4CECA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cecA00
3LWLA 2P5GA 2E6MA 3RRHA 1QSSA 1WSJA 4NCAA 2VG5A 1KFDA 3IRXA 4OKJA 4N47A 3V81A 4FW2A 3TAPA 1BI4B 2Z1JA 3M8QA 4CFCA 4Z4CA 2FBYA 1C1BA 4DQSA 1SKRA 4AHUA 4N76A 4LH4A 3NH1A 4DFPA 3I0SA 1VRTA 1NK8A 4FYDA 4Y1DA 1A5VA 1RDAA 1RT5A 2VG6A 1N5YA 4GVMA 3OYFA 2HHWA 5FRNA 1ZBUA 4CGGA 3V9WA 1SKWA 3OYHA 2W42A 4KB0A 1RT3A 5KI6A 2XHBA 4YFUA 4CEZA 4M3XA 4HUFA 1L3UA 2P5OA 4EP5A 3P5JA 4I2PA 1KCFA 1UOCA 1TK0A 1ASWA 3JYTA 3JSMA 3M8RA 2QK9A 3VQ6A 3T19A 1G15A 3O3FA 2Z1GA 2RKIA 4CFAA 4DMNA 3LDSA 4M3ZA 3MEGA 4CJKA 4M3UA 1HYZA 3LZIA 4I9LA 1YTUA 2WONA 1TAQA 5HLFA 3LALA 4ZTJA 4BDPA 4CJ5A 4KHUA 4DQPA 2OPRA 2KFNA 4OPKA 4W5OA 2D0BA 1W0HA 1Y97A 2PZSA 4CJUA 4Z4GA 3QEPA 3QESA 1KRPA 1S1VA 4DTOA 4FZXC 4FJKA 3ZSXA 2KTQA 2HHVA 3QEXA 4CEQA 4KHQA 3SUQA 3T1AA 4E89A 3NCIA 1X9SA 3I0RA 3KK1A 3VA3A 1WAJA 3TWHA 3SUNA 1WSEA 4FJNA 3OYLA 1LAWA 2B6AA 3THVA 1JLQA 3OYCA 4J2BA 3H08A 2XY5A 3NAEA 3G0ZA 1TL1A 3NFAA 2OZMA 4FJ8A 3ZT1A 3AVKA 1NK4A 1IKWA 2OPSA 1FKPA 2YNHA 3L2QA 5CY4A 4M3RA 4CE9A 4CIGA 3O3HA 1L3VA 3RR7A 3NH0A 4FJJA 4CGFA 2FC0A 3AO2A 3LZJA 3OJUA 5J2MA 3CFOA 3TARA 1YT3A 3F9KA 1VK0A 3MEDA 5KGWA 4CFDA 4KI4A 4OGEA 4CECA 1LWEA 3HL8A 3ALYA 4ZHRA 1YVUA 2X78A 2VWJA 1VRUA 1HYVA 1X9MA 3V1RA 3HVRA 1T05A 4K8XA 5CZ2A 4BWMA 5J2QA 1NK0A 3FFIA 3MXJA 4OKKA 3MAQA 3KLIA 3L3VA 4YNQA 1A5XA 2BGGA 4CJ3A 1RTIA 3ZSZA 3VA0A 3AVBA 4FM2A 2FBTA 4OVLA 3NDKA 4FCYA 1VSHA 3K58A 1LAVA 3ZT4A 3HVTA 1D9FA 4OPJA 4DSLA 3HPGA 4N5SA 3KLFA 3L2WA 3TAQA 3AO5A 3TANA 3RRGA 4W5QA 1K6YA 1KLNA 3RMAA 5FDLA 2YKNA 1Q8IA 3QETA 2G8HA 1CXQA 4KTWA 4F3OA 3KKSA 3VQ9A 3SV4A 5C42A 1XC9A 3AA5X 3ZT2A 1XWLA 3KLEA 3F73A 1S1TA 4OGCA 1QHTA 3VQ7A 1VSEA 4JRPA 4DTPA 3L2UA 1Q9XA 4FM1A 3OYEA 4DF8A 2OPQA 3SQ4A 1J54A 1KLMA 4OJRA 1QTMA 2QKKA 3QNNA 4PY5A 1A5WA 2KQ2A 1JLGA 1WSHA 4DTMA 2XRIA 3U6FA 2PYLA 3KLHA 3DM2A 2HHXA 1B9FA 1JXBA 1WSGA 1BL3A 1UAXA 3RMDA 1L3TA 4Z4HA 3ZT0A 5HRNA 4ELVA 3D0PA 4CCHA 4KB1A 4FJGA 3VQPA 1EETA 3ZT3A 2IOCA 3TAFA 2JLEA 4DSEA 3C6UA 4LSNA 3LP0A 4HCBA 3KKRA 5HROA 1LWFA 3OYJA 4CGHA 3C94A 3AVHA 4CJ4A 4E0DA 4PWDA 2RF2A 4ID1A 4C8MA 1REVA 3OYBA 4CESA 4LSLA 3SQ0A 4EZ6A 3TI0A 3RWUA 4FJIA 1GOAA 4O5BA 3K59A 1T03A 3SV3A 4Z4IA 4DQRA 3UIQA 3VQ5A 4FLWA 4I9QA 3HO1A 3CQ8A 4CERA 1VSFA 2IAJA 1MU2A 1XHXA 5J2PA 1ZBFA 1J5OA 5KTQA 4IG3A 4KTQA 5C25A 1C0MA 4F3TA 3IG1A 1IKYA 4FVMA 4DTRA 4R5PA 4AHRA 2OYQA 1BCOA 3LAMA 3M8PA 1HJRA 1NJXA 5I42A 3MXMA 3OYIA 4CF1A 4DLEA 4FZYA 4E7IA 3KJVA 3TAGA 1X9WA 3AVGA 4EZ9A 1TKDA 3HJFA 3O3GA 4B9UA 3DRRA 3T3FA 4M42A 1QE1A 2HHQA 3V9UA 2JGUA 1RILA 1SL2A 4DWIA 3PY8A 4MQ3A 1S5JA 3MEEA 4TSXA 2QXFA 1UA0A 2KZZA 2ITGA 3LPUA 3SUOA 3ZSRA 1IKXA 1TV6A 4CJWA 1BHLA 4CHQA 3K5MA 5D3GA 4DU1A 2F8SA 2FBVA 4CEBA 4CEOA 1BQNA 3C95A 3DLRA 3IS9A 2E6LA 4FLVA 4W5TA 1EXQA 1JL2A 4E7HA 4AHCA 1QSYA 1WN7A 1W9HA 4DLGA 4CJVA 3RMBA 4AH9A 1C1AA 3RMCA 4Z4EA 1NJYA 3CM5A 4LH5A 4WE1A 3PV8A 3DMJA 2D0AA 1RTDA 1I39A 4DSJA 1U04A 4H4MA 3L8BA 4HUEA 2RPIA 3K2PA 4KO0A 4B9NA 4FW1A 2E4LA 4JS4A 4B8CA 3NGIA 4FJXA 4DTSA 4CF0A 3AVFA 1TGOA 4M3WA 3M8SA 4B9TA 3AO1A 1Z26A 4JLHA 4Y1CA 2HNDA 2KW4A 3O4QA 2PY5A 3AO4A 1Q9YA 4QCLA 1DLOA 2A1SA 3V9ZA 4M3YA 1D5AA 1TK5A 4B9VA 4CFBA 2ZE2A 5DMRA 3QERA 1KVBA 3ITHA 3SZ2A 3OS2A 4F2RA 4LY7A 4JRQA 4CHNA 2XO7A 3PO4A 1TKXA 3KIOA 1HQUA 2XY8A 4RG8A 2DFHA 3BGRA 3OYAA 3K5LA 4CJTA 3DOLA 4MFBA 4CGJA 5T7BA 3EY1A 2ZQBA 3PX4A 4PA1A 3ZSWA 4RW4A 3QEWA 3SUPA 3AA2A 3I8DA 1HRHA 3OS0A 4B9MA 4DTNA 2HVHA 3NGYA 3PUFA 4AHSA 3TABA 1NKBA 4KHNA 1JL1A 5FRMA 4CF8A 4IBNA 1NKEA 3NF6A 1ZBLA 1RTJA 3S3MA 3BDPA 1Z25A 2RN2A 3LAKA 2OZSA 4BDYA 1NOYA 3NH2A 1ASVA 2GBZA 1S9EA 2IGIA 4Q5VA 4DTJA 4RW8A 3DRSA 3L2RA 2D0CA 4LD0A 4FK2A 2X6SA 3DYAA 1S6QA 1L5UA 1NKCA 1ASUA 2YNFA 2HB5A 3P83D 4Z0UA 5SZTA 4C8LA 4KHYA 2IDOA 2G8VA 1VSMA 2GUIA 3O4NA 4H4OA 1EX4A 3QLHA 4CIEA 4Q0BA 2G8WA 3CFPA 4DTUA 1RCHA 2HMIA 4NCBA 3L3UA 1SV5A 1SL0A 2B4JA 1I3AA 4CJRA 3HXMA 1FKOA 1NK7A 1RDBA 4B9LA 3LPTA 4IKFA 3AA3A 4BACA 3L2VA 1TL3A 3OVNA 3EZ5A 1RBVA 1S1XA 2HW3A 1WNSA 3PO5A 4UQGA 1NJZA 1ZBIA 1UWBA 1GOBA 2PYJA 4DSIA 4FJMA 3DOKA 3S3OA 3AVLA 1TKZA 5E41A 4FJHA 2HNZA 3AVJA 4DS5A 1RBRA 4E7KA 1CLQA 1F21A 5EU7A 4M41A 2HHTA 5CYQA 2A1RA 4I7FA 3TAEA 4CHZA 3U3GA 4CHYA 3HP6A 1NJWA 1RT6A 1C0TA 4E7JA 4HCCA 1DTTA 4FLTA 3K5OA 3OJSA 2F8TA 3AVAA 4NYFA 4HUGA 3VQDA 4KHWA 4RW7A 3HP9A 4O0IA 3B6PA 4KAZA 1GOCA 4J2AA 3SI6A 3HK2A 4FLXA 1KSPA 4FLZA 3NF9A 1RT1A 1EP4A 1NK5A 2XY7A 1J9AA 1TVRA 4BE0A 4DQQA 1C0UA 3V6DA 1VSJA 4H8KA 3C6TA 1EKEA 4DF4A 3RTVA 1HPZA 4FZZA 2Y1JA 3ZSOA 4B9SA 4B3OA 2I5JA 2ZD1A 4GW6A 1LV5A 1IH7A 4CK3A 3NGZA 1XI1A 2YHAA 1RBUA 3MXIA 3KTQA 4M3TA 2BE2A 1JLFA 3PX6A 4KRFA 4QAGA 1WLJA 5HRPA 1B9DA 2OA8A 3NBPA 1RDCA 4JS5A 3KD1E 1HNVA 3SCXA 4FM0A 1S6PA 1TKTA 4NCGA 2YNIA 2DY4A 3HPHA 3HSTB 1WSFA 4CJPA 3OS1A 1UA1A 1D8YA 4DS4A 1S1UA 4CJQA 3SYZA 4ELUA 4N41A 3NE6A 3VQ8A 2Q3SA 4KPYA 3DLBA 3OYNA 1U45A 4FJLA 4G1QA 2BDPA 4DU3A 1HMVA 3WNHA 4IG0A 3KK3A 1RT7A 2X74A 3HM9A 1SL1A 1QSLA 4HTUA 3V9XA 3OY9A 4KREA 1QQCA 4AHVA 2G8FA 3E01A 4OKEA 1S1WA 1YTAA 2BANA 4B8AB 3OYGA 2KZMA 4ICLA 1D9DA 4PQUA 1IG9A 3QIPA 5SWMA 4KKOA 4J2DA 1QS4A 1VSDA 3ULDA 3CYMA 4CEEA 3S9HA 2YHBA 1RT2A 4CK2A 4O0JA 1U48A 4M45A 4IFYA 1CXUA 1LWCA 2YV0X 1XHZA 4PUOA 4FJ5A 3AVMA 1BQMA 1JLEA 2G8UA 2P1JA 3OYDA 3LWMA 4FLUA 4C8NA 3U3YA 1WSIA 1S9GA 2XY6A 4IFVA 3AV9A 3WNFA 3HT3A 2ATQA 1NK9A 5C24A 2X6NA 3VQQA 4W5RA 2Z1HA 2EX3A 4ZTFA 1BI4A 3VQBA 3HPOA 1VSKA 1VSIA 3EYZA 1RT4A 1T7PA 1IKVA 4HVJA 3KK2A 4OLAA 1BIZA 2DFEA 4DFMA 5JS2A 4ID5A 3V1OA 4DG1A 3RR8A 4FLYA 4RW9A 3LANA 3V1QA 1TK8A 3NF7A 4CK1A 3MECA 4DSFA 1KVCA 3VN5A 4CHOA 1BIUA 2HNYA 4W5NA 4BDZA 3B6OA 2IC3A 3SPYA 4CJFA 4BE1A 1DTQA 3S3NA 1HYSA 4DTXA 1HQEA 2VWKA 4E3SA 3KLGA 4AHTA 1BISA 4AILC 1ZBHA 4FK4A 1B92A 4I2QA 2OPPA 1LW2A 4E19A 3QEIA 4FJ7A 4GMJB 2O4GA 1X1PA 2FBXA 2P51A 5J2NA 1SUQA 4KTZA 4HHTA 3AVIA 2LSNA 2NUBA 2YKMA 4OLBA 4CJSA 4NYNA 3VQCA 3WNEA 1C1CA 1U49A 3PX0A 4E1MA 4B08A 1JLAA 3OYMA 2F96A 1SKSA 4L8RB 2VG7A 3ZCMA 3DI6A 4O44A 4CJEA 1U4BA 4QOZB 5JS1A 3HYFA 3LP3A 3K5NA 3ZSYA 1T8EA 4DSKA 1KTQA 3QINA 3VQEA 4E1NA 3DLKA 4CGIA 4XIUA 4CEDA 1BGXT 5KRTA 4K8ZA 4F4KA 2G8IA 2HVIA 1L3SA 1RDDA 3V9SA 3A2FA 4F8RA 5HP1A 4CIFA 3NHGA 4Z4FA 4CEFA 4KHSA 5DK5A 1CZ9A 5K14A 1RBTA 4E7LA 1FK9A 3ASMA 4O4GA 3OYKA 3G10A 3LP2A 2ETJA 4RW6A 2G8KA 1RNHA 1ITGA 2WOMA 3KD5E 2AJQA 5HRRA 1KFSA 2KFZA 1LW0A 1RBSA 2DTUA 1RTHA 4DQIA 3AVNA 3CG7A 1IO2A 3NF8A 5CZ1A 1WAFA 3TR8A 3SQ1A 3DRPA 3WNGA 1JLCA 2IS3A 1O1WA 2Z1IA 3P1GA 3SJJA 3D45A 2EHGA 4J2EA 1JKHA 4O55A 2Y1IA 2D5RA 4FK0A 1FXXA 2YNGA 1JXEA 5HBMA 2GV9A 5FROA 3QIOA 3ISNC 4CJLA 3V4IA 1ZYQA 1C6VA 3CFRA 1JLBA 3DLEA 3LP1A 4CHPA 4DFKA 4KI6A 1BCMA 4CF2A 3SNNA 3AO3A 2O4IA 3QO9A 1KVAA 5I3UA 4IDKA 3ZSVA 4FJ9A 3AVCA 1N6QA 1HNIA 2B5JA 4F2SA 2HHSA 3K57A 4CGDA 4FXDA 5J1EA 4N56A 3IAYA 3SPZA 5HRSA 1CZBA 4EP4A 4DFJA 1NK6A 4C8KA 4ELTA 4CF9A 2QKBA 1TAUA 4C8OA 3QNOA 3QEVA 3VQAA 3SQ2A 2DFFA 4CEAA 3AA4A 3DLHA 2HHUA 4KV8A 4DU4A 3VQ4A 1J53A 1NOZA 1VSLA 4KFBA 3CM6A 5KRSA 2R7YA 4BE2A 3ZSQA 3DLGA 4BWJA 1U47A 1R0AA 5CYMA 3TAMA 5KGXA
chains in the Genus database with same CATH superfamily
2P5GA 4Z4FA 5FLXO 3RRHA 1WSJA 1QSSA 4N47A 4CJ7A 1YF5L 4FW2A 4YOVA 4CFCA 4YOWA 4N76A 4JK8A 2QWMA 4JI8K 4Y1DA 1RDAA 1RT5A 1N5YA 3EE8A 2ASPA 1QQMA 2W40A 3VGMA 5FRNA 2ITMA 3V9WA 4DR5K 3OYHA 2W42A 5FPDA 1RT3A 4CEZA 4M3XA 4EP5A 3HBTA 4IOXA 3A5MC 4EAHD 3VQ6A 1G15A 2Z1GA 2RKIA 1Q18A 3LDSA 3MEGA 4DR2K 1YTUA 2WONA 1N34K 4CJ5A 2OPRA 2PZSA 5C15A 2GX9A 4Z4GA 2ZGZA 1MA9B 4KHQA 3SUQA 3T1AA 4E89A 2GELA 3I0RA 5B8HA 3KK1A 1WSEA 4J2BA 3NAEA 1MWMA 4FJ8A 2KHOA 5AQOA 1FKPA 4CE9A 1HR0K 3O3HA 4JK9A 2FC0A 3AO2A 3OJUA 1YVNA 1VK0A 4PL7A 1GLBG 4ISGA 3V1RA 1T05A 3WT0A 4BWMA 1YHQN 4H5NA 3MXJA 3KLIA 4YNQA 4EFHA 3AARA 3WXJA 3EO3A 3SAGA 4GV3A 1TUYA 2FBTA 3R9PA 1D9FA 3OBWA 4LF9K 3QETA 2OCEA 1XWLA 3KLEA 3F73A 4DTPA 3VQ7A 1NGGA 4JRPA 4DF8A 5AFUA 1HPMA 3SQ4A 4OJRA 1QTMA 3QNNA 3H46O 2XRIA 2PYLA 4BC3A 2HHXA 1JXBA 4YOTA 3ULEB 3SAFA 2VQFK 3ZT0A 4MO4A 4CCHA 2NNWA 1NGJA 2IVPA 4FJGA 3VQPA 3ZT3A 3TAFA 4DSEA 3HTVA 4LSNA 2HF4A 5HROA 3C94A 4ISFA 4PWDA 4ID1A 4LSLA 4FJIA 5LY3A 3TI0A 2NRXA 1T03A 1MDUB 3VQ5A 4FLWA 3HO1A 1ILYA 2E2OA 2IAJA 5J2PA 1DGKN 5C25A 3IG1A 1IKYA 1U2VA 4IOCL 1HJRA 3MXMA 1O13A 3OYIA 4DV3K 3KHYA 4U67L 4KBOA 3O3GA 5A2QO 4M42A 3DXKA 3KVGA 1S5JA 4TSXA 4BY9C 2HOEA 1UA0A 2KZZA 4JHDA 3SUOA 5BPMA 5EX5A 4K41A 2IVOA 3BZKA 4CJWA 5D3GA 2FBVA 4DV4K 3IS9A 2A3ZA 3EEQA 2E6LA 1HNZK 1YI2N 3EL2A 1W9HA 4LF5K 2GUPA 4DLGA 1NG9A 1RTDA 4BRCA 2P9LB 1I39A 2GWJA 3L8BA 4BRQA 5AFUH 4DTSA 2HMPA 3AVFA 1U2VB 4WYBA 1Z26A 4JLHA 3TU5A 3HSCA 2E2NA 5AQIA 3F5TA 3QERA 3OS2A 4F2RA 3PLAA 4JKDA 1TKXA 4WQ5A 3FR0A 3RSEB 3EY1A 4DB3A 3ZSWA 3ZLJA 3AA2A 4LFCK 3TABA 2CH6A 1NKEA 3NF6A 1K8AO 2P9LA 1Z25A 2VCPA 3AAQA 4BDYA 2UXDK 2GBZA 4Q5VA 1S6QA 2YNFA 5H1SQ 1ZC6A 2IDOA 