4CECA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cecA00
1UOCA 4OPKA 4M45A 3MEEA 1CZ9A 1S1WA 4CJEA 4DQQA 3K5NA 3DRRA 1F21A 1C0TA 1S1XA 4E7JA 3VQBA 2LSNA 4CK3A 2HNDA 3RWUA 4FJ7A 1DTTA 1S6QA 4CEAA 4KB0A 1VRTA 4W5QA 3OS1A 4B9TA 1RCHA 1CXQA 2O4GA 3LALA 4RW6A 4CJPA 4B8AB 4XIUA 1SL1A 3V1OA 2KQ2A 1VSKA 4DF4A 4MFBA 1U4BA 4IG0A 5KI6A 4Z4HA 4NCAA 5HLFA 1J53A 4CGGA 4OKEA 3M8PA 3B6OA 4BDPA 2ZE2A 3L8BA 2HHUA 3D45A 3MAQA 2D0CA 4RW4A 1HMVA 2DY4A 3C6TA 1IO2A 3K5OA 1TGOA 1BL3A 4NYFA 4HHTA 4CEOA 2B6AA 3AVLA 1TK8A 3QEIA 2RF2A 2HVHA 3L2RA 4EZ9A 1BI4A 1RDDA 2ZD1A 5HRSA 4YFUA 3ZSYA 4GW6A 4H4OA 4IFVA 4TSXA 4DSKA 5T7BA 4YNQA 4K8ZA 1RT5A 3HPOA 4IDKA 2Y1IA 4F2RA 5HRRA 1WSIA 1WN7A 5E41A 3HVRA 1RDBA 3SJJA 4FJGA 3S3MA 2IGIA 3KLIA 2YHAA 3CFOA 5HROA 2JLEA 3TWHA 2BGGA 1C1BA 4FLVA 4NYNA 2FC0A 1NK9A 1S9EA 2VG6A 3PY8A 1W9HA 3VQEA 3DRPA 4KPYA 2FBYA 3FFIA 1K6YA 3P83D 4W5RA 3OJSA 4DLEA 4DTNA 1Q8IA 1D9FA 1SKRA 2A1SA 2IOCA 3OYNA 1BCOA 1VSDA 4OLAA 3TAMA 3NAEA 4HTUA 2FBVA 4AHTA 3ZCMA 3QEVA 2HB5A 1C0UA 3LDSA 3LP0A 5D3GA 4QCLA 1SL2A 3QESA 4FM2A 3VA3A 2G8FA 2HHTA 3DLEA 3TARA 2GBZA 1TVRA 3ASMA 2ETJA 3RMDA 3MXIA 1N6QA 1S1VA 1QSYA 1SKWA 2QKBA 1QSSA 4ICLA 4DFMA 3VN5A 5FRMA 4KRFA 5HP1A 1VSHA 4EP4A 3VQAA 3F9KA 3KD1E 2AJQA 3TAEA 1TAUA 3SUQA 1LWCA 2YV0X 1SUQA 3K5LA 3OYIA 3AO3A 3T19A 3V9XA 3THVA 3OYGA 5I42A 3K2PA 4Z4GA 2XY5A 4KV8A 3AVKA 1WSHA 3LWMA 1HNVA 5HRPA 3MXMA 1XHXA 4JLHA 3C6UA 4HUEA 3VQCA 1LW2A 2HVIA 4C8NA 4CEFA 1BI4B 3OYMA 3L2QA 1NJYA 4CERA 1J54A 4CIEA 4Z4IA 1YTUA 4HUFA 4FJIA 1JKHA 3PO5A 4O0JA 4I2PA 4N56A 1VK0A 4OKKA 4E19A 4FLXA 1RTHA 4DFKA 3TAFA 4JRQA 1UA1A 1CXUA 3TR8A 4CEDA 1RT2A 4FM1A 3HO1A 4BE2A 4DTMA 5J2QA 4FJJA 2ATQA 3AVMA 3VA0A 2XY7A 3DLRA 4E0DA 1QS4A 4DTUA 3QLHA 3O4QA 1LWEA 4FW2A 3AO1A 4E89A 1X9MA 4OJRA 3HK2A 2JGUA 4EP5A 1VSMA 5CZ1A 4CHOA 4R5PA 3DM2A 4LH5A 1LW0A 3HJFA 4OPJA 3EYZA 3OYHA 4FJXA 3VQ5A 3QO9A 1U49A 1QSLA 4LD0A 2G8VA 1TKXA 3F73A 4KHWA 1IG9A 3BGRA 4M3ZA 2ITGA 5J1EA 5J2NA 4FJLA 4Z0UA 1S9GA 4IFYA 1HPZA 2Z1HA 1D5AA 4EZ6A 4CJQA 1IKVA 1QE1A 1W0HA 4DSJA 3V9ZA 3VQ6A 2X78A 1HYZA 1T8EA 1NKBA 1QQCA 2OPQA 1FKPA 4FK0A 3RMBA 4RW7A 4M3UA 3SUOA 3V9UA 1SL0A 1IKWA 2NUBA 2VWKA 2KTQA 1JLQA 3CM5A 2DFHA 3SUNA 4DTPA 1A5WA 1TKTA 4DSEA 4DTSA 4ELVA 3OYFA 3ZSQA 4B9LA 3CYMA 3PV8A 4CJRA 5SZTA 3LPUA 4O55A 5J2MA 3ZSVA 4CGFA 3JYTA 4CJ3A 3DOKA 1TL3A 3OYCA 4ZTFA 2WOMA 4C8OA 3S3NA 4FJ5A 4KTZA 3NH1A 1TKDA 1LAVA 2XHBA 1KLNA 1JLAA 4ID1A 1VSIA 3ZT2A 1T05A 4FJ8A 3LP2A 1ZBUA 3OYKA 2O4IA 1D8YA 4DS5A 4KHSA 3EZ5A 4CEBA 1TAQA 2P1JA 4GMJB 3TAPA 3KTQA 3K59A 4M3TA 4AH9A 5FROA 5I3UA 1WSEA 2F8TA 4PWDA 1T03A 2F8SA 3AVHA 4DSFA 4KB1A 4Q0BA 3VQQA 1NKCA 2W42A 4FZZA 1I39A 4DU1A 4CEEA 2HW3A 3LANA 2OZMA 4E7LA 1KFDA 3PX0A 2DFEA 4J2AA 4OKJA 1BIZA 4E1MA 4PUOA 3T3FA 2EHGA 4RW8A 3DLKA 4B9VA 2VG5A 1RT7A 1KCFA 4JRPA 1RT6A 1B9DA 3OYAA 3AA3A 4KTWA 4CFAA 3QEWA 4IKFA 4CF0A 2OYQA 4UQGA 1RBRA 1C0MA 3L2UA 4DTOA 3CFRA 4DU4A 4ELTA 2P51A 3AVIA 2D5RA 1JLGA 4CGIA 1RT3A 3ITHA 3ZSWA 3NGZA 1RT1A 3RRGA 2IDOA 2XRIA 2YKNA 3L3UA 4W5NA 3OJUA 1GOAA 5HRNA 4LSLA 4J2EA 4LSNA 2X6SA 4DS4A 3PX6A 2HHWA 5C42A 3SI6A 4CF8A 1NKEA 1KVCA 1VSFA 1L3UA 3QIOA 4B9UA 2OPRA 1NK7A 2DFFA 3OS2A 3NCIA 4FLYA 4JS5A 1A5VA 3HP6A 3G0ZA 4CIFA 3T1AA 4M3XA 2DTUA 4CK2A 4Z4CA 3SV4A 2PZSA 3WNGA 2QKKA 1IH7A 4M3RA 1BHLA 3U6FA 3AVCA 2IAJA 3HP9A 3ALYA 4CJ4A 4OLBA 3H08A 2E6MA 4N5SA 2RN2A 4ZHRA 3OS0A 4IG3A 3QETA 3RR8A 3LZIA 5J2PA 4DTRA 1UA0A 1KRPA 4KHNA 4B9SA 1WSGA 3AVJA 4FK2A 1HNIA 3HXMA 3SQ4A 1A5XA 1NOZA 4AHUA 3KLEA 4E7KA 1ZYQA 1HRHA 4CJKA 4CF9A 4FYDA 4B3OA 4BWJA 2VWJA 1YT3A 4NCGA 2Z1IA 4B9NA 3NGIA 2G8KA 3IG1A 4ID5A 4Y1CA 5CY4A 1S5JA 3ULDA 4DLGA 3A2FA 4KTQA 3AO5A 3SQ0A 1VSLA 3CG7A 2X74A 3DMJA 1XI1A 4B8CA 4J2BA 1REVA 2F96A 1EP4A 1NK4A 3AVGA 2XO7A 5JS2A 4E1NA 1HYSA 1X9SA 4RG8A 1VSEA 4O44A 4DQPA 5KRSA 1L3TA 4QOZB 3PX4A 4CHYA 3C95A 4Q5VA 3SCXA 1ITGA 2WONA 2PYJA 3O3HA 3O3GA 1L3SA 1WLJA 1Y97A 4NCBA 1DLOA 3AVFA 4O5BA 1EETA 4W5TA 3HT3A 3NF9A 4CHPA 3UIQA 4PA1A 3ZT1A 2A1RA 3OYDA 3B6PA 3LP1A 1XC9A 1TL1A 3HSTB 2P5GA 2B4JA 4DSIA 3WNHA 4FXDA 3O3FA 2Y1JA 1HJRA 3LWLA 4FLZA 2FBTA 4MQ3A 1LV5A 4G1QA 4C8MA 1NK5A 1CLQA 3C94A 4KHQA 3HPGA 1T7PA 1U48A 2BDPA 2YHBA 3QNOA 1Q9YA 3NDKA 1FKOA 4DQRA 4HUGA 2OPSA 1NK6A 3KKSA 4CK1A 3ISNC 2RPIA 4DWIA 3AO2A 4CHQA 4B08A 2Q3SA 3SNNA 4BE1A 5DMRA 4FZXC 1NJZA 1TKZA 1WNSA 3AA2A 4DFJA 1I3AA 3DI6A 4CFDA 1JL2A 3CFPA 1L3VA 4M42A 4B9MA 3DOLA 4CE9A 2HNYA 3SQ1A 1B92A 3HVTA 2G8WA 3M8RA 3ZSRA 3TI0A 1U04A 4CJLA 3O4NA 1ZBHA 3RMAA 1L5UA 3L2WA 3EY1A 2HMIA 1HQUA 4M41A 4CJWA 1J5OA 4LH4A 3CM6A 4Y1DA 3WNEA 1SKSA 1ASVA 2YKMA 4FJ9A 2KZMA 3KLGA 5FDLA 4CIGA 3L2VA 3NHGA 2IC3A 1O1WA 3VQDA 1RDCA 2HHVA 2OZSA 3I0RA 1JLFA 4FJNA 3V9SA 3P1GA 4AILC 2GUIA 4O0IA 3AA5X 4H4MA 3V4IA 3OVNA 1NK0A 3IAYA 3OY9A 4OVLA 3SPYA 3HYFA 1WAJA 4BDZA 4DTJA 4DU3A 1WAFA 1FK9A 4FJMA 3NFAA 5KTQA 2YNIA 4E7HA 4DQSA 4E3SA 3AVBA 3QIPA 3ZSXA 4F8RA 2YNHA 3M8QA 4CF2A 3VQ4A 1C1AA 3AVNA 5CYMA 4DMNA 4F3OA 1EX4A 1Q9XA 2OPPA 3AV9A 3IRXA 2FBXA 1HQEA 4FW1A 4H8KA 3LZJA 2KW4A 4N41A 2XY8A 5KRTA 4CJ5A 1JL1A 4K8XA 4KI4A 3ZT0A 3BDPA 2E6LA 1C1CA 2RKIA 1RBSA 2YNFA 1NK8A 4HCBA 3S9HA 3PUFA 1NJWA 4Z4EA 2HHQA 3K58A 1B9FA 4CHNA 3KKRA 3DLGA 4PQUA 2GV9A 3RRHA 1YVUA 2P5OA 3OYJA 5K14A 4OGCA 3U3GA 4CECA 3SZ2A 3LP3A 3QNNA 1RTDA 4LY7A 3MEGA 2HHSA 2D0BA 3U3YA 4AHCA 1VRUA 5C24A 4AHRA 4CJUA 3D0PA 1U45A 1BCMA 1JLCA 4RW9A 1TK0A 3RR7A 3NF8A 4L8RB 3QEXA 3P5JA 3SUPA 2VG7A 1TK5A 1D9DA 3QERA 2Z1GA 3HPHA 3OYEA 2I5JA 4KHUA 1J9AA 3OYBA 3NF7A 2B5JA 4KO0A 2QK9A 1RILA 1BQNA 4FCYA 2G8HA 4I9QA 3V1QA 4FLWA 2KFZA 1ZBLA 5JS1A 1QHTA 4FVMA 3VQ8A 4CJVA 3SPZA 1RDAA 1R0AA 1RNHA 3TANA 3NH2A 2PY5A 4F2SA 2G8IA 5CYQA 1UAXA 1IKYA 4M3WA 4DSLA 4CJSA 3AVAA 1ASUA 3VQ9A 1HYVA 3PO4A 1S1UA 4F4KA 3AO4A 4KKOA 1UWBA 3HM9A 4FM0A 2QXFA 4CF1A 3VQ7A 4CEQA 3L3VA 4I9LA 1KTQA 4OGEA 4BACA 4BE0A 3SYZA 2KZZA 3IS9A 3QEPA 3JSMA 4J2DA 4GVMA 4CFBA 3K5MA 1WSJA 4CESA 4W5OA 3NH0A 3V9WA 4KFBA 4WE1A 3V81A 4ZTJA 4Z4FA 4E7IA 1KFSA 5CZ2A 3I8DA 3CQ8A 3TAGA 1QTMA 3MXJA 5KGXA 4F3TA 3AA4A 1N5YA 3TABA 1KVAA 3KK2A 4KI6A 2BANA 3QINA 2R7YA 1G15A 3NBPA 4KAZA 3NF6A 4QAGA 2IS3A 1XWLA 4HCCA 3RMCA 3I0SA 1IKXA 3KLFA 4M3YA 1ZBFA 3G10A 1X9WA 1RTJA 1LAWA 2EX3A 3V1RA 1BQMA 1BIUA 3K57A 4FK4A 3LAKA 1RBTA 4CHZA 3ZSOA 1EKEA 3KIOA 4CJFA 3ZT4A 3ZSZA 4CJTA 4DTXA 1GOBA 1BISA 3TAQA 1FXXA 5SWMA 1EXQA 4I2QA 4N47A 4IBNA 4JS4A 4FLTA 2X6NA 3DRSA 3S3OA 4CEZA 1RBUA 4O4GA 1JXBA 2YNGA 4FJKA 1X1PA 1RT4A 4CGJA 1ASWA 3OYLA 3HL8A 4I7FA 3E01A 4AHSA 2PYLA 4KHYA 2KFNA 3MEDA 4C8LA 5HBMA 1KVBA 1C6VA 4DF8A 2D0AA 4HVJA 2G8UA 4FLUA 1MU2A 1NOYA 1LWFA 5KGWA 1NJXA 3ZT3A 1JLEA 1RTIA 3KJVA 4CGHA 1RBVA 4CFCA 3KK3A 4C8KA 4CCHA 1TV6A 1S6PA 3MECA 1WSFA 4BWMA 1SV5A 4CGDA 5DK5A 3RTVA 1KLMA 3V6DA 2ZQBA 3WNFA 1KSPA 2XY6A 4DG1A 5EU7A 4PY5A 5C25A 4DFPA 3LAMA 4AHVA 1XHZA 1DTQA 3SQ2A 1JXEA 1U47A 2HNZA 1ZBIA 3DLHA 2BE2A 4N76A 3M8SA 3KLHA 3NGYA 4DQIA 3DLBA 4KREA 2Z1JA 4FZYA 3DYAA 1S1TA 2E4LA 3KD5E 3VQPA 2OA8A 4ELUA 1Z25A 3NE6A 4FJHA 3SV3A 5FRNA 1CZBA 3LPTA 1VSJA 4BDYA 1GOCA 1Z26A 3KK1A 1YTAA 1JLBA 2HHXA 1BGXT
chains in the Genus database with same CATH superfamily
1S1XA 3VQBA 2HNDA 3RWUA 3CXCM 4W5QA 2I7NA 1RCHA 1SL1A 4B8AB 3V1OA 2Q0RA 3QFUA 4IG0A 4NCAA 4CGGA 4BDPA 2HHUA 3MAQA 5BPLA 2DY4A 3FZLA 4DB3A 1TGOA 1BL3A 1ATSA 4NYFA 1M1KO 3SK3A 4HHTA 3CCJN 2RF2A 5HRSA 2ZD1A 4B3MK 4DR5K 4H4OA 3TSQA 4F2RA 2YCHA 1RDBA 4FJGA 2IGIA 2BGGA 1ILYA 2YX6A 4IZ9A 2FC0A 2HF4A 5H1SQ 1WBBA 3SBTA 3MCPA 3DXKA 1K6YA 3OJSA 4DR2K 1NBWA 4OLAA 3CCLN 2UXDK 2QWQA 3CCSN 1P8ZA 2F7TA 4AHTA 4BQZA 3LDSA 4WQ5A 5A2QO 5KQDA 4FM2A 3DLEA 3ASMA 4PL8A 3RMDA 3MXIA 4O8UA 1S1VA 3THYA 4DFMA 4JKGA 3VN5A 3VEYA 4EP4A 3F9KA 3KD1E 3ZLJA 3TAEA 1TAUA 3SUQA 1BO5O 2FF6A 1LWCA 1SUQA 4AQYK 3AO3A 3AVKA 4WFBL 1WSHA 2VQEK 1HNVA 1XHXA 4JLHA 1LW2A 4Z4IA 4CERA 1J54A 3EO3A 4CIEA 1YTUA 1NG9A 4O0JA 4I2PA 4CZLA 4BROA 4HTLA 1MA9B 4DFKA 4JRQA 1BOTO 3HO1A 4DTMA 3E1YA 5FLXO 4E0DA 5F2RA 1QS4A 4BRHA 3AGRA 3AO1A 1OKJA 2QW9A 1VSMA 4CHOA 1LW0A 2ZJRL 4OPJA 2O8BB 4FJXA 1QSLA 3QO9A 4FSVA 1GLLO 3W0LA 4BQLA 1S9GA 1BA0A 3VMFB 2QXLA 1QQCA 4RW7A 2YHWA 3WT0A 4FWRA 3V9UA 5GADP 1IKWA 2CGKA 2NUBA 2VWKA 4DV2K 1A5WA 3L6QA 3OYFA 4CJRA 2J4RA 3LPUA 4O55A 3JYTA 4CJ3A 1TL3A 2HHHK 4FO0A 1OH5A 4C8OA 4IXCA 4KTZA 3NH1A 2FSJA 3P31A 2XHBA 3FZHA 1ZBSA 1T05A 3OYKA 3C6AA 4XH4A 4DS5A 3BUZB 5KPRA 4X62K 3TAPA 4AH9A 4DSFA 4JV5K 4DHYA 3THYB 3UE5A 3DWLA 2DFEA 4WFNL 4OKJA 1QQNA 1BIZA 3E9PA 4PUOA 3O1BA 4MDBA 3DLKA 2ZF5O 3QEWA 3C7NA 4CF0A 3AY9A 2ZJQL 1RBRA 4AF1A 2P51A 4ISFA 4CGIA 1RT3A 3ITHA 1K8AO 3RRGA 2IDOA 3OJUA 4J2EA 1XNQK 2HHWA 5C42A 1YIJN 3WUHA 1VSFA 3NMUA 2OPRA 3KZBA 1VQNN 1A5VA 3BF1A 4FWNA 1X9JA 4CIFA 4M3XA 2O8FA 3JS6A 4X65K 3CCMN 3SV4A 5DM7L 2YJEA 1IH7A 4IEIA 1IV0A 2YI1A 2O8BA 4JKGB 4LF9K 1N33K 5J2PA 1SZ2A 4WQ5C 5BPNA 3VF6A 4KHNA 4O5FA 4B9SA 4FK2A 3VF4A 