4CEFA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cefA00
2QK9A 4CJTA 1HNVA 1HYSA 1KFDA 2DFEA 2D0BA 3C95A 4RW9A 1N5YA 5JS1A 3HK2A 2IDOA 2FC0A 3ZT4A 1U04A 5SZTA 4CJLA 1TKTA 3MAQA 2YKMA 1SL0A 3EY1A 3PX4A 4DWIA 3V6DA 3K5NA 2ATQA 3AVFA 2HW3A 2IAJA 4O55A 1SUQA 1JLBA 3VQQA 4HHTA 3S3MA 1EETA 3ULDA 4FJXA 3B6PA 4OLBA 4M3RA 3ITHA 4B9SA 4IFYA 4G1QA 1YVUA 4CF9A 4FJNA 4M3YA 1REVA 1S1UA 3LP0A 3NF9A 3L8BA 2OA8A 4B9TA 4JRQA 1D8YA 4QOZB 3KLHA 4KPYA 1EKEA 4CK1A 4CCHA 4FK4A 3E01A 2HVHA 4Y1CA 1T7PA 2QXFA 4B9UA 1EX4A 3MXIA 3VQPA 3SV3A 3V9XA 3DI6A 2ETJA 1VSJA 3OYLA 3M8PA 3V81A 2RN2A 4FVMA 2I5JA 1RILA 3OYDA 1Q9XA 1RBUA 1S6PA 1RT2A 2B4JA 4B08A 1JKHA 1UAXA 3WNFA 4F3OA 1YTUA 1KVCA 3A2FA 3KK1A 1NK4A 2BE2A 5CYMA 4CGFA 4CJSA 3OS2A 3UIQA 4O44A 4DSIA 3KLGA 1NOZA 1HQUA 1SKRA 3MEGA 2FBXA 2BDPA 3SI6A 4KRFA 1HYZA 3OYCA 2R7YA 1NK9A 3QNNA 4CEFA 3QETA 3AVHA 1D9DA 3KJVA 4CFBA 1FKPA 4DTSA 3HJFA 1GOCA 5FDLA 4F4KA 4J2DA 1D5AA 3TAQA 2O4GA 4B8AB 1TL3A 2WOMA 4TSXA 3AO2A 2FBTA 3MEEA 3QIOA 1KVBA 4QAGA 4BWMA 1BGXT 4C8NA 3IS9A 4HVJA 4OPJA 3NGZA 3OYMA 4KTQA 4CJFA 4JRPA 3NH1A 2YNIA 1BISA 1VSMA 3P83D 4DTMA 1Y97A 3IG1A 1SKWA 4GVMA 4OJRA 3T1AA 2HB5A 4FJIA 3PY8A 4FJ8A 2AJQA 2X74A 3KD1E 1ZBUA 3HPHA 4H8KA 3ZSOA 4KB0A 1UOCA 2Y1IA 2E6LA 1GOBA 1S1WA 3K58A 4HCBA 3OYBA 2VWJA 4F3TA 1WN7A 4IBNA 4I9LA 4CHOA 5T7BA 4B9VA 3K59A 4FJLA 1NK7A 1KRPA 4Z4GA 4CEZA 4CHQA 3QINA 5D3GA 1TV6A 1I39A 3MEDA 4I2QA 3QEVA 1B9DA 1JLQA 3PUFA 3ZT3A 1G15A 3K57A 3OYNA 3VA3A 5HP1A 2IGIA 2F96A 1BIZA 1C0UA 1JXBA 4DTNA 2OPRA 1FKOA 4Q5VA 4DLEA 4DQSA 1LW0A 5CY4A 4DSLA 1IKVA 1LV5A 1J9AA 2XY8A 3DRSA 4CJEA 3VQAA 3O3FA 2GV9A 4OKJA 3SQ1A 3AA2A 3T19A 3VQ4A 4DMNA 4J2EA 4N76A 2KFNA 1IKXA 1IH7A 3NGIA 4CHNA 4RW7A 5J2PA 