4CECA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cecA00
1C1AA 4I9LA 3PX0A 2HHTA 1ASWA 4WE1A 2F96A 1X1PA 1Y97A 3D45A 1RDAA 4AHRA 3LAMA 1RDBA 4CF0A 4BE0A 4DTJA 3MXMA 1IKWA 1BGXT 3E01A 1D8YA 4DSEA 3ZT2A 4JRQA 3ZT1A 1LWEA 1S6QA 1LAWA 1EP4A 4I2QA 2YNFA 4CHPA 4PA1A 3RMCA 1RILA 2KTQA 4GVMA 4B08A 3KK2A 3QEWA 1U45A 1SL2A 2B5JA 3VQ6A 1C6VA 1VRTA 4CGJA 2ZE2A 1WSGA 1LWCA 3KD1E 1VSEA 3CM6A 4CEEA 3G0ZA 2Q3SA 3V9WA 2HNYA 1LWFA 2Z1IA 2D0CA 4NYNA 4I9QA 4QCLA 4DSIA 3NH2A 3ASMA 4NCAA 4LD0A 1UA0A 4DTNA 1U4BA 3LP0A 4FJJA 1EKEA 4N47A 3KIOA 4IFYA 3QEPA 1JL2A 3WNFA 1IKVA 3IG1A 5I42A 3OYLA 4DLGA 4B3OA 3SZ2A 3SV4A 1JLCA 3V9XA 1QSLA 3ALYA 4DQSA 2Y1JA 4DU4A 1RBRA 3KLFA 3U6FA 1KVCA 1VSKA 1N6QA 3TI0A 5CYMA 3L2UA 1TKZA 1TL3A 1RT7A 3AO5A 3AA5X 4W5OA 3KK3A 2PYLA 3K5OA 1RBTA 1QTMA 5FRNA 5FDLA 4HCCA 4KHWA 3KK1A 4JS4A 3L2WA 4FM0A 4DQPA 1CLQA 3WNHA 3OJSA 4NCGA 2RKIA 5SWMA 3OS2A 3TAQA 4CEZA 5HRPA 4OLBA 4FW2A 3DRPA 3HVRA 3V9ZA 1SKWA 4DSKA 2HW3A 1JLEA 3CM5A 4O55A 4CJSA 2G8VA 1VSMA 3LALA 4CJVA 4E0DA 4KHQA 3HYFA 1CXUA 4FCYA 1L3VA 1SUQA 3AVJA 1YTUA 3T1AA 1Q9YA 4FLVA 4DG1A 1BQMA 1I3AA 1S5JA 4CJ5A 3VA3A 2P1JA 1HYZA 3C6TA 1D5AA 2EX3A 3DM2A 2G8IA 5EU7A 3VQQA 3MECA 1NJZA 4DTSA 1U48A 4O5BA 3V4IA 1DLOA 1Z26A 3L2RA 1T7PA 4K8XA 1QQCA 1NKBA 4Z4CA 1S6PA 4RW4A 5JS2A 3OS1A 2XHBA 4ELUA 4FJNA 2OZMA 1SL0A 4DSLA 2HNDA 4FLXA 3OYBA 3THVA 1NJYA 4FZYA 4FLWA 4AILC 2P5OA 4E89A 4Z4EA 2HHVA 4CJPA 3TWHA 1NKCA 4C8LA 1C1BA 4HCBA 3KKRA 2I5JA 3AA4A 5HRRA 2G8UA 3K59A 2BGGA 3PUFA 4DU1A 3SQ0A 1FXXA 3DI6A 3OYFA 3I0SA 4Z4HA 4I7FA 3HSTB 3NAEA 3B6PA 3UIQA 1LW0A 2DY4A 4J2AA 4CFBA 3DLGA 4G1QA 4RW9A 4M42A 2O4IA 2DFFA 3EY1A 4C8KA 1F21A 4ID5A 3TABA 2YKMA 1KCFA 1B9FA 1WN7A 2DFEA 2P51A 3QLHA 1RCHA 1VSFA 3KTQA 3C94A 2QXFA 3VQ5A 1NJXA 1D9DA 3P83D 4HUEA 3AVBA 4KPYA 4CEDA 4F4KA 4PQUA 3L3VA 1VSLA 4JS5A 3JSMA 5I3UA 1NK0A 2QK9A 1T03A 1WSEA 3OY9A 3V1QA 1REVA 1NOYA 4BE1A 4NCBA 4CF8A 3HXMA 3ZSRA 3JYTA 1L3SA 3AVMA 2IOCA 3WNGA 1WNSA 1FKPA 1HYVA 2G8HA 3O4NA 3ZSQA 5HRSA 1WAFA 3V81A 4PWDA 1T8EA 3K5LA 3G10A 5HBMA 1NK8A 4EZ9A 3KLEA 2XY6A 1VRUA 5C42A 3NHGA 4AHVA 3O3GA 4M3UA 3ZSOA 4O44A 3TAGA 3AVCA 1HQUA 1HRHA 2XO7A 4CGHA 4FLTA 3KJVA 2VWJA 5FRMA 3LP2A 4RG8A 3M8PA 3K57A 3HP9A 4L8RB 4BWJA 3QERA 2XY8A 2LSNA 4HHTA 3AVFA 1J5OA 4B9SA 4KAZA 2FBTA 3C95A 3DOKA 3KLIA 4N41A 3SPYA 1J54A 1RTJA 4LSLA 2FBXA 1S1TA 4CJWA 1U49A 5KTQA 1NK6A 2G8KA 2F8TA 3ZSVA 2XY5A 4DWIA 1UAXA 3MXJA 1RT4A 3VQ4A 3HK2A 1CXQA 3AVIA 1BHLA 1BL3A 3S3NA 2Z1HA 5HRNA 2YV0X 3VQ9A 2ETJA 3SI6A 4TSXA 1TGOA 4OVLA 3O3FA 3RMDA 4GMJB 3NGZA 4DTOA 4H8KA 3VQPA 1TKDA 1BI4A 3T19A 4CJFA 2KW4A 4FJIA 4FYDA 2IAJA 2AJQA 1BI4B 1T05A 4M3ZA 3SV3A 2JLEA 1A5VA 3DRRA 5CZ2A 3VA0A 3RWUA 1HYSA 3M8RA 2HHQA 4W5NA 2GBZA 1KLMA 1KTQA 3NF8A 4CF9A 4Z4GA 5CZ1A 4DTMA 1HNVA 3C6UA 3MEDA 2PY5A 4DFKA 3PX6A 4CF2A 2E6MA 1UWBA 1WSFA 5J2QA 2HHSA 4FJGA 3NGIA 3DYAA 1HMVA 3AVGA 3EZ5A 4N76A 3AA3A 3O4QA 5FROA 3BGRA 1KFDA 1QE1A 1RBSA 2KQ2A 3WNEA 4CJQA 3TAPA 1R0AA 5C24A 4DLEA 2D5RA 3S9HA 1LAVA 4JLHA 4DU3A 4CGFA 3ZSZA 1GOBA 1IKXA 3LZIA 1RT1A 4CGGA 5K14A 2B4JA 4EP5A 5KRSA 3RRGA 3VN5A 4KO0A 4FJ7A 1JLAA 2O4GA 4CGIA 1KSPA 2GV9A 3IRXA 2A1SA 2G8FA 3K5NA 4CJTA 3TR8A 2R7YA 3QNOA 4C8NA 4M3XA 3OJUA 1FKOA 4CEBA 4B9TA 1BCOA 2ITGA 3OVNA 4B9NA 2KFZA 3NDKA 3AVHA 3SUPA 3AVLA 3IS9A 2E4LA 1KFSA 1BIZA 3KLGA 2HB5A 2IS3A 3NF6A 3EYZA 3SQ4A 4M3WA 1XHZA 4DQRA 4CECA 4CHYA 1EXQA 3OYHA 5J2NA 4M3YA 1W0HA 4MQ3A 4CJ4A 3HPOA 4CHNA 1B92A 4E3SA 2G8WA 4KRFA 1EETA 1BQNA 3S3OA 3NCIA 3H08A 5KGXA 1K6YA 4W5RA 2W42A 4J2EA 2HVHA 1RBUA 2HHUA 4CK1A 2RN2A 1JLGA 1C0MA 2WONA 1U47A 1JXBA 1X9WA 4IFVA 4OJRA 4J2BA 4BDPA 3T3FA 4CEFA 4CF1A 1ZBFA 5E41A 3LP1A 2X78A 3O3HA 4CJEA 3L2VA 4Y1DA 5C25A 5HROA 3SPZA 3DLKA 3HPHA 3A2FA 4CIGA 3LAKA 4DFJA 2BDPA 4O0IA 4CK2A 4M3TA 4CHOA 3QIOA 1QSYA 4B9MA 2Z1JA 3QESA 2D0BA 4FZZA 4DQQA 4ZTJA 3ISNC 4DMNA 2PZSA 4BWMA 4RW8A 4OGEA 1KLNA 1ZBIA 1ASVA 2IGIA 1HQEA 2HNZA 1EX4A 4O4GA 1QSSA 1WLJA 3RR7A 3AVKA 4KTZA 3AVNA 4I2PA 3NGYA 4N5SA 1NK4A 4E7JA 2FC0A 2VG5A 4M41A 4CFCA 3OYGA 3V9SA 4KV8A 4ZTFA 1SKRA 3HO1A 4KB1A 1RT6A 4LSNA 2X6SA 1Z25A 2B6AA 4OKEA 5HLFA 1NK5A 2VG7A 1IH7A 4CJ3A 4ZHRA 3SQ1A 1TKTA 1NKEA 2YNIA 3FFIA 1I39A 4DSFA 4AHSA 3SUOA 1G15A 2VWKA 3CFPA 4F2SA 1LW2A 4QOZB 2FBYA 3AA2A 2OA8A 4FJMA 3PV8A 1NK7A 3TAMA 4CE9A 4E19A 4FJKA 3HL8A 3DOLA 1TK8A 4CHZA 2KZZA 2HHWA 1HPZA 3VQ8A 1SL1A 4LY7A 4B9VA 4B9UA 4FJ9A 5CYQA 1ZYQA 3PO5A 3S3MA 4F8RA 1CZ9A 4DF4A 3TAFA 1DTQA 1XI1A 4F3OA 1MU2A 3V1RA 1QHTA 3B6OA 4XIUA 4CEAA 1WAJA 4E7KA 1L3TA 1RTDA 4UQGA 5J2PA 3LZJA 3I8DA 1WSJA 3RMAA 1ITGA 3AVAA 3OYKA 1UA1A 1YTAA 3CG7A 4KHSA 3OYNA 1RTIA 1U04A 3VQDA 3CFRA 2DTUA 4C8OA 4ELTA 3ULDA 1C1CA 2YNGA 4CFDA 3TARA 1IO2A 3NH0A 3V6DA 4F3TA 3NBPA 4H4OA 4FJ5A 3V9UA 4LH4A 2BE2A 3LPTA 3ZSXA 1IKYA 3HT3A 2P5GA 3NFAA 1TK0A 1J53A 3BDPA 1TAQA 4KTQA 2YHAA 3VQEA 4E1NA 4CK3A 1O1WA 5KI6A 1ZBHA 4ELVA 4Z4IA 3HM9A 3F73A 2DFHA 1VSIA 4IG0A 4CIEA 3CFOA 4OGCA 4CEOA 3K58A 3HPGA 4CESA 3D0PA 4BDYA 1IG9A 4KFBA 3ZSYA 4CGDA 4CJUA 4BDZA 4GW6A 3SJJA 3QO9A 2OYQA 3U3YA 1NK9A 2NUBA 1X9MA 1JLBA 1SV5A 2D0AA 5DMRA 3OYIA 1N5YA 1BIUA 3ZT3A 4E7HA 3ZT0A 3DLRA 4KHUA 2KFNA 4IKFA 1TAUA 4FVMA 3DLBA 1DTTA 1UOCA 3MAQA 1TK5A 3OS0A 3SQ2A 4CJRA 2ATQA 4JRPA 2OPPA 4J2DA 3F9KA 1KVBA 4FW1A 5KRTA 4HTUA 4DFPA 4PY5A 4B8CA 2JGUA 1TKXA 3QEIA 4KI6A 4DS5A 2Z1GA 4HVJA 3ITHA 4B8AB 4BACA 1S1VA 4AHTA 4FJXA 1SKSA 4IBNA 1RT3A 4W5QA 4E7LA 4AHUA 4KHYA 1TL1A 2KZMA 1S1XA 4H4MA 3CYMA 3RMBA 4YFUA 1S9GA 4RW6A 4FLYA 3SUQA 1NJWA 3AO1A 5SZTA 3TAEA 4FM2A 4KHNA 4LH5A 4KB0A 1RBVA 4CIFA 4EP4A 4DTXA 2YNHA 4FK4A 3OYDA 1S1UA 4ID1A 3RRHA 3PX4A 4FJ8A 3VQCA 2EHGA 4CJLA 4HUGA 3DLEA 1XHXA 3DMJA 3LP3A 4K8ZA 3K5MA 3QNNA 4DSJA 3PO4A 3VQAA 1L5UA 1KVAA 1ZBUA 3K2PA 1J9AA 3P1GA 4OKKA 4O0JA 5CY4A 3QEVA 4EZ6A 5D3GA 4OKJA 4FJHA 4B9LA 1B9DA 1C0TA 2HVIA 2HHXA 1WSHA 1RT2A 3DRSA 3ZSWA 4KI4A 4FZXC 4DQIA 1VSHA 3M8QA 4DS4A 3AO4A 5JS1A 3AO2A 3KKSA 2OPSA 1JLFA 2BANA 1A5XA 1XC9A 4M45A 3QINA 3HP6A 4Q5VA 5T7BA 2IC3A 1ASUA 5J2MA 4KTWA 1JLQA 1HJRA 3LDSA 4KKOA 1HNIA 3HVTA 1VSJA 4OLAA 3RR8A 2X74A 4YNQA 3LWMA 3V1OA 3OYJA 2FBVA 4FK0A 4CCHA 1S9EA 2ZQBA 3OYCA 1JL1A 4E1MA 2XRIA 2YKNA 2Y1IA 4FXDA 3OYEA 3KLHA 3RTVA 1CZBA 3LANA 3P5JA 4IG3A 4IDKA 3ZT4A 4AH9A 1NOZA 4Y1CA 3ZCMA 4FLZA 2HMIA 3AV9A 1JKHA 3TANA 5J1EA 1YVUA 3MEEA 1W9HA 3QEXA 1KRPA 3AO3A 4F2RA 2RPIA 2OPRA 4C8MA 2PYJA 4Q0BA 1RT5A 3LPUA 2IDOA 1GOAA 4Z0UA 1GOCA 1YT3A 1C0UA 3MEGA 3PY8A 1JXEA 2E6LA 3L3UA 4DTUA 3L8BA 2QKKA 4CEQA 2X6NA 4PUOA 2QKBA 2ZD1A 4CERA 4DTRA 1RNHA 1VK0A 4MFBA 4CHQA 3IAYA 4FK2A 1FK9A 3NH1A 1BISA 3DLHA 4OPJA 3CQ8A 1Q8IA 4DF8A 3VQBA 4CFAA 3SNNA 2A1RA 4N56A 4BE2A 4OPKA 4FLUA 1BCMA 1S1WA 3OYMA 3I0RA 3LWLA 4HUFA 4DFMA 1L3UA 2OZSA 1WSIA 1RDDA 4DTPA 1TVRA 3QIPA 4KREA 3L2QA 1Q9XA 3NE6A 3U3GA 3HJFA 2F8SA 5DK5A 3NF7A 3SUNA 2GUIA 1ZBLA 1A5WA 4W5TA 2VG6A 1X9SA 2XY7A 1D9FA 3QETA 4QAGA 1TV6A 2RF2A 1QS4A 1XWLA 4NYFA 2YHBA 4FM1A 5HP1A 1LV5A 4RW7A 3SYZA 4FJLA 1RDCA 4AHCA 1VSDA 3KD5E 3M8SA 5KGWA 4E7IA 4CJKA 3MXIA 3NF9A 3VQ7A 1RTHA 3OYAA 2WOMA 3SCXA 4R5PA 4ICLA 2OPQA 4M3RA 4Z4FA
chains in the Genus database with same CATH superfamily
3C6AA 2QTDA 2HHTA 1Y97A 2D4WA 4CD1A 3E01A 1D8YA 3ZT2A 4JRQA 1S6QA 2YNFA 1Y64A 4PA1A 4GVMA 4H5WA 1U45A 3VQ6A 1BOTO 1C6VA 3H3NO 1WSGA 1LWCA 4DKWA 3VOVA 5M1OA 2BTFA 2D0CA 4QCLA 3HRGA 3ASMA 1UA0A 3TPQA 3LP0A 1T6DA 3QEPA 3OYLA 3V9XA 5JLFA 3JAMO 1T44A 1RBRA 1VSKA 3EL2A 3AO5A 2PYLA 3K5OA 1RBTA 4HCCA 4WQ5A 4JS4A 4FM0A 1Z05A 5AQGA 4DUZK 1CLQA 5SWMA 3OS2A 4U7BA 3H45C 4FW2A 3V9ZA 3VENA 3CM5A 1IJJA 3FE1A 4CJVA 1NMNA 1XQSC 4FWKA 3E1YA 4A5AA 4DG1A 2JWKA 2P1JA 1D5AA 4QS9A 3V4IA 1Z26A 3L2RA 5AZIA 5AZIB 3OS1A 2OZMA 1IG8A 2HNDA 4FLXA 3THVA 4AILC 4RTFD 4CJPA 4HCBA 2F9TA 5BR8K 3AA4A 1K8KA 3PUFA 1HNZK 4I7FA 4DV4K 3NAEA 3B6PA 4B9QA 1LW0A 5BN8A 2DY4A 3WUHA 5AQWA 4RW9A 2QW9A 4C8KA 1F21A 5E84A 2YKMA 1KCFA 2UXCK 1D9DA 2QXFA 4PL8A 3G25A 4F4KA 3HOTA 3L3VA 1VSLA 3THXA 2I7PA 2UUCK 4BRPA 2IIRA 2IOCA 4HWIA 1HYVA 3O4NA 3ZSQA 4EHTA 1WAFA 1N34K 4PWDA 3K5LA 2VGMA 3G10A 1NK8A 3F2KA 2XY6A 1VRUA 5HL7L 4AHVA 3O3GA 3CMAN 3NVMA 3AVCA 5BRFA 2NRRA 3KJVA 2VWJA 3D2FA 4FWRA 1ZXOA 2XY8A 2LSNA 4X66K 5F0XA 5AQKA 3SPYA 1FJGK 3P38A 2G8KA 2F8TA 4J8FA 3ID6A 2XY5A 1NGBA 1UAXA 4MLEA 3HK2A 3OBYA 3AVIA 1BL3A 2FSNA 4BR4A 3EN9A 3VQ9A 1TGOA 1K8AO 3RMDA 3G6EN 1T6CA 4JI7K 4MDBA 2AJQA 3A0IX 3SV3A 2JLEA 1S3XA 4PKHA 1A5VA 4W5NA 3M8RA 2UU9K 2GBZA 3LDQA 2F9WA 5GIOA 1RFQA 1UWBA 5J2QA 5F1XA 4FJGA 3NGIA 4H0TB 3CERA 3DYAA 4N76A 1RBSA 1HX1A 2ZJRL 1BA1A 3ULEB 4H0VB 5C24A 2D5RA 3S9HA 4NB4A 1GOBA 1RT1A 5K14A 2O4GA 3VF2A 4CGIA 1VQPN 4CJTA 3A5LC 1FKOA 3C6HA 1MDUB 3ATVA 3AVHA 3KHYA 1K73O 1P8ZA 3SUPA 1V4TA 1BIZA 3EYZA 4C1NK 1XHZA 4DQRA 3O1BA 5J2NA 1NU0A 4MQ3A 3WEEA 3HPOA 4CHNA 4DR4K 3WEEB 3EE8A 4A2AA 3NCIA 3H08A 2QWMA 1GLCG 2W42A 4WQ5C 5LMNK 1JLGA 1GLJO 3HI0A 2WONA 