3THWB 4DV1K 4H5VA 1OH7A 4CF9A 1U2VA 4BWJA 4NCGA 4B9NA 1HNZK 4JKAA 1WUAA 5CY4A 2QWNA 3ULDA 4DLGA 3H3OB 3AO5A 3SQ0A 3DMJA 4KHPK 5EX5A 4IEEA 3KWIA 2XO7A 5JS2A 1HYSA 2VYPA 5I9EB 1Q18A 4CVNE 1ITGA 1TUYA 3C6HA 3O3HA 3O3GA 4B3TK 1DLOA 3HT3A 3ZT1A 2A1RA 3B6PA 1TL1A 3WNHA 2A5XA 2BTFA 3LWLA 1LV5A 4C8MA 5BRFA 3CCEN 4BRQA 2QM1A 2BDPA 2BUPA 3DXMA 3QNOA 3NDKA 1YITN 2OPSA 4DWIA 4JEPA 4YOVA 1NJZA 5KPZA 4BR0A 3CPEA 4H0PA 1JL2A 2A40A 5CE3A 1L3VA 4M42A 4YOXA 4CZJA 4CE9A 2HNYA 2G8WA 4IJAA 3M8RA 3CJ7A 5CR4A 4FWMA 3RMAA 1L5UA 3EY1A 4CJWA 1J5OA 3T7ZA 1HUXA 3J7YP 3KLGA 4WF9L 4JI0K 3UB5A 3J80O 3QBXA 3R3LA 3I0RA 3CQXA 2O8EB 4IDHA 3V4IA 4V19S 4K42A 3OY9A 4B1UB 3HYFA 3HZ6A 5C2FA 4EHUA 1WAFA 2CH6A 1O13A 2OTJN 3NFAA 5KTQA 3ENOA 3ZSXA 3QIPA 3VGMA 2PAVA 4F3OA 4OO1J 1Q9XA 2OPPA 3G25A 2FBXA 4H8KA 3LZJA 2KW4A 4DR1K 4N41A 3QBWA 4WQ4A 1EWQA 3AAPA 2YNFA 1NGIA 4HCBA 3ZX2A 3PUFA 4Z4EA 1X3MA 2IVNA 2HHQA 3CD6N 3DLGA 3ENHA 3N4PA 4CZGA 1YVUA 5LJWA 4U7BA 3OYJA 5K14A 1NMNA 4MDAA 4CECA 4DQ8A 1VQ8N 3H45C 1RTDA 2NZTA 5C12A 4CW7B 1T44A 3U3YA 4AHCA 4CJUA 3D0PA 1U45A 4RW9A 4R79A 3FE1A 4L8RB 3MCAB 3QEXA 2PFUA 1D9DA 3P38A 3OYEA 3M3ZA 2B5JA 4BREA 2G8HA 4I9QA 3V1QA 3D6RA 1ZBLA 4FVMA 2P9SB 1R0AA 1RNHA 2W41A 3FR0A 2PY5A 4F2SA 3ZYYX 5JICA 4DV4K 5C15A 4BC5A 3AVAA 1ASUA 2Q31A 2QXFA 3VQ7A 4BACA 3L3VA 4I9LA 4OGEA 2NLXA 3IS9A 3T69A 1OH6A 3M5RA 4CESA 4ZTJA 4ISGA 2ZJPL 3WXIA 3I8DA 3CQ8A 2E5LK 1HKCA 1VQPN 3TABA 3D2EB 1LCUA 3JXUA 2R7YA 4AM7A 5M1OA 1G15A 3NF6A 4QAGA 1XWLA 3I0SA 3G10A 1RTJA 4B1ZA 1LAWA 3BZCA 3EKUA 3K57A 2O8EA 1RBTA 1ZXOA 3G6EN 3ZSOA 1EKEA 4DTXA 1GOBA 5SWMA 1EXQA 1XMOK 2X6NA 1RBUA 4FWSA 1JXBA 4DV0K 2YNGA 3CC7N 4A5BA 1W7AA 2KFNA 1BDGA 3ZX0A 1Y64A 1C6VA 3TSPA 2D0AA 4HVJA 4DF8A 1MU2A 1NJXA 4YOTA 4J8FA 3VTHA 3KK3A 2UUCK 4BWMA 1S6PA 4CGDA 1SV5A 3RTVA 5DK5A 1TUUA 2O8DB 4DG1A 2YHYA 3MWTA 1Z05A 4DFPA 1XHZA 2HNZA 3DLHA 3KLHA 4KREA 2Z1JA 4FZYA 3HRGA 4BRNA 3SV3A 3LPTA 4Y1CA 1Z26A 2HHXA 1BGXT 1S1WA 4CJEA 3A5LC 2O8DA 5BN8A 1S6QA 4KB0A 1VRTA 4CJPA 3LALA 2KQ2A 3O9RA 1VSKA 4MFBA 1YJ9N 5KI6A 4Z4HA 4BR4A 4JKDA 3M8PA 3SAGA 2YJFA 2ZE2A 3VERA 2HMPA 4RW4A 4XH5A 3C6TA 1ZC6A 5CHIA 4BR7A 4CEOA 1NU0A 3AVLA 1TK8A 1BI4A 4YFUA 4DSKA 4FWKA 4YNQA 1RT5A 3HPOA 1DT9A 3FFKB 3HVRA 4LFBK 2D0OA 4IJNA 4K25A 1NGHA 3CFOA 1N34K 2JLEA 3TWHA 1C1BA 4FLVA 4NYNA 3R9PA 1NK9A 2VG6A 5AR0A 4KPYA 2FBYA 4DTNA 1D9FA 4JHDA 2UU9K 1SKRA 2A1SA 1BCOA 1VSDA 5AQRA 4HTUA 1Q81O 3F9MA 3LP0A 3O8MA 2EWSA 2OANA 4DR6K 4BR5A 3TARA 2GBZA 1N6QA 4FL9A 3VEXA 3CC2N 1VSHA 1VQ5N 4BRKA 2YV0X 2UXCK 5HL7L 3OYGA 4KV8A 1G99A 4KH5A 1W97L 5HRPA 4CZFA 1ATNA 4WCEL 5E84A 4Y0WA 2HVIA 1XC3A 4CEFA 1BI4B 1NJYA 1T3VA 4HUFA 2BH1A 3PO5A 3CJ9A 4BRAA 1RTHA 3HBTA 4CEDA 4BE2A 4FJJA 3AVMA 3VA0A 1YUWA 4NXMK 4OJRA 5BR9A 4JHDB 4YY3K 3DM2A 3EYZA 3VQ5A 3WQUA 1U49A 1VQ4N 3D2FB 3F73A 4KHWA 5J1EA 4PKGA 5J2NA 3RSEB 5MLCQ 1HPZA 3E9OA 4KH6A 4EZ6A 1QE1A 5AQHA 3V9ZA 5AQPA 3CCQN 1HYZA 1NKBA 4M3UA 3SUOA 1SL0A 3I33A 3SUNA 1TKTA 4DSEA 4DTSA 2F9WA 3CYMA 4I6MA 3PV8A 5SZTA 3S3NA 1GLCG 1JLAA 1VSIA 1ZBUA 4CD1A 4ILHA 5I3UA 3O5BA 3EE9A 1NKCA 2ITMA 3LANA 4LF4K 4E7LA 1KFDA 3PX0A 3FZMA 1E3MA 3T3FA 2EHGA 3GL1A 4BRFA 1KCFA 3G4SN 4UQGA 2P9LA 3L2UA 4DTOA 3DLLL 4DU4A 1YF5L 3HI0A 4JAXA 3VEVA 3VEOA 4JI8K 2IIRA 1QZ6A 4BY9C 4LSLA 1IG8A 4LSNA 5ADXA 3SI6A 1L3UA 4B9UA 3QIOA 1NK7A 3OS2A 3NCIA 4FLYA 4JS5A 1KAYA 3HP6A 3G0ZA 4CK2A 3G71N 3H46O 2UXBK 2NRWA 3U6FA 2IAJA 3W3DA 3GE1A 4JKEA 4H0YB 2RN2A 4A5AA 3OS0A 1QVGM 2ASOA 3WQTA 4BR9A 1H1VA 3DXMB 2E1ZA 1NOZA 3KLEA 2UYTA 3Q7BA 1NGFA 1YT3A 2Z1IA 1QQOA 3IMXA 4ID5A 4CZMA 4IO8A 3M6GA 1VQ7N 4XEIA 3QB0A 2F96A 2NRXA 3TPQA 5AZJB 3AVGA 5JLHA 1IBKK 4MO5A 4O44A 4GY2B 5AQGA 3PX4A 1VQMN 2O8FB 4Q5VA 1WLJA 1Y97A 4NCBA 3AVFA 3UIQA 1EETA 4CZHA 3VF2A 4PA1A 2P9KA 3UKUB 4CZIA 3OYDA 3HSTB 4QS7A 2B4JA 1HJRA 4FLZA 1S72N 1NGBA 3R6MA 1CLQA 4H0XB 1U48A 3PLAA 1Q9YA 2Q1NA 4HUGA 1NK6A 1BUPA 3ISNC 1V4TA 1HKGA 4B08A 2ZGZA 3E9LA 3SNNA 4BE1A 4NLCA 2OCEA 4CFDA 3WXMB 1HJOA 3CFPA 3CF5L 3SQ1A 4B1WB 4FWOA 3HVTA 3MDQA 3R1XA 3TU5A 3D7EO 1U04A 4CJLA 3O4NA 1ZBHA 3R8EA 1HQUA 4M41A 2V7ZA 4CBWA 3RVCA 3WNEA 1YI2N 1SKSA 2UUBK 3THXB 4FJ9A 1XNRK 3WEEA 2IC3A 2OZSA 1YVNA 4FJNA 3QMLA 4AILC 2GUIA 4KH4A 4O0IA 5BPMA 1NK0A 1HNWK 3LL3A 4H03B 1WAJA 3O9UA 4DTJA 4JNEA 4DV5K 3HTVA 3AVBA 5AQFA 3WEEB 3VQ4A 3WXKA 4M7XA 1EX4A 5EOYA 1HQEA 4FW1A 2Q2RA 4RTFD 3N4QA 5AZIA 1C1CA 4B1VA 1NK8A 1NJWA 4FWLA 1I94K 2FXUA 1B9FA 2WC9A 4DKWA 3KKRA 2O8CB 1C0GA 3H1QA 3VPZA 4JKCA 3LM2A 4LY7A 3THWA 2D0BA 5C24A 1YHQN 1BCMA 1JLCA 2P9NA 2WFBA 3DJCA 1TK0A 2FSKA 5LY3A 2JWKA 2VG7A 3HPHA 1J9AA 3OYBA 4KO0A 2QK9A 1RILA 4FCYA 4X64K 5JS1A 1XMQK 3VQ8A 5E26A 1RDAA 5F1XA 3NH2A 4OPHA 5GAEP 1UAXA 4H5RA 5M1FA 4M3WA 4DSLA 4CJSA 1HYVA 1S1UA 1QQMA 3AO4A 4BR2A 3HM9A 4FM0A 2P9NB 3C7NB 1KTQA 4BE0A 2KZZA 1XQSC 3K5MA 4BRDA 5ELZA 1KFSA 1QTMA 3TAGA 3O80A 4F3TA 1N5YA 3THXA 2BANA 1K73O 3BEXA 5LL6Z 3MN9A 3UKUA 2HSTA 1R59O 4JK7A 3RMCA 1IKXA 4M3YA 4NLBA 4CJFA 2HF3A 1MDUB 3H3NO 4CJTA 1YJNN 1BISA 3TAQA 4I2QA 3CPWM 4JS4A 4FLTA 2VCPA 3E01A 4C8LA 5FPNA 2G8UA 5KGWA 1JLEA 1KC8O 5AQSA 3TTDA 1KLMA 2QA4N 3WNFA 1K9MO 5EU7A 2FLOA 2O8CA 1ZBIA 4X66K 3M8SA 3NGYA 4DQIA 4FOEA 2NRRA 3DYAA 1Q7YO 4B1XB 3NE6A 2ASMA 1CZBA 2NRHA 2Q97A 5C2DA 3KK1A 1FJGK 3A0IX 4GKJK 1UOCA 4BRCA 2WUSA 1CZ9A 3K5NA 3DRRA 1F21A 4E7JA 4H0VB 4FJ7A 1DTTA 3U4LA 5M1PA 3OS1A 3EZWA 1CXQA 2O4GA 4RW6A 3CJCA 3O6WA 2QWOA 4DV6K 4JI2K 3L8BA 3D45A 3IDHA 1HMVA 1IO2A 3K5OA 4K0KK 3M1FA 3QEIA 5BRDA 2HVHA 4EZ9A 1NGJA 1RDDA 2A6AA 3ZSYA 4TSXA 5C10A 5T7BA 5HRRA 3OBWA 5JVGL 2YHAA 5HROA 1S9EA 3KHYA 3VQEA 3DRPA 4GVEA 1TYQA 3P83D 1YXQA 1Q8IA 2A41A 3OYNA 1CZAN 5AZJA 3TAMA 3NAEA 1N36K 1NGCA 3QEVA 2HB5A 5D3GA 3C0BA 1SL2A 3QESA 1MWKA 1TVRA 1VQON 5FRMA 3VQAA 2V52B 3THVA 3V9XA 5I42A 4Z4GA 3K2PA 2XY5A 5JVHL 2FF3B 4LFAK 3NVKA 3LWMA 3MXMA 3ZETB 2QWPA 5AQQA 4HUEA 3VQCA 1NM1A 4C8NA 3OYMA 4FJIA 1JKHA 4N56A 3ID8A 1VK0A 4FLXA 2KLAA 1UA1A 2VGNA 3TR8A 1RT2A 2IVOA 3ID6A 1BU6O 1N32K 2ATQA 2XY7A 4FW2A 2A42A 4B1YB 4LF7K 3JAMO 4E89A 3ZETA 1X9MA 2GWKA 2JGUA 4EP5A 1NMDA 5CZ1A 1NWKA 3HJFA 2D1KA 1RDUA 3P4IA 1IG9A 4M3ZA 1Q82O 2ITGA 5GIOA 4Z0UA 4DR4K 4CJQA 1IKVA 3VQ6A 1OVYA 2X78A 2OPQA 1FKPA 1IBLK 4E1JA 3K0SA 1JLQA 2KTQA 4JD2B 2DFHA 4DTPA 3FGUA 4ELVA 4FVUA 4B9LA 3ZSQA 3SAHA 4IO9L 3L0QA 2CGLA 5J2MA 3ZSVA 4CGFA 1YJWN 5AQZA 3VETA 3K9KA 1GLAG 1LOTB 5AQVA 4O8KA 3VEZA 1KD1O 4FJ8A 1KLNA 3CI5A 4JI3K 4KHSA 4QS9A 3EZ5A 4CEBA 2P1JA 3KTQA 4BGBA 5FROA 4PWDA 1KXPA 4KB1A 4MLEA 4JI6K 3VQQA 4EAHD 2W42A 1I39A 5JMVA 4DU1A 5LMUK 3NVMA 2OZMA 1E4GT 4LF8K 2HBLA 3L4IA 4RW8A 2GELA 2GX9A 4A62A 2VG5A 5FPEA 4B9VA 4JRPA 1RT6A 1B9DA 3VGLA 4KTWA 4CFAA 2OYQA 1EO1A 1C0MA 2E2OA 4A57A 3CFRA 4ELTA 3AVIA 2D5RA 1JLGA 3GOIA 4JN4A 3ZSWA 2KHOA 5FPMA 4W5NA 1GOAA 5HRNA 4DS4A 4CF8A 1NKEA 3FZKA 5LJVA 2DFFA 3BY5A 4HWIA 5DM6L 2PZSA 4AM6A 2Q0UA 3WNGA 4H5WA 3VOVA 1BHLA 2ZWHA 2E6MA 3HOTA 4IG3A 3RR8A 3KK7A 1FW6A 3AVJA 1HNIA 3HXMA 3CMEN 1RGIA 4JI5K 1QZ5A 4CBXA 4B3OA 2V51B 3LM9A 3NGIA 3MK6A 1N8RO 1WBDA 2X74A 1XI1A 4JD2A 4B8CA 5HOOA 1REVA 1X9SA 1IJJA 4DQPA 4QOZB 5KPTA 3C95A 3SCXA 2WONA 5AQIA 1KAZA 1L3SA 4O5BA 4W5TA 4LFCK 5B8HA 1XC9A 2P5GA 3AAQA 2Y1JA 2FBTA 4L3QA 4MQ3A 4G1QA 3ENBA 4K43A 1NK5A 3C94A 4KHQA 3HPGA 1T7PA 3C65A 4YOWA 4JKFA 5EVZA 1FKOA 5EXWA 4DQRA 2HBMA 3KKSA 4CK1A 3AO2A 5DMRA 1TKZA 1WNSA 3AA2A 3SBGA 3DI6A 2I7PA 4UY8O 3PIPL 1B92A 3T1HK 3ZSRA 3TI0A 3IFRA 3L2WA 2HMIA 4LH4A 3VGKA 3CETA 4PKHA 1ASVA 2YKMA 3K9JA 5FDLA 3NHGA 1O1WA 2ASPA 1RDCA 4JKBA 4H0TB 3MX2A 3P1GA 1C0FA 3CCUN 1HNXK 4H4MA 3OVNA 3IAYA 2P9LB 4OVLA 2H3GX 4M63C 1WOQA 4A61A 4FJMA 4A59A 3F2KA 2YNIA 4E7HA 2QWLA 4E3SA 4F8RA 4CF2A 3CQYA 3QICA 4DMNA 3DXKB 4GKKK 3AV9A 3IRXA 3KWGA 4BRPA 4DR3K 5AJ3K 4CJ5A 1JL1A 5KRTA 4K8XA 1KAXA 2E6LA 1RBSA 3S9HA 4LF6K 4CHNA 2W40A 2P5OA 5TKWA 2CH5A 4OGCA 1GLDG 1VQ6N 3J7AP 3MEGA 4BRIA 2HHSA 1VRUA 3PSFA 1WB9A 3NF8A 3P5JA 3L4QA 4DCHA 1TK5A 3QERA 3HSCA 4KHUA 2F9TA 3NF7A 1BQNA 2KFZA 2PBDA 2IVPA 3SPZA 4C1NI 1GLJO 3TTFA 5CYQA 1IKYA 3I56N 3VQ9A 4F4KA 4CZEA 4KKOA 1VQ9N 4CF1A 1J6ZA 3SYZA 3QEPA 3JSMA 4GVMA 1WSJA 3V9WA 4JK9A 3V81A 4Z4FA 2QTDA 5AQJA 4E7IA 5CZ2A 5KGXA 3A5OC 2GEMA 3KK2A 4BC3A 3QINA 3WXJA 3NBPA 4G9ZA 3SMPA 4HCCA 3KLFA 1ZBFA 4YDUC 2EX3A 3QFPA 4FK4A 3LAKA 4CHZA 1JCEA 3GBTA 4ZTFA 3KIOA 2FSNA 2HOEA 3ATVA 1VHXA 3DRSA 5F0XA 4O4GA 3SJHA 1VQLN 4FJKA 4U67L 1RT4A 4CGJA 3A5MC 3HL8A 4AHSA 2PYLA 3MEDA 5HBMA 4FLUA 1NOYA 1LWFA 3MMVA 3ZT3A 3KJVA 1RTIA 4CGHA 1RBVA 4QS8A 4CCHA 1K8KB 3MECA 3V6DA 1WSFA 2P9PB 2YHXA 2P9KB 4PY5A 2RHKA 4ILGB 3LAMA 4AHVA 5AQTA 2QEXN 1DTQA 1U47A 1JXEA 4N76A 3U8XA 3DLBA 2GTDA 4CJ7A 2E4LA 4C23A 3KD5E 1JCFA 2OA8A 1Z25A 4CD3A 3MWPA 4GV3A 4FJHA 2QI2A 1VSJA 1YTAA 4FWPA 4OPKA 4M45A 3MEEA 4YOYA 3EKSA 4DQQA 1C0TA 3MN6A 2LSNA 4CK3A 2P9IA 4WFAL 4CEAA 3ZX3A 3I8BA 4JKHA 4B9TA 4XIUA 1RDWX 1IBMK 1U2VB 3OA9A 4DF4A 1U4BA 5HLFA 