1U49 A;  2E5L K;  2HBL A;  4JKF A;  3WEE A;  2GV9 A;  4FLX A;  4HHT A;  4YOU A;  2F7T A;  3HI0 A;  3SQ2 A;  1ZXO A;  3CFR A;  3U3Y A;  2DPN A;  4A2A A;  4ILH A;  1SQK A;  3LAL A;  5AQP A;  2DFE A;  5HRS A;  1BIZ A;  3TWH A;  4LH5 A;  4KV8 A;  3SI6 A;  3CET A;  4YOR A;  1TK0 A;  2A42 A;  2FBY A;  3KKS A;  3C94 A;  1Q8I A;  3OYL A;  4DV7 K;  1ASV A;  3VEZ A;  4Z0U A;  4FXD A;  4F9O A;  1TL3 A;  4WQ4 C;  4CHZ A;  2QKK A;  3PIP L;  4RG8 A;  3ZEU B;  3CFO A;  5FRN A;  4O55 A;  1IG8 A;  3KLF A;  2VQF K;  4WFN L;  3RWU A;  3O9R A;  3AA3 A;  4OPA A;  4BDY A;  1TYQ B;  1ZC6 A;  1U45 A;  2GWJ A;  2QXF A;  1RBV A;  3L4Q A;  2WBN A;  3SV4 A;  4F4K A;  5ADX H;  3CER A;  3SAF A;  2O8B A;  1MDU B;  1CXU A;  3D7E O;  4CEF A;  2P9P A;  4BE0 A;  5JIC A;  1HKB A;  4CJK A;  4KHN A;  2A1S A;  4CFC A;  4FW1 A;  5BN9 A;  1QHA A;  1YF5 L;  2DFF A;  4CGH A;  5EU7 A;  4Z94 A;  4J2B A;  1RDD A;  2FSN A;  2NRV A;  1S72 N;  1K8A O;  2OPS A;  4IO9 L;  5D3G A;  5KGW A;  4LSL A;  4NB4 A;  3S41 A;  3VQA A;  4W5N A;  2BE2 A;  1NK8 A;  4I6M A;  4IFE A;  3DRS A;  3SJH A;  4C1N I;  3IRX A;  1TKD A;  1Q18 A;  4CEB A;  1LWF A;  4FWL A;  3VEO A;  4G9Z A;  3CXC M;  4CZM A;  1NU0 A;  3LL3 A;  3UIQ A;  3TTF A;  1WSH A;  4I7F A;  4JRQ A;  4CJQ A;  3KD1 E;  2KKZ A;  1GLL O;  1NOZ A;  2JGU A;  1KVB A;  1BA1 A;  2YI1 A;  3VF4 A;  4CHN A;  2ITG A;  4IBN A;  2E1Y A;  1CZB A;  4ELT A;  3S3M A;  4M3T A;  3FE1 A;  3NF8 A;  1C0F A;  2Z1H A;  2A5X A;  2E1Z A;  5K14 A;  5C25 A;  1BO5 O;  2HMI A;  3LPU A;  4CGF A;  1OH6 A;  4CZE A;  4EFH A;  4JI5 K;  1A5W A;  4QS7 A;  2DTU A;  3C6U A;  2IVO A;  1R0A A;  1LW2 A;  4CF1 A;  4B3M K;  4JI7 K;  3CCS N;  4M3U A;  4B3R K;  2HBJ A;  4FK4 A;  3M8R A;  3O3G A;  4E89 A;  3G71 N;  4IOA L;  2HF3 A;  2QM1 A;  4JN4 A;  2P5O A;  3V1R A;  1WSG A;  1VQP N;  1RT5 A;  4E7L A;  3NH0 A;  4BRQ A;  2PZS A;  4B1Y B;  4CEC A;  2KZZ A;  3NGI A;  5DM7 L;  3IG1 A;  2QWN A;  3ZSO A;  4LF9 K;  2D0O A;  3AV9 A;  2YJF A;  3CYM A;  3SYZ A;  3K2P A;  1N8R O;  1ZBS A;  4DQ8 A;  4DUZ K;  2YX6 A;  1T3V A;  4BQZ A;  1R59 O;  3WXJ A;  1G15 A;  3H45 C;  2F4V K;  3OYF A;  4CJE A;  3EE8 A;  1NGC A;  5AZI B;  4CJV A;  2P9S A;  1S1X A;  1T8E A;  3CQY A;  4JEP A;  1CZA N;  3J7Y P;  3LWM A;  4CJP A;  4X65 K;  4DFP A;  1JLB A;  3NGY A;  4BC4 A;  1ATS A;  2VYP A;  4CES A;  4R79 A;  3FZK A;  2P9K B;  4CEA A;  3ZSV A;  4EHT A;  4FK2 A;  3AVG A;  4KH5 A;  1WB9 A;  4DLE A;  4KRE A;  4CF9 A;  3D2E A;  1D9D A;  4BY9 C;  4WE1 A;  3TPQ A;  3ALY A;  4DTO A;  1T03 A;  4H5T A;  3AVN A;  4CW7 B;  1YAG A;  5DMR A;  1RT4 A;  4Y1D A;  1HJR A;  3BZK A;  3NFA A;  3SMS A;  4PKI A;  2GEM A;  1YXQ A;  4XH1 A;  1W0H A;  2F96 A;  1NJI O;  2HVI A;  4DB3 A;  1YTA A;  3HO1 A;  2V51 B;  4IJN A;  4JI2 K;  3I8D A;  3E66 A;  4H5V A;  3G0Z A;  2RPI A;  4FZZ A;  4H8K A;  5C24 A;  1ILY A;  4O0I A;  5FPM A;  4DTP A;  2XRI A;  2UYT A;  1BI4 A;  4JKE A;  2AP1 A;  1HUX A;  4DQQ A;  2VQE