1U47A 4OJRA 3KVGA 4O8UA 3T3FA 4CF1A 3LP1A 2O8EA 3DLKA 4CIGA 3BF3A 3QIOA 4CHOA 1O13A 1QSYA 2Z1JA 4MDAA 3QESA 4FZZA 4ZTJA 2D1KA 4OGEA 4O8KA 2IGIA 1QSSA 2QWQA 3AVKA 1VAZA 2PAVA 4I2PA 3NGYA 4N5SA 1SAZA 3UIQA 4FJLA 3OYGA 4KB1A 1E4GT 2X6SA 1Z25A 2B6AA 1M1KO 4OKEA 4NXMK 2V51B 1NKEA 2ZF5O 5AQNA 5E26A 4DSFA 3GG4A 1G15A 2VWKA 4ISEA 3CFPA 3ZEUA 2Q31A 3BZKA 1OVQA 2FBYA 2PBDA 3AA2A 3PV8A 3O5BA 3ZEUB 3TAMA 2V52B 3DOLA 5M1PA 2KZZA 2HHWA 3VQ8A 3QFPA 2HBJA 4LY7A 4X65K 5M1NA 5AQQA 5CYQA 3PO5A 1XI1A 4JD2B 4QS7A 2ZM6K 4KHPK 3LZJA 3I8DA 3I8BA 1ITGA 3AVAA 2ITMA 1U04A 3VESA 1C1CA 2YNGA 2A5XA 3TARA 1BU6O 3V6DA 2WTUA 3NBPA 4H4OA 4FJ5A 3LM2A 2BE2A 1IKYA 2W41A 4G9ZA 2HBKA 3I56N 1TAQA 4KTQA 3O9UA 4E1NA 2OCEA 3S41A 3K58A 3H3OB 4CESA 4FWSA 5CHIA 1WB9A 3ZETA 3G71N 3QO9A 2OYQA 5GINA 4JN4A 3ZETB 1TAUA 4E7HA 3ZT0A 4IKFA 1ILYA 3DLBA 1DTTA 4CZEA 2PFUA 2YI1A 3OS0A 4GVEA 4CJRA 1NGDA 2OPPA 3ENBA 3OHRA 1VQ9N 4J2DA 4DFPA 4B8CA 2JGUA 2NRTA 3QEIA 2BH1A 4HTLA 4DS5A 3ITHA 2NRHA 3J80O 3PIOL 4WFBL 1SKSA 4B3TK 1RT3A 3D7EO 3U9DA 4M63C 1TL1A 4RW6A 4FLYA 5DM7L 1NJWA 2NRWA 5SZTA 2YNHA 3DLLL 4ILGB 3RRHA 1XUPO 3PX4A 4YOYA 1Q81O 3VQCA 5AQSA 3QNNA 3PO4A 3K2PA 3DXKA 1W97L 3M6GA 1SS6A 2HHHK 1C0TA 3AGRA 1WSHA 3Q7BA 4GV6A 2D0OA 5JS1A 3KKSA 3WXMB 4B3RK 1XMQK 2UXBK 4ISFA 4ILJA 5T7BA 5J2MA 3SLCA 4KTWA 2QA4N 3KWIA 2OANA 5AQLA 2FBVA 4FK0A 2GWKA 2YKNA 3U9ZA 4LF4K 3OYEA 3RTVA 4IG3A 4FLZA 2QWNA 2KKZA 1NOZA 2GWJA 3TTDA 1JKHA 3TANA 1IBLK 3MEEA 4FJ9A 1W9HA 3U4LA 2RPIA 2PYJA 3LPUA 1GOAA 3BEXA 3E9OA 3L3UA 1C0GA 3SMPA 4CEQA 4RCHA 2FLOA 2QM1A 4PUOA 4DTRA 4MFBA 4CHQA 3CJ9A 4OPHA 4FK2A 4IEIA 4OPJA 5JVGL 5IT9O 4DF8A 3VQBA 2E2OA 4JI6K 4BE2A 4EHUA 1S1WA 4DFMA 3LWLA 4H0YB 1RDDA 3QIPA 4KREA 5C10A 3L2QA 1Q9XA 1MWKA 5GIPA 1ZBLA 2GUIA 1A5WA 1X9SA 4M7XA 5BPNA 1QS4A 3BZCA 1M90O 4QS8A 5HP1A 4CZMA 5FPDA 1VSDA 4E7IA 4JHDA 3VEXA 4GV9A 3VQ7A 4JHDB 2Q1NA 2OPQA 4M3RA 4I6MA 2E1YA 1C1AA 4DV6K 3PX0A 2F96A 3MXMA 3LAMA 1RDBA 5TKWA 4YOVA 3F5TA 3P4IA 1IKWA 3UKUA 4FPAA 1LWEA 3UKUB 2VWBA 1LAWA 1EP4A 4I2QA 4BR7A 3RMCA 1RILA 4B08A 3QEWA 1SL2A 2B5JA 3O8MA 3ZX3A 3KD1E 3CM6A 2Q3SA 2HNYA 3K0SA 4IOCL 3IDHA 3NH2A 4K43A 4Y0WA 4DTNA 4FJJA 2HSTA 3FGUA 3KIOA 2E8AA 5JICA 3LDLA 1K9MO 3IG1A 5I42A 4B3OA 1CZAN 3SZ2A 3SV4A 1JLCA 1QSLA 1VQ4N 5BRHA 3WXIA 2QI2A 4DU4A 4IFEA 3KLFA 3U6FA 2P9LA 5CYMA 3U8XA 1TKZA 3L2UA 4MO5A 3CCJN 3AA5X 2P9LB 4R79A 4BRGA 1QTMA 5FRNA 3QB0A 3WNHA 3WQTA 2YJFA 4CEZA 3CPWM 3HVRA 3DRPA 2HW3A 3VERA 4KHQA 4YOTA 1L3VA 1YTUA 1QHAA 3T1AA 1YIJN 4LC9B 3THWA 1S5JA 4CJ5A 3THWB 3VA3A 1HYZA 2EX3A 2G8IA 2E5LK 3VQQA 1NJZA 1U48A 1DLOA 1T7PA 3ID8A 2P9KA 1S6PA 4ELUA 1H1VA 2P9KB 1SL0A 4Z4EA 3OYBA 4FLWA 2VGNA 1C1BA 1RGIA 4YDUA 5HRRA 2BGGA 3DI6A 1ATNA 4NLBA 3OYFA 2P9UA 1W7AA 2QWLA 2P9UB 4Z4HA 4BRLA 4BRKA 4CFBA 5LJVA 4CD3A 2DFFA 3J7ZO 4ID5A 4F9OA 3MDQA 2ZJQL 1WN7A 2DFEA 3QLHA 1VSFA 1IV0A 3C94A 4IO9L 2V7YA 3O80A 4JS5A 5I3UA 2AA4A 1NK0A 3CCVN 1T3VA 2NRZA 1REVA 1NLVA 1L3SA 3AVMA 3L4QA 2G8HA 3V81A 1T8EA 1EQYA 1NGCA 3DAWA 5HBMA 3KLEA 1GLAG 3QBWA 4UY8O 1NNEA 4EFHA 3TAGA 1WBBA 4WFAL 3VEVA 5JLHA 2XO7A 5EOYA 4CGHA 4FLTA 3OW2M 1HKCA 4RG8A 3M8PA 3HP9A 4KAZA 4B1XB 3KLIA 1J54A 4JI1K 3O9RA 1DKGD 4BRNA 3QDKA 1CXQA 4JNEA 2Z1HA 4AF1A 4JEPA 3SI6A 4OVLA 3O3FA 4GMJB 4DTOA 1HKBA 4CJFA 2FF3B 3RWUA 1HYSA 1HNXK 1KTQA 5C2FA 1N32K 1HNVA 3C6UA 2PY5A 4DFKA 3PX6A 2E6MA 1WSFA 2GELA 1YXQA 1HMVA 3DJCA 3EZ5A 1VQLN 1Z6RA 3O4QA 3BGRA 2GEMA 2KQ2A 1R0AA 3M1FA 3BF1A 4JLHA 5MLCQ 3MWPA 1IKXA 3LZIA 4CGGA 1U6ZA 3RRGA 4KO0A 3A5MC 1KSPA 2GV9A 3IRXA 3TR8A 3CQYA 4CEBA 3O4WA 5ADXH 2ITGA 3WQUA 2E4LA 3TSPA 3T1YK 3KLGA 2HB5A 2IS3A 3VEZA 1W0HA 4YY3K 1RBUA 4AM6A 4J2BA 4BDPA 3IUCA 1Q86O 3JXUA 4CEFA 1ZBFA 3D6RA 1QVFM 2X78A 4WCEL 3O3HA 1NBWA 4KBOA 3L2VA 5C25A 3SPZA 3HPHA 4DFJA 2BDPA 3QBXA 2D0BA 4DV3K 2RE2A 3CCMN 3ISNC 4RW8A 1ZBIA 3AAQA 5F2RA 3WXJA 3HSCA 3O6WA 5FPEA 4KTZA 2NNWA 1OKJA 2ZGZA 1NK4A 1SKRA 4ZTFA 3FZKA 4DV5K 4FWPA 5GAGP 3AY9A 2VG7A 1IH7A 4CJ3A 4BRDA 4YDUC 2BUPA 3IFRA 3IMXA 1LW2A 4QOZB 4AQYK 4FJMA 3FFKB 3EKUA 4CE9A 4E19A 1XNQK 4B9VA 2UUAK 4B9UA 4B1ZA 4A61A 3S3MA 4F3OA 4DF4A 1DTQA 4BRIA 3V1RA 1QHTA 4CEAA 1L3TA 4UQGA 5J2PA 3R8EA 1UA1A 4KHSA 3OYKA 5FPMA 2WC9A 1RTIA 2DTUA 3ULDA 3NH0A 4IEEA 1NGFA 3V9UA 4B1VA 2P5GA 1U2VB 1NGEA 1J53A 3BDPA 4CBXA 5AQYA 1GLFO 5CE3A 5KQDA 1O1WA 5KI6A 1ZBHA 3KZBA 1X3MA 3HPGA 3K9JA 2NZTA 4BC5A 1HUXA 1IG9A 1VQ6N 4CGDA 3H1QA 1EWRA 4H5TA 1JLBA 4H0OA 3DLRA 2E1ZA 3ULEA 1TK5A 1TUYA 3SQ2A 3K9KA 1BG3A 4HTUA 4PY5A 5AQMA 3C7NB 5JMVA 4FJXA 5B8HA 4B1UB 4AHUA 1Q82O 1XMOK 4FO0A 3AO1A 4KH4A 4EP4A 4BY9C 2ZWHA 5H1SQ 1XC3A 3DLEA 4BQLA 3K5MA 4DSJA 4O0JA 5CY4A 3QEVA 5D3GA 4OKJA 2O8FA 4FJHA 5EX5A 1B9DA 2O8FB 4JK8A 3ENOA 1P90A 5M1FA 1VSHA 3M8QA 3EKSA 5HOOA 2IVOA 3AO4A 2OPSA 1A5XA 1XC9A 3VPZA 3QINA 4RWTA 3HP6A 4DR7K 3LDSA 4CZIA 1VSJA 4CCHA 5AQUA 1S9EA 2ZQBA 2O8DA 2O8DB 3P5JA 1BDGA 3LANA 3ZT4A 4KHWA 3ZCMA 3AGKA 2HMIA 4IDHA 5J1EA 4GNIA 4Q0BA 1RT5A 1GOCA 1YT3A 3MEGA 3CPEA 5AZJB 2QKKA 2X6NA 1RNHA 4NO7A 3NH1A 1I94K 1Q8IA 4B1YB 3OYMA 3I0RA 4DQ8A 4H5VA 3EZWA 3W3DA 4DTPA 2A3ZA 4JD2A 2A41A 2IVPA 1YJWN 4YOXA 3NE6A 4BR0A 4MLHA 1G99A 4CVNE 2CGJA 3QETA 1D9FA 4QAGA 1TV6A 1XWLA 4FM1A 1R59O 1RDCA 3M8SA 3D2EA 3D2EB 3N4QA 2WOMA 4R5PA 4ICLA 4Z4FA 5LMUK 4OO1J 4I9LA 1ASWA 4WE1A 4AHRA 1RDAA 4DTJA 3VMFB 4DSEA 3ZT1A 4BRHA 4PHTX 1WBDA 5BN9A 3C65A 4CGJA 4BRCA 1VSEA 4CEEA 2Z1IA 4I9QA 3I33A 4DSIA 4DV1K 4NCAA 5AQPA 1NM1A 1IBMK 2H3GX 3CJCA 4N47A 1BUPA 4IFYA 4DV2K 1IKVA 4DLGA 3FZHA 4DQSA 2Y1JA 4BRAA 1KVCA 3TI0A 1TL3A 3MX5A 3MCAB 1QZ6A 2P9SB 3P31A 5FDLA 1VQ8N 3KK1A 3O9QA 5M1KA 3L2WA 2A42A 3SAHA 2KLAA 5HRPA 4OLBA 3EO3A 4DSKA 2P9NB 4C23A 2P9IB 4O55A 2G8VA 1E3MA 1VSMA 3LALA 2O8CA 4FWNA 3HYFA 1CXUA 3J8AA 4PL7A 2VQEK 4FCYA 1SUQA 3AVJA 2O8CB 4FLVA 1BQMA 3FLCO 2HOEA 4CZKA 2YX6A 4IOXA 4O5BA 4IJNA 2NRVA 3RSEB 1QQCA 3E66A 1NKBA 4K8XA 5JS2A 4DSLA 1NJYA 5AQVA 1NKCA 2I5JA 2E2NA 3K59A 1FXXA 3I0SA 4H5RA 4M42A 4LFAK 2O4IA 3EY1A 5LL6Z 1B9FA 2P51A 3FZLA 3KTQA 4B1WB 3VQ5A 4BC3A 1NJXA 4JKAA 4KPYA 4PQUA 4CEDA 1VQKN 3CI5A 3WXKA 1GLEG 1WSEA 1T03A 3V1QA 5C12A 1NOYA 3LM9A 4BE1A 5AQFA 1FKPA 3O08A 3WXLA 4B3MK 4EZ9A 1KD1O 3CCUN 5LY3A 4M3UA 3I55N 1QQMA 1HRHA 1HQUA 3TU5A 3LP2A 3VF6A 4L8RB 1KAXA 5AQZA 2ZJPL 3CQXA 3F9MA 4BWJA 3QERA 4B9SA 2I7NA 2FBTA 3C95A 5AFUA 4DR5K 1NK6A 3R6MA 5KTQA 1U49A 4DB3A 3CCSN 4DWIA 2CGKA 1MA9B 1BHLA 3S3NA 5HRNA 2YV0X 3VETA 4TSXA 3O9TA 3CC7N 3GE1A 4PKGA 4H8KA 1ZBSA 3VQPA 3T19A 3CCRN 1TKDA 4FJIA 3CCLN 5GAEP 1T05A 4M3ZA 5CZ2A 3VA0A 2HHQA 4KH5A 1HJOA 1KLMA 4Z4GA 4DTMA 3MEDA 3BP8A 4DR3K 4YOWA 1YF5L 3OA9A 3AVGA 4CJQA 1QE1A 3TAPA 5TKYA 3WNEA 3JS6A 5AQIA 2ASMA 2WUSA 5KRSA 2B4JA 4A59A 2YHWA 2R7YA 4EAHD 3QNOA 4C8NA 4M3XA 2KFZA 3OVNA 4JI5K 3NDKA 2HF4A 3ZX2A 3AVLA 3IS9A 1KFSA 3SQ4A 4CECA 4JKHA 1YJ9N 4GKJK 3R3LA 1B92A 4KRFA 1N33K 4W5RA 4J2EA 1K6YA 2HHUA 2RN2A 1C0MA 1GLBG 1NMDA 1JXBA 4IFVA 2F7TA 3PSFA 1VQON 4CZGA 2P9PA 3CCQN 4BG9A 4CJEA 2P9PB 4Y1DA 5HROA 1OH8A 3A2FA 3LAKA 4O0IA 4K41A 3E9LA 4B3SK 4B9MA 3KK7A 4DMNA 2PZSA 1HR0K 1ASVA 2Q0RA 2HNZA 3HZ6A 4O4GA 3RR7A 2CH5A 3M5RA 4E7JA 2FC0A 3V9SA 3HO1A 3L0QA 1RT6A 4LSNA 2HBLA 2E20A 3HOSA 4ZHRA 3N4PA 1HPMA 3SQ1A 4V19S 1SZ2A 4K42A 4XH4A 3FFIA 4AHSA 3THYB 4F2SA 3VGKA 4BRQA 2OA8A 1NK7A 2KHOA 3HL8A 2QWRA 3ZYYX 1RDUA 1TK8A 1HPZA 3R9PA 3LL3A 4F8RA 3TSUA 1YJNN 3ENHA 3CMEN 3B6OA 4XIUA 1WAJA 2GUPA 4E1JA 1RTDA 4BC2A 3RMAA 1YTAA 3CG7A 4OPAA 3VTHA 3OYNA 4C8OA 4ELTA 2OTLN 3MX2A 4M7YA 1IO2A 4F3TA 4OX9K 4FOIA 3ZSXA 3HT3A 3NFAA 2HBMA 5KPZA 4NXNK 1Q18A 2CH6A 2YHAA 1YVNA 1C0FA 4ELVA 1DGKN 2DFHA 1VSIA 4IG0A 4CIEA 3CFOA 4OGCA 1YI2N 2J4RA 4BDYA 1YITN 5FPNA 2WBNA 5GADP 3SJJA 1KC8O 3U3YA 1NK9A 1FW6A 2NUBA 4WF9L 3ZT3A 1TYQA 4JK7A 4FVMA 1HKGA 1UOCA 1TYQB 4DUYK 1WOQA 3IKMA 4C1NI 3F9KA 3CCEN 4FW1A 5KRTA 3GL1A 4KI6A 1TKXA 3A8YA 2Z1GA 2YHYA 4B8AB 4BACA 1S1VA 4AHTA 3J7YP 5EXWA 1NGIA 5CR4A 3BUZB 4E7LA 4CW7B 1S1XA 4H4MA 3CYMA 3SUQA 4KHNA 1TUUA 5AQRA 4LH5A 4KB0A 4FK4A 1NGHA 3OYDA 4JK9A 4BREA 1VHXA 4FJ8A 3FZFA 2EHGA 4HUGA 1XHXA 3DMJA 3LP3A 3VQAA 1L5UA 1ZC6A 1J9AA 3P1GA 4OKKA 4IWVA 4EZ6A 4IZ9A 5BRDA 4B9LA 1JCGA 2HVIA 2HHXA 1RT2A 3DRSA 3GDQA 3LDOA 2WFBA 4L3QA 3O1WA 4Q5VA 2IC3A 1ASUA 1NGGA 1HJRA 2FXUA 4OLAA 1GLLO 4YNQA 3V1OA 3OYJA 3CJ1A 4FXDA 2XRIA 4FWMA 3KLHA 1CZBA 4AH9A 3AV9A 5AJ3K 1KRPA 5BPMA 3PLAA 2OPRA 4C8MA 4H03B 3A5OC 1K8KB 1OH6A 1JXEA 2E6LA 3L8BA 2ZD1A 4K25A 4CERA 1VK0A 4IOAL 4JI0K 3IAYA 1BISA 3SNNA 4N56A 4OPKA 1VQMN 3ATUA 3R1XA 1NG9A 4FOEA 1ATSA 1WSIA 1OH7A 2OZSA 5LJWA 3E9PA 3U3GA 3HJFA 5DK5A 2E2QA 3NF7A 3THXB 1SQKA 4W5TA 2VG6A 4WQ4A 3O9SA 3FR0A 2YHBA 2VQFK 4FVUA 1U2VA 3MN9A 3TTCA 3KD5E 1DT9A 4LF9K 2YCHA 1X9JA 4CJKA 3NF9A 3AARA 1RTHA 3J7AP 3D2FB 4BGAA 3D45A 1X1PA 4CF0A 4BE0A 5DM6L 5BREA 1BGXT 4DCHA 4YHHK 4H5NA 5EY4A 4CHPA 2KTQA 1V4SA 3H46O 3KWGA 5AQTA 1ATRA 3KK2A 4BVPA 5FLXO 4JV5K 5ADXA 1VRTA 2ZE2A 3NVKA 2V7ZA 3G0ZA 3V9WA 1LWFA 4JKCA 4NYNA 1YHQN 2OTJN 3C7NA 3VGMA 4LD0A 1BWFO 1U4BA 1EKEA 5AQOA 4LFCK 4K0KK 1JL2A 3WNFA 3VEOA 3ALYA 5KQ8A 1N36K 1Q7YO 4DR1K 1N6QA 3CC4N 1RT7A 3CC2N 3PSIA 4W5OA 3KK3A 5EVZA 4DQPA 4JKFA 3OJSA 4NCGA 2RKIA 2YHXA 3TAQA 4JI2K 1SKWA 1JLEA 4GY2B 4CJSA 4E0DA 3CXCM 2HF3A 1Q9YA 1RDWX 2Q36A 3BY5A 1I3AA 4JI8K 3C6TA 4DV0K 3DM2A 5EU7A 3MECA 1XNRK 4LF6K 4DTSA 2NLXA 5BPLA 1YUWA 3W0LA 3J81O 1DEJA 4Z4CA 3H1VX 4RW4A 2XHBA 4FJNA 1NGJA 4FZYA 2P5OA 4E89A 2HHVA 3TWHA 4C8LA 2O8EB 3KKRA 1QQOA 1VQ5N 2G8UA 4A5BA 4A62A 4DU1A 3SQ0A 5AZJA 2F4VK 5C2DA 2ASOA 3HSTB 2UYTA 3FZMA 4J2AA 4FWQA 3DLGA 4G1QA 1GLDG 4A57A 3TABA 4LF5K 4NLCA 4CI6A 1RCHA 2FF6A 3P83D 4HUEA 1QZ5A 3AVBA 4JAXA 5AQJA 3Q7CA 3QICA 3VTIA 2AP1A 3JSMA 2QK9A 5I9EB 3OY9A 1WUAA 4CZFA 4NCBA 4JI4K 4CF8A 3HXMA 3ZSRA 1LCUA 3JYTA 4EIAA 3WNGA 1WNSA 2E2PA 4BG8A 5HRSA 2QEXN 2O8BA 3MK6A 5C42A 3SAGA 3NHGA 2VCPA 2O8BB 1JJ2M 3ZSOA 4O44A 4JI3K 4FPBA 4BR5A 3CJBA 1YAGA 1HNWK 5FRMA 3K57A 3VEYA 2A6AA 3RVCA 4HHTA 3AVFA 3DOKA 3CF5L 4N41A 4LSLA 1RTJA 2FBXA 1S1TA 4CJWA 1QVGM 5JVHL 4WFNL 3ZSVA 3T7ZA 3MXJA 1RT4A 3VQ4A 4WQ4C 4XEIA 2FSJA 5AQHA 4LF8K 2ASPA 1X3NA 2ETJA 4BVOA 3VGLA 3NGZA 1BI4A 3L4IA 2KW4A 4FYDA 2IAJA 5BR9A 1BI4B 3UKRA 5M1QA 3DRRA 3ZLJA 3UKRB 4KH6A 1JCFA 3NF8A 3ZX0A 4CF9A 4CZJA 5CZ1A 4LFBK 4O5FA 4DV7K 2UUBK 4CF2A 1S22A 2HHSA 2DPNA 4DR2K 4MO4A 3AA3A 2GTDA 5FROA 1KFDA 2HMPA 2P9SA 3UB5A 4DLEA 1LAVA 4ILHA 2NRXA 4DU3A 4CGFA 4ISGA 3ZSZA 1VQNN 5ELZA 5AFUH 4EP5A 3G4SN 4XH5A 1E4FT 3VN5A 4FJ7A 1JLAA 4FSVA 2A1SA 2G8FA 2P9NA 2EWSA 3K5NA 4IXCA 2P9IA 3OJUA 4B9TA 1BCOA 4B9NA 3T69A 5GAHP 3M3ZA 2QWOA 5AR0A 1VQ7N 3NF6A 4M3WA 4CHYA 1EXQA 3OYHA 4M3YA 4CJ4A 4E3SA 2G8WA 4DR6K 1EETA 1BQNA 3S3OA 3RSEA 5KGXA 2HVHA 3P39A 2W6LA 4X62K 4CK1A 1X9WA 3DXKB 3OTOK 3WT0A 5E41A 2QWPA 4CK2A 4M3TA 4X64K 3MCPA 2RHKA 3AAPA 4DQQA 3NMUA 4IO8A 4BWMA 1KLNA 1HQEA 3EEQA 1EX4A 1WLJA 3T1HK 4CBWA 3AVNA 4CJ7A 4FL9A 1ESVA 1J5OA 2VG5A 4M41A 4CFCA 4KV8A 1J5EK 5IWAK 5HLFA 1NK5A 1TKTA 4BROA 5C15A 4BRFA 4Z94A 2YNIA 4BRMA 1I39A 3SUOA 4U67L 3LDNA 5A2QO 1EO1A 2Q2RA 4FJKA 4JYAK 3DXMA 4CHZA 5KPTA 1SL1A 3MMVA 3SAFA 3DXMB 4BC4A 1ZYQA 1CZ9A 3TAFA 1MU2A 4JKEA 3SBTA 3TSQA 3HBTA 2GX9A 4E7KA 1S72N 1WSJA 4BR9A 1MWMA 2UXDK 3CJ7A 3VQDA 3CFRA 4GV3A 1KAZA 4CFDA 3HTVA 4CZHA 3GBTA 1LOTB 3H6EA 3L6QA 4LH4A 3DWLA 3LPTA 1N8RO 3VEWA 3EE9A 3VF4A 1TK0A 1KAYA 3VQEA 1IBKK 4CBUA 4I6MB 4CK3A 1D4XA 4PKIA 4BGBA 4Z4IA 3HM9A 3F73A 1NJIO 3B8AX 4CEOA 3D0PA 2VYPA 4KFBA 3ZSYA 4CJUA 4BDZA 4GW6A 1X9MA 1SV5A 2D0AA 5DMRA 4A2BA 3SBGA 1BIUA 3OYIA 1N5YA 2Q97A 4KHUA 2KFNA 5KPRA 4BQZA 1JCEA 3MAQA 1OH5A 2ATQA 4AM7A 4JRPA 3CETA 4XH1A 1KVBA 4HVJA 1EWQA 3MN6A 4H0XB 3SJHA 3A5NC 4IBNA 4W5QA 3CJAA 4KHYA 2KZMA 1W2BM 2QXLA 5C0YA 3RMBA 4YFUA 1S9GA 3TAEA 4FM2A 4FWOA 1RBVA 4CIFA 1NGAA 4DTXA 4GKKK 1S1UA 4ID1A 4JKGA 4H0PA 2FSKA 4BR2A 3MN7A 4JKGB 4CJLA 3MN5A 4K8ZA 3GOIA 2A40A 2W6KA 4JKDA 1KVAA 1ZBUA 5AQXA 1HLUA 1BA0A 3ZSWA 4KI4A 4FZXC 2Q0UA 4DQIA 1KQSM 4DS4A 2E88A 3AO2A 1JLFA 2BANA 4M45A 1OVYA 1QQNA 3CHWA 1NWKA 1JLQA 4KKOA 1HNIA 3HVTA 4CZLA 2X74A 4DHYA 3PIPL 3LWMA 3RR8A 3OYCA 1JL1A 4E1MA 2Y1IA 4FWLA 4IDKA 4JKBA 4Y1CA 3QEXA 1YVUA 2IVNA 3AO3A 3OBWA 4F2RA 3QMLA 4Z0UA 2IDOA 3UE5A 3PY8A 1C0UA 3HM8A 3THYA 4IJAA 4DTUA 3SMSA 2QKBA 3CD6N 1FK9A 3CIPA 3DLHA 3MWTA 3CQ8A 4CFAA 2A1RA 3LDPA 4FLUA 1BCMA 4HUFA 1L3UA 3C0BA 1TVRA 2W40A 1KXPA 3QFUA 4YOUA 2F8SA 3SUNA 1J6ZA 2CGLA 2XY7A 2D0PA 2RF2A 3TTFA 4LF7K 2JWLA 2YJEA 4NYFA 3SK3A 1LV5A 4RW7A 3SYZA 4AHCA 5KGWA 3MXIA 2ZGYA 4YORA 4WYBA 3OYAA 3SCXA 1BO5O
chains in the Genus database with same CATH topology
1C1AA 4I9LA 3PX0A 2HHTA 1ASWA 4WE1A 2F96A 1X1PA 1Y97A 3D45A 1RDAA 4AHRA 3LAMA 1RDBA 4CF0A 4BE0A 4DTJA 3MXMA 1IKWA 1BGXT 3E01A 1D8YA 4DSEA 3ZT2A 4JRQA 3ZT1A 1LWEA 1S6QA 1LAWA 1EP4A 4I2QA 2YNFA 4CHPA 4PA1A 3RMCA 1RILA 2KTQA 4GVMA 4B08A 3KK2A 3QEWA 1U45A 1SL2A 2B5JA 3VQ6A 1C6VA 1VRTA 4CGJA 2ZE2A 1WSGA 1LWCA 3KD1E 1VSEA 3CM6A 4CEEA 3G0ZA 2Q3SA 3V9WA 2HNYA 1LWFA 2Z1IA 2D0CA 4NYNA 4I9QA 4QCLA 4DSIA 3NH2A 3ASMA 4NCAA 4LD0A 1UA0A 4DTNA 1U4BA 3LP0A 4FJJA 1EKEA 4N47A 3KIOA 4IFYA 3QEPA 1JL2A 3WNFA 1IKVA 3IG1A 5I42A 3OYLA 4DLGA 4B3OA 3SZ2A 3SV4A 1JLCA 3V9XA 1QSLA 3ALYA 4DQSA 2Y1JA 4DU4A 1RBRA 3KLFA 3U6FA 1KVCA 1VSKA 1N6QA 3TI0A 5CYMA 3L2UA 1TKZA 1TL3A 1RT7A 3AO5A 3AA5X 4W5OA 3KK3A 2PYLA 3K5OA 1RBTA 1QTMA 5FRNA 5FDLA 4HCCA 4KHWA 3KK1A 4JS4A 3L2WA 4FM0A 4DQPA 1CLQA 3WNHA 3OJSA 4NCGA 2RKIA 5SWMA 3OS2A 3TAQA 4CEZA 5HRPA 4OLBA 4FW2A 3DRPA 3HVRA 3V9ZA 1SKWA 4DSKA 2HW3A 1JLEA 3CM5A 4O55A 4CJSA 2G8VA 1VSMA 3LALA 4CJVA 4E0DA 4KHQA 3HYFA 1CXUA 4FCYA 1L3VA 1SUQA 3AVJA 1YTUA 3T1AA 1Q9YA 4FLVA 4DG1A 1BQMA 1I3AA 1S5JA 4CJ5A 3VA3A 2P1JA 1HYZA 3C6TA 1D5AA 2EX3A 3DM2A 2G8IA 5EU7A 3VQQA 3MECA 1NJZA 4DTSA 1U48A 4O5BA 3V4IA 1DLOA 1Z26A 3L2RA 1T7PA 4K8XA 1QQCA 1NKBA 4Z4CA 1S6PA 4RW4A 5JS2A 3OS1A 2XHBA 4ELUA 4FJNA 2OZMA 1SL0A 4DSLA 2HNDA 4FLXA 3OYBA 3THVA 1NJYA 4FZYA 4FLWA 4AILC 2P5OA 4E89A 4Z4EA 2HHVA 4CJPA 3TWHA 1NKCA 4C8LA 1C1BA 4HCBA 3KKRA 2I5JA 3AA4A 5HRRA 2G8UA 3K59A 2BGGA 3PUFA 4DU1A 3SQ0A 1FXXA 3DI6A 3OYFA 3I0SA 4Z4HA 4I7FA 3HSTB 3NAEA 3B6PA 3UIQA 1LW0A 2DY4A 4J2AA 4CFBA 3DLGA 4G1QA 4RW9A 4M42A 2O4IA 2DFFA 3EY1A 4C8KA 1F21A 4ID5A 3TABA 2YKMA 1KCFA 1B9FA 1WN7A 2DFEA 2P51A 3QLHA 1RCHA 1VSFA 3KTQA 3C94A 2QXFA 3VQ5A 1NJXA 1D9DA 3P83D 4HUEA 3AVBA 4KPYA 4CEDA 4F4KA 4PQUA 3L3VA 1VSLA 4JS5A 3JSMA 5I3UA 1NK0A 2QK9A 1T03A 1WSEA 3OY9A 3V1QA 1REVA 1NOYA 4BE1A 4NCBA 4CF8A 3HXMA 3ZSRA 3JYTA 1L3SA 3AVMA 2IOCA 3WNGA 1WNSA 1FKPA 1HYVA 2G8HA 3O4NA 3ZSQA 5HRSA 1WAFA 3V81A 4PWDA 1T8EA 3K5LA 3G10A 5HBMA 1NK8A 4EZ9A 3KLEA 2XY6A 1VRUA 5C42A 3NHGA 4AHVA 3O3GA 4M3UA 3ZSOA 4O44A 3TAGA 3AVCA 1HQUA 1HRHA 2XO7A 4CGHA 4FLTA 3KJVA 2VWJA 5FRMA 3LP2A 4RG8A 3M8PA 3K57A 3HP9A 4L8RB 4BWJA 3QERA 2XY8A 2LSNA 4HHTA 3AVFA 1J5OA 4B9SA 4KAZA 2FBTA 3C95A 3DOKA 3KLIA 4N41A 3SPYA 1J54A 1RTJA 4LSLA 2FBXA 1S1TA 4CJWA 1U49A 5KTQA 1NK6A 2G8KA 2F8TA 3ZSVA 2XY5A 4DWIA 1UAXA 3MXJA 1RT4A 3VQ4A 3HK2A 1CXQA 3AVIA 1BHLA 1BL3A 3S3NA 2Z1HA 5HRNA 2YV0X 3VQ9A 2ETJA 3SI6A 4TSXA 1TGOA 4OVLA 3O3FA 3RMDA 4GMJB 3NGZA 4DTOA 4H8KA 3VQPA 1TKDA 1BI4A 3T19A 4CJFA 2KW4A 4FJIA 4FYDA 2IAJA 2AJQA 1BI4B 1T05A 4M3ZA 3SV3A 2JLEA 1A5VA 3DRRA 5CZ2A 3VA0A 3RWUA 1HYSA 3M8RA 2HHQA 4W5NA 2GBZA 1KLMA 1KTQA 3NF8A 4CF9A 4Z4GA 5CZ1A 4DTMA 1HNVA 3C6UA 3MEDA 2PY5A 4DFKA 3PX6A 4CF2A 2E6MA 1UWBA 1WSFA 5J2QA 2HHSA 4FJGA 3NGIA 3DYAA 1HMVA 3AVGA 3EZ5A 4N76A 3AA3A 3O4QA 5FROA 3BGRA 1KFDA 1QE1A 1RBSA 2KQ2A 3WNEA 4CJQA 3TAPA 1R0AA 5C24A 4DLEA 2D5RA 3S9HA 1LAVA 4JLHA 4DU3A 4CGFA 3ZSZA 1GOBA 1IKXA 3LZIA 1RT1A 4CGGA 5K14A 2B4JA 4EP5A 5KRSA 3RRGA 3VN5A 4KO0A 4FJ7A 1JLAA 2O4GA 4CGIA 1KSPA 2GV9A 3IRXA 2A1SA 2G8FA 3K5NA 4CJTA 3TR8A 2R7YA 3QNOA 4C8NA 4M3XA 3OJUA 1FKOA 4CEBA 4B9TA 1BCOA 2ITGA 3OVNA 4B9NA 2KFZA 3NDKA 3AVHA 3SUPA 3AVLA 3IS9A 2E4LA 1KFSA 1BIZA 3KLGA 2HB5A 2IS3A 3NF6A 3EYZA 3SQ4A 4M3WA 1XHZA 4DQRA 4CECA 4CHYA 1EXQA 3OYHA 5J2NA 4M3YA 1W0HA 4MQ3A 4CJ4A 3HPOA 4CHNA 1B92A 4E3SA 2G8WA 4KRFA 1EETA 1BQNA 3S3OA 3NCIA 3H08A 5KGXA 1K6YA 4W5RA 2W42A 4J2EA 2HVHA 1RBUA 2HHUA 4CK1A 2RN2A 1JLGA 1C0MA 2WONA 1U47A 1JXBA 1X9WA 4IFVA 4OJRA 4J2BA 4BDPA 3T3FA 4CEFA 4CF1A 1ZBFA 5E41A 3LP1A 2X78A 3O3HA 4CJEA 3L2VA 4Y1DA 5C25A 5HROA 3SPZA 3DLKA 3HPHA 3A2FA 4CIGA 3LAKA 4DFJA 2BDPA 4O0IA 4CK2A 4M3TA 4CHOA 3QIOA 1QSYA 4B9MA 2Z1JA 3QESA 2D0BA 4FZZA 4DQQA 4ZTJA 3ISNC 4DMNA 2PZSA 4BWMA 4RW8A 4OGEA 1KLNA 1ZBIA 1ASVA 2IGIA 1HQEA 2HNZA 1EX4A 4O4GA 1QSSA 1WLJA 3RR7A 3AVKA 4KTZA 3AVNA 4I2PA 3NGYA 4N5SA 1NK4A 4E7JA 2FC0A 2VG5A 4M41A 4CFCA 3OYGA 3V9SA 4KV8A 4ZTFA 1SKRA 3HO1A 4KB1A 1RT6A 4LSNA 2X6SA 1Z25A 2B6AA 4OKEA 5HLFA 1NK5A 2VG7A 1IH7A 4CJ3A 4ZHRA 3SQ1A 1TKTA 1NKEA 2YNIA 3FFIA 1I39A 4DSFA 4AHSA 3SUOA 1G15A 2VWKA 3CFPA 4F2SA 1LW2A 4QOZB 2FBYA 3AA2A 2OA8A 4FJMA 3PV8A 1NK7A 3TAMA 4CE9A 4E19A 4FJKA 3HL8A 3DOLA 1TK8A 4CHZA 2KZZA 2HHWA 1HPZA 3VQ8A 1SL1A 4LY7A 4B9VA 4B9UA 4FJ9A 5CYQA 1ZYQA 3PO5A 3S3MA 4F8RA 1CZ9A 4DF4A 3TAFA 1DTQA 1XI1A 4F3OA 1MU2A 3V1RA 1QHTA 3B6OA 4XIUA 4CEAA 1WAJA 4E7KA 1L3TA 1RTDA 4UQGA 5J2PA 3LZJA 3I8DA 1WSJA 3RMAA 1ITGA 3AVAA 3OYKA 1UA1A 1YTAA 3CG7A 4KHSA 3OYNA 1RTIA 1U04A 3VQDA 3CFRA 2DTUA 4C8OA 4ELTA 3ULDA 1C1CA 2YNGA 4CFDA 3TARA 1IO2A 3NH0A 3V6DA 4F3TA 3NBPA 4H4OA 4FJ5A 3V9UA 4LH4A 2BE2A 3LPTA 3ZSXA 1IKYA 3HT3A 2P5GA 3NFAA 1TK0A 1J53A 3BDPA 1TAQA 4KTQA 2YHAA 3VQEA 4E1NA 4CK3A 1O1WA 5KI6A 1ZBHA 4ELVA 4Z4IA 3HM9A 3F73A 2DFHA 1VSIA 4IG0A 4CIEA 3CFOA 4OGCA 4CEOA 3K58A 3HPGA 4CESA 3D0PA 4BDYA 1IG9A 4KFBA 3ZSYA 4CGDA 4CJUA 4BDZA 4GW6A 3SJJA 3QO9A 2OYQA 3U3YA 1NK9A 2NUBA 1X9MA 1JLBA 1SV5A 2D0AA 5DMRA 3OYIA 1N5YA 1BIUA 3ZT3A 4E7HA 3ZT0A 3DLRA 4KHUA 2KFNA 4IKFA 1TAUA 4FVMA 3DLBA 1DTTA 1UOCA 3MAQA 1TK5A 3OS0A 3SQ2A 4CJRA 2ATQA 4JRPA 2OPPA 4J2DA 3F9KA 1KVBA 4FW1A 5KRTA 4HTUA 4DFPA 