1J53A 4OKEA 3B6OA 3D2EA 5KQ8A 4LC9B 3OBYA 2D0CA 5TKYA 1Q86O 1NGDA 2B6AA 2P9SA 3L2RA 4GW6A 4IFVA 4WQ4C 2D0PA 2Q36A 4K8ZA 4IDKA 5M1NA 2Y1IA 4IFEA 4FOIA 1WSIA 1WN7A 1ATRA 5E41A 3VEWA 2E2QA 3SJJA 5EY4A 3S3MA 3KLIA 1EQYA 3CCVN 3O9TA 3TTCA 3PY8A 1W9HA 5AQUA 3AGKA 3FFIA 4W5RA 4DLEA 4NXNK 2IOCA 1ESVA 2FBVA 3ZCMA 1C0UA 4QCLA 1SS6A 1P90A 1W2BM 3VA3A 5GAHP 2G8FA 2HHTA 3LDPA 5ADXH 2ETJA 1QSYA 2QKBA 3F5TA 2DTUA 1SKWA 1QSSA 4ICLA 4GV6A 4KRFA 3IUCA 5HP1A 2HBJA 2AJQA 3SAFA 3PSIA 3K5LA 3OYIA 3T19A 5AQKA 1NLVA 2VGMA 4LF5K 1DGKN 4JI1K 1T6CA 2AA4A 3C6UA 3CC4N 3L2QA 5AFUA 4MLHA 2QWRA 4B9QA 4CBUA 4PL7A 4OKKA 4E19A 3TAFA 4JI7K 3Q7CA 1CXUA 2E88A 4FM1A 5J2QA 3BZKA 3DLRA 2V7YA 3LDNA 1S3XA 3O9SA 3O4QA 3QLHA 1LWEA 4DTUA 3U9DA 2AP1A 3CMAN 3HK2A 1OVQA 4R5PA 1VAZA 4LH5A 5AQLA 5AFUH 1XUPO 3UKRB 3J81O 3OYHA 2W6KA 4LD0A 2G8VA 1TKXA 4NO7A 4M7YA 5BR8K 3BGRA 1EWRA 4FJLA 3IKMA 4IFYA 2Z1HA 2P9PA 1QHAA 3EEQA 1D5AA 1W0HA 4DSJA 1SQKA 4EIAA 1T8EA 4FK0A 3RMBA 3O9QA 1X3NA 4RCHA 1BWFO 3CM5A 4RWTA 1JCGA 1OH8A 2GWJA 3DOKA 4K41A 3LDOA 3OYCA 2WOMA 4IOCL 3EL2A 4FJ5A 4DV3K 4PHTX 1TKDA 4WYBA 1LAVA 4ID1A 3H6EA 3ZT2A 3LP2A 2O4IA 1D8YA 1NJIO 1VQKN 4GV9A 1TAQA 3B8AX 4GMJB 1YAGA 3K59A 4M3TA 3KVGA 1WSEA 2F8TA 1T03A 2F8SA 3AVHA 4Q0BA 4XH1A 5AQOA 4FZZA 4CEEA 4CI6A 2HW3A 4YORA 3VESA 1HR0K 4EHTA 4J2AA 3UKRA 4E1MA 3AARA 3HM8A 5JLFA 1RT7A 4A2BA 3OYAA 4BVPA 3AA3A 4IKFA 4BC2A 3QDKA 3ATUA 3NGZA 1RT1A 3MN7A 3HOSA 2XRIA 2YKNA 3L3UA 1D4XA 2X6SA 3PX6A 2E1YA 1KVCA 3D2FA 1GLBG 4BG8A 3T1AA 3SLCA 2WBNA 3H1VX 4Z4CA 2F4VK 4FPBA 4BC4A 3CERA 2QKKA 4JK8A 4M3RA 3AVCA 3ALYA 3HP9A 4CJ4A 4OLBA 3GG4A 3H08A 1HPMA 4N5SA 4ZHRA 3QETA 4CZKA 3LDQA 4PKIA 3LZIA 4FPAA 4DTRA 5BN9A 1UA0A 1KRPA 1WSGA 3CJ1A 1HLUA 1RFQA 3TSUA 3OTOK 3SQ4A 1A5XA 5BREA 3P39A 4AHUA 1DEJA 1JJ2M 2ZGYA 4YOUA 4E7KA 1BA1A 1HRHA 4CJKA 2VWBA 1ZYQA 4FYDA 3MN5A 2VWJA 3GDQA 2NRVA 2G8KA 3IG1A 3O08A 1TYQB 1S5JA 3A2FA 1VSLA 3CG7A 2VQFK 4J2BA 5C0YA 1EP4A 1NK4A 4E1NA 2WTUA 4RG8A 1VSEA 5AQYA 5KRSA 1L3TA 5GINA 4CHYA 4BGAA 4IOXA 2PYJA 3NF9A 4CHPA 4BG9A 2QWMA 3LP1A 3FZFA 4I6MB 1Z6RA 1U6ZA 4DSIA 5AQXA 4FXDA 3O3FA 1NNEA 2HBKA 3SMSA 3CJAA 2YHBA 5BRHA 4BVOA 2RPIA 4CHQA 2W6LA 2Q3SA 4FZXC 4DFJA 2UUAK 1I3AA 2P9IB 2A3ZA 2CGJA 2E8AA 3DOLA 4B9MA 4BRGA 2E2NA 1NGGA 4IOAL 5LMNK 3CM6A 4Y1DA 2ZM6K 4H5TA 1KQSM 3CIPA 4ILJA 4B3SK 2KZMA 4CIGA 3L2VA 2P9UA 3VQDA 2HHVA 1JLFA 3MX5A 3V9SA 4DUZK 3J8AA 4MO4A 3AA5X 1SAZA 5FPDA 4YHHK 4BDZA 4JI4K 4DU3A 3ZEUA 1FK9A 1T6DA 2GUPA 4DQSA 1HKBA 2YNHA 4KBOA 3M8QA 3E66A 1C1AA 3AVNA 5CYMA 2NRZA 5IT9O 2P9UB 1NGAA 3A5NC 4NB4A 2XY8A 1M90O 4KI4A 4DUYK 3ZT0A 4FWQA 3BDPA 1QVFM 2RKIA 3O1WA 3S41A 3K58A 2JWLA 3ULEA 3WXLA 4PQUA 2GV9A 3J7ZO 3RRHA 3U3GA 3SZ2A 4IWVA 1MWMA 2D4WA 3LP3A 3QNNA 4GNIA 3CJBA 4AHRA 3RR7A 3LDLA 5GAGP 3SUPA 3DAWA 2Z1GA 2I5JA 2NRTA 4EFHA 3U9ZA 3RSEA 3PIOL 4A2AA 3VTIA 4FLWA 1QHTA 1GLEG 4CJVA 4B3RK 2KKZA 3TANA 4JYAK 3O4WA 3A8YA 2G8IA 3FLCO 2NNWA 4F9OA 3PO4A 5AQNA 1BG3A 1UWBA 1E4FT 1DKGD 3SPYA 4CEQA 4H0OA 4Z94A 4OPAA 4J2DA 4CFBA 2DPNA 3BF3A 4W5OA 3NH0A 4KFBA 4WE1A 1K8KA 3MXJA 4BRMA 3AA4A 1KVAA 4KI6A 3ULEB 4KAZA 2IS3A 5AQMA 5M1KA 4C1NK 1X9WA 3V1RA 1BQMA 1BIUA 1J5EK 3ZT4A 1GLFO 3ZSZA 3CHWA 1FXXA 3T1YK 2E20A 4N47A 4IBNA 3EN9A 3S3OA 4CEZA 5M1QA 1X1PA 1S22A 2RE2A 1ASWA 3OYLA 4KHYA 4I7FA 4YDUA 1KVBA 3BP8A 3ZEUB 3EE8A 3I55N 2OTLN 4CFCA 5AQWA 3CCRN 4C8KA 1TV6A 5IWAK 4KTQA 2ZQBA 1KSPA 2XY6A 4ISEA 4DV7K 5C25A 1NGEA 2E2PA 3SQ2A 2BE2A 3VENA 4H5NA 5GIPA 1HX1A 1S1TA 5AZIB 3VQPA 3OW2M 4ELUA 4BRLA 3OHRA 5FRNA 4BDYA 1GOCA 4DR7K 1V4SA 4OX9K 1JLBA
chains in the Genus database with same CATH topology
1UOCA 4OPKA 4M45A 3MEEA 1CZ9A 1S1WA 4CJEA 4DQQA 3K5NA 3DRRA 1F21A 1C0TA 1S1XA 4E7JA 3VQBA 2LSNA 4CK3A 2HNDA 3RWUA 4FJ7A 1DTTA 1S6QA 4CEAA 4KB0A 1VRTA 4W5QA 3OS1A 4B9TA 1RCHA 1CXQA 2O4GA 3LALA 4RW6A 4CJPA 4B8AB 4XIUA 1SL1A 3V1OA 2KQ2A 1VSKA 4DF4A 4MFBA 1U4BA 4IG0A 5KI6A 4Z4HA 4NCAA 5HLFA 1J53A 4CGGA 4OKEA 3M8PA 3B6OA 4BDPA 2ZE2A 3L8BA 2HHUA 3D45A 3MAQA 2D0CA 4RW4A 1HMVA 2DY4A 3C6TA 1IO2A 3K5OA 1TGOA 1BL3A 4NYFA 4HHTA 4CEOA 2B6AA 3AVLA 1TK8A 3QEIA 2RF2A 2HVHA 3L2RA 4EZ9A 1BI4A 1RDDA 2ZD1A 5HRSA 4YFUA 3ZSYA 4GW6A 4H4OA 4IFVA 4TSXA 4DSKA 5T7BA 4YNQA 4K8ZA 1RT5A 3HPOA 4IDKA 2Y1IA 4F2RA 5HRRA 1WSIA 1WN7A 5E41A 3HVRA 1RDBA 3SJJA 4FJGA 3S3MA 2IGIA 3KLIA 2YHAA 3CFOA 5HROA 2JLEA 3TWHA 2BGGA 1C1BA 4FLVA 4NYNA 2FC0A 1NK9A 1S9EA 2VG6A 3PY8A 1W9HA 3VQEA 3DRPA 4KPYA 2FBYA 3FFIA 1K6YA 3P83D 4W5RA 3OJSA 4DLEA 4DTNA 1Q8IA 1D9FA 1SKRA 2A1SA 2IOCA 3OYNA 1BCOA 1VSDA 4OLAA 3TAMA 3NAEA 4HTUA 2FBVA 4AHTA 3ZCMA 3QEVA 2HB5A 1C0UA 3LDSA 3LP0A 5D3GA 4QCLA 1SL2A 3QESA 4FM2A 3VA3A 2G8FA 2HHTA 3DLEA 3TARA 2GBZA 1TVRA 3ASMA 2ETJA 3RMDA 3MXIA 1N6QA 1S1VA 1QSYA 1SKWA 2QKBA 1QSSA 4ICLA 4DFMA 3VN5A 5FRMA 4KRFA 5HP1A 1VSHA 4EP4A 3VQAA 3F9KA 3KD1E 2AJQA 3TAEA 1TAUA 3SUQA 1LWCA 2YV0X 1SUQA 3K5LA 3OYIA 3AO3A 3T19A 3V9XA 3THVA 3OYGA 5I42A 3K2PA 4Z4GA 2XY5A 4KV8A 3AVKA 1WSHA 3LWMA 1HNVA 5HRPA 3MXMA 1XHXA 4JLHA 3C6UA 4HUEA 3VQCA 1LW2A 2HVIA 4C8NA 4CEFA 1BI4B 3OYMA 3L2QA 1NJYA 4CERA 1J54A 4CIEA 4Z4IA 1YTUA 4HUFA 4FJIA 1JKHA 3PO5A 4O0JA 4I2PA 4N56A 1VK0A 4OKKA 4E19A 4FLXA 1RTHA 4DFKA 3TAFA 4JRQA 1UA1A 1CXUA 3TR8A 4CEDA 1RT2A 4FM1A 3HO1A 4BE2A 4DTMA 5J2QA 4FJJA 2ATQA 3AVMA 3VA0A 2XY7A 3DLRA 4E0DA 1QS4A 4DTUA 3QLHA 3O4QA 1LWEA 4FW2A 3AO1A 4E89A 1X9MA 4OJRA 3HK2A 2JGUA 4EP5A 1VSMA 5CZ1A 4CHOA 4R5PA 3DM2A 4LH5A 1LW0A 3HJFA 4OPJA 3EYZA 3OYHA 4FJXA 3VQ5A 3QO9A 1U49A 1QSLA 4LD0A 2G8VA 1TKXA 3F73A 4KHWA 1IG9A 3BGRA 4M3ZA 2ITGA 5J1EA 5J2NA 4FJLA 4Z0UA 1S9GA 4IFYA 1HPZA 2Z1HA 1D5AA 4EZ6A 4CJQA 1IKVA 1QE1A 1W0HA 4DSJA 3V9ZA 3VQ6A 2X78A 1HYZA 1T8EA 1NKBA 1QQCA 2OPQA 1FKPA 4FK0A 3RMBA 4RW7A 4M3UA 3SUOA 3V9UA 1SL0A 1IKWA 2NUBA 2VWKA 2KTQA 1JLQA 3CM5A 2DFHA 3SUNA 4DTPA 1A5WA 1TKTA 4DSEA 4DTSA 4ELVA 3OYFA 3ZSQA 4B9LA 3CYMA 3PV8A 4CJRA 5SZTA 3LPUA 4O55A 5J2MA 3ZSVA 4CGFA 3JYTA 4CJ3A 3DOKA 1TL3A 3OYCA 4ZTFA 2WOMA 4C8OA 3S3NA 4FJ5A 4KTZA 3NH1A 1TKDA 1LAVA 2XHBA 1KLNA 1JLAA 4ID1A 1VSIA 3ZT2A 1T05A 4FJ8A 3LP2A 1ZBUA 3OYKA 2O4IA 1D8YA 4DS5A 4KHSA 3EZ5A 4CEBA 1TAQA 2P1JA 4GMJB 3TAPA 3KTQA 3K59A 4M3TA 4AH9A 5FROA 5I3UA 1WSEA 2F8TA 4PWDA 1T03A 2F8SA 3AVHA 4DSFA 4KB1A 4Q0BA 3VQQA 1NKCA 2W42A 4FZZA 1I39A 4DU1A 4CEEA 2HW3A 3LANA 2OZMA 4E7LA 1KFDA 3PX0A 2DFEA 4J2AA 4OKJA 1BIZA 4E1MA 4PUOA 3T3FA 2EHGA 4RW8A 3DLKA 4B9VA 2VG5A 1RT7A 1KCFA 4JRPA 1RT6A 1B9DA 3OYAA 3AA3A 4KTWA 4CFAA 3QEWA 4IKFA 4CF0A 2OYQA 4UQGA 1RBRA 1C0MA 3L2UA 4DTOA 3CFRA 4DU4A 4ELTA 2P51A 3AVIA 2D5RA 1JLGA 4CGIA 1RT3A 3ITHA 3ZSWA 3NGZA 1RT1A 3RRGA 2IDOA 2XRIA 2YKNA 3L3UA 4W5NA 3OJUA 1GOAA 5HRNA 4LSLA 4J2EA 4LSNA 2X6SA 4DS4A 3PX6A 2HHWA 5C42A 3SI6A 4CF8A 1NKEA 1KVCA 1VSFA 1L3UA 3QIOA 4B9UA 2OPRA 1NK7A 2DFFA 3OS2A 3NCIA 4FLYA 4JS5A 1A5VA 3HP6A 3G0ZA 4CIFA 3T1AA 4M3XA 2DTUA 4CK2A 4Z4CA 3SV4A 2PZSA 3WNGA 2QKKA 1IH7A 4M3RA 1BHLA 3U6FA 3AVCA 2IAJA 3HP9A 3ALYA 4CJ4A 4OLBA 3H08A 2E6MA 4N5SA 2RN2A 4ZHRA 3OS0A 4IG3A 3QETA 3RR8A 3LZIA 5J2PA 4DTRA 1UA0A 1KRPA 4KHNA 4B9SA 1WSGA 3AVJA 4FK2A 1HNIA 3HXMA 3SQ4A 1A5XA 1NOZA 4AHUA 3KLEA 4E7KA 1ZYQA 1HRHA 4CJKA 4CF9A 4FYDA 4B3OA 4BWJA 2VWJA 1YT3A 4NCGA 2Z1IA 4B9NA 3NGIA 2G8KA 3IG1A 4ID5A 4Y1CA 5CY4A 1S5JA 3ULDA 4DLGA 3A2FA 4KTQA 3AO5A 3SQ0A 1VSLA 3CG7A 2X74A 3DMJA 1XI1A 4B8CA 4J2BA 1REVA 2F96A 1EP4A 1NK4A 3AVGA 2XO7A 5JS2A 4E1NA 1HYSA 1X9SA 4RG8A 1VSEA 4O44A 4DQPA 5KRSA 1L3TA 4QOZB 3PX4A 4CHYA 3C95A 4Q5VA 3SCXA 1ITGA 2WONA 2PYJA 3O3HA 3O3GA 1L3SA 1WLJA 1Y97A 4NCBA 1DLOA 3AVFA 4O5BA 1EETA 4W5TA 3HT3A 3NF9A 4CHPA 3UIQA 4PA1A 3ZT1A 2A1RA 3OYDA 3B6PA 3LP1A 1XC9A 1TL1A 3HSTB 2P5GA 2B4JA 4DSIA 3WNHA 4FXDA 3O3FA 2Y1JA 1HJRA 3LWLA 4FLZA 2FBTA 4MQ3A 1LV5A 4G1QA 4C8MA 1NK5A 1CLQA 3C94A 4KHQA 3HPGA 1T7PA 1U48A 2BDPA 2YHBA 3QNOA 1Q9YA 3NDKA 1FKOA 4DQRA 4HUGA 2OPSA 1NK6A 3KKSA 4CK1A 3ISNC 2RPIA 4DWIA 3AO2A 4CHQA 4B08A 2Q3SA 3SNNA 4BE1A 5DMRA 4FZXC 1NJZA 1TKZA 1WNSA 3AA2A 4DFJA 1I3AA 3DI6A 4CFDA 1JL2A 3CFPA 1L3VA 4M42A 4B9MA 3DOLA 4CE9A 2HNYA 3SQ1A 1B92A 3HVTA 2G8WA 3M8RA 3ZSRA 3TI0A 1U04A 4CJLA 3O4NA 1ZBHA 3RMAA 1L5UA 3L2WA 3EY1A 2HMIA 1HQUA 4M41A 4CJWA 1J5OA 4LH4A 3CM6A 4Y1DA 3WNEA 1SKSA 1ASVA 2YKMA 4FJ9A 2KZMA 3KLGA 5FDLA 4CIGA 3L2VA 3NHGA 2IC3A 1O1WA 3VQDA 1RDCA 2HHVA 2OZSA 3I0RA 1JLFA 4FJNA 3V9SA 3P1GA 4AILC 2GUIA 4O0IA 3AA5X 4H4MA 3V4IA 3OVNA 1NK0A 3IAYA 3OY9A 4OVLA 3SPYA 3HYFA 1WAJA 4BDZA 4DTJA 4DU3A 1WAFA 1FK9A 4FJMA 3NFAA 5KTQA 2YNIA 4E7HA 4DQSA 4E3SA 3AVBA 3QIPA 3ZSXA 4F8RA 2YNHA 3M8QA 4CF2A 3VQ4A 1C1AA 3AVNA 5CYMA 4DMNA 4F3OA 1EX4A 1Q9XA 2OPPA 3AV9A 3IRXA 2FBXA 1HQEA 4FW1A 4H8KA 3LZJA 2KW4A 4N41A 2XY8A 5KRTA 4CJ5A 1JL1A 4K8XA 4KI4A 3ZT0A 3BDPA 2E6LA 1C1CA 2RKIA 1RBSA 2YNFA 1NK8A 4HCBA 3S9HA 3PUFA 1NJWA 4Z4EA 2HHQA 3K58A 1B9FA 4CHNA 3KKRA 3DLGA 4PQUA 2GV9A 3RRHA 1YVUA 2P5OA 3OYJA 5K14A 4OGCA 3U3GA 4CECA 3SZ2A 3LP3A 3QNNA 