K;  3MXJ A;  2G8K A;  4JK9 A;  2HOE A;  5M1N A;  5GAE P;  5AFU H;  2HHU A;  5BRD A;  2QEX N;  4J8F A;  3CCM N;  4CZH A;  1RDB A;  4RWT A;  2VWB A;  1XHX A;  1J5E K;  1T44 A;  2D0C A;  2IDO A;  1Z25 A;  5LJV A;  4HTL A;  4GV9 A;  4DSF A;  4DMN A;  1N34 K;  4KHU A;  4L8R B;  4DTM A;  3O4W A;  2PY5 A;  3SLC A;  3KIO A;  4Y0W A;  2B5J A;  1REV A;  3SQ4 A;  4M3W A;  1XNR K;  1KLM A;  4Z4C A;  3GL1 A;  3RMA A;  3HOT A;  3QEI A;  2ASP A;  3DXK A;  3E1Y A;  4B8C A;  4DR5 K;  4BGA A;  4KH4 A;  4U67 L;  4BC3 A;  4GW6 A;  2ZQB A;  3CJ7 A;  3T19 A;  4WQ4 A;  4B08 A;  3MAQ A;  3R9P A;  4GVM A;  4CJL A;  1GLD G;  3OYE A;  1BQM A;  2AJQ A;  3AAP A;  4DV5 K;  2HST A;  3DRR A;  3K57 A;  4MLE A;  3VF6 A;  2YHX A;  4HUE A;  3WNE A;  3RMB A;  4FLU A;  2HHQ A;  5J2Q A;  1EWQ A;  5AQK A;  3HRG A;  3KK7 A;  1SKS A;  4LF8 K;  3O5B A;  3WNH A;  4LFB K;  1U2V A;  1A5V A;  3O1B A;  1W97 L;  4JD2 A;  3CPW M;  4EZ9 A;  3THX A;  5AJ3 K;  1WNS A;  2LSN A;  4EAH D;  4B9V A;  5BN8 A;  4FCY A;  3QIC A;  4I2Q A;  4Y1C A;  3L0Q A;  3OYI A;  2YHB A;  2UUC K;  1D9F A;  4FWO A;  2GUP A;  5HRN A;  3T1A A;  1ESV A;  1Z6R A;  3OYC A;  3K9K A;  1Z05 A;  2WC9 A;  3AVK A;  4YDU C;  3H1V X;  5M1O A;  1NK6 A;  4KRF A;  1BOT O;  5CYQ A;  3GBT A;  4CJ5 A;  4K25 A;  3MEE A;  1P8Z A;  2OA8 A;  3AAR A;  3M8Q A;  2ITM A;  4FJM A;  4H4M A;  4M42 A;  1HNW K;  5M1Q A;  1ASU A;  1Q82 O;  4K43 A;  1GLF O;  1B9D A;  2KQ2 A;  4UY8 O;  4FJH A;  3E9P A;  3LAK A;  3VQ5 A;  3WNF A;  3SNN A;  3EEQ A;  2QW9 A;  4IKF A;  3ZT2 A;  2HMP A;  2B6A A;  4M41 A;  1X3N A;  4E1N A;  4BRH A;  2D0P A;  3QEP A;  1KXP A;  4DR7 K;  1J6Z A;  3A8Y A;  4PKG A;  3PSF A;  1MWM A;  3QML A;  3DLB A;  4BVO A;  1T6C A;  4N56 A;  1EO1 A;  4DV0 K;  4KFB A;  1XNQ K;  3F2K A;  2G8U A;  2KHO A;  3S3N A;  5HLF A;  3FZH A;  2NNW A;  2QTD A;  4JKA A;  2BUP A;  3LM9 A;  1N36 K;  2E2Q A;  5KPR A;  1BCM A;  1NGI A;  1NOY A;  4CE9 A;  1N33 K;  1H1V A;  3H3O B;  4BWJ A;  2YNG A;  1ZYQ A;  3AVL A;  4YOY A;  3HK2 A;  1KQS M;  3MED A;  3NH2 A;  3OJS A;  1BWF O;  1OKJ A;  3SAG A;  2FF6 A;  3O3F A;  1L3V A;  2NLX A;  1NGA A;  4FK0 A;  4HUF A;  3ENH A;  4ZHR A;  3CCU N;  1X9W A;  2F9T A;  5ADX A;  4CZL A;  1IO2 A;  3LP0 A;  4E7I A;  5JLH A;  3FR0 A;  4E19 A;  3SQ1 A;  3DAW A;  4CZK A;  3QES A;  4OO1 J;  3OHR A;  4DR6 K;  2O4G A;  2QXL A;  4PY5 A;  1U6Z A;  4AHV A;  4CGJ A;  5GIO A;  1ZBU A;  2YNH A;  3ZEU A;  2WFB A;  3TAB A;  5BR9 A;  1QZ6 A;  3OYM A;  1GOA A;  2HB5 A;  4E3S A;  3ATU A;  3OVN A;  1K6Y A;  1LWE A;  4OKJ A;  4JS5 A;  3SUO A;  3KLH A;  1UWB A;  4DSI A;  4C8M A;  1ASW A;  4CZF A;  2RE2 A;  2Q0U A;  1RT1 A;  1VSK A;  4CI6 A;  2W40 A;  1QHT A;  1G99 A;  4EP5 A;  1JCE A;  1C0M A;  1VQ9 N;  3HJF A;  3QNN A;  1KC8 O;  4B9U A;  1NLV A;  4FWS A;  3RRG A;  3JS6 A;  1FXX A;  1HKG A;  1HX1 A;  3QEX A;  4BVP A;  3WXI A;  1Y64 A;  1LCU A;  4DV4 K;  5AZJ B;  5AQT A;  3VQQ A;  1NMN A;  1C6V A;  2IGI A;  4ELV