4CECA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cecA00
4CGDA 4DS5A 1RDCA 4UQGA 4LH5A 3BGRA 1QSSA 2QKBA 1WLJA 4E89A 4DG1A 4Z4EA 1Y97A 3ZSXA 1C0UA 2OZSA 1JXBA 1TGOA 4CEOA 3V1OA 4FK4A 1JLQA 4KREA 4MFBA 1A5XA 2YNFA 1LV5A 1XWLA 5DK5A 4OKKA 4IKFA 2KZMA 3KK1A 3NF7A 4JS4A 1NK4A 3D45A 3VQ9A 2JLEA 3ZSQA 3CG7A 1RT2A 4CJQA 1TV6A 1DLOA 3ZT2A 3KK3A 1Q9YA 4KKOA 4OGEA 4CGFA 1VSFA 3MAQA 3C6UA 4KHQA 1WN7A 1U49A 1NK9A 1JLCA 2YNIA 3SUPA 2RN2A 1LAVA 1RBUA 3K57A 4EZ6A 3VQQA 2IOCA 3AO5A 2GV9A 4OKEA 4M3RA 4DSJA 2F8SA 3CM6A 1Q9XA 4NYNA 3OYCA 5FRMA 4E7LA 3MEGA 1JLBA 5J2PA 2P51A 3AVKA 3P5JA 1Z26A 4KHNA 3AVMA 3QEIA 1X9WA 2BANA 4ZTJA 1J5OA 4KTQA 3AVFA 3NGYA 4FCYA 3PO5A 1RT4A 1C0MA 3O3HA 3AO2A 4LY7A 2KTQA 4F8RA 4RW8A 3IRXA 5FDLA 2FBTA 4AH9A 4CJPA 4CIEA 4BE1A 4FLYA 1KFDA 3V9XA 5SZTA 4FJLA 2BGGA 1ASVA 1BQNA 4CIFA 4W5QA 4CHQA 3OS2A 4HCCA 4I9LA 4CFCA 4DSKA 4AHUA 3UIQA 1C1CA 1U4BA 1NOZA 5HRPA 3ZT4A 3K2PA 3OS1A 2F96A 3WNFA 4FJ7A 1VRTA 3LP1A 3KLEA 3KLIA 2VWJA 1VRUA 1WSJA 3TAMA 3L2RA 1BI4A 1TK0A 3WNEA 3K5OA 3NCIA 1J54A 4DWIA 3NF9A 5K14A 3SQ0A 4KHWA 1W0HA 4O0JA 4FLTA 1UA1A 3ZSVA 3I0RA 4CHOA 3OYLA 4FJIA 1WSHA 3AVNA 3L3VA 4JS5A 3PV8A 4N76A 1RTHA 3TANA 2PYJA 4FK2A 2AJQA 4AHTA 4E3SA 4FLWA 3QEWA 4CEFA 3DOKA 3IAYA 4CJ3A 1SKSA 1EXQA 2DFHA 2XHBA 3OJUA 2Q3SA 3TABA 2PY5A 1J53A 2RF2A 4B9MA 3DMJA 3S3MA 4ID1A 3TI0A 4CCHA 2ZQBA 4DTPA 2E6MA 3VQPA 4E7KA 4BDZA 1RT1A 2KQ2A 4DTUA 4DTNA 1IG9A 4AHRA 4DU1A 4Z4GA 4IG0A 2VG7A 3RMCA 3V81A 1RTDA 1QSLA 1C6VA 1ZBFA 3DRRA 5HP1A 2PYLA 1TAUA 3B6OA 3TR8A 2IGIA 3DLHA 2EX3A 3HPGA 4CJTA 2OPPA 1YTUA 3VQEA 1L3UA 1ZBHA 1F21A 1HNVA 3BDPA 3TAPA 1HQUA 1WSFA 3QESA 1VSHA 3QLHA 2D5RA 1RCHA 4CJ5A 3T19A 1NJYA 2HHSA 1KTQA 4DF4A 4B08A 1JLAA 3C94A 1KFSA 4CEDA 3ZT0A 4CE9A 3OYNA 4DFJA 3AVBA 4ZTFA 2HVIA 3S3NA 3DM2A 4IFVA 4E7IA 4FJ9A 3AO1A 4CJSA 4FM1A 4DU4A 3HK2A 3WNHA 4CERA 2YNHA 1SKWA 1UWBA 4B8CA 2RKIA 1NOYA 4ID5A 1NKCA 1NK5A 1D8YA 4BE0A 4DQSA 2XRIA 1A5VA 1YT3A 2IDOA 1KVBA 3OS0A 2OA8A 1C1BA 4CK2A 5KTQA 3OYFA 4CEEA 1T03A 1L3SA 5KRSA 4F3TA 1HRHA 5DMRA 3SUOA 1XHZA 4DS4A 1NJZA 3PX4A 4R5PA 3LWMA 1BIUA 1X9MA 1B92A 4HCBA 1U04A 1BGXT 4CF1A 3KIOA 4N5SA 3RRHA 1QS4A 2HHQA 4M45A 4DSLA 3L2WA 4FJKA 3QEVA 4HTUA 2WOMA 4AILC 3SPZA 1NK0A 1EKEA 4B9UA 4KHUA 3PUFA 1RILA 2Y1IA 3RR8A 3RMBA 4DQPA 3DYAA 5I42A 4F2RA 3K5MA 3ZT1A 1IO2A 3NF8A 4PA1A 4FLZA 4CK3A 3DRSA 4FK0A 4GMJB 3T1AA 3OYIA 3KJVA 1U45A 1ITGA 1T05A 3NGZA 3DLRA 1DTQA 2YHBA 1JLEA 3MEDA 2GBZA 4N41A 3RWUA 1HMVA 4E1NA 4DQQA 3F9KA 4PQUA 4CJFA 4KV8A 1SL1A 1NK6A 3IG1A 4OGCA 3L8BA 4CHZA 3SPYA 3U3GA 3VQBA 3OJSA 3A2FA 3NBPA 1ZBUA 4DLEA 4O0IA 1LWEA 4MQ3A 5CZ1A 4CIGA 1QQCA 4HUEA 3TWHA 3AO3A 3SV3A 3QIOA 5C24A 1VSKA 3SQ2A 1KLMA 2Z1JA 4Z4CA 3LDSA 3SJJA 3LALA 3SZ2A 3EYZA 2ITGA 1NKBA 3HPHA 4B9LA 3OYHA 1GOBA 5J2MA 4OPJA 3NHGA 3OY9A 4W5NA 2YNGA 2BE2A 4RG8A 3HVTA 2G8UA 4KPYA 3M8QA 1UAXA 4EZ9A 3OYEA 1SKRA 2RPIA 3VQAA 1MU2A 3V9UA 4PWDA 4CFAA 4O44A 1WAJA 3EZ5A 1I39A 1LWCA 1FKPA 2B4JA 3V9SA 1UOCA 1S1UA 4LSNA 4AHVA 3V4IA 4H8KA 5I3UA 4GW6A 3LWLA 2HNZA 1XHXA 4Q0BA 4B9NA 3V1RA 1U47A 3JYTA 1VSDA 4FJNA 3VQDA 3DLGA 3H08A 4I2PA 1SV5A 3AA4A 4I7FA 1TL3A 4NCGA 5FRNA 2G8IA 4DU3A 5D3GA 1XC9A 1TKXA 4FZZA 4CJRA 3CFRA 3LZJA 1JLFA 1HQEA 1D9FA 1RDDA 1YTAA 3AVGA 3I8DA 1HNIA 4CEBA 4CJWA 4B9TA 3PO4A 2EHGA 2ZD1A 1TKZA 3SNNA 4H4OA 4CF9A 1QSYA 2HHVA 4BE2A 3ZSRA 5SWMA 2R7YA 3V6DA 4BACA 4J2BA 4M3UA 1HYVA 3CM5A 2O4GA 1O1WA 3NAEA 3KKRA 4H4MA 4OKJA 4BDPA 2HNDA 2XY7A 3MECA 3PX0A 3HL8A 2X6SA 2QXFA 3ZSZA 5KRTA 1WSGA 1IH7A 2BDPA 3SYZA 2D0CA 1JL1A 1NK8A 4B8AB 4CK1A 1NK7A 4F3OA 2O4IA 3NFAA 4CFDA 4N56A 3QIPA 3ULDA 2Z1IA 2P1JA 3DLKA 2QKKA 3VA3A 4ELVA 4M42A 2X6NA 3QERA 4QAGA 2X78A 3AO4A 3ZCMA 4BWJA 4FXDA 1S1WA 3ZT3A 1RT6A 4KB1A 4YFUA 4KB0A 3ALYA 4O4GA 2XY6A 4DQRA 1REVA 3QNOA 1BQMA 1WAFA 4W5OA 5T7BA 3HP9A 1S5JA 4AHSA 3AVCA 1TKDA 4CJEA 4FM0A 4B9VA 4M41A 3QINA 3AA2A 1C1AA 5HRRA 2HB5A 3C95A 4FJGA 1K6YA 4CJUA 2IS3A 4DSIA 2Z1GA 4WE1A 3B6PA 1W9HA 4YNQA 1VSMA 1HJRA 3NE6A 2G8VA 4KFBA 5C25A 3RRGA 4FYDA 3AVLA 3L2VA 1YVUA 4E1MA 3OYGA 3M8RA 2W42A 4KI6A 4NCAA 2KFZA 1L3TA 5HRSA 4Z0UA 3CFPA 1ZBLA 1RBSA 1TL1A 4JLHA 3HVRA 4FLUA 4CGJA 2A1RA 4M3XA 3OYBA 3RR7A 1ASUA 3HJFA 2VWKA 2HNYA 3L2QA 2HHUA 2I5JA 2IAJA 4FW1A 3TAFA 1BI4B 1RT3A 3NDKA 2DFEA 3VA0A 4ELUA 4K8ZA 4FJXA 4RW6A 4DTRA 1WSEA 3S3OA 3L3UA 3SUQA 4RW9A 2HW3A 4G1QA 1D9DA 3VQ8A 1A5WA 2DFFA 1IKVA 1TAQA 1RBVA 4KTWA 1KSPA 4E0DA 3NH0A 2KZZA 3P1GA 2HHWA 1RBTA 4CEAA 3LPUA 3LP3A 1VSLA 4FZXC 1KVAA 1JKHA 1R0AA 3K58A 3QO9A 1LW0A 3LP2A 1RT5A 4IG3A 4DFPA 4QCLA 2YKNA 1RDBA 1S9GA 1U48A 3HO1A 4CHNA 4ICLA 4ZHRA 4N47A 2LSNA 2G8KA 1BL3A 3E01A 3T3FA 4B3OA 4FLVA 3DI6A 2G8HA 3VQ5A 3V1QA 3CQ8A 1S9EA 3AVHA 4OVLA 1BCMA 3OVNA 1S6QA 4RW7A 3KLHA 4Z4IA 1L5UA 1FKOA 4FJ8A 4HVJA 4B9SA 2HHXA 3TAGA 2OYQA 3NH1A 4DMNA 1EETA 3QNNA 3ZSYA 1TVRA 4CF0A 3IS9A 2FBXA 2B5JA 3MXJA 1RNHA 4C8KA 2QK9A 2YHAA 4F4KA 3M8SA 3AA3A 4OPKA 4Y1DA 1JL2A 1IKXA 1I3AA 1KLNA 1BIZA 1RTIA 1GOAA 3TAQA 2OPSA 3MXMA 4AHCA 3TAEA 3QEXA 5EU7A 3VQ6A 4CFBA 3ZSOA 2P5GA 2PZSA 4JRQA 4LH4A 2FBYA 3P83D 4CJ4A 3LAMA 3O3FA 3RTVA 3PY8A 2VG6A 4CHPA 4FM2A 3KD1E 3DOLA 3LP0A 3LANA 3PX6A 1UA0A 5C42A 5KGXA 3HM9A 4J2EA 4OJRA 4GVMA 4CEZA 1XI1A 3KK2A 3U3YA 3DLBA 2HVHA 4F2SA 4CF2A 5CYMA 2Y1JA 1RTJA 5CY4A 4DTMA 1BHLA 2P5OA 5E41A 3RMAA 4EP4A 2VG5A 4CGGA 3KD5E 3KLGA 1GOCA 4O5BA 3EY1A 4DLGA 1NKEA 2X74A 1SUQA 2G8WA 1LWFA 4FJMA 5CZ2A 1L3VA 3JSMA 2IC3A 3C6TA 4KO0A 4BDYA 4OLBA 4CHYA 3AA5X 3LPTA 4CECA 4Z4FA 1TKTA 2OPQA 3AVIA 1VK0A 1S1VA 3VN5A 4E7HA 1LAWA 3VQ7A 4C8OA 4DTSA 1WSIA 3O4NA 4Q5VA 4M3WA 1VSIA 4IBNA 4DTJA 4JRPA 3ISNC 3LZIA 4HUGA 3KLFA 2XY5A 5HLFA 4I9QA 1CZ9A 3SI6A 1RBRA 3ASMA 4FZYA 1NJXA 4J2DA 3THVA 2FBVA 1N6QA 3O3GA 2G8FA 1HYSA 3OYAA 4LD0A 3KKSA 2B6AA 2D0AA 4EP5A 3HT3A 4DFKA 4KI4A 1X1PA 4HHTA 2XY8A 3ZSWA 1CLQA 4KHYA 4Z4HA 2XO7A 4HUFA 3FFIA 2DTUA 4K8XA 5JS2A 1S1XA 1IKYA 5HBMA 3AVAA 3HPOA 4J2AA 1T7PA 3QEPA 3QETA 1QTMA 4Y1CA 3RMDA 4W5TA 2D0BA 4CF8A 1ZYQA 4FLXA 2ETJA 3WNGA 1TK5A 4KAZA 2HMIA 1S1TA 4FJJA 2KW4A 3G10A 3VQCA 4CGIA 1SL0A 4DF8A 2KFNA 3OYJA 4DQIA 2F8TA 4OLAA 1KCFA 4NCBA 4CESA 5KGWA 4DSFA 1J9AA 1D5AA 1Z25A 4CGHA 4LSLA 4E7JA 2NUBA 3CFOA 3SCXA 1NJWA 1C0TA 2E4LA 1JLGA 4FW2A 4RW4A 4E19A 1EP4A 1VSJA 4KHSA 3I0SA 4TSXA 5JS1A 3NGIA 4M3YA 2WONA 1G15A 3HYFA 4I2QA 4C8MA 2OPRA 3V9WA 3NH2A 5J2QA 4DFMA 3V9ZA 1LW2A 3K5LA 5HROA 3TARA 1HYZA 4CJKA 4FJHA 3LAKA 3SUNA 3HP6A 2YV0X 5FROA 3AV9A 4C8NA 1WNSA 3S9HA 4M3TA 3SV4A 3L2UA 4XIUA 1RDAA 4KRFA 4BWMA 4PUOA 2HHTA 1JXEA 3SQ4A 3CYMA 1BISA 4IFYA 1KRPA 2GUIA 1CXUA 2E6LA 4O55A 4ELTA 3U6FA 4KTZA 3K5NA 4DTOA 1B9DA 1QE1A 5CYQA 1RT7A 3VQ4A 4L8RB 4FVMA 4FJ5A 3D0PA 2Z1HA 4CEQA 1TK8A 3G0ZA 3ITHA 2ZE2A 4IDKA 1X9SA 3OYDA 1ZBIA 1ASWA 5HRNA 3OYMA 4W5RA 2YKMA 3M8PA 3O4QA 1N5YA 4QOZB 1FXXA 1KVCA 2ATQA 3MXIA 1IKWA 3KTQA 3MEEA 1CZBA 1EX4A 3AVJA 2FC0A 3DRPA 5J2NA 1HPZA 1VSEA 2A1SA 5KI6A 2DY4A 4CJVA 4DSEA 4C8LA 3HXMA 1SL2A 1B9FA 1DTTA 1FK9A 1BCOA 2OZMA 3NF6A 3F73A 4PY5A 1QHTA 4NYFA 2JGUA 1T8EA 3K59A 4CJLA 5J1EA 3SQ1A 4M3ZA 3OYKA 1S6PA 1Q8IA 4DTXA 3HSTB 3DLEA 1CXQA
chains in the Genus database with same CATH superfamily
2GX9A 1JJ2M 4IOAL 4BR7A 5BRDA 4DG1A 3UE5A 5C12A 1NU0A 1C0UA 2OZSA 4CEOA 3V1OA 1W2BM 1Q82O 3DAWA 5AZJB 1CZAN 2P9PA 3ZSQA 3CG7A 3L6QA 1RT2A 3M5RA 4KKOA 4OGEA 1VSFA 4ISGA 3ZX2A 1MDUB 1XC3A 1RBUA 2IOCA 3AO5A 2GV9A 1OVQA 4NYNA 4E7LA 5J2PA 2P9UA 3AVMA 1X9WA 2BANA 4ZTJA 3BUZB 3G4SN 1C0MA 2F4VK 3AO2A 3U8XA 5AQNA 4BE1A 3ZX0A 5AZIA 2NRTA 5SZTA 4CIFA 4MDAA 4JK8A 2P9NB 5M1QA 4DV6K 1U4BA 2F96A 4WFNL 1VRTA 3KLEA 1YJ9N 2E1ZA 3CQYA 2W41A 4DWIA 3O6WA 2NLXA 3EEQA 1W0HA 4PKIA 4JK7A 4FLTA 3ZSVA 1WSHA 3AVNA 1RTHA 2AJQA 4FLWA 4CJ7A 3N4PA 4CJ3A 1EXQA 3HTVA 2XHBA 1J53A 4B9MA 4CCHA 2ZQBA 4BRDA 2UXCK 1IG9A 2VG7A 1QSLA 3DRRA 5HP1A 3Q7BA 2IGIA 3IFRA 3KZBA 3RSEA 3DLHA 3HPGA 1YTUA 3G6EN 1HNVA 5AQIA 3CHWA 3QLHA 2D5RA 4CJ5A 3IUCA 2FF3B 3VEYA 1NJYA 3PIOL 4B08A 3CERA 3CCLN 1KFSA 2HVIA 3ZT0A 1NG9A 2IIRA 3DM2A 3AO1A 1YXQA 4B1YB 4LF6K 3WNHA 3JS6A 4MO5A 2CH5A 1D8YA 4DQSA 1J6ZA 2IDOA 3OS0A 3R8EA 1C1BA 1T03A 1HRHA 2VWBA 4DS4A 4GKKK 4HCBA 1BGXT 5LMUK 3CCSN 3RRHA 1QS4A 4M45A 4DSLA 2ZJRL 1Q81O 4HTUA 3SPZA 3D2EB 1NK0A 2KKZA 3PSFA 4XH1A 3ULEA 2VGMA 1RILA 4DQPA 4F2RA 3NF8A 4EHTA 4PA1A 2QTDA 3DRSA 3KJVA 1DTQA 3CJCA 3ENOA 2GBZA 1T6DA 4N41A 1HMVA 4E1NA 4DR7K 4JKBA 5EXWA 1NK6A 2AP1A 3FZFA 3QIOA 3SJJA 4YY3K 2FF6A 3SZ2A 4LF5K 2YHYA 4B9LA 3G25A 1DKGD 3CXCM 4OPJA 3NHGA 1JCGA 1HX1A 3OY9A 4W5NA 4OX9K 4KPYA 3M8QA 1UAXA 1NJIO 3MN5A 3V9UA 4CFAA 1WAJA 5AR0A 4DR1K 1LWCA 3V9SA 4LSNA 4BVPA 4K25A 4CZMA 3V1RA 4FJNA 3DLGA 5FPNA 1SV5A 5FRNA 4AM7A 3EE9A 5JLHA 4JKEA 2UU9K 4H0VB 3OTOK 3PIPL 4B3SK 4JD2B 1T44A 3GBTA 4GV6A 4C23A 3I8DA 3CCUN 4K41A 4BE2A 1RGIA 3MWTA 3CC4N 3KKRA 4H4MA 2HNDA 3HL8A 2ZM6K 5KRTA 2QXFA 3ENBA 4H0PA 1WSGA 3U9DA 5IT9O 2O4IA 3MX5A 1HKGA 