1RTDA 4LY7A 3MEGA 2HHSA 2D0BA 3U3YA 4AHCA 1VRUA 5C24A 4AHRA 4CJUA 3D0PA 1U45A 1BCMA 1JLCA 4RW9A 1TK0A 3RR7A 3NF8A 4L8RB 3QEXA 3P5JA 3SUPA 2VG7A 1TK5A 1D9DA 3QERA 2Z1GA 3HPHA 3OYEA 2I5JA 4KHUA 1J9AA 3OYBA 3NF7A 2B5JA 4KO0A 2QK9A 1RILA 1BQNA 4FCYA 2G8HA 4I9QA 3V1QA 4FLWA 2KFZA 1ZBLA 5JS1A 1QHTA 4FVMA 3VQ8A 4CJVA 3SPZA 1RDAA 1R0AA 1RNHA 3TANA 3NH2A 2PY5A 4F2SA 2G8IA 5CYQA 1UAXA 1IKYA 4M3WA 4DSLA 4CJSA 3AVAA 1ASUA 3VQ9A 1HYVA 3PO4A 1S1UA 4F4KA 3AO4A 4KKOA 1UWBA 3HM9A 4FM0A 2QXFA 4CF1A 3VQ7A 4CEQA 3L3VA 4I9LA 1KTQA 4OGEA 4BACA 4BE0A 3SYZA 2KZZA 3IS9A 3QEPA 3JSMA 4J2DA 4GVMA 4CFBA 3K5MA 1WSJA 4CESA 4W5OA 3NH0A 3V9WA 4KFBA 4WE1A 3V81A 4ZTJA 4Z4FA 4E7IA 1KFSA 5CZ2A 3I8DA 3CQ8A 3TAGA 1QTMA 3MXJA 5KGXA 4F3TA 3AA4A 1N5YA 3TABA 1KVAA 3KK2A 4KI6A 2BANA 3QINA 2R7YA 1G15A 3NBPA 4KAZA 3NF6A 4QAGA 2IS3A 1XWLA 4HCCA 3RMCA 3I0SA 1IKXA 3KLFA 4M3YA 1ZBFA 3G10A 1X9WA 1RTJA 1LAWA 2EX3A 3V1RA 1BQMA 1BIUA 3K57A 4FK4A 3LAKA 1RBTA 4CHZA 3ZSOA 1EKEA 3KIOA 4CJFA 3ZT4A 3ZSZA 4CJTA 4DTXA 1GOBA 1BISA 3TAQA 1FXXA 5SWMA 1EXQA 4I2QA 4N47A 4IBNA 4JS4A 4FLTA 2X6NA 3DRSA 3S3OA 4CEZA 1RBUA 4O4GA 1JXBA 2YNGA 4FJKA 1X1PA 1RT4A 4CGJA 1ASWA 3OYLA 3HL8A 4I7FA 3E01A 4AHSA 2PYLA 4KHYA 2KFNA 3MEDA 4C8LA 5HBMA 1KVBA 1C6VA 4DF8A 2D0AA 4HVJA 2G8UA 4FLUA 1MU2A 1NOYA 1LWFA 5KGWA 1NJXA 3ZT3A 1JLEA 1RTIA 3KJVA 4CGHA 1RBVA 4CFCA 3KK3A 4C8KA 4CCHA 1TV6A 1S6PA 3MECA 1WSFA 4BWMA 1SV5A 4CGDA 5DK5A 3RTVA 1KLMA 3V6DA 2ZQBA 3WNFA 1KSPA 2XY6A 4DG1A 5EU7A 4PY5A 5C25A 4DFPA 3LAMA 4AHVA 1XHZA 1DTQA 3SQ2A 1JXEA 1U47A 2HNZA 1ZBIA 3DLHA 2BE2A 4N76A 3M8SA 3KLHA 3NGYA 4DQIA 3DLBA 4KREA 2Z1JA 4FZYA 3DYAA 1S1TA 2E4LA 3KD5E 3VQPA 2OA8A 4ELUA 1Z25A 3NE6A 4FJHA 3SV3A 5FRNA 1CZBA 3LPTA 1VSJA 4BDYA 1GOCA 1Z26A 3KK1A 1YTAA 1JLBA 2HHXA 1BGXT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UOC A;  4OPK A;  4M45 A;  3MEE A;  1CZ9 A;  1S1W A;  4CJE A;  4DQQ A;  3K5N A;  3DRR A;  1F21 A;  1C0T A;  1S1X A;  4E7J A;  3VQB A;  2LSN A;  4CK3 A;  2HND A;  3RWU A;  4FJ7 A;  1DTT A;  1S6Q A;  4CEA A;  4KB0 A;  1VRT A;  4W5Q A;  3OS1 A;  4B9T A;  1RCH A;  1CXQ A;  2O4G A;  3LAL A;  4RW6 A;  4CJP A;  4B8A B;  4XIU A;  1SL1 A;  3V1O A;  2KQ2 A;  1VSK A;  4DF4 A;  4MFB A;  1U4B A;  4IG0 A;  5KI6 A;  4Z4H A;  4NCA A;  5HLF A;  1J53 A;  4CGG A;  4OKE A;  3M8P A;  3B6O A;  4BDP A;  2ZE2 A;  3L8B A;  2HHU A;  3D45 A;  3MAQ A;  2D0C A;  4RW4 A;  1HMV A;  2DY4 A;  3C6T A;  1IO2 A;  3K5O A;  1TGO A;  1BL3 A;  4NYF A;  4HHT A;  4CEO A;  2B6A A;  3AVL A;  1TK8 A;  3QEI A;  2RF2 A;  2HVH A;  3L2R A;  4EZ9 A;  1BI4 A;  1RDD A;  2ZD1 A;  5HRS A;  4YFU A;  3ZSY A;  4GW6 A;  4H4O A;  4IFV A;  4TSX A;  4DSK A;  5T7B A;  4YNQ A;  4K8Z A;  1RT5 A;  3HPO A;  4IDK A;  2Y1I A;  4F2R A;  5HRR A;  1WSI A;  1WN7 A;  5E41 A;  3HVR A;  1RDB A;  3SJJ A;  4FJG A;  3S3M A;  2IGI A;  3KLI A;  2YHA A;  3CFO A;  5HRO A;  2JLE A;  3TWH A;  2BGG A;  1C1B A;  4FLV A;  4NYN A;  2FC0 A;  1NK9 A;  1S9E A;  2VG6 A;  3PY8 A;  1W9H A;  3VQE A;  3DRP A;  4KPY A;  2FBY A;  3FFI A;  1K6Y A;  3P83 D;  4W5R A;  3OJS A;  4DLE A;  4DTN A;  1Q8I A;  1D9F A;  1SKR A;  2A1S A;  2IOC A;  3OYN A;  1BCO A;  1VSD A;  4OLA A;  3TAM A;  3NAE A;  4HTU A;  2FBV A;  4AHT A;  3ZCM A;  3QEV A;  2HB5 A;  1C0U A;  3LDS A;  3LP0 A;  5D3G A;  4QCL A;  1SL2 A;  3QES A;  4FM2 A;  3VA3 A;  2G8F A;  2HHT A;  3DLE A;  3TAR A;  2GBZ A;  1TVR A;  3ASM A;  2ETJ A;  3RMD A;  3MXI A;  1N6Q A;  1S1V A;  1QSY A;  1SKW A;  2QKB A;  1QSS A;  4ICL A;  4DFM A;  3VN5 A;  5FRM A;  4KRF A;  5HP1 A;  1VSH A;  4EP4 A;  3VQA A;  3F9K A;  3KD1 E;  2AJQ A;  3TAE A;  1TAU A;  3SUQ A;  1LWC A;  2YV0 X;  1SUQ A;  3K5L A;  3OYI A;  3AO3 A;  3T19 A;  3V9X A;  3THV A;  3OYG A;  5I42 A;  3K2P A;  4Z4G A;  2XY5 A;  4KV8 A;  3AVK A;  1WSH A;  3LWM A;  1HNV A;  5HRP A;  3MXM A;  1XHX A;  4JLH A;  3C6U A;  4HUE A;  3VQC A;  1LW2 A;  2HVI A;  4C8N A;  4CEF A;  1BI4 B;  3OYM A;  3L2Q A;  1NJY A;  4CER A;  1J54 A;  4CIE A;  4Z4I A;  1YTU A;  4HUF A;  4FJI A;  1JKH A;  3PO5 A;  4O0J A;  4I2P A;  4N56 A;  1VK0 A;  4OKK A;  4E19 A;  4FLX A;  1RTH A;  4DFK A;  3TAF A;  4JRQ A;  1UA1 A;  1CXU A;  3TR8 A;  4CED A;  1RT2 A;  4FM1 A;  3HO1 A;  4BE2 A;  4DTM A;  5J2Q A;  4FJJ A;  2ATQ A;  3AVM A;  3VA0 A;  2XY7 A;  3DLR A;  4E0D A;  1QS4 A;  4DTU A;  3QLH A;  3O4Q A;  1LWE A;  4FW2 A;  3AO1 A;  4E89 A;  1X9M A;  4OJR A;  3HK2 A;  2JGU A;  4EP5 A;  1VSM A;  5CZ1 A;  4CHO A;  4R5P A;  3DM2 A;  4LH5 A;  1LW0 A;  3HJF A;  4OPJ A;  3EYZ A;  3OYH A;  4FJX A;  3VQ5 A;  3QO9 A;  1U49 A;  1QSL A;  4LD0 A;  2G8V A;  1TKX A;  3F73 A;  4KHW A;  1IG9 A;  3BGR A;  4M3Z A;  2ITG A;  5J1E A;  5J2N A;  4FJL A;  4Z0U A;  1S9G A;  4IFY A;  1HPZ A;  2Z1H A;  1D5A A;  4EZ6 A;  4CJQ A;  1IKV A;  1QE1 A;  1W0H A;  4DSJ A;  3V9Z A;  3VQ6 A;  2X78 A;  1HYZ A;  1T8E A;  1NKB A;  1QQC A;  2OPQ A;  1FKP A;  4FK0 A;  3RMB A;  4RW7 A;  4M3U A;  3SUO A;  3V9U A;  1SL0 A;  1IKW A;  2NUB A;  2VWK A;  2KTQ A;  1JLQ A;  3CM5 A;  2DFH A;  3SUN A;  4DTP A;  1A5W A;  1TKT A;  4DSE A;  4DTS A;  4ELV A;  3OYF A;  3ZSQ A;  4B9L A;  3CYM A;  3PV8 A;  4CJR A;  5SZT A;  3LPU A;  4O55 A;  5J2M A;  3ZSV A;  4CGF A;  3JYT A;  4CJ3 A;  3DOK A;  1TL3 A;  3OYC A;  4ZTF A;  2WOM A;  4C8O A;  3S3N A;  4FJ5 A;  4KTZ A;  3NH1 A;  1TKD A;  1LAV A;  2XHB A;  1KLN A;  1JLA A;  4ID1 A;  1VSI A;  3ZT2 A;  1T05 A;  4FJ8 A;  3LP2 A;  1ZBU A;  3OYK A;  2O4I A;  1D8Y A;  4DS5 A;  4KHS A;  3EZ5 A;  4CEB A;  1TAQ A;  2P1J A;  4GMJ B;  3TAP A;  3KTQ A;  3K59 A;  4M3T A;  4AH9 A;  5FRO A;  5I3U A;  1WSE A;  2F8T A;  4PWD A;  1T03 A;  2F8S A;  3AVH A;  4DSF A;  4KB1 A;  4Q0B A;  3VQQ A;  1NKC A;  2W42 A;  4FZZ A;  1I39 A;  4DU1 A;  4CEE A;  2HW3 A;  3LAN A;  2OZM A;  4E7L A;  1KFD A;  3PX0 A;  2DFE A;  4J2A A;  4OKJ A;  1BIZ A;  4E1M A;  4PUO A;  3T3F A;  2EHG A;  4RW8 A;  3DLK A;  4B9V A;  2VG5 A;  1RT7 A;  1KCF A;  4JRP A;  1RT6 A;  1B9D A;  3OYA A;  3AA3 A;  4KTW A;  4CFA A;  3QEW A;  4IKF A;  4CF0 A;  2OYQ A;  4UQG A;  1RBR A;  1C0M A;  3L2U A;  4DTO A;  3CFR A;  4DU4 A;  4ELT A;  2P51 A;  3AVI A;  2D5R A;  1JLG A;  4CGI A;  1RT3 A;  3ITH A;  3ZSW A;  3NGZ A;  1RT1 A;  3RRG A;  2IDO A;  2XRI A;  2YKN A;  3L3U A;  4W5N A;  3OJU A;  1GOA A;  5HRN A;  4LSL A;  4J2E A;  4LSN A;  2X6S A;  4DS4 A;  3PX6 A;  2HHW A;  5C42 A;  3SI6 A;  4CF8 A;  1NKE A;  1KVC A;  1VSF A;  1L3U A;  3QIO A;  4B9U A;  2OPR A;  1NK7 A;  2DFF A;  3OS2 A;  3NCI A;  4FLY A;  4JS5 A;  1A5V A;  3HP6 A;  3G0Z A;  4CIF A;  3T1A A;  4M3X A;  2DTU A;  4CK2 A;  4Z4C A;  3SV4 A;  2PZS A;  3WNG A;  2QKK A;  1IH7 A;  4M3R A;  1BHL A;  3U6F A;  3AVC A;  2IAJ A;  3HP9 A;  3ALY A;  4CJ4 A;  4OLB A;  3H08 A;  2E6M A;  4N5S A;  2RN2 A;  4ZHR A;  3OS0 A;  4IG3 A;  3QET A;  3RR8 A;  3LZI A;  5J2P A;  4DTR A;  1UA0 A;  1KRP A;  4KHN A;  4B9S A;  1WSG A;  3AVJ A;  4FK2 A;  1HNI A;  3HXM A;  3SQ4 A;  1A5X A;  1NOZ A;  4AHU A;  3KLE A;  4E7K A;  1ZYQ A;  1HRH A;  4CJK A;  4CF9 A;  4FYD A;  4B3O A;  4BWJ A;  2VWJ A;  1YT3 A;  4NCG A;  2Z1I A;  4B9N A;  3NGI A;  2G8K A;  3IG1 A;  4ID5 A;  4Y1C A;  5CY4 A;  1S5J A;  3ULD A;  4DLG A;  3A2F A;  4KTQ A;  3AO5 A;  3SQ0 A;  1VSL A;  3CG7 A;  2X74 A;  3DMJ A;  1XI1 A;  4B8C A;  4J2B A;  1REV A;  2F96 A;  1EP4 A;  1NK4 A;  3AVG A;  2XO7 A;  5JS2 A;  4E1N A;  1HYS A;  1X9S A;  4RG8 A;  1VSE A;  4O44 A;  4DQP A;  5KRS A;  1L3T A;  4QOZ B;  3PX4 A;  4CHY A;  3C95 A;  4Q5V A;  3SCX A;  1ITG A;  2WON A;  2PYJ A;  3O3H A;  3O3G A;  1L3S A;  1WLJ A;  1Y97 A;  4NCB A;  1DLO A;  3AVF A;  4O5B A;  1EET A;  4W5T A;  3HT3 A;  3NF9 A;  4CHP A;  3UIQ A;  4PA1 A;  3ZT1 A;  2A1R A;  3OYD A;  3B6P A;  3LP1 A;  1XC9 A;  1TL1 A;  3HST B;  2P5G A;  2B4J A;  4DSI A;  3WNH A;  4FXD A;  3O3F A;  2Y1J A;  1HJR A;  3LWL A;  4FLZ A;  2FBT A;  4MQ3 A;  1LV5 A;  4G1Q A;  4C8M A;  1NK5 A;  1CLQ A;  3C94 A;  4KHQ A;  3HPG A;  1T7P A;  1U48 A;  2BDP A;  2YHB A;  3QNO A;  1Q9Y A;  3NDK A;  1FKO A;  4DQR A;  4HUG A;  2OPS A;  1NK6 A;  3KKS A;  4CK1 A;  3ISN C;  2RPI A;  4DWI A;  3AO2 A;  4CHQ A;  4B08 A;  2Q3S A;  3SNN A;  4BE1 A;  5DMR A;  4FZX C;  1NJZ A;  1TKZ A;  1WNS A;  3AA2 A;  4DFJ A;  1I3A A;  3DI6 A;  4CFD A;  1JL2 A;  3CFP A;  1L3V A;  4M42 A;  4B9M A;  3DOL A;  4CE9 A;  2HNY A;  3SQ1 A;  1B92 A;  3HVT A;  2G8W A;  3M8R A;  3ZSR A;  3TI0 A;  1U04 A;  4CJL A;  3O4N A;  1ZBH A;  3RMA A;  1L5U A;  3L2W A;  3EY1 A;  2HMI A;  1HQU A;  4M41 A;  4CJW A;  1J5O A;  4LH4 A;  3CM6 A;  4Y1D A;  3WNE A;  1SKS A;  1ASV A;  2YKM A;  4FJ9 A;  2KZM A;  3KLG A;  5FDL A;  4CIG A;  3L2V A;  3NHG A;  2IC3 A;  1O1W A;  3VQD A;  1RDC A;  2HHV A;  2OZS A;  3I0R A;  1JLF A;  4FJN A;  3V9S A;  3P1G A;  4AIL C;  2GUI A;  