A;  2AA4 A;  2QKB A;  5BRH A;  1JLC A;  4DSL A;  2WTU A;  1UA1 A;  5LL6 Z;  2E20 A;  3D2F B;  4ID5 A;  3J7A P;  1BA0 A;  3AVM A;  1HRH A;  2P9L B;  2E2P A;  3CQX A;  3I55 N;  3TAM A;  1XUP O;  1NKE A;  4QCL A;  1UAX A;  2VCP A;  1X1P A;  4CD1 A;  3PY8 A;  3HL8 A;  1E4G T;  1YHQ N;  2FSJ A;  3B6P A;  1VQK N;  3NF6 A;  3AVC A;  3K5L A;  4X62 K;  2V7Z A;  4WQ5 C;  5AQI A;  3AA2 A;  3VES A;  3DLL L;  1IBM K;  4F2S A;  4FPA A;  5CE3 A;  3AO1 A;  1EP4 A;  3M1F A;  4B9N A;  3UKR B;  3T7Z A;  1M1K O;  1Q9Y A;  2PYJ A;  4IFV A;  4BRL A;  1HQE A;  4Z4F A;  1JL2 A;  2F9W A;  3EKU A;  1KFS A;  5I42 A;  3QIO A;  4B3O A;  3CJB A;  4H0O A;  4NO7 A;  3CQ8 A;  3Q7B A;  3BF1 A;  1TUY A;  2JWK A;  1VQ5 N;  3AY9 A;  4MQ3 A;  3M6G A;  4F2R A;  3KK2 A;  3BUZ B;  3K5O A;  4OGC A;  4BQL A;  3GOI A;  4FJ5 A;  3WQT A;  2D0B A;  3AVI A;  3R8E A;  1TL1 A;  3VET A;  3V81 A;  3SBT A;  4DTU A;  1CZ9 A;  3SUN A;  4DQR A;  2IOC A;  2QWO A;  1RT3 A;  5C2D A;  1J5O A;  1W9H A;  3A2F A;  4K8Z A;  3AVB A;  5F0X A;  3I0R A;  1BHL A;  4FWK A;  4YDU A;  5GAH P;  4J2A A;  4FJI A;  2P9U A;  2EX3 A;  4ZTF A;  1YTU A;  2HVH A;  2X78 A;  5BRF A;  1LV5 A;  1RFQ A;  4CHY A;  2GWK A;  3MEC A;  4NCG A;  3Q7C A;  4MLH A;  3CF5 L;  3SPY A;  3OY9 A;  1A5X A;  2P9K A;  4B9T A;  4M7X A;  1X9J A;  3PV8 A;  1VSD A;  3HZ6 A;  4JHD B;  5AQZ A;  3EZ5 A;  4CIF A;  2CGJ A;  4HVJ A;  3M8S A;  1NK0 A;  4CJ7 A;  5MLC Q;  3W0L A;  2RF2 A;  3I56 N;  4ID1 A;  5GAD P;  3MN7 A;  2ZF5 O;  3G25 A;  4WFA L;  1RTD A;  4PUO A;  3ZSW A;  1W2B M;  3NAE A;  4JNE A;  4OVL A;  2NUB A;  4GNI A;  4OKE A;  4O5B A;  3KWG A;  3P83 D;  1GLB G;  3D45 A;  2YJE A;  5CY4 A;  3B6O A;  1TGO A;  1JLE A;  5KPT A;  3VQ4 A;  1QSL A;  3U9Z A;  5J2N A;  3L2U A;  1I94 K;  2DY4 A;  3TR8 A;  2D0A A;  4JKB A;  1SL0 A;  4AHT A;  4K41 A;  1IBL K;  4O5F A;  2ZD1 A;  1V4S A;  1QE1 A;  4CIE A;  2O8C B;  3D6R A;  3ZT4 A;  3BZC A;  1IBK K;  4JKH A;  4JK7 A;  5LMN K;  1HQU A;  3LDN A;  3ZT3 A;  4CZG A;  1D8Y A;  1HPZ A;  3QO9 A;  2UXB K;  2YHW A;  2PAV A;  3ID6 A;  3O9T A;  3E9O A;  4W5Q A;  3DI6 A;  1WAJ A;  4DTN A;  1ATN A;  4DLG A;  3D0P A;  5GIP A;  1WOQ A;  3VER A;  1RCH A;  3LZJ A;  3SK3 A;  4C8N A;  5KQ8 A;  3A5N C;  1W7A A;  1C1A A;  1XC3 A;  2E88 A;  1RGI A;  4KO0 A;  3VGK A;  3O4N A;  1RBU A;  3OYK A;  2FXU A;  2HHV A;  2NRW A;  3THY B;  4Z4E A;  3N4P A;  1WSF A;  4M3Y A;  3OBW A;  4Z4I A;  3SMP A;  1UOC A;  2QWL A;  1QSY A;  1XHZ A;  2X6N A;  2A6A A;  2OPQ A;  5CZ2 A;  4DQP A;  3OYG A;  4BWM A;  1VSM A;  4DTJ A;  2D5R A;  3IFR A;  2E4L A;  2HND A;  3A0I X;  4YOW A;  2NRR A;  3HP6 A;  3UKU A;  4XEI A;  3NCI A;  4C8K A;  3RSE A;  5HBM A;  1VQ6 N;  4MO5 A;  4FWR A;  2YKM A;  3PX0 A;  1ZBI A;  1BUP A;  1OVQ A;  5A2Q O;  5AQN A;  3OA9 A;  1J9A A;  5LY3 A;  3ZSZ A;  1JCG A;  4H0Y B;  3T3F A;  2O4I A;  2QWP A;  4BRM A;  4DQI A;  3CC4 N;  2O8E A;  2RKI A;  3VEX A;  1KAY A;  4DV3 K;  3CM5 A;  1NK5 A;  