3ULDA 2QKKA 3VA3A 1HLUA 3SAFA 4CZLA 4FXDA 4MDBA 3ZT3A 5AFUA 3LL3A 3RVCA 2CH6A 4DQRA 1BQMA 3HP9A 3CETA 4JI1K 3C6HA 4PHTX 4B9VA 4M41A 4JI2K 4DR5K 1K6YA 3L0QA 2IS3A 3DWLA 4CJUA 4WE1A 3B6PA 3ZEUB 3RRGA 3AVLA 3L2VA 3M8RA 5AZIB 3ATUA 4Z0UA 1RBSA 1TL1A 2QWMA 3HVRA 4BRLA 1V4TA 2FLOA 3BZKA 4A5BA 2HF4A 2I5JA 3SLCA 4FW1A 3TAFA 2HBKA 3VEWA 1RT3A 3NDKA 2DFEA 1YITN 1E3MA 5AQKA 4H5VA 3SUQA 4RW9A 1H1VA 2QWNA 4CEAA 3LPUA 4B1XB 1VSLA 1BWFO 1KVAA 2Q36A 5E26A 1JKHA 2QI2A 1LW0A 3LP2A 4IG3A 5EVZA 1LOTB 2QW9A 3CQXA 4ICLA 1BL3A 4BGBA 2RHKA 3DI6A 1QZ5A 3K9KA 4Z4IA 4RW7A 1VQ8N 3F2KA 1L5UA 1FKOA 5BPNA 4FJ8A 1GLLO 3P4IA 2DPNA 5BPMA 2FBXA 3MXJA 1RNHA 4FVUA 1NGAA 4YDUC 5KPRA 4MLHA 4OPKA 4GNIA 3H45C 1RTIA 4JKHA 5AQGA 3HBTA 3TAQA 5M1OA 2F7TA 5GAEP 1GLAG 1YF5L 2E2NA 3VQ6A 4CFBA 5GAHP 1P90A 4LH4A 3O3FA 2Q0RA 3VEOA 3TSPA 5C42A 3HM9A 4OJRA 2VGNA 4CF2A 5CY4A 4DTMA 5E41A 3RMAA 3UKUA 4EP4A 4CZHA 1LCUA 3KLGA 1GOCA 4O5BA 4DLGA 1NKEA 1SUQA 2PBDA 2AA4A 4WQ4A 1V4SA 2V52B 4BDYA 1XMOK 5KPTA 2GELA 4LFAK 1S1VA 5AQOA 3VEXA 1M90O 3O4NA 3O5BA 4IOCL 2UXBK 2XY5A 1CZ9A 4CZJA 4FZYA 4J2DA 2NRWA 2FBVA 1VQLN 1N6QA 3VF2A 2A40A 2G8FA 1HYSA 3LDLA 4LD0A 2B6AA 4EP5A 5A2QO 3HT3A 4DFKA 4CZFA 4IXCA 1BUPA 2XY8A 4LF7K 1N32K 4Z4HA 1X3NA 4K8XA 2FSNA 4H0YB 3GDQA 3QETA 2D0BA 3TTDA 4KAZA 3MN9A 4IFEA 2HMIA 1SL0A 4YORA 4DF8A 1Z25A 4LSLA 3D2FB 1NJWA 2O8CB 4E19A 2GTDA 2YX6A 5JS1A 2WONA 3CMAN 4C8MA 4JKCA 3K5LA 3SUNA 3HP6A 4YOWA 3AV9A 4C8NA 3S9HA 1YHQN 1NMDA 3L2UA 4XIUA 1RDAA 4BR0A 1GLDG 3SQ4A 3CYMA 4IFYA 1KRPA 5C0YA 4BR4A 4KTZA 1XQSC 5CYQA 4FWRA 2Z1HA 3M3ZA 3ITHA 4JKGA 1X9SA 5E84A 5HRNA 5M1KA 1EWQA 2YKMA 3O4QA 4QOZB 1FXXA 2E2QA 3KTQA 2D1KA 1EX4A 5J2NA 1HPZA 4DV7K 1HPMA 2DY4A 4NXNK 3HXMA 4BQZA 1FK9A 4QS9A 1BCOA 3NF6A 4JKFA 4PY5A 1QHTA 4NYFA 1T8EA 2FSJA 3K59A 3SQ1A 5BN9A 1MWMA 1S6PA 4DFPA 3HSTB 3QERA 3DLEA 1IJJA 4DS5A 1KC8O 1QSSA 2QKBA 5LY3A 4BRIA 4PKHA 1Y97A 3A5LC 1P8ZA 4KREA 4MFBA 2YNFA 5LJVA 4DR6K 2F9WA 5DK5A 4JS4A 2JLEA 2P9SA 5AQFA 4WFBL 1TV6A 1Q9YA 2HHHK 3C6UA 1U49A 1JLCA 2YNIA 1S22A 3CM6A 2A3ZA 2ZJPL 4V19S 2P51A 2QWQA 1Z26A 5AQSA 3VERA 3AVFA 3JXUA 5FDLA 3V9XA 4IZ9A 5C2DA 1ASVA 4HCCA 3O1BA 3LM2A 4XH4A 1NOZA 5AQRA 1M1KO 3K2PA 3OS1A 1YJNN 3THXB 1WSJA 3TAMA 3I55N 3NCIA 1MA9B 5K14A 3VF6A 2UUBK 4KHWA 4O0JA 1UA1A 3N4QA 3PV8A 3TANA 2PYJA 3QEWA 3DOKA 4CBUA 3IAYA 4FWNA 3CJAA 3OJUA 2PY5A 3O08A 1OH6A 4ID1A 4DV3K 3CCQN 3VQPA 4A62A 4BDZA 2V7ZA 4JNEA 4DTNA 4AHRA 3QICA 4Z4GA 1OH5A 1C6VA 3B6OA 3TR8A 2EX3A 3TSUA 3VQEA 1ZBHA 3K9JA 4AQYK 1HQUA 3QESA 1RFQA 4BROA 3T19A 3C94A 4X64K 2W6LA 4ZTFA 3FGUA 4CJSA 4BY9C 4FJ9A 4FM1A 3HK2A 2YNHA 2D0PA 3MN7A 1SKWA 1UWBA 2RKIA 1KAZA 4K42A 3O9SA 2XRIA 4LC9B 5AQZA 2OA8A 4BG9A 4F3TA 5KRSA 5DMRA 1VQ4N 1XHZA 3LWMA 1BIUA 4O8KA 1B92A 1X9MA 3AAPA 4CF1A 2Q2RA 4WCEL 4IEEA 4JI6K 2H3GX 3KVGA 4IEIA 1N33K 4KHUA 2Y1IA 3RR8A 3K5MA 1IO2A 4FLZA 4B3RK 4QS8A 3GL1A 1ITGA 1T05A 3NGZA 3DLRA 1QQOA 4LF9K 4CJFA 4OGCA 3L8BA 4CHZA 1K73O 1K8KA 1ZBUA 3OW2M 4CIGA 1QQCA 3SV3A 2WBNA 5I9EB 3KWGA 2E2OA 2ITGA 1NKBA 3HM8A 3QFPA 2HSTA 3WXLA 3PSIA 3I8BA 2RPIA 3NVMA 4Y0WA 1IBKK 4O44A 3EZ5A 3J7YP 1I39A 2O8DA 3HOSA 4DKWA 3QFUA 1S1UA 2ZGYA 3V4IA 2ITMA 4JKGB 3F5TA 3CD6N 3FZLA 4I2PA 4I7FA 4NCGA 3MX2A 4DR4K 3VETA 4DU3A 4CD1A 3CFRA 3LZJA 4DV0K 1JLFA 1D9FA 3MN6A 3PO4A 2ZD1A 2HHVA 4CF9A 3DXKA 3ZSRA 3J8AA 2R7YA 5GIPA 4J2BA 4M3UA 4UY8O 3FLCO 3A0IX 1O1WA 3NAEA 4BDPA 3ZSZA 3W0LA 3SYZA 2D0CA 5GAGP 1JL1A 4B8AB 4BRAA 2GWKA 4N56A 3QIPA 2P1JA 3SAHA 1QQMA 4ELVA 5AQTA 4BRFA 1BDGA 1IG8A 4YFUA 1S3XA 3E9PA 1QQNA 4W5OA 4IJAA 3H3NO 1S5JA 3HRGA 2NZTA 3C7NA 3AA2A 5HRRA 2HB5A 2YI1A 1ILYA 4AM6A 2Z1GA 4DSIA 4YNQA 1W9HA 1N36K 5LL6Z 3WXJA 1HJRA 1SZ2A 2G8VA 1D4XA 3O80A 2ASOA 3ID6A 4E1MA 2W42A 3QBXA 4NCAA 2E2PA 2WC9A 5ADXH 1L3TA 5HRSA 1ZBLA 4Z94A 4JLHA 3IDHA 5JVHL 3BZCA 4M3XA 3OYBA 3RR7A 3HJFA 2HHUA 1OKJA 3O1WA 3LM9A 2HBJA 3WXKA 4ELUA 4DTRA 3E1YA 3S3OA 4G1QA 2DFFA 2I7NA 4KTWA 4B3MK 4E0DA 2KZZA 3P1GA 3BY5A 1O13A 4M7XA 4O5FA 4A57A 3CIPA 1VQ5N 3QO9A 4R79A 2YKNA 3VENA 3EE8A 3I33A 4FOIA 3HO1A 3J7AP 5AQHA 2G8KA 4B3OA 5AQXA 4A59A 2J4RA 5MLCQ 2G8HA 3VQ5A 3V1QA 1S9EA 4OVLA 2A5XA 3OVNA 3KLHA 2E1YA 4DR2K 3TAGA 2OYQA 1KQSM 4BRHA 4DMNA 3ZSYA 1TVRA 5GIOA 2YHAA 2IVOA 3M8SA 3AA3A 1I3AA 1BIZA 1GOAA 4PKGA 4WQ4C 2OPSA 2P9KB 3QEXA 3FZMA 3ZSOA 2PZSA 4CJ4A 2VG6A 3LP0A 1UA0A 4J2EA 2EWSA 1XI1A 3U3YA 2HBMA 3VF4A 2P5OA 1BHLA 3J7ZO 3F9MA 3KD5E 4ILHA 5KQ8A 2G8WA 1LWFA 3THYA 5CZ2A 3JSMA 2IC3A 4KO0A 1FJGK 1BU6O 2Q0UA 1VK0A 4E7HA 2O8BA 1LAWA 3VQ7A 3CJ9A 3WEEB 4C8OA 3WUHA 4DTSA 4B1UB 5IWAK 1VSIA 4DTJA 4C1NK 5HLFA 2O8EB 4I9QA 3SI6A 3ASMA 1K9MO 4H5WA 1N8RO 2PFUA 1HUXA 1YAGA 1OH7A 2D0AA 3DXMA 3WT0A 2XO7A 4C1NI 3T1HK 5JS2A 2P9PB 1K8KB 5HBMA 4JI0K 4J2AA 1T7PA 2YHXA 1QTMA 4X66K 4Y1CA 3RMDA 3LDNA 2BH1A 1ZYQA 2ETJA 1S1TA 4FJJA 2KFNA 1HR0K 4J8FA 1SQKA 2P9UB 3FZHA 1J9AA 2V7YA 5AQUA 4CGHA 2NUBA 3CFOA 4E7JA 1C0TA 1JLGA 4FW2A 3TTCA 1VSJA 4KHSA 3R3LA 1KD1O 1XUPO 1G15A 5AQMA 3A5OC 4I2QA 3V9WA 5J2QA 3I56N 5HROA 4FJHA 4NXMK 3LAKA 2YV0X 4M3TA 3SBTA 1WNSA 3M1FA 2BTFA 3SV4A 3EKSA 1XNRK 2ZJQL 1OVYA 4GKJK 4KBOA 3GE1A 3U6FA 4DTOA 1B9DA 1S72N 5AJ3K 4DV4K 4FJ5A 4FWOA 3DLLL 3DXKB 3OYDA 3VGKA 5JVGL 4W5RA 3M8PA 1NM1A 2ATQA 3H46O 3ZLJA 3MEEA 5CE3A 2A1SA 1ESVA 4C8LA 1SL2A 4A2AA 4BRQA 5AQQA 3AAQA 5F1XA 1GLBG 4CJLA 2KLAA 3RSEB 3P39A 3HI0A 4DTXA 1E4GT 4UQGA 3TU5A 1Q86O 3A5MC 4E89A 4JV5K 1TGOA 5EY4A 4U7BA 3SMPA 4FK4A 1A5XA 4IKFA 1IBMK 2KZMA 1NK4A 3D45A 3VQ9A 3PLAA 3ZETA 3KK3A 1DLOA 4CGFA 1WN7A 1NK9A 3SUPA 1LAVA 4EZ6A 1BG3A 2GEMA 2F8SA 4M3RA 4DSJA 4FSVA 3QB0A 3OYCA 1VQ9N 4KHNA 5M1NA 3SBGA 3PO5A 5JLFA 4O8UA 5HOOA 1NMNA 1BO5O 2KTQA 3IRXA 1VAZA 4OO1J 2UUCK 4DV1K 1X3MA 4IO8A 3ULEB 4FLYA 1KFDA 4I6MA 2BGGA 4CHQA 4I9LA 3MCPA 4CFCA 1WBBA 3ZT4A 3O9TA 3WNFA 3LDPA 4BRNA 3KLIA 2VWJA 3L2RA 3TSQA 3WNEA 3SQ0A 4B1WB 3I0RA 3OYLA 4JS5A 3L3VA 4FK2A 4AHTA 1I94K 2DFHA 4BR9A 5C10A 3TABA 2QWOA 5B8HA 2RF2A 3S3MA 3EL2A 4K0KK 4E7KA 1NGEA 1DEJA 1RT1A 2ZF5O 1QHAA 3RMCA 1RTDA 3WQTA 4YOVA 4KHPK 4CZKA 1HNZK 1WSFA 1VSHA 5BR8K 1RCHA 5CR4A 5H1SQ 4FL9A 3SAGA 5AQVA 4PL8A 5GADP 2E20A 4CEDA 4CE9A 3OYNA 3AVBA 2QWRA 4IFVA 3CCEN 4CERA 1NGJA 3CCVN 2QXLA 2O8BB 1A5VA 1KVBA 3O8MA 1T6CA 5KTQA 4CK2A 3OYFA 1EWRA 4OPHA 4JHDA 3KIOA 1NGGA 4XEIA 4N5SA 5AQLA 2HHQA 3L2WA 4FJKA 3QEVA 4OPAA 2WOMA 4B9UA 2YJEA 2VQEK 3RMBA 3DYAA 5I42A 2P9NA 1IBLK 3H1VX 4FWMA 5AQPA 4GMJB 3T1AA 2A42A 4E1JA 2BUPA 1ATNA 2NRXA 1JCFA 1JLEA 2QWLA 3VESA 4DQQA 1SL1A 3IG1A 5EX5A 1U6ZA 3OJSA 3A2FA 4DLEA 4O0IA 1LWEA 4MQ3A 3AO3A 1NGDA 1VSKA 2Z1JA 3LDSA 2P9IA 3LALA 3EYZA 2F9TA 3WQUA 3ATVA 3HPHA 1RDUA 5J2MA 3A8YA 2OCEA 3VMFB 3J80O 3HOTA 2G8UA 3LDOA 4EZ9A 1N34K 5ELZA 3VQAA 3T69A 4PWDA 1YVNA 4H0TB 4JEPA 4AHVA 3HZ6A 3T7ZA 5I3UA 4GW6A 1XHXA 4B9NA 1VSDA 3VQDA 3H08A 2QM1A 1TL3A 2G8IA 5D3GA 1TKXA 2QA4N 4FZZA 4CJRA 4CI6A 1HNIA 4CJWA 4B9TA 2EHGA 2FXUA 4JI4K 1QSYA 3SNNA 4H4OA 3VGMA 4NLCA 5SWMA 4EIAA 4LF8K 3HSCA 3V6DA 1HYVA 3CM5A 4ISFA 4BGAA 2O4GA 4OKJA 2XY7A 3MECA 3T1YK 4BC3A 2X6SA 2CGKA 3IMXA 3CF5L 2NRHA 4YOYA 1X9JA 1NK8A 3D2EA 1NK7A 4F3OA 5EOYA 3DLKA 5BREA 4M42A 4QAGA 3E9LA 2X78A 4BWJA 1S1WA 4JYAK 2XY6A 3J81O 3QNOA 5T7BA 3UKUB 2E88A 3AVCA 4FM0A 3QINA 3CC2N 1C1AA 3C95A 4FJGA 4HTLA 4ISEA 3VTHA 3LDQA 3MCAB 5AFUH 1NGIA 1K8AO 5C25A 4FYDA 2IVPA 3ZYYX 4KI6A 3D7EO 2WFBA 5BRHA 5HL7L 2IAJA 4K8ZA 4RW6A 1RDWX 2HW3A 1D9DA 1A5WA 4CZEA 1KSPA 1TAQA 1RBVA 1G99A 4IOXA 2HHWA 2IVNA 3LP3A 4FZXC 3E9OA 1QVFM 1TYQA 3ENHA 4BR2A 2Q1NA 1E4FT 2W40A 4BRPA 1RT5A 2E8AA 3QDKA 1S9GA 5F0XA 4ZHRA 4N47A 2LSNA 4JD2A 3C6AA 4FLVA 4FJIA 3AVHA 4B3TK 3R6MA 4HVJA 4JK9A 3NH1A 1EETA 5TKWA 3CCRN 3IS9A 4C8KA 3G71N 2QK9A 1JL2A 1NWKA 1KLNA 2CGLA 3AY9A 1C0GA 4B1ZA 4BRKA 3TAEA 2HOEA 3KWIA 1VQKN 4JRQA 3RTVA 3LAMA 4CHPA 4FM2A 3LANA 3SMSA 5KGXA 3TTFA 1RTJA 4BC4A 3H1QA 4CGGA 2JWLA 5TKYA 4JHDB 4FJMA 4RWTA 4DUYK 1L3VA 4DV5K 3ZEUA 3C6TA 3LPTA 4CECA 4Z4FA 1TKTA 2OPQA 3AVIA 3BF3A 3VN5A 4FO0A 1WSIA 1QVGM 4M3WA 4IBNA 2YJFA 4JRPA 3ISNC 3LZIA 3KLFA 1RBRA 4NB4A 3W3DA 3O3GA 3MDQA 1NGCA 4KI4A 1X1PA 4HHTA 2D0OA 1CLQA 4KHYA 4HUFA 3FZKA 3FFIA 3HPOA 3CPEA 2P9SB 1NNEA 2P9IB 4BRMA 2KW4A 2WUSA 1NGBA 3OYJA 3EN9A 2F8TA 1KCFA 4NCBA 4CESA 1W7AA 5KGWA 4DSFA 1WOQA 4L3QA 3B8AX 3CCJN 3SCXA 4LFBK 2E4LA 3ZX3A 4RW4A 4MO4A 3NGIA 1HNXK 1FW6A 1BA0A 2P9LA 1LW2A 3TARA 1HYZA 5C2FA 4CJKA 2O8FA 5FROA 2NRZA 1WB9A 2HHTA 2GUIA 4ELTA 4O55A 1EQYA 1QE1A 1DT9A 3VQ4A 4L8RB 3OBWA 5M1PA 3D0PA 4CEQA 3THWA 4FWSA 1XNQK 1ZBIA 1N5YA 1VQPN 3EZWA 1IKWA 4M7YA 4FOEA 2FC0A 3VEVA 1W97L 4CJVA 4AF1A 2WTUA 4DSEA 1VHXA 1J5EK 1B9FA 1ZBSA 2OZMA 3F73A 3DJCA 2NRRA 2JGUA 4H0OA 5J1EA 4BR5A 2JWKA 2ASMA 1Q8IA 4FLUA 4KTQA 1CXQA 1HKBA 4CGDA 1RDCA 4LH5A 3BGRA 4ILGB 1WLJA 4Z4EA 4WYBA 3CJ7A 3ZSXA 4WQ5A 1GLEG 1JXBA 2OANA 1JLQA 4U67L 3QMLA 1LV5A 1XWLA 4GY2B 4OKKA 3KK1A 3NF7A 5JICA 1OH8A 1ATRA 4A5AA 4CJQA 3ZT2A 4DV2K 3L4QA 