4O0I A;  3AA5 X;  4H4M A;  3V4I A;  3OVN A;  1NK0 A;  3IAY A;  3OY9 A;  4OVL A;  3SPY A;  3HYF A;  1WAJ A;  4BDZ A;  4DTJ A;  4DU3 A;  1WAF A;  1FK9 A;  4FJM A;  3NFA A;  5KTQ A;  2YNI A;  4E7H A;  4DQS A;  4E3S A;  3AVB A;  3QIP A;  3ZSX A;  4F8R A;  2YNH A;  3M8Q A;  4CF2 A;  3VQ4 A;  1C1A A;  3AVN A;  5CYM A;  4DMN A;  4F3O A;  1EX4 A;  1Q9X A;  2OPP A;  3AV9 A;  3IRX A;  2FBX A;  1HQE A;  4FW1 A;  4H8K A;  3LZJ A;  2KW4 A;  4N41 A;  2XY8 A;  5KRT A;  4CJ5 A;  1JL1 A;  4K8X A;  4KI4 A;  3ZT0 A;  3BDP A;  2E6L A;  1C1C A;  2RKI A;  1RBS A;  2YNF A;  1NK8 A;  4HCB A;  3S9H A;  3PUF A;  1NJW A;  4Z4E A;  2HHQ A;  3K58 A;  1B9F A;  4CHN A;  3KKR A;  3DLG A;  4PQU A;  2GV9 A;  3RRH A;  1YVU A;  2P5O A;  3OYJ A;  5K14 A;  4OGC A;  3U3G A;  4CEC A;  3SZ2 A;  3LP3 A;  3QNN A;  1RTD A;  4LY7 A;  3MEG A;  2HHS A;  2D0B A;  3U3Y A;  4AHC A;  1VRU A;  5C24 A;  4AHR A;  4CJU A;  3D0P A;  1U45 A;  1BCM A;  1JLC A;  4RW9 A;  1TK0 A;  3RR7 A;  3NF8 A;  4L8R B;  3QEX A;  3P5J A;  3SUP A;  2VG7 A;  1TK5 A;  1D9D A;  3QER A;  2Z1G A;  3HPH A;  3OYE A;  2I5J A;  4KHU A;  1J9A A;  3OYB A;  3NF7 A;  2B5J A;  4KO0 A;  2QK9 A;  1RIL A;  1BQN A;  4FCY A;  2G8H A;  4I9Q A;  3V1Q A;  4FLW A;  2KFZ A;  1ZBL A;  5JS1 A;  1QHT A;  4FVM A;  3VQ8 A;  4CJV A;  3SPZ A;  1RDA A;  1R0A A;  1RNH A;  3TAN A;  3NH2 A;  2PY5 A;  4F2S A;  2G8I A;  5CYQ A;  1UAX A;  1IKY A;  4M3W A;  4DSL A;  4CJS A;  3AVA A;  1ASU A;  3VQ9 A;  1HYV A;  3PO4 A;  1S1U A;  4F4K A;  3AO4 A;  4KKO A;  1UWB A;  3HM9 A;  4FM0 A;  2QXF A;  4CF1 A;  3VQ7 A;  4CEQ A;  3L3V A;  4I9L A;  1KTQ A;  4OGE A;  4BAC A;  4BE0 A;  3SYZ A;  2KZZ A;  3IS9 A;  3QEP A;  3JSM A;  4J2D A;  4GVM A;  4CFB A;  3K5M A;  1WSJ A;  4CES A;  4W5O A;  3NH0 A;  3V9W A;  4KFB A;  4WE1 A;  3V81 A;  4ZTJ A;  4Z4F A;  4E7I A;  1KFS A;  5CZ2 A;  3I8D A;  3CQ8 A;  3TAG A;  1QTM A;  3MXJ A;  5KGX A;  4F3T A;  3AA4 A;  1N5Y A;  3TAB A;  1KVA A;  3KK2 A;  4KI6 A;  2BAN A;  3QIN A;  2R7Y A;  1G15 A;  3NBP A;  4KAZ A;  3NF6 A;  4QAG A;  2IS3 A;  1XWL A;  4HCC A;  3RMC A;  3I0S A;  1IKX A;  3KLF A;  4M3Y A;  1ZBF A;  3G10 A;  1X9W A;  1RTJ A;  1LAW A;  2EX3 A;  3V1R A;  1BQM A;  1BIU A;  3K57 A;  4FK4 A;  3LAK A;  1RBT A;  4CHZ A;  3ZSO A;  1EKE A;  3KIO A;  4CJF A;  3ZT4 A;  3ZSZ A;  4CJT A;  4DTX A;  1GOB A;  1BIS A;  3TAQ A;  1FXX A;  5SWM A;  1EXQ A;  4I2Q A;  4N47 A;  4IBN A;  4JS4 A;  4FLT A;  2X6N A;  3DRS A;  3S3O A;  4CEZ A;  1RBU A;  4O4G A;  1JXB A;  2YNG A;  4FJK A;  1X1P A;  1RT4 A;  4CGJ A;  1ASW A;  3OYL A;  3HL8 A;  4I7F A;  3E01 A;  4AHS A;  2PYL A;  4KHY A;  2KFN A;  3MED A;  4C8L A;  5HBM A;  1KVB A;  1C6V A;  4DF8 A;  2D0A A;  4HVJ A;  2G8U A;  4FLU A;  1MU2 A;  1NOY A;  1LWF A;  5KGW A;  1NJX A;  3ZT3 A;  1JLE A;  1RTI A;  3KJV A;  4CGH A;  1RBV A;  4CFC A;  3KK3 A;  4C8K A;  4CCH A;  1TV6 A;  1S6P A;  3MEC A;  1WSF A;  4BWM A;  1SV5 A;  4CGD A;  5DK5 A;  3RTV A;  1KLM A;  3V6D A;  2ZQB A;  3WNF A;  1KSP A;  2XY6 A;  4DG1 A;  5EU7 A;  4PY5 A;  5C25 A;  4DFP A;  3LAM A;  4AHV A;  1XHZ A;  1DTQ A;  3SQ2 A;  1JXE A;  1U47 A;  2HNZ A;  1ZBI A;  3DLH A;  2BE2 A;  4N76 A;  3M8S A;  3KLH A;  3NGY A;  4DQI A;  3DLB A;  4KRE A;  2Z1J A;  4FZY A;  3DYA A;  1S1T A;  2E4L A;  3KD5 E;  3VQP A;  2OA8 A;  4ELU A;  1Z25 A;  3NE6 A;  4FJH A;  3SV3 A;  5FRN A;  1CZB A;  3LPT A;  1VSJ A;  4BDY A;  1GOC A;  1Z26 A;  3KK1 A;  1YTA A;  1JLB A;  2HHX A;  1BGX T; 
#chains in the Genus database with same CATH topology
 1S1X A;  3VQB A;  2HND A;  3RWU A;  3CXC M;  4W5Q A;  2I7N A;  1RCH A;  1SL1 A;  4B8A B;  3V1O A;  2Q0R A;  3QFU A;  4IG0 A;  4NCA A;  4CGG A;  4BDP A;  2HHU A;  3MAQ A;  5BPL A;  2DY4 A;  3FZL A;  4DB3 A;  1TGO A;  1BL3 A;  1ATS A;  4NYF A;  1M1K O;  3SK3 A;  4HHT A;  3CCJ N;  2RF2 A;  5HRS A;  2ZD1 A;  4B3M K;  4DR5 K;  4H4O A;  3TSQ A;  4F2R A;  2YCH A;  1RDB A;  4FJG A;  2IGI A;  2BGG A;  1ILY A;  2YX6 A;  4IZ9 A;  2FC0 A;  2HF4 A;  5H1S Q;  1WBB A;  3SBT A;  3MCP A;  3DXK A;  1K6Y A;  3OJS A;  4DR2 K;  1NBW A;  4OLA A;  3CCL N;  2UXD K;  2QWQ A;  3CCS N;  1P8Z A;  2F7T A;  4AHT A;  4BQZ A;  3LDS A;  4WQ5 A;  5A2Q O;  5KQD A;  4FM2 A;  3DLE A;  3ASM A;  4PL8 A;  3RMD A;  3MXI A;  4O8U A;  1S1V A;  3THY A;  4DFM A;  4JKG A;  3VN5 A;  3VEY A;  4EP4 A;  3F9K A;  3KD1 E;  3ZLJ A;  3TAE A;  1TAU A;  3SUQ A;  1BO5 O;  2FF6 A;  1LWC A;  1SUQ A;  4AQY K;  3AO3 A;  3AVK A;  4WFB L;  1WSH A;  2VQE K;  1HNV A;  1XHX A;  4JLH A;  1LW2 A;  4Z4I A;  4CER A;  1J54 A;  3EO3 A;  4CIE A;  1YTU A;  1NG9 A;  4O0J A;  4I2P A;  4CZL A;  4BRO A;  4HTL A;  1MA9 B;  4DFK A;  4JRQ A;  1BOT O;  3HO1 A;  4DTM A;  3E1Y A;  5FLX O;  4E0D A;  5F2R A;  1QS4 A;  4BRH A;  3AGR A;  3AO1 A;  1OKJ A;  2QW9 A;  1VSM A;  4CHO A;  1LW0 A;  2ZJR L;  4OPJ A;  2O8B B;  4FJX A;  1QSL A;  3QO9 A;  4FSV A;  1GLL O;  3W0L A;  4BQL A;  1S9G A;  1BA0 A;  3VMF B;  2QXL A;  1QQC A;  4RW7 A;  2YHW A;  3WT0 A;  4FWR A;  3V9U A;  5GAD P;  1IKW A;  2CGK A;  2NUB A;  2VWK A;  4DV2 K;  1A5W A;  3L6Q A;  3OYF A;  4CJR A;  2J4R A;  3LPU A;  4O55 A;  3JYT A;  4CJ3 A;  1TL3 A;  2HHH K;  4FO0 A;  1OH5 A;  4C8O A;  4IXC A;  4KTZ A;  3NH1 A;  2FSJ A;  3P31 A;  2XHB A;  3FZH A;  1ZBS A;  1T05 A;  3OYK A;  3C6A A;  4XH4 A;  4DS5 A;  3BUZ B;  5KPR A;  4X62 K;  3TAP A;  4AH9 A;  4DSF A;  4JV5 K;  4DHY A;  3THY B;  3UE5 A;  3DWL A;  2DFE A;  4WFN L;  4OKJ A;  1QQN A;  1BIZ A;  3E9P A;  4PUO A;  3O1B A;  4MDB A;  3DLK A;  2ZF5 O;  3QEW A;  3C7N A;  4CF0 A;  3AY9 A;  2ZJQ L;  1RBR A;  4AF1 A;  2P51 A;  4ISF A;  4CGI A;  1RT3 A;  3ITH A;  1K8A O;  3RRG A;  2IDO A;  3OJU A;  4J2E A;  1XNQ K;  2HHW A;  5C42 A;  1YIJ N;  3WUH A;  1VSF A;  3NMU A;  2OPR A;  3KZB A;  1VQN N;  1A5V A;  3BF1 A;  4FWN A;  1X9J A;  4CIF A;  4M3X A;  2O8F A;  3JS6 A;  4X65 K;  3CCM N;  3SV4 A;  5DM7 L;  2YJE A;  1IH7 A;  4IEI A;  1IV0 A;  2YI1 A;  2O8B A;  4JKG B;  4LF9 K;  1N33 K;  5J2P A;  1SZ2 A;  4WQ5 C;  5BPN A;  3VF6 A;  4KHN A;  4O5F A;  4B9S A;  4FK2 A;  3VF4 A;  3THW B;  4DV1 K;  4H5V A;  1OH7 A;  4CF9 A;  1U2V A;  4BWJ A;  4NCG A;  4B9N A;  1HNZ K;  4JKA A;  1WUA A;  5CY4 A;  2QWN A;  3ULD A;  4DLG A;  3H3O B;  3AO5 A;  3SQ0 A;  3DMJ A;  4KHP K;  5EX5 A;  4IEE A;  3KWI A;  2XO7 A;  5JS2 A;  1HYS A;  2VYP A;  5I9E B;  1Q18 A;  4CVN E;  1ITG A;  1TUY A;  3C6H A;  3O3H A;  3O3G A;  4B3T K;  1DLO A;  3HT3 A;  3ZT1 A;  2A1R A;  3B6P A;  1TL1 A;  3WNH A;  2A5X A;  2BTF A;  3LWL A;  1LV5 A;  4C8M A;  5BRF A;  3CCE N;  4BRQ A;  2QM1 A;  2BDP A;  2BUP A;  3DXM A;  3QNO A;  3NDK A;  1YIT N;  2OPS A;  4DWI A;  4JEP A;  4YOV A;  1NJZ A;  5KPZ A;  4BR0 A;  3CPE A;  4H0P A;  1JL2 A;  2A40 A;  5CE3 A;  1L3V A;  4M42 A;  4YOX A;  4CZJ A;  4CE9 A;  2HNY A;  2G8W A;  4IJA A;  3M8R A;  3CJ7 A;  5CR4 A;  4FWM A;  3RMA A;  1L5U A;  3EY1 A;  4CJW A;  1J5O A;  3T7Z A;  1HUX A;  3J7Y P;  3KLG A;  4WF9 L;  4JI0 K;  3UB5 A;  3J80 O;  3QBX A;  3R3L A;  3I0R A;  3CQX A;  2O8E B;  4IDH A;  3V4I A;  4V19 S;  4K42 A;  3OY9 A;  4B1U B;  3HYF A;  3HZ6 A;  5C2F A;  4EHU A;  1WAF A;  2CH6 A;  1O13 A;  2OTJ N;  3NFA A;  5KTQ A;  3ENO A;  3ZSX A;  3QIP A;  3VGM A;  2PAV A;  4F3O A;  4OO1 J;  1Q9X A;  2OPP A;  3G25 A;  2FBX A;  4H8K A;  3LZJ A;  2KW4 A;  4DR1 K;  4N41 A;  3QBW A;  4WQ4 A;  1EWQ A;  3AAP A;  2YNF A;  1NGI A;  4HCB A;  3ZX2 A;  3PUF A;  4Z4E A;  1X3M A;  2IVN A;  2HHQ A;  3CD6 N;  3DLG A;  3ENH A;  3N4P A;  4CZG A;  1YVU A;  5LJW A;  4U7B A;  3OYJ A;  5K14 A;  1NMN A;  4MDA A;  4CEC A;  4DQ8 A;  1VQ8 N;  3H45 C;  1RTD A;  2NZT A;  5C12 A;  4CW7 B;  1T44 A;  3U3Y A;  4AHC A;  4CJU A;  3D0P A;  1U45 A;  4RW9 A;  4R79 A;  3FE1 A;  4L8R B;  3MCA B;  3QEX A;  2PFU A;  1D9D A;  3P38 A;  3OYE A;  3M3Z A;  2B5J A;  4BRE A;  2G8H A;  4I9Q A;  3V1Q A;  3D6R A;  1ZBL A;  4FVM A;  2P9S B;  1R0A A;  1RNH A;  2W41 A;  3FR0 A;  2PY5 A;  4F2S A;  3ZYY X;  5JIC A;  4DV4 K;  5C15 A;  4BC5 A;  3AVA A;  1ASU A;  2Q31 A;  2QXF A;  3VQ7 A;  4BAC A;  3L3V A;  4I9L A;  4OGE A;  2NLX A;  3IS9 A;  3T69 A;  1OH6 A;  3M5R A;  4CES A;  4ZTJ A;  4ISG A;  2ZJP L;  3WXI A;  3I8D A;  3CQ8 A;  2E5L K;  1HKC A;  1VQP N;  3TAB A;  3D2E B;  1LCU A;  3JXU A;  2R7Y A;  4AM7 A;  5M1O A;  1G15 A;  3NF6 A;  4QAG A;  1XWL A;  3I0S A;  3G10 A;  1RTJ A;  4B1Z A;  1LAW A;  3BZC A;  3EKU A;  3K57 A;  2O8E A;  1RBT A;  1ZXO A;  3G6E N;  3ZSO A;  1EKE A;  4DTX A;  1GOB A;  5SWM A;  1EXQ A;  1XMO K;  2X6N A;  1RBU A;  4FWS A;  1JXB A;  4DV0 K;  2YNG A;  3CC7 N;  4A5B A;  1W7A A;  2KFN A;  1BDG A;  3ZX0 A;  1Y64 A;  1C6V A;  3TSP A;  2D0A A;  4HVJ A;  4DF8 A;  1MU2 A;  1NJX A;  4YOT A;  4J8F A;  3VTH A;  3KK3 A;  2UUC K;  4BWM A;  1S6P A;  4CGD A;  