4CFD A;  1L3S A;  2E8A A;  1VQ4 N;  4JS4 A;  4HTU A;  3K5M A;  2JWL A;  4DR1 K;  4IXC A;  5DM6 L;  4QOZ B;  3KJV A;  1KTQ A;  4E1J A;  4EIA A;  3AGR A;  4HCC A;  2EWS A;  3P38 A;  1S1V A;  1Z26 A;  3M3Z A;  3C6A A;  4JI4 K;  3FLC O;  3J8A A;  4A57 A;  1K8K B;  2ZE2 A;  1DGK N;  4B3S K;  4KPY A;  3C7N B;  3CHW A;  3OS1 A;  2ASM A;  2CGL A;  2NRX A;  4O44 A;  2P9I B;  3H1Q A;  4ZTJ A;  3S9H A;  5LMU K;  4IOC L;  3R1X A;  1NMD A;  5AQM A;  3K9J A;  5KI6 A;  2FBT A;  3PSI A;  1T7P A;  2BGG A;  2Y1J A;  3FZL A;  5HRP A;  3B8A X;  1BQN A;  3WEE B;  1ATR A;  4NCB A;  3F9M A;  4CJW A;  2IIR A;  3ZX0 A;  5KRS A;  2NRH A;  3P4I A;  4AHC A;  3FZM A;  1SV5 A;  5AQR A;  3ZET A;  1BIS A;  1BDG A;  3AVF A;  5AQF A;  1ITG A;  4IO8 A;  1YUW A;  5AQY A;  4IDK A;  4DSK A;  2IVN A;  4DG1 A;  3CJ1 A;  4W5T A;  2XY5 A;  3PX4 A;  4GKJ K;  2OTL N;  1U04 A;  2HHH K;  4ISE A;  4RCH A;  4OLA A;  1KCF A;  1VRT A;  2P1J A;  3MCA B;  3QEV A;  4FJ9 A;  1NK4 A;  1NGE A;  1DTT A;  5C2F A;  3CJ9 A;  4BR0 A;  4CEZ A;  3TAG A;  4DR4 K;  4JI8 K;  1EWR A;  3CCE N;  5M1P A;  3AAQ A;  2W6K A;  1C1C A;  5EXW A;  4QS8 A;  4MDB A;  3ENO A;  3QB0 A;  1BCO A;  2O8F A;  2X6S A;  3OS0 A;  3GDQ A;  4BRP A;  4BE2 A;  3EN9 A;  3KTQ A;  2BH1 A;  3JSM A;  1JLA A;  3L3U A;  3O9Q A;  2YKN A;  2VG5 A;  4FW2 A;  2OAN A;  1QQO A;  3T69 A;  2OYQ A;  3H46 O;  3SAH A;  3KWI A;  4DWI A;  3O1W A;  1SUQ A;  3EL2 A;  3FGU A;  1M90 O;  3NMU A;  4CBW A;  4BRE A;  1OH7 A;  2YNI A;  4B9L A;  4JLH A;  4IG0 A;  3LP3 A;  4AHR A;  4I6M B;  1L3U A;  3AVH A;  3VQE A;  5I3U A;  3TTD A;  4FJL A;  1TVR A;  3SBG A;  5AZJ A;  1HR0 K;  1RIL A;  4A5B A;  2QA4 N;  2VG6 A;  3IS9 A;  1NGJ A;  1QVF M;  1IKV A;  1C0T A;  3L2W A;  1Y97 A;  3GE1 A;  3C65 A;  4CEE A;  3D2F A;  1NJX A;  4IJA A;  1KD1 O;  3KZB A;  4C8L A;  2UXC K;  3HPO A;  4GVE A;  4FPB A;  3CCJ N;  3T1H K;  2ASO A;  5HOO A;  2F8S A;  3V1Q A;  2A40 A;  4NXM K;  3NF7 A;  5M1K A;  3ZX2 A;  4CBU A;  3TU5 A;  3CMA N;  4CHQ A;  1KAZ A;  3LP1 A;  4AIL C;  3VQB A;  1HYV A;  3V6D A;  3CM6 A;  2CGK A;  2QWM A;  3ZYY X;  5J2M A;  1DLO A;  2DFH A;  4HUG A;  4KHS A;  4FZX C;  3C0B A;  3QBX A;  1XWL A;  3QET A;  5C0Y A;  3DOL A;  3J7Z O;  3TAQ A;  3MN5 A;  1KFD A;  3SV3 A;  5F2R A;  1JLG A;  1RBT A;  3OYJ A;  4GV3 A;  1FJG K;  3JYT A;  4I2P A;  3MN6 A;  3RRH A;  2EHG A;  1VSI A;  4CZJ A;  4CF2 A;  3OW2 M;  3PO5 A;  3CC7 N;  1NK7 A;  3LDL A;  4QAG A;  5BPM A;  1SKW A;  1LOT B;  3IKM A;  3VQP A;  4H0V B;  3TAP A;  3RR8 A;  3TAN A;  1Q9X A;  1SL1 A;  2WUS A;  2CH6 A;  2PFU A;  1T05 A;  4KTZ A;  3NVM A;  1B92 A;  3CIP A;  4CVN E;  4MDA A;  3WNG A;  2P9S B;  4BRN A;  4C1N K;  4M63 C;  2OCE A;  4AHU A;  1VQO N;  1WBB A;  4AM7 A;  4C8O A;  2V7Y A;  3EYZ A;  4DHY A;  4DF4 A;  4K8X A;  4KHQ A;  2OZM A;  4CJS A;  3C6T A;  3AO3 A;  3VQ8 A;  3T1Y K;  1JJ2 M;  4BR5 A;  1IG9 A;  1WAF A;  3EE9 A;  1VK0 A;  3MX2 A;  4CHO A;  4H0T B;  1FK9 A;  1S6Q A;  