4PY5A 4B8CA 2JGUA 1TKXA 3QEIA 4KI6A 4DS5A 2Z1GA 4HVJA 3ITHA 4B8AB 4BACA 1S1VA 4AHTA 4FJXA 1SKSA 4IBNA 1RT3A 4W5QA 4E7LA 4AHUA 4KHYA 1TL1A 2KZMA 1S1XA 4H4MA 3CYMA 3RMBA 4YFUA 1S9GA 4RW6A 4FLYA 3SUQA 1NJWA 3AO1A 5SZTA 3TAEA 4FM2A 4KHNA 4LH5A 4KB0A 1RBVA 4CIFA 4EP4A 4DTXA 2YNHA 4FK4A 3OYDA 1S1UA 4ID1A 3RRHA 3PX4A 4FJ8A 3VQCA 2EHGA 4CJLA 4HUGA 3DLEA 1XHXA 3DMJA 3LP3A 4K8ZA 3K5MA 3QNNA 4DSJA 3PO4A 3VQAA 1L5UA 1KVAA 1ZBUA 3K2PA 1J9AA 3P1GA 4OKKA 4O0JA 5CY4A 3QEVA 4EZ6A 5D3GA 4OKJA 4FJHA 4B9LA 1B9DA 1C0TA 2HVIA 2HHXA 1WSHA 1RT2A 3DRSA 3ZSWA 4KI4A 4FZXC 4DQIA 1VSHA 3M8QA 4DS4A 3AO4A 5JS1A 3AO2A 3KKSA 2OPSA 1JLFA 2BANA 1A5XA 1XC9A 4M45A 3QINA 3HP6A 4Q5VA 5T7BA 2IC3A 1ASUA 5J2MA 4KTWA 1JLQA 1HJRA 3LDSA 4KKOA 1HNIA 3HVTA 1VSJA 4OLAA 3RR8A 2X74A 4YNQA 3LWMA 3V1OA 3OYJA 2FBVA 4FK0A 4CCHA 1S9EA 2ZQBA 3OYCA 1JL1A 4E1MA 2XRIA 2YKNA 2Y1IA 4FXDA 3OYEA 3KLHA 3RTVA 1CZBA 3LANA 3P5JA 4IG3A 4IDKA 3ZT4A 4AH9A 1NOZA 4Y1CA 3ZCMA 4FLZA 2HMIA 3AV9A 1JKHA 3TANA 5J1EA 1YVUA 3MEEA 1W9HA 3QEXA 1KRPA 3AO3A 4F2RA 2RPIA 2OPRA 4C8MA 2PYJA 4Q0BA 1RT5A 3LPUA 2IDOA 1GOAA 4Z0UA 1GOCA 1YT3A 1C0UA 3MEGA 3PY8A 1JXEA 2E6LA 3L3UA 4DTUA 3L8BA 2QKKA 4CEQA 2X6NA 4PUOA 2QKBA 2ZD1A 4CERA 4DTRA 1RNHA 1VK0A 4MFBA 4CHQA 3IAYA 4FK2A 1FK9A 3NH1A 1BISA 3DLHA 4OPJA 3CQ8A 1Q8IA 4DF8A 3VQBA 4CFAA 3SNNA 2A1RA 4N56A 4BE2A 4OPKA 4FLUA 1BCMA 1S1WA 3OYMA 3I0RA 3LWLA 4HUFA 4DFMA 1L3UA 2OZSA 1WSIA 1RDDA 4DTPA 1TVRA 3QIPA 4KREA 3L2QA 1Q9XA 3NE6A 3U3GA 3HJFA 2F8SA 5DK5A 3NF7A 3SUNA 2GUIA 1ZBLA 1A5WA 4W5TA 2VG6A 1X9SA 2XY7A 1D9FA 3QETA 4QAGA 1TV6A 2RF2A 1QS4A 1XWLA 4NYFA 2YHBA 4FM1A 5HP1A 1LV5A 4RW7A 3SYZA 4FJLA 1RDCA 4AHCA 1VSDA 3KD5E 3M8SA 5KGWA 4E7IA 4CJKA 3MXIA 3NF9A 3VQ7A 1RTHA 3OYAA 2WOMA 3SCXA 4R5PA 4ICLA 2OPQA 4M3RA 4Z4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C1A A;  4I9L A;  3PX0 A;  2HHT A;  1ASW A;  4WE1 A;  2F96 A;  1X1P A;  1Y97 A;  3D45 A;  1RDA A;  4AHR A;  3LAM A;  1RDB A;  4CF0 A;  4BE0 A;  4DTJ A;  3MXM A;  1IKW A;  1BGX T;  3E01 A;  1D8Y A;  4DSE A;  3ZT2 A;  4JRQ A;  3ZT1 A;  1LWE A;  1S6Q A;  1LAW A;  1EP4 A;  4I2Q A;  2YNF A;  4CHP A;  4PA1 A;  3RMC A;  1RIL A;  2KTQ A;  4GVM A;  4B08 A;  3KK2 A;  3QEW A;  1U45 A;  1SL2 A;  2B5J A;  3VQ6 A;  1C6V A;  1VRT A;  4CGJ A;  2ZE2 A;  1WSG A;  1LWC A;  3KD1 E;  1VSE A;  3CM6 A;  4CEE A;  3G0Z A;  2Q3S A;  3V9W A;  2HNY A;  1LWF A;  2Z1I A;  2D0C A;  4NYN A;  4I9Q A;  4QCL A;  4DSI A;  3NH2 A;  3ASM A;  4NCA A;  4LD0 A;  1UA0 A;  4DTN A;  1U4B A;  3LP0 A;  4FJJ A;  1EKE A;  4N47 A;  3KIO A;  4IFY A;  3QEP A;  1JL2 A;  3WNF A;  1IKV A;  3IG1 A;  5I42 A;  3OYL A;  4DLG A;  4B3O A;  3SZ2 A;  3SV4 A;  1JLC A;  3V9X A;  1QSL A;  3ALY A;  4DQS A;  2Y1J A;  4DU4 A;  1RBR A;  3KLF A;  3U6F A;  1KVC A;  1VSK A;  1N6Q A;  3TI0 A;  5CYM A;  3L2U A;  1TKZ A;  1TL3 A;  1RT7 A;  3AO5 A;  3AA5 X;  4W5O A;  3KK3 A;  2PYL A;  3K5O A;  1RBT A;  1QTM A;  5FRN A;  5FDL A;  4HCC A;  4KHW A;  3KK1 A;  4JS4 A;  3L2W A;  4FM0 A;  4DQP A;  1CLQ A;  3WNH A;  3OJS A;  4NCG A;  2RKI A;  5SWM A;  3OS2 A;  3TAQ A;  4CEZ A;  5HRP A;  4OLB A;  4FW2 A;  3DRP A;  3HVR A;  3V9Z A;  1SKW A;  4DSK A;  2HW3 A;  1JLE A;  3CM5 A;  4O55 A;  4CJS A;  2G8V A;  1VSM A;  3LAL A;  4CJV A;  4E0D A;  4KHQ A;  3HYF A;  1CXU A;  4FCY A;  1L3V A;  1SUQ A;  3AVJ A;  1YTU A;  3T1A A;  1Q9Y A;  4FLV A;  4DG1 A;  1BQM A;  1I3A A;  1S5J A;  4CJ5 A;  3VA3 A;  2P1J A;  1HYZ A;  3C6T A;  1D5A A;  2EX3 A;  3DM2 A;  2G8I A;  5EU7 A;  3VQQ A;  3MEC A;  1NJZ A;  4DTS A;  1U48 A;  4O5B A;  3V4I A;  1DLO A;  1Z26 A;  3L2R A;  1T7P A;  4K8X A;  1QQC A;  1NKB A;  4Z4C A;  1S6P A;  4RW4 A;  5JS2 A;  3OS1 A;  2XHB A;  4ELU A;  4FJN A;  2OZM A;  1SL0 A;  4DSL A;  2HND A;  4FLX A;  3OYB A;  3THV A;  1NJY A;  4FZY A;  4FLW A;  4AIL C;  2P5O A;  4E89 A;  4Z4E A;  2HHV A;  4CJP A;  3TWH A;  1NKC A;  4C8L A;  1C1B A;  4HCB A;  3KKR A;  2I5J A;  3AA4 A;  5HRR A;  2G8U A;  3K59 A;  2BGG A;  3PUF A;  4DU1 A;  3SQ0 A;  1FXX A;  3DI6 A;  3OYF A;  3I0S A;  4Z4H A;  4I7F A;  3HST B;  3NAE A;  3B6P A;  3UIQ A;  1LW0 A;  2DY4 A;  4J2A A;  4CFB A;  3DLG A;  4G1Q A;  4RW9 A;  4M42 A;  2O4I A;  2DFF A;  3EY1 A;  4C8K A;  1F21 A;  4ID5 A;  3TAB A;  2YKM A;  1KCF A;  1B9F A;  1WN7 A;  2DFE A;  2P51 A;  3QLH A;  1RCH A;  1VSF A;  3KTQ A;  3C94 A;  2QXF A;  3VQ5 A;  1NJX A;  1D9D A;  3P83 D;  4HUE A;  3AVB A;  4KPY A;  4CED A;  4F4K A;  4PQU A;  3L3V A;  1VSL A;  4JS5 A;  3JSM A;  5I3U A;  1NK0 A;  2QK9 A;  1T03 A;  1WSE A;  3OY9 A;  3V1Q A;  1REV A;  1NOY A;  4BE1 A;  4NCB A;  4CF8 A;  3HXM A;  3ZSR A;  3JYT A;  1L3S A;  3AVM A;  2IOC A;  3WNG A;  1WNS A;  1FKP A;  1HYV A;  2G8H A;  3O4N A;  3ZSQ A;  5HRS A;  1WAF A;  3V81 A;  4PWD A;  1T8E A;  3K5L A;  3G10 A;  5HBM A;  1NK8 A;  4EZ9 A;  3KLE A;  2XY6 A;  1VRU A;  5C42 A;  3NHG A;  4AHV A;  3O3G A;  4M3U A;  3ZSO A;  4O44 A;  3TAG A;  3AVC A;  1HQU A;  1HRH A;  2XO7 A;  4CGH A;  4FLT A;  3KJV A;  2VWJ A;  5FRM A;  3LP2 A;  4RG8 A;  3M8P A;  3K57 A;  3HP9 A;  4L8R B;  4BWJ A;  3QER A;  2XY8 A;  2LSN A;  4HHT A;  3AVF A;  1J5O A;  4B9S A;  4KAZ A;  2FBT A;  3C95 A;  3DOK A;  3KLI A;  4N41 A;  3SPY A;  1J54 A;  1RTJ A;  4LSL A;  2FBX A;  1S1T A;  4CJW A;  1U49 A;  5KTQ A;  1NK6 A;  2G8K A;  2F8T A;  3ZSV A;  2XY5 A;  4DWI A;  1UAX A;  3MXJ A;  1RT4 A;  3VQ4 A;  3HK2 A;  1CXQ A;  3AVI A;  1BHL A;  1BL3 A;  3S3N A;  2Z1H A;  5HRN A;  2YV0 X;  3VQ9 A;  2ETJ A;  3SI6 A;  4TSX A;  1TGO A;  4OVL A;  3O3F A;  3RMD A;  4GMJ B;  3NGZ A;  4DTO A;  4H8K A;  3VQP A;  1TKD A;  1BI4 A;  3T19 A;  4CJF A;  2KW4 A;  4FJI A;  4FYD A;  2IAJ A;  2AJQ A;  1BI4 B;  1T05 A;  4M3Z A;  3SV3 A;  2JLE A;  1A5V A;  3DRR A;  5CZ2 A;  3VA0 A;  3RWU A;  1HYS A;  3M8R A;  2HHQ A;  4W5N A;  2GBZ A;  1KLM A;  1KTQ A;  3NF8 A;  4CF9 A;  4Z4G A;  5CZ1 A;  4DTM A;  1HNV A;  3C6U A;  3MED A;  2PY5 A;  4DFK A;  3PX6 A;  4CF2 A;  2E6M A;  1UWB A;  1WSF A;  5J2Q A;  2HHS A;  4FJG A;  3NGI A;  3DYA A;  1HMV A;  3AVG A;  3EZ5 A;  4N76 A;  3AA3 A;  3O4Q A;  5FRO A;  3BGR A;  1KFD A;  1QE1 A;  1RBS A;  2KQ2 A;  3WNE A;  4CJQ A;  3TAP A;  1R0A A;  5C24 A;  4DLE A;  2D5R A;  3S9H A;  1LAV A;  4JLH A;  4DU3 A;  4CGF A;  3ZSZ A;  1GOB A;  1IKX A;  3LZI A;  1RT1 A;  4CGG A;  5K14 A;  2B4J A;  4EP5 A;  5KRS A;  3RRG A;  3VN5 A;  4KO0 A;  4FJ7 A;  1JLA A;  2O4G A;  4CGI A;  1KSP A;  2GV9 A;  3IRX A;  2A1S A;  2G8F A;  3K5N A;  4CJT A;  3TR8 A;  2R7Y A;  3QNO A;  4C8N A;  4M3X A;  3OJU A;  1FKO A;  4CEB A;  4B9T A;  1BCO A;  2ITG A;  3OVN A;  4B9N A;  2KFZ A;  3NDK A;  3AVH A;  3SUP A;  3AVL A;  3IS9 A;  2E4L A;  1KFS A;  1BIZ A;  3KLG A;  2HB5 A;  2IS3 A;  3NF6 A;  3EYZ A;  3SQ4 A;  4M3W A;  1XHZ A;  4DQR A;  4CEC A;  4CHY A;  1EXQ A;  3OYH A;  5J2N A;  4M3Y A;  1W0H A;  4MQ3 A;  4CJ4 A;  3HPO A;  4CHN A;  1B92 A;  4E3S A;  2G8W A;  4KRF A;  1EET A;  1BQN A;  3S3O A;  3NCI A;  3H08 A;  5KGX A;  1K6Y A;  4W5R A;  2W42 A;  4J2E A;  2HVH A;  1RBU A;  2HHU A;  4CK1 A;  2RN2 A;  1JLG A;  1C0M A;  2WON A;  1U47 A;  1JXB A;  1X9W A;  4IFV A;  4OJR A;  4J2B A;  4BDP A;  3T3F A;  4CEF A;  4CF1 A;  1ZBF A;  5E41 A;  3LP1 A;  2X78 A;  3O3H A;  4CJE A;  3L2V A;  4Y1D A;  5C25 A;  5HRO A;  3SPZ A;  3DLK A;  3HPH A;  3A2F A;  4CIG A;  3LAK A;  4DFJ A;  2BDP A;  4O0I A;  4CK2 A;  4M3T A;  4CHO A;  3QIO A;  1QSY A;  4B9M A;  2Z1J A;  3QES A;  2D0B A;  4FZZ A;  4DQQ A;  4ZTJ A;  3ISN C;  4DMN A;  2PZS A;  4BWM A;  4RW8 A;  4OGE A;  1KLN A;  1ZBI A;  1ASV A;  2IGI A;  1HQE A;  2HNZ A;  1EX4 A;  4O4G A;  1QSS A;  1WLJ A;  3RR7 A;  3AVK A;  4KTZ A;  3AVN A;  4I2P A;  3NGY A;  4N5S A;  1NK4 A;  4E7J A;  2FC0 A;  2VG5 A;  4M41 A;  4CFC A;  3OYG A;  3V9S A;  4KV8 A;  4ZTF A;  1SKR A;  3HO1 A;  4KB1 A;  1RT6 A;  4LSN A;  2X6S A;  1Z25 A;  2B6A A;  4OKE A;  5HLF A;  1NK5 A;  2VG7 A;  1IH7 A;  4CJ3 A;  4ZHR A;  3SQ1 A;  1TKT A;  1NKE A;  2YNI A;  3FFI A;  1I39 A;  4DSF A;  4AHS A;  3SUO A;  1G15 A;  2VWK A;  3CFP A;  4F2S A;  1LW2 A;  4QOZ B;  2FBY A;  3AA2 A;  2OA8 A;  4FJM A;  3PV8 A;  1NK7 A;  3TAM A;  4CE9 A;  4E19 A;  4FJK A;  3HL8 A;  3DOL A;  1TK8 A;  4CHZ A;  2KZZ A;  2HHW A;  1HPZ A;  3VQ8 A;  1SL1 A;  4LY7 A;  4B9V A;  4B9U A;  4FJ9 A;  5CYQ A;  1ZYQ A;  3PO5 A;  3S3M A;  4F8R A;  1CZ9 A;  4DF4 A;  3TAF A;  1DTQ A;  1XI1 A;  4F3O A;  1MU2 A;  3V1R A;  1QHT A;  3B6O A;  4XIU A;  4CEA A;  1WAJ A;  4E7K A;  1L3T A;  1RTD A;  4UQG A;  5J2P A;  3LZJ A;  3I8D A;  1WSJ A;  3RMA A;  1ITG A;  3AVA A;  3OYK A;  1UA1 A;  1YTA A;  3CG7 A;  4KHS A;  3OYN A;  1RTI A;  1U04 A;  3VQD A;  3CFR A;  2DTU A;  4C8O A;  4ELT A;  3ULD A;  1C1C A;  2YNG A;  4CFD A;  3TAR A;  1IO2 A;  3NH0 A;  3V6D A;  4F3T A;  3NBP A;  