1SV5 A;  3RTV A;  5DK5 A;  1TUU A;  2O8D B;  4DG1 A;  2YHY A;  3MWT A;  1Z05 A;  4DFP A;  1XHZ A;  2HNZ A;  3DLH A;  3KLH A;  4KRE A;  2Z1J A;  4FZY A;  3HRG A;  4BRN A;  3SV3 A;  3LPT A;  4Y1C A;  1Z26 A;  2HHX A;  1BGX T;  1S1W A;  4CJE A;  3A5L C;  2O8D A;  5BN8 A;  1S6Q A;  4KB0 A;  1VRT A;  4CJP A;  3LAL A;  2KQ2 A;  3O9R A;  1VSK A;  4MFB A;  1YJ9 N;  5KI6 A;  4Z4H A;  4BR4 A;  4JKD A;  3M8P A;  3SAG A;  2YJF A;  2ZE2 A;  3VER A;  2HMP A;  4RW4 A;  4XH5 A;  3C6T A;  1ZC6 A;  5CHI A;  4BR7 A;  4CEO A;  1NU0 A;  3AVL A;  1TK8 A;  1BI4 A;  4YFU A;  4DSK A;  4FWK A;  4YNQ A;  1RT5 A;  3HPO A;  1DT9 A;  3FFK B;  3HVR A;  4LFB K;  2D0O A;  4IJN A;  4K25 A;  1NGH A;  3CFO A;  1N34 K;  2JLE A;  3TWH A;  1C1B A;  4FLV A;  4NYN A;  3R9P A;  1NK9 A;  2VG6 A;  5AR0 A;  4KPY A;  2FBY A;  4DTN A;  1D9F A;  4JHD A;  2UU9 K;  1SKR A;  2A1S A;  1BCO A;  1VSD A;  5AQR A;  4HTU A;  1Q81 O;  3F9M A;  3LP0 A;  3O8M A;  2EWS A;  2OAN A;  4DR6 K;  4BR5 A;  3TAR A;  2GBZ A;  1N6Q A;  4FL9 A;  3VEX A;  3CC2 N;  1VSH A;  1VQ5 N;  4BRK A;  2YV0 X;  2UXC K;  5HL7 L;  3OYG A;  4KV8 A;  1G99 A;  4KH5 A;  1W97 L;  5HRP A;  4CZF A;  1ATN A;  4WCE L;  5E84 A;  4Y0W A;  2HVI A;  1XC3 A;  4CEF A;  1BI4 B;  1NJY A;  1T3V A;  4HUF A;  2BH1 A;  3PO5 A;  3CJ9 A;  4BRA A;  1RTH A;  3HBT A;  4CED A;  4BE2 A;  4FJJ A;  3AVM A;  3VA0 A;  1YUW A;  4NXM K;  4OJR A;  5BR9 A;  4JHD B;  4YY3 K;  3DM2 A;  3EYZ A;  3VQ5 A;  3WQU A;  1U49 A;  1VQ4 N;  3D2F B;  3F73 A;  4KHW A;  5J1E A;  4PKG A;  5J2N A;  3RSE B;  5MLC Q;  1HPZ A;  3E9O A;  4KH6 A;  4EZ6 A;  1QE1 A;  5AQH A;  3V9Z A;  5AQP A;  3CCQ N;  1HYZ A;  1NKB A;  4M3U A;  3SUO A;  1SL0 A;  3I33 A;  3SUN A;  1TKT A;  4DSE A;  4DTS A;  2F9W A;  3CYM A;  4I6M A;  3PV8 A;  5SZT A;  3S3N A;  1GLC G;  1JLA A;  1VSI A;  1ZBU A;  4CD1 A;  4ILH A;  5I3U A;  3O5B A;  3EE9 A;  1NKC A;  2ITM A;  3LAN A;  4LF4 K;  4E7L A;  1KFD A;  3PX0 A;  3FZM A;  1E3M A;  3T3F A;  2EHG A;  3GL1 A;  4BRF A;  1KCF A;  3G4S N;  4UQG A;  2P9L A;  3L2U A;  4DTO A;  3DLL L;  4DU4 A;  1YF5 L;  3HI0 A;  4JAX A;  3VEV A;  3VEO A;  4JI8 K;  2IIR A;  1QZ6 A;  4BY9 C;  4LSL A;  1IG8 A;  4LSN A;  5ADX A;  3SI6 A;  1L3U A;  4B9U A;  3QIO A;  1NK7 A;  3OS2 A;  3NCI A;  4FLY A;  4JS5 A;  1KAY A;  3HP6 A;  3G0Z A;  4CK2 A;  3G71 N;  3H46 O;  2UXB K;  2NRW A;  3U6F A;  2IAJ A;  3W3D A;  3GE1 A;  4JKE A;  4H0Y B;  2RN2 A;  4A5A A;  3OS0 A;  1QVG M;  2ASO A;  3WQT A;  4BR9 A;  1H1V A;  3DXM B;  2E1Z A;  1NOZ A;  3KLE A;  2UYT A;  3Q7B A;  1NGF A;  1YT3 A;  2Z1I A;  1QQO A;  3IMX A;  4ID5 A;  4CZM A;  4IO8 A;  3M6G A;  1VQ7 N;  4XEI A;  3QB0 A;  2F96 A;  2NRX A;  3TPQ A;  5AZJ B;  3AVG A;  5JLH A;  1IBK K;  4MO5 A;  4O44 A;  4GY2 B;  5AQG A;  3PX4 A;  1VQM N;  2O8F B;  4Q5V A;  1WLJ A;  1Y97 A;  4NCB A;  3AVF A;  3UIQ A;  1EET A;  4CZH A;  3VF2 A;  4PA1 A;  2P9K A;  3UKU B;  4CZI A;  3OYD A;  3HST B;  4QS7 A;  2B4J A;  1HJR A;  4FLZ A;  1S72 N;  1NGB A;  3R6M A;  1CLQ A;  4H0X B;  1U48 A;  3PLA A;  1Q9Y A;  2Q1N A;  4HUG A;  1NK6 A;  1BUP A;  3ISN C;  1V4T A;  1HKG A;  4B08 A;  2ZGZ A;  3E9L A;  3SNN A;  4BE1 A;  4NLC A;  2OCE A;  4CFD A;  3WXM B;  1HJO A;  3CFP A;  3CF5 L;  3SQ1 A;  4B1W B;  4FWO A;  3HVT A;  3MDQ A;  3R1X A;  3TU5 A;  3D7E O;  1U04 A;  4CJL A;  3O4N A;  1ZBH A;  3R8E A;  1HQU A;  4M41 A;  2V7Z A;  4CBW A;  3RVC A;  3WNE A;  1YI2 N;  1SKS A;  2UUB K;  3THX B;  4FJ9 A;  1XNR K;  3WEE A;  2IC3 A;  2OZS A;  1YVN A;  4FJN A;  3QML A;  4AIL C;  2GUI A;  4KH4 A;  4O0I A;  5BPM A;  1NK0 A;  1HNW K;  3LL3 A;  4H03 B;  1WAJ A;  3O9U A;  4DTJ A;  4JNE A;  4DV5 K;  3HTV A;  3AVB A;  5AQF A;  3WEE B;  3VQ4 A;  3WXK A;  4M7X A;  1EX4 A;  5EOY A;  1HQE A;  4FW1 A;  2Q2R A;  4RTF D;  3N4Q A;  5AZI A;  1C1C A;  4B1V A;  1NK8 A;  1NJW A;  4FWL A;  1I94 K;  2FXU A;  1B9F A;  2WC9 A;  4DKW A;  3KKR A;  2O8C B;  1C0G A;  3H1Q A;  3VPZ A;  4JKC A;  3LM2 A;  4LY7 A;  3THW A;  2D0B A;  5C24 A;  1YHQ N;  1BCM A;  1JLC A;  2P9N A;  2WFB A;  3DJC A;  1TK0 A;  2FSK A;  5LY3 A;  2JWK A;  2VG7 A;  3HPH A;  1J9A A;  3OYB A;  4KO0 A;  2QK9 A;  1RIL A;  4FCY A;  4X64 K;  5JS1 A;  1XMQ K;  3VQ8 A;  5E26 A;  1RDA A;  5F1X A;  3NH2 A;  4OPH A;  5GAE P;  1UAX A;  4H5R A;  5M1F A;  4M3W A;  4DSL A;  4CJS A;  1HYV A;  1S1U A;  1QQM A;  3AO4 A;  4BR2 A;  3HM9 A;  4FM0 A;  2P9N B;  3C7N B;  1KTQ A;  4BE0 A;  2KZZ A;  1XQS C;  3K5M A;  4BRD A;  5ELZ A;  1KFS A;  1QTM A;  3TAG A;  3O80 A;  4F3T A;  1N5Y A;  3THX A;  2BAN A;  1K73 O;  3BEX A;  5LL6 Z;  3MN9 A;  3UKU A;  2HST A;  1R59 O;  4JK7 A;  3RMC A;  1IKX A;  4M3Y A;  4NLB A;  4CJF A;  2HF3 A;  1MDU B;  3H3N O;  4CJT A;  1YJN N;  1BIS A;  3TAQ A;  4I2Q A;  3CPW M;  4JS4 A;  4FLT A;  2VCP A;  3E01 A;  4C8L A;  5FPN A;  2G8U A;  5KGW A;  1JLE A;  1KC8 O;  5AQS A;  3TTD A;  1KLM A;  2QA4 N;  3WNF A;  1K9M O;  5EU7 A;  2FLO A;  2O8C A;  1ZBI A;  4X66 K;  3M8S A;  3NGY A;  4DQI A;  4FOE A;  2NRR A;  3DYA A;  1Q7Y O;  4B1X B;  3NE6 A;  2ASM A;  1CZB A;  2NRH A;  2Q97 A;  5C2D A;  3KK1 A;  1FJG K;  3A0I X;  4GKJ K;  1UOC A;  4BRC A;  2WUS A;  1CZ9 A;  3K5N A;  3DRR A;  1F21 A;  4E7J A;  4H0V B;  4FJ7 A;  1DTT A;  3U4L A;  5M1P A;  3OS1 A;  3EZW A;  1CXQ A;  2O4G A;  4RW6 A;  3CJC A;  3O6W A;  2QWO A;  4DV6 K;  4JI2 K;  3L8B A;  3D45 A;  3IDH A;  1HMV A;  1IO2 A;  3K5O A;  4K0K K;  3M1F A;  3QEI A;  5BRD A;  2HVH A;  4EZ9 A;  1NGJ A;  1RDD A;  2A6A A;  3ZSY A;  4TSX A;  5C10 A;  5T7B A;  5HRR A;  3OBW A;  5JVG L;  2YHA A;  5HRO A;  1S9E A;  3KHY A;  3VQE A;  3DRP A;  4GVE A;  1TYQ A;  3P83 D;  1YXQ A;  1Q8I A;  2A41 A;  3OYN A;  1CZA N;  5AZJ A;  3TAM A;  3NAE A;  1N36 K;  1NGC A;  3QEV A;  2HB5 A;  5D3G A;  3C0B A;  1SL2 A;  3QES A;  1MWK A;  1TVR A;  1VQO N;  5FRM A;  3VQA A;  2V52 B;  3THV A;  3V9X A;  5I42 A;  4Z4G A;  3K2P A;  2XY5 A;  5JVH L;  2FF3 B;  4LFA K;  3NVK A;  3LWM A;  3MXM A;  3ZET B;  2QWP A;  5AQQ A;  4HUE A;  3VQC A;  1NM1 A;  4C8N A;  3OYM A;  4FJI A;  1JKH A;  4N56 A;  3ID8 A;  1VK0 A;  4FLX A;  2KLA A;  1UA1 A;  2VGN A;  3TR8 A;  1RT2 A;  2IVO A;  3ID6 A;  1BU6 O;  1N32 K;  2ATQ A;  2XY7 A;  4FW2 A;  2A42 A;  4B1Y B;  4LF7 K;  3JAM O;  4E89 A;  3ZET A;  1X9M A;  2GWK A;  2JGU A;  4EP5 A;  1NMD A;  5CZ1 A;  1NWK A;  3HJF A;  2D1K A;  1RDU A;  3P4I A;  1IG9 A;  4M3Z A;  1Q82 O;  2ITG A;  5GIO A;  4Z0U A;  4DR4 K;  4CJQ A;  1IKV A;  3VQ6 A;  1OVY A;  2X78 A;  2OPQ A;  1FKP A;  1IBL K;  4E1J A;  3K0S A;  1JLQ A;  2KTQ A;  4JD2 B;  2DFH A;  4DTP A;  3FGU A;  4ELV A;  4FVU A;  4B9L A;  3ZSQ A;  3SAH A;  4IO9 L;  3L0Q A;  2CGL A;  5J2M A;  3ZSV A;  4CGF A;  1YJW N;  5AQZ A;  3VET A;  3K9K A;  1GLA G;  1LOT B;  5AQV A;  4O8K A;  3VEZ A;  1KD1 O;  4FJ8 A;  1KLN A;  3CI5 A;  4JI3 K;  4KHS A;  4QS9 A;  3EZ5 A;  4CEB A;  2P1J A;  3KTQ A;  4BGB A;  5FRO A;  4PWD A;  1KXP A;  4KB1 A;  4MLE A;  4JI6 K;  3VQQ A;  4EAH D;  2W42 A;  1I39 A;  5JMV A;  4DU1 A;  5LMU K;  3NVM A;  2OZM A;  1E4G T;  4LF8 K;  2HBL A;  3L4I A;  4RW8 A;  2GEL A;  2GX9 A;  4A62 A;  2VG5 A;  5FPE A;  4B9V A;  4JRP A;  1RT6 A;  1B9D A;  3VGL A;  4KTW A;  4CFA A;  2OYQ A;  1EO1 A;  1C0M A;  2E2O A;  4A57 A;  3CFR A;  4ELT A;  3AVI A;  2D5R A;  1JLG A;  3GOI A;  4JN4 A;  3ZSW A;  2KHO A;  5FPM A;  4W5N A;  1GOA A;  5HRN A;  4DS4 A;  4CF8 A;  1NKE A;  3FZK A;  5LJV A;  2DFF A;  3BY5 A;  4HWI A;  5DM6 L;  2PZS A;  4AM6 A;  2Q0U A;  3WNG A;  4H5W A;  3VOV A;  1BHL A;  2ZWH A;  2E6M A;  3HOT A;  4IG3 A;  3RR8 A;  3KK7 A;  1FW6 A;  3AVJ A;  1HNI A;  3HXM A;  3CME N;  1RGI A;  4JI5 K;  1QZ5 A;  4CBX A;  4B3O A;  2V51 B;  3LM9 A;  3NGI A;  3MK6 A;  1N8R O;  1WBD A;  2X74 A;  1XI1 A;  4JD2 A;  4B8C A;  5HOO A;  1REV A;  1X9S A;  1IJJ A;  4DQP A;  4QOZ B;  5KPT A;  3C95 A;  3SCX A;  2WON A;  5AQI A;  1KAZ A;  1L3S A;  4O5B A;  4W5T A;  4LFC K;  5B8H A;  1XC9 A;  2P5G A;  3AAQ A;  2Y1J A;  2FBT A;  4L3Q A;  4MQ3 A;  4G1Q A;  3ENB A;  4K43 A;  1NK5 A;  3C94 A;  4KHQ A;  3HPG A;  1T7P A;  3C65 A;  4YOW A;  4JKF A;  5EVZ A;  1FKO A;  5EXW A;  4DQR A;  2HBM A;  3KKS A;  4CK1 A;  3AO2 A;  5DMR A;  1TKZ A;  1WNS A;  3AA2 A;  3SBG A;  3DI6 A;  2I7P A;  4UY8 O;  3PIP L;  1B92 A;  3T1H K;  3ZSR A;  3TI0 A;  3IFR A;  3L2W A;  2HMI A;  4LH4 A;  3VGK A;  3CET A;  4PKH A;  1ASV A;  2YKM A;  3K9J A;  5FDL A;  3NHG A;  1O1W A;  2ASP A;  1RDC A;  4JKB A;  4H0T B;  3MX2 A;  3P1G A;  1C0F A;  3CCU N;  1HNX K;  4H4M A;  3OVN A;  3IAY A;  2P9L B;  4OVL A;  2H3G X;  4M63 C;  1WOQ A;  4A61 A;  4FJM A;  4A59 A;  3F2K A;  2YNI A;  4E7H A;  2QWL A;  4E3S A;  4F8R A;  4CF2 A;  3CQY A;  3QIC A;  4DMN A;  3DXK B;  4GKK K;  3AV9 A;  3IRX A;  3KWG A;  4BRP A;  4DR3 K;  5AJ3 