1FXXA 4H4MA 3AVMA 3RRHA 4F2SA 2KZMA 1EXQA 1XHZA 1JLAA 2P51A 4E7IA 4DFPA 5HLFA 3AA4A 1TAUA 2IC3A 3AO4A 4HTUA 1NK8A 1X9MA 1LAVA 3KLEA 4FM0A 4BDPA 4OGEA 1KTQA 3HP9A 3I0SA 4KKOA 3OYAA 3PO5A 2KQ2A 5JS2A 3L2QA 3M8SA 4FLZA 1NJWA 2G8VA 4O4GA 5FRMA 3QNOA 4ZTJA 4PQUA 2HHTA 3AO5A 3RMBA 3T3FA 4W5OA 3DLEA 3AVBA 2DY4A 4CJKA 1CLQA 3V1RA 4C8LA 1SL1A 4W5NA 4Z4IA 1TK5A 5FRNA 3HO1A 1WSHA 3O4NA 1JLEA 4DQQA 4E7LA 2G8WA 3RR8A 4M3WA 4DTOA 4KHNA 4F2RA 3S3NA 1U49A 1JLGA 1ZBHA 4LH5A 3NF7A 4I2PA 4DFMA 1KLMA 1VK0A 4W5QA 4FM1A 1VRTA 3OYFA 3QERA 5E41A 1KFSA 1TKXA 2Q3SA 5I42A 2FBYA 4B8CA 3RR7A 1RBTA 2Z1HA 4ID1A 4KV8A 4HCCA 3PX0A 4HUFA 3HT3A 3DLBA 4KAZA 5J2NA 1WSIA 4CJQA 1W0HA 4IG0A 5DMRA 4DSEA 2PZSA 4W5TA 4FW1A 2HNZA 3L2RA 4DSJA 4E0DA 3P1GA 1LWCA 4JS5A 1ZYQA 2D0AA 4CGJA 1ZBIA 1SKSA 1CZ9A 1U45A 1YT3A 1T8EA 3QESA 4DTXA 4DTPA 2KZZA 3CM5A 4CF8A 2HHWA 4FCYA 4AHTA 4OPKA 3RWUA 2HHQA 2D0CA 1BIUA 1RT3A 3LALA 3HYFA 1WLJA 4R5PA 3LDSA 1RT6A 4CESA 1S9EA 3VQ8A 1VSKA 2KFZA 3QEWA 4FYDA 1KCFA 1RBRA 4KHSA 4DSFA 3G0ZA 1BHLA 3QLHA 4M45A 4CEBA 4FXDA 3OJUA 1NKBA 1QSSA 2VWKA 1JLCA 4AHSA 2E4LA 4BDYA 1TK8A 1CZBA 4CHYA 1BQNA 1IKYA 3LAMA 4ICLA 4LY7A 1TKDA 1SV5A 3O4QA 1F21A 3M8QA 2Z1IA 1IO2A 4M41A 1U47A 4KHUA 3DMJA 3IAYA 2OZMA 3U3GA 2Z1JA 3ZT2A 4Z0UA 3OYHA 5KRTA 3LZJA 2HHSA 2FBVA 1HJRA 1QTMA 4B9MA 1UWBA 4ELVA 1S1XA 2ITGA 3QEPA 1C1BA 3SYZA 1S1TA 3LP2A 4BE1A 5SWMA 4PY5A 1C0MA 3DM2A 1NKCA 2OPSA 5C42A 3NCIA 1Q9YA 3AVIA 3MXMA 2ZE2A 3V4IA 4O0IA 4CF2A 4Z4CA 1U4BA 3DRRA 3KIOA 4MQ3A 5C24A 4KREA 4OVLA 4FLWA 3SQ0A 3AO1A 3QEXA 4PWDA 4AHVA 4DF4A 3KLIA 1RDAA 4CE9A 3V9ZA 2XY5A 5C25A 3OYIA 4FJ9A 3ISNC 4FLVA 4OKEA 1RBSA 4CK2A 1WAFA 3CG7A 1J53A 4ID5A 2NUBA 1X1PA 3LP3A 3L3UA 4PUOA 1MU2A 3LP1A 3VQDA 