4H4O A;  4FJ5 A;  3V9U A;  4LH4 A;  2BE2 A;  3LPT A;  3ZSX A;  1IKY A;  3HT3 A;  2P5G A;  3NFA A;  1TK0 A;  1J53 A;  3BDP A;  1TAQ A;  4KTQ A;  2YHA A;  3VQE A;  4E1N A;  4CK3 A;  1O1W A;  5KI6 A;  1ZBH A;  4ELV A;  4Z4I A;  3HM9 A;  3F73 A;  2DFH A;  1VSI A;  4IG0 A;  4CIE A;  3CFO A;  4OGC A;  4CEO A;  3K58 A;  3HPG A;  4CES A;  3D0P A;  4BDY A;  1IG9 A;  4KFB A;  3ZSY A;  4CGD A;  4CJU A;  4BDZ A;  4GW6 A;  3SJJ A;  3QO9 A;  2OYQ A;  3U3Y A;  1NK9 A;  2NUB A;  1X9M A;  1JLB A;  1SV5 A;  2D0A A;  5DMR A;  3OYI A;  1N5Y A;  1BIU A;  3ZT3 A;  4E7H A;  3ZT0 A;  3DLR A;  4KHU A;  2KFN A;  4IKF A;  1TAU A;  4FVM A;  3DLB A;  1DTT A;  1UOC A;  3MAQ A;  1TK5 A;  3OS0 A;  3SQ2 A;  4CJR A;  2ATQ A;  4JRP A;  2OPP A;  4J2D A;  3F9K A;  1KVB A;  4FW1 A;  5KRT A;  4HTU A;  4DFP A;  4PY5 A;  4B8C A;  2JGU A;  1TKX A;  3QEI A;  4KI6 A;  4DS5 A;  2Z1G A;  4HVJ A;  3ITH A;  4B8A B;  4BAC A;  1S1V A;  4AHT A;  4FJX A;  1SKS A;  4IBN A;  1RT3 A;  4W5Q A;  4E7L A;  4AHU A;  4KHY A;  1TL1 A;  2KZM A;  1S1X A;  4H4M A;  3CYM A;  3RMB A;  4YFU A;  1S9G A;  4RW6 A;  4FLY A;  3SUQ A;  1NJW A;  3AO1 A;  5SZT A;  3TAE A;  4FM2 A;  4KHN A;  4LH5 A;  4KB0 A;  1RBV A;  4CIF A;  4EP4 A;  4DTX A;  2YNH A;  4FK4 A;  3OYD A;  1S1U A;  4ID1 A;  3RRH A;  3PX4 A;  4FJ8 A;  3VQC A;  2EHG A;  4CJL A;  4HUG A;  3DLE A;  1XHX A;  3DMJ A;  3LP3 A;  4K8Z A;  3K5M A;  3QNN A;  4DSJ A;  3PO4 A;  3VQA A;  1L5U A;  1KVA A;  1ZBU A;  3K2P A;  1J9A A;  3P1G A;  4OKK A;  4O0J A;  5CY4 A;  3QEV A;  4EZ6 A;  5D3G A;  4OKJ A;  4FJH A;  4B9L A;  1B9D A;  1C0T A;  2HVI A;  2HHX A;  1WSH A;  1RT2 A;  3DRS A;  3ZSW A;  4KI4 A;  4FZX C;  4DQI A;  1VSH A;  3M8Q A;  4DS4 A;  3AO4 A;  5JS1 A;  3AO2 A;  3KKS A;  2OPS A;  1JLF A;  2BAN A;  1A5X A;  1XC9 A;  4M45 A;  3QIN A;  3HP6 A;  4Q5V A;  5T7B A;  2IC3 A;  1ASU A;  5J2M A;  4KTW A;  1JLQ A;  1HJR A;  3LDS A;  4KKO A;  1HNI A;  3HVT A;  1VSJ A;  4OLA A;  3RR8 A;  2X74 A;  4YNQ A;  3LWM A;  3V1O A;  3OYJ A;  2FBV A;  4FK0 A;  4CCH A;  1S9E A;  2ZQB A;  3OYC A;  1JL1 A;  4E1M A;  2XRI A;  2YKN A;  2Y1I A;  4FXD A;  3OYE A;  3KLH A;  3RTV A;  1CZB A;  3LAN A;  3P5J A;  4IG3 A;  4IDK A;  3ZT4 A;  4AH9 A;  1NOZ A;  4Y1C A;  3ZCM A;  4FLZ A;  2HMI A;  3AV9 A;  1JKH A;  3TAN A;  5J1E A;  1YVU A;  3MEE A;  1W9H A;  3QEX A;  1KRP A;  3AO3 A;  4F2R A;  2RPI A;  2OPR A;  4C8M A;  2PYJ A;  4Q0B A;  1RT5 A;  3LPU A;  2IDO A;  1GOA A;  4Z0U A;  1GOC A;  1YT3 A;  1C0U A;  3MEG A;  3PY8 A;  1JXE A;  2E6L A;  3L3U A;  4DTU A;  3L8B A;  2QKK A;  4CEQ A;  2X6N A;  4PUO A;  2QKB A;  2ZD1 A;  4CER A;  4DTR A;  1RNH A;  1VK0 A;  4MFB A;  4CHQ A;  3IAY A;  4FK2 A;  1FK9 A;  3NH1 A;  1BIS A;  3DLH A;  4OPJ A;  3CQ8 A;  1Q8I A;  4DF8 A;  3VQB A;  4CFA A;  3SNN A;  2A1R A;  4N56 A;  4BE2 A;  4OPK A;  4FLU A;  1BCM A;  1S1W A;  3OYM A;  3I0R A;  3LWL A;  4HUF A;  4DFM A;  1L3U A;  2OZS A;  1WSI A;  1RDD A;  4DTP A;  1TVR A;  3QIP A;  4KRE A;  3L2Q A;  1Q9X A;  3NE6 A;  3U3G A;  3HJF A;  2F8S A;  5DK5 A;  3NF7 A;  3SUN A;  2GUI A;  1ZBL A;  1A5W A;  4W5T A;  2VG6 A;  1X9S A;  2XY7 A;  1D9F A;  3QET A;  4QAG A;  1TV6 A;  2RF2 A;  1QS4 A;  1XWL A;  4NYF A;  2YHB A;  4FM1 A;  5HP1 A;  1LV5 A;  4RW7 A;  3SYZ A;  4FJL A;  1RDC A;  4AHC A;  1VSD A;  3KD5 E;  3M8S A;  5KGW A;  4E7I A;  4CJK A;  3MXI A;  3NF9 A;  3VQ7 A;  1RTH A;  3OYA A;  2WOM A;  3SCX A;  4R5P A;  4ICL A;  2OPQ A;  4M3R A;  4Z4F A; 
#chains in the Genus database with same CATH topology
 3C6A A;  2QTD A;  2HHT A;  1Y97 A;  2D4W A;  4CD1 A;  3E01 A;  1D8Y A;  3ZT2 A;  4JRQ A;  1S6Q A;  2YNF A;  1Y64 A;  4PA1 A;  4GVM A;  4H5W A;  1U45 A;  3VQ6 A;  1BOT O;  1C6V A;  3H3N O;  1WSG A;  1LWC A;  4DKW A;  3VOV A;  5M1O A;  2BTF A;  2D0C A;  4QCL A;  3HRG A;  3ASM A;  1UA0 A;  3TPQ A;  3LP0 A;  1T6D A;  3QEP A;  3OYL A;  3V9X A;  5JLF A;  3JAM O;  1T44 A;  1RBR A;  1VSK A;  3EL2 A;  3AO5 A;  2PYL A;  3K5O A;  1RBT A;  4HCC A;  4WQ5 A;  4JS4 A;  4FM0 A;  1Z05 A;  5AQG A;  4DUZ K;  1CLQ A;  5SWM A;  3OS2 A;  4U7B A;  3H45 C;  4FW2 A;  3V9Z A;  3VEN A;  3CM5 A;  1IJJ A;  3FE1 A;  4CJV A;  1NMN A;  1XQS C;  4FWK A;  3E1Y A;  4A5A A;  4DG1 A;  2JWK A;  2P1J A;  1D5A A;  4QS9 A;  3V4I A;  1Z26 A;  3L2R A;  5AZI A;  5AZI B;  3OS1 A;  2OZM A;  1IG8 A;  2HND A;  4FLX A;  3THV A;  4AIL C;  4RTF D;  4CJP A;  4HCB A;  2F9T A;  5BR8 K;  3AA4 A;  1K8K A;  3PUF A;  1HNZ K;  4I7F A;  4DV4 K;  3NAE A;  3B6P A;  4B9Q A;  1LW0 A;  5BN8 A;  2DY4 A;  3WUH A;  5AQW A;  4RW9 A;  2QW9 A;  4C8K A;  1F21 A;  5E84 A;  2YKM A;  1KCF A;  2UXC K;  1D9D A;  2QXF A;  4PL8 A;  3G25 A;  4F4K A;  3HOT A;  3L3V A;  1VSL A;  3THX A;  2I7P A;  2UUC K;  4BRP A;  2IIR A;  2IOC A;  4HWI A;  1HYV A;  3O4N A;  3ZSQ A;  4EHT A;  1WAF A;  1N34 K;  4PWD A;  3K5L A;  2VGM A;  3G10 A;  1NK8 A;  3F2K A;  2XY6 A;  1VRU A;  5HL7 L;  4AHV A;  3O3G A;  3CMA N;  3NVM A;  3AVC A;  5BRF A;  2NRR A;  3KJV A;  2VWJ A;  3D2F A;  4FWR A;  1ZXO A;  2XY8 A;  2LSN A;  4X66 K;  5F0X A;  5AQK A;  3SPY A;  1FJG K;  3P38 A;  2G8K A;  2F8T A;  4J8F A;  3ID6 A;  2XY5 A;  1NGB A;  1UAX A;  4MLE A;  3HK2 A;  3OBY A;  3AVI A;  1BL3 A;  2FSN A;  4BR4 A;  3EN9 A;  3VQ9 A;  1TGO A;  1K8A O;  3RMD A;  3G6E N;  1T6C A;  4JI7 K;  4MDB A;  2AJQ A;  3A0I X;  3SV3 A;  2JLE A;  1S3X A;  4PKH A;  1A5V A;  4W5N A;  3M8R A;  2UU9 K;  2GBZ A;  3LDQ A;  2F9W A;  5GIO A;  1RFQ A;  1UWB A;  5J2Q A;  5F1X A;  4FJG A;  3NGI A;  4H0T B;  3CER A;  3DYA A;  4N76 A;  1RBS A;  1HX1 A;  2ZJR L;  1BA1 A;  3ULE B;  4H0V B;  5C24 A;  2D5R A;  3S9H A;  4NB4 A;  1GOB A;  1RT1 A;  5K14 A;  2O4G A;  3VF2 A;  4CGI A;  1VQP N;  4CJT A;  3A5L C;  1FKO A;  3C6H A;  1MDU B;  3ATV A;  3AVH A;  3KHY A;  1K73 O;  1P8Z A;  3SUP A;  1V4T A;  1BIZ A;  3EYZ A;  4C1N K;  1XHZ A;  4DQR A;  3O1B A;  5J2N A;  1NU0 A;  4MQ3 A;  3WEE A;  3HPO A;  4CHN A;  4DR4 K;  3WEE B;  3EE8 A;  4A2A A;  3NCI A;  3H08 A;  2QWM A;  1GLC G;  2W42 A;  4WQ5 C;  5LMN K;  1JLG A;  1GLJ O;  3HI0 A;  2WON A;  1U47 A;  4OJR A;  3KVG A;  4O8U A;  3T3F A;  4CF1 A;  3LP1 A;  2O8E A;  3DLK A;  4CIG A;  3BF3 A;  3QIO A;  4CHO A;  1O13 A;  1QSY A;  2Z1J A;  4MDA A;  3QES A;  4FZZ A;  4ZTJ A;  2D1K A;  4OGE A;  4O8K A;  2IGI A;  1QSS A;  2QWQ A;  3AVK A;  1VAZ A;  2PAV A;  4I2P A;  3NGY A;  4N5S A;  1SAZ A;  3UIQ A;  4FJL A;  3OYG A;  4KB1 A;  1E4G T;  2X6S A;  1Z25 A;  2B6A A;  1M1K O;  4OKE A;  4NXM K;  2V51 B;  1NKE A;  2ZF5 O;  5AQN A;  5E26 A;  4DSF A;  3GG4 A;  1G15 A;  2VWK A;  4ISE A;  3CFP A;  3ZEU A;  2Q31 A;  3BZK A;  1OVQ A;  2FBY A;  2PBD A;  3AA2 A;  3PV8 A;  3O5B A;  3ZEU B;  3TAM A;  2V52 B;  3DOL A;  5M1P A;  2KZZ A;  2HHW A;  3VQ8 A;  3QFP A;  2HBJ A;  4LY7 A;  4X65 K;  5M1N A;  5AQQ A;  5CYQ A;  3PO5 A;  1XI1 A;  4JD2 B;  4QS7 A;  2ZM6 K;  4KHP K;  3LZJ A;  3I8D A;  3I8B A;  1ITG A;  3AVA A;  2ITM A;  1U04 A;  3VES A;  1C1C A;  2YNG A;  2A5X A;  3TAR A;  1BU6 O;  3V6D A;  2WTU A;  3NBP A;  4H4O A;  4FJ5 A;  3LM2 A;  2BE2 A;  1IKY A;  2W41 A;  4G9Z A;  2HBK A;  3I56 N;  1TAQ A;  4KTQ A;  3O9U A;  4E1N A;  2OCE A;  3S41 A;  3K58 A;  3H3O B;  4CES A;  4FWS A;  5CHI A;  1WB9 A;  3ZET A;  3G71 N;  3QO9 A;  2OYQ A;  5GIN A;  4JN4 A;  3ZET B;  1TAU A;  4E7H A;  3ZT0 A;  4IKF A;  1ILY A;  3DLB A;  1DTT A;  4CZE A;  2PFU A;  2YI1 A;  3OS0 A;  4GVE A;  4CJR A;  1NGD A;  2OPP A;  3ENB A;  3OHR A;  1VQ9 N;  4J2D A;  4DFP A;  4B8C A;  2JGU A;  2NRT A;  3QEI A;  2BH1 A;  4HTL A;  4DS5 A;  3ITH A;  2NRH A;  3J80 O;  3PIO L;  4WFB L;  1SKS A;  4B3T K;  1RT3 A;  3D7E O;  3U9D A;  4M63 C;  1TL1 A;  4RW6 A;  4FLY A;  5DM7 L;  1NJW A;  2NRW A;  5SZT A;  2YNH A;  3DLL L;  4ILG B;  3RRH A;  1XUP O;  3PX4 A;  4YOY A;  1Q81 O;  3VQC A;  5AQS A;  3QNN A;  3PO4 A;  3K2P A;  3DXK A;  1W97 L;  3M6G A;  1SS6 A;  2HHH K;  1C0T A;  3AGR A;  1WSH A;  3Q7B A;  4GV6 A;  2D0O A;  5JS1 A;  3KKS A;  3WXM B;  4B3R K;  1XMQ K;  2UXB K;  4ISF A;  4ILJ A;  5T7B A;  5J2M A;  3SLC A;  4KTW A;  2QA4 N;  3KWI A;  2OAN A;  5AQL A;  2FBV A;  4FK0 A;  2GWK A;  2YKN A;  3U9Z A;  4LF4 K;  3OYE A;  3RTV A;  4IG3 A;  4FLZ A;  2QWN A;  2KKZ A;  1NOZ A;  2GWJ A;  3TTD A;  1JKH A;  3TAN A;  1IBL K;  3MEE A;  4FJ9 A;  1W9H A;  3U4L A;  2RPI A;  2PYJ A;  3LPU A;  1GOA A;  3BEX A;  3E9O A;  3L3U A;  1C0G A;  3SMP A;  4CEQ A;  4RCH A;  2FLO A;  2QM1 A;  4PUO A;  4DTR A;  4MFB A;  4CHQ A;  3CJ9 A;  4OPH A;  4FK2 A;  4IEI A;  4OPJ A;  5JVG L;  5IT9 O;  4DF8 A;  3VQB A;  2E2O A;  4JI6 K;  4BE2 A;  4EHU A;  1S1W A;  4DFM A;  3LWL A;  4H0Y B;  1RDD A;  3QIP A;  4KRE A;  5C10 A;  3L2Q A;  1Q9X A;  1MWK A;  5GIP A;  1ZBL A;  2GUI A;  1A5W A;  1X9S A;  4M7X A;  5BPN A;  1QS4 