K;  4CJ5 A;  1JL1 A;  5KRT A;  4K8X A;  1KAX A;  2E6L A;  1RBS A;  3S9H A;  4LF6 K;  4CHN A;  2W40 A;  2P5O A;  5TKW A;  2CH5 A;  4OGC A;  1GLD G;  1VQ6 N;  3J7A P;  3MEG A;  4BRI A;  2HHS A;  1VRU A;  3PSF A;  1WB9 A;  3NF8 A;  3P5J A;  3L4Q A;  4DCH A;  1TK5 A;  3QER A;  3HSC A;  4KHU A;  2F9T A;  3NF7 A;  1BQN A;  2KFZ A;  2PBD A;  2IVP A;  3SPZ A;  4C1N I;  1GLJ O;  3TTF A;  5CYQ A;  1IKY A;  3I56 N;  3VQ9 A;  4F4K A;  4CZE A;  4KKO A;  1VQ9 N;  4CF1 A;  1J6Z A;  3SYZ A;  3QEP A;  3JSM A;  4GVM A;  1WSJ A;  3V9W A;  4JK9 A;  3V81 A;  4Z4F A;  2QTD A;  5AQJ A;  4E7I A;  5CZ2 A;  5KGX A;  3A5O C;  2GEM A;  3KK2 A;  4BC3 A;  3QIN A;  3WXJ A;  3NBP A;  4G9Z A;  3SMP A;  4HCC A;  3KLF A;  1ZBF A;  4YDU C;  2EX3 A;  3QFP A;  4FK4 A;  3LAK A;  4CHZ A;  1JCE A;  3GBT A;  4ZTF A;  3KIO A;  2FSN A;  2HOE A;  3ATV A;  1VHX A;  3DRS A;  5F0X A;  4O4G A;  3SJH A;  1VQL N;  4FJK A;  4U67 L;  1RT4 A;  4CGJ A;  3A5M C;  3HL8 A;  4AHS A;  2PYL A;  3MED A;  5HBM A;  4FLU A;  1NOY A;  1LWF A;  3MMV A;  3ZT3 A;  3KJV A;  1RTI A;  4CGH A;  1RBV A;  4QS8 A;  4CCH A;  1K8K B;  3MEC A;  3V6D A;  1WSF A;  2P9P B;  2YHX A;  2P9K B;  4PY5 A;  2RHK A;  4ILG B;  3LAM A;  4AHV A;  5AQT A;  2QEX N;  1DTQ A;  1U47 A;  1JXE A;  4N76 A;  3U8X A;  3DLB A;  2GTD A;  4CJ7 A;  2E4L A;  4C23 A;  3KD5 E;  1JCF A;  2OA8 A;  1Z25 A;  4CD3 A;  3MWP A;  4GV3 A;  4FJH A;  2QI2 A;  1VSJ A;  1YTA A;  4FWP A;  4OPK A;  4M45 A;  3MEE A;  4YOY A;  3EKS A;  4DQQ A;  1C0T A;  3MN6 A;  2LSN A;  4CK3 A;  2P9I A;  4WFA L;  4CEA A;  3ZX3 A;  3I8B A;  4JKH A;  4B9T A;  4XIU A;  1RDW X;  1IBM K;  1U2V B;  3OA9 A;  4DF4 A;  1U4B A;  5HLF A;  1J53 A;  4OKE A;  3B6O A;  3D2E A;  5KQ8 A;  4LC9 B;  3OBY A;  2D0C A;  5TKY A;  1Q86 O;  1NGD A;  2B6A A;  2P9S A;  3L2R A;  4GW6 A;  4IFV A;  4WQ4 C;  2D0P A;  2Q36 A;  4K8Z A;  4IDK A;  5M1N A;  2Y1I A;  4IFE A;  4FOI A;  1WSI A;  1WN7 A;  1ATR A;  5E41 A;  3VEW A;  2E2Q A;  3SJJ A;  5EY4 A;  3S3M A;  3KLI A;  1EQY A;  3CCV N;  3O9T A;  3TTC A;  3PY8 A;  1W9H A;  5AQU A;  3AGK A;  3FFI A;  4W5R A;  4DLE A;  4NXN K;  2IOC A;  1ESV A;  2FBV A;  3ZCM A;  1C0U A;  4QCL A;  1SS6 A;  1P90 A;  1W2B M;  3VA3 A;  5GAH P;  2G8F A;  2HHT A;  3LDP A;  5ADX H;  2ETJ A;  1QSY A;  2QKB A;  3F5T A;  2DTU A;  1SKW A;  1QSS A;  4ICL A;  4GV6 A;  4KRF A;  3IUC A;  5HP1 A;  2HBJ A;  2AJQ A;  3SAF A;  3PSI A;  3K5L A;  3OYI A;  3T19 A;  5AQK A;  1NLV A;  2VGM A;  4LF5 K;  1DGK N;  4JI1 K;  1T6C A;  2AA4 A;  3C6U A;  3CC4 N;  3L2Q A;  5AFU A;  4MLH A;  2QWR A;  4B9Q A;  4CBU A;  4PL7 A;  4OKK A;  4E19 A;  3TAF A;  4JI7 K;  3Q7C A;  1CXU A;  2E88 A;  4FM1 A;  5J2Q A;  3BZK A;  3DLR A;  2V7Y A;  3LDN A;  1S3X A;  3O9S A;  3O4Q A;  3QLH A;  1LWE A;  4DTU A;  3U9D A;  2AP1 A;  3CMA N;  3HK2 A;  1OVQ A;  4R5P A;  1VAZ A;  4LH5 A;  5AQL A;  5AFU H;  1XUP O;  3UKR B;  3J81 O;  3OYH A;  2W6K A;  4LD0 A;  2G8V A;  1TKX A;  4NO7 A;  4M7Y A;  5BR8 K;  3BGR A;  1EWR A;  4FJL A;  3IKM A;  4IFY A;  2Z1H A;  2P9P A;  1QHA A;  3EEQ A;  1D5A A;  1W0H A;  4DSJ A;  1SQK A;  4EIA A;  1T8E A;  4FK0 A;  3RMB A;  3O9Q A;  1X3N A;  4RCH A;  1BWF O;  3CM5 A;  4RWT A;  1JCG A;  1OH8 A;  2GWJ A;  3DOK A;  4K41 A;  3LDO A;  3OYC A;  2WOM A;  4IOC L;  3EL2 A;  4FJ5 A;  4DV3 K;  4PHT X;  1TKD A;  4WYB A;  1LAV A;  4ID1 A;  3H6E A;  3ZT2 A;  3LP2 A;  2O4I A;  1D8Y A;  1NJI O;  1VQK N;  4GV9 A;  1TAQ A;  3B8A X;  4GMJ B;  1YAG A;  3K59 A;  4M3T A;  3KVG A;  1WSE A;  2F8T A;  1T03 A;  2F8S A;  3AVH A;  4Q0B A;  4XH1 A;  5AQO A;  4FZZ A;  4CEE A;  4CI6 A;  2HW3 A;  4YOR A;  3VES A;  1HR0 K;  4EHT A;  4J2A A;  3UKR A;  4E1M A;  3AAR A;  3HM8 A;  5JLF A;  1RT7 A;  4A2B A;  3OYA A;  4BVP A;  3AA3 A;  4IKF A;  4BC2 A;  3QDK A;  3ATU A;  3NGZ A;  1RT1 A;  3MN7 A;  3HOS A;  2XRI A;  2YKN A;  3L3U A;  1D4X A;  2X6S A;  3PX6 A;  2E1Y A;  1KVC A;  3D2F A;  1GLB G;  4BG8 A;  3T1A A;  3SLC A;  2WBN A;  3H1V X;  4Z4C A;  2F4V K;  4FPB A;  4BC4 A;  3CER A;  2QKK A;  4JK8 A;  4M3R A;  3AVC A;  3ALY A;  3HP9 A;  4CJ4 A;  4OLB A;  3GG4 A;  3H08 A;  1HPM A;  4N5S A;  4ZHR A;  3QET A;  4CZK A;  3LDQ A;  4PKI A;  3LZI A;  4FPA A;  4DTR A;  5BN9 A;  1UA0 A;  1KRP A;  1WSG A;  3CJ1 A;  1HLU A;  1RFQ A;  3TSU A;  3OTO K;  3SQ4 A;  1A5X A;  5BRE A;  3P39 A;  4AHU A;  1DEJ A;  1JJ2 M;  2ZGY A;  4YOU A;  4E7K A;  1BA1 A;  1HRH A;  4CJK A;  2VWB A;  1ZYQ A;  4FYD A;  3MN5 A;  2VWJ A;  3GDQ A;  2NRV A;  2G8K A;  3IG1 A;  3O08 A;  1TYQ B;  1S5J A;  3A2F A;  1VSL A;  3CG7 A;  2VQF K;  4J2B A;  5C0Y A;  1EP4 A;  1NK4 A;  4E1N A;  2WTU A;  4RG8 A;  1VSE A;  5AQY A;  5KRS A;  1L3T A;  5GIN A;  4CHY A;  4BGA A;  4IOX A;  2PYJ A;  3NF9 A;  4CHP A;  4BG9 A;  2QWM A;  3LP1 A;  3FZF A;  4I6M B;  1Z6R A;  1U6Z A;  4DSI A;  5AQX A;  4FXD A;  3O3F A;  1NNE A;  2HBK A;  3SMS A;  3CJA A;  2YHB A;  5BRH A;  4BVO A;  2RPI A;  4CHQ A;  2W6L A;  2Q3S A;  4FZX C;  4DFJ A;  2UUA K;  1I3A A;  2P9I B;  2A3Z A;  2CGJ A;  2E8A A;  3DOL A;  4B9M A;  4BRG A;  2E2N A;  1NGG A;  4IOA L;  5LMN K;  3CM6 A;  4Y1D A;  2ZM6 K;  4H5T A;  1KQS M;  3CIP A;  4ILJ A;  4B3S K;  2KZM A;  4CIG A;  3L2V A;  2P9U A;  3VQD A;  2HHV A;  1JLF A;  3MX5 A;  3V9S A;  4DUZ K;  3J8A A;  4MO4 A;  3AA5 X;  1SAZ A;  5FPD A;  4YHH K;  4BDZ A;  4JI4 K;  4DU3 A;  3ZEU A;  1FK9 A;  1T6D A;  2GUP A;  4DQS A;  1HKB A;  2YNH A;  4KBO A;  3M8Q A;  3E66 A;  1C1A A;  3AVN A;  5CYM A;  2NRZ A;  5IT9 O;  2P9U B;  1NGA A;  3A5N C;  4NB4 A;  2XY8 A;  1M90 O;  4KI4 A;  4DUY K;  3ZT0 A;  4FWQ A;  3BDP A;  1QVF M;  2RKI A;  3O1W A;  3S41 A;  3K58 A;  2JWL A;  3ULE A;  3WXL A;  4PQU A;  2GV9 A;  3J7Z O;  3RRH A;  3U3G A;  3SZ2 A;  4IWV A;  1MWM A;  2D4W A;  3LP3 A;  3QNN A;  4GNI A;  3CJB A;  4AHR A;  3RR7 A;  3LDL A;  5GAG P;  3SUP A;  3DAW A;  2Z1G A;  2I5J A;  2NRT A;  4EFH A;  3U9Z A;  3RSE A;  3PIO L;  4A2A A;  3VTI A;  4FLW A;  1QHT A;  1GLE G;  4CJV A;  4B3R K;  2KKZ A;  3TAN A;  4JYA K;  3O4W A;  3A8Y A;  2G8I A;  3FLC O;  2NNW A;  4F9O A;  3PO4 A;  5AQN A;  1BG3 A;  1UWB A;  1E4F T;  1DKG D;  3SPY A;  4CEQ A;  4H0O A;  4Z94 A;  4OPA A;  4J2D A;  4CFB A;  2DPN A;  3BF3 A;  4W5O A;  3NH0 A;  4KFB A;  4WE1 A;  1K8K A;  3MXJ A;  4BRM A;  3AA4 A;  1KVA A;  4KI6 A;  3ULE B;  4KAZ A;  2IS3 A;  5AQM A;  5M1K A;  4C1N K;  1X9W A;  3V1R A;  1BQM A;  1BIU A;  1J5E K;  3ZT4 A;  1GLF O;  3ZSZ A;  3CHW A;  1FXX A;  3T1Y K;  2E20 A;  4N47 A;  4IBN A;  3EN9 A;  3S3O A;  4CEZ A;  5M1Q A;  1X1P A;  1S22 A;  2RE2 A;  1ASW A;  3OYL A;  4KHY A;  4I7F A;  4YDU A;  1KVB A;  3BP8 A;  3ZEU B;  3EE8 A;  3I55 N;  2OTL N;  4CFC A;  5AQW A;  3CCR N;  4C8K A;  1TV6 A;  5IWA K;  4KTQ A;  2ZQB A;  1KSP A;  2XY6 A;  4ISE A;  4DV7 K;  5C25 A;  1NGE A;  2E2P A;  3SQ2 A;  2BE2 A;  3VEN A;  4H5N A;  5GIP A;  1HX1 A;  1S1T A;  5AZI B;  3VQP A;  3OW2 M;  4ELU A;  4BRL A;  3OHR A;  5FRN A;  4BDY A;  1GOC A;  4DR7 K;  1V4S A;  4OX9 K;  1JLB A; 
#chains in the Genus database with same CATH homology
 1UOC A;  4OPK A;  4M45 A;  3MEE A;  1CZ9 A;  1S1W A;  4CJE A;  4DQQ A;  3K5N A;  3DRR A;  1F21 A;  1C0T A;  1S1X A;  4E7J A;  3VQB A;  2LSN A;  4CK3 A;  2HND A;  3RWU A;  4FJ7 A;  1DTT A;  1S6Q A;  4CEA A;  4KB0 A;  1VRT A;  4W5Q A;  3OS1 A;  4B9T A;  1RCH A;  1CXQ A;  2O4G A;  3LAL A;  4RW6 A;  4CJP A;  4B8A B;  4XIU A;  1SL1 A;  3V1O A;  2KQ2 A;  1VSK A;  4DF4 A;  4MFB A;  1U4B A;  4IG0 A;  5KI6 A;  4Z4H A;  4NCA A;  5HLF A;  1J53 A;  4CGG A;  4OKE A;  3M8P A;  3B6O A;  4BDP A;  2ZE2 A;  3L8B A;  2HHU A;  3D45 A;  3MAQ A;  2D0C A;  4RW4 A;  1HMV A;  2DY4 A;  3C6T A;  1IO2 A;  3K5O A;  1TGO A;  1BL3 A;  4NYF A;  4HHT A;  4CEO A;  2B6A A;  3AVL A;  1TK8 A;  3QEI A;  2RF2 A;  2HVH A;  3L2R A;  4EZ9 A;  1BI4 A;  1RDD A;  2ZD1 A;  5HRS A;  4YFU A;  3ZSY A;  4GW6 A;  4H4O A;  4IFV A;  4TSX A;  4DSK A;  5T7B A;  4YNQ A;  4K8Z A;  1RT5 A;  3HPO A;  4IDK A;  2Y1I A;  4F2R A;  5HRR A;  1WSI A;  1WN7 A;  5E41 A;  3HVR A;  1RDB A;  3SJJ A;  4FJG A;  3S3M A;  2IGI A;  3KLI A;  2YHA A;  3CFO A;  5HRO A;  2JLE A;  3TWH A;  2BGG A;  1C1B A;  4FLV A;  4NYN A;  2FC0 A;  1NK9 A;  1S9E A;  2VG6 A;  3PY8 A;  1W9H A;  3VQE A;  3DRP A;  4KPY A;  2FBY A;  3FFI A;  1K6Y A;  3P83 D;  4W5R A;  3OJS A;  4DLE A;  4DTN A;  1Q8I A;  1D9F A;  1SKR A;  2A1S A;  2IOC A;  3OYN A;  1BCO A;  1VSD A;  4OLA A;  3TAM A;  3NAE A;  4HTU A;  2FBV A;  4AHT A;  3ZCM A;  3QEV A;  2HB5 A;  1C0U A;  3LDS A;  3LP0 A;  5D3G A;  4QCL A;  1SL2 A;  3QES A;  4FM2 A;  3VA3 A;  2G8F A;  2HHT A;  3DLE A;  3TAR A;  2GBZ A;  1TVR A;  3ASM A;  2ETJ A;  3RMD A;  3MXI A;  1N6Q A;  1S1V A;  1QSY A;  1SKW A;  2QKB A;  1QSS A;  4ICL A;  4DFM A;  3VN5 A;  5FRM A;  