3MAQA 4KHQA 4BG8A 3SK3A 2RN2A 3K57A 3VQQA 4OKEA 3CC7N 1Q9XA 5FRMA 3MEGA 1JLBA 3AVKA 3P5JA 3GOIA 3QEIA 2ASPA 3SJHA 4BREA 3D2FA 1J5OA 3CJ1A 2O8CA 4FCYA 3NGYA 4JI7K 1XMQK 4HWIA 1RT4A 3O3HA 4LY7A 4F8RA 4RW8A 2FBTA 4AH9A 4CJPA 4CIEA 4FJLA 1BQNA 1BOTO 4W5QA 3OS2A 3NVKA 1TYQB 4AHUA 4DSKA 3UIQA 1C1CA 1KXPA 5HRPA 3H3OB 4FJ7A 3LP1A 1VRUA 1BI4A 1TK0A 3K5OA 3MWPA 1J54A 4IWVA 1Y64A 3NF9A 2NRVA 4LF4K 4CHOA 4N76A 3KK7A 2DTUA 3S41A 4ILJA 5KQDA 4H5TA 4E3SA 4CEFA 1SKSA 2Q3SA 1VQNN 3DMJA 3TI0A 4DTPA 2E6MA 3BEXA 2KQ2A 4DTUA 4DU1A 4IG0A 3V81A 4DHYA 2PYLA 1ZBFA 1TAUA 4CJTA 2OPPA 3U4LA 2O8DB 1L3UA 1F21A 1YIJN 3BDPA 4G9ZA 5DM7L 3TAPA 1GLJO 4LFCK 3O9UA 2OTLN 1KAXA 2HHSA 1KTQA 4DF4A 1KAYA 4B1VA 5BPLA 1JLAA 1DGKN 4DFJA 3S3NA 3BP8A 4CW7B 4E7IA 5CHIA 3GG4A 4JAXA 1EO1A 4DU4A 4JKAA 4B8CA 4WF9L 1NOYA 4ID5A 1NKCA 1NK5A 4BE0A 1YT3A 5F2RA 4EFHA 4YOXA 1Z05A 1NGFA 1L3SA 4X62K 4CEEA 3SUOA 1NJZA 3PX4A 4R5PA 2VYPA 3C0BA 1U04A 1SAZA 4AILC 3D6RA 3TPQA 1EKEA 1GLCG 3PUFA 3P31A 3ZT1A 5DM6L 5C15A 2HMPA 2D4WA 4CK3A 4FK0A 4YHHK 3OYIA 1U45A 3THXA 4RTFD 2YHBA 3MEDA 4NLBA 3K0SA 3RWUA 3F9KA 4PQUA 2Q97A 4KV8A 3SPYA 4CZIA 3U3GA 3VQBA 4F9OA 3NBPA 1YUWA 3C7NB 5CZ1A 4HUEA 3TWHA 5C24A 3SQ2A 1KLMA 4Z4CA 3UKRA 3NMUA 2P9LB 4KH4A 3OYHA 2FSKA 3R1XA 1GOBA 2O8FB 2YNGA 1R59O 2BE2A 3HVTA 4RG8A 4BC5A 5LJWA 4DUZK 2V51B 3OYEA 1SKRA 4CBWA 1MU2A 1Z6RA 5FPMA 3AGRA 2UXDK 1FKPA 2B4JA 3CI5A 4GV9A 1UOCA 4H8KA 3THWB 4QS7A 3LWLA 2HNZA 4X65K 4Q0BA 1U47A 3JYTA 1U2VA 2UYTA 3BF1A 3AA4A 4K43A 1XC9A 2W6KA 5BR9A 1HQEA 3WXIA 1RDDA 1YTAA 3AVGA 2UUAK 4CEBA 1VQMN 3E66A 4YOUA 1TKZA 3MMVA 4BACA 4JI8K 4EHUA 4DR3K 3PX0A 4FWQA 2HF3A 3IKMA 2BDPA 1IH7A 4DCHA 3O9QA 1YI2N 4CK1A 2GWJA 3NFAA 4CFDA 1WBDA 1TUYA 2Z1IA 4IO9L 2X6NA 3CJBA 2NNWA 1HKCA 3AGKA 3ZCMA 3AO4A 2GUPA 1RT6A 4KB1A 4KB0A 3ALYA 4O4GA 3L4IA 5ADXA 1REVA 1WAFA 4CD3A 5AZJA 4AHSA 1TKDA 4CJEA 4B9QA 2ZWHA 3A5NC 3THYB 1VSMA 3NE6A 4KFBA 4JI5K 1YVUA 3OYGA 2KFZA 4BRGA 3CFPA 4KH6A 2QWPA 3EO3A 4CGJA 2A1RA 5KPZA 2VQFK 1ASUA 2RE2A 2VWKA 3OA9A 2HNYA 3Q7CA 3L2QA 5FLXO 5M1FA 3KHYA 1BI4B 3VA0A 4FJXA 4CBXA 3DXMB 4MLEA 1WSEA 3L3UA 3VQ8A 1IKVA 3M6GA 3NH0A 2HBLA 1RBTA 5LMNK 1GLFO 4FWPA 3FE1A 1R0AA 3K58A 4A2BA 3OBYA 2A6AA 4QCLA 1RDBA 2OTJN 1U48A 4CHNA 1HNWK 5AQYA 2YHWA 3E01A 3T3FA 4CVNE 1JCEA 3CQ8A 1BCMA 1S6QA 4FPBA 2E5LK 4B9SA 1ATSA 2HHXA 1VQ6N 3QNNA 4CF0A 5GINA 2B5JA 3JAMO 4H5NA 4F4KA 1ZC6A 4JN4A 4PL7A 4Y1DA 1Q7YO 1IKXA 4YOTA 1C0FA 3VPZA 3O9RA 3MXMA 1VQ7N 4AHCA 1BA1A 4BQLA 5EU7A 3R9PA 2P5GA 2FBYA 3P83D 4GV3A 3PY8A 1NBWA 3KD1E 3DOLA 3PX6A 1NLVA 4GVMA 4CEZA 4BRCA 3KK2A 2PAVA 3WXMB 3DLBA 2HVHA 4F2SA 2KHOA 2A41A 4H0XB 5CYMA 3CCMN 2Y1JA 3QBWA 3MK6A 4YDUA 2VG5A 5AQWA 3EY1A 5FPDA 2X74A 2YCHA 3O4WA 4EAHD 2I7PA 4OLBA 4CHYA 3AA5X 4IDHA 4RCHA 1TUUA 4Q5VA 5AQJA 4HUGA 4CZGA 4FWKA 1NJXA 4FPAA 3THVA 3OYAA 3VGLA 3KKSA 5BN8A 4KH5A 1WUAA 2ZGZA 4XH5A 3ZSWA 3CMEN 1S1XA 1IKYA 3AVAA 3P38A 3CPWM 1NGHA 3EKUA 3C65A 3ZETB 1IV0A 1ZXOA 4JKDA 3QEPA 3U9ZA 1QZ6A 3UKRB 4DB3A 4W5TA 4CF8A 4FLXA 3WNGA 1TK5A 3G10A 3VQCA 4CGIA 2VCPA 4DQIA 3VOVA 3VTIA 5FPEA 2CGJA 3FFKB 1D5AA 4JI3K 1MWKA 1EP4A 4IJNA 3VEZA 3I0SA 4FWLA 4TSXA 2Q31A 3AARA 3HYFA 4M3YA 5JMVA 2OPRA 3NH2A 4H5RA 4DFMA 3V9ZA 4GVEA 4I6MB 4BVOA 4H03B 1U2VB 4KRFA 4BWMA 2P9KA 1T3VA 3FR0A 1JXEA 4PUOA 3ID8A 1BISA 1VQON 1CXUA 2E6LA 3K5NA 1YJWN 1RT7A 4FVMA 3H6EA 1TK8A 1SS6A 3G0ZA 2ZE2A 4IDKA 4A61A 1ASWA 3OYMA 4DQ8A 4WQ5C 3MXIA 1KVCA 1HJOA 5BRFA 4BC2A 1CZBA 3AVJA 3DRPA 1VSEA 5KI6A 1Q18A 3OHRA 2QEXN 1DTTA 4M63C 3UB5A 4NO7A 3WEEA 4M3ZA 3OYKA 4WFAL 2O8EA 4OLAA
chains in the Genus database with same CATH topology
4CGDA 4DS5A 1RDCA 4UQGA 4LH5A 3BGRA 1QSSA 2QKBA 1WLJA 4E89A 4DG1A 4Z4EA 1Y97A 3ZSXA 1C0UA 2OZSA 1JXBA 1TGOA 4CEOA 3V1OA 4FK4A 1JLQA 4KREA 4MFBA 1A5XA 2YNFA 1LV5A 1XWLA 5DK5A 4OKKA 4IKFA 2KZMA 3KK1A 3NF7A 4JS4A 1NK4A 3D45A 3VQ9A 2JLEA 3ZSQA 3CG7A 1RT2A 4CJQA 1TV6A 1DLOA 3ZT2A 3KK3A 1Q9YA 4KKOA 4OGEA 4CGFA 1VSFA 3MAQA 3C6UA 4KHQA 1WN7A 1U49A 1NK9A 1JLCA 2YNIA 3SUPA 2RN2A 1LAVA 1RBUA 3K57A 4EZ6A 3VQQA 2IOCA 3AO5A 2GV9A 4OKEA 4M3RA 4DSJA 2F8SA 3CM6A 1Q9XA 4NYNA 3OYCA 5FRMA 4E7LA 3MEGA 1JLBA 5J2PA 2P51A 3AVKA 3P5JA 1Z26A 4KHNA 3AVMA 3QEIA 1X9WA 2BANA 4ZTJA 1J5OA 4KTQA 3AVFA 3NGYA 4FCYA 3PO5A 1RT4A 1C0MA 3O3HA 3AO2A 4LY7A 2KTQA 4F8RA 4RW8A 3IRXA 5FDLA 2FBTA 4AH9A 4CJPA 4CIEA 4BE1A 4FLYA 1KFDA 3V9XA 5SZTA 4FJLA 2BGGA 1ASVA 1BQNA 4CIFA 4W5QA 4CHQA 3OS2A 4HCCA 4I9LA 4CFCA 4DSKA 4AHUA 3UIQA 1C1CA 1U4BA 1NOZA 5HRPA 3ZT4A 3K2PA 3OS1A 2F96A 3WNFA 4FJ7A 1VRTA 3LP1A 3KLEA 3KLIA 2VWJA 1VRUA 1WSJA 3TAMA 3L2RA 1BI4A 1TK0A 3WNEA 3K5OA 3NCIA 1J54A 4DWIA 3NF9A 5K14A 3SQ0A 4KHWA 1W0HA 4O0JA 4FLTA 1UA1A 3ZSVA 3I0RA 4CHOA 3OYLA 4FJIA 1WSHA 3AVNA 3L3VA 4JS5A 3PV8A 4N76A 1RTHA 3TANA 2PYJA 4FK2A 2AJQA 4AHTA 4E3SA 4FLWA 3QEWA 4CEFA 3DOKA 3IAYA 4CJ3A 1SKSA 1EXQA 2DFHA 2XHBA 3OJUA 2Q3SA 3TABA 2PY5A 1J53A 2RF2A 4B9MA 3DMJA 3S3MA 4ID1A 3TI0A 4CCHA 2ZQBA 4DTPA 2E6MA 3VQPA 4E7KA 4BDZA 1RT1A 2KQ2A 4DTUA 4DTNA 1IG9A 4AHRA 4DU1A 4Z4GA 4IG0A 2VG7A 3RMCA 3V81A 1RTDA 1QSLA 1C6VA 1ZBFA 3DRRA 5HP1A 2PYLA 1TAUA 3B6OA 3TR8A 2IGIA 3DLHA 2EX3A 3HPGA 4CJTA 2OPPA 1YTUA 3VQEA 1L3UA 1ZBHA 1F21A 1HNVA 3BDPA 3TAPA 1HQUA 1WSFA 3QESA 1VSHA 3QLHA 2D5RA 1RCHA 4CJ5A 3T19A 1NJYA 2HHSA 1KTQA 4DF4A 4B08A 1JLAA 3C94A 1KFSA 4CEDA 3ZT0A 4CE9A 3OYNA 4DFJA 3AVBA 4ZTFA 2HVIA 3S3NA 3DM2A 4IFVA 4E7IA 4FJ9A 3AO1A 4CJSA 4FM1A 4DU4A 3HK2A 3WNHA 4CERA 2YNHA 1SKWA 1UWBA 4B8CA 2RKIA 1NOYA 4ID5A 1NKCA 1NK5A 1D8YA 4BE0A 4DQSA 2XRIA 1A5VA 1YT3A 2IDOA 1KVBA 3OS0A 2OA8A 1C1BA 4CK2A 5KTQA 3OYFA 4CEEA 1T03A 1L3SA 5KRSA 4F3TA 1HRHA 5DMRA 3SUOA 1XHZA 4DS4A 1NJZA 3PX4A 4R5PA 3LWMA 1BIUA 1X9MA 1B92A 4HCBA 1U04A 1BGXT 4CF1A 3KIOA 4N5SA 3RRHA 1QS4A 2HHQA 4M45A 4DSLA 3L2WA 4FJKA 3QEVA 4HTUA 2WOMA 4AILC 3SPZA 1NK0A 1EKEA 4B9UA 4KHUA 3PUFA 1RILA 2Y1IA 3RR8A 3RMBA 4DQPA 3DYAA 5I42A 4F2RA 3K5MA 3ZT1A 1IO2A 3NF8A 4PA1A 4FLZA 4CK3A 3DRSA 4FK0A 4GMJB 3T1AA 3OYIA 3KJVA 1U45A 1ITGA 1T05A 3NGZA 3DLRA 1DTQA 2YHBA 1JLEA 3MEDA 2GBZA 4N41A 3RWUA 1HMVA 4E1NA 4DQQA 3F9KA 4PQUA 4CJFA 4KV8A 1SL1A 1NK6A 3IG1A 4OGCA 3L8BA 4CHZA 3SPYA 3U3GA 3VQBA 3OJSA 3A2FA 3NBPA 1ZBUA 4DLEA 4O0IA 1LWEA 4MQ3A 5CZ1A 4CIGA 1QQCA 4HUEA 3TWHA 3AO3A 3SV3A 3QIOA 5C24A 1VSKA 3SQ2A 1KLMA 2Z1JA 4Z4CA 3LDSA 3SJJA 3LALA 3SZ2A 3EYZA 2ITGA 1NKBA 3HPHA 4B9LA 3OYHA 1GOBA 5J2MA 4OPJA 3NHGA 3OY9A 4W5NA 2YNGA 2BE2A 4RG8A 3HVTA 2G8UA 4KPYA 3M8QA 1UAXA 4EZ9A 3OYEA 1SKRA 2RPIA 3VQAA 1MU2A 3V9UA 4PWDA 4CFAA 4O44A 1WAJA 3EZ5A 1I39A 1LWCA 1FKPA 2B4JA 3V9SA 1UOCA 1S1UA 4LSNA 4AHVA 3V4IA 4H8KA 5I3UA 4GW6A 3LWLA 2HNZA 1XHXA 4Q0BA 4B9NA 3V1RA 1U47A 3JYTA 1VSDA 4FJNA 3VQDA 3DLGA 3H08A 4I2PA 1SV5A 3AA4A 4I7FA 1TL3A 4NCGA 5FRNA 2G8IA 4DU3A 5D3GA 1XC9A 1TKXA 4FZZA 4CJRA 3CFRA 3LZJA 1JLFA 1HQEA 1D9FA 1RDDA 1YTAA 3AVGA 3I8DA 1HNIA 4CEBA 4CJWA 4B9TA 3PO4A 2EHGA 2ZD1A 1TKZA 3SNNA 4H4OA 4CF9A 1QSYA 2HHVA 4BE2A 3ZSRA 5SWMA 2R7YA 3V6DA 4BACA 4J2BA 4M3UA 1HYVA 3CM5A 2O4GA 1O1WA 3NAEA 3KKRA 4H4MA 4OKJA 4BDPA 2HNDA 2XY7A 3MECA 3PX0A 3HL8A 2X6SA 2QXFA 3ZSZA 5KRTA 1WSGA 1IH7A 2BDPA 3SYZA 2D0CA 1JL1A 1NK8A 4B8AB 4CK1A 1NK7A 4F3OA 2O4IA 3NFAA 4CFDA 4N56A 3QIPA 3ULDA 2Z1IA 2P1JA 3DLKA 2QKKA 3VA3A 4ELVA 4M42A 2X6NA 3QERA 4QAGA 2X78A 3AO4A 3ZCMA 4BWJA 4FXDA 1S1WA 3ZT3A 1RT6A 4KB1A 4YFUA 4KB0A 3ALYA 4O4GA 2XY6A 4DQRA 1REVA 3QNOA 1BQMA 1WAFA 4W5OA 5T7BA 3HP9A 1S5JA 4AHSA 3AVCA 1TKDA 4CJEA 4FM0A 4B9VA 4M41A 3QINA 3AA2A 1C1AA 5HRRA 2HB5A 3C95A 4FJGA 1K6YA 4CJUA 2IS3A 4DSIA 2Z1GA 4WE1A 3B6PA 1W9HA 4YNQA 1VSMA 1HJRA 3NE6A 2G8VA 4KFBA 5C25A 3RRGA 4FYDA 3AVLA 3L2VA 1YVUA 4E1MA 3OYGA 3M8RA 2W42A 4KI6A 4NCAA 2KFZA 1L3TA 5HRSA 4Z0UA 3CFPA 1ZBLA 1RBSA 1TL1A 4JLHA 3HVRA 4FLUA 4CGJA 2A1RA 4M3XA 3OYBA 3RR7A 1ASUA 3HJFA 2VWKA 2HNYA 3L2QA 2HHUA 2I5JA 2IAJA 4FW1A 3TAFA 1BI4B 1RT3A 3NDKA 2DFEA 3VA0A 4ELUA 4K8ZA 4FJXA 4RW6A 4DTRA 1WSEA 3S3OA 3L3UA 3SUQA 4RW9A 2HW3A 4G1QA 1D9DA 3VQ8A 1A5WA 2DFFA 1IKVA 1TAQA 1RBVA 4KTWA 1KSPA 4E0DA 3NH0A 2KZZA 3P1GA 2HHWA 1RBTA 4CEAA 3LPUA 3LP3A 1VSLA 4FZXC 1KVAA 1JKHA 1R0AA 3K58A 3QO9A 1LW0A 3LP2A 1RT5A 4IG3A 4DFPA 4QCLA 2YKNA 1RDBA 1S9GA 1U48A 3HO1A 4CHNA 4ICLA 4ZHRA 4N47A 2LSNA 2G8KA 1BL3A 3E01A 3T3FA 4B3OA 4FLVA 3DI6A 2G8HA 3VQ5A 3V1QA 3CQ8A 1S9EA 3AVHA 4OVLA 1BCMA 3OVNA 1S6QA 4RW7A 3KLHA 4Z4IA 1L5UA 1FKOA 4FJ8A 4HVJA 4B9SA 2HHXA 3TAGA 2OYQA 3NH1A 4DMNA 1EETA 3QNNA 3ZSYA 1TVRA 4CF0A 3IS9A 2FBXA 2B5JA 3MXJA 1RNHA 4C8KA 2QK9A 2YHAA 4F4KA 3M8SA 3AA3A 4OPKA 4Y1DA 1JL2A 1IKXA 1I3AA 1KLNA 1BIZA 1RTIA 1GOAA 3TAQA 2OPSA 3MXMA 4AHCA 3TAEA 3QEXA 5EU7A 3VQ6A 4CFBA 3ZSOA 2P5GA 2PZSA 4JRQA 4LH4A 2FBYA 3P83D 4CJ4A 3LAMA 3O3FA 3RTVA 3PY8A 2VG6A 4CHPA 4FM2A 3KD1E 3DOLA 3LP0A 3LANA 3PX6A 1UA0A 5C42A 5KGXA 3HM9A 4J2EA 4OJRA 4GVMA 4CEZA 1XI1A 3KK2A 3U3YA 3DLBA 2HVHA 4F2SA 4CF2A 5CYMA 2Y1JA 1RTJA 5CY4A 4DTMA 1BHLA 