5CE3A 4H4OA 4Q0BA 3O5BA 4JN4A 2HMIA 4NCBA 4Z94A 3QBWA 3MX2A 4CJRA 3GL1A 1QQNA 3AA3A 3OVNA 1RBVA 2HW3A 1NJZA 1UWBA 3O1WA 3E9LA 3CC2N 3DOKA 3AVLA 3K9KA 2CGKA 3A0IX 1KAXA 1RBRA 4FSVA 4E7KA 3QFPA 5EU7A 4DQ8A 2A1RA 4CHYA 3J7ZO 1DKGD 1DTTA 4FLTA 3K5OA 3AVAA 4NYFA 4HUGA 3HP9A 4O8UA 3B6PA 4LF4K 3CIPA 3HK2A 1KSPA 3NF9A 1RT1A 2D4WA 2XY7A 4IFEA 4DQQA 1HNWK 4H8KA 3C6TA 5AZJB 3RTVA 2VWBA 4R79A 2Y1JA 3THXB 4B3OA 3Q7BA 2D0PA 3VEOA 4CK3A 3NVKA 2YHAA 4O5FA 2BE2A 1JLFA 4QAGA 5M1NA 3E9PA 3CMAN 3SCXA 4FM0A 4BRNA 1MWKA 4QS9A 1BWFO 1P8ZA 1BOTO 1WSFA 1OH6A 1S1UA 1VQKN 1KQSM 1Y64A 5KPTA 2BDPA 4DR7K 5BRFA 3C0BA 1SL1A 4IEIA 3OY9A 3L4IA 5GAHP 4ICLA 4PQUA 4J8FA 3FZLA 4KKOA 2E1YA 1QS4A 4WFBL 3JXUA 4JK7A 4CK2A 4IFYA 1CXUA 4PUOA 1EWRA 1BQMA 1HKGA 2P1JA 3OYDA 1NGAA 1S9GA 2XY6A 4IFVA 3WUHA 1RFQA 4CZGA 4AF1A 2O8EB 2DFEA 4A59A 3EN9A 4OPAA 3CCRN 3V1OA 5JVGL 1TK8A 3EKSA 4CK1A 4DSFA 1KVCA 3VN5A 4B1VA 4BDZA 4DUZK 1XQSC 4CJFA 3O80A 4BR0A 4DCHA 4E3SA 2VWKA 3KLGA 3ATUA 1LW2A 4H5VA 4E19A 1E4FT 3QEIA 2O8DB 1VQPN 1X1PA 2FBXA 5J2NA 4JI4K 4CW7B 3AVIA 2LSNA 2NUBA 2YKMA 3C7NA 4NYNA 1U49A 4BR9A 4B08A 2F96A 3GOIA 1SKSA 2VG7A 4BRPA 3DI6A 3T1HK 4CJEA 4IXCA 3G71N 4QOZB 3UKUA 4JYAK 3E66A 4H0OA 4KH5A 4JHDB 3VQEA 4E1NA 1QVFM 5I9EB 2FLOA 4I6MA 1RDDA 2H3GX 1FK9A 3G10A 4H5TA 3K0SA 2AJQA 2O8EA 3FGUA 1NMDA 5HRRA 1TUUA 1KFSA 4BR2A 2OTLN 3CJ7A 5CZ1A 1JLCA 1YJNN 2IS3A 1O1WA 2Z1IA 3ENHA 5AZIA 3I56N 2BUPA 1XNQK 3VF2A 4C1NK 5GIPA 2CH5A 2D5RA 4LC9B 2P9PA 1FXXA 2YNGA 3ISNC 1C6VA 2JWLA 3CFRA 4DFKA 4CF2A 4YHHK 3AO3A 4K0KK 3QO9A 3ZSVA 1HNIA 3K57A 5C2FA 4CGDA 4CZHA 3IAYA 5TKWA 4EP4A 3ULEA 1NK6A 4C8KA 3VQAA 4CEAA 2NLXA 3IFRA 3AA4A 1R0AA 3VQ4A 1J53A 3A5NC 3FZMA 3ZSQA 3DLGA 3AY9A 3ZX3A 5HL7L 3ZEUA 5KGXA 2VG5A 1KFDA 2O8FB 1TYQA 5ADXA 1BI4B 2Z1JA 3U9ZA 4Z4CA 5GIOA 2YJFA 1SKRA 2HBMA 4LH4A 1NK8A 1A5VA 2E1ZA 4GVMA 2HHWA 3VENA 4MLEA 1NGHA 1J6ZA 5KI6A 2XHBA 4HUFA 4LFBK 1UOCA 2W6LA 1TK0A 1ASWA 3JSMA 1Q81O 4H5WA 2UUAK 3E1YA 1HYZA 4I9LA 4B3MK 4ZTJA 3LALA 4DQPA 3VPZA 3CC4N 4OPKA 2D0BA 1Y97A 5AQVA 3BZCA 1S1VA 3T1YK 2YHWA 3ZSXA 3QEXA 1YITN 4B3TK 1X9SA 1NBWA 3O9RA 3OYLA 1JLQA 2XY5A 5BREA 2Q31A 3IUCA 1TL1A 2OZMA 4BRLA 2OPSA 3I33A 1N32K 3D2FB 5CY4A 3OA9A 4CIGA 1GLCG 3NH0A 4CGFA 3MN9A 1VQNN 2Q36A 5J2MA 4A61A 3TARA 3F9KA 3MEDA 5KGWA 4MLHA 4CECA 3HL8A 4ZHRA 1YVUA 5AQGA 3ZX0A 4K8XA 2P9UB 1X9JA 1NK0A 3TTCA 5C2DA 4OKKA 3L3VA 3KWIA 2ZJRL 1RTIA 3TSQA 4FM2A 1QZ5A 3TPQA 3FZHA 1LAVA 1VAZA 4OPJA 3HPGA 3TANA 3L2WA 3TAQA 4W5QA 3G4SN 1K6YA 1KLNA 1GLDG 1CXQA 1GLFO 4F3OA 3KKSA 3SV4A 5C42A 4H0YB 3ZT2A 1QHTA 1Q9XA 4FM1A 3OYEA 3PIPL 3D2EA 2KQ2A 2IIRA 4DTMA 3KLHA 3DM2A 1BL3A 1UAXA 1L3TA 1V4SA 4ELVA 3U4LA 5GADP 2ZJPL 1LWFA 4CGHA 4FWLA 3P38A 1REVA 3OYBA 1SQKA 4BRKA 1HKCA 5FPMA 1QHAA 1BA0A 1VHXA 2HF3A 2P9UA 1XHXA 1ZBFA 3OW2M 5KTQA 2FSKA 1C0MA 1RDUA 4R5PA 4AHRA 1BCOA 1NJXA 4H0VB 3BUZB 5I42A 4DLEA 3MK6A 3TAGA 3AVGA 1VQ9N 5LL6Z 3DXMA 1SL2A 3PY8A 3MEEA 2ITGA 5AQRA 3ZSRA 1TV6A 1XUPO 3K5MA 3O4WA 4FWKA 3C95A 4LF6K 2FXUA 1QSYA 2O8CA 3PSIA 4AHCA 1NGBA 3CXCM 4CJVA 1VQMN 3RMCA 2QWQA 4FVUA 4DSJA 1EQYA 1HLUA 1K8KA 3DLLL 2O8BB 4B8CA 1TGOA 3AO1A 4Y1CA 2KW4A 1WB9A 3AO4A 4B1WB 4QCLA 2A1SA 3V9ZA 4GKJK 2FSNA 3J8AA 1TK5A 1KVBA 4BVOA 4LY7A 4JRQA 3PO4A 2QEXN 3KIOA 1HQUA 5BRDA 3O9TA 4MFBA 5T7BA 2ZQBA 3QEWA 3N4QA 4DTNA 3NGYA 3PUFA 1NKBA 4CVNE 5FRMA 5LMNK 1NJIO 3S3MA 4H0TB 5F2RA 3CCVN 3NH2A 1S9EA 4DTJA 4LD0A 4FK2A 1SS6A 3LDPA 1L5UA 1NKCA 1ASUA 3P83D 4Z0UA 3CD6N 3NMUA 3UKRB 4BQZA 3O4NA 1EX4A 4DTUA 3TSUA 1ATNA 3D7EO 3L0QA 4GVEA 5C12A 1I3AA 1U6ZA 5KPRA 3J80O 3HXMA 1IBKK 1RDBA 2QXLA 4XH4A 1S1XA 5AQWA 1K9MO 1ZBIA 3CCUN 4FJHA 4FOEA 2V52B 5E41A 1C0FA 3AVJA 2GTDA 2QWLA 3O6WA 4X64K 4M41A 2P9IA 3A8YA 3U3GA 3HP6A 1RT6A 3RSEA 1C0TA 4HCCA 4B1UB 3CERA 3VQDA 4BGAA 5F0XA 4J2AA 3TSPA 4K25A 2UUBK 4JEPA 4I6MB 2QW9A 1KAZA 5M1OA 5JMVA 3V6DA 2P9NA 1JCEA 1EKEA 1ESVA 4B9SA 4FWRA 1LV5A 3NGZA 3KTQA 2KKZA 3I8BA 4KRFA 3PX6A 5HRPA 2P9IB 1HNVA 1RGIA 1S6PA 2YJEA 1E4GT 4F9OA 4WQ4A 2YNIA 3HPHA 3HSTB 1YUWA 4DS4A 4ELUA 3CCJN 2NRTA 2A41A 3N4PA 3J7AP 3OYNA 1U45A 4G1QA 2QWPA 3WNHA 4IG0A 1RT7A 4OKEA 1S1WA 3BP8A 2BANA 5AQPA 3OYGA 4B3SK 5CHIA 5GINA 5SWMA 4GNIA 3CYMA 1NM1A 1RT2A 3C6AA 1LWCA 2YV0X 4YORA 4FJ5A 3AVMA 2F9WA 3O9UA 4C8NA 4BG9A 3CETA 4BRFA 3AV9A 1NGIA 1G99A 2X6NA 1NGFA 2EX3A 5AR0A 4DUYK 4ZTFA 1BI4A 3VQBA 1VSKA 3R6MA 4JI2K 1S3XA 3UB5A 1I94K 1T44A 4OLAA 2VQEK 4X62K 4AM6A 4JI3K 1NGDA 2A6AA 3NF7A 3HRGA 3MECA 1HJOA 1S72N 4CHOA 2HNYA 4CD3A 4NXMK 4IDHA 3WXMB 1VQON 3S3NA 1HYSA 4IZ9A 3ID6A 1ZBHA 1IG8A 1KC8O 4FK4A 1B92A 3J7YP 3MN5A 5F1XA 2O4GA 1H1VA 1SUQA 4KTZA 4OX9K 3I55N 4JKGA 2BTFA 2P9PB 4OLBA 3VQCA 1C1CA 3P31A 4E1MA 5E26A 1JLAA 3OYMA 4L8RB 3IKMA 3ZCMA 4O44A 1JJ2M 1U4BA 2YCHA 2AA4A 4H5RA 3R8EA 3K5NA 1KTQA 3DLKA 4JKHA 1M1KO 1L3SA 4F8RA 5HP1A 4LF7K 3NHGA 4KHSA 1CZ9A 5K14A 3ASMA 4O4GA 3OYKA 3LP2A 2G8KA 1RNHA 1ITGA 4DV0K 2E5LK 1CZAN 2KFZA 1LW0A 3FLCO 1WAFA 3SQ1A 4JKCA 2QA4N 3P1GA 3SJJA 2RE2A 5ELZA 3F2KA 4O55A 2Y1IA 3C7NB 3K9JA 1JXEA 4IJAA 4DV7K 1KD1O 4QS7A 4K43A 2O4IA 3VEWA 3CF5L 3AVCA 2B5JA 1HUXA 2HHSA 5AQKA 3KWGA 4FXDA 2V51B 4N56A 4AM7A 3SPZA 1CZBA 2E8AA 3EKUA 1TAUA 2DFFA 2HHUA 4KV8A 4A2BA 1NOZA 4MDAA 3CM6A 4BWJA 1U47A 2NRVA 1QZ6A 5CYMA 3VA0A 3LWLA 3ZX2A 4CZKA 4NCAA 1BU6O 3IRXA 2FF6A 4OKJA 2I7NA 2FBYA 1RDWX 1C1BA 4DQSA 4AHUA 4DFPA 3CPEA 1KAYA 1VRTA 4FYDA 1WBDA 3ZETB 1VQ6N 5IT9O 4JI6K 1C0GA 4CGGA 4KB0A 3VF6A 4A5AA 4YFUA 3VEZA 1L3UA 1VQ5N 3P5JA 4I2PA 3SJHA 1KCFA 5BPLA 3PIOL 3IMXA 3M8RA 3BEXA 4CFAA 2Q2RA 1EWQA 5JICA 3DXKB 1HNXK 4GY2B 4M3UA 4BDPA 1X3NA 1IV0A 1XNRK 4E1JA 2KFNA 1W0HA 2YI1A 1WUAA 2FF3B 2P9NB 4DTOA 4FWSA 4FZXC 3MWTA 4CEQA 3VTHA 4FWMA 3NCIA 4K42A 4L3QA 3HOSA 1NMNA 3VA3A 4WF9L 2NRHA 2B6AA 3THVA 3H08A 4CZLA 2ZWHA 4CZJA 3ENBA 1NGEA 3AVKA 1IKWA 2YNHA 3QICA 1L3VA 4M3RA 3THXA 3RR7A 4BR4A 4NXNK 3LZJA 4ILGB 3AAPA 1YT3A 4DR1K 4OGEA 4IO8A 1LWEA 2X78A 2VWJA 1VRUA 3HVRA 1ATSA 5CZ2A 1Q7YO 3BY5A 1YJ9N 3U9DA 3UE5A 5BR9A 4FCYA 1VSHA 3ZT4A 3HVTA 1JCGA 5GAGP 3KLFA 2E2QA 3RRGA 5JLFA 3RMAA 3AA5X 2PFUA 3L2UA 3M5RA 5AQHA 3RVCA 3CCLN 2OPQA 3CCEN 3W0LA 3U6FA 3MDQA 2GWKA 1B9FA 1WSGA 1NGCA 3RMDA 5M1FA 4Z4HA 5HRNA 3GBTA 2A5XA 1EETA 2NZTA 2IOCA 2JLEA 4HCBA 3LP0A 3IDHA 3KKRA 2D1KA 3C65A 4CJ4A 2RF2A 3VMFB 4C8MA 4OO1J 4CESA 3L6QA 1GOAA 2F7TA 4O5BA 3H45C 3K59A 3SV3A 1N36K 4Z4IA 4DQRA 3WQTA 4CZEA 3UIQA 2WFBA 1VSFA 1W97L 2QWRA 3CJCA 1N8RO 3VGLA 1J5OA 4HWIA 4IWVA 5FPNA 3Q7CA 3SK3A 4KTQA 4F3TA 4DV2K 4H03B 5BN9A 2OYQA 1BDGA 3LAMA 2A42A 4FPAA 4CF1A 4PKHA 4GV6A 3KJVA 2WUSA 1X9WA 4EZ9A 1TKDA 3HJFA 4B9UA 3DRRA 2UYTA 2HHQA 4DWIA 3NVMA 3MWPA 2QXFA 1BHLA 1YAGA 2I7PA 2F8SA 4CEOA 4BRDA 3S41A 3DLRA 1VQLN 4FLVA 3THWB 4W5TA 4B1ZA 4HTLA 1WN7A 2NRWA 3RMBA 3LL3A 4MO5A 4AH9A 3JAMO 3CM5A 4WE1A 3J81O 2D0OA 5JVHL 2PBDA 4H4MA 3CMEN 2RPIA 4KO0A 4B9NA 4FW1A 2E4LA 3NGIA 1GLLO 4M3WA 3M8SA 4B9TA 3OBYA 2HNDA 3O4QA 1Q9YA 1DLOA 4PHTX 1D5AA 4V19S 3MN6A 4CFBA 2ZE2A 4YOYA 5DMRA 3ITHA 4A5BA 3CJAA 4CHNA 4BRIA 2IVNA 3ZYYX 2XY8A 4RG8A 2DFHA 3BGRA 4CJTA 3G6EN 3DOLA 3HI0A 5ADXH 5FPEA 4PA1A 4RW4A 3H1QA 3SUPA 3O9QA 1KXPA 3I8DA 1HRHA 4WQ5C 3OS0A 4DV6K 1JL1A 4IBNA 1ZBLA 3VGKA 3BDPA 2RN2A 3LAKA 2CGJA 2OZSA 1ZBSA 1NOYA 1ASVA 2IGIA 3DRSA 3L2RA 4WFNL 5SZTA 1K73O 3HOTA 4C8LA 3VTIA 5BRHA 1Z6RA 5IWAK 1RCHA 4AQYK 3L3UA 1SV5A 1SL0A 4LF8K 2ASOA 1FKOA 3LPTA 4IKFA 3L2VA 4RTFD 4X66K 3EZ5A 4CI6A 1WNSA 3PO5A 1GOBA 3WXKA 4JI1K 1TKZA 3QMLA 4DS5A 2GEMA 2HHTA 4I7FA 3TAEA 4CBXA 3D2FA 2WC9A 4JKGB 1GOCA 3O08A 1VQ7N 3WXIA 4FLXA 3R1XA 4FWOA 4H0PA 5LMUK 3U8XA 1EP4A 1NK5A 3CJ9A 3CQXA 5EVZA 4FWPA 4BC2A 1VSJA 4KH6A 4DF4A 3VETA 5AQNA 4NB4A 4FZZA 3ZSOA 2ZD1A 4GW6A 4C1NI 1XI1A 1RBUA 1NWKA 2RHKA 3MXIA 2Q97A 1IBLK 4BC4A 5AQYA 2P9SA 2YHXA 1WLJA 1B9DA 2OA8A 3NBPA 1RDCA 3KD1E 5AQMA 1TKTA 3ZEUB 1BG3A 4NCGA 2DY4A 4CJPA 1UA1A 3GE1A 4N41A 4CJQA 4PKIA 1HX1A 4JKBA 4KPYA 4EHUA 3OHRA 4DU3A 1HMVA 3SBTA 1GLEG 1WBBA 4NO7A 3HM9A 2X74A 1QSLA 4KREA 4B3RK 3D6RA 4AHVA 4B8AB 1YTAA 5AJ3K 1FW6A 3ULDA 3S9HA 1OKJA 4YDUA 1U48A 1XHZA 3PSFA 4JD2A 3WQUA 3H3OB 3LWMA 5AQSA 4FLUA 3U3YA 1T3VA 2J4RA 3F9MA 3WNFA 4YOXA 1NNEA 5C24A 3VQQA 2Z1HA 1VSIA 3EYZA 1IKVA 3CC7N 5TKYA 1BIZA 4DR4K 4PL8A 4ID5A 1QVGM 3RR8A 4B1YB 3V1QA 1D4XA 4H0XB 3VEYA 4B9QA 1J5EK 1BIUA 4W5NA 3SPYA 2IC3A 2ZGYA 1DTQA 1LCUA 4DTXA 2UU9K 1HQEA 1BISA 2OPPA 2E2PA 3R3LA 1Z05A 3SMSA 4GMJB 1XMOK 4HHTA 4BRGA 3H3NO 2V7ZA 1XMQK 4CJSA 3WNEA 4JNEA 2HBKA 4YOUA 3THWA 3MCPA 5JS1A 4UY8O 3ZSYA 1T8EA 2BH1A 3T69A 3QINA 4M7YA 3DJCA 4CGIA 4CEDA 4K8ZA 4F4KA 3V9SA 4WFAL 4CIFA 3DAWA 1QQOA 1RBTA 4A57A 3FE1A 3W3DA 2QWOA 3HM8A 5AZJA 3ENOA 2VGMA 3CJBA 4DQIA 4KHPK 3CG7A 1IO2A 3NF8A 1OH7A 3VERA 4JV5K 3A5OC 2EHGA 1YIJN 5HBMA 3V4IA 3QIOA 4QS8A 1FJGK 4CHPA 4KI6A 3SNNA 4OPHA 5I3UA 3WXLA 1N6QA 1N33K 3CCQN 5HRSA 2QKBA 1IBMK 3WEEB 4CF9A 2E88A 3EE9A 4C8OA 2F4VK 1E3MA 2YHYA 4BVPA 3DLHA 