A;  3BZC A;  1M90 O;  4QS8 A;  5HP1 A;  4CZM A;  5FPD A;  1VSD A;  4E7I A;  4JHD A;  3VEX A;  4GV9 A;  3VQ7 A;  4JHD B;  2Q1N A;  2OPQ A;  4M3R A;  4I6M A;  2E1Y A;  1C1A A;  4DV6 K;  3PX0 A;  2F96 A;  3MXM A;  3LAM A;  1RDB A;  5TKW A;  4YOV A;  3F5T A;  3P4I A;  1IKW A;  3UKU A;  4FPA A;  1LWE A;  3UKU B;  2VWB A;  1LAW A;  1EP4 A;  4I2Q A;  4BR7 A;  3RMC A;  1RIL A;  4B08 A;  3QEW A;  1SL2 A;  2B5J A;  3O8M A;  3ZX3 A;  3KD1 E;  3CM6 A;  2Q3S A;  2HNY A;  3K0S A;  4IOC L;  3IDH A;  3NH2 A;  4K43 A;  4Y0W A;  4DTN A;  4FJJ A;  2HST A;  3FGU A;  3KIO A;  2E8A A;  5JIC A;  3LDL A;  1K9M O;  3IG1 A;  5I42 A;  4B3O A;  1CZA N;  3SZ2 A;  3SV4 A;  1JLC A;  1QSL A;  1VQ4 N;  5BRH A;  3WXI A;  2QI2 A;  4DU4 A;  4IFE A;  3KLF A;  3U6F A;  2P9L A;  5CYM A;  3U8X A;  1TKZ A;  3L2U A;  4MO5 A;  3CCJ N;  3AA5 X;  2P9L B;  4R79 A;  4BRG A;  1QTM A;  5FRN A;  3QB0 A;  3WNH A;  3WQT A;  2YJF A;  4CEZ A;  3CPW M;  3HVR A;  3DRP A;  2HW3 A;  3VER A;  4KHQ A;  4YOT A;  1L3V A;  1YTU A;  1QHA A;  3T1A A;  1YIJ N;  4LC9 B;  3THW A;  1S5J A;  4CJ5 A;  3THW B;  3VA3 A;  1HYZ A;  2EX3 A;  2G8I A;  2E5L K;  3VQQ A;  1NJZ A;  1U48 A;  1DLO A;  1T7P A;  3ID8 A;  2P9K A;  1S6P A;  4ELU A;  1H1V A;  2P9K B;  1SL0 A;  4Z4E A;  3OYB A;  4FLW A;  2VGN A;  1C1B A;  1RGI A;  4YDU A;  5HRR A;  2BGG A;  3DI6 A;  1ATN A;  4NLB A;  3OYF A;  2P9U A;  1W7A A;  2QWL A;  2P9U B;  4Z4H A;  4BRL A;  4BRK A;  4CFB A;  5LJV A;  4CD3 A;  2DFF A;  3J7Z O;  4ID5 A;  4F9O A;  3MDQ A;  2ZJQ L;  1WN7 A;  2DFE A;  3QLH A;  1VSF A;  1IV0 A;  3C94 A;  4IO9 L;  2V7Y A;  3O80 A;  4JS5 A;  5I3U A;  2AA4 A;  1NK0 A;  3CCV N;  1T3V A;  2NRZ A;  1REV A;  1NLV A;  1L3S A;  3AVM A;  3L4Q A;  2G8H A;  3V81 A;  1T8E A;  1EQY A;  1NGC A;  3DAW A;  5HBM A;  3KLE A;  1GLA G;  3QBW A;  4UY8 O;  1NNE A;  4EFH A;  3TAG A;  1WBB A;  4WFA L;  3VEV A;  5JLH A;  2XO7 A;  5EOY A;  4CGH A;  4FLT A;  3OW2 M;  1HKC A;  4RG8 A;  3M8P A;  3HP9 A;  4KAZ A;  4B1X B;  3KLI A;  1J54 A;  4JI1 K;  3O9R A;  1DKG D;  4BRN A;  3QDK A;  1CXQ A;  4JNE A;  2Z1H A;  4AF1 A;  4JEP A;  3SI6 A;  4OVL A;  3O3F A;  4GMJ B;  4DTO A;  1HKB A;  4CJF A;  2FF3 B;  3RWU A;  1HYS A;  1HNX K;  1KTQ A;  5C2F A;  1N32 K;  1HNV A;  3C6U A;  2PY5 A;  4DFK A;  3PX6 A;  2E6M A;  1WSF A;  2GEL A;  1YXQ A;  1HMV A;  3DJC A;  3EZ5 A;  1VQL N;  1Z6R A;  3O4Q A;  3BGR A;  2GEM A;  2KQ2 A;  1R0A A;  3M1F A;  3BF1 A;  4JLH A;  5MLC Q;  3MWP A;  1IKX A;  3LZI A;  4CGG A;  1U6Z A;  3RRG A;  4KO0 A;  3A5M C;  1KSP A;  2GV9 A;  3IRX A;  3TR8 A;  3CQY A;  4CEB A;  3O4W A;  5ADX H;  2ITG A;  3WQU A;  2E4L A;  3TSP A;  3T1Y K;  3KLG A;  2HB5 A;  2IS3 A;  3VEZ A;  1W0H A;  4YY3 K;  1RBU A;  4AM6 A;  4J2B A;  4BDP A;  3IUC A;  1Q86 O;  3JXU A;  4CEF A;  1ZBF A;  3D6R A;  1QVF M;  2X78 A;  4WCE L;  3O3H A;  1NBW A;  4KBO A;  3L2V A;  5C25 A;  3SPZ A;  3HPH A;  4DFJ A;  2BDP A;  3QBX A;  2D0B A;  4DV3 K;  2RE2 A;  3CCM N;  3ISN C;  4RW8 A;  1ZBI A;  3AAQ A;  5F2R A;  3WXJ A;  3HSC A;  3O6W A;  5FPE A;  4KTZ A;  2NNW A;  1OKJ A;  2ZGZ A;  1NK4 A;  1SKR A;  4ZTF A;  3FZK A;  4DV5 K;  4FWP A;  5GAG P;  3AY9 A;  2VG7 A;  1IH7 A;  4CJ3 A;  4BRD A;  4YDU C;  2BUP A;  3IFR A;  3IMX A;  1LW2 A;  4QOZ B;  4AQY K;  4FJM A;  3FFK B;  3EKU A;  4CE9 A;  4E19 A;  1XNQ K;  4B9V A;  2UUA K;  4B9U A;  4B1Z A;  4A61 A;  3S3M A;  4F3O A;  4DF4 A;  1DTQ A;  4BRI A;  3V1R A;  1QHT A;  4CEA A;  1L3T A;  4UQG A;  5J2P A;  3R8E A;  1UA1 A;  4KHS A;  3OYK A;  5FPM A;  2WC9 A;  1RTI A;  2DTU A;  3ULD A;  3NH0 A;  4IEE A;  1NGF A;  3V9U A;  4B1V A;  2P5G A;  1U2V B;  1NGE A;  1J53 A;  3BDP A;  4CBX A;  5AQY A;  1GLF O;  5CE3 A;  5KQD A;  1O1W A;  5KI6 A;  1ZBH A;  3KZB A;  1X3M A;  3HPG A;  3K9J A;  2NZT A;  4BC5 A;  1HUX A;  1IG9 A;  1VQ6 N;  4CGD A;  3H1Q A;  1EWR A;  4H5T A;  1JLB A;  4H0O A;  3DLR A;  2E1Z A;  3ULE A;  1TK5 A;  1TUY A;  3SQ2 A;  3K9K A;  1BG3 A;  4HTU A;  4PY5 A;  5AQM A;  3C7N B;  5JMV A;  4FJX A;  5B8H A;  4B1U B;  4AHU A;  1Q82 O;  1XMO K;  4FO0 A;  3AO1 A;  4KH4 A;  4EP4 A;  4BY9 C;  2ZWH A;  5H1S Q;  1XC3 A;  3DLE A;  4BQL A;  3K5M A;  4DSJ A;  4O0J A;  5CY4 A;  3QEV A;  5D3G A;  4OKJ A;  2O8F A;  4FJH A;  5EX5 A;  1B9D A;  2O8F B;  4JK8 A;  3ENO A;  1P90 A;  5M1F A;  1VSH A;  3M8Q A;  3EKS A;  5HOO A;  2IVO A;  3AO4 A;  2OPS A;  1A5X A;  1XC9 A;  3VPZ A;  3QIN A;  4RWT A;  3HP6 A;  4DR7 K;  3LDS A;  4CZI A;  1VSJ A;  4CCH A;  5AQU A;  1S9E A;  2ZQB A;  2O8D A;  2O8D B;  3P5J A;  1BDG A;  3LAN A;  3ZT4 A;  4KHW A;  3ZCM A;  3AGK A;  2HMI A;  4IDH A;  5J1E A;  4GNI A;  4Q0B A;  1RT5 A;  1GOC A;  1YT3 A;  3MEG A;  3CPE A;  5AZJ B;  2QKK A;  2X6N A;  1RNH A;  4NO7 A;  3NH1 A;  1I94 K;  1Q8I A;  4B1Y B;  3OYM A;  3I0R A;  4DQ8 A;  4H5V A;  3EZW A;  3W3D A;  4DTP A;  2A3Z A;  4JD2 A;  2A41 A;  2IVP A;  1YJW N;  4YOX A;  3NE6 A;  4BR0 A;  4MLH A;  1G99 A;  4CVN E;  2CGJ A;  3QET A;  1D9F A;  4QAG A;  1TV6 A;  1XWL A;  4FM1 A;  1R59 O;  1RDC A;  3M8S A;  3D2E A;  3D2E B;  3N4Q A;  2WOM A;  4R5P A;  4ICL A;  4Z4F A;  5LMU K;  4OO1 J;  4I9L A;  1ASW A;  4WE1 A;  4AHR A;  1RDA A;  4DTJ A;  3VMF B;  4DSE A;  3ZT1 A;  4BRH A;  4PHT X;  1WBD A;  5BN9 A;  3C65 A;  4CGJ A;  4BRC A;  1VSE A;  4CEE A;  2Z1I A;  4I9Q A;  3I33 A;  4DSI A;  4DV1 K;  4NCA A;  5AQP A;  1NM1 A;  1IBM K;  2H3G X;  3CJC A;  4N47 A;  1BUP A;  4IFY A;  4DV2 K;  1IKV A;  4DLG A;  3FZH A;  4DQS A;  2Y1J A;  4BRA A;  1KVC A;  3TI0 A;  1TL3 A;  3MX5 A;  3MCA B;  1QZ6 A;  2P9S B;  3P31 A;  5FDL A;  1VQ8 N;  3KK1 A;  3O9Q A;  5M1K A;  3L2W A;  2A42 A;  3SAH A;  2KLA A;  5HRP A;  4OLB A;  3EO3 A;  4DSK A;  2P9N B;  4C23 A;  2P9I B;  4O55 A;  2G8V A;  1E3M A;  1VSM A;  3LAL A;  2O8C A;  4FWN A;  3HYF A;  1CXU A;  3J8A A;  4PL7 A;  2VQE K;  4FCY A;  1SUQ A;  3AVJ A;  2O8C B;  4FLV A;  1BQM A;  3FLC O;  2HOE A;  4CZK A;  2YX6 A;  4IOX A;  4O5B A;  4IJN A;  2NRV A;  3RSE B;  1QQC A;  3E66 A;  1NKB A;  4K8X A;  5JS2 A;  4DSL A;  1NJY A;  5AQV A;  1NKC A;  2I5J A;  2E2N A;  3K59 A;  1FXX A;  3I0S A;  4H5R A;  4M42 A;  4LFA K;  2O4I A;  3EY1 A;  5LL6 Z;  1B9F A;  2P51 A;  3FZL A;  3KTQ A;  4B1W B;  3VQ5 A;  4BC3 A;  1NJX A;  4JKA A;  4KPY A;  4PQU A;  4CED A;  1VQK N;  3CI5 A;  3WXK A;  1GLE G;  1WSE A;  1T03 A;  3V1Q A;  5C12 A;  1NOY A;  3LM9 A;  4BE1 A;  5AQF A;  1FKP A;  3O08 A;  3WXL A;  4B3M K;  4EZ9 A;  1KD1 O;  3CCU N;  5LY3 A;  4M3U A;  3I55 N;  1QQM A;  1HRH A;  1HQU A;  3TU5 A;  3LP2 A;  3VF6 A;  4L8R B;  1KAX A;  5AQZ A;  2ZJP L;  3CQX A;  3F9M A;  4BWJ A;  3QER A;  4B9S A;  2I7N A;  2FBT A;  3C95 A;  5AFU A;  4DR5 K;  1NK6 A;  3R6M A;  5KTQ A;  1U49 A;  4DB3 A;  3CCS N;  4DWI A;  2CGK A;  1MA9 B;  1BHL A;  3S3N A;  5HRN A;  2YV0 X;  3VET A;  4TSX A;  3O9T A;  3CC7 N;  3GE1 A;  4PKG A;  4H8K A;  1ZBS A;  3VQP A;  3T19 A;  3CCR N;  1TKD A;  4FJI A;  3CCL N;  5GAE P;  1T05 A;  4M3Z A;  5CZ2 A;  3VA0 A;  2HHQ A;  4KH5 A;  1HJO A;  1KLM A;  4Z4G A;  4DTM A;  3MED A;  3BP8 A;  4DR3 K;  4YOW A;  1YF5 L;  3OA9 A;  3AVG A;  4CJQ A;  1QE1 A;  3TAP A;  5TKY A;  3WNE A;  3JS6 A;  5AQI A;  2ASM A;  2WUS A;  5KRS A;  2B4J A;  4A59 A;  2YHW A;  2R7Y A;  4EAH D;  3QNO A;  4C8N A;  4M3X A;  2KFZ A;  3OVN A;  4JI5 K;  3NDK A;  2HF4 A;  3ZX2 A;  3AVL A;  3IS9 A;  1KFS A;  3SQ4 A;  4CEC A;  4JKH A;  1YJ9 N;  4GKJ K;  3R3L A;  1B92 A;  4KRF A;  1N33 K;  4W5R A;  4J2E A;  1K6Y A;  2HHU A;  2RN2 A;  1C0M A;  1GLB G;  1NMD A;  1JXB A;  4IFV A;  2F7T A;  3PSF A;  1VQO N;  4CZG A;  2P9P A;  3CCQ N;  4BG9 A;  4CJE A;  2P9P B;  4Y1D A;  5HRO A;  1OH8 A;  3A2F A;  3LAK A;  4O0I A;  4K41 A;  3E9L A;  4B3S K;  4B9M A;  3KK7 A;  4DMN A;  2PZS A;  1HR0 K;  1ASV A;  2Q0R A;  2HNZ A;  3HZ6 A;  4O4G A;  3RR7 A;  2CH5 A;  3M5R A;  4E7J A;  2FC0 A;  3V9S A;  3HO1 A;  3L0Q A;  1RT6 A;  4LSN A;  2HBL A;  2E20 A;  3HOS A;  4ZHR A;  3N4P A;  1HPM A;  3SQ1 A;  4V19 S;  1SZ2 A;  4K42 A;  4XH4 A;  3FFI A;  4AHS A;  3THY B;  4F2S A;  3VGK A;  4BRQ A;  2OA8 A;  1NK7 A;  2KHO A;  3HL8 A;  2QWR A;  3ZYY X;  1RDU A;  1TK8 A;  1HPZ A;  3R9P A;  3LL3 A;  4F8R A;  3TSU A;  1YJN N;  3ENH A;  3CME N;  3B6O A;  4XIU A;  1WAJ A;  2GUP A;  4E1J A;  1RTD A;  4BC2 A;  3RMA A;  1YTA A;  3CG7 A;  4OPA A;  3VTH A;  3OYN A;  4C8O A;  4ELT A;  2OTL N;  3MX2 A;  4M7Y A;  1IO2 A;  4F3T A;  4OX9 K;  4FOI A;  3ZSX A;  3HT3 A;  3NFA A;  2HBM A;  5KPZ A;  4NXN K;  1Q18 A;  2CH6 A;  2YHA A;  1YVN A;  1C0F A;  4ELV A;  1DGK N;  2DFH A;  1VSI A;  4IG0 A;  4CIE A;  3CFO A;  4OGC A;  1YI2 N;  2J4R A;  4BDY A;  1YIT N;  5FPN A;  2WBN A;  5GAD P;  3SJJ A;  1KC8 O;  3U3Y A;  1NK9 A;  1FW6 A;  2NUB A;  4WF9 L;  3ZT3 A;  1TYQ A;  4JK7 A;  4FVM A;  1HKG