1NWK A;  2NRZ A;  2HNY A;  1T6D A;  3HPH A;  3IDH A;  4MO4 A;  4CED A;  3CJC A;  5KTQ A;  4CFB A;  3DJC A;  3FFI A;  1LAW A;  1QQN A;  3V9Z A;  4KAZ A;  1IKW A;  4FWQ A;  1BI4 B;  3KVG A;  3WQU A;  4DR3 K;  1N6Q A;  2P51 A;  5AQU A;  2HF4 A;  4B9M A;  1VSL A;  4CD3 A;  3O80 A;  4FJK A;  4A59 A;  1TYQ A;  4QS9 A;  4CF8 A;  1EKE A;  4LH4 A;  3DRP A;  2Z1I A;  3R6M A;  3QEW A;  2GTD A;  3BF3 A;  1EXQ A;  2XHB A;  4CCH A;  3PIO L;  2IS3 A;  3QLH A;  2IAJ A;  2Q36 A;  3VQ9 A;  3NF9 A;  3HTV A;  3L6Q A;  3HXM A;  4JV5 K;  1XMO K;  1K9M O;  1S1T A;  1NGG A;  3OYB A;  4KI6 A;  1TKT A;  3DXK B;  5AQQ A;  3LDS A;  1OVY A;  3CPE A;  4O8K A;  5CR4 A;  5E84 A;  3OS2 A;  5SWM A;  4CEO A;  5E41 A;  4WCE L;  3LDQ A;  1WSI A;  3KHY A;  2VWJ A;  2G8V A;  5DK5 A;  3EO3 A;  1DEJ A;  4BRC A;  1HNV A;  4F3O A;  3HP9 A;  1WSE A;  2R7Y A;  1TKZ A;  2PYL A;  3QIP A;  5AQV A;  3LP2 A;  3PLA A;  1HMV A;  4CGG A;  3NBP A;  3DWL A;  3VEN A;  5CHI A;  3VEY A;  3V9U A;  3VTH A;  4DU3 A;  4XH5 A;  1J54 A;  4M3Z A;  4WYB A;  4BDP A;  3LDO A;  2UUA K;  2FSK A;  3VQ7 A;  4JD2 B;  3K59 A;  2IVP A;  3AO2 A;  3THX B;  4A2B A;  1YIT N;  4PQU A;  2VG7 A;  2BTF A;  1X9S A;  1C0G A;  4CF0 A;  5TKW A;  3TSQ A;  4DSE A;  2ZJP L;  3L2Q A;  4JYA K;  4LFC K;  1NG9 A;  4YOX A;  4FWM A;  1N32 K;  3MMV A;  3NDK A;  1C1B A;  4ELU A;  3OJU A;  5JLF A;  3ENB A;  1NKB A;  3DM2 A;  4CJF A; 
#chains in the Genus database with same CATH homology
 1JXE A;  1NK9 A;  1QSS A;  4C8N A;  3SUQ A;  1KVA A;  2RN2 A;  4DQQ A;  1C1A A;  4FJJ A;  3MXJ A;  2G8K A;  2HHU A;  4KO0 A;  3O4N A;  1U47 A;  4EZ6 A;  1RBU A;  4CK3 A;  1HYS A;  3OYK A;  2KW4 A;  2HHV A;  4RW8 A;  1RTI A;  1RDB A;  4I9Q A;  4Z4E A;  1WSF A;  1XHX A;  4F4K A;  4M3Y A;  2IC3 A;  4Z4I A;  1UOC A;  2D0C A;  2IDO A;  1Z25 A;  3SZ2 A;  4RW6 A;  4DSF A;  4DMN A;  1QSY A;  1XHZ A;  1I3A A;  2X6N A;  3P5J A;  5J1E A;  3HVR A;  2OPQ A;  4KHU A;  4L8R B;  4DTM A;  5CZ2 A;  4DQP A;  2PY5 A;  3OYG A;  4BWM A;  4N41 A;  1VSM A;  3KIO A;  4DTJ A;  2B5J A;  1REV A;  3SQ4 A;  2D5R A;  4M3W A;  1C0U A;  1KLM A;  2E4L A;  2HND A;  4Z4C A;  3HP6 A;  3ULD A;  4FM1 A;  4LY7 A;  3K5N A;  2OPP A;  3NCI A;  1SKR A;  3DLH A;  4C8K A;  3QER A;  3RMA A;  3DLG A;  2VWK A;  5HP1 A;  3QEI A;  5HBM A;  4LD0 A;  4DS4 A;  2YKM A;  4B8C A;  1CXQ A;  3PX0 A;  1ZBI A;  4GW6 A;  2ZQB A;  4KKO A;  3CG7 A;  3T19 A;  4W5R A;  2OPR A;  4B08 A;  3MAQ A;  1UA0 A;  4AH9 A;  4E7J A;  4GVM A;  1J9A A;  3ZSY A;  1F21 A;  4CJL A;  3OYE A;  3ZSZ A;  1BQM A;  3KLI A;  3NE6 A;  2AJQ A;  1CLQ A;  1RT6 A;  3T3F A;  2O4I A;  4NCA A;  2E6M A;  3DRR A;  3K57 A;  4DQI A;  2GUI A;  3ZT0 A;  2RKI A;  4CK1 A;  4HUE A;  4OJR A;  5KRT A;  4Z4H A;  3WNE A;  3ZT1 A;  4J2D A;  1S9E A;  3RMB A;  3U6F A;  4DTX A;  4FLU A;  1S1U A;  1VSH A;  2HHQ A;  5J2Q A;  1IH7 A;  2WON A;  3CM5 A;  1NK5 A;  2G8I A;  4CFD A;  4E7K A;  1L3S A;  4KHY A;  1SKS A;  1BIU A;  4KTQ A;  4JS4 A;  1RTJ A;  4HTU A;  3K5M A;  3WNH A;  4QOZ B;  4R5P A;  3KJV A;  1A5V A;  4DFJ A;  1KTQ A;  1NJZ A;  3BGR A;  4EZ9 A;  4O4G A;  4CHP A;  4HCC A;  4F3T A;  1WNS A;  2LSN A;  1S1V A;  4DTS A;  4B9V A;  4FCY A;  1Z26 A;  4Q0B A;  5FRO A;  3NH1 A;  1I39 A;  4I2Q A;  4Y1C A;  2XY7 A;  2E6L A;  3OYI A;  2ZE2 A;  2JLE A;  3AA4 A;  1JXB A;  3L2V A;  3RR7 A;  4KPY A;  2Q3S A;  2YHB A;  3OS1 A;  4B8A B;  3C95 A;  4RW4 A;  4O44 A;  3SQ0 A;  4KHW A;  4DF8 A;  1D9F A;  4FM0 A;  3HM9 A;  1FKP A;  2FBX A;  4ZTJ A;  3SPZ A;  5HRN A;  1XC9 A;  3T1A A;  1EX4 A;  3OYC A;  3S9H A;  4BE1 A;  3AVK A;  4J2E A;  1ZBF A;  1S6P A;  1NK6 A;  4KRF A;  5KI6 A;  2FBT A;  3G10 A;  5CYQ A;  1T7P A;  3DYA A;  4BAC A;  2BGG A;  1O1W A;  1RDC A;  1HNI A;  4CJ5 A;  5CYM A;  4FM2 A;  1RT7 A;  3MEE A;  5KGX A;  2Y1J A;  5HRP A;  1N5Y A;  2OA8 A;  1BQN A;  4KI4 A;  3M8Q A;  5HRR A;  4NCB A;  3HPG A;  4W5O A;  3LWL A;  2P5G A;  4CJW A;  4FJM A;  4H4M A;  3RTV A;  4M42 A;  1ASU A;  4N5S A;  5KRS A;  4N76 A;  3V9S A;  2YV0 X;  2KQ2 A;  1B9D A;  4AHC A;  4FJH A;  4ICL A;  4B9S A;  3LAK A;  3VQ5 A;  1SV5 A;  3WNF A;  1RT2 A;  4CIG A;  1BIS A;  1TAU A;  3AVF A;  4MFB A;  1ITG A;  3SNN A;  4FJ8 A;  4G1Q A;  5FDL A;  1S9G A;  3ZT2 A;  4IDK A;  3ZCM A;  3NGZ A;  3L8B A;  1X9M A;  2B6A A;  3MXI A;  4M41 A;  4DSK A;  1RBR A;  3AA5 X;  4DG1 A;  4FJN A;  3KLG A;  4W5T A;  2XY5 A;  3PX4 A;  2HHX A;  4KB1 A;  4E1N A;  2YNF A;  1EET A;  1YVU A;  3QEP A;  1U04 A;  1L3T A;  4TSX A;  5SZT A;  4FZY A;  2B4J A;  3SJJ A;  1U4B A;  1HYZ A;  4O0J A;  1KCF A;  5JS2 A;  1VRT A;  2P1J A;  4OLA A;  3QEV A;  2FBV A;  2YHA A;  4FJ9 A;  5FRM A;  2OZS A;  1NK4 A;  4UQG A;  1DTT A;  1TKX A;  3DLB A;  1QS4 A;  4DS5 A;  1WLJ A;  4AHS A;  2G8F A;  1LAV A;  4N56 A;  4CEZ A;  3TAG A;  2KZZ A;  4BDZ A;  4M45 A;  4F8R A;  4GMJ B;  4NYF A;  4CJ3 A;  1TAQ A;  1NJY A;  4KFB A;  4DFM A;  2G8U A;  3S3N A;  1C1C A;  5HLF A;  4OPJ A;  2ATQ A;  1BCO A;  4CJF A;  1D5A A;  2HHS A;  2X6S A;  3OS0 A;  4PWD A;  1IKX A;  1LWC A;  4CGD A;  4CEQ A;  4BE2 A;  1BCM A;  1NOY A;  4CE9 A;  3I0S A;  1ZBH A;  3KTQ A;  3K58 A;  1QTM A;  4LSN A;  4BWJ A;  2YNG A;  3JSM A;  1ZYQ A;  3BDP A;  3AVL A;  1JLA A;  3L3V A;  3L3U A;  4FLZ A;  3HK2 A;  3MED A;  1JKH A;  3ZSX A;  3NH2 A;  4CJT A;  3TAE A;  1U48 A;  3OJS A;  1TK8 A;  2YKN A;  2VG5 A;  4FJX A;  3SCX A;  3VQC A;  1S5J A;  4FW2 A;  3V1O A;  3O3F A;  2Y1I A;  1L3V A;  2G8W A;  3ZSQ A;  5J2P A;  2OYQ A;  3KK1 A;  1TK5 A;  1KVC A;  3OYH A;  4DSJ A;  4DWI A;  4DTR A;  1J53 A;  3AO4 A;  1RTH A;  3OYN A;  4HUF A;  4FK0 A;  1SUQ A;  4ZHR A;  3VA3 A;  3MXM A;  1X9W A;  2G8H A;  3V9W A;  2BDP A;  1BL3 A;  1IO2 A;  2I5J A;  2YNI A;  4I9L A;  4B9L A;  3LP0 A;  4JLH A;  3DMJ A;  4IG0 A;  4CER A;  4E7I A;  3VQD A;  4DU4 A;  1LW0 A;  3LP3 A;  1RDA A;  4AHR A;  4E19 A;  4FLV A;  3SQ1 A;  5JS1 A;  1L3U A;  4XIU A;  4CJ4 A;  3AVH A;  2ETJ A;  1FKO A;  