1VSLA 4KFBA 1R59O 4BE2A 5HLFA 4JKEA 5DM6L 2E6MA 3LM2A 3V81A 3TAPA 3M8QA 2ASMA 3NH1A 5CR4A 3I0SA 2HBLA 3H1VX 2VG6A 4M7XA 3QB0A 3OYFA 4CBWA 2FSJA 1ZBUA 1SKWA 4GV9A 5AZIB 2P5OA 3JYTA 2QK9A 3T19A 5JLHA 3O3FA 1DT9A 3O9SA 5LJWA 4DMNA 1Q82O 4M3ZA 4CJKA 1K8KB 3LZIA 2O8BA 1TAQA 1NLVA 4KHUA 2VYPA 4W5OA 5AQQA 3DXMB 4CJUA 4XH1A 3QEPA 3QESA 4JI0K 1KRPA 2OTJN 4FJKA 4FWQA 2KTQA 4DHYA 2HHVA 2PAVA 3P39A 3SUNA 1WAJA 3TWHA 4GKKK 4FJNA 1LAWA 2HSTA 1BA1A 5EY4A 3OYCA 3G0ZA 2KLAA 3NFAA 3ZT1A 4IJNA 1NK4A 3VESA 3L2QA 4FWNA 4FJJA 5AQJA 4C23A 1GLJO 2CGLA 3CFOA 3MMVA 4CFDA 4KI4A 4BR7A 3ALYA 1HYVA 4O8KA 1X9MA 5J2QA 3FFIA 1NU0A 3MAQA 1A5XA 2BGGA 4CJ3A 2E20A 3ZSZA 3OTOK 3AVBA 4OVLA 3NDKA 5AQTA 3K58A 3FFKB 5M1KA 5AQZA 4YDUC 3O8MA 4N5SA 3AO5A 4FPBA 1XC3A 5FDLA 2YKNA 1Q8IA 4JKFA 2G8HA 4KTWA 3VQ9A 1XC9A 4DSLA 4IO9L 1S1TA 4OGCA 3SLCA 1VSEA 5C10A 1OVQA 1J54A 1KLMA 2QKKA 4PY5A 4BRMA 1A5WA 1JLGA 1WSHA 3M3ZA 3LDOA 2UUCK 4RCHA 3E9OA 3D0PA 4KB1A 3UKRA 2HBJA 1OH8A 4ILJA 3C6UA 4XH5A 3OYJA 3AVHA 4E0DA 2W6KA 5AQFA 3SQ0A 4EZ6A 3BF1A 3RWUA 5GAEP 4I9QA 3CQ8A 4CERA 4Y0WA 5EOYA 2NRRA 1MU2A 2ZF5O 2O8DA 4IG3A 4DTRA 4FVMA 1BUPA 3M8PA 5M1QA 4NLCA 4FZYA 4E7IA 4JI5K 4FL9A 5C0YA 3DWLA 3T3FA 1QE1A 3CQYA 3V9UA 2JGUA 1RILA 2ZM6K 4MQ3A 4EIAA 3THYB 2P9KA 3LPUA 3LM9A 1IKXA 4CHQA 4DU1A 4CEBA 1BQNA 2YX6A 2A40A 4E7HA 1EXQA 1JL2A 5AQXA 3P4IA 1DEJA 1C1AA 4Z4EA 1NJYA 4LH5A 3PV8A 3DMJA 2D0AA 4DR6K 1U04A 4HUEA 1JCFA 3K2PA 4JS4A 4FJXA 3TTDA 4CF0A 4BROA 3SBGA 1LOTB 1P90A 2ZJQL 2PY5A 3QDKA 4M3YA 2P9KB 4B9VA 4U7BA 4JAXA 5KPZA 1OH5A 4FO0A 3SMPA 2Q1NA 3SZ2A 4EHTA 2Q0RA 2XO7A 4BR5A 3K5LA 5E84A 4BGBA 3OYAA 4CGJA 1OVYA 3WEEA 4X65K 3PX4A 5BN8A 4ISEA 4B9MA 2HVHA 4BRAA 4AHSA 4KHNA 4CF8A 1RTJA 3A5LC 4A2AA 4G9ZA 4RW8A 3CI5A 2D0CA 2X6SA 3DYAA 2HB5A 1BO5O 2EWSA 4KHYA 3CCMN 1VSMA 2GUIA 2G8VA 3QLHA 4CIEA 2G8WA 3CFPA 3VEXA 2B4JA 1NK7A 4B9LA 5HOOA 4BACA 1VQ8N 1TL3A 4DV1K 3SAHA 3H6EA 1X3MA 4UQGA 4YY3K 2PYJA 4DSIA 4FJMA 3S3OA 1T6DA 1T6CA 2HNZA 3ATVA 1CLQA 5AQUA 1F21A 4JKAA 5CYQA 2HHHK 3UKUB 4CHZA 3TTFA 1NJWA 3GG4A 4NLBA 1VQ4N 5AQLA 4E7JA 4BG8A 5KQ8A 3OJSA 4B1XB 4LFAK 2F8TA 4KHWA 4RW7A 4O0IA 1V4TA 4KAZA 2QTDA 3HZ6A 3SI6A 1WOQA 4FLZA 1Q86O 2NRZA 2OANA 1J9AA 1TVRA 4BE0A 1C0UA 4PKGA 1HPZA 3QFUA 2I5JA 3VOVA 1M90O 1IH7A 4M3TA 3CCSN 4WQ4C 3M6GA 4JS5A 4A62A 2UXCK 3AGRA 1GLAG 4IEEA 4JI7K 1D8YA 3OS1A 3FZKA 3B8AX 3SYZA 4MDBA 3NE6A 3VQ8A 2Q3SA 3DLBA 4FJLA 2WBNA 1HKBA 5DM7L 3KK3A 2O8CB 3KK7A 3MX5A 4HTUA 3V9XA 4CZMA 4CZFA 1QQCA 2G8FA 3E01A 2KZMA 1D9DA 1IG9A 3QIPA 2O8FA 5MLCQ 4J2DA 1VSDA 5M1PA 4XEIA 4DR3K 4CEEA 2YHBA 1ZXOA 4O0JA 5LJVA 4WCEL 4M45A 3MCAB 2JWKA 3BF3A 1JLEA 2G8UA 5EXWA 3T7ZA 1WSIA 3MN7A 3AGKA 2ATQA 3HT3A 1NK9A 4W5RA 3HPOA 3VEVA 1RT4A 3FZFA 4BC5A 1T7PA 4HVJA 4BREA 3KK2A 2P9SB 4DFMA 3M1FA 4IOAL 5JS2A 4DG1A 3ZETA 2VGNA 4FLYA 1W7AA 4RW9A 3LANA 3JS6A 3O1BA 4CBUA 4ILHA 3B6OA 4BE1A 2UXBK 4CZIA 4AHTA 4AILC 4BRHA 4I2QA 4FJ7A 3CHWA 4M63C 2P51A 2QM1A 4DKWA 1W2BM 4JD2B 2W41A 3PX0A 1YJWN 1SZ2A 4DV5K 3HYFA 3LP3A 3GDQA 3THYA 4DSKA 1EO1A 3L4QA 4XIUA 2Q0UA 1TYQB 3EZWA 5KQDA 1BGXT 5KRTA 2HVIA 2G8IA 3A2FA 3G25A 4CEFA 1S22A 5DK5A 4E7LA 5BR8K 2F9TA 5BPNA 4RW6A 4KH4A 2ETJA 3QBXA 3KD5E 2WOMA 2QI2A 1YXQA 4RWTA 1RBSA 2DTUA 3CPWM 3KZBA 1RTHA 3AVNA 3TR8A 3LDLA 3DRPA 3WNGA 2V7YA 3D45A 2AP1A 4J2EA 1JKHA 1SAZA 4FK0A 2GV9A 5FROA 1ZYQA 4CJLA 3D2EB 3C6HA 1JLBA 2DPNA 3DLEA 3LP1A 1BCMA 1ATRA 1KVAA 3LDQA 4IDKA 4FJ9A 4F2SA 5J1EA 3VF4A 3CJ1A 4CD1A 4DFJA 1IJJA 4ELTA 2QWNA 3QNOA 3QEVA 3SQ2A 3ID8A 3LDNA 4DU4A 4BQLA 5KRSA 2R7YA 2WTUA 3TAMA 4FOIA
chains in the Genus database with same CATH topology
3LWLA 2P5GA 2E6MA 3RRHA 1QSSA 1WSJA 4NCAA 2VG5A 1KFDA 3IRXA 4OKJA 4N47A 3V81A 4FW2A 3TAPA 1BI4B 2Z1JA 3M8QA 4CFCA 4Z4CA 2FBYA 1C1BA 4DQSA 1SKRA 4AHUA 4N76A 4LH4A 3NH1A 4DFPA 3I0SA 1VRTA 1NK8A 4FYDA 4Y1DA 1A5VA 1RDAA 1RT5A 2VG6A 1N5YA 4GVMA 3OYFA 2HHWA 5FRNA 1ZBUA 4CGGA 3V9WA 1SKWA 3OYHA 2W42A 4KB0A 1RT3A 5KI6A 2XHBA 4YFUA 4CEZA 4M3XA 4HUFA 1L3UA 2P5OA 4EP5A 3P5JA 4I2PA 1KCFA 1UOCA 1TK0A 1ASWA 3JYTA 3JSMA 3M8RA 2QK9A 3VQ6A 3T19A 1G15A 3O3FA 2Z1GA 2RKIA 4CFAA 4DMNA 3LDSA 4M3ZA 3MEGA 4CJKA 4M3UA 1HYZA 3LZIA 4I9LA 1YTUA 2WONA 1TAQA 5HLFA 3LALA 4ZTJA 4BDPA 4CJ5A 4KHUA 4DQPA 2OPRA 2KFNA 4OPKA 4W5OA 2D0BA 1W0HA 1Y97A 2PZSA 4CJUA 4Z4GA 3QEPA 3QESA 1KRPA 1S1VA 4DTOA 4FZXC 4FJKA 3ZSXA 2KTQA 2HHVA 3QEXA 4CEQA 4KHQA 3SUQA 3T1AA 4E89A 3NCIA 1X9SA 3I0RA 3KK1A 3VA3A 1WAJA 3TWHA 3SUNA 1WSEA 4FJNA 3OYLA 1LAWA 2B6AA 3THVA 1JLQA 3OYCA 4J2BA 3H08A 2XY5A 3NAEA 3G0ZA 1TL1A 3NFAA 2OZMA 4FJ8A 3ZT1A 3AVKA 1NK4A 1IKWA 2OPSA 1FKPA 2YNHA 3L2QA 5CY4A 4M3RA 4CE9A 4CIGA 3O3HA 1L3VA 3RR7A 3NH0A 4FJJA 4CGFA 2FC0A 3AO2A 3LZJA 3OJUA 5J2MA 3CFOA 3TARA 1YT3A 3F9KA 1VK0A 3MEDA 5KGWA 4CFDA 4KI4A 4OGEA 4CECA 1LWEA 3HL8A 3ALYA 4ZHRA 1YVUA 2X78A 2VWJA 1VRUA 1HYVA 1X9MA 3V1RA 3HVRA 1T05A 4K8XA 5CZ2A 4BWMA 5J2QA 1NK0A 3FFIA 3MXJA 4OKKA 3MAQA 3KLIA 3L3VA 4YNQA 1A5XA 2BGGA 4CJ3A 1RTIA 3ZSZA 3VA0A 3AVBA 4FM2A 2FBTA 4OVLA 3NDKA 4FCYA 1VSHA 3K58A 1LAVA 3ZT4A 3HVTA 1D9FA 4OPJA 4DSLA 3HPGA 4N5SA 3KLFA 3L2WA 3TAQA 3AO5A 3TANA 3RRGA 4W5QA 1K6YA 1KLNA 3RMAA 5FDLA 2YKNA 1Q8IA 3QETA 2G8HA 1CXQA 4KTWA 4F3OA 3KKSA 3VQ9A 3SV4A 5C42A 1XC9A 3AA5X 3ZT2A 1XWLA 3KLEA 3F73A 1S1TA 4OGCA 1QHTA 3VQ7A 1VSEA 4JRPA 4DTPA 3L2UA 1Q9XA 4FM1A 3OYEA 4DF8A 2OPQA 3SQ4A 1J54A 1KLMA 4OJRA 1QTMA 2QKKA 3QNNA 4PY5A 1A5WA 2KQ2A 1JLGA 1WSHA 4DTMA 2XRIA 3U6FA 2PYLA 3KLHA 3DM2A 2HHXA 1B9FA 1JXBA 1WSGA 1BL3A 1UAXA 3RMDA 1L3TA 4Z4HA 3ZT0A 5HRNA 4ELVA 3D0PA 4CCHA 4KB1A 4FJGA 3VQPA 1EETA 3ZT3A 2IOCA 3TAFA 2JLEA 4DSEA 3C6UA 4LSNA 3LP0A 4HCBA 3KKRA 5HROA 1LWFA 3OYJA 4CGHA 3C94A 3AVHA 4CJ4A 4E0DA 4PWDA 2RF2A 4ID1A 4C8MA 1REVA 3OYBA 4CESA 4LSLA 3SQ0A 4EZ6A 3TI0A 3RWUA 4FJIA 1GOAA 4O5BA 3K59A 1T03A 3SV3A 4Z4IA 4DQRA 3UIQA 3VQ5A 4FLWA 4I9QA 3HO1A 3CQ8A 4CERA 1VSFA 2IAJA 1MU2A 1XHXA 5J2PA 1ZBFA 1J5OA 5KTQA 4IG3A 4KTQA 5C25A 1C0MA 4F3TA 3IG1A 1IKYA 4FVMA 4DTRA 4R5PA 4AHRA 2OYQA 1BCOA 3LAMA 3M8PA 1HJRA 1NJXA 5I42A 3MXMA 3OYIA 4CF1A 4DLEA 4FZYA 4E7IA 3KJVA 3TAGA 1X9WA 3AVGA 4EZ9A 1TKDA 3HJFA 3O3GA 4B9UA 3DRRA 3T3FA 4M42A 1QE1A 2HHQA 3V9UA 2JGUA 1RILA 1SL2A 4DWIA 3PY8A 4MQ3A 1S5JA 3MEEA 4TSXA 2QXFA 1UA0A 2KZZA 2ITGA 3LPUA 3SUOA 3ZSRA 1IKXA 1TV6A 4CJWA 1BHLA 4CHQA 3K5MA 5D3GA 4DU1A 2F8SA 2FBVA 4CEBA 4CEOA 1BQNA 3C95A 3DLRA 3IS9A 2E6LA 4FLVA 4W5TA 1EXQA 1JL2A 4E7HA 4AHCA 1QSYA 1WN7A 1W9HA 4DLGA 4CJVA 3RMBA 4AH9A 1C1AA 3RMCA 4Z4EA 1NJYA 3CM5A 4LH5A 4WE1A 3PV8A 3DMJA 2D0AA 1RTDA 1I39A 4DSJA 1U04A 4H4MA 3L8BA 4HUEA 2RPIA 3K2PA 4KO0A 4B9NA 4FW1A 2E4LA 4JS4A 4B8CA 3NGIA 4FJXA 4DTSA 4CF0A 3AVFA 1TGOA 4M3WA 3M8SA 4B9TA 3AO1A 1Z26A 4JLHA 4Y1CA 2HNDA 2KW4A 3O4QA 2PY5A 3AO4A 1Q9YA 4QCLA 1DLOA 2A1SA 3V9ZA 4M3YA 1D5AA 1TK5A 4B9VA 4CFBA 2ZE2A 5DMRA 3QERA 1KVBA 3ITHA 3SZ2A 3OS2A 4F2RA 4LY7A 4JRQA 4CHNA 2XO7A 3PO4A 1TKXA 3KIOA 1HQUA 2XY8A 4RG8A 2DFHA 3BGRA 3OYAA 3K5LA 4CJTA 3DOLA 4MFBA 4CGJA 5T7BA 3EY1A 2ZQBA 3PX4A 4PA1A 3ZSWA 4RW4A 3QEWA 3SUPA 3AA2A 3I8DA 1HRHA 3OS0A 4B9MA 4DTNA 2HVHA 3NGYA 3PUFA 4AHSA 3TABA 1NKBA 4KHNA 1JL1A 5FRMA 4CF8A 4IBNA 1NKEA 3NF6A 1ZBLA 1RTJA 3S3MA 3BDPA 1Z25A 2RN2A 3LAKA 2OZSA 4BDYA 1NOYA 3NH2A 1ASVA 2GBZA 1S9EA 2IGIA 4Q5VA 4DTJA 4RW8A 3DRSA 3L2RA 2D0CA 4LD0A 4FK2A 2X6SA 3DYAA 1S6QA 1L5UA 1NKCA 1ASUA 2YNFA 2HB5A 3P83D 4Z0UA 5SZTA 4C8LA 4KHYA 2IDOA 2G8VA 1VSMA 2GUIA 3O4NA 4H4OA 1EX4A 3QLHA 4CIEA 4Q0BA 2G8WA 3CFPA 4DTUA 1RCHA 2HMIA 4NCBA 3L3UA 1SV5A 1SL0A 2B4JA 1I3AA 4CJRA 3HXMA 1FKOA 1NK7A 1RDBA 4B9LA 3LPTA 4IKFA 3AA3A 4BACA 3L2VA 1TL3A 3OVNA 3EZ5A 1RBVA 1S1XA 2HW3A 1WNSA 3PO5A 4UQGA 1NJZA 1ZBIA 1UWBA 1GOBA 2PYJA 4DSIA 4FJMA 3DOKA 3S3OA 3AVLA 1TKZA 5E41A 4FJHA 2HNZA 3AVJA 4DS5A 1RBRA 4E7KA 1CLQA 1F21A 5EU7A 4M41A 2HHTA 5CYQA 2A1RA 4I7FA 3TAEA 4CHZA 3U3GA 4CHYA 3HP6A 1NJWA 1RT6A 1C0TA 4E7JA 4HCCA 1DTTA 4FLTA 3K5OA 3OJSA 2F8TA 3AVAA 4NYFA 4HUGA 3VQDA 4KHWA 4RW7A 3HP9A 4O0IA 3B6PA 4KAZA 1GOCA 4J2AA 3SI6A 3HK2A 4FLXA 1KSPA 4FLZA 3NF9A 1RT1A 1EP4A 1NK5A 2XY7A 1J9AA 1TVRA 4BE0A 4DQQA 1C0UA 3V6DA 1VSJA 4H8KA 3C6TA 1EKEA 4DF4A 3RTVA 1HPZA 4FZZA 2Y1JA 3ZSOA 4B9SA 4B3OA 2I5JA 2ZD1A 4GW6A 1LV5A 1IH7A 4CK3A 3NGZA 1XI1A 2YHAA 1RBUA 3MXIA 3KTQA 4M3TA 2BE2A 1JLFA 3PX6A 4KRFA 4QAGA 1WLJA 5HRPA 1B9DA 2OA8A 3NBPA 1RDCA 4JS5A 3KD1E 1HNVA 3SCXA 4FM0A 1S6PA 1TKTA 4NCGA 2YNIA 2DY4A 3HPHA 3HSTB 1WSFA 4CJPA 3OS1A 1UA1A 1D8YA 4DS4A 1S1UA 4CJQA 3SYZA 4ELUA 4N41A 3NE6A 3VQ8A 2Q3SA 4KPYA 3DLBA 3OYNA 1U45A 4FJLA 4G1QA 2BDPA 4DU3A 1HMVA 3WNHA 4IG0A 3KK3A 1RT7A 2X74A 3HM9A 1SL1A 1QSLA 4HTUA 3V9XA 3OY9A 4KREA 1QQCA 4AHVA 2G8FA 3E01A 4OKEA 1S1WA 1YTAA 2BANA 4B8AB 3OYGA 2KZMA 4ICLA 1D9DA 4PQUA 1IG9A 3QIPA 5SWMA 4KKOA 4J2DA 1QS4A 1VSDA 3ULDA 3CYMA 4CEEA 3S9HA 2YHBA 1RT2A 4CK2A 4O0JA 1U48A 4M45A 4IFYA 1CXUA 1LWCA 2YV0X 1XHZA 4PUOA 4FJ5A 3AVMA 1BQMA 1JLEA 2G8UA 2P1JA 