A;  1UOC A;  1TYQ B;  4DUY K;  1WOQ A;  3IKM A;  4C1N I;  3F9K A;  3CCE N;  4FW1 A;  5KRT A;  3GL1 A;  4KI6 A;  1TKX A;  3A8Y A;  2Z1G A;  2YHY A;  4B8A B;  4BAC A;  1S1V A;  4AHT A;  3J7Y P;  5EXW A;  1NGI A;  5CR4 A;  3BUZ B;  4E7L A;  4CW7 B;  1S1X A;  4H4M A;  3CYM A;  3SUQ A;  4KHN A;  1TUU A;  5AQR A;  4LH5 A;  4KB0 A;  4FK4 A;  1NGH A;  3OYD A;  4JK9 A;  4BRE A;  1VHX A;  4FJ8 A;  3FZF A;  2EHG A;  4HUG A;  1XHX A;  3DMJ A;  3LP3 A;  3VQA A;  1L5U A;  1ZC6 A;  1J9A A;  3P1G A;  4OKK A;  4IWV A;  4EZ6 A;  4IZ9 A;  5BRD A;  4B9L A;  1JCG A;  2HVI A;  2HHX A;  1RT2 A;  3DRS A;  3GDQ A;  3LDO A;  2WFB A;  4L3Q A;  3O1W A;  4Q5V A;  2IC3 A;  1ASU A;  1NGG A;  1HJR A;  2FXU A;  4OLA A;  1GLL O;  4YNQ A;  3V1O A;  3OYJ A;  3CJ1 A;  4FXD A;  2XRI A;  4FWM A;  3KLH A;  1CZB A;  4AH9 A;  3AV9 A;  5AJ3 K;  1KRP A;  5BPM A;  3PLA A;  2OPR A;  4C8M A;  4H03 B;  3A5O C;  1K8K B;  1OH6 A;  1JXE A;  2E6L A;  3L8B A;  2ZD1 A;  4K25 A;  4CER A;  1VK0 A;  4IOA L;  4JI0 K;  3IAY A;  1BIS A;  3SNN A;  4N56 A;  4OPK A;  1VQM N;  3ATU A;  3R1X A;  1NG9 A;  4FOE A;  1ATS A;  1WSI A;  1OH7 A;  2OZS A;  5LJW A;  3E9P A;  3U3G A;  3HJF A;  5DK5 A;  2E2Q A;  3NF7 A;  3THX B;  1SQK A;  4W5T A;  2VG6 A;  4WQ4 A;  3O9S A;  3FR0 A;  2YHB A;  2VQF K;  4FVU A;  1U2V A;  3MN9 A;  3TTC A;  3KD5 E;  1DT9 A;  4LF9 K;  2YCH A;  1X9J A;  4CJK A;  3NF9 A;  3AAR A;  1RTH A;  3J7A P;  3D2F B;  4BGA A;  3D45 A;  1X1P A;  4CF0 A;  4BE0 A;  5DM6 L;  5BRE A;  1BGX T;  4DCH A;  4YHH K;  4H5N A;  5EY4 A;  4CHP A;  2KTQ A;  1V4S A;  3H46 O;  3KWG A;  5AQT A;  1ATR A;  3KK2 A;  4BVP A;  5FLX O;  4JV5 K;  5ADX A;  1VRT A;  2ZE2 A;  3NVK A;  2V7Z A;  3G0Z A;  3V9W A;  1LWF A;  4JKC A;  4NYN A;  1YHQ N;  2OTJ N;  3C7N A;  3VGM A;  4LD0 A;  1BWF O;  1U4B A;  1EKE A;  5AQO A;  4LFC K;  4K0K K;  1JL2 A;  3WNF A;  3VEO A;  3ALY A;  5KQ8 A;  1N36 K;  1Q7Y O;  4DR1 K;  1N6Q A;  3CC4 N;  1RT7 A;  3CC2 N;  3PSI A;  4W5O A;  3KK3 A;  5EVZ A;  4DQP A;  4JKF A;  3OJS A;  4NCG A;  2RKI A;  2YHX A;  3TAQ A;  4JI2 K;  1SKW A;  1JLE A;  4GY2 B;  4CJS A;  4E0D A;  3CXC M;  2HF3 A;  1Q9Y A;  1RDW X;  2Q36 A;  3BY5 A;  1I3A A;  4JI8 K;  3C6T A;  4DV0 K;  3DM2 A;  5EU7 A;  3MEC A;  1XNR K;  4LF6 K;  4DTS A;  2NLX A;  5BPL A;  1YUW A;  3W0L A;  3J81 O;  1DEJ A;  4Z4C A;  3H1V X;  4RW4 A;  2XHB A;  4FJN A;  1NGJ A;  4FZY A;  2P5O A;  4E89 A;  2HHV A;  3TWH A;  4C8L A;  2O8E B;  3KKR A;  1QQO A;  1VQ5 N;  2G8U A;  4A5B A;  4A62 A;  4DU1 A;  3SQ0 A;  5AZJ A;  2F4V K;  5C2D A;  2ASO A;  3HST B;  2UYT A;  3FZM A;  4J2A A;  4FWQ A;  3DLG A;  4G1Q A;  1GLD G;  4A57 A;  3TAB A;  4LF5 K;  4NLC A;  4CI6 A;  1RCH A;  2FF6 A;  3P83 D;  4HUE A;  1QZ5 A;  3AVB A;  4JAX A;  5AQJ A;  3Q7C A;  3QIC A;  3VTI A;  2AP1 A;  3JSM A;  2QK9 A;  5I9E B;  3OY9 A;  1WUA A;  4CZF A;  4NCB A;  4JI4 K;  4CF8 A;  3HXM A;  3ZSR A;  1LCU A;  3JYT A;  4EIA A;  3WNG A;  1WNS A;  2E2P A;  4BG8 A;  5HRS A;  2QEX N;  2O8B A;  3MK6 A;  5C42 A;  3SAG A;  3NHG A;  2VCP A;  2O8B B;  1JJ2 M;  3ZSO A;  4O44 A;  4JI3 K;  4FPB A;  4BR5 A;  3CJB A;  1YAG A;  1HNW K;  5FRM A;  3K57 A;  3VEY A;  2A6A A;  3RVC A;  4HHT A;  3AVF A;  3DOK A;  3CF5 L;  4N41 A;  4LSL A;  1RTJ A;  2FBX A;  1S1T A;  4CJW A;  1QVG M;  5JVH L;  4WFN L;  3ZSV A;  3T7Z A;  3MXJ A;  1RT4 A;  3VQ4 A;  4WQ4 C;  4XEI A;  2FSJ A;  5AQH A;  4LF8 K;  2ASP A;  1X3N A;  2ETJ A;  4BVO A;  3VGL A;  3NGZ A;  1BI4 A;  3L4I A;  2KW4 A;  4FYD A;  2IAJ A;  5BR9 A;  1BI4 B;  3UKR A;  5M1Q A;  3DRR A;  3ZLJ A;  3UKR B;  4KH6 A;  1JCF A;  3NF8 A;  3ZX0 A;  4CF9 A;  4CZJ A;  5CZ1 A;  4LFB K;  4O5F A;  4DV7 K;  2UUB K;  4CF2 A;  1S22 A;  2HHS A;  2DPN A;  4DR2 K;  4MO4 A;  3AA3 A;  2GTD A;  5FRO A;  1KFD A;  2HMP A;  2P9S A;  3UB5 A;  4DLE A;  1LAV A;  4ILH A;  2NRX A;  4DU3 A;  4CGF A;  4ISG A;  3ZSZ A;  1VQN N;  5ELZ A;  5AFU H;  4EP5 A;  3G4S N;  4XH5 A;  1E4F T;  3VN5 A;  4FJ7 A;  1JLA A;  4FSV A;  2A1S A;  2G8F A;  2P9N A;  2EWS A;  3K5N A;  4IXC A;  2P9I A;  3OJU A;  4B9T A;  1BCO A;  4B9N A;  3T69 A;  5GAH P;  3M3Z A;  2QWO A;  5AR0 A;  1VQ7 N;  3NF6 A;  4M3W A;  4CHY A;  1EXQ A;  3OYH A;  4M3Y A;  4CJ4 A;  4E3S A;  2G8W A;  4DR6 K;  1EET A;  1BQN A;  3S3O A;  3RSE A;  5KGX A;  2HVH A;  3P39 A;  2W6L A;  4X62 K;  4CK1 A;  1X9W A;  3DXK B;  3OTO K;  3WT0 A;  5E41 A;  2QWP A;  4CK2 A;  4M3T A;  4X64 K;  3MCP A;  2RHK A;  3AAP A;  4DQQ A;  3NMU A;  4IO8 A;  4BWM A;  1KLN A;  1HQE A;  3EEQ A;  1EX4 A;  1WLJ A;  3T1H K;  4CBW A;  3AVN A;  4CJ7 A;  4FL9 A;  1ESV A;  1J5O A;  2VG5 A;  4M41 A;  4CFC A;  4KV8 A;  1J5E K;  5IWA K;  5HLF A;  1NK5 A;  1TKT A;  4BRO A;  5C15 A;  4BRF A;  4Z94 A;  2YNI A;  4BRM A;  1I39 A;  3SUO A;  4U67 L;  3LDN A;  5A2Q O;  1EO1 A;  2Q2R A;  4FJK A;  4JYA K;  3DXM A;  4CHZ A;  5KPT A;  1SL1 A;  3MMV A;  3SAF A;  3DXM B;  4BC4 A;  1ZYQ A;  1CZ9 A;  3TAF A;  1MU2 A;  4JKE A;  3SBT A;  3TSQ A;  3HBT A;  2GX9 A;  4E7K A;  1S72 N;  1WSJ A;  4BR9 A;  1MWM A;  2UXD K;  3CJ7 A;  3VQD A;  3CFR A;  4GV3 A;  1KAZ A;  4CFD A;  3HTV A;  4CZH A;  3GBT A;  1LOT B;  3H6E A;  3L6Q A;  4LH4 A;  3DWL A;  3LPT A;  1N8R O;  3VEW A;  3EE9 A;  3VF4 A;  1TK0 A;  1KAY A;  3VQE A;  1IBK K;  4CBU A;  4I6M B;  4CK3 A;  1D4X A;  4PKI A;  4BGB A;  4Z4I A;  3HM9 A;  3F73 A;  1NJI O;  3B8A X;  4CEO A;  3D0P A;  2VYP A;  4KFB A;  3ZSY A;  4CJU A;  4BDZ A;  4GW6 A;  1X9M A;  1SV5 A;  2D0A A;  5DMR A;  4A2B A;  3SBG A;  1BIU A;  3OYI A;  1N5Y A;  2Q97 A;  4KHU A;  2KFN A;  5KPR A;  4BQZ A;  1JCE A;  3MAQ A;  1OH5 A;  2ATQ A;  4AM7 A;  4JRP A;  3CET A;  4XH1 A;  1KVB A;  4HVJ A;  1EWQ A;  3MN6 A;  4H0X B;  3SJH A;  3A5N C;  4IBN A;  4W5Q A;  3CJA A;  4KHY A;  2KZM A;  1W2B M;  2QXL A;  5C0Y A;  3RMB A;  4YFU A;  1S9G A;  3TAE A;  4FM2 A;  4FWO A;  1RBV A;  4CIF A;  1NGA A;  4DTX A;  4GKK K;  1S1U A;  4ID1 A;  4JKG A;  4H0P A;  2FSK A;  4BR2 A;  3MN7 A;  4JKG B;  4CJL A;  3MN5 A;  4K8Z A;  3GOI A;  2A40 A;  2W6K A;  4JKD A;  1KVA A;  1ZBU A;  5AQX A;  1HLU A;  1BA0 A;  3ZSW A;  4KI4 A;  4FZX C;  2Q0U A;  4DQI A;  1KQS M;  4DS4 A;  2E88 A;  3AO2 A;  1JLF A;  2BAN A;  4M45 A;  1OVY A;  1QQN A;  3CHW A;  1NWK A;  1JLQ A;  4KKO A;  1HNI A;  3HVT A;  4CZL A;  2X74 A;  4DHY A;  3PIP L;  3LWM A;  3RR8 A;  3OYC A;  1JL1 A;  4E1M A;  2Y1I A;  4FWL A;  4IDK A;  4JKB A;  4Y1C A;  3QEX A;  1YVU A;  2IVN A;  3AO3 A;  3OBW A;  4F2R A;  3QML A;  4Z0U A;  2IDO A;  3UE5 A;  3PY8 A;  1C0U A;  3HM8 A;  3THY A;  4IJA A;  4DTU A;  3SMS A;  2QKB A;  3CD6 N;  1FK9 A;  3CIP A;  3DLH A;  3MWT A;  3CQ8 A;  4CFA A;  2A1R A;  3LDP A;  4FLU A;  1BCM A;  4HUF A;  1L3U A;  3C0B A;  1TVR A;  2W40 A;  1KXP A;  3QFU A;  4YOU A;  2F8S A;  3SUN A;  1J6Z A;  2CGL A;  2XY7 A;  2D0P A;  2RF2 A;  3TTF A;  4LF7 K;  2JWL A;  2YJE A;  4NYF A;  3SK3 A;  1LV5 A;  4RW7 A;  3SYZ A;  4AHC A;  5KGW A;  3MXI A;  2ZGY A;  4YOR A;  4WYB A;  3OYA A;  3SCX A;  1BO5 O; 
#chains in the Genus database with same CATH homology
 1C1A A;  4I9L A;  3PX0 A;  2HHT A;  1ASW A;  4WE1 A;  2F96 A;  1X1P A;  1Y97 A;  3D45 A;  1RDA A;  4AHR A;  3LAM A;  1RDB A;  4CF0 A;  4BE0 A;  4DTJ A;  3MXM A;  1IKW A;  1BGX T;  3E01 A;  1D8Y A;  4DSE A;  3ZT2 A;  4JRQ A;  3ZT1 A;  1LWE A;  1S6Q A;  1LAW A;  1EP4 A;  4I2Q A;  2YNF A;  4CHP A;  4PA1 A;  3RMC A;  1RIL A;  2KTQ A;  4GVM A;  4B08 A;  3KK2 A;  3QEW A;  1U45 A;  1SL2 A;  2B5J A;  3VQ6 A;  1C6V A;  1VRT A;  4CGJ A;  2ZE2 A;  1WSG A;  1LWC A;  3KD1 E;  1VSE A;  3CM6 A;  4CEE A;  3G0Z A;  2Q3S A;  3V9W A;  2HNY A;  1LWF A;  2Z1I A;  2D0C A;  4NYN A;  4I9Q A;  4QCL A;  4DSI A;  3NH2 A;  3ASM A;  4NCA A;  4LD0 A;  1UA0 A;  4DTN A;  1U4B A;  3LP0 A;  4FJJ A;  1EKE A;  4N47 A;  3KIO A;  4IFY A;  3QEP A;  1JL2 A;  3WNF A;  1IKV A;  3IG1 A;  5I42 A;  3OYL A;  4DLG A;  4B3O A;  3SZ2 A;  3SV4 A;  1JLC A;  3V9X A;  1QSL A;  3ALY A;  4DQS A;  2Y1J A;  4DU4 A;  1RBR A;  3KLF A;  3U6F A;  1KVC A;  1VSK A;  1N6Q A;  3TI0 A;  5CYM A;  3L2U A;  1TKZ A;  1TL3 A;  1RT7 A;  3AO5 A;  3AA5 X;  4W5O A;  3KK3 A;  2PYL A;  3K5O A;  1RBT A;  1QTM A;  5FRN A;  5FDL A;  4HCC A;  4KHW A;  3KK1 A;  4JS4 A;  3L2W A;  4FM0 A;  4DQP A;  1CLQ A;  3WNH A;  3OJS A;  4NCG A;  2RKI A;  5SWM A;  3OS2 A;  3TAQ A;  4CEZ A;  5HRP A;  4OLB A;  4FW2 A;  3DRP A;  3HVR A;  3V9Z A;  1SKW A;  4DSK A;  2HW3 A;  1JLE A;  3CM5 A;  4O55 A;  4CJS A;  2G8V A;  1VSM A;  3LAL A;  4CJV A;  4E0D A;  4KHQ A;  3HYF A;  1CXU A;  4FCY A;  1L3V A;  1SUQ A;  3AVJ A;  1YTU A;  3T1A A;  1Q9Y A;  4FLV A;  4DG1 A;  1BQM A;  1I3A A;  1S5J A;  4CJ5 A;  3VA3 A;  2P1J A;  1HYZ A;  3C6T A;  1D5A A;  2EX3 A;  3DM2 A;  2G8I A;  5EU7 A;  3VQQ A;  3MEC A;  1NJZ A;  