2P5OA 5E41A 3RMAA 4EP4A 2VG5A 4CGGA 3KD5E 3KLGA 1GOCA 4O5BA 3EY1A 4DLGA 1NKEA 2X74A 1SUQA 2G8WA 1LWFA 4FJMA 5CZ2A 1L3VA 3JSMA 2IC3A 3C6TA 4KO0A 4BDYA 4OLBA 4CHYA 3AA5X 3LPTA 4CECA 4Z4FA 1TKTA 2OPQA 3AVIA 1VK0A 1S1VA 3VN5A 4E7HA 1LAWA 3VQ7A 4C8OA 4DTSA 1WSIA 3O4NA 4Q5VA 4M3WA 1VSIA 4IBNA 4DTJA 4JRPA 3ISNC 3LZIA 4HUGA 3KLFA 2XY5A 5HLFA 4I9QA 1CZ9A 3SI6A 1RBRA 3ASMA 4FZYA 1NJXA 4J2DA 3THVA 2FBVA 1N6QA 3O3GA 2G8FA 1HYSA 3OYAA 4LD0A 3KKSA 2B6AA 2D0AA 4EP5A 3HT3A 4DFKA 4KI4A 1X1PA 4HHTA 2XY8A 3ZSWA 1CLQA 4KHYA 4Z4HA 2XO7A 4HUFA 3FFIA 2DTUA 4K8XA 5JS2A 1S1XA 1IKYA 5HBMA 3AVAA 3HPOA 4J2AA 1T7PA 3QEPA 3QETA 1QTMA 4Y1CA 3RMDA 4W5TA 2D0BA 4CF8A 1ZYQA 4FLXA 2ETJA 3WNGA 1TK5A 4KAZA 2HMIA 1S1TA 4FJJA 2KW4A 3G10A 3VQCA 4CGIA 1SL0A 4DF8A 2KFNA 3OYJA 4DQIA 2F8TA 4OLAA 1KCFA 4NCBA 4CESA 5KGWA 4DSFA 1J9AA 1D5AA 1Z25A 4CGHA 4LSLA 4E7JA 2NUBA 3CFOA 3SCXA 1NJWA 1C0TA 2E4LA 1JLGA 4FW2A 4RW4A 4E19A 1EP4A 1VSJA 4KHSA 3I0SA 4TSXA 5JS1A 3NGIA 4M3YA 2WONA 1G15A 3HYFA 4I2QA 4C8MA 2OPRA 3V9WA 3NH2A 5J2QA 4DFMA 3V9ZA 1LW2A 3K5LA 5HROA 3TARA 1HYZA 4CJKA 4FJHA 3LAKA 3SUNA 3HP6A 2YV0X 5FROA 3AV9A 4C8NA 1WNSA 3S9HA 4M3TA 3SV4A 3L2UA 4XIUA 1RDAA 4KRFA 4BWMA 4PUOA 2HHTA 1JXEA 3SQ4A 3CYMA 1BISA 4IFYA 1KRPA 2GUIA 1CXUA 2E6LA 4O55A 4ELTA 3U6FA 4KTZA 3K5NA 4DTOA 1B9DA 1QE1A 5CYQA 1RT7A 3VQ4A 4L8RB 4FVMA 4FJ5A 3D0PA 2Z1HA 4CEQA 1TK8A 3G0ZA 3ITHA 2ZE2A 4IDKA 1X9SA 3OYDA 1ZBIA 1ASWA 5HRNA 3OYMA 4W5RA 2YKMA 3M8PA 3O4QA 1N5YA 4QOZB 1FXXA 1KVCA 2ATQA 3MXIA 1IKWA 3KTQA 3MEEA 1CZBA 1EX4A 3AVJA 2FC0A 3DRPA 5J2NA 1HPZA 1VSEA 2A1SA 5KI6A 2DY4A 4CJVA 4DSEA 4C8LA 3HXMA 1SL2A 1B9FA 1DTTA 1FK9A 1BCOA 2OZMA 3NF6A 3F73A 4PY5A 1QHTA 4NYFA 2JGUA 1T8EA 3K59A 4CJLA 5J1EA 3SQ1A 4M3ZA 3OYKA 1S6PA 1Q8IA 4DTXA 3HSTB 3DLEA 1CXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGD A;  4DS5 A;  1RDC A;  4UQG A;  4LH5 A;  3BGR A;  1QSS A;  2QKB A;  1WLJ A;  4E89 A;  4DG1 A;  4Z4E A;  1Y97 A;  3ZSX A;  1C0U A;  2OZS A;  1JXB A;  1TGO A;  4CEO A;  3V1O A;  4FK4 A;  1JLQ A;  4KRE A;  4MFB A;  1A5X A;  2YNF A;  1LV5 A;  1XWL A;  5DK5 A;  4OKK A;  4IKF A;  2KZM A;  3KK1 A;  3NF7 A;  4JS4 A;  1NK4 A;  3D45 A;  3VQ9 A;  2JLE A;  3ZSQ A;  3CG7 A;  1RT2 A;  4CJQ A;  1TV6 A;  1DLO A;  3ZT2 A;  3KK3 A;  1Q9Y A;  4KKO A;  4OGE A;  4CGF A;  1VSF A;  3MAQ A;  3C6U A;  4KHQ A;  1WN7 A;  1U49 A;  1NK9 A;  1JLC A;  2YNI A;  3SUP A;  2RN2 A;  1LAV A;  1RBU A;  3K57 A;  4EZ6 A;  3VQQ A;  2IOC A;  3AO5 A;  2GV9 A;  4OKE A;  4M3R A;  4DSJ A;  2F8S A;  3CM6 A;  1Q9X A;  4NYN A;  3OYC A;  5FRM A;  4E7L A;  3MEG A;  1JLB A;  5J2P A;  2P51 A;  3AVK A;  3P5J A;  1Z26 A;  4KHN A;  3AVM A;  3QEI A;  1X9W A;  2BAN A;  4ZTJ A;  1J5O A;  4KTQ A;  3AVF A;  3NGY A;  4FCY A;  3PO5 A;  1RT4 A;  1C0M A;  3O3H A;  3AO2 A;  4LY7 A;  2KTQ A;  4F8R A;  4RW8 A;  3IRX A;  5FDL A;  2FBT A;  4AH9 A;  4CJP A;  4CIE A;  4BE1 A;  4FLY A;  1KFD A;  3V9X A;  5SZT A;  4FJL A;  2BGG A;  1ASV A;  1BQN A;  4CIF A;  4W5Q A;  4CHQ A;  3OS2 A;  4HCC A;  4I9L A;  4CFC A;  4DSK A;  4AHU A;  3UIQ A;  1C1C A;  1U4B A;  1NOZ A;  5HRP A;  3ZT4 A;  3K2P A;  3OS1 A;  2F96 A;  3WNF A;  4FJ7 A;  1VRT A;  3LP1 A;  3KLE A;  3KLI A;  2VWJ A;  1VRU A;  1WSJ A;  3TAM A;  3L2R A;  1BI4 A;  1TK0 A;  3WNE A;  3K5O A;  3NCI A;  1J54 A;  4DWI A;  3NF9 A;  5K14 A;  3SQ0 A;  4KHW A;  1W0H A;  4O0J A;  4FLT A;  1UA1 A;  3ZSV A;  3I0R A;  4CHO A;  3OYL A;  4FJI A;  1WSH A;  3AVN A;  3L3V A;  4JS5 A;  3PV8 A;  4N76 A;  1RTH A;  3TAN A;  2PYJ A;  4FK2 A;  2AJQ A;  4AHT A;  4E3S A;  4FLW A;  3QEW A;  4CEF A;  3DOK A;  3IAY A;  4CJ3 A;  1SKS A;  1EXQ A;  2DFH A;  2XHB A;  3OJU A;  2Q3S A;  3TAB A;  2PY5 A;  1J53 A;  2RF2 A;  4B9M A;  3DMJ A;  3S3M A;  4ID1 A;  3TI0 A;  4CCH A;  2ZQB A;  4DTP A;  2E6M A;  3VQP A;  4E7K A;  4BDZ A;  1RT1 A;  2KQ2 A;  4DTU A;  4DTN A;  1IG9 A;  4AHR A;  4DU1 A;  4Z4G A;  4IG0 A;  2VG7 A;  3RMC A;  3V81 A;  1RTD A;  1QSL A;  1C6V A;  1ZBF A;  3DRR A;  5HP1 A;  2PYL A;  1TAU A;  3B6O A;  3TR8 A;  2IGI A;  3DLH A;  2EX3 A;  3HPG A;  4CJT A;  2OPP A;  1YTU A;  3VQE A;  1L3U A;  1ZBH A;  1F21 A;  1HNV A;  3BDP A;  3TAP A;  1HQU A;  1WSF A;  3QES A;  1VSH A;  3QLH A;  2D5R A;  1RCH A;  4CJ5 A;  3T19 A;  1NJY A;  2HHS A;  1KTQ A;  4DF4 A;  4B08 A;  1JLA A;  3C94 A;  1KFS A;  4CED A;  3ZT0 A;  4CE9 A;  3OYN A;  4DFJ A;  3AVB A;  4ZTF A;  2HVI A;  3S3N A;  3DM2 A;  4IFV A;  4E7I A;  4FJ9 A;  3AO1 A;  4CJS A;  4FM1 A;  4DU4 A;  3HK2 A;  3WNH A;  4CER A;  2YNH A;  1SKW A;  1UWB A;  4B8C A;  2RKI A;  1NOY A;  4ID5 A;  1NKC A;  1NK5 A;  1D8Y A;  4BE0 A;  4DQS A;  2XRI A;  1A5V A;  1YT3 A;  2IDO A;  1KVB A;  3OS0 A;  2OA8 A;  1C1B A;  4CK2 A;  5KTQ A;  3OYF A;  4CEE A;  1T03 A;  1L3S A;  5KRS A;  4F3T A;  1HRH A;  5DMR A;  3SUO A;  1XHZ A;  4DS4 A;  1NJZ A;  3PX4 A;  4R5P A;  3LWM A;  1BIU A;  1X9M A;  1B92 A;  4HCB A;  1U04 A;  1BGX T;  4CF1 A;  3KIO A;  4N5S A;  3RRH A;  1QS4 A;  2HHQ A;  4M45 A;  4DSL A;  3L2W A;  4FJK A;  3QEV A;  4HTU A;  2WOM A;  4AIL C;  3SPZ A;  1NK0 A;  1EKE A;  4B9U A;  4KHU A;  3PUF A;  1RIL A;  2Y1I A;  3RR8 A;  3RMB A;  4DQP A;  3DYA A;  5I42 A;  4F2R A;  3K5M A;  3ZT1 A;  1IO2 A;  3NF8 A;  4PA1 A;  4FLZ A;  4CK3 A;  3DRS A;  4FK0 A;  4GMJ B;  3T1A A;  3OYI A;  3KJV A;  1U45 A;  1ITG A;  1T05 A;  3NGZ A;  3DLR A;  1DTQ A;  2YHB A;  1JLE A;  3MED A;  2GBZ A;  4N41 A;  3RWU A;  1HMV A;  4E1N A;  4DQQ A;  3F9K A;  4PQU A;  4CJF A;  4KV8 A;  1SL1 A;  1NK6 A;  3IG1 A;  4OGC A;  3L8B A;  4CHZ A;  3SPY A;  3U3G A;  3VQB A;  3OJS A;  3A2F A;  3NBP A;  1ZBU A;  4DLE A;  4O0I A;  1LWE A;  4MQ3 A;  5CZ1 A;  4CIG A;  1QQC A;  4HUE A;  3TWH A;  3AO3 A;  3SV3 A;  3QIO A;  5C24 A;  1VSK A;  3SQ2 A;  1KLM A;  2Z1J A;  4Z4C A;  3LDS A;  3SJJ A;  3LAL A;  3SZ2 A;  3EYZ A;  2ITG A;  1NKB A;  3HPH A;  4B9L A;  3OYH A;  1GOB A;  5J2M A;  4OPJ A;  3NHG A;  3OY9 A;  4W5N A;  2YNG A;  2BE2 A;  4RG8 A;  3HVT A;  2G8U A;  4KPY A;  3M8Q A;  1UAX A;  4EZ9 A;  3OYE A;  1SKR A;  2RPI A;  3VQA A;  1MU2 A;  3V9U A;  4PWD A;  4CFA A;  4O44 A;  1WAJ A;  3EZ5 A;  1I39 A;  1LWC A;  1FKP A;  2B4J A;  3V9S A;  1UOC A;  1S1U A;  4LSN A;  4AHV A;  3V4I A;  4H8K A;  5I3U A;  4GW6 A;  3LWL A;  2HNZ A;  1XHX A;  4Q0B A;  4B9N A;  3V1R A;  1U47 A;  3JYT A;  1VSD A;  4FJN A;  3VQD A;  3DLG A;  3H08 A;  4I2P A;  1SV5 A;  3AA4 A;  4I7F A;  1TL3 A;  4NCG A;  5FRN A;  2G8I A;  4DU3 A;  5D3G A;  1XC9 A;  1TKX A;  4FZZ A;  4CJR A;  3CFR A;  3LZJ A;  1JLF A;  1HQE A;  1D9F A;  1RDD A;  1YTA A;  3AVG A;  3I8D A;  1HNI A;  4CEB A;  4CJW A;  4B9T A;  3PO4 A;  2EHG A;  2ZD1 A;  1TKZ A;  3SNN A;  4H4O A;  4CF9 A;  1QSY A;  2HHV A;  4BE2 A;  3ZSR A;  5SWM A;  2R7Y A;  3V6D A;  4BAC A;  4J2B A;  4M3U A;  1HYV A;  3CM5 A;  2O4G A;  1O1W A;  3NAE A;  3KKR A;  4H4M A;  4OKJ A;  4BDP A;  2HND A;  2XY7 A;  3MEC A;  3PX0 A;  3HL8 A;  2X6S A;  2QXF A;  3ZSZ A;  5KRT A;  1WSG A;  1IH7 A;  2BDP A;  3SYZ A;  2D0C A;  1JL1 A;  1NK8 A;  4B8A B;  4CK1 A;  1NK7 A;  4F3O A;  2O4I A;  3NFA A;  4CFD A;  4N56 A;  3QIP A;  3ULD A;  2Z1I A;  2P1J A;  3DLK A;  2QKK A;  3VA3 A;  4ELV A;  4M42 A;  2X6N A;  3QER A;  4QAG A;  2X78 A;  3AO4 A;  3ZCM A;  4BWJ A;  4FXD A;  1S1W A;  3ZT3 A;  1RT6 A;  4KB1 A;  4YFU A;  4KB0 A;  3ALY A;  4O4G A;  2XY6 A;  4DQR A;  1REV A;  3QNO A;  1BQM A;  1WAF A;  4W5O A;  5T7B A;  3HP9 A;  1S5J A;  4AHS A;  3AVC A;  1TKD A;  4CJE A;  4FM0 A;  4B9V A;  4M41 A;  3QIN A;  3AA2 A;  1C1A A;  5HRR A;  2HB5 A;  3C95 A;  4FJG A;  1K6Y A;  4CJU A;  2IS3 A;  4DSI A;  2Z1G A;  4WE1 A;  3B6P A;  1W9H A;  4YNQ A;  1VSM A;  1HJR A;  3NE6 A;  2G8V A;  4KFB A;  5C25 A;  3RRG A;  4FYD A;  3AVL A;  3L2V A;  1YVU A;  4E1M A;  3OYG A;  3M8R A;  2W42 A;  4KI6 A;  4NCA A;  2KFZ A;  1L3T A;  5HRS A;  4Z0U A;  3CFP A;  1ZBL A;  1RBS A;  1TL1 A;  4JLH A;  3HVR A;  4FLU A;  4CGJ A;  2A1R A;  4M3X A;  3OYB A;  3RR7 A;  1ASU A;  3HJF A;  2VWK A;  2HNY A;  3L2Q A;  2HHU A;  2I5J A;  2IAJ A;  4FW1 A;  3TAF A;  1BI4 B;  1RT3 A;  3NDK A;  2DFE A;  3VA0 A;  4ELU A;  4K8Z A;  4FJX A;  4RW6 A;  4DTR A;  1WSE A;  3S3O A;  3L3U A;  3SUQ A;  4RW9 A;  2HW3 A;  4G1Q A;  1D9D A;  3VQ8 A;  1A5W A;  2DFF A;  1IKV A;  1TAQ A;  1RBV A;  4KTW A;  1KSP A;  4E0D A;  3NH0 A;  2KZZ A;  3P1G A;  2HHW A;  1RBT A;  4CEA A;  3LPU A;  3LP3 A;  1VSL A;  4FZX C;  1KVA A;  1JKH A;  1R0A A;  3K58 A;  3QO9 A;  1LW0 A;  3LP2 A;  1RT5 A;  4IG3 A;  4DFP A;  4QCL A;  2YKN A;  1RDB A;  1S9G A;  1U48 A;  3HO1 A;  4CHN A;  4ICL A;  4ZHR A;  4N47 A;  2LSN A;  2G8K A;  1BL3 A;  3E01 A;  3T3F A;  4B3O A;  4FLV A;  3DI6 A;  2G8H A;  3VQ5 A;  3V1Q A;  3CQ8 A;  1S9E A;  3AVH A;  4OVL A;  1BCM A;  3OVN A;  1S6Q A;  4RW7 A;  