3OYDA 3LWMA 4FLUA 4C8NA 3U3YA 1WSIA 1S9GA 2XY6A 4IFVA 3AV9A 3WNFA 3HT3A 2ATQA 1NK9A 5C24A 2X6NA 3VQQA 4W5RA 2Z1HA 2EX3A 4ZTFA 1BI4A 3VQBA 3HPOA 1VSKA 1VSIA 3EYZA 1RT4A 1T7PA 1IKVA 4HVJA 3KK2A 4OLAA 1BIZA 2DFEA 4DFMA 5JS2A 4ID5A 3V1OA 4DG1A 3RR8A 4FLYA 4RW9A 3LANA 3V1QA 1TK8A 3NF7A 4CK1A 3MECA 4DSFA 1KVCA 3VN5A 4CHOA 1BIUA 2HNYA 4W5NA 4BDZA 3B6OA 2IC3A 3SPYA 4CJFA 4BE1A 1DTQA 3S3NA 1HYSA 4DTXA 1HQEA 2VWKA 4E3SA 3KLGA 4AHTA 1BISA 4AILC 1ZBHA 4FK4A 1B92A 4I2QA 2OPPA 1LW2A 4E19A 3QEIA 4FJ7A 4GMJB 2O4GA 1X1PA 2FBXA 2P51A 5J2NA 1SUQA 4KTZA 4HHTA 3AVIA 2LSNA 2NUBA 2YKMA 4OLBA 4CJSA 4NYNA 3VQCA 3WNEA 1C1CA 1U49A 3PX0A 4E1MA 4B08A 1JLAA 3OYMA 2F96A 1SKSA 4L8RB 2VG7A 3ZCMA 3DI6A 4O44A 4CJEA 1U4BA 4QOZB 5JS1A 3HYFA 3LP3A 3K5NA 3ZSYA 1T8EA 4DSKA 1KTQA 3QINA 3VQEA 4E1NA 3DLKA 4CGIA 4XIUA 4CEDA 1BGXT 5KRTA 4K8ZA 4F4KA 2G8IA 2HVIA 1L3SA 1RDDA 3V9SA 3A2FA 4F8RA 5HP1A 4CIFA 3NHGA 4Z4FA 4CEFA 4KHSA 5DK5A 1CZ9A 5K14A 1RBTA 4E7LA 1FK9A 3ASMA 4O4GA 3OYKA 3G10A 3LP2A 2ETJA 4RW6A 2G8KA 1RNHA 1ITGA 2WOMA 3KD5E 2AJQA 5HRRA 1KFSA 2KFZA 1LW0A 1RBSA 2DTUA 1RTHA 4DQIA 3AVNA 3CG7A 1IO2A 3NF8A 5CZ1A 1WAFA 3TR8A 3SQ1A 3DRPA 3WNGA 1JLCA 2IS3A 1O1WA 2Z1IA 3P1GA 3SJJA 3D45A 2EHGA 4J2EA 1JKHA 4O55A 2Y1IA 2D5RA 4FK0A 1FXXA 2YNGA 1JXEA 5HBMA 2GV9A 5FROA 3QIOA 3ISNC 4CJLA 3V4IA 1ZYQA 1C6VA 3CFRA 1JLBA 3DLEA 3LP1A 4CHPA 4DFKA 4KI6A 1BCMA 4CF2A 3SNNA 3AO3A 2O4IA 3QO9A 1KVAA 5I3UA 4IDKA 3ZSVA 4FJ9A 3AVCA 1N6QA 1HNIA 2B5JA 4F2SA 2HHSA 3K57A 4CGDA 4FXDA 5J1EA 4N56A 3IAYA 3SPZA 5HRSA 1CZBA 4EP4A 4DFJA 1NK6A 4C8KA 4ELTA 4CF9A 2QKBA 1TAUA 4C8OA 3QNOA 3QEVA 3VQAA 3SQ2A 2DFFA 4CEAA 3AA4A 3DLHA 2HHUA 4KV8A 4DU4A 3VQ4A 1J53A 1NOZA 1VSLA 4KFBA 3CM6A 5KRSA 2R7YA 4BE2A 3ZSQA 3DLGA 4BWJA 1U47A 1R0AA 5CYMA 3TAMA 5KGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWL A;  2P5G A;  2E6M A;  3RRH A;  1QSS A;  1WSJ A;  4NCA A;  2VG5 A;  1KFD A;  3IRX A;  4OKJ A;  4N47 A;  3V81 A;  4FW2 A;  3TAP A;  1BI4 B;  2Z1J A;  3M8Q A;  4CFC A;  4Z4C A;  2FBY A;  1C1B A;  4DQS A;  1SKR A;  4AHU A;  4N76 A;  4LH4 A;  3NH1 A;  4DFP A;  3I0S A;  1VRT A;  1NK8 A;  4FYD A;  4Y1D A;  1A5V A;  1RDA A;  1RT5 A;  2VG6 A;  1N5Y A;  4GVM A;  3OYF A;  2HHW A;  5FRN A;  1ZBU A;  4CGG A;  3V9W A;  1SKW A;  3OYH A;  2W42 A;  4KB0 A;  1RT3 A;  5KI6 A;  2XHB A;  4YFU A;  4CEZ A;  4M3X A;  4HUF A;  1L3U A;  2P5O A;  4EP5 A;  3P5J A;  4I2P A;  1KCF A;  1UOC A;  1TK0 A;  1ASW A;  3JYT A;  3JSM A;  3M8R A;  2QK9 A;  3VQ6 A;  3T19 A;  1G15 A;  3O3F A;  2Z1G A;  2RKI A;  4CFA A;  4DMN A;  3LDS A;  4M3Z A;  3MEG A;  4CJK A;  4M3U A;  1HYZ A;  3LZI A;  4I9L A;  1YTU A;  2WON A;  1TAQ A;  5HLF A;  3LAL A;  4ZTJ A;  4BDP A;  4CJ5 A;  4KHU A;  4DQP A;  2OPR A;  2KFN A;  4OPK A;  4W5O A;  2D0B A;  1W0H A;  1Y97 A;  2PZS A;  4CJU A;  4Z4G A;  3QEP A;  3QES A;  1KRP A;  1S1V A;  4DTO A;  4FZX C;  4FJK A;  3ZSX A;  2KTQ A;  2HHV A;  3QEX A;  4CEQ A;  4KHQ A;  3SUQ A;  3T1A A;  4E89 A;  3NCI A;  1X9S A;  3I0R A;  3KK1 A;  3VA3 A;  1WAJ A;  3TWH A;  3SUN A;  1WSE A;  4FJN A;  3OYL A;  1LAW A;  2B6A A;  3THV A;  1JLQ A;  3OYC A;  4J2B A;  3H08 A;  2XY5 A;  3NAE A;  3G0Z A;  1TL1 A;  3NFA A;  2OZM A;  4FJ8 A;  3ZT1 A;  3AVK A;  1NK4 A;  1IKW A;  2OPS A;  1FKP A;  2YNH A;  3L2Q A;  5CY4 A;  4M3R A;  4CE9 A;  4CIG A;  3O3H A;  1L3V A;  3RR7 A;  3NH0 A;  4FJJ A;  4CGF A;  2FC0 A;  3AO2 A;  3LZJ A;  3OJU A;  5J2M A;  3CFO A;  3TAR A;  1YT3 A;  3F9K A;  1VK0 A;  3MED A;  5KGW A;  4CFD A;  4KI4 A;  4OGE A;  4CEC A;  1LWE A;  3HL8 A;  3ALY A;  4ZHR A;  1YVU A;  2X78 A;  2VWJ A;  1VRU A;  1HYV A;  1X9M A;  3V1R A;  3HVR A;  1T05 A;  4K8X A;  5CZ2 A;  4BWM A;  5J2Q A;  1NK0 A;  3FFI A;  3MXJ A;  4OKK A;  3MAQ A;  3KLI A;  3L3V A;  4YNQ A;  1A5X A;  2BGG A;  4CJ3 A;  1RTI A;  3ZSZ A;  3VA0 A;  3AVB A;  4FM2 A;  2FBT A;  4OVL A;  3NDK A;  4FCY A;  1VSH A;  3K58 A;  1LAV A;  3ZT4 A;  3HVT A;  1D9F A;  4OPJ A;  4DSL A;  3HPG A;  4N5S A;  3KLF A;  3L2W A;  3TAQ A;  3AO5 A;  3TAN A;  3RRG A;  4W5Q A;  1K6Y A;  1KLN A;  3RMA A;  5FDL A;  2YKN A;  1Q8I A;  3QET A;  2G8H A;  1CXQ A;  4KTW A;  4F3O A;  3KKS A;  3VQ9 A;  3SV4 A;  5C42 A;  1XC9 A;  3AA5 X;  3ZT2 A;  1XWL A;  3KLE A;  3F73 A;  1S1T A;  4OGC A;  1QHT A;  3VQ7 A;  1VSE A;  4JRP A;  4DTP A;  3L2U A;  1Q9X A;  4FM1 A;  3OYE A;  4DF8 A;  2OPQ A;  3SQ4 A;  1J54 A;  1KLM A;  4OJR A;  1QTM A;  2QKK A;  3QNN A;  4PY5 A;  1A5W A;  2KQ2 A;  1JLG A;  1WSH A;  4DTM A;  2XRI A;  3U6F A;  2PYL A;  3KLH A;  3DM2 A;  2HHX A;  1B9F A;  1JXB A;  1WSG A;  1BL3 A;  1UAX A;  3RMD A;  1L3T A;  4Z4H A;  3ZT0 A;  5HRN A;  4ELV A;  3D0P A;  4CCH A;  4KB1 A;  4FJG A;  3VQP A;  1EET A;  3ZT3 A;  2IOC A;  3TAF A;  2JLE A;  4DSE A;  3C6U A;  4LSN A;  3LP0 A;  4HCB A;  3KKR A;  5HRO A;  1LWF A;  3OYJ A;  4CGH A;  3C94 A;  3AVH A;  4CJ4 A;  4E0D A;  4PWD A;  2RF2 A;  4ID1 A;  4C8M A;  1REV A;  3OYB A;  4CES A;  4LSL A;  3SQ0 A;  4EZ6 A;  3TI0 A;  3RWU A;  4FJI A;  1GOA A;  4O5B A;  3K59 A;  1T03 A;  3SV3 A;  4Z4I A;  4DQR A;  3UIQ A;  3VQ5 A;  4FLW A;  4I9Q A;  3HO1 A;  3CQ8 A;  4CER A;  1VSF A;  2IAJ A;  1MU2 A;  1XHX A;  5J2P A;  1ZBF A;  1J5O A;  5KTQ A;  4IG3 A;  4KTQ A;  5C25 A;  1C0M A;  4F3T A;  3IG1 A;  1IKY A;  4FVM A;  4DTR A;  4R5P A;  4AHR A;  2OYQ A;  1BCO A;  3LAM A;  3M8P A;  1HJR A;  1NJX A;  5I42 A;  3MXM A;  3OYI A;  4CF1 A;  4DLE A;  4FZY A;  4E7I A;  3KJV A;  3TAG A;  1X9W A;  3AVG A;  4EZ9 A;  1TKD A;  3HJF A;  3O3G A;  4B9U A;  3DRR A;  3T3F A;  4M42 A;  1QE1 A;  2HHQ A;  3V9U A;  2JGU A;  1RIL A;  1SL2 A;  4DWI A;  3PY8 A;  4MQ3 A;  1S5J A;  3MEE A;  4TSX A;  2QXF A;  1UA0 A;  2KZZ A;  2ITG A;  3LPU A;  3SUO A;  3ZSR A;  1IKX A;  1TV6 A;  4CJW A;  1BHL A;  4CHQ A;  3K5M A;  5D3G A;  4DU1 A;  2F8S A;  2FBV A;  4CEB A;  4CEO A;  1BQN A;  3C95 A;  3DLR A;  3IS9 A;  2E6L A;  4FLV A;  4W5T A;  1EXQ A;  1JL2 A;  4E7H A;  4AHC A;  1QSY A;  1WN7 A;  1W9H A;  4DLG A;  4CJV A;  3RMB A;  4AH9 A;  1C1A A;  3RMC A;  4Z4E A;  1NJY A;  3CM5 A;  4LH5 A;  4WE1 A;  3PV8 A;  3DMJ A;  2D0A A;  1RTD A;  1I39 A;  4DSJ A;  1U04 A;  4H4M A;  3L8B A;  4HUE A;  2RPI A;  3K2P A;  4KO0 A;  4B9N A;  4FW1 A;  2E4L A;  4JS4 A;  4B8C A;  3NGI A;  4FJX A;  4DTS A;  4CF0 A;  3AVF A;  1TGO A;  4M3W A;  3M8S A;  4B9T A;  3AO1 A;  1Z26 A;  4JLH A;  4Y1C A;  2HND A;  2KW4 A;  3O4Q A;  2PY5 A;  3AO4 A;  1Q9Y A;  4QCL A;  1DLO A;  2A1S A;  3V9Z A;  4M3Y A;  1D5A A;  1TK5 A;  4B9V A;  4CFB A;  2ZE2 A;  5DMR A;  3QER A;  1KVB A;  3ITH A;  3SZ2 A;  3OS2 A;  4F2R A;  4LY7 A;  4JRQ A;  4CHN A;  2XO7 A;  3PO4 A;  1TKX A;  3KIO A;  1HQU A;  2XY8 A;  4RG8 A;  2DFH A;  3BGR A;  3OYA A;  3K5L A;  4CJT A;  3DOL A;  4MFB A;  4CGJ A;  5T7B A;  3EY1 A;  2ZQB A;  3PX4 A;  4PA1 A;  3ZSW A;  4RW4 A;  3QEW A;  3SUP A;  3AA2 A;  3I8D A;  1HRH A;  3OS0 A;  4B9M A;  4DTN A;  2HVH A;  3NGY A;  3PUF A;  4AHS A;  3TAB A;  1NKB A;  4KHN A;  1JL1 A;  5FRM A;  4CF8 A;  4IBN A;  1NKE A;  3NF6 A;  1ZBL A;  1RTJ A;  3S3M A;  3BDP A;  1Z25 A;  2RN2 A;  3LAK A;  2OZS A;  4BDY A;  1NOY A;  3NH2 A;  1ASV A;  2GBZ A;  1S9E A;  2IGI A;  4Q5V A;  4DTJ A;  4RW8 A;  3DRS A;  3L2R A;  2D0C A;  4LD0 A;  4FK2 A;  2X6S A;  3DYA A;  1S6Q A;  1L5U A;  1NKC A;  1ASU A;  2YNF A;  2HB5 A;  3P83 D;  4Z0U A;  5SZT A;  4C8L A;  4KHY A;  2IDO A;  2G8V A;  1VSM A;  2GUI A;  3O4N A;  4H4O A;  1EX4 A;  3QLH A;  4CIE A;  4Q0B A;  2G8W A;  3CFP A;  4DTU A;  1RCH A;  2HMI A;  4NCB A;  3L3U A;  1SV5 A;  1SL0 A;  2B4J A;  1I3A A;  4CJR A;  3HXM A;  1FKO A;  1NK7 A;  1RDB A;  4B9L A;  3LPT A;  4IKF A;  3AA3 A;  4BAC A;  3L2V A;  1TL3 A;  3OVN A;  3EZ5 A;  1RBV A;  1S1X A;  2HW3 A;  1WNS A;  3PO5 A;  4UQG A;  1NJZ A;  1ZBI A;  1UWB A;  1GOB A;  2PYJ A;  4DSI A;  4FJM A;  3DOK A;  3S3O A;  3AVL A;  1TKZ A;  5E41 A;  4FJH A;  2HNZ A;  3AVJ A;  4DS5 A;  1RBR A;  4E7K A;  1CLQ A;  1F21 A;  5EU7 A;  4M41 A;  2HHT A;  5CYQ A;  2A1R A;  4I7F A;  3TAE A;  4CHZ A;  3U3G A;  4CHY A;  3HP6 A;  1NJW A;  1RT6 A;  1C0T A;  4E7J A;  4HCC A;  1DTT A;  4FLT A;  3K5O A;  3OJS A;  2F8T A;  3AVA A;  4NYF A;  4HUG A;  3VQD A;  4KHW A;  4RW7 A;  3HP9 A;  4O0I A;  3B6P A;  4KAZ A;  1GOC A;  4J2A A;  3SI6 A;  3HK2 A;  4FLX A;  1KSP A;  4FLZ A;  3NF9 A;  1RT1 A;  1EP4 A;  1NK5 A;  2XY7 A;  1J9A A;  1TVR A;  4BE0 A;  4DQQ A;  1C0U A;  3V6D A;  1VSJ A;  4H8K A;  3C6T A;  1EKE A;  4DF4 A;  3RTV A;  1HPZ A;  4FZZ A;  2Y1J A;  3ZSO A;  4B9S A;  4B3O A;  2I5J A;  2ZD1 A;  4GW6 A;  1LV5 A;  1IH7 A;  4CK3 A;  3NGZ A;  1XI1 A;  2YHA A;  1RBU A;  3MXI A;  3KTQ A;  4M3T A;  2BE2 A;  1JLF A;  3PX6 A;  4KRF A;  4QAG A;  1WLJ A;  5HRP A;  1B9D A;  2OA8 A;  3NBP A;  1RDC A;  4JS5 A;  3KD1 E;  1HNV A;  