4KRF A;  5HP1 A;  1VSH A;  4EP4 A;  3VQA A;  3F9K A;  3KD1 E;  2AJQ A;  3TAE A;  1TAU A;  3SUQ A;  1LWC A;  2YV0 X;  1SUQ A;  3K5L A;  3OYI A;  3AO3 A;  3T19 A;  3V9X A;  3THV A;  3OYG A;  5I42 A;  3K2P A;  4Z4G A;  2XY5 A;  4KV8 A;  3AVK A;  1WSH A;  3LWM A;  1HNV A;  5HRP A;  3MXM A;  1XHX A;  4JLH A;  3C6U A;  4HUE A;  3VQC A;  1LW2 A;  2HVI A;  4C8N A;  4CEF A;  1BI4 B;  3OYM A;  3L2Q A;  1NJY A;  4CER A;  1J54 A;  4CIE A;  4Z4I A;  1YTU A;  4HUF A;  4FJI A;  1JKH A;  3PO5 A;  4O0J A;  4I2P A;  4N56 A;  1VK0 A;  4OKK A;  4E19 A;  4FLX A;  1RTH A;  4DFK A;  3TAF A;  4JRQ A;  1UA1 A;  1CXU A;  3TR8 A;  4CED A;  1RT2 A;  4FM1 A;  3HO1 A;  4BE2 A;  4DTM A;  5J2Q A;  4FJJ A;  2ATQ A;  3AVM A;  3VA0 A;  2XY7 A;  3DLR A;  4E0D A;  1QS4 A;  4DTU A;  3QLH A;  3O4Q A;  1LWE A;  4FW2 A;  3AO1 A;  4E89 A;  1X9M A;  4OJR A;  3HK2 A;  2JGU A;  4EP5 A;  1VSM A;  5CZ1 A;  4CHO A;  4R5P A;  3DM2 A;  4LH5 A;  1LW0 A;  3HJF A;  4OPJ A;  3EYZ A;  3OYH A;  4FJX A;  3VQ5 A;  3QO9 A;  1U49 A;  1QSL A;  4LD0 A;  2G8V A;  1TKX A;  3F73 A;  4KHW A;  1IG9 A;  3BGR A;  4M3Z A;  2ITG A;  5J1E A;  5J2N A;  4FJL A;  4Z0U A;  1S9G A;  4IFY A;  1HPZ A;  2Z1H A;  1D5A A;  4EZ6 A;  4CJQ A;  1IKV A;  1QE1 A;  1W0H A;  4DSJ A;  3V9Z A;  3VQ6 A;  2X78 A;  1HYZ A;  1T8E A;  1NKB A;  1QQC A;  2OPQ A;  1FKP A;  4FK0 A;  3RMB A;  4RW7 A;  4M3U A;  3SUO A;  3V9U A;  1SL0 A;  1IKW A;  2NUB A;  2VWK A;  2KTQ A;  1JLQ A;  3CM5 A;  2DFH A;  3SUN A;  4DTP A;  1A5W A;  1TKT A;  4DSE A;  4DTS A;  4ELV A;  3OYF A;  3ZSQ A;  4B9L A;  3CYM A;  3PV8 A;  4CJR A;  5SZT A;  3LPU A;  4O55 A;  5J2M A;  3ZSV A;  4CGF A;  3JYT A;  4CJ3 A;  3DOK A;  1TL3 A;  3OYC A;  4ZTF A;  2WOM A;  4C8O A;  3S3N A;  4FJ5 A;  4KTZ A;  3NH1 A;  1TKD A;  1LAV A;  2XHB A;  1KLN A;  1JLA A;  4ID1 A;  1VSI A;  3ZT2 A;  1T05 A;  4FJ8 A;  3LP2 A;  1ZBU A;  3OYK A;  2O4I A;  1D8Y A;  4DS5 A;  4KHS A;  3EZ5 A;  4CEB A;  1TAQ A;  2P1J A;  4GMJ B;  3TAP A;  3KTQ A;  3K59 A;  4M3T A;  4AH9 A;  5FRO A;  5I3U A;  1WSE A;  2F8T A;  4PWD A;  1T03 A;  2F8S A;  3AVH A;  4DSF A;  4KB1 A;  4Q0B A;  3VQQ A;  1NKC A;  2W42 A;  4FZZ A;  1I39 A;  4DU1 A;  4CEE A;  2HW3 A;  3LAN A;  2OZM A;  4E7L A;  1KFD A;  3PX0 A;  2DFE A;  4J2A A;  4OKJ A;  1BIZ A;  4E1M A;  4PUO A;  3T3F A;  2EHG A;  4RW8 A;  3DLK A;  4B9V A;  2VG5 A;  1RT7 A;  1KCF A;  4JRP A;  1RT6 A;  1B9D A;  3OYA A;  3AA3 A;  4KTW A;  4CFA A;  3QEW A;  4IKF A;  4CF0 A;  2OYQ A;  4UQG A;  1RBR A;  1C0M A;  3L2U A;  4DTO A;  3CFR A;  4DU4 A;  4ELT A;  2P51 A;  3AVI A;  2D5R A;  1JLG A;  4CGI A;  1RT3 A;  3ITH A;  3ZSW A;  3NGZ A;  1RT1 A;  3RRG A;  2IDO A;  2XRI A;  2YKN A;  3L3U A;  4W5N A;  3OJU A;  1GOA A;  5HRN A;  4LSL A;  4J2E A;  4LSN A;  2X6S A;  4DS4 A;  3PX6 A;  2HHW A;  5C42 A;  3SI6 A;  4CF8 A;  1NKE A;  1KVC A;  1VSF A;  1L3U A;  3QIO A;  4B9U A;  2OPR A;  1NK7 A;  2DFF A;  3OS2 A;  3NCI A;  4FLY A;  4JS5 A;  1A5V A;  3HP6 A;  3G0Z A;  4CIF A;  3T1A A;  4M3X A;  2DTU A;  4CK2 A;  4Z4C A;  3SV4 A;  2PZS A;  3WNG A;  2QKK A;  1IH7 A;  4M3R A;  1BHL A;  3U6F A;  3AVC A;  2IAJ A;  3HP9 A;  3ALY A;  4CJ4 A;  4OLB A;  3H08 A;  2E6M A;  4N5S A;  2RN2 A;  4ZHR A;  3OS0 A;  4IG3 A;  3QET A;  3RR8 A;  3LZI A;  5J2P A;  4DTR A;  1UA0 A;  1KRP A;  4KHN A;  4B9S A;  1WSG A;  3AVJ A;  4FK2 A;  1HNI A;  3HXM A;  3SQ4 A;  1A5X A;  1NOZ A;  4AHU A;  3KLE A;  4E7K A;  1ZYQ A;  1HRH A;  4CJK A;  4CF9 A;  4FYD A;  4B3O A;  4BWJ A;  2VWJ A;  1YT3 A;  4NCG A;  2Z1I A;  4B9N A;  3NGI A;  2G8K A;  3IG1 A;  4ID5 A;  4Y1C A;  5CY4 A;  1S5J A;  3ULD A;  4DLG A;  3A2F A;  4KTQ A;  3AO5 A;  3SQ0 A;  1VSL A;  3CG7 A;  2X74 A;  3DMJ A;  1XI1 A;  4B8C A;  4J2B A;  1REV A;  2F96 A;  1EP4 A;  1NK4 A;  3AVG A;  2XO7 A;  5JS2 A;  4E1N A;  1HYS A;  1X9S A;  4RG8 A;  1VSE A;  4O44 A;  4DQP A;  5KRS A;  1L3T A;  4QOZ B;  3PX4 A;  4CHY A;  3C95 A;  4Q5V A;  3SCX A;  1ITG A;  2WON A;  2PYJ A;  3O3H A;  3O3G A;  1L3S A;  1WLJ A;  1Y97 A;  4NCB A;  1DLO A;  3AVF A;  4O5B A;  1EET A;  4W5T A;  3HT3 A;  3NF9 A;  4CHP A;  3UIQ A;  4PA1 A;  3ZT1 A;  2A1R A;  3OYD A;  3B6P A;  3LP1 A;  1XC9 A;  1TL1 A;  3HST B;  2P5G A;  2B4J A;  4DSI A;  3WNH A;  4FXD A;  3O3F A;  2Y1J A;  1HJR A;  3LWL A;  4FLZ A;  2FBT A;  4MQ3 A;  1LV5 A;  4G1Q A;  4C8M A;  1NK5 A;  1CLQ A;  3C94 A;  4KHQ A;  3HPG A;  1T7P A;  1U48 A;  2BDP A;  2YHB A;  3QNO A;  1Q9Y A;  3NDK A;  1FKO A;  4DQR A;  4HUG A;  2OPS A;  1NK6 A;  3KKS A;  4CK1 A;  3ISN C;  2RPI A;  4DWI A;  3AO2 A;  4CHQ A;  4B08 A;  2Q3S A;  3SNN A;  4BE1 A;  5DMR A;  4FZX C;  1NJZ A;  1TKZ A;  1WNS A;  3AA2 A;  4DFJ A;  1I3A A;  3DI6 A;  4CFD A;  1JL2 A;  3CFP A;  1L3V A;  4M42 A;  4B9M A;  3DOL A;  4CE9 A;  2HNY A;  3SQ1 A;  1B92 A;  3HVT A;  2G8W A;  3M8R A;  3ZSR A;  3TI0 A;  1U04 A;  4CJL A;  3O4N A;  1ZBH A;  3RMA A;  1L5U A;  3L2W A;  3EY1 A;  2HMI A;  1HQU A;  4M41 A;  4CJW A;  1J5O A;  4LH4 A;  3CM6 A;  4Y1D A;  3WNE A;  1SKS A;  1ASV A;  2YKM A;  4FJ9 A;  2KZM A;  3KLG A;  5FDL A;  4CIG A;  3L2V A;  3NHG A;  2IC3 A;  1O1W A;  3VQD A;  1RDC A;  2HHV A;  2OZS A;  3I0R A;  1JLF A;  4FJN A;  3V9S A;  3P1G A;  4AIL C;  2GUI A;  4O0I A;  3AA5 X;  4H4M A;  3V4I A;  3OVN A;  1NK0 A;  3IAY A;  3OY9 A;  4OVL A;  3SPY A;  3HYF A;  1WAJ A;  4BDZ A;  4DTJ A;  4DU3 A;  1WAF A;  1FK9 A;  4FJM A;  3NFA A;  5KTQ A;  2YNI A;  4E7H A;  4DQS A;  4E3S A;  3AVB A;  3QIP A;  3ZSX A;  4F8R A;  2YNH A;  3M8Q A;  4CF2 A;  3VQ4 A;  1C1A A;  3AVN A;  5CYM A;  4DMN A;  4F3O A;  1EX4 A;  1Q9X A;  2OPP A;  3AV9 A;  3IRX A;  2FBX A;  1HQE A;  4FW1 A;  4H8K A;  3LZJ A;  2KW4 A;  4N41 A;  2XY8 A;  5KRT A;  4CJ5 A;  1JL1 A;  4K8X A;  4KI4 A;  3ZT0 A;  3BDP A;  2E6L A;  1C1C A;  2RKI A;  1RBS A;  2YNF A;  1NK8 A;  4HCB A;  3S9H A;  3PUF A;  1NJW A;  4Z4E A;  2HHQ A;  3K58 A;  1B9F A;  4CHN A;  3KKR A;  3DLG A;  4PQU A;  2GV9 A;  3RRH A;  1YVU A;  2P5O A;  3OYJ A;  5K14 A;  4OGC A;  3U3G A;  4CEC A;  3SZ2 A;  3LP3 A;  3QNN A;  1RTD A;  4LY7 A;  3MEG A;  2HHS A;  2D0B A;  3U3Y A;  4AHC A;  1VRU A;  5C24 A;  4AHR A;  4CJU A;  3D0P A;  1U45 A;  1BCM A;  1JLC A;  4RW9 A;  1TK0 A;  3RR7 A;  3NF8 A;  4L8R B;  3QEX A;  3P5J A;  3SUP A;  2VG7 A;  1TK5 A;  1D9D A;  3QER A;  2Z1G A;  3HPH A;  3OYE A;  2I5J A;  4KHU A;  1J9A A;  3OYB A;  3NF7 A;  2B5J A;  4KO0 A;  2QK9 A;  1RIL A;  1BQN A;  4FCY A;  2G8H A;  4I9Q A;  3V1Q A;  4FLW A;  2KFZ A;  1ZBL A;  5JS1 A;  1QHT A;  4FVM A;  3VQ8 A;  4CJV A;  3SPZ A;  1RDA A;  1R0A A;  1RNH A;  3TAN A;  3NH2 A;  2PY5 A;  4F2S A;  2G8I A;  5CYQ A;  1UAX A;  1IKY A;  4M3W A;  4DSL A;  4CJS A;  3AVA A;  1ASU A;  3VQ9 A;  1HYV A;  3PO4 A;  1S1U A;  4F4K A;  3AO4 A;  4KKO A;  1UWB A;  3HM9 A;  4FM0 A;  2QXF A;  4CF1 A;  3VQ7 A;  4CEQ A;  3L3V A;  4I9L A;  1KTQ A;  4OGE A;  4BAC A;  4BE0 A;  3SYZ A;  2KZZ A;  3IS9 A;  3QEP A;  3JSM A;  4J2D A;  4GVM A;  4CFB A;  3K5M A;  1WSJ A;  4CES A;  4W5O A;  3NH0 A;  3V9W A;  4KFB A;  4WE1 A;  3V81 A;  4ZTJ A;  4Z4F A;  4E7I A;  1KFS A;  5CZ2 A;  3I8D A;  3CQ8 A;  3TAG A;  1QTM A;  3MXJ A;  5KGX A;  4F3T A;  3AA4 A;  1N5Y A;  3TAB A;  1KVA A;  3KK2 A;  4KI6 A;  2BAN A;  3QIN A;  2R7Y A;  1G15 A;  3NBP A;  4KAZ A;  3NF6 A;  4QAG A;  2IS3 A;  1XWL A;  4HCC A;  3RMC A;  3I0S A;  1IKX A;  3KLF A;  4M3Y A;  1ZBF A;  3G10 A;  1X9W A;  1RTJ A;  1LAW A;  2EX3 A;  3V1R A;  1BQM A;  1BIU A;  3K57 A;  4FK4 A;  3LAK A;  1RBT A;  4CHZ A;  3ZSO A;  1EKE A;  3KIO A;  4CJF A;  3ZT4 A;  3ZSZ A;  4CJT A;  4DTX A;  1GOB A;  1BIS A;  3TAQ A;  1FXX A;  5SWM A;  1EXQ A;  4I2Q A;  4N47 A;  4IBN A;  4JS4 A;  4FLT A;  2X6N A;  3DRS A;  3S3O A;  4CEZ A;  1RBU A;  4O4G A;  1JXB A;  2YNG A;  4FJK A;  1X1P A;  1RT4 A;  4CGJ A;  1ASW A;  3OYL A;  3HL8 A;  4I7F A;  3E01 A;  4AHS A;  2PYL A;  4KHY A;  2KFN A;  3MED A;  4C8L A;  5HBM A;  1KVB A;  1C6V A;  4DF8 A;  2D0A A;  4HVJ A;  2G8U A;  4FLU A;  1MU2 A;  1NOY A;  1LWF A;  5KGW A;  1NJX A;  3ZT3 A;  1JLE A;  1RTI A;  3KJV A;  4CGH A;  1RBV A;  4CFC A;  3KK3 A;  4C8K A;  4CCH A;  1TV6 A;  1S6P A;  3MEC A;  1WSF A;  4BWM A;  1SV5 A;  4CGD A;  5DK5 A;  3RTV A;  1KLM A;  3V6D A;  2ZQB A;  3WNF A;  1KSP A;  2XY6 A;  4DG1 A;  5EU7 A;  4PY5 A;  5C25 A;  4DFP A;  3LAM A;  4AHV A;  1XHZ A;  1DTQ A;  3SQ2 A;  1JXE A;  1U47 A;  2HNZ A;  1ZBI A;  3DLH A;  2BE2 A;  4N76 A;  3M8S A;  3KLH A;  3NGY A;  4DQI A;  3DLB A;  4KRE A;  2Z1J A;  4FZY A;  3DYA A;  1S1T A;  2E4L A;  3KD5 E;  3VQP A;  2OA8 A;  4ELU A;  1Z25 A;  3NE6 A;  4FJH A;  3SV3 A;  5FRN A;  1CZB A;  3LPT A;  1VSJ A;  4BDY A;  1GOC A;  1Z26 A;  3KK1 A;  1YTA A;  1JLB A;  2HHX A;  1BGX T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...