3KLH A;  4Z4I A;  1L5U A;  1FKO A;  4FJ8 A;  4HVJ A;  4B9S A;  2HHX A;  3TAG A;  2OYQ A;  3NH1 A;  4DMN A;  1EET A;  3QNN A;  3ZSY A;  1TVR A;  4CF0 A;  3IS9 A;  2FBX A;  2B5J A;  3MXJ A;  1RNH A;  4C8K A;  2QK9 A;  2YHA A;  4F4K A;  3M8S A;  3AA3 A;  4OPK A;  4Y1D A;  1JL2 A;  1IKX A;  1I3A A;  1KLN A;  1BIZ A;  1RTI A;  1GOA A;  3TAQ A;  2OPS A;  3MXM A;  4AHC A;  3TAE A;  3QEX A;  5EU7 A;  3VQ6 A;  4CFB A;  3ZSO A;  2P5G A;  2PZS A;  4JRQ A;  4LH4 A;  2FBY A;  3P83 D;  4CJ4 A;  3LAM A;  3O3F A;  3RTV A;  3PY8 A;  2VG6 A;  4CHP A;  4FM2 A;  3KD1 E;  3DOL A;  3LP0 A;  3LAN A;  3PX6 A;  1UA0 A;  5C42 A;  5KGX A;  3HM9 A;  4J2E A;  4OJR A;  4GVM A;  4CEZ A;  1XI1 A;  3KK2 A;  3U3Y A;  3DLB A;  2HVH A;  4F2S A;  4CF2 A;  5CYM A;  2Y1J A;  1RTJ A;  5CY4 A;  4DTM A;  1BHL A;  2P5O A;  5E41 A;  3RMA A;  4EP4 A;  2VG5 A;  4CGG A;  3KD5 E;  3KLG A;  1GOC A;  4O5B A;  3EY1 A;  4DLG A;  1NKE A;  2X74 A;  1SUQ A;  2G8W A;  1LWF A;  4FJM A;  5CZ2 A;  1L3V A;  3JSM A;  2IC3 A;  3C6T A;  4KO0 A;  4BDY A;  4OLB A;  4CHY A;  3AA5 X;  3LPT A;  4CEC A;  4Z4F A;  1TKT A;  2OPQ A;  3AVI A;  1VK0 A;  1S1V A;  3VN5 A;  4E7H A;  1LAW A;  3VQ7 A;  4C8O A;  4DTS A;  1WSI A;  3O4N A;  4Q5V A;  4M3W A;  1VSI A;  4IBN A;  4DTJ A;  4JRP A;  3ISN C;  3LZI A;  4HUG A;  3KLF A;  2XY5 A;  5HLF A;  4I9Q A;  1CZ9 A;  3SI6 A;  1RBR A;  3ASM A;  4FZY A;  1NJX A;  4J2D A;  3THV A;  2FBV A;  1N6Q A;  3O3G A;  2G8F A;  1HYS A;  3OYA A;  4LD0 A;  3KKS A;  2B6A A;  2D0A A;  4EP5 A;  3HT3 A;  4DFK A;  4KI4 A;  1X1P A;  4HHT A;  2XY8 A;  3ZSW A;  1CLQ A;  4KHY A;  4Z4H A;  2XO7 A;  4HUF A;  3FFI A;  2DTU A;  4K8X A;  5JS2 A;  1S1X A;  1IKY A;  5HBM A;  3AVA A;  3HPO A;  4J2A A;  1T7P A;  3QEP A;  3QET A;  1QTM A;  4Y1C A;  3RMD A;  4W5T A;  2D0B A;  4CF8 A;  1ZYQ A;  4FLX A;  2ETJ A;  3WNG A;  1TK5 A;  4KAZ A;  2HMI A;  1S1T A;  4FJJ A;  2KW4 A;  3G10 A;  3VQC A;  4CGI A;  1SL0 A;  4DF8 A;  2KFN A;  3OYJ A;  4DQI A;  2F8T A;  4OLA A;  1KCF A;  4NCB A;  4CES A;  5KGW A;  4DSF A;  1J9A A;  1D5A A;  1Z25 A;  4CGH A;  4LSL A;  4E7J A;  2NUB A;  3CFO A;  3SCX A;  1NJW A;  1C0T A;  2E4L A;  1JLG A;  4FW2 A;  4RW4 A;  4E19 A;  1EP4 A;  1VSJ A;  4KHS A;  3I0S A;  4TSX A;  5JS1 A;  3NGI A;  4M3Y A;  2WON A;  1G15 A;  3HYF A;  4I2Q A;  4C8M A;  2OPR A;  3V9W A;  3NH2 A;  5J2Q A;  4DFM A;  3V9Z A;  1LW2 A;  3K5L A;  5HRO A;  3TAR A;  1HYZ A;  4CJK A;  4FJH A;  3LAK A;  3SUN A;  3HP6 A;  2YV0 X;  5FRO A;  3AV9 A;  4C8N A;  1WNS A;  3S9H A;  4M3T A;  3SV4 A;  3L2U A;  4XIU A;  1RDA A;  4KRF A;  4BWM A;  4PUO A;  2HHT A;  1JXE A;  3SQ4 A;  3CYM A;  1BIS A;  4IFY A;  1KRP A;  2GUI A;  1CXU A;  2E6L A;  4O55 A;  4ELT A;  3U6F A;  4KTZ A;  3K5N A;  4DTO A;  1B9D A;  1QE1 A;  5CYQ A;  1RT7 A;  3VQ4 A;  4L8R B;  4FVM A;  4FJ5 A;  3D0P A;  2Z1H A;  4CEQ A;  1TK8 A;  3G0Z A;  3ITH A;  2ZE2 A;  4IDK A;  1X9S A;  3OYD A;  1ZBI A;  1ASW A;  5HRN A;  3OYM A;  4W5R A;  2YKM A;  3M8P A;  3O4Q A;  1N5Y A;  4QOZ B;  1FXX A;  1KVC A;  2ATQ A;  3MXI A;  1IKW A;  3KTQ A;  3MEE A;  1CZB A;  1EX4 A;  3AVJ A;  2FC0 A;  3DRP A;  5J2N A;  1HPZ A;  1VSE A;  2A1S A;  5KI6 A;  2DY4 A;  4CJV A;  4DSE A;  4C8L A;  3HXM A;  1SL2 A;  1B9F A;  1DTT A;  1FK9 A;  1BCO A;  2OZM A;  3NF6 A;  3F73 A;  4PY5 A;  1QHT A;  4NYF A;  2JGU A;  1T8E A;  3K59 A;  4CJL A;  5J1E A;  3SQ1 A;  4M3Z A;  3OYK A;  1S6P A;  1Q8I A;  4DTX A;  3HST B;  3DLE A;  1CXQ A; 
#chains in the Genus database with same CATH topology
 2GX9 A;  1JJ2 M;  4IOA L;  4BR7 A;  5BRD A;  4DG1 A;  3UE5 A;  5C12 A;  1NU0 A;  1C0U A;  2OZS A;  4CEO A;  3V1O A;  1W2B M;  1Q82 O;  3DAW A;  5AZJ B;  1CZA N;  2P9P A;  3ZSQ A;  3CG7 A;  3L6Q A;  1RT2 A;  3M5R A;  4KKO A;  4OGE A;  1VSF A;  4ISG A;  3ZX2 A;  1MDU B;  1XC3 A;  1RBU A;  2IOC A;  3AO5 A;  2GV9 A;  1OVQ A;  4NYN A;  4E7L A;  5J2P A;  2P9U A;  3AVM A;  1X9W A;  2BAN A;  4ZTJ A;  3BUZ B;  3G4S N;  1C0M A;  2F4V K;  3AO2 A;  3U8X A;  5AQN A;  4BE1 A;  3ZX0 A;  5AZI A;  2NRT A;  5SZT A;  4CIF A;  4MDA A;  4JK8 A;  2P9N B;  5M1Q A;  4DV6 K;  1U4B A;  2F96 A;  4WFN L;  1VRT A;  3KLE A;  1YJ9 N;  2E1Z A;  3CQY A;  2W41 A;  4DWI A;  3O6W A;  2NLX A;  3EEQ A;  1W0H A;  4PKI A;  4JK7 A;  4FLT A;  3ZSV A;  1WSH A;  3AVN A;  1RTH A;  2AJQ A;  4FLW A;  4CJ7 A;  3N4P A;  4CJ3 A;  1EXQ A;  3HTV A;  2XHB A;  1J53 A;  4B9M A;  4CCH A;  2ZQB A;  4BRD A;  2UXC K;  1IG9 A;  2VG7 A;  1QSL A;  3DRR A;  5HP1 A;  3Q7B A;  2IGI A;  3IFR A;  3KZB A;  3RSE A;  3DLH A;  3HPG A;  1YTU A;  3G6E N;  1HNV A;  5AQI A;  3CHW A;  3QLH A;  2D5R A;  4CJ5 A;  3IUC A;  2FF3 B;  3VEY A;  1NJY A;  3PIO L;  4B08 A;  3CER A;  3CCL N;  1KFS A;  2HVI A;  3ZT0 A;  1NG9 A;  2IIR A;  3DM2 A;  3AO1 A;  1YXQ A;  4B1Y B;  4LF6 K;  3WNH A;  3JS6 A;  4MO5 A;  2CH5 A;  1D8Y A;  4DQS A;  1J6Z A;  2IDO A;  3OS0 A;  3R8E A;  1C1B A;  1T03 A;  1HRH A;  2VWB A;  4DS4 A;  4GKK K;  4HCB A;  1BGX T;  5LMU K;  3CCS N;  3RRH A;  1QS4 A;  4M45 A;  4DSL A;  2ZJR L;  1Q81 O;  4HTU A;  3SPZ A;  3D2E B;  1NK0 A;  2KKZ A;  3PSF A;  4XH1 A;  3ULE A;  2VGM A;  1RIL A;  4DQP A;  4F2R A;  3NF8 A;  4EHT A;  4PA1 A;  2QTD A;  3DRS A;  3KJV A;  1DTQ A;  3CJC A;  3ENO A;  2GBZ A;  1T6D A;  4N41 A;  1HMV A;  4E1N A;  4DR7 K;  4JKB A;  5EXW A;  1NK6 A;  2AP1 A;  3FZF A;  3QIO A;  3SJJ A;  4YY3 K;  2FF6 A;  3SZ2 A;  4LF5 K;  2YHY A;  4B9L A;  3G25 A;  1DKG D;  3CXC M;  4OPJ A;  3NHG A;  1JCG A;  1HX1 A;  3OY9 A;  4W5N A;  4OX9 K;  4KPY A;  3M8Q A;  1UAX A;  1NJI O;  3MN5 A;  3V9U A;  4CFA A;  1WAJ A;  5AR0 A;  4DR1 K;  1LWC A;  3V9S A;  4LSN A;  4BVP A;  4K25 A;  4CZM A;  3V1R A;  4FJN A;  3DLG A;  5FPN A;  1SV5 A;  5FRN A;  4AM7 A;  3EE9 A;  5JLH A;  4JKE A;  2UU9 K;  4H0V B;  3OTO K;  3PIP L;  4B3S K;  4JD2 B;  1T44 A;  3GBT A;  4GV6 A;  4C23 A;  3I8D A;  3CCU N;  4K41 A;  4BE2 A;  1RGI A;  3MWT A;  3CC4 N;  3KKR A;  4H4M A;  2HND A;  3HL8 A;  2ZM6 K;  5KRT A;  2QXF A;  3ENB A;  4H0P A;  1WSG A;  3U9D A;  5IT9 O;  2O4I A;  3MX5 A;  1HKG A;  3ULD A;  2QKK A;  3VA3 A;  1HLU A;  3SAF A;  4CZL A;  4FXD A;  4MDB A;  3ZT3 A;  5AFU A;  3LL3 A;  3RVC A;  2CH6 A;  4DQR A;  1BQM A;  3HP9 A;  3CET A;  4JI1 K;  3C6H A;  4PHT X;  4B9V A;  4M41 A;  4JI2 K;  4DR5 K;  1K6Y A;  3L0Q A;  2IS3 A;  3DWL A;  4CJU A;  4WE1 A;  3B6P A;  3ZEU B;  3RRG A;  3AVL A;  3L2V A;  3M8R A;  5AZI B;  3ATU A;  4Z0U A;  1RBS A;  1TL1 A;  2QWM A;  3HVR A;  4BRL A;  1V4T A;  2FLO A;  3BZK A;  4A5B A;  2HF4 A;  2I5J A;  3SLC A;  4FW1 A;  3TAF A;  2HBK A;  3VEW A;  1RT3 A;  3NDK A;  2DFE A;  1YIT N;  1E3M A;  5AQK A;  4H5V A;  3SUQ A;  4RW9 A;  1H1V A;  2QWN A;  4CEA A;  3LPU A;  4B1X B;  1VSL A;  1BWF O;  1KVA A;  2Q36 A;  5E26 A;  1JKH A;  2QI2 A;  1LW0 A;  3LP2 A;  4IG3 A;  5EVZ A;  1LOT B;  2QW9 A;  3CQX A;  4ICL A;  1BL3 A;  4BGB A;  2RHK A;  3DI6 A;  1QZ5 A;  3K9K A;  4Z4I A;  4RW7 A;  1VQ8 N;  3F2K A;  1L5U A;  1FKO A;  5BPN A;  4FJ8 A;  1GLL O;  3P4I A;  2DPN A;  5BPM A;  2FBX A;  3MXJ A;  1RNH A;  4FVU A;  1NGA A;  4YDU C;  5KPR A;  4MLH A;  4OPK A;  4GNI A;  3H45 C;  1RTI A;  4JKH A;  5AQG A;  3HBT A;  3TAQ A;  5M1O A;  2F7T A;  5GAE P;  1GLA G;  1YF5 L;  2E2N A;  3VQ6 A;  4CFB A;  5GAH P;  1P90 A;  4LH4 A;  3O3F A;  2Q0R A;  3VEO A;  3TSP A;  5C42 A;  3HM9 A;  4OJR A;  2VGN A;  4CF2 A;  5CY4 A;  4DTM A;  5E41 A;  3RMA A;  3UKU A;  4EP4 A;  4CZH A;  1LCU A;  3KLG A;  1GOC A;  4O5B A;  4DLG A;  1NKE A;  1SUQ A;  2PBD A;  2AA4 A;  4WQ4 A;  1V4S A;  2V52 B;  4BDY A;  1XMO K;  5KPT A;  2GEL A;  4LFA K;  1S1V A;  5AQO A;  3VEX A;  1M90 O;  3O4N A;  3O5B A;  4IOC L;  2UXB K;  2XY5 A;  1CZ9 A;  4CZJ A;  4FZY A;  4J2D A;  2NRW A;  2FBV A;  1VQL N;  1N6Q A;  3VF2 A;  2A40 A;  2G8F A;  1HYS A;  3LDL A;  4LD0 A;  2B6A A;  4EP5 A;  5A2Q O;  3HT3 A;  4DFK A;  4CZF A;  4IXC A;  1BUP A;  2XY8 A;  4LF7 K;  1N32 K;  4Z4H A;  1X3N A;  4K8X A;  2FSN A;  4H0Y B;  3GDQ A;  3QET A;  2D0B A;  3TTD A;  4KAZ A;  3MN9 A;  4IFE A;  2HMI A;  1SL0 A;  4YOR A;  4DF8 A;  1Z25 A;  4LSL A;  3D2F B;  1NJW A;  2O8C B;  4E19 A;  2GTD A;  2YX6 A;  5JS1 A;  2WON A;  3CMA N;  4C8M A;  4JKC A;  3K5L A;  3SUN A;  3HP6 A;  4YOW A;  3AV9 A;  4C8N A;  3S9H A;  1YHQ N;  1NMD A;  3L2U A;  4XIU A;  1RDA A;  4BR0 A;  1GLD G;  3SQ4 A;  3CYM A;  4IFY A;  1KRP A;  5C0Y A;  4BR4 A;  4KTZ A;  1XQS C;  5CYQ A;  4FWR A;  2Z1H A;  3M3Z A;  3ITH A;  4JKG A;  1X9S A;  5E84 A;  5HRN A;  5M1K A;  1EWQ A;  2YKM A;  3O4Q A;  4QOZ B;  1FXX A;  2E2Q A;  3KTQ A;  2D1K A;  1EX4 A;  5J2N A;  1HPZ A;  4DV7 K;  1HPM A;  2DY4 A;  4NXN K;  3HXM A;  4BQZ A;  1FK9 A;  4QS9 A;  1BCO A;  3NF6 A;  4JKF A;  4PY5 A;  1QHT A;  4NYF A;  1T8E A;  2FSJ A;  3K59 