3SCX A;  4FM0 A;  1S6P A;  1TKT A;  4NCG A;  2YNI A;  2DY4 A;  3HPH A;  3HST B;  1WSF A;  4CJP A;  3OS1 A;  1UA1 A;  1D8Y A;  4DS4 A;  1S1U A;  4CJQ A;  3SYZ A;  4ELU A;  4N41 A;  3NE6 A;  3VQ8 A;  2Q3S A;  4KPY A;  3DLB A;  3OYN A;  1U45 A;  4FJL A;  4G1Q A;  2BDP A;  4DU3 A;  1HMV A;  3WNH A;  4IG0 A;  3KK3 A;  1RT7 A;  2X74 A;  3HM9 A;  1SL1 A;  1QSL A;  4HTU A;  3V9X A;  3OY9 A;  4KRE A;  1QQC A;  4AHV A;  2G8F A;  3E01 A;  4OKE A;  1S1W A;  1YTA A;  2BAN A;  4B8A B;  3OYG A;  2KZM A;  4ICL A;  1D9D A;  4PQU A;  1IG9 A;  3QIP A;  5SWM A;  4KKO A;  4J2D A;  1QS4 A;  1VSD A;  3ULD A;  3CYM A;  4CEE A;  3S9H A;  2YHB A;  1RT2 A;  4CK2 A;  4O0J A;  1U48 A;  4M45 A;  4IFY A;  1CXU A;  1LWC A;  2YV0 X;  1XHZ A;  4PUO A;  4FJ5 A;  3AVM A;  1BQM A;  1JLE A;  2G8U A;  2P1J A;  3OYD A;  3LWM A;  4FLU A;  4C8N A;  3U3Y A;  1WSI A;  1S9G A;  2XY6 A;  4IFV A;  3AV9 A;  3WNF A;  3HT3 A;  2ATQ A;  1NK9 A;  5C24 A;  2X6N A;  3VQQ A;  4W5R A;  2Z1H A;  2EX3 A;  4ZTF A;  1BI4 A;  3VQB A;  3HPO A;  1VSK A;  1VSI A;  3EYZ A;  1RT4 A;  1T7P A;  1IKV A;  4HVJ A;  3KK2 A;  4OLA A;  1BIZ A;  2DFE A;  4DFM A;  5JS2 A;  4ID5 A;  3V1O A;  4DG1 A;  3RR8 A;  4FLY A;  4RW9 A;  3LAN A;  3V1Q A;  1TK8 A;  3NF7 A;  4CK1 A;  3MEC A;  4DSF A;  1KVC A;  3VN5 A;  4CHO A;  1BIU A;  2HNY A;  4W5N A;  4BDZ A;  3B6O A;  2IC3 A;  3SPY A;  4CJF A;  4BE1 A;  1DTQ A;  3S3N A;  1HYS A;  4DTX A;  1HQE A;  2VWK A;  4E3S A;  3KLG A;  4AHT A;  1BIS A;  4AIL C;  1ZBH A;  4FK4 A;  1B92 A;  4I2Q A;  2OPP A;  1LW2 A;  4E19 A;  3QEI A;  4FJ7 A;  4GMJ B;  2O4G A;  1X1P A;  2FBX A;  2P51 A;  5J2N A;  1SUQ A;  4KTZ A;  4HHT A;  3AVI A;  2LSN A;  2NUB A;  2YKM A;  4OLB A;  4CJS A;  4NYN A;  3VQC A;  3WNE A;  1C1C A;  1U49 A;  3PX0 A;  4E1M A;  4B08 A;  1JLA A;  3OYM A;  2F96 A;  1SKS A;  4L8R B;  2VG7 A;  3ZCM A;  3DI6 A;  4O44 A;  4CJE A;  1U4B A;  4QOZ B;  5JS1 A;  3HYF A;  3LP3 A;  3K5N A;  3ZSY A;  1T8E A;  4DSK A;  1KTQ A;  3QIN A;  3VQE A;  4E1N A;  3DLK A;  4CGI A;  4XIU A;  4CED A;  1BGX T;  5KRT A;  4K8Z A;  4F4K A;  2G8I A;  2HVI A;  1L3S A;  1RDD A;  3V9S A;  3A2F A;  4F8R A;  5HP1 A;  4CIF A;  3NHG A;  4Z4F A;  4CEF A;  4KHS A;  5DK5 A;  1CZ9 A;  5K14 A;  1RBT A;  4E7L A;  1FK9 A;  3ASM A;  4O4G A;  3OYK A;  3G10 A;  3LP2 A;  2ETJ A;  4RW6 A;  2G8K A;  1RNH A;  1ITG A;  2WOM A;  3KD5 E;  2AJQ A;  5HRR A;  1KFS A;  2KFZ A;  1LW0 A;  1RBS A;  2DTU A;  1RTH A;  4DQI A;  3AVN A;  3CG7 A;  1IO2 A;  3NF8 A;  5CZ1 A;  1WAF A;  3TR8 A;  3SQ1 A;  3DRP A;  3WNG A;  1JLC A;  2IS3 A;  1O1W A;  2Z1I A;  3P1G A;  3SJJ A;  3D45 A;  2EHG A;  4J2E A;  1JKH A;  4O55 A;  2Y1I A;  2D5R A;  4FK0 A;  1FXX A;  2YNG A;  1JXE A;  5HBM A;  2GV9 A;  5FRO A;  3QIO A;  3ISN C;  4CJL A;  3V4I A;  1ZYQ A;  1C6V A;  3CFR A;  1JLB A;  3DLE A;  3LP1 A;  4CHP A;  4DFK A;  4KI6 A;  1BCM A;  4CF2 A;  3SNN A;  3AO3 A;  2O4I A;  3QO9 A;  1KVA A;  5I3U A;  4IDK A;  3ZSV A;  4FJ9 A;  3AVC A;  1N6Q A;  1HNI A;  2B5J A;  4F2S A;  2HHS A;  3K57 A;  4CGD A;  4FXD A;  5J1E A;  4N56 A;  3IAY A;  3SPZ A;  5HRS A;  1CZB A;  4EP4 A;  4DFJ A;  1NK6 A;  4C8K A;  4ELT A;  4CF9 A;  2QKB A;  1TAU A;  4C8O A;  3QNO A;  3QEV A;  3VQA A;  3SQ2 A;  2DFF A;  4CEA A;  3AA4 A;  3DLH A;  2HHU A;  4KV8 A;  4DU4 A;  3VQ4 A;  1J53 A;  1NOZ A;  1VSL A;  4KFB A;  3CM6 A;  5KRS A;  2R7Y A;  4BE2 A;  3ZSQ A;  3DLG A;  4BWJ A;  1U47 A;  1R0A A;  5CYM A;  3TAM A;  5KGX A; 
#chains in the Genus database with same CATH topology
 2P5G A;  4Z4F A;  5FLX O;  3RRH A;  1WSJ A;  1QSS A;  4N47 A;  4CJ7 A;  1YF5 L;  4FW2 A;  4YOV A;  4CFC A;  4YOW A;  4N76 A;  4JK8 A;  2QWM A;  4JI8 K;  4Y1D A;  1RDA A;  1RT5 A;  1N5Y A;  3EE8 A;  2ASP A;  1QQM A;  2W40 A;  3VGM A;  5FRN A;  2ITM A;  3V9W A;  4DR5 K;  3OYH A;  2W42 A;  5FPD A;  1RT3 A;  4CEZ A;  4M3X A;  4EP5 A;  3HBT A;  4IOX A;  3A5M C;  4EAH D;  3VQ6 A;  1G15 A;  2Z1G A;  2RKI A;  1Q18 A;  3LDS A;  3MEG A;  4DR2 K;  1YTU A;  2WON A;  1N34 K;  4CJ5 A;  2OPR A;  2PZS A;  5C15 A;  2GX9 A;  4Z4G A;  2ZGZ A;  1MA9 B;  4KHQ A;  3SUQ A;  3T1A A;  4E89 A;  2GEL A;  3I0R A;  5B8H A;  3KK1 A;  1WSE A;  4J2B A;  3NAE A;  1MWM A;  4FJ8 A;  2KHO A;  5AQO A;  1FKP A;  4CE9 A;  1HR0 K;  3O3H A;  4JK9 A;  2FC0 A;  3AO2 A;  3OJU A;  1YVN A;  1VK0 A;  4PL7 A;  1GLB G;  4ISG A;  3V1R A;  1T05 A;  3WT0 A;  4BWM A;  1YHQ N;  4H5N A;  3MXJ A;  3KLI A;  4YNQ A;  4EFH A;  3AAR A;  3WXJ A;  3EO3 A;  3SAG A;  4GV3 A;  1TUY A;  2FBT A;  3R9P A;  1D9F A;  3OBW A;  4LF9 K;  3QET A;  2OCE A;  1XWL A;  3KLE A;  3F73 A;  4DTP A;  3VQ7 A;  1NGG A;  4JRP A;  4DF8 A;  5AFU A;  1HPM A;  3SQ4 A;  4OJR A;  1QTM A;  3QNN A;  3H46 O;  2XRI A;  2PYL A;  4BC3 A;  2HHX A;  1JXB A;  4YOT A;  3ULE B;  3SAF A;  2VQF K;  3ZT0 A;  4MO4 A;  4CCH A;  2NNW A;  1NGJ A;  2IVP A;  4FJG A;  3VQP A;  3ZT3 A;  3TAF A;  4DSE A;  3HTV A;  4LSN A;  2HF4 A;  5HRO A;  3C94 A;  4ISF A;  4PWD A;  4ID1 A;  4LSL A;  4FJI A;  5LY3 A;  3TI0 A;  2NRX A;  1T03 A;  1MDU B;  3VQ5 A;  4FLW A;  3HO1 A;  1ILY A;  2E2O A;  2IAJ A;  5J2P A;  1DGK N;  5C25 A;  3IG1 A;  1IKY A;  1U2V A;  4IOC L;  1HJR A;  3MXM A;  1O13 A;  3OYI A;  4DV3 K;  3KHY A;  4U67 L;  4KBO A;  3O3G A;  5A2Q O;  4M42 A;  3DXK A;  3KVG A;  1S5J A;  4TSX A;  4BY9 C;  2HOE A;  1UA0 A;  2KZZ A;  4JHD A;  3SUO A;  5BPM A;  5EX5 A;  4K41 A;  2IVO A;  3BZK A;  4CJW A;  5D3G A;  2FBV A;  4DV4 K;  3IS9 A;  2A3Z A;  3EEQ A;  2E6L A;  1HNZ K;  1YI2 N;  3EL2 A;  1W9H A;  4LF5 K;  2GUP A;  4DLG A;  1NG9 A;  1RTD A;  4BRC A;  2P9L B;  1I39 A;  2GWJ A;  3L8B A;  4BRQ A;  5AFU H;  4DTS A;  2HMP A;  3AVF A;  1U2V B;  4WYB A;  1Z26 A;  4JLH A;  3TU5 A;  3HSC A;  2E2N A;  5AQI A;  3F5T A;  3QER A;  3OS2 A;  4F2R A;  3PLA A;  4JKD A;  1TKX A;  4WQ5 A;  3FR0 A;  3RSE B;  3EY1 A;  4DB3 A;  3ZSW A;  3ZLJ A;  3AA2 A;  4LFC K;  3TAB A;  2CH6 A;  1NKE A;  3NF6 A;  1K8A O;  2P9L A;  1Z25 A;  2VCP A;  3AAQ A;  4BDY A;  2UXD K;  2GBZ A;  4Q5V A;  1S6Q A;  2YNF A;  5H1S Q;  1ZC6 A;  2IDO A;  5CE3 A;  4H4O A;  4Q0B A;  3O5B A;  4JN4 A;  2HMI A;  4NCB A;  4Z94 A;  3QBW A;  3MX2 A;  4CJR A;  3GL1 A;  1QQN A;  3AA3 A;  3OVN A;  1RBV A;  2HW3 A;  1NJZ A;  1UWB A;  3O1W A;  3E9L A;  3CC2 N;  3DOK A;  3AVL A;  3K9K A;  2CGK A;  3A0I X;  1KAX A;  1RBR A;  4FSV A;  4E7K A;  3QFP A;  5EU7 A;  4DQ8 A;  2A1R A;  4CHY A;  3J7Z O;  1DKG D;  1DTT A;  4FLT A;  3K5O A;  3AVA A;  4NYF A;  4HUG A;  3HP9 A;  4O8U A;  3B6P A;  4LF4 K;  3CIP A;  3HK2 A;  1KSP A;  3NF9 A;  1RT1 A;  2D4W A;  2XY7 A;  4IFE A;  4DQQ A;  1HNW K;  4H8K A;  3C6T A;  5AZJ B;  3RTV A;  2VWB A;  4R79 A;  2Y1J A;  3THX B;  4B3O A;  3Q7B A;  2D0P A;  3VEO A;  4CK3 A;  3NVK A;  2YHA A;  4O5F A;  2BE2 A;  1JLF A;  4QAG A;  5M1N A;  3E9P A;  3CMA N;  3SCX A;  4FM0 A;  4BRN A;  1MWK A;  4QS9 A;  1BWF O;  1P8Z A;  1BOT O;  1WSF A;  1OH6 A;  1S1U A;  1VQK N;  1KQS M;  1Y64 A;  5KPT A;  2BDP A;  4DR7 K;  5BRF A;  3C0B A;  1SL1 A;  4IEI A;  3OY9 A;  3L4I A;  5GAH P;  4ICL A;  4PQU A;  4J8F A;  3FZL A;  4KKO A;  2E1Y A;  1QS4 A;  4WFB L;  3JXU A;  4JK7 A;  4CK2 A;  4IFY A;  1CXU A;  4PUO A;  1EWR A;  1BQM A;  1HKG A;  2P1J A;  3OYD A;  1NGA A;  1S9G A;  2XY6 A;  4IFV A;  3WUH A;  1RFQ A;  4CZG A;  4AF1 A;  2O8E B;  2DFE A;  4A59 A;  3EN9 A;  4OPA A;  3CCR N;  3V1O A;  5JVG L;  1TK8 A;  3EKS A;  4CK1 A;  4DSF A;  1KVC A;  3VN5 A;  4B1V A;  4BDZ A;  4DUZ K;  1XQS C;  4CJF A;  3O80 A;  4BR0 A;  4DCH A;  4E3S A;  2VWK A;  3KLG A;  3ATU A;  1LW2 A;  4H5V A;  4E19 A;  1E4F T;  3QEI A;  2O8D B;  1VQP N;  1X1P A;  2FBX A;  5J2N A;  4JI4 K;  4CW7 B;  3AVI A;  2LSN A;  2NUB A;  2YKM A;  3C7N A;  4NYN A;  1U49 A;  4BR9 A;  4B08 A;  2F96 A;  3GOI A;  1SKS A;  2VG7 A;  4BRP A;  3DI6 A;  3T1H K;  4CJE A;  4IXC A;  3G71 N;  4QOZ B;  3UKU A;  4JYA K;  3E66 A;  4H0O A;  4KH5 A;  4JHD B;  3VQE A;  4E1N A;  1QVF M;  5I9E B;  2FLO A;  4I6M A;  1RDD A;  2H3G X;  1FK9 A;  3G10 A;  4H5T A;  3K0S A;  2AJQ A;  2O8E A;  3FGU A;  1NMD A;  5HRR A;  1TUU A;  1KFS A;  4BR2 A;  2OTL N;  3CJ7 A;  5CZ1 A;  1JLC A;  1YJN N;  2IS3 A;  1O1W A;  2Z1I A;  3ENH A;  5AZI A;  3I56 N;  2BUP A;  1XNQ K;  3VF2 A;  4C1N K;  5GIP A;  2CH5 A;  2D5R A;  4LC9 B;  2P9P A;  1FXX A;  2YNG A;  3ISN C;  1C6V A;  2JWL A;  3CFR A;  4DFK A;  4CF2 A;  4YHH K;  3AO3 A;  4K0K K;  3QO9 A;  3ZSV A;  1HNI A;  3K57 A;  5C2F A;  4CGD A;  4CZH A;  3IAY A;  5TKW A;  4EP4 A;  3ULE A;  1NK6 A;  4C8K A;  3VQA A;  4CEA A;  2NLX A;  3IFR A;  3AA4 A;  1R0A A;  3VQ4 A;  1J53 A;  3A5N C;  3FZM A;  3ZSQ A;  3DLG A;  3AY9 A;  3ZX3 A;  5HL7 L;  3ZEU A;  5KGX A;  2VG5 A;  1KFD A;  2O8F B;  1TYQ A;  5ADX A;  1BI4 B;  2Z1J A;  3U9Z A;  4Z4C