4DTS A;  1U48 A;  4O5B A;  3V4I A;  1DLO A;  1Z26 A;  3L2R A;  1T7P A;  4K8X A;  1QQC A;  1NKB A;  4Z4C A;  1S6P A;  4RW4 A;  5JS2 A;  3OS1 A;  2XHB A;  4ELU A;  4FJN A;  2OZM A;  1SL0 A;  4DSL A;  2HND A;  4FLX A;  3OYB A;  3THV A;  1NJY A;  4FZY A;  4FLW A;  4AIL C;  2P5O A;  4E89 A;  4Z4E A;  2HHV A;  4CJP A;  3TWH A;  1NKC A;  4C8L A;  1C1B A;  4HCB A;  3KKR A;  2I5J A;  3AA4 A;  5HRR A;  2G8U A;  3K59 A;  2BGG A;  3PUF A;  4DU1 A;  3SQ0 A;  1FXX A;  3DI6 A;  3OYF A;  3I0S A;  4Z4H A;  4I7F A;  3HST B;  3NAE A;  3B6P A;  3UIQ A;  1LW0 A;  2DY4 A;  4J2A A;  4CFB A;  3DLG A;  4G1Q A;  4RW9 A;  4M42 A;  2O4I A;  2DFF A;  3EY1 A;  4C8K A;  1F21 A;  4ID5 A;  3TAB A;  2YKM A;  1KCF A;  1B9F A;  1WN7 A;  2DFE A;  2P51 A;  3QLH A;  1RCH A;  1VSF A;  3KTQ A;  3C94 A;  2QXF A;  3VQ5 A;  1NJX A;  1D9D A;  3P83 D;  4HUE A;  3AVB A;  4KPY A;  4CED A;  4F4K A;  4PQU A;  3L3V A;  1VSL A;  4JS5 A;  3JSM A;  5I3U A;  1NK0 A;  2QK9 A;  1T03 A;  1WSE A;  3OY9 A;  3V1Q A;  1REV A;  1NOY A;  4BE1 A;  4NCB A;  4CF8 A;  3HXM A;  3ZSR A;  3JYT A;  1L3S A;  3AVM A;  2IOC A;  3WNG A;  1WNS A;  1FKP A;  1HYV A;  2G8H A;  3O4N A;  3ZSQ A;  5HRS A;  1WAF A;  3V81 A;  4PWD A;  1T8E A;  3K5L A;  3G10 A;  5HBM A;  1NK8 A;  4EZ9 A;  3KLE A;  2XY6 A;  1VRU A;  5C42 A;  3NHG A;  4AHV A;  3O3G A;  4M3U A;  3ZSO A;  4O44 A;  3TAG A;  3AVC A;  1HQU A;  1HRH A;  2XO7 A;  4CGH A;  4FLT A;  3KJV A;  2VWJ A;  5FRM A;  3LP2 A;  4RG8 A;  3M8P A;  3K57 A;  3HP9 A;  4L8R B;  4BWJ A;  3QER A;  2XY8 A;  2LSN A;  4HHT A;  3AVF A;  1J5O A;  4B9S A;  4KAZ A;  2FBT A;  3C95 A;  3DOK A;  3KLI A;  4N41 A;  3SPY A;  1J54 A;  1RTJ A;  4LSL A;  2FBX A;  1S1T A;  4CJW A;  1U49 A;  5KTQ A;  1NK6 A;  2G8K A;  2F8T A;  3ZSV A;  2XY5 A;  4DWI A;  1UAX A;  3MXJ A;  1RT4 A;  3VQ4 A;  3HK2 A;  1CXQ A;  3AVI A;  1BHL A;  1BL3 A;  3S3N A;  2Z1H A;  5HRN A;  2YV0 X;  3VQ9 A;  2ETJ A;  3SI6 A;  4TSX A;  1TGO A;  4OVL A;  3O3F A;  3RMD A;  4GMJ B;  3NGZ A;  4DTO A;  4H8K A;  3VQP A;  1TKD A;  1BI4 A;  3T19 A;  4CJF A;  2KW4 A;  4FJI A;  4FYD A;  2IAJ A;  2AJQ A;  1BI4 B;  1T05 A;  4M3Z A;  3SV3 A;  2JLE A;  1A5V A;  3DRR A;  5CZ2 A;  3VA0 A;  3RWU A;  1HYS A;  3M8R A;  2HHQ A;  4W5N A;  2GBZ A;  1KLM A;  1KTQ A;  3NF8 A;  4CF9 A;  4Z4G A;  5CZ1 A;  4DTM A;  1HNV A;  3C6U A;  3MED A;  2PY5 A;  4DFK A;  3PX6 A;  4CF2 A;  2E6M A;  1UWB A;  1WSF A;  5J2Q A;  2HHS A;  4FJG A;  3NGI A;  3DYA A;  1HMV A;  3AVG A;  3EZ5 A;  4N76 A;  3AA3 A;  3O4Q A;  5FRO A;  3BGR A;  1KFD A;  1QE1 A;  1RBS A;  2KQ2 A;  3WNE A;  4CJQ A;  3TAP A;  1R0A A;  5C24 A;  4DLE A;  2D5R A;  3S9H A;  1LAV A;  4JLH A;  4DU3 A;  4CGF A;  3ZSZ A;  1GOB A;  1IKX A;  3LZI A;  1RT1 A;  4CGG A;  5K14 A;  2B4J A;  4EP5 A;  5KRS A;  3RRG A;  3VN5 A;  4KO0 A;  4FJ7 A;  1JLA A;  2O4G A;  4CGI A;  1KSP A;  2GV9 A;  3IRX A;  2A1S A;  2G8F A;  3K5N A;  4CJT A;  3TR8 A;  2R7Y A;  3QNO A;  4C8N A;  4M3X A;  3OJU A;  1FKO A;  4CEB A;  4B9T A;  1BCO A;  2ITG A;  3OVN A;  4B9N A;  2KFZ A;  3NDK A;  3AVH A;  3SUP A;  3AVL A;  3IS9 A;  2E4L A;  1KFS A;  1BIZ A;  3KLG A;  2HB5 A;  2IS3 A;  3NF6 A;  3EYZ A;  3SQ4 A;  4M3W A;  1XHZ A;  4DQR A;  4CEC A;  4CHY A;  1EXQ A;  3OYH A;  5J2N A;  4M3Y A;  1W0H A;  4MQ3 A;  4CJ4 A;  3HPO A;  4CHN A;  1B92 A;  4E3S A;  2G8W A;  4KRF A;  1EET A;  1BQN A;  3S3O A;  3NCI A;  3H08 A;  5KGX A;  1K6Y A;  4W5R A;  2W42 A;  4J2E A;  2HVH A;  1RBU A;  2HHU A;  4CK1 A;  2RN2 A;  1JLG A;  1C0M A;  2WON A;  1U47 A;  1JXB A;  1X9W A;  4IFV A;  4OJR A;  4J2B A;  4BDP A;  3T3F A;  4CEF A;  4CF1 A;  1ZBF A;  5E41 A;  3LP1 A;  2X78 A;  3O3H A;  4CJE A;  3L2V A;  4Y1D A;  5C25 A;  5HRO A;  3SPZ A;  3DLK A;  3HPH A;  3A2F A;  4CIG A;  3LAK A;  4DFJ A;  2BDP A;  4O0I A;  4CK2 A;  4M3T A;  4CHO A;  3QIO A;  1QSY A;  4B9M A;  2Z1J A;  3QES A;  2D0B A;  4FZZ A;  4DQQ A;  4ZTJ A;  3ISN C;  4DMN A;  2PZS A;  4BWM A;  4RW8 A;  4OGE A;  1KLN A;  1ZBI A;  1ASV A;  2IGI A;  1HQE A;  2HNZ A;  1EX4 A;  4O4G A;  1QSS A;  1WLJ A;  3RR7 A;  3AVK A;  4KTZ A;  3AVN A;  4I2P A;  3NGY A;  4N5S A;  1NK4 A;  4E7J A;  2FC0 A;  2VG5 A;  4M41 A;  4CFC A;  3OYG A;  3V9S A;  4KV8 A;  4ZTF A;  1SKR A;  3HO1 A;  4KB1 A;  1RT6 A;  4LSN A;  2X6S A;  1Z25 A;  2B6A A;  4OKE A;  5HLF A;  1NK5 A;  2VG7 A;  1IH7 A;  4CJ3 A;  4ZHR A;  3SQ1 A;  1TKT A;  1NKE A;  2YNI A;  3FFI A;  1I39 A;  4DSF A;  4AHS A;  3SUO A;  1G15 A;  2VWK A;  3CFP A;  4F2S A;  1LW2 A;  4QOZ B;  2FBY A;  3AA2 A;  2OA8 A;  4FJM A;  3PV8 A;  1NK7 A;  3TAM A;  4CE9 A;  4E19 A;  4FJK A;  3HL8 A;  3DOL A;  1TK8 A;  4CHZ A;  2KZZ A;  2HHW A;  1HPZ A;  3VQ8 A;  1SL1 A;  4LY7 A;  4B9V A;  4B9U A;  4FJ9 A;  5CYQ A;  1ZYQ A;  3PO5 A;  3S3M A;  4F8R A;  1CZ9 A;  4DF4 A;  3TAF A;  1DTQ A;  1XI1 A;  4F3O A;  1MU2 A;  3V1R A;  1QHT A;  3B6O A;  4XIU A;  4CEA A;  1WAJ A;  4E7K A;  1L3T A;  1RTD A;  4UQG A;  5J2P A;  3LZJ A;  3I8D A;  1WSJ A;  3RMA A;  1ITG A;  3AVA A;  3OYK A;  1UA1 A;  1YTA A;  3CG7 A;  4KHS A;  3OYN A;  1RTI A;  1U04 A;  3VQD A;  3CFR A;  2DTU A;  4C8O A;  4ELT A;  3ULD A;  1C1C A;  2YNG A;  4CFD A;  3TAR A;  1IO2 A;  3NH0 A;  3V6D A;  4F3T A;  3NBP A;  4H4O A;  4FJ5 A;  3V9U A;  4LH4 A;  2BE2 A;  3LPT A;  3ZSX A;  1IKY A;  3HT3 A;  2P5G A;  3NFA A;  1TK0 A;  1J53 A;  3BDP A;  1TAQ A;  4KTQ A;  2YHA A;  3VQE A;  4E1N A;  4CK3 A;  1O1W A;  5KI6 A;  1ZBH A;  4ELV A;  4Z4I A;  3HM9 A;  3F73 A;  2DFH A;  1VSI A;  4IG0 A;  4CIE A;  3CFO A;  4OGC A;  4CEO A;  3K58 A;  3HPG A;  4CES A;  3D0P A;  4BDY A;  1IG9 A;  4KFB A;  3ZSY A;  4CGD A;  4CJU A;  4BDZ A;  4GW6 A;  3SJJ A;  3QO9 A;  2OYQ A;  3U3Y A;  1NK9 A;  2NUB A;  1X9M A;  1JLB A;  1SV5 A;  2D0A A;  5DMR A;  3OYI A;  1N5Y A;  1BIU A;  3ZT3 A;  4E7H A;  3ZT0 A;  3DLR A;  4KHU A;  2KFN A;  4IKF A;  1TAU A;  4FVM A;  3DLB A;  1DTT A;  1UOC A;  3MAQ A;  1TK5 A;  3OS0 A;  3SQ2 A;  4CJR A;  2ATQ A;  4JRP A;  2OPP A;  4J2D A;  3F9K A;  1KVB A;  4FW1 A;  5KRT A;  4HTU A;  4DFP A;  4PY5 A;  4B8C A;  2JGU A;  1TKX A;  3QEI A;  4KI6 A;  4DS5 A;  2Z1G A;  4HVJ A;  3ITH A;  4B8A B;  4BAC A;  1S1V A;  4AHT A;  4FJX A;  1SKS A;  4IBN A;  1RT3 A;  4W5Q A;  4E7L A;  4AHU A;  4KHY A;  1TL1 A;  2KZM A;  1S1X A;  4H4M A;  3CYM A;  3RMB A;  4YFU A;  1S9G A;  4RW6 A;  4FLY A;  3SUQ A;  1NJW A;  3AO1 A;  5SZT A;  3TAE A;  4FM2 A;  4KHN A;  4LH5 A;  4KB0 A;  1RBV A;  4CIF A;  4EP4 A;  4DTX A;  2YNH A;  4FK4 A;  3OYD A;  1S1U A;  4ID1 A;  3RRH A;  3PX4 A;  4FJ8 A;  3VQC A;  2EHG A;  4CJL A;  4HUG A;  3DLE A;  1XHX A;  3DMJ A;  3LP3 A;  4K8Z A;  3K5M A;  3QNN A;  4DSJ A;  3PO4 A;  3VQA A;  1L5U A;  1KVA A;  1ZBU A;  3K2P A;  1J9A A;  3P1G A;  4OKK A;  4O0J A;  5CY4 A;  3QEV A;  4EZ6 A;  5D3G A;  4OKJ A;  4FJH A;  4B9L A;  1B9D A;  1C0T A;  2HVI A;  2HHX A;  1WSH A;  1RT2 A;  3DRS A;  3ZSW A;  4KI4 A;  4FZX C;  4DQI A;  1VSH A;  3M8Q A;  4DS4 A;  3AO4 A;  5JS1 A;  3AO2 A;  3KKS A;  2OPS A;  1JLF A;  2BAN A;  1A5X A;  1XC9 A;  4M45 A;  3QIN A;  3HP6 A;  4Q5V A;  5T7B A;  2IC3 A;  1ASU A;  5J2M A;  4KTW A;  1JLQ A;  1HJR A;  3LDS A;  4KKO A;  1HNI A;  3HVT A;  1VSJ A;  4OLA A;  3RR8 A;  2X74 A;  4YNQ A;  3LWM A;  3V1O A;  3OYJ A;  2FBV A;  4FK0 A;  4CCH A;  1S9E A;  2ZQB A;  3OYC A;  1JL1 A;  4E1M A;  2XRI A;  2YKN A;  2Y1I A;  4FXD A;  3OYE A;  3KLH A;  3RTV A;  1CZB A;  3LAN A;  3P5J A;  4IG3 A;  4IDK A;  3ZT4 A;  4AH9 A;  1NOZ A;  4Y1C A;  3ZCM A;  4FLZ A;  2HMI A;  3AV9 A;  1JKH A;  3TAN A;  5J1E A;  1YVU A;  3MEE A;  1W9H A;  3QEX A;  1KRP A;  3AO3 A;  4F2R A;  2RPI A;  2OPR A;  4C8M A;  2PYJ A;  4Q0B A;  1RT5 A;  3LPU A;  2IDO A;  1GOA A;  4Z0U A;  1GOC A;  1YT3 A;  1C0U A;  3MEG A;  3PY8 A;  1JXE A;  2E6L A;  3L3U A;  4DTU A;  3L8B A;  2QKK A;  4CEQ A;  2X6N A;  4PUO A;  2QKB A;  2ZD1 A;  4CER A;  4DTR A;  1RNH A;  1VK0 A;  4MFB A;  4CHQ A;  3IAY A;  4FK2 A;  1FK9 A;  3NH1 A;  1BIS A;  3DLH A;  4OPJ A;  3CQ8 A;  1Q8I A;  4DF8 A;  3VQB A;  4CFA A;  3SNN A;  2A1R A;  4N56 A;  4BE2 A;  4OPK A;  4FLU A;  1BCM A;  1S1W A;  3OYM A;  3I0R A;  3LWL A;  4HUF A;  4DFM A;  1L3U A;  2OZS A;  1WSI A;  1RDD A;  4DTP A;  1TVR A;  3QIP A;  4KRE A;  3L2Q A;  1Q9X A;  3NE6 A;  3U3G A;  3HJF A;  2F8S A;  5DK5 A;  3NF7 A;  3SUN A;  2GUI A;  1ZBL A;  1A5W A;  4W5T A;  2VG6 A;  1X9S A;  2XY7 A;  1D9F A;  3QET A;  4QAG A;  1TV6 A;  2RF2 A;  1QS4 A;  1XWL A;  4NYF A;  2YHB A;  4FM1 A;  5HP1 A;  1LV5 A;  4RW7 A;  3SYZ A;  4FJL A;  1RDC A;  4AHC A;  1VSD A;  3KD5 E;  3M8S A;  5KGW A;  4E7I A;  4CJK A;  3MXI A;  3NF9 A;  3VQ7 A;  1RTH A;  3OYA A;  2WOM A;  3SCX A;  4R5P A;  4ICL A;  2OPQ A;  4M3R A;  4Z4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...