A;  3SQ1 A;  5BN9 A;  1MWM A;  1S6P A;  4DFP A;  3HST B;  3QER A;  3DLE A;  1IJJ A;  4DS5 A;  1KC8 O;  1QSS A;  2QKB A;  5LY3 A;  4BRI A;  4PKH A;  1Y97 A;  3A5L C;  1P8Z A;  4KRE A;  4MFB A;  2YNF A;  5LJV A;  4DR6 K;  2F9W A;  5DK5 A;  4JS4 A;  2JLE A;  2P9S A;  5AQF A;  4WFB L;  1TV6 A;  1Q9Y A;  2HHH K;  3C6U A;  1U49 A;  1JLC A;  2YNI A;  1S22 A;  3CM6 A;  2A3Z A;  2ZJP L;  4V19 S;  2P51 A;  2QWQ A;  1Z26 A;  5AQS A;  3VER A;  3AVF A;  3JXU A;  5FDL A;  3V9X A;  4IZ9 A;  5C2D A;  1ASV A;  4HCC A;  3O1B A;  3LM2 A;  4XH4 A;  1NOZ A;  5AQR A;  1M1K O;  3K2P A;  3OS1 A;  1YJN N;  3THX B;  1WSJ A;  3TAM A;  3I55 N;  3NCI A;  1MA9 B;  5K14 A;  3VF6 A;  2UUB K;  4KHW A;  4O0J A;  1UA1 A;  3N4Q A;  3PV8 A;  3TAN A;  2PYJ A;  3QEW A;  3DOK A;  4CBU A;  3IAY A;  4FWN A;  3CJA A;  3OJU A;  2PY5 A;  3O08 A;  1OH6 A;  4ID1 A;  4DV3 K;  3CCQ N;  3VQP A;  4A62 A;  4BDZ A;  2V7Z A;  4JNE A;  4DTN A;  4AHR A;  3QIC A;  4Z4G A;  1OH5 A;  1C6V A;  3B6O A;  3TR8 A;  2EX3 A;  3TSU A;  3VQE A;  1ZBH A;  3K9J A;  4AQY K;  1HQU A;  3QES A;  1RFQ A;  4BRO A;  3T19 A;  3C94 A;  4X64 K;  2W6L A;  4ZTF A;  3FGU A;  4CJS A;  4BY9 C;  4FJ9 A;  4FM1 A;  3HK2 A;  2YNH A;  2D0P A;  3MN7 A;  1SKW A;  1UWB A;  2RKI A;  1KAZ A;  4K42 A;  3O9S A;  2XRI A;  4LC9 B;  5AQZ A;  2OA8 A;  4BG9 A;  4F3T A;  5KRS A;  5DMR A;  1VQ4 N;  1XHZ A;  3LWM A;  1BIU A;  4O8K A;  1B92 A;  1X9M A;  3AAP A;  4CF1 A;  2Q2R A;  4WCE L;  4IEE A;  4JI6 K;  2H3G X;  3KVG A;  4IEI A;  1N33 K;  4KHU A;  2Y1I A;  3RR8 A;  3K5M A;  1IO2 A;  4FLZ A;  4B3R K;  4QS8 A;  3GL1 A;  1ITG A;  1T05 A;  3NGZ A;  3DLR A;  1QQO A;  4LF9 K;  4CJF A;  4OGC A;  3L8B A;  4CHZ A;  1K73 O;  1K8K A;  1ZBU A;  3OW2 M;  4CIG A;  1QQC A;  3SV3 A;  2WBN A;  5I9E B;  3KWG A;  2E2O A;  2ITG A;  1NKB A;  3HM8 A;  3QFP A;  2HST A;  3WXL A;  3PSI A;  3I8B A;  2RPI A;  3NVM A;  4Y0W A;  1IBK K;  4O44 A;  3EZ5 A;  3J7Y P;  1I39 A;  2O8D A;  3HOS A;  4DKW A;  3QFU A;  1S1U A;  2ZGY A;  3V4I A;  2ITM A;  4JKG B;  3F5T A;  3CD6 N;  3FZL A;  4I2P A;  4I7F A;  4NCG A;  3MX2 A;  4DR4 K;  3VET A;  4DU3 A;  4CD1 A;  3CFR A;  3LZJ A;  4DV0 K;  1JLF A;  1D9F A;  3MN6 A;  3PO4 A;  2ZD1 A;  2HHV A;  4CF9 A;  3DXK A;  3ZSR A;  3J8A A;  2R7Y A;  5GIP A;  4J2B A;  4M3U A;  4UY8 O;  3FLC O;  3A0I X;  1O1W A;  3NAE A;  4BDP A;  3ZSZ A;  3W0L A;  3SYZ A;  2D0C A;  5GAG P;  1JL1 A;  4B8A B;  4BRA A;  2GWK A;  4N56 A;  3QIP A;  2P1J A;  3SAH A;  1QQM A;  4ELV A;  5AQT A;  4BRF A;  1BDG A;  1IG8 A;  4YFU A;  1S3X A;  3E9P A;  1QQN A;  4W5O A;  4IJA A;  3H3N O;  1S5J A;  3HRG A;  2NZT A;  3C7N A;  3AA2 A;  5HRR A;  2HB5 A;  2YI1 A;  1ILY A;  4AM6 A;  2Z1G A;  4DSI A;  4YNQ A;  1W9H A;  1N36 K;  5LL6 Z;  3WXJ A;  1HJR A;  1SZ2 A;  2G8V A;  1D4X A;  3O80 A;  2ASO A;  3ID6 A;  4E1M A;  2W42 A;  3QBX A;  4NCA A;  2E2P A;  2WC9 A;  5ADX H;  1L3T A;  5HRS A;  1ZBL A;  4Z94 A;  4JLH A;  3IDH A;  5JVH L;  3BZC A;  4M3X A;  3OYB A;  3RR7 A;  3HJF A;  2HHU A;  1OKJ A;  3O1W A;  3LM9 A;  2HBJ A;  3WXK A;  4ELU A;  4DTR A;  3E1Y A;  3S3O A;  4G1Q A;  2DFF A;  2I7N A;  4KTW A;  4B3M K;  4E0D A;  2KZZ A;  3P1G A;  3BY5 A;  1O13 A;  4M7X A;  4O5F A;  4A57 A;  3CIP A;  1VQ5 N;  3QO9 A;  4R79 A;  2YKN A;  3VEN A;  3EE8 A;  3I33 A;  4FOI A;  3HO1 A;  3J7A P;  5AQH A;  2G8K A;  4B3O A;  5AQX A;  4A59 A;  2J4R A;  5MLC Q;  2G8H A;  3VQ5 A;  3V1Q A;  1S9E A;  4OVL A;  2A5X A;  3OVN A;  3KLH A;  2E1Y A;  4DR2 K;  3TAG A;  2OYQ A;  1KQS M;  4BRH A;  4DMN A;  3ZSY A;  1TVR A;  5GIO A;  2YHA A;  2IVO A;  3M8S A;  3AA3 A;  1I3A A;  1BIZ A;  1GOA A;  4PKG A;  4WQ4 C;  2OPS A;  2P9K B;  3QEX A;  3FZM A;  3ZSO A;  2PZS A;  4CJ4 A;  2VG6 A;  3LP0 A;  1UA0 A;  4J2E A;  2EWS A;  1XI1 A;  3U3Y A;  2HBM A;  3VF4 A;  2P5O A;  1BHL A;  3J7Z O;  3F9M A;  3KD5 E;  4ILH A;  5KQ8 A;  2G8W A;  1LWF A;  3THY A;  5CZ2 A;  3JSM A;  2IC3 A;  4KO0 A;  1FJG K;  1BU6 O;  2Q0U A;  1VK0 A;  4E7H A;  2O8B A;  1LAW A;  3VQ7 A;  3CJ9 A;  3WEE B;  4C8O A;  3WUH A;  4DTS A;  4B1U B;  5IWA K;  1VSI A;  4DTJ A;  4C1N K;  5HLF A;  2O8E B;  4I9Q A;  3SI6 A;  3ASM A;  1K9M O;  4H5W A;  1N8R O;  2PFU A;  1HUX A;  1YAG A;  1OH7 A;  2D0A A;  3DXM A;  3WT0 A;  2XO7 A;  4C1N I;  3T1H K;  5JS2 A;  2P9P B;  1K8K B;  5HBM A;  4JI0 K;  4J2A A;  1T7P A;  2YHX A;  1QTM A;  4X66 K;  4Y1C A;  3RMD A;  3LDN A;  2BH1 A;  1ZYQ A;  2ETJ A;  1S1T A;  4FJJ A;  2KFN A;  1HR0 K;  4J8F A;  1SQK A;  2P9U B;  3FZH A;  1J9A A;  2V7Y A;  5AQU A;  4CGH A;  2NUB A;  3CFO A;  4E7J A;  1C0T A;  1JLG A;  4FW2 A;  3TTC A;  1VSJ A;  4KHS A;  3R3L A;  1KD1 O;  1XUP O;  1G15 A;  5AQM A;  3A5O C;  4I2Q A;  3V9W A;  5J2Q A;  3I56 N;  5HRO A;  4FJH A;  4NXM K;  3LAK A;  2YV0 X;  4M3T A;  3SBT A;  1WNS A;  3M1F A;  2BTF A;  3SV4 A;  3EKS A;  1XNR K;  2ZJQ L;  1OVY A;  4GKJ K;  4KBO A;  3GE1 A;  3U6F A;  4DTO A;  1B9D A;  1S72 N;  5AJ3 K;  4DV4 K;  4FJ5 A;  4FWO A;  3DLL L;  3DXK B;  3OYD A;  3VGK A;  5JVG L;  4W5R A;  3M8P A;  1NM1 A;  2ATQ A;  3H46 O;  3ZLJ A;  3MEE A;  5CE3 A;  2A1S A;  1ESV A;  4C8L A;  1SL2 A;  4A2A A;  4BRQ A;  5AQQ A;  3AAQ A;  5F1X A;  1GLB G;  4CJL A;  2KLA A;  3RSE B;  3P39 A;  3HI0 A;  4DTX A;  1E4G T;  4UQG A;  3TU5 A;  1Q86 O;  3A5M C;  4E89 A;  4JV5 K;  1TGO A;  5EY4 A;  4U7B A;  3SMP A;  4FK4 A;  1A5X A;  4IKF A;  1IBM K;  2KZM A;  1NK4 A;  3D45 A;  3VQ9 A;  3PLA A;  3ZET A;  3KK3 A;  1DLO A;  4CGF A;  1WN7 A;  1NK9 A;  3SUP A;  1LAV A;  4EZ6 A;  1BG3 A;  2GEM A;  2F8S A;  4M3R A;  4DSJ A;  4FSV A;  3QB0 A;  3OYC A;  1VQ9 N;  4KHN A;  5M1N A;  3SBG A;  3PO5 A;  5JLF A;  4O8U A;  5HOO A;  1NMN A;  1BO5 O;  2KTQ A;  3IRX A;  1VAZ A;  4OO1 J;  2UUC K;  4DV1 K;  1X3M A;  4IO8 A;  3ULE B;  4FLY A;  1KFD A;  4I6M A;  2BGG A;  4CHQ A;  4I9L A;  3MCP A;  4CFC A;  1WBB A;  3ZT4 A;  3O9T A;  3WNF A;  3LDP A;  4BRN A;  3KLI A;  2VWJ A;  3L2R A;  3TSQ A;  3WNE A;  3SQ0 A;  4B1W B;  3I0R A;  3OYL A;  4JS5 A;  3L3V A;  4FK2 A;  4AHT A;  1I94 K;  2DFH A;  4BR9 A;  5C10 A;  3TAB A;  2QWO A;  5B8H A;  2RF2 A;  3S3M A;  3EL2 A;  4K0K K;  4E7K A;  1NGE A;  1DEJ A;  1RT1 A;  2ZF5 O;  1QHA A;  3RMC A;  1RTD A;  3WQT A;  4YOV A;  4KHP K;  4CZK A;  1HNZ K;  1WSF A;  1VSH A;  5BR8 K;  1RCH A;  5CR4 A;  5H1S Q;  4FL9 A;  3SAG A;  5AQV A;  4PL8 A;  5GAD P;  2E20 A;  4CED A;  4CE9 A;  3OYN A;  3AVB A;  2QWR A;  4IFV A;  3CCE N;  4CER A;  1NGJ A;  3CCV N;  2QXL A;  2O8B B;  1A5V A;  1KVB A;  3O8M A;  1T6C A;  5KTQ A;  4CK2 A;  3OYF A;  1EWR A;  4OPH A;  4JHD A;  3KIO A;  1NGG A;  4XEI A;  4N5S A;  5AQL A;  2HHQ A;  3L2W A;  4FJK A;  3QEV A;  4OPA A;  2WOM A;  4B9U A;  2YJE A;  2VQE K;  3RMB A;  3DYA A;  5I42 A;  2P9N A;  1IBL K;  3H1V X;  4FWM A;  5AQP A;  4GMJ B;  3T1A A;  2A42 A;  4E1J A;  2BUP A;  1ATN A;  2NRX A;  1JCF A;  1JLE A;  2QWL A;  3VES A;  4DQQ A;  1SL1 A;  3IG1 A;  5EX5 A;  1U6Z A;  3OJS A;  3A2F A;  4DLE A;  4O0I A;  1LWE A;  4MQ3 A;  3AO3 A;  1NGD A;  1VSK A;  2Z1J A;  3LDS A;  2P9I A;  3LAL A;  3EYZ A;  2F9T A;  3WQU A;  3ATV A;  3HPH A;  1RDU A;  5J2M A;  3A8Y A;  2OCE A;  3VMF B;  3J80 O;  3HOT A;  2G8U A;  3LDO A;  4EZ9 A;  1N34 K;  5ELZ A;  3VQA A;  3T69 A;  4PWD A;  1YVN A;  4H0T B;  4JEP A;  4AHV A;  3HZ6 A;  3T7Z A;  5I3U A;  4GW6 A;  1XHX A;  4B9N A;  1VSD A;  3VQD A;  3H08 A;  2QM1 A;  1TL3 A;  2G8I A;  5D3G A;  1TKX A;  2QA4 N;  4FZZ A;  4CJR A;  4CI6 A;  1HNI A;  4CJW A;  4B9T A;  2EHG A;  2FXU A;  4JI4 K;  1QSY A;  3SNN A;  4H4O A;  3VGM A;  4NLC A;  5SWM A;  4EIA A;  4LF8 K;  3HSC A;  3V6D A;  1HYV A;  3CM5 A;  4ISF A;  4BGA A;  2O4G A;  4OKJ A;  2XY7 A;  3MEC A;  3T1Y K;  4BC3 A;  2X6S A;  2CGK A;  3IMX A;  3CF5 L;  2NRH A;  4YOY A;  1X9J A;  1NK8 A;  3D2E A;  1NK7 A;  4F3O A;  5EOY A;  3DLK A;  5BRE A;  4M42 A;  4QAG A;  3E9L A;  2X78 A;  4BWJ A;  1S1W A;  4JYA K;  2XY6 A;  3J81 O;  3QNO A;  5T7B A;  3UKU B;  2E88 A;  3AVC A;  4FM0 A;  3QIN A;  3CC2 N;  1C1A A;  3C95 A;  4FJG A;  4HTL A;  4ISE A;  3VTH A;  3LDQ A;  3MCA B;  5AFU H;  1NGI A;  1K8A O;  5C25 A;  4FYD A;  2IVP A;  3ZYY X;  4KI6 A;  3D7E O;  2WFB A;  5BRH A;  5HL7 L;  2IAJ A;  4K8Z A;  4RW6 A;  1RDW X;  2HW3 A;  1D9D A;  1A5W A;  4CZE A;  1KSP A;  1TAQ A;  1RBV A;  1G99 A;  4IOX A;  2HHW A;  2IVN A;  3LP3 A;  4FZX C;  3E9O A;  1QVF M;  1TYQ A;  3ENH A;  4BR2 A;  2Q1N A;  1E4F T;  2W40 A;  4BRP A;  1RT5 A;  2E8A A;  3QDK A;  1S9G A;  5F0X A;  4ZHR A;  4N47 A;  2LSN A;  4JD2 A;  3C6A A;  4FLV A;  4FJI A;  3AVH A;  4B3T K;  3R6M A;  4HVJ A;  4JK9 A;  3NH1 A;  1EET A;  5TKW A;  3CCR N;  3IS9 A;  4C8K A;  3G71 N;  2QK9 A;  1JL2 A;  1NWK A;  1KLN A;  2CGL A;  3AY9 A;  1C0G A;  4B1Z A;  4BRK A;  3TAE A;  2HOE A;  3KWI