A;  5GIO A;  2YJF A;  1SKR A;  2HBM A;  4LH4 A;  1NK8 A;  1A5V A;  2E1Z A;  4GVM A;  2HHW A;  3VEN A;  4MLE A;  1NGH A;  1J6Z A;  5KI6 A;  2XHB A;  4HUF A;  4LFB K;  1UOC A;  2W6L A;  1TK0 A;  1ASW A;  3JSM A;  1Q81 O;  4H5W A;  2UUA K;  3E1Y A;  1HYZ A;  4I9L A;  4B3M K;  4ZTJ A;  3LAL A;  4DQP A;  3VPZ A;  3CC4 N;  4OPK A;  2D0B A;  1Y97 A;  5AQV A;  3BZC A;  1S1V A;  3T1Y K;  2YHW A;  3ZSX A;  3QEX A;  1YIT N;  4B3T K;  1X9S A;  1NBW A;  3O9R A;  3OYL A;  1JLQ A;  2XY5 A;  5BRE A;  2Q31 A;  3IUC A;  1TL1 A;  2OZM A;  4BRL A;  2OPS A;  3I33 A;  1N32 K;  3D2F B;  5CY4 A;  3OA9 A;  4CIG A;  1GLC G;  3NH0 A;  4CGF A;  3MN9 A;  1VQN N;  2Q36 A;  5J2M A;  4A61 A;  3TAR A;  3F9K A;  3MED A;  5KGW A;  4MLH A;  4CEC A;  3HL8 A;  4ZHR A;  1YVU A;  5AQG A;  3ZX0 A;  4K8X A;  2P9U B;  1X9J A;  1NK0 A;  3TTC A;  5C2D A;  4OKK A;  3L3V A;  3KWI A;  2ZJR L;  1RTI A;  3TSQ A;  4FM2 A;  1QZ5 A;  3TPQ A;  3FZH A;  1LAV A;  1VAZ A;  4OPJ A;  3HPG A;  3TAN A;  3L2W A;  3TAQ A;  4W5Q A;  3G4S N;  1K6Y A;  1KLN A;  1GLD G;  1CXQ A;  1GLF O;  4F3O A;  3KKS A;  3SV4 A;  5C42 A;  4H0Y B;  3ZT2 A;  1QHT A;  1Q9X A;  4FM1 A;  3OYE A;  3PIP L;  3D2E A;  2KQ2 A;  2IIR A;  4DTM A;  3KLH A;  3DM2 A;  1BL3 A;  1UAX A;  1L3T A;  1V4S A;  4ELV A;  3U4L A;  5GAD P;  2ZJP L;  1LWF A;  4CGH A;  4FWL A;  3P38 A;  1REV A;  3OYB A;  1SQK A;  4BRK A;  1HKC A;  5FPM A;  1QHA A;  1BA0 A;  1VHX A;  2HF3 A;  2P9U A;  1XHX A;  1ZBF A;  3OW2 M;  5KTQ A;  2FSK A;  1C0M A;  1RDU A;  4R5P A;  4AHR A;  1BCO A;  1NJX A;  4H0V B;  3BUZ B;  5I42 A;  4DLE A;  3MK6 A;  3TAG A;  3AVG A;  1VQ9 N;  5LL6 Z;  3DXM A;  1SL2 A;  3PY8 A;  3MEE A;  2ITG A;  5AQR A;  3ZSR A;  1TV6 A;  1XUP O;  3K5M A;  3O4W A;  4FWK A;  3C95 A;  4LF6 K;  2FXU A;  1QSY A;  2O8C A;  3PSI A;  4AHC A;  1NGB A;  3CXC M;  4CJV A;  1VQM N;  3RMC A;  2QWQ A;  4FVU A;  4DSJ A;  1EQY A;  1HLU A;  1K8K A;  3DLL L;  2O8B B;  4B8C A;  1TGO A;  3AO1 A;  4Y1C A;  2KW4 A;  1WB9 A;  3AO4 A;  4B1W B;  4QCL A;  2A1S A;  3V9Z A;  4GKJ K;  2FSN A;  3J8A A;  1TK5 A;  1KVB A;  4BVO A;  4LY7 A;  4JRQ A;  3PO4 A;  2QEX N;  3KIO A;  1HQU A;  5BRD A;  3O9T A;  4MFB A;  5T7B A;  2ZQB A;  3QEW A;  3N4Q A;  4DTN A;  3NGY A;  3PUF A;  1NKB A;  4CVN E;  5FRM A;  5LMN K;  1NJI O;  3S3M A;  4H0T B;  5F2R A;  3CCV N;  3NH2 A;  1S9E A;  4DTJ A;  4LD0 A;  4FK2 A;  1SS6 A;  3LDP A;  1L5U A;  1NKC A;  1ASU A;  3P83 D;  4Z0U A;  3CD6 N;  3NMU A;  3UKR B;  4BQZ A;  3O4N A;  1EX4 A;  4DTU A;  3TSU A;  1ATN A;  3D7E O;  3L0Q A;  4GVE A;  5C12 A;  1I3A A;  1U6Z A;  5KPR A;  3J80 O;  3HXM A;  1IBK K;  1RDB A;  2QXL A;  4XH4 A;  1S1X A;  5AQW A;  1K9M O;  1ZBI A;  3CCU N;  4FJH A;  4FOE A;  2V52 B;  5E41 A;  1C0F A;  3AVJ A;  2GTD A;  2QWL A;  3O6W A;  4X64 K;  4M41 A;  2P9I A;  3A8Y A;  3U3G A;  3HP6 A;  1RT6 A;  3RSE A;  1C0T A;  4HCC A;  4B1U B;  3CER A;  3VQD A;  4BGA A;  5F0X A;  4J2A A;  3TSP A;  4K25 A;  2UUB K;  4JEP A;  4I6M B;  2QW9 A;  1KAZ A;  5M1O A;  5JMV A;  3V6D A;  2P9N A;  1JCE A;  1EKE A;  1ESV A;  4B9S A;  4FWR A;  1LV5 A;  3NGZ A;  3KTQ A;  2KKZ A;  3I8B A;  4KRF A;  3PX6 A;  5HRP A;  2P9I B;  1HNV A;  1RGI A;  1S6P A;  2YJE A;  1E4G T;  4F9O A;  4WQ4 A;  2YNI A;  3HPH A;  3HST B;  1YUW A;  4DS4 A;  4ELU A;  3CCJ N;  2NRT A;  2A41 A;  3N4P A;  3J7A P;  3OYN A;  1U45 A;  4G1Q A;  2QWP A;  3WNH A;  4IG0 A;  1RT7 A;  4OKE A;  1S1W A;  3BP8 A;  2BAN A;  5AQP A;  3OYG A;  4B3S K;  5CHI A;  5GIN A;  5SWM A;  4GNI A;  3CYM A;  1NM1 A;  1RT2 A;  3C6A A;  1LWC A;  2YV0 X;  4YOR A;  4FJ5 A;  3AVM A;  2F9W A;  3O9U A;  4C8N A;  4BG9 A;  3CET A;  4BRF A;  3AV9 A;  1NGI A;  1G99 A;  2X6N A;  1NGF A;  2EX3 A;  5AR0 A;  4DUY K;  4ZTF A;  1BI4 A;  3VQB A;  1VSK A;  3R6M A;  4JI2 K;  1S3X A;  3UB5 A;  1I94 K;  1T44 A;  4OLA A;  2VQE K;  4X62 K;  4AM6 A;  4JI3 K;  1NGD A;  2A6A A;  3NF7 A;  3HRG A;  3MEC A;  1HJO A;  1S72 N;  4CHO A;  2HNY A;  4CD3 A;  4NXM K;  4IDH A;  3WXM B;  1VQO N;  3S3N A;  1HYS A;  4IZ9 A;  3ID6 A;  1ZBH A;  1IG8 A;  1KC8 O;  4FK4 A;  1B92 A;  3J7Y P;  3MN5 A;  5F1X A;  2O4G A;  1H1V A;  1SUQ A;  4KTZ A;  4OX9 K;  3I55 N;  4JKG A;  2BTF A;  2P9P B;  4OLB A;  3VQC A;  1C1C A;  3P31 A;  4E1M A;  5E26 A;  1JLA A;  3OYM A;  4L8R B;  3IKM A;  3ZCM A;  4O44 A;  1JJ2 M;  1U4B A;  2YCH A;  2AA4 A;  4H5R A;  3R8E A;  3K5N A;  1KTQ A;  3DLK A;  4JKH A;  1M1K O;  1L3S A;  4F8R A;  5HP1 A;  4LF7 K;  3NHG A;  4KHS A;  1CZ9 A;  5K14 A;  3ASM A;  4O4G A;  3OYK A;  3LP2 A;  2G8K A;  1RNH A;  1ITG A;  4DV0 K;  2E5L K;  1CZA N;  2KFZ A;  1LW0 A;  3FLC O;  1WAF A;  3SQ1 A;  4JKC A;  2QA4 N;  3P1G A;  3SJJ A;  2RE2 A;  5ELZ A;  3F2K A;  4O55 A;  2Y1I A;  3C7N B;  3K9J A;  1JXE A;  4IJA A;  4DV7 K;  1KD1 O;  4QS7 A;  4K43 A;  2O4I A;  3VEW A;  3CF5 L;  3AVC A;  2B5J A;  1HUX A;  2HHS A;  5AQK A;  3KWG A;  4FXD A;  2V51 B;  4N56 A;  4AM7 A;  3SPZ A;  1CZB A;  2E8A A;  3EKU A;  1TAU A;  2DFF A;  2HHU A;  4KV8 A;  4A2B A;  1NOZ A;  4MDA A;  3CM6 A;  4BWJ A;  1U47 A;  2NRV A;  1QZ6 A;  5CYM A;  3VA0 A;  3LWL A;  3ZX2 A;  4CZK A;  4NCA A;  1BU6 O;  3IRX A;  2FF6 A;  4OKJ A;  2I7N A;  2FBY A;  1RDW X;  1C1B A;  4DQS A;  4AHU A;  4DFP A;  3CPE A;  1KAY A;  1VRT A;  4FYD A;  1WBD A;  3ZET B;  1VQ6 N;  5IT9 O;  4JI6 K;  1C0G A;  4CGG A;  4KB0 A;  3VF6 A;  4A5A A;  4YFU A;  3VEZ A;  1L3U A;  1VQ5 N;  3P5J A;  4I2P A;  3SJH A;  1KCF A;  5BPL A;  3PIO L;  3IMX A;  3M8R A;  3BEX A;  4CFA A;  2Q2R A;  1EWQ A;  5JIC A;  3DXK B;  1HNX K;  4GY2 B;  4M3U A;  4BDP A;  1X3N A;  1IV0 A;  1XNR K;  4E1J A;  2KFN A;  1W0H A;  2YI1 A;  1WUA A;  2FF3 B;  2P9N B;  4DTO A;  4FWS A;  4FZX C;  3MWT A;  4CEQ A;  3VTH A;  4FWM A;  3NCI A;  4K42 A;  4L3Q A;  3HOS A;  1NMN A;  3VA3 A;  4WF9 L;  2NRH A;  2B6A A;  3THV A;  3H08 A;  4CZL A;  2ZWH A;  4CZJ A;  3ENB A;  1NGE A;  3AVK A;  1IKW A;  2YNH A;  3QIC A;  1L3V A;  4M3R A;  3THX A;  3RR7 A;  4BR4 A;  4NXN K;  3LZJ A;  4ILG B;  3AAP A;  1YT3 A;  4DR1 K;  4OGE A;  4IO8 A;  1LWE A;  2X78 A;  2VWJ A;  1VRU A;  3HVR A;  1ATS A;  5CZ2 A;  1Q7Y O;  3BY5 A;  1YJ9 N;  3U9D A;  3UE5 A;  5BR9 A;  4FCY A;  1VSH A;  3ZT4 A;  3HVT A;  1JCG A;  5GAG P;  3KLF A;  2E2Q A;  3RRG A;  5JLF A;  3RMA A;  3AA5 X;  2PFU A;  3L2U A;  3M5R A;  5AQH A;  3RVC A;  3CCL N;  2OPQ A;  3CCE N;  3W0L A;  3U6F A;  3MDQ A;  2GWK A;  1B9F A;  1WSG A;  1NGC A;  3RMD A;  5M1F A;  4Z4H A;  5HRN A;  3GBT A;  2A5X A;  1EET A;  2NZT A;  2IOC A;  2JLE A;  4HCB A;  3LP0 A;  3IDH A;  3KKR A;  2D1K A;  3C65 A;  4CJ4 A;  2RF2 A;  3VMF B;  4C8M A;  4OO1 J;  4CES A;  3L6Q A;  1GOA A;  2F7T A;  4O5B A;  3H45 C;  3K59 A;  3SV3 A;  1N36 K;  4Z4I A;  4DQR A;  3WQT A;  4CZE A;  3UIQ A;  2WFB A;  1VSF A;  1W97 L;  2QWR A;  3CJC A;  1N8R O;  3VGL A;  1J5O A;  4HWI A;  4IWV A;  5FPN A;  3Q7C A;  3SK3 A;  4KTQ A;  4F3T A;  4DV2 K;  4H03 B;  5BN9 A;  2OYQ A;  1BDG A;  3LAM A;  2A42 A;  4FPA A;  4CF1 A;  4PKH A;  4GV6 A;  3KJV A;  2WUS A;  1X9W A;  4EZ9 A;  1TKD A;  3HJF A;  4B9U A;  3DRR A;  2UYT A;  2HHQ A;  4DWI A;  3NVM A;  3MWP A;  2QXF A;  1BHL A;  1YAG A;  2I7P A;  2F8S A;  4CEO A;  4BRD A;  3S41 A;  3DLR A;  1VQL N;  4FLV A;  3THW B;  4W5T A;  4B1Z A;  4HTL A;  1WN7 A;  2NRW A;  3RMB A;  3LL3 A;  4MO5 A;  4AH9 A;  3JAM O;  3CM5 A;  4WE1 A;  3J81 O;  2D0O A;  5JVH L;  2PBD A;  4H4M A;  3CME N;  2RPI A;  4KO0 A;  4B9N A;  4FW1 A;  2E4L A;  3NGI A;  1GLL O;  4M3W A;  3M8S A;  4B9T A;  3OBY A;  2HND A;  3O4Q A;  1Q9Y A;  1DLO A;  4PHT X;  1D5A A;  4V19 S;  3MN6 A;  4CFB A;  2ZE2 A;  4YOY A;  5DMR A;  3ITH A;  4A5B A;  3CJA A;  4CHN A;  4BRI A;  2IVN A;  3ZYY X;  2XY8 A;  4RG8 A;  2DFH A;  3BGR A;  4CJT A;  3G6E N;  3DOL A;  3HI0 A;  5ADX H;  5FPE A;  4PA1 A;  4RW4 A;  3H1Q A;  3SUP A;  3O9Q A;  1KXP A;  3I8D A;  1HRH A;  4WQ5 C;  3OS0 A;  4DV6 K;  1JL1 A;  4IBN A;  1ZBL A;  3VGK A;  3BDP A;  2RN2 A;  3LAK A;  2CGJ A;  2OZS A;  1ZBS A;  1NOY A;  1ASV A;  2IGI A;  3DRS A;  3L2R A;  4WFN L;  5SZT A;  1K73 O;  3HOT A;  4C8L A;  3VTI A;  5BRH A;  1Z6R A;  5IWA K;  1RCH A;  4AQY K;  3L3U A;  1SV5 A;  1SL0 A;  4LF8 K;  2ASO A;  1FKO A;  3LPT A;  4IKF A;  3L2V A;  4RTF D;  4X66 K;  3EZ5 A;  4CI6 A;  1WNS A;  3PO5 A;  1GOB A;  3WXK A;  4JI1 K;  1TKZ A;  3QML A;  4DS5 A;  2GEM A;  2HHT A;  4I7F A;  3TAE A;  4CBX A;  3D2F A;  2WC9 A;  4JKG B;  1GOC A;  3O08 A;  1VQ7 N;  3WXI A;  4FLX A;  3R1X A;  4FWO A;  4H0P A;  5LMU K;  3U8X A;  1EP4 A;  1NK5 A;  3CJ9 A;  3CQX A;  5EVZ A;  4FWP A;  4BC2 A;  1VSJ A;  4KH6 A;  4DF4 A;  3VET A;  5AQN A;  4NB4 A;  4FZZ A;  3ZSO A;  2ZD1 A;  4GW6 A;  4C1N I;  1XI1 A;  1RBU A;  1NWK A;  2RHK A;  3MXI A;  2Q97 A;  1IBL K;  4BC4 A;  5AQY