3QES A;  2F8T A;  3VQE A;  5I3U A;  2O4G A;  1VRU A;  4AHV A;  3OYD A;  4H4O A;  1TVR A;  4CGI A;  4CGJ A;  4FJL A;  4PY5 A;  3MEG A;  1RIL A;  1ZBU A;  1S1W A;  2YNH A;  1U49 A;  2VG6 A;  4FLX A;  2GV9 A;  3IS9 A;  4RW7 A;  3TAB A;  1IKV A;  1C0T A;  1MU2 A;  4HHT A;  4NYN A;  3OYM A;  3KLE A;  1GOA A;  3SQ2 A;  2HB5 A;  1Y97 A;  3L2W A;  4E3S A;  4CEE A;  1NJX A;  4C8L A;  3OVN A;  1K6Y A;  1LWE A;  3ASM A;  4OKJ A;  3CFR A;  4JS5 A;  3U3Y A;  4FLT A;  3SUO A;  1SL2 A;  1L5U A;  3HPO A;  2KFZ A;  3KLH A;  2X74 A;  3LAL A;  1UWB A;  2DFE A;  5HRS A;  1BIZ A;  4Q5V A;  3TWH A;  4DSI A;  4C8M A;  4LH5 A;  3V1Q A;  2F8S A;  1ASW A;  4KV8 A;  3NF7 A;  3DLR A;  3SI6 A;  1RT1 A;  1VSK A;  1QHT A;  3S3O A;  4EP5 A;  4EP4 A;  3AO5 A;  1TK0 A;  1RNH A;  1C0M A;  4KTW A;  3HJF A;  4CHQ A;  3QNN A;  4B9U A;  2FBY A;  3KKS A;  3C94 A;  1Q8I A;  3OYL A;  3RRG A;  4M3R A;  2HHW A;  3LP1 A;  1FXX A;  3QEX A;  1VSF A;  1ASV A;  3HVT A;  4AIL C;  3VQB A;  1HYV A;  3V6D A;  3CM6 A;  3LPT A;  3PUF A;  4Z0U A;  4CK2 A;  3HYF A;  4FXD A;  1TL3 A;  1DLO A;  5J2M A;  2DFH A;  3DLE A;  2XO7 A;  4HUG A;  4CHZ A;  4KHS A;  4FZX C;  2KFN A;  3AVA A;  2QKK A;  4RG8 A;  4FVM A;  3VQQ A;  2GBZ A;  3TAR A;  1XWL A;  3QET A;  1C6V A;  2IGI A;  3CFO A;  3DOL A;  5FRN A;  4FYD A;  4O55 A;  4ELV A;  2QKB A;  3KLF A;  3TAQ A;  1JLC A;  1KFD A;  1UA1 A;  3AA3 A;  1WSJ A;  3SV3 A;  4DSL A;  4BDY A;  1U45 A;  3RWU A;  4ID5 A;  2QXF A;  1JLG A;  3AVM A;  1RBT A;  1HRH A;  1RBV A;  3NHG A;  4JRP A;  3KK3 A;  3OYJ A;  2W42 A;  2Z1G A;  3SV4 A;  3TAM A;  3JYT A;  1NKE A;  4I2P A;  3RRH A;  1UAX A;  1XI1 A;  2EHG A;  1VSI A;  4CF2 A;  3VA0 A;  3PO5 A;  4QCL A;  3V9X A;  4CFA A;  1X1P A;  1NK7 A;  4QAG A;  1JLF A;  3PY8 A;  3HL8 A;  4PA1 A;  3EY1 A;  1SKW A;  4DU1 A;  1CXU A;  4CEF A;  3B6P A;  3VQP A;  4BE0 A;  3AVJ A;  3LAM A;  3NF6 A;  3TAP A;  3AVC A;  3RR8 A;  3TAN A;  4CJK A;  3K5L A;  1Q9X A;  4KHN A;  1SL1 A;  2A1S A;  4CFC A;  1KLN A;  4FW1 A;  2HHT A;  3AA2 A;  4KTZ A;  1T05 A;  2DFF A;  4CGH A;  5EU7 A;  4DFK A;  4J2B A;  2DY4 A;  1B92 A;  3DOK A;  1RDD A;  4F2S A;  3AO1 A;  1EP4 A;  4B9N A;  2OPS A;  3WNG A;  5D3G A;  5KGW A;  1Q9Y A;  4IFV A;  4LSL A;  2PYJ A;  3RMC A;  3VQA A;  1B9F A;  4W5N A;  1HQE A;  4Z4F A;  1JL2 A;  2BE2 A;  1NK8 A;  4AHU A;  3PX6 A;  3TI0 A;  4DQS A;  3DRS A;  3P1G A;  3QNO A;  1KFS A;  5I42 A;  3IRX A;  1WN7 A;  3QIO A;  1TKD A;  4C8O A;  4B3O A;  4OKK A;  1QQC A;  3EYZ A;  4DF4 A;  4CEB A;  1LWF A;  4K8X A;  4KHQ A;  2OZM A;  4CJS A;  3LZJ A;  3CQ8 A;  3HST B;  1GOC A;  3VN5 A;  3C6T A;  3AO3 A;  3VQ8 A;  3KKR A;  3TAF A;  1IG9 A;  1WAF A;  1NKC A;  2FC0 A;  3UIQ A;  1VK0 A;  4MQ3 A;  4CHO A;  4HCB A;  1FK9 A;  1WSH A;  4I7F A;  3H08 A;  3KK2 A;  1S6Q A;  4JRQ A;  4F2R A;  3DLK A;  2BAN A;  4CJQ A;  3KD1 E;  3CFP A;  2HNY A;  3K5O A;  2WOM A;  1BGX T;  1NOZ A;  2JGU A;  4OGC A;  3ZSR A;  1KVB A;  4FJ5 A;  