A;  1VQK N;  4JRQ A;  3RTV A;  3LAM A;  4CHP A;  4FM2 A;  3LAN A;  3SMS A;  5KGX A;  3TTF A;  1RTJ A;  4BC4 A;  3H1Q A;  4CGG A;  2JWL A;  5TKY A;  4JHD B;  4FJM A;  4RWT A;  4DUY K;  1L3V A;  4DV5 K;  3ZEU A;  3C6T A;  3LPT A;  4CEC A;  4Z4F A;  1TKT A;  2OPQ A;  3AVI A;  3BF3 A;  3VN5 A;  4FO0 A;  1WSI A;  1QVG M;  4M3W A;  4IBN A;  2YJF A;  4JRP A;  3ISN C;  3LZI A;  3KLF A;  1RBR A;  4NB4 A;  3W3D A;  3O3G A;  3MDQ A;  1NGC A;  4KI4 A;  1X1P A;  4HHT A;  2D0O A;  1CLQ A;  4KHY A;  4HUF A;  3FZK A;  3FFI A;  3HPO A;  3CPE A;  2P9S B;  1NNE A;  2P9I B;  4BRM A;  2KW4 A;  2WUS A;  1NGB A;  3OYJ A;  3EN9 A;  2F8T A;  1KCF A;  4NCB A;  4CES A;  1W7A A;  5KGW A;  4DSF A;  1WOQ A;  4L3Q A;  3B8A X;  3CCJ N;  3SCX A;  4LFB K;  2E4L A;  3ZX3 A;  4RW4 A;  4MO4 A;  3NGI A;  1HNX K;  1FW6 A;  1BA0 A;  2P9L A;  1LW2 A;  3TAR A;  1HYZ A;  5C2F A;  4CJK A;  2O8F A;  5FRO A;  2NRZ A;  1WB9 A;  2HHT A;  2GUI A;  4ELT A;  4O55 A;  1EQY A;  1QE1 A;  1DT9 A;  3VQ4 A;  4L8R B;  3OBW A;  5M1P A;  3D0P A;  4CEQ A;  3THW A;  4FWS A;  1XNQ K;  1ZBI A;  1N5Y A;  1VQP N;  3EZW A;  1IKW A;  4M7Y A;  4FOE A;  2FC0 A;  3VEV A;  1W97 L;  4CJV A;  4AF1 A;  2WTU A;  4DSE A;  1VHX A;  1J5E K;  1B9F A;  1ZBS A;  2OZM A;  3F73 A;  3DJC A;  2NRR A;  2JGU A;  4H0O A;  5J1E A;  4BR5 A;  2JWK A;  2ASM A;  1Q8I A;  4FLU A;  4KTQ A;  1CXQ A;  1HKB A;  4CGD A;  1RDC A;  4LH5 A;  3BGR A;  4ILG B;  1WLJ A;  4Z4E A;  4WYB A;  3CJ7 A;  3ZSX A;  4WQ5 A;  1GLE G;  1JXB A;  2OAN A;  1JLQ A;  4U67 L;  3QML A;  1LV5 A;  1XWL A;  4GY2 B;  4OKK A;  3KK1 A;  3NF7 A;  5JIC A;  1OH8 A;  1ATR A;  4A5A A;  4CJQ A;  3ZT2 A;  4DV2 K;  3L4Q A;  3MAQ A;  4KHQ A;  4BG8 A;  3SK3 A;  2RN2 A;  3K57 A;  3VQQ A;  4OKE A;  3CC7 N;  1Q9X A;  5FRM A;  3MEG A;  1JLB A;  3AVK A;  3P5J A;  3GOI A;  3QEI A;  2ASP A;  3SJH A;  4BRE A;  3D2F A;  1J5O A;  3CJ1 A;  2O8C A;  4FCY A;  3NGY A;  4JI7 K;  1XMQ K;  4HWI A;  1RT4 A;  3O3H A;  4LY7 A;  4F8R A;  4RW8 A;  2FBT A;  4AH9 A;  4CJP A;  4CIE A;  4FJL A;  1BQN A;  1BOT O;  4W5Q A;  3OS2 A;  3NVK A;  1TYQ B;  4AHU A;  4DSK A;  3UIQ A;  1C1C A;  1KXP A;  5HRP A;  3H3O B;  4FJ7 A;  3LP1 A;  1VRU A;  1BI4 A;  1TK0 A;  3K5O A;  3MWP A;  1J54 A;  4IWV A;  1Y64 A;  3NF9 A;  2NRV A;  4LF4 K;  4CHO A;  4N76 A;  3KK7 A;  2DTU A;  3S41 A;  4ILJ A;  5KQD A;  4H5T A;  4E3S A;  4CEF A;  1SKS A;  2Q3S A;  1VQN N;  3DMJ A;  3TI0 A;  4DTP A;  2E6M A;  3BEX A;  2KQ2 A;  4DTU A;  4DU1 A;  4IG0 A;  3V81 A;  4DHY A;  2PYL A;  1ZBF A;  1TAU A;  4CJT A;  2OPP A;  3U4L A;  2O8D B;  1L3U A;  1F21 A;  1YIJ N;  3BDP A;  4G9Z A;  5DM7 L;  3TAP A;  1GLJ O;  4LFC K;  3O9U A;  2OTL N;  1KAX A;  2HHS A;  1KTQ A;  4DF4 A;  1KAY A;  4B1V A;  5BPL A;  1JLA A;  1DGK N;  4DFJ A;  3S3N A;  3BP8 A;  4CW7 B;  4E7I A;  5CHI A;  3GG4 A;  4JAX A;  1EO1 A;  4DU4 A;  4JKA A;  4B8C A;  4WF9 L;  1NOY A;  4ID5 A;  1NKC A;  1NK5 A;  4BE0 A;  1YT3 A;  5F2R A;  4EFH A;  4YOX A;  1Z05 A;  1NGF A;  1L3S A;  4X62 K;  4CEE A;  3SUO A;  1NJZ A;  3PX4 A;  4R5P A;  2VYP A;  3C0B A;  1U04 A;  1SAZ A;  4AIL C;  3D6R A;  3TPQ A;  1EKE A;  1GLC G;  3PUF A;  3P31 A;  3ZT1 A;  5DM6 L;  5C15 A;  2HMP A;  2D4W A;  4CK3 A;  4FK0 A;  4YHH K;  3OYI A;  1U45 A;  3THX A;  4RTF D;  2YHB A;  3MED A;  4NLB A;  3K0S A;  3RWU A;  3F9K A;  4PQU A;  2Q97 A;  4KV8 A;  3SPY A;  4CZI A;  3U3G A;  3VQB A;  4F9O A;  3NBP A;  1YUW A;  3C7N B;  5CZ1 A;  4HUE A;  3TWH A;  5C24 A;  3SQ2 A;  1KLM A;  4Z4C A;  3UKR A;  3NMU A;  2P9L B;  4KH4 A;  3OYH A;  2FSK A;  3R1X A;  1GOB A;  2O8F B;  2YNG A;  1R59 O;  2BE2 A;  3HVT A;  4RG8 A;  4BC5 A;  5LJW A;  4DUZ K;  2V51 B;  3OYE A;  1SKR A;  4CBW A;  1MU2 A;  1Z6R A;  5FPM A;  3AGR A;  2UXD K;  1FKP A;  2B4J A;  3CI5 A;  4GV9 A;  1UOC A;  4H8K A;  3THW B;  4QS7 A;  3LWL A;  2HNZ A;  4X65 K;  4Q0B A;  1U47 A;  3JYT A;  1U2V A;  2UYT A;  3BF1 A;  3AA4 A;  4K43 A;  1XC9 A;  2W6K A;  5BR9 A;  1HQE A;  3WXI A;  1RDD A;  1YTA A;  3AVG A;  2UUA K;  4CEB A;  1VQM N;  3E66 A;  4YOU A;  1TKZ A;  3MMV A;  4BAC A;  4JI8 K;  4EHU A;  4DR3 K;  3PX0 A;  4FWQ A;  2HF3 A;  3IKM A;  2BDP A;  1IH7 A;  4DCH A;  3O9Q A;  1YI2 N;  4CK1 A;  2GWJ A;  3NFA A;  4CFD A;  1WBD A;  1TUY A;  2Z1I A;  4IO9 L;  2X6N A;  3CJB A;  2NNW A;  1HKC A;  3AGK A;  3ZCM A;  3AO4 A;  2GUP A;  1RT6 A;  4KB1 A;  4KB0 A;  3ALY A;  4O4G A;  3L4I A;  5ADX A;  1REV A;  1WAF A;  4CD3 A;  5AZJ A;  4AHS A;  1TKD A;  4CJE A;  4B9Q A;  2ZWH A;  3A5N C;  3THY B;  1VSM A;  3NE6 A;  4KFB A;  4JI5 K;  1YVU A;  3OYG A;  2KFZ A;  4BRG A;  3CFP A;  4KH6 A;  2QWP A;  3EO3 A;  4CGJ A;  2A1R A;  5KPZ A;  2VQF K;  1ASU A;  2RE2 A;  2VWK A;  3OA9 A;  2HNY A;  3Q7C A;  3L2Q A;  5FLX O;  5M1F A;  3KHY A;  1BI4 B;  3VA0 A;  4FJX A;  4CBX A;  3DXM B;  4MLE A;  1WSE A;  3L3U A;  3VQ8 A;  1IKV A;  3M6G A;  3NH0 A;  2HBL A;  1RBT A;  5LMN K;  1GLF O;  4FWP A;  3FE1 A;  1R0A A;  3K58 A;  4A2B A;  3OBY A;  2A6A A;  4QCL A;  1RDB A;  2OTJ N;  1U48 A;  4CHN A;  1HNW K;  5AQY A;  2YHW A;  3E01 A;  3T3F A;  4CVN E;  1JCE A;  3CQ8 A;  1BCM A;  1S6Q A;  4FPB A;  2E5L K;  4B9S A;  1ATS A;  2HHX A;  1VQ6 N;  3QNN A;  4CF0 A;  5GIN A;  2B5J A;  3JAM O;  4H5N A;  4F4K A;  1ZC6 A;  4JN4 A;  4PL7 A;  4Y1D A;  1Q7Y O;  1IKX A;  4YOT A;  1C0F A;  3VPZ A;  3O9R A;  3MXM A;  1VQ7 N;  4AHC A;  1BA1 A;  4BQL A;  5EU7 A;  3R9P A;  2P5G A;  2FBY A;  3P83 D;  4GV3 A;  3PY8 A;  1NBW A;  3KD1 E;  3DOL A;  3PX6 A;  1NLV A;  4GVM A;  4CEZ A;  4BRC A;  3KK2 A;  2PAV A;  3WXM B;  3DLB A;  2HVH A;  4F2S A;  2KHO A;  2A41 A;  4H0X B;  5CYM A;  3CCM N;  2Y1J A;  3QBW A;  3MK6 A;  4YDU A;  2VG5 A;  5AQW A;  3EY1 A;  5FPD A;  2X74 A;  2YCH A;  3O4W A;  4EAH D;  2I7P A;  4OLB A;  4CHY A;  3AA5 X;  4IDH A;  4RCH A;  1TUU A;  4Q5V A;  5AQJ A;  4HUG A;  4CZG A;  4FWK A;  1NJX A;  4FPA A;  3THV A;  3OYA A;  3VGL A;  3KKS A;  5BN8 A;  4KH5 A;  1WUA A;  2ZGZ A;  4XH5 A;  3ZSW A;  3CME N;  1S1X A;  1IKY A;  3AVA A;  3P38 A;  3CPW M;  1NGH A;  3EKU A;  3C65 A;  3ZET B;  1IV0 A;  1ZXO A;  4JKD A;  3QEP A;  3U9Z A;  1QZ6 A;  3UKR B;  4DB3 A;  4W5T A;  4CF8 A;  4FLX A;  3WNG A;  1TK5 A;  3G10 A;  3VQC A;  4CGI A;  2VCP A;  4DQI A;  3VOV A;  3VTI A;  5FPE A;  2CGJ A;  3FFK B;  1D5A A;  4JI3 K;  1MWK A;  1EP4 A;  4IJN A;  3VEZ A;  3I0S A;  4FWL A;  4TSX A;  2Q31 A;  3AAR A;  3HYF A;  4M3Y A;  5JMV A;  2OPR A;  3NH2 A;  4H5R A;  4DFM A;  3V9Z A;  4GVE A;  4I6M B;  4BVO A;  4H03 B;  1U2V B;  4KRF A;  4BWM A;  2P9K A;  1T3V A;  3FR0 A;  1JXE A;  4PUO A;  3ID8 A;  1BIS A;  1VQO N;  1CXU A;  2E6L A;  3K5N A;  1YJW N;  1RT7 A;  4FVM A;  3H6E A;  1TK8 A;  1SS6 A;  3G0Z A;  2ZE2 A;  4IDK A;  4A61 A;  1ASW A;  3OYM A;  4DQ8 A;  4WQ5 C;  3MXI A;  1KVC A;  1HJO A;  5BRF A;  4BC2 A;  1CZB A;  3AVJ A;  3DRP A;  1VSE A;  5KI6 A;  1Q18 A;  3OHR A;  2QEX N;  1DTT A;  4M63 C;  3UB5 A;  4NO7 A;  3WEE A;  4M3Z A;  3OYK A;  4WFA L;  2O8E A;  4OLA A; 
#chains in the Genus database with same CATH homology
 4CGD A;  4DS5 A;  1RDC A;  4UQG A;  4LH5 A;  3BGR A;  1QSS A;  2QKB A;  1WLJ A;  4E89 A;  4DG1 A;  4Z4E A;  1Y97 A;  3ZSX A;  1C0U A;  2OZS A;  1JXB A;  1TGO A;  4CEO A;  3V1O A;  4FK4 A;  1JLQ A;  4KRE A;  4MFB A;  1A5X A;  2YNF A;  1LV5 A;  1XWL A;  5DK5 A;  4OKK A;  4IKF A;  2KZM A;  3KK1 A;  3NF7 A;  4JS4 A;  1NK4 A;  3D45 A;  3VQ9 A;  2JLE A;  3ZSQ A;  3CG7 A;  1RT2 A;  4CJQ A;  1TV6 A;  1DLO A;  3ZT2 A;  3KK3 A;  1Q9Y A;  4KKO A;  4OGE A;  4CGF A;  1VSF A;  3MAQ A;  3C6U A;  4KHQ A;  1WN7 A;  1U49 A;  1NK9 A;  1JLC A;  2YNI A;  3SUP A;  2RN2 A;  1LAV A;  1RBU A;  3K57 A;  4EZ6 A;  3VQQ A;  2IOC A;  3AO5 A;  2GV9 A;  4OKE A;  4M3R A;  4DSJ A;  2F8S A;  3CM6 A;  1Q9X A;  4NYN A;  3OYC A;  5FRM A;  4E7L A;  3MEG A;  1JLB A;  5J2P A;  2P51 A;  3AVK A;  3P5J A;  1Z26 A;  4KHN A;  3AVM A;  3QEI A;  1X9W A;  2BAN A;  4ZTJ A;  1J5O A;  4KTQ A;  3AVF A;  3NGY A;  4FCY A;  3PO5 A;  1RT4 A;  1C0M A;  3O3H A;  3AO2 A;  4LY7 A;  2KTQ A;  4F8R A;  4RW8 A;  3IRX A;  5FDL A;  2FBT A;  4AH9 A;  4CJP A;  4CIE A;  4BE1 A;  4FLY A;  1KFD A;  3V9X A;  5SZT A;  4FJL A;  2BGG A;  1ASV A;  1BQN A;  4CIF A;  4W5Q A;  4CHQ A;  3OS2 A;  4HCC A;  4I9L A;  4CFC A;  4DSK A;  4AHU A;  3UIQ A;  1C1C A;  1U4B A;  1NOZ A;  5HRP A;  3ZT4 A;  3K2P A;  3OS1 A;  2F96 A;  3WNF A;  4FJ7 A;  1VRT A;  3LP1 A;  3KLE A;  3KLI A;  2VWJ A;  1VRU A;  1WSJ A;  3TAM A;  3L2R A;  1BI4 A;  1TK0 A;  3WNE A;  3K5O A;  3NCI A;  1J54 A;  4DWI A;  3NF9 A;  5K14 A;  3SQ0 A;  4KHW A;  1W0H A;  4O0J A;  4FLT A;  1UA1 A;  3ZSV A;  3I0R A;  4CHO A;  3OYL A;  4FJI A;  1WSH A;  3AVN A;  3L3V A;  4JS5 A;  3PV8 A;  4N76 A;  1RTH A;  3TAN A;  2PYJ A;  4FK2 A;  