3OYEA 3HVRA 2PYLA 4Z4FA 1C1AA 1VSHA 4FZXC 3ZT0A 3ZCMA 2HVIA 3PX6A 1XI1A 3CFOA 1T03A 1K6YA 4LH4A 1HNIA 4CJ3A 4F8RA 3SQ2A 1NK5A 4CHPA 1RT4A 1RCHA 4DFJA 5J2MA 2P5GA 3V1QA 4RG8A 4KHQA 4CJWA 1C1CA 3SUPA 3DLHA 3LWMA 3EZ5A 1FK9A 4GMJB 3O3GA 3HP6A 3DLGA 4E7KA 3IRXA 2XY7A 1J5OA 4EZ6A 2ZD1A 1RTHA 4KTZA 3LZIA 4CECA 3NDKA 2HNYA 4J2AA 1D9FA 1Z25A 2XO7A 4DU3A 4FM2A 4CHZA 3ZSVA 2OYQA 3TWHA 4CIGA 3TI0A 4EZ9A 4KO0A 4DSKA 3L2UA 4CEAA 4E1NA 5CYQA 3DYAA 4NYFA 4ELUA 3SNNA 1CXQA 3ZSYA 2YNHA 1WSFA 1TKZA 1NKEA 3BDPA 4YNQA 2XHBA 4E7HA 5HRRA 3OYKA 4N5SA 1RT5A 1LWEA 3HPGA 4CF0A 3NHGA 2HHXA 2YNFA 4UQGA 1VSEA 3OYGA 4W5RA 3WNEA 3V9SA 4E7JA 4N41A 3H08A 1NJZA 1WNSA 3K5MA 3C94A 4N47A 1XWLA 5DK5A 1WSGA 3VQ6A 2IS3A 4KI4A 4CGGA 1L3UA 1VSLA 1QS4A 4QCLA 3U3YA 3DRPA 1NK6A 2OPQA 4CERA 1BCMA 1TAQA 2B5JA 3CYMA 2YV0X 3NF8A 3VQ5A 3VQ9A 1WAJA 4OLAA 3L3VA 4DG1A 4Y1DA 4DU1A 4LSNA 3AV9A 4XIUA 2ZQBA 3NBPA 4CJ4A 2B6AA 1KVAA 1BL3A 3DOKA 1GOAA 3RMCA 3SUOA 2P5OA 4M3UA 4Q0BA 4DS5A 4FJ7A 2GUIA 4DTJA 3THVA 4CFAA 4FLXA 4NCBA 4DU4A 3TAPA 3ZSZA 3MECA 5KGXA 3CFPA 5HROA 5J2QA 4IKFA 3OJSA 1QSLA 3AVAA 3C6TA 3TAFA 4FK2A 4CIEA 1CXUA 1A5VA 1S9GA 4NCGA 4FJGA 4CFCA 1S1VA 5EU7A 4IFVA 3L2WA 1BI4A 3L2VA 3VN5A 1YTAA 4AHUA 3OS0A 1QE1A 2IOCA 1XC9A 3SV4A 4HUGA 3P5JA 2PY5A 1R0AA 3C6UA 2D5RA 2HNDA 4CJRA 3LPUA 4FLYA 3TARA 3DLRA 2G8UA 2X6NA 5HBMA 4B9NA 4IG3A 3AO3A 4OGCA 1DTTA 1TVRA 5KGWA 3NH2A 3I8DA 4DF8A 3TANA 2G8FA 4BE0A 1RBVA 2F8TA 5J1EA 3ZSRA 1L5UA 2QKKA 3CQ8A 4CJ5A 2GBZA 1RT7A 4CJPA 4NCAA 3K5OA 1JXEA 2JGUA 2VG6A 4AILC 1BCOA 1NJYA 1A5XA 4EP4A 1N6QA 3AA5X 2YKNA 3S9HA 4AHRA 3AVGA 2YNGA 1TL1A 3F73A 4M42A 2DTUA 2EHGA 2RF2A 2OPPA 4CF1A 5I3UA 1HPZA 4Z4EA 3KLFA 1JLFA 2VG5A 3LAKA 3KKRA 3VQEA 4CEDA 3OVNA 