A;  2P9S A;  2YHX A;  1WLJ A;  1B9D A;  2OA8 A;  3NBP A;  1RDC A;  3KD1 E;  5AQM A;  1TKT A;  3ZEU B;  1BG3 A;  4NCG A;  2DY4 A;  4CJP A;  1UA1 A;  3GE1 A;  4N41 A;  4CJQ A;  4PKI A;  1HX1 A;  4JKB A;  4KPY A;  4EHU A;  3OHR A;  4DU3 A;  1HMV A;  3SBT A;  1GLE G;  1WBB A;  4NO7 A;  3HM9 A;  2X74 A;  1QSL A;  4KRE A;  4B3R K;  3D6R A;  4AHV A;  4B8A B;  1YTA A;  5AJ3 K;  1FW6 A;  3ULD A;  3S9H A;  1OKJ A;  4YDU A;  1U48 A;  1XHZ A;  3PSF A;  4JD2 A;  3WQU A;  3H3O B;  3LWM A;  5AQS A;  4FLU A;  3U3Y A;  1T3V A;  2J4R A;  3F9M A;  3WNF A;  4YOX A;  1NNE A;  5C24 A;  3VQQ A;  2Z1H A;  1VSI A;  3EYZ A;  1IKV A;  3CC7 N;  5TKY A;  1BIZ A;  4DR4 K;  4PL8 A;  4ID5 A;  1QVG M;  3RR8 A;  4B1Y B;  3V1Q A;  1D4X A;  4H0X B;  3VEY A;  4B9Q A;  1J5E K;  1BIU A;  4W5N A;  3SPY A;  2IC3 A;  2ZGY A;  1DTQ A;  1LCU A;  4DTX A;  2UU9 K;  1HQE A;  1BIS A;  2OPP A;  2E2P A;  3R3L A;  1Z05 A;  3SMS A;  4GMJ B;  1XMO K;  4HHT A;  4BRG A;  3H3N O;  2V7Z A;  1XMQ K;  4CJS A;  3WNE A;  4JNE A;  2HBK A;  4YOU A;  3THW A;  3MCP A;  5JS1 A;  4UY8 O;  3ZSY A;  1T8E A;  2BH1 A;  3T69 A;  3QIN A;  4M7Y A;  3DJC A;  4CGI A;  4CED A;  4K8Z A;  4F4K A;  3V9S A;  4WFA L;  4CIF A;  3DAW A;  1QQO A;  1RBT A;  4A57 A;  3FE1 A;  3W3D A;  2QWO A;  3HM8 A;  5AZJ A;  3ENO A;  2VGM A;  3CJB A;  4DQI A;  4KHP K;  3CG7 A;  1IO2 A;  3NF8 A;  1OH7 A;  3VER A;  4JV5 K;  3A5O C;  2EHG A;  1YIJ N;  5HBM A;  3V4I A;  3QIO A;  4QS8 A;  1FJG K;  4CHP A;  4KI6 A;  3SNN A;  4OPH A;  5I3U A;  3WXL A;  1N6Q A;  1N33 K;  3CCQ N;  5HRS A;  2QKB A;  1IBM K;  3WEE B;  4CF9 A;  2E88 A;  3EE9 A;  4C8O A;  2F4V K;  1E3M A;  2YHY A;  4BVP A;  3DLH A;  1VSL A;  4KFB A;  1R59 O;  4BE2 A;  5HLF A;  4JKE A;  5DM6 L;  2E6M A;  3LM2 A;  3V81 A;  3TAP A;  3M8Q A;  2ASM A;  3NH1 A;  5CR4 A;  3I0S A;  2HBL A;  3H1V X;  2VG6 A;  4M7X A;  3QB0 A;  3OYF A;  4CBW A;  2FSJ A;  1ZBU A;  1SKW A;  4GV9 A;  5AZI B;  2P5O A;  3JYT A;  2QK9 A;  3T19 A;  5JLH A;  3O3F A;  1DT9 A;  3O9S A;  5LJW A;  4DMN A;  1Q82 O;  4M3Z A;  4CJK A;  1K8K B;  3LZI A;  2O8B A;  1TAQ A;  1NLV A;  4KHU A;  2VYP A;  4W5O A;  5AQQ A;  3DXM B;  4CJU A;  4XH1 A;  3QEP A;  3QES A;  4JI0 K;  1KRP A;  2OTJ N;  4FJK A;  4FWQ A;  2KTQ A;  4DHY A;  2HHV A;  2PAV A;  3P39 A;  3SUN A;  1WAJ A;  3TWH A;  4GKK K;  4FJN A;  1LAW A;  2HST A;  1BA1 A;  5EY4 A;  3OYC A;  3G0Z A;  2KLA A;  3NFA A;  3ZT1 A;  4IJN A;  1NK4 A;  3VES A;  3L2Q A;  4FWN A;  4FJJ A;  5AQJ A;  4C23 A;  1GLJ O;  2CGL A;  3CFO A;  3MMV A;  4CFD A;  4KI4 A;  4BR7 A;  3ALY A;  1HYV A;  4O8K A;  1X9M A;  5J2Q A;  3FFI A;  1NU0 A;  3MAQ A;  1A5X A;  2BGG A;  4CJ3 A;  2E20 A;  3ZSZ A;  3OTO K;  3AVB A;  4OVL A;  3NDK A;  5AQT A;  3K58 A;  3FFK B;  5M1K A;  5AQZ A;  4YDU C;  3O8M A;  4N5S A;  3AO5 A;  4FPB A;  1XC3 A;  5FDL A;  2YKN A;  1Q8I A;  4JKF A;  2G8H A;  4KTW A;  3VQ9 A;  1XC9 A;  4DSL A;  4IO9 L;  1S1T A;  4OGC A;  3SLC A;  1VSE A;  5C10 A;  1OVQ A;  1J54 A;  1KLM A;  2QKK A;  4PY5 A;  4BRM A;  1A5W A;  1JLG A;  1WSH A;  3M3Z A;  3LDO A;  2UUC K;  4RCH A;  3E9O A;  3D0P A;  4KB1 A;  3UKR A;  2HBJ A;  1OH8 A;  4ILJ A;  3C6U A;  4XH5 A;  3OYJ A;  3AVH A;  4E0D A;  2W6K A;  5AQF A;  3SQ0 A;  4EZ6 A;  3BF1 A;  3RWU A;  5GAE P;  4I9Q A;  3CQ8 A;  4CER A;  4Y0W A;  5EOY A;  2NRR A;  1MU2 A;  2ZF5 O;  2O8D A;  4IG3 A;  4DTR A;  4FVM A;  1BUP A;  3M8P A;  5M1Q A;  4NLC A;  4FZY A;  4E7I A;  4JI5 K;  4FL9 A;  5C0Y A;  3DWL A;  3T3F A;  1QE1 A;  3CQY A;  3V9U A;  2JGU A;  1RIL A;  2ZM6 K;  4MQ3 A;  4EIA A;  3THY B;  2P9K A;  3LPU A;  3LM9 A;  1IKX A;  4CHQ A;  4DU1 A;  4CEB A;  1BQN A;  2YX6 A;  2A40 A;  4E7H A;  1EXQ A;  1JL2 A;  5AQX A;  3P4I A;  1DEJ A;  1C1A A;  4Z4E A;  1NJY A;  4LH5 A;  3PV8 A;  3DMJ A;  2D0A A;  4DR6 K;  1U04 A;  4HUE A;  1JCF A;  3K2P A;  4JS4 A;  4FJX A;  3TTD A;  4CF0 A;  4BRO A;  3SBG A;  1LOT B;  1P90 A;  2ZJQ L;  2PY5 A;  3QDK A;  4M3Y A;  2P9K B;  4B9V A;  4U7B A;  4JAX A;  5KPZ A;  1OH5 A;  4FO0 A;  3SMP A;  2Q1N A;  3SZ2 A;  4EHT A;  2Q0R A;  2XO7 A;  4BR5 A;  3K5L A;  5E84 A;  4BGB A;  3OYA A;  4CGJ A;  1OVY A;  3WEE A;  4X65 K;  3PX4 A;  5BN8 A;  4ISE A;  4B9M A;  2HVH A;  4BRA A;  4AHS A;  4KHN A;  4CF8 A;  1RTJ A;  3A5L C;  4A2A A;  4G9Z A;  4RW8 A;  3CI5 A;  2D0C A;  2X6S A;  3DYA A;  2HB5 A;  1BO5 O;  2EWS A;  4KHY A;  3CCM N;  1VSM A;  2GUI A;  2G8V A;  3QLH A;  4CIE A;  2G8W A;  3CFP A;  3VEX A;  2B4J A;  1NK7 A;  4B9L A;  5HOO A;  4BAC A;  1VQ8 N;  1TL3 A;  4DV1 K;  3SAH A;  3H6E A;  1X3M A;  4UQG A;  4YY3 K;  2PYJ A;  4DSI A;  4FJM A;  3S3O A;  1T6D A;  1T6C A;  2HNZ A;  3ATV A;  1CLQ A;  5AQU A;  1F21 A;  4JKA A;  5CYQ A;  2HHH K;  3UKU B;  4CHZ A;  3TTF A;  1NJW A;  3GG4 A;  4NLB A;  1VQ4 N;  5AQL A;  4E7J A;  4BG8 A;  5KQ8 A;  3OJS A;  4B1X B;  4LFA K;  2F8T A;  4KHW A;  4RW7 A;  4O0I A;  1V4T A;  4KAZ A;  2QTD A;  3HZ6 A;  3SI6 A;  1WOQ A;  4FLZ A;  1Q86 O;  2NRZ A;  2OAN A;  1J9A A;  1TVR A;  4BE0 A;  1C0U A;  4PKG A;  1HPZ A;  3QFU A;  2I5J A;  3VOV A;  1M90 O;  1IH7 A;  4M3T A;  3CCS N;  4WQ4 C;  3M6G A;  4JS5 A;  4A62 A;  2UXC K;  3AGR A;  1GLA G;  4IEE A;  4JI7 K;  1D8Y A;  3OS1 A;  3FZK A;  3B8A X;  3SYZ A;  4MDB A;  3NE6 A;  3VQ8 A;  2Q3S A;  3DLB A;  4FJL A;  2WBN A;  1HKB A;  5DM7 L;  3KK3 A;  2O8C B;  3KK7 A;  3MX5 A;  4HTU A;  3V9X A;  4CZM A;  4CZF A;  1QQC A;  2G8F A;  3E01 A;  2KZM A;  1D9D A;  1IG9 A;  3QIP A;  2O8F A;  5MLC Q;  4J2D A;  1VSD A;  5M1P A;  4XEI A;  4DR3 K;  4CEE A;  2YHB A;  1ZXO A;  4O0J A;  5LJV A;  4WCE L;  4M45 A;  3MCA B;  2JWK A;  3BF3 A;  1JLE A;  2G8U A;  5EXW A;  3T7Z A;  1WSI A;  3MN7 A;  3AGK A;  2ATQ A;  3HT3 A;  1NK9 A;  4W5R A;  3HPO A;  3VEV A;  1RT4 A;  3FZF A;  4BC5 A;  1T7P A;  4HVJ A;  4BRE A;  3KK2 A;  2P9S B;  4DFM A;  3M1F A;  4IOA L;  5JS2 A;  4DG1 A;  3ZET A;  2VGN A;  4FLY A;  1W7A A;  4RW9 A;  3LAN A;  3JS6 A;  3O1B A;  4CBU A;  4ILH A;  3B6O A;  4BE1 A;  2UXB K;  4CZI A;  4AHT A;  4AIL C;  4BRH A;  4I2Q A;  4FJ7 A;  3CHW A;  4M63 C;  2P51 A;  2QM1 A;  4DKW A;  1W2B M;  4JD2 B;  2W41 A;  3PX0 A;  1YJW N;  1SZ2 A;  4DV5 K;  3HYF A;  3LP3 A;  3GDQ A;  3THY A;  4DSK A;  1EO1 A;  3L4Q A;  4XIU A;  2Q0U A;  1TYQ B;  3EZW A;  5KQD A;  1BGX T;  5KRT A;  2HVI A;  2G8I A;  3A2F A;  3G25 A;  4CEF A;  1S22 A;  5DK5 A;  4E7L A;  5BR8 K;  2F9T A;  5BPN A;  4RW6 A;  4KH4 A;  2ETJ A;  3QBX A;  3KD5 E;  2WOM A;  2QI2 A;  1YXQ A;  4RWT A;  1RBS A;  2DTU A;  3CPW M;  3KZB A;  1RTH A;  3AVN A;  3TR8 A;  3LDL A;  3DRP A;  3WNG A;  2V7Y A;  3D45 A;  2AP1 A;  4J2E A;  1JKH A;  1SAZ A;  4FK0 A;  2GV9 A;  5FRO A;  1ZYQ A;  4CJL A;  3D2E B;  3C6H A;  1JLB A;  2DPN A;  3DLE A;  3LP1 A;  1BCM A;  1ATR A;  1KVA A;  3LDQ A;  4IDK A;  4FJ9 A;  4F2S A;  5J1E A;  3VF4 A;  3CJ1 A;  4CD1 A;  4DFJ A;  1IJJ A;  4ELT A;  2QWN A;  3QNO A;  3QEV A;  3SQ2 A;  3ID8 A;  3LDN A;  4DU4 A;  4BQL A;  5KRS A;  2R7Y A;  2WTU A;  3TAM A;  4FOI A; 
#chains in the Genus database with same CATH homology
 3LWL A;  2P5G A;  2E6M A;  3RRH A;  1QSS A;  1WSJ A;  4NCA A;  2VG5 A;  1KFD A;  3IRX A;  4OKJ A;  4N47 A;  3V81 A;  4FW2 A;  3TAP A;  1BI4 B;  2Z1J A;  3M8Q A;  4CFC A;  4Z4C A;  2FBY A;  1C1B A;  4DQS A;  1SKR A;  4AHU A;  4N76 A;  4LH4 A;  3NH1 A;  4DFP A;  3I0S A;  1VRT A;  1NK8 A;  4FYD A;  4Y1D A;  1A5V A;  1RDA A;  1RT5 A;  2VG6 A;  1N5Y A;  4GVM A;  3OYF A;  2HHW A;  5FRN A;  1ZBU A;  4CGG A;  3V9W A;  1SKW A;  3OYH A;  2W42 A;  4KB0 A;  1RT3 A;  5KI6 A;  2XHB A;  4YFU A;  4CEZ A;  4M3X A;  4HUF A;  1L3U A;  2P5O A;  4EP5 A;  3P5J A;  4I2P A;  1KCF A;  1UOC A;  1TK0 A;  1ASW A;  3JYT A;  3JSM A;  3M8R A;  2QK9 A;  3VQ6 A;  3T19 A;  1G15 A;  3O3F A;  2Z1G A;  2RKI A;  4CFA A;  4DMN A;  3LDS A;  4M3Z A;  3MEG A;  4CJK A;  4M3U A;  1HYZ A;  3LZI A;  4I9L A;  1YTU A;  2WON A;  1TAQ A;  5HLF A;  3LAL A;  4ZTJ A;  4BDP A;  4CJ5 A;  4KHU A;  4DQP A;  2OPR A;  2KFN A;  4OPK A;  4W5O A;  2D0B A;  1W0H A;  1Y97 A;  2PZS A;  4CJU A;  4Z4G A;  3QEP A;  3QES A;  1KRP A;  1S1V A;  4DTO A;  4FZX C;  4FJK A;  3ZSX A;  2KTQ A;  2HHV A;  3QEX A;  4CEQ A;  4KHQ A;  3SUQ A;  3T1A A;  4E89 A;  3NCI A;  1X9S A;  3I0R A;  3KK1 A;  3VA3 A;  1WAJ A;  3TWH A;  3SUN A;  1WSE A;  4FJN A;  3OYL A;  1LAW A;  2B6A A;  3THV A;  1JLQ A;  3OYC A;  4J2B A;  3H08 A;  2XY5 A;  3NAE A;  3G0Z A;  1TL1 A;  3NFA A;  2OZM A;  4FJ8 A;  3ZT1 A;  3AVK A;  1NK4 A;  1IKW A;  2OPS A;  1FKP A;  2YNH A;  3L2Q A;  5CY4 A;  4M3R A;  4CE9 A;  4CIG A;  3O3H A;  1L3V A;  3RR7 A;  3NH0 A;  4FJJ A;  4CGF A;  2FC0 A;  3AO2 A;  3LZJ A;  3OJU A;  5J2M A;  3CFO A;  3TAR A;  1YT3 A;  3F9K A;  1VK0 A;  3MED A;  5KGW A;  4CFD A;  4KI4 A;  4OGE A;  4CEC A;  