2AJQ A;  4AHT A;  4E3S A;  4FLW A;  3QEW A;  4CEF A;  3DOK A;  3IAY A;  4CJ3 A;  1SKS A;  1EXQ A;  2DFH A;  2XHB A;  3OJU A;  2Q3S A;  3TAB A;  2PY5 A;  1J53 A;  2RF2 A;  4B9M A;  3DMJ A;  3S3M A;  4ID1 A;  3TI0 A;  4CCH A;  2ZQB A;  4DTP A;  2E6M A;  3VQP A;  4E7K A;  4BDZ A;  1RT1 A;  2KQ2 A;  4DTU A;  4DTN A;  1IG9 A;  4AHR A;  4DU1 A;  4Z4G A;  4IG0 A;  2VG7 A;  3RMC A;  3V81 A;  1RTD A;  1QSL A;  1C6V A;  1ZBF A;  3DRR A;  5HP1 A;  2PYL A;  1TAU A;  3B6O A;  3TR8 A;  2IGI A;  3DLH A;  2EX3 A;  3HPG A;  4CJT A;  2OPP A;  1YTU A;  3VQE A;  1L3U A;  1ZBH A;  1F21 A;  1HNV A;  3BDP A;  3TAP A;  1HQU A;  1WSF A;  3QES A;  1VSH A;  3QLH A;  2D5R A;  1RCH A;  4CJ5 A;  3T19 A;  1NJY A;  2HHS A;  1KTQ A;  4DF4 A;  4B08 A;  1JLA A;  3C94 A;  1KFS A;  4CED A;  3ZT0 A;  4CE9 A;  3OYN A;  4DFJ A;  3AVB A;  4ZTF A;  2HVI A;  3S3N A;  3DM2 A;  4IFV A;  4E7I A;  4FJ9 A;  3AO1 A;  4CJS A;  4FM1 A;  4DU4 A;  3HK2 A;  3WNH A;  4CER A;  2YNH A;  1SKW A;  1UWB A;  4B8C A;  2RKI A;  1NOY A;  4ID5 A;  1NKC A;  1NK5 A;  1D8Y A;  4BE0 A;  4DQS A;  2XRI A;  1A5V A;  1YT3 A;  2IDO A;  1KVB A;  3OS0 A;  2OA8 A;  1C1B A;  4CK2 A;  5KTQ A;  3OYF A;  4CEE A;  1T03 A;  1L3S A;  5KRS A;  4F3T A;  1HRH A;  5DMR A;  3SUO A;  1XHZ A;  4DS4 A;  1NJZ A;  3PX4 A;  4R5P A;  3LWM A;  1BIU A;  1X9M A;  1B92 A;  4HCB A;  1U04 A;  1BGX T;  4CF1 A;  3KIO A;  4N5S A;  3RRH A;  1QS4 A;  2HHQ A;  4M45 A;  4DSL A;  3L2W A;  4FJK A;  3QEV A;  4HTU A;  2WOM A;  4AIL C;  3SPZ A;  1NK0 A;  1EKE A;  4B9U A;  4KHU A;  3PUF A;  1RIL A;  2Y1I A;  3RR8 A;  3RMB A;  4DQP A;  3DYA A;  5I42 A;  4F2R A;  3K5M A;  3ZT1 A;  1IO2 A;  3NF8 A;  4PA1 A;  4FLZ A;  4CK3 A;  3DRS A;  4FK0 A;  4GMJ B;  3T1A A;  3OYI A;  3KJV A;  1U45 A;  1ITG A;  1T05 A;  3NGZ A;  3DLR A;  1DTQ A;  2YHB A;  1JLE A;  3MED A;  2GBZ A;  4N41 A;  3RWU A;  1HMV A;  4E1N A;  4DQQ A;  3F9K A;  4PQU A;  4CJF A;  4KV8 A;  1SL1 A;  1NK6 A;  3IG1 A;  4OGC A;  3L8B A;  4CHZ A;  3SPY A;  3U3G A;  3VQB A;  3OJS A;  3A2F A;  3NBP A;  1ZBU A;  4DLE A;  4O0I A;  1LWE A;  4MQ3 A;  5CZ1 A;  4CIG A;  1QQC A;  4HUE A;  3TWH A;  3AO3 A;  3SV3 A;  3QIO A;  5C24 A;  1VSK A;  3SQ2 A;  1KLM A;  2Z1J A;  4Z4C A;  3LDS A;  3SJJ A;  3LAL A;  3SZ2 A;  3EYZ A;  2ITG A;  1NKB A;  3HPH A;  4B9L A;  3OYH A;  1GOB A;  5J2M A;  4OPJ A;  3NHG A;  3OY9 A;  4W5N A;  2YNG A;  2BE2 A;  4RG8 A;  3HVT A;  2G8U A;  4KPY A;  3M8Q A;  1UAX A;  4EZ9 A;  3OYE A;  1SKR A;  2RPI A;  3VQA A;  1MU2 A;  3V9U A;  4PWD A;  4CFA A;  4O44 A;  1WAJ A;  3EZ5 A;  1I39 A;  1LWC A;  1FKP A;  2B4J A;  3V9S A;  1UOC A;  1S1U A;  4LSN A;  4AHV A;  3V4I A;  4H8K A;  5I3U A;  4GW6 A;  3LWL A;  2HNZ A;  1XHX A;  4Q0B A;  4B9N A;  3V1R A;  1U47 A;  3JYT A;  1VSD A;  4FJN A;  3VQD A;  3DLG A;  3H08 A;  4I2P A;  1SV5 A;  3AA4 A;  4I7F A;  1TL3 A;  4NCG A;  5FRN A;  2G8I A;  4DU3 A;  5D3G A;  1XC9 A;  1TKX A;  4FZZ A;  4CJR A;  3CFR A;  3LZJ A;  1JLF A;  1HQE A;  1D9F A;  1RDD A;  1YTA A;  3AVG A;  3I8D A;  1HNI A;  4CEB A;  4CJW A;  4B9T A;  3PO4 A;  2EHG A;  2ZD1 A;  1TKZ A;  3SNN A;  4H4O A;  4CF9 A;  1QSY A;  2HHV A;  4BE2 A;  3ZSR A;  5SWM A;  2R7Y A;  3V6D A;  4BAC A;  4J2B A;  4M3U A;  1HYV A;  3CM5 A;  2O4G A;  1O1W A;  3NAE A;  3KKR A;  4H4M A;  4OKJ A;  4BDP A;  2HND A;  2XY7 A;  3MEC A;  3PX0 A;  3HL8 A;  2X6S A;  2QXF A;  3ZSZ A;  5KRT A;  1WSG A;  1IH7 A;  2BDP A;  3SYZ A;  2D0C A;  1JL1 A;  1NK8 A;  4B8A B;  4CK1 A;  1NK7 A;  4F3O A;  2O4I A;  3NFA A;  4CFD A;  4N56 A;  3QIP A;  3ULD A;  2Z1I A;  2P1J A;  3DLK A;  2QKK A;  3VA3 A;  4ELV A;  4M42 A;  2X6N A;  3QER A;  4QAG A;  2X78 A;  3AO4 A;  3ZCM A;  4BWJ A;  4FXD A;  1S1W A;  3ZT3 A;  1RT6 A;  4KB1 A;  4YFU A;  4KB0 A;  3ALY A;  4O4G A;  2XY6 A;  4DQR A;  1REV A;  3QNO A;  1BQM A;  1WAF A;  4W5O A;  5T7B A;  3HP9 A;  1S5J A;  4AHS A;  3AVC A;  1TKD A;  4CJE A;  4FM0 A;  4B9V A;  4M41 A;  3QIN A;  3AA2 A;  1C1A A;  5HRR A;  2HB5 A;  3C95 A;  4FJG A;  1K6Y A;  4CJU A;  2IS3 A;  4DSI A;  2Z1G A;  4WE1 A;  3B6P A;  1W9H A;  4YNQ A;  1VSM A;  1HJR A;  3NE6 A;  2G8V A;  4KFB A;  5C25 A;  3RRG A;  4FYD A;  3AVL A;  3L2V A;  1YVU A;  4E1M A;  3OYG A;  3M8R A;  2W42 A;  4KI6 A;  4NCA A;  2KFZ A;  1L3T A;  5HRS A;  4Z0U A;  3CFP A;  1ZBL A;  1RBS A;  1TL1 A;  4JLH A;  3HVR A;  4FLU A;  4CGJ A;  2A1R A;  4M3X A;  3OYB A;  3RR7 A;  1ASU A;  3HJF A;  2VWK A;  2HNY A;  3L2Q A;  2HHU A;  2I5J A;  2IAJ A;  4FW1 A;  3TAF A;  1BI4 B;  1RT3 A;  3NDK A;  2DFE A;  3VA0 A;  4ELU A;  4K8Z A;  4FJX A;  4RW6 A;  4DTR A;  1WSE A;  3S3O A;  3L3U A;  3SUQ A;  4RW9 A;  2HW3 A;  4G1Q A;  1D9D A;  3VQ8 A;  1A5W A;  2DFF A;  1IKV A;  1TAQ A;  1RBV A;  4KTW A;  1KSP A;  4E0D A;  3NH0 A;  2KZZ A;  3P1G A;  2HHW A;  1RBT A;  4CEA A;  3LPU A;  3LP3 A;  1VSL A;  4FZX C;  1KVA A;  1JKH A;  1R0A A;  3K58 A;  3QO9 A;  1LW0 A;  3LP2 A;  1RT5 A;  4IG3 A;  4DFP A;  4QCL A;  2YKN A;  1RDB A;  1S9G A;  1U48 A;  3HO1 A;  4CHN A;  4ICL A;  4ZHR A;  4N47 A;  2LSN A;  2G8K A;  1BL3 A;  3E01 A;  3T3F A;  4B3O A;  4FLV A;  3DI6 A;  2G8H A;  3VQ5 A;  3V1Q A;  3CQ8 A;  1S9E A;  3AVH A;  4OVL A;  1BCM A;  3OVN A;  1S6Q A;  4RW7 A;  3KLH A;  4Z4I A;  1L5U A;  1FKO A;  4FJ8 A;  4HVJ A;  4B9S A;  2HHX A;  3TAG A;  2OYQ A;  3NH1 A;  4DMN A;  1EET A;  3QNN A;  3ZSY A;  1TVR A;  4CF0 A;  3IS9 A;  2FBX A;  2B5J A;  3MXJ A;  1RNH A;  4C8K A;  2QK9 A;  2YHA A;  4F4K A;  3M8S A;  3AA3 A;  4OPK A;  4Y1D A;  1JL2 A;  1IKX A;  1I3A A;  1KLN A;  1BIZ A;  1RTI A;  1GOA A;  3TAQ A;  2OPS A;  3MXM A;  4AHC A;  3TAE A;  3QEX A;  5EU7 A;  3VQ6 A;  4CFB A;  3ZSO A;  2P5G A;  2PZS A;  4JRQ A;  4LH4 A;  2FBY A;  3P83 D;  4CJ4 A;  3LAM A;  3O3F A;  3RTV A;  3PY8 A;  2VG6 A;  4CHP A;  4FM2 A;  3KD1 E;  3DOL A;  3LP0 A;  3LAN A;  3PX6 A;  1UA0 A;  5C42 A;  5KGX A;  3HM9 A;  4J2E A;  4OJR A;  4GVM A;  4CEZ A;  1XI1 A;  3KK2 A;  3U3Y A;  3DLB A;  2HVH A;  4F2S A;  4CF2 A;  5CYM A;  2Y1J A;  1RTJ A;  5CY4 A;  4DTM A;  1BHL A;  2P5O A;  5E41 A;  3RMA A;  4EP4 A;  2VG5 A;  4CGG A;  3KD5 E;  3KLG A;  1GOC A;  4O5B A;  3EY1 A;  4DLG A;  1NKE A;  2X74 A;  1SUQ A;  2G8W A;  1LWF A;  4FJM A;  5CZ2 A;  1L3V A;  3JSM A;  2IC3 A;  3C6T A;  4KO0 A;  4BDY A;  4OLB A;  4CHY A;  3AA5 X;  3LPT A;  4CEC A;  4Z4F A;  1TKT A;  2OPQ A;  3AVI A;  1VK0 A;  1S1V A;  3VN5 A;  4E7H A;  1LAW A;  3VQ7 A;  4C8O A;  4DTS A;  1WSI A;  3O4N A;  4Q5V A;  4M3W A;  1VSI A;  4IBN A;  4DTJ A;  4JRP A;  3ISN C;  3LZI A;  4HUG A;  3KLF A;  2XY5 A;  5HLF A;  4I9Q A;  1CZ9 A;  3SI6 A;  1RBR A;  3ASM A;  4FZY A;  1NJX A;  4J2D A;  3THV A;  2FBV A;  1N6Q A;  3O3G A;  2G8F A;  1HYS A;  3OYA A;  4LD0 A;  3KKS A;  2B6A A;  2D0A A;  4EP5 A;  3HT3 A;  4DFK A;  4KI4 A;  1X1P A;  4HHT A;  2XY8 A;  3ZSW A;  1CLQ A;  4KHY A;  4Z4H A;  2XO7 A;  4HUF A;  3FFI A;  2DTU A;  4K8X A;  5JS2 A;  1S1X A;  1IKY A;  5HBM A;  3AVA A;  3HPO A;  4J2A A;  1T7P A;  3QEP A;  3QET A;  1QTM A;  4Y1C A;  3RMD A;  4W5T A;  2D0B A;  4CF8 A;  1ZYQ A;  4FLX A;  2ETJ A;  3WNG A;  1TK5 A;  4KAZ A;  2HMI A;  1S1T A;  4FJJ A;  2KW4 A;  3G10 A;  3VQC A;  4CGI A;  1SL0 A;  4DF8 A;  2KFN A;  3OYJ A;  4DQI A;  2F8T A;  4OLA A;  1KCF A;  4NCB A;  4CES A;  5KGW A;  4DSF A;  1J9A A;  1D5A A;  1Z25 A;  4CGH A;  4LSL A;  4E7J A;  2NUB A;  3CFO A;  3SCX A;  1NJW A;  1C0T A;  2E4L A;  1JLG A;  4FW2 A;  4RW4 A;  4E19 A;  1EP4 A;  1VSJ A;  4KHS A;  3I0S A;  4TSX A;  5JS1 A;  3NGI A;  4M3Y A;  2WON A;  1G15 A;  3HYF A;  4I2Q A;  4C8M A;  2OPR A;  3V9W A;  3NH2 A;  5J2Q A;  4DFM A;  3V9Z A;  1LW2 A;  3K5L A;  5HRO A;  3TAR A;  1HYZ A;  4CJK A;  4FJH A;  3LAK A;  3SUN A;  3HP6 A;  2YV0 X;  5FRO A;  3AV9 A;  4C8N A;  1WNS A;  3S9H A;  4M3T A;  3SV4 A;  3L2U A;  4XIU A;  1RDA A;  4KRF A;  4BWM A;  4PUO A;  2HHT A;  1JXE A;  3SQ4 A;  3CYM A;  1BIS A;  4IFY A;  1KRP A;  2GUI A;  1CXU A;  2E6L A;  4O55 A;  4ELT A;  3U6F A;  4KTZ A;  3K5N A;  4DTO A;  1B9D A;  1QE1 A;  5CYQ A;  1RT7 A;  3VQ4 A;  4L8R B;  4FVM A;  4FJ5 A;  3D0P A;  2Z1H A;  4CEQ A;  1TK8 A;  3G0Z A;  3ITH A;  2ZE2 A;  4IDK A;  1X9S A;  3OYD A;  1ZBI A;  1ASW A;  5HRN A;  3OYM A;  4W5R A;  2YKM A;  3M8P A;  3O4Q A;  1N5Y A;  4QOZ B;  1FXX A;  1KVC A;  2ATQ A;  3MXI A;  1IKW A;  3KTQ A;  3MEE A;  1CZB A;  1EX4 A;  3AVJ A;  2FC0 A;  3DRP A;  5J2N A;  1HPZ A;  1VSE A;  2A1S A;  5KI6 A;  2DY4 A;  4CJV A;  4DSE A;  4C8L A;  3HXM A;  1SL2 A;  1B9F A;  1DTT A;  1FK9 A;  1BCO A;  2OZM A;  3NF6 A;  3F73 A;  4PY5 A;  1QHT A;  4NYF A;  2JGU A;  1T8E A;  3K59 A;  4CJL A;  5J1E A;  3SQ1 A;  4M3Z A;  3OYK A;  1S6P A;  1Q8I A;  4DTX A;  3HST B;  3DLE A;  1CXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...