2KZM A;  3HPH A;  4CHN A;  2ITG A;  3IAY A;  3LZI A;  2D0B A;  3AVI A;  4IBN A;  4CJU A;  1TL1 A;  1JLQ A;  4CED A;  1VSJ A;  1CZB A;  4IG3 A;  3V81 A;  1JL1 A;  3S3M A;  4ELT A;  4DTU A;  4E1M A;  1KRP A;  4M3T A;  1CZ9 A;  3NF8 A;  3U3G A;  3SUN A;  2Z1H A;  4DQR A;  5KTQ A;  3ITH A;  2IOC A;  5K14 A;  4CFB A;  5C25 A;  3L2R A;  1J5O A;  1RT3 A;  3FFI A;  2HMI A;  1LAW A;  3LPU A;  4CGF A;  5T7B A;  3O3H A;  1W9H A;  3A2F A;  4K8Z A;  3V9Z A;  3AVB A;  2QK9 A;  4KAZ A;  1IKW A;  1KSP A;  1BI4 B;  3I0R A;  1A5W A;  1BHL A;  2DTU A;  3C6U A;  1N6Q A;  1R0A A;  4J2A A;  2A1R A;  2P51 A;  1LW2 A;  4CF1 A;  3OYA A;  4FJI A;  4ZTF A;  2EX3 A;  4Z4G A;  4N47 A;  1YTU A;  4B9M A;  1VSL A;  4M3U A;  2HVH A;  2X78 A;  4FK4 A;  4CJR A;  1LV5 A;  3M8R A;  4FJK A;  4CHY A;  3O3G A;  3PO4 A;  4YFU A;  3MEC A;  4NCG A;  4KB0 A;  4CF8 A;  4E89 A;  1EKE A;  4LH4 A;  3SPY A;  3OY9 A;  3DRP A;  1A5X A;  2Z1I A;  4B9T A;  3QEW A;  1IKY A;  3PV8 A;  1VSD A;  3ISN C;  2P5O A;  4FLY A;  3V1R A;  4IFY A;  1EXQ A;  1WSG A;  3EZ5 A;  1RT5 A;  2XHB A;  4CIF A;  4E7L A;  3THV A;  2HNZ A;  3NH0 A;  4CCH A;  2PZS A;  2IS3 A;  3QLH A;  4CEC A;  4HVJ A;  3E01 A;  3IG1 A;  3ZSO A;  3M8S A;  3NGI A;  1NK0 A;  4OLB A;  2IAJ A;  2RF2 A;  4ID1 A;  3VQ9 A;  3AV9 A;  3NF9 A;  3CYM A;  3SYZ A;  3K2P A;  3QIN A;  3HXM A;  1RTD A;  1S1T A;  5HRO A;  4PUO A;  3ZSW A;  3F73 A;  3NAE A;  3OYB A;  4OVL A;  2NUB A;  4YNQ A;  4M3X A;  1G15 A;  4OKE A;  4OPK A;  4KI6 A;  4O5B A;  1YT3 A;  3OYF A;  1TKT A;  1DTQ A;  4CJE A;  3LDS A;  3P83 D;  3D45 A;  4CJV A;  1NJW A;  5CY4 A;  1S1X A;  3OS2 A;  3B6O A;  5CZ1 A;  4FLW A;  1T8E A;  5SWM A;  4CEO A;  1TGO A;  1JLE A;  5E41 A;  3VQ4 A;  1QSL A;  4OGE A;  5J2N A;  3LWM A;  3L2U A;  3RMD A;  1WSI A;  4CJP A;  2VWJ A;  4DFP A;  1JLB A;  2D0A A;  3NGY A;  5DK5 A;  3TR8 A;  5C42 A;  1SL0 A;  4CES A;  2G8V A;  1HNV A;  4AHT A;  2XY8 A;  4F3O A;  3O4Q A;  3HP9 A;  4E7H A;  4CEA A;  1WSE A;  2ZD1 A;  2R7Y A;  3ZSV A;  1RBS A;  1QE1 A;  4FK2 A;  1TKZ A;  3AVG A;  4CIE A;  2PYL A;  3QIP A;  4DLE A;  3LP2 A;  4KRE A;  4CF9 A;  2XY6 A;  1HMV A;  4CGG A;  3ZT4 A;  1D9D A;  3LAN A;  3NBP A;  4WE1 A;  4FJ7 A;  4IKF A;  3V9U A;  3ALY A;  4DTO A;  4DU3 A;  1T03 A;  2Z1J A;  2HW3 A;  1HQU A;  1J54 A;  4M3Z A;  3M8P A;  3ZT3 A;  3AVN A;  4BDP A;  5DMR A;  1RT4 A;  1VSE A;  4Y1D A;  1HJR A;  1HPZ A;  3NFA A;  3QO9 A;  3VQ7 A;  1D8Y A;  3K59 A;  3AO2 A;  2KTQ A;  3HT3 A;  4PQU A;  1W0H A;  2F96 A;  2VG7 A;  4RW9 A;  1X9S A;  2HVI A;  3SUP A;  1YTA A;  3VQ6 A;  3KD5 E;  4CF0 A;  3HO1 A;  4E0D A;  4W5Q A;  4DSE A;  3I8D A;  3DI6 A;  1WAJ A;  3L2Q A;  4DTN A;  3G0Z A;  4FJG A;  2RPI A;  4DLG A;  4FZZ A;  4H8K A;  1ZBL A;  5C24 A;  3NDK A;  1C1B A;  4O0I A;  1TV6 A;  4DTP A;  4ELU A;  3F9K A;  3OJU A;  3D0P A;  3V4I A;  2XRI A;  1RCH A;  1NKB A;  3DM2 A;  1GOB A;  1BI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...