1LWE A;  3HL8 A;  3ALY A;  4ZHR A;  1YVU A;  2X78 A;  2VWJ A;  1VRU A;  1HYV A;  1X9M A;  3V1R A;  3HVR A;  1T05 A;  4K8X A;  5CZ2 A;  4BWM A;  5J2Q A;  1NK0 A;  3FFI A;  3MXJ A;  4OKK A;  3MAQ A;  3KLI A;  3L3V A;  4YNQ A;  1A5X A;  2BGG A;  4CJ3 A;  1RTI A;  3ZSZ A;  3VA0 A;  3AVB A;  4FM2 A;  2FBT A;  4OVL A;  3NDK A;  4FCY A;  1VSH A;  3K58 A;  1LAV A;  3ZT4 A;  3HVT A;  1D9F A;  4OPJ A;  4DSL A;  3HPG A;  4N5S A;  3KLF A;  3L2W A;  3TAQ A;  3AO5 A;  3TAN A;  3RRG A;  4W5Q A;  1K6Y A;  1KLN A;  3RMA A;  5FDL A;  2YKN A;  1Q8I A;  3QET A;  2G8H A;  1CXQ A;  4KTW A;  4F3O A;  3KKS A;  3VQ9 A;  3SV4 A;  5C42 A;  1XC9 A;  3AA5 X;  3ZT2 A;  1XWL A;  3KLE A;  3F73 A;  1S1T A;  4OGC A;  1QHT A;  3VQ7 A;  1VSE A;  4JRP A;  4DTP A;  3L2U A;  1Q9X A;  4FM1 A;  3OYE A;  4DF8 A;  2OPQ A;  3SQ4 A;  1J54 A;  1KLM A;  4OJR A;  1QTM A;  2QKK A;  3QNN A;  4PY5 A;  1A5W A;  2KQ2 A;  1JLG A;  1WSH A;  4DTM A;  2XRI A;  3U6F A;  2PYL A;  3KLH A;  3DM2 A;  2HHX A;  1B9F A;  1JXB A;  1WSG A;  1BL3 A;  1UAX A;  3RMD A;  1L3T A;  4Z4H A;  3ZT0 A;  5HRN A;  4ELV A;  3D0P A;  4CCH A;  4KB1 A;  4FJG A;  3VQP A;  1EET A;  3ZT3 A;  2IOC A;  3TAF A;  2JLE A;  4DSE A;  3C6U A;  4LSN A;  3LP0 A;  4HCB A;  3KKR A;  5HRO A;  1LWF A;  3OYJ A;  4CGH A;  3C94 A;  3AVH A;  4CJ4 A;  4E0D A;  4PWD A;  2RF2 A;  4ID1 A;  4C8M A;  1REV A;  3OYB A;  4CES A;  4LSL A;  3SQ0 A;  4EZ6 A;  3TI0 A;  3RWU A;  4FJI A;  1GOA A;  4O5B A;  3K59 A;  1T03 A;  3SV3 A;  4Z4I A;  4DQR A;  3UIQ A;  3VQ5 A;  4FLW A;  4I9Q A;  3HO1 A;  3CQ8 A;  4CER A;  1VSF A;  2IAJ A;  1MU2 A;  1XHX A;  5J2P A;  1ZBF A;  1J5O A;  5KTQ A;  4IG3 A;  4KTQ A;  5C25 A;  1C0M A;  4F3T A;  3IG1 A;  1IKY A;  4FVM A;  4DTR A;  4R5P A;  4AHR A;  2OYQ A;  1BCO A;  3LAM A;  3M8P A;  1HJR A;  1NJX A;  5I42 A;  3MXM A;  3OYI A;  4CF1 A;  4DLE A;  4FZY A;  4E7I A;  3KJV A;  3TAG A;  1X9W A;  3AVG A;  4EZ9 A;  1TKD A;  3HJF A;  3O3G A;  4B9U A;  3DRR A;  3T3F A;  4M42 A;  1QE1 A;  2HHQ A;  3V9U A;  2JGU A;  1RIL A;  1SL2 A;  4DWI A;  3PY8 A;  4MQ3 A;  1S5J A;  3MEE A;  4TSX A;  2QXF A;  1UA0 A;  2KZZ A;  2ITG A;  3LPU A;  3SUO A;  3ZSR A;  1IKX A;  1TV6 A;  4CJW A;  1BHL A;  4CHQ A;  3K5M A;  5D3G A;  4DU1 A;  2F8S A;  2FBV A;  4CEB A;  4CEO A;  1BQN A;  3C95 A;  3DLR A;  3IS9 A;  2E6L A;  4FLV A;  4W5T A;  1EXQ A;  1JL2 A;  4E7H A;  4AHC A;  1QSY A;  1WN7 A;  1W9H A;  4DLG A;  4CJV A;  3RMB A;  4AH9 A;  1C1A A;  3RMC A;  4Z4E A;  1NJY A;  3CM5 A;  4LH5 A;  4WE1 A;  3PV8 A;  3DMJ A;  2D0A A;  1RTD A;  1I39 A;  4DSJ A;  1U04 A;  4H4M A;  3L8B A;  4HUE A;  2RPI A;  3K2P A;  4KO0 A;  4B9N A;  4FW1 A;  2E4L A;  4JS4 A;  4B8C A;  3NGI A;  4FJX A;  4DTS A;  4CF0 A;  3AVF A;  1TGO A;  4M3W A;  3M8S A;  4B9T A;  3AO1 A;  1Z26 A;  4JLH A;  4Y1C A;  2HND A;  2KW4 A;  3O4Q A;  2PY5 A;  3AO4 A;  1Q9Y A;  4QCL A;  1DLO A;  2A1S A;  3V9Z A;  4M3Y A;  1D5A A;  1TK5 A;  4B9V A;  4CFB A;  2ZE2 A;  5DMR A;  3QER A;  1KVB A;  3ITH A;  3SZ2 A;  3OS2 A;  4F2R A;  4LY7 A;  4JRQ A;  4CHN A;  2XO7 A;  3PO4 A;  1TKX A;  3KIO A;  1HQU A;  2XY8 A;  4RG8 A;  2DFH A;  3BGR A;  3OYA A;  3K5L A;  4CJT A;  3DOL A;  4MFB A;  4CGJ A;  5T7B A;  3EY1 A;  2ZQB A;  3PX4 A;  4PA1 A;  3ZSW A;  4RW4 A;  3QEW A;  3SUP A;  3AA2 A;  3I8D A;  1HRH A;  3OS0 A;  4B9M A;  4DTN A;  2HVH A;  3NGY A;  3PUF A;  4AHS A;  3TAB A;  1NKB A;  4KHN A;  1JL1 A;  5FRM A;  4CF8 A;  4IBN A;  1NKE A;  3NF6 A;  1ZBL A;  1RTJ A;  3S3M A;  3BDP A;  1Z25 A;  2RN2 A;  3LAK A;  2OZS A;  4BDY A;  1NOY A;  3NH2 A;  1ASV A;  2GBZ A;  1S9E A;  2IGI A;  4Q5V A;  4DTJ A;  4RW8 A;  3DRS A;  3L2R A;  2D0C A;  4LD0 A;  4FK2 A;  2X6S A;  3DYA A;  1S6Q A;  1L5U A;  1NKC A;  1ASU A;  2YNF A;  2HB5 A;  3P83 D;  4Z0U A;  5SZT A;  4C8L A;  4KHY A;  2IDO A;  2G8V A;  1VSM A;  2GUI A;  3O4N A;  4H4O A;  1EX4 A;  3QLH A;  4CIE A;  4Q0B A;  2G8W A;  3CFP A;  4DTU A;  1RCH A;  2HMI A;  4NCB A;  3L3U A;  1SV5 A;  1SL0 A;  2B4J A;  1I3A A;  4CJR A;  3HXM A;  1FKO A;  1NK7 A;  1RDB A;  4B9L A;  3LPT A;  4IKF A;  3AA3 A;  4BAC A;  3L2V A;  1TL3 A;  3OVN A;  3EZ5 A;  1RBV A;  1S1X A;  2HW3 A;  1WNS A;  3PO5 A;  4UQG A;  1NJZ A;  1ZBI A;  1UWB A;  1GOB A;  2PYJ A;  4DSI A;  4FJM A;  3DOK A;  3S3O A;  3AVL A;  1TKZ A;  5E41 A;  4FJH A;  2HNZ A;  3AVJ A;  4DS5 A;  1RBR A;  4E7K A;  1CLQ A;  1F21 A;  5EU7 A;  4M41 A;  2HHT A;  5CYQ A;  2A1R A;  4I7F A;  3TAE A;  4CHZ A;  3U3G A;  4CHY A;  3HP6 A;  1NJW A;  1RT6 A;  1C0T A;  4E7J A;  4HCC A;  1DTT A;  4FLT A;  3K5O A;  3OJS A;  2F8T A;  3AVA A;  4NYF A;  4HUG A;  3VQD A;  4KHW A;  4RW7 A;  3HP9 A;  4O0I A;  3B6P A;  4KAZ A;  1GOC A;  4J2A A;  3SI6 A;  3HK2 A;  4FLX A;  1KSP A;  4FLZ A;  3NF9 A;  1RT1 A;  1EP4 A;  1NK5 A;  2XY7 A;  1J9A A;  1TVR A;  4BE0 A;  4DQQ A;  1C0U A;  3V6D A;  1VSJ A;  4H8K A;  3C6T A;  1EKE A;  4DF4 A;  3RTV A;  1HPZ A;  4FZZ A;  2Y1J A;  3ZSO A;  4B9S A;  4B3O A;  2I5J A;  2ZD1 A;  4GW6 A;  1LV5 A;  1IH7 A;  4CK3 A;  3NGZ A;  1XI1 A;  2YHA A;  1RBU A;  3MXI A;  3KTQ A;  4M3T A;  2BE2 A;  1JLF A;  3PX6 A;  4KRF A;  4QAG A;  1WLJ A;  5HRP A;  1B9D A;  2OA8 A;  3NBP A;  1RDC A;  4JS5 A;  3KD1 E;  1HNV A;  3SCX A;  4FM0 A;  1S6P A;  1TKT A;  4NCG A;  2YNI A;  2DY4 A;  3HPH A;  3HST B;  1WSF A;  4CJP A;  3OS1 A;  1UA1 A;  1D8Y A;  4DS4 A;  1S1U A;  4CJQ A;  3SYZ A;  4ELU A;  4N41 A;  3NE6 A;  3VQ8 A;  2Q3S A;  4KPY A;  3DLB A;  3OYN A;  1U45 A;  4FJL A;  4G1Q A;  2BDP A;  4DU3 A;  1HMV A;  3WNH A;  4IG0 A;  3KK3 A;  1RT7 A;  2X74 A;  3HM9 A;  1SL1 A;  1QSL A;  4HTU A;  3V9X A;  3OY9 A;  4KRE A;  1QQC A;  4AHV A;  2G8F A;  3E01 A;  4OKE A;  1S1W A;  1YTA A;  2BAN A;  4B8A B;  3OYG A;  2KZM A;  4ICL A;  1D9D A;  4PQU A;  1IG9 A;  3QIP A;  5SWM A;  4KKO A;  4J2D A;  1QS4 A;  1VSD A;  3ULD A;  3CYM A;  4CEE A;  3S9H A;  2YHB A;  1RT2 A;  4CK2 A;  4O0J A;  1U48 A;  4M45 A;  4IFY A;  1CXU A;  1LWC A;  2YV0 X;  1XHZ A;  4PUO A;  4FJ5 A;  3AVM A;  1BQM A;  1JLE A;  2G8U A;  2P1J A;  3OYD A;  3LWM A;  4FLU A;  4C8N A;  3U3Y A;  1WSI A;  1S9G A;  2XY6 A;  4IFV A;  3AV9 A;  3WNF A;  3HT3 A;  2ATQ A;  1NK9 A;  5C24 A;  2X6N A;  3VQQ A;  4W5R A;  2Z1H A;  2EX3 A;  4ZTF A;  1BI4 A;  3VQB A;  3HPO A;  1VSK A;  1VSI A;  3EYZ A;  1RT4 A;  1T7P A;  1IKV A;  4HVJ A;  3KK2 A;  4OLA A;  1BIZ A;  2DFE A;  4DFM A;  5JS2 A;  4ID5 A;  3V1O A;  4DG1 A;  3RR8 A;  4FLY A;  4RW9 A;  3LAN A;  3V1Q A;  1TK8 A;  3NF7 A;  4CK1 A;  3MEC A;  4DSF A;  1KVC A;  3VN5 A;  4CHO A;  1BIU A;  2HNY A;  4W5N A;  4BDZ A;  3B6O A;  2IC3 A;  3SPY A;  4CJF A;  4BE1 A;  1DTQ A;  3S3N A;  1HYS A;  4DTX A;  1HQE A;  2VWK A;  4E3S A;  3KLG A;  4AHT A;  1BIS A;  4AIL C;  1ZBH A;  4FK4 A;  1B92 A;  4I2Q A;  2OPP A;  1LW2 A;  4E19 A;  3QEI A;  4FJ7 A;  4GMJ B;  2O4G A;  1X1P A;  2FBX A;  2P51 A;  5J2N A;  1SUQ A;  4KTZ A;  4HHT A;  3AVI A;  2LSN A;  2NUB A;  2YKM A;  4OLB A;  4CJS A;  4NYN A;  3VQC A;  3WNE A;  1C1C A;  1U49 A;  3PX0 A;  4E1M A;  4B08 A;  1JLA A;  3OYM A;  2F96 A;  1SKS A;  4L8R B;  2VG7 A;  3ZCM A;  3DI6 A;  4O44 A;  4CJE A;  1U4B A;  4QOZ B;  5JS1 A;  3HYF A;  3LP3 A;  3K5N A;  3ZSY A;  1T8E A;  4DSK A;  1KTQ A;  3QIN A;  3VQE A;  4E1N A;  3DLK A;  4CGI A;  4XIU A;  4CED A;  1BGX T;  5KRT A;  4K8Z A;  4F4K A;  2G8I A;  2HVI A;  1L3S A;  1RDD A;  3V9S A;  3A2F A;  4F8R A;  5HP1 A;  4CIF A;  3NHG A;  4Z4F A;  4CEF A;  4KHS A;  5DK5 A;  1CZ9 A;  5K14 A;  1RBT A;  4E7L A;  1FK9 A;  3ASM A;  4O4G A;  3OYK A;  3G10 A;  3LP2 A;  2ETJ A;  4RW6 A;  2G8K A;  1RNH A;  1ITG A;  2WOM A;  3KD5 E;  2AJQ A;  5HRR A;  1KFS A;  2KFZ A;  1LW0 A;  1RBS A;  2DTU A;  1RTH A;  4DQI A;  3AVN A;  3CG7 A;  1IO2 A;  3NF8 A;  5CZ1 A;  1WAF A;  3TR8 A;  3SQ1 A;  3DRP A;  3WNG A;  1JLC A;  2IS3 A;  1O1W A;  2Z1I A;  3P1G A;  3SJJ A;  3D45 A;  2EHG A;  4J2E A;  1JKH A;  4O55 A;  2Y1I A;  2D5R A;  4FK0 A;  1FXX A;  2YNG A;  1JXE A;  5HBM A;  2GV9 A;  5FRO A;  3QIO A;  3ISN C;  4CJL A;  3V4I A;  1ZYQ A;  1C6V A;  3CFR A;  1JLB A;  3DLE A;  3LP1 A;  4CHP A;  4DFK A;  4KI6 A;  1BCM A;  4CF2 A;  3SNN A;  3AO3 A;  2O4I A;  3QO9 A;  1KVA A;  5I3U A;  4IDK A;  3ZSV A;  4FJ9 A;  3AVC A;  1N6Q A;  1HNI A;  2B5J A;  4F2S A;  2HHS A;  3K57 A;  4CGD A;  4FXD A;  5J1E A;  4N56 A;  3IAY A;  3SPZ A;  5HRS A;  1CZB A;  4EP4 A;  4DFJ A;  1NK6 A;  4C8K A;  4ELT A;  4CF9 A;  2QKB A;  1TAU A;  4C8O A;  3QNO A;  3QEV A;  3VQA A;  3SQ2 A;  2DFF A;  4CEA A;  3AA4 A;  3DLH A;  2HHU A;  4KV8 A;  4DU4 A;  3VQ4 A;  1J53 A;  1NOZ A;  1VSL A;  4KFB A;  3CM6 A;  5KRS A;  2R7Y A;  4BE2 A;  3ZSQ A;  3DLG A;  4BWJ A;  1U47 A;  1R0A A;  5CYM A;  3TAM A;  5KGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...