4KHYA 2F8SA 1B9FA 1VRUA 3NGYA 2OZSA 1KLNA 3D45A 4IDKA 4E1MA 1IKWA 1Z26A 2A1RA 3K2PA 1U48A 2G8HA 1VSIA 4CFDA 2O4IA 1RDBA 2W42A 1UA1A 4FLTA 1S5JA 3I0RA 1WSEA 1DLOA 3V1OA 4CK3A 3VA0A 3OY9A 3VQ7A 2LSNA 4CEQA 4O5BA 4CJVA 1J54A 4YFUA 2JLEA 4C8KA 3M8RA 3JSMA 1HYVA 1ZBFA 3KKSA 2X78A 2KW4A 1HMVA 1ITGA 2DFFA 3ASMA 3NE6A 3PV8A 1SL2A 3JYTA 3K5LA 2HHVA 4C8OA 4CJUA 3PO4A 2X6SA 4FZZA 1RTDA 1LAWA 4K8ZA 3QO9A 2Z1GA 3BGRA 4MFBA 3ZSXA 1W9HA 3ZT1A 3RTVA 4KHWA 2P1JA 4RW8A 3O3HA 3HPOA 3AA3A 1XHXA 2BANA 3TAEA 4H4OA 3S3OA 4M3TA 1RT1A 3KTQA 3KD5E 1L3VA 1A5WA 1TGOA 1QHTA 3SPZA 1ZBLA 4DLGA 3SUNA 2HHUA 2RPIA 2DFHA 2XRIA 3DOLA 3HSTB 3SZ2A 3U6FA 3HM9A 4KI6A 3QEIA 2E6MA 1DTQA 1KSPA 2KTQA 3SJJA 3D0PA 3NF6A 4CIFA 2EX3A 3AVNA 1C0TA 4FK0A 3HVTA 3CFRA 3TAMA 1RTJA 1Q8IA 4RW6A 5K14A 2A1SA 3SQ4A 4KTWA 4K8XA 4L8RB 3SPYA 3AVCA 4JLHA 4WE1A 1VSDA 4CGDA 4AH9A 1RTIA 4J2BA 3WNGA 1L3TA 4FJJA 5CZ2A 2YHAA 5HRPA 3KK3A 3HXMA 3TR8A 3B6OA 1WSJA 4O0JA 1LW2A 3NFAA 3VQCA 3LWLA 4JS4A 4BACA 2WONA 4N56A 4DTRA 4DQIA 3TABA 4CEEA 3RRGA 5HRNA 4LD0A 1NJXA 1QQCA 4DFKA 4CGHA 3V9UA 1ASUA 4DQPA 4FLUA 1C6VA 4E3SA 2BGGA 3EYZA 4M3ZA 4RW4A 4DQRA 4NYNA 3SUQA 1BQMA 4CGIA 4DTUA 3RMAA 2QKBA 3AVJA 4BWJA 4ZHRA 4AHCA 2VG7A 3G10A 3KK2A 1L3SA 2RKIA 3QIPA 4FJMA 1JL1A 1ASWA 4B9LA 3ALYA 3ZSQA 4FJHA 3NH0A 4I7FA 3NAEA 1ASVA 3RMDA 2XY6A 1HQEA 5KRSA 3V9WA 4GW6A 4FZYA 1O1WA 1I3AA 3MXJA 4HUEA 3OYJA 5HRSA 4DS4A 1QSYA 1RDCA 4EP5A 2HMIA 4Z4HA 1EP4A 1T05A 3WNHA 3LPTA 4B3OA 5FROA 2PYJA 4I9QA 4KFBA 3ZSWA 4E89A 2G8KA 3OS1A 2Y1JA 1VSFA 4PA1A 1RDDA 1B92A 1UA0A 5KTQA 3SCXA 1NK0A 1RNHA 3F9KA 1S6QA 4ZTFA 3CM6A 1TK0A 3DLKA 1HRHA 4C8MA 1X9WA 1BI4B 4FJKA 1X9SA 3HL8A 1JL2A 4ELTA 1LWFA 4KB1A 2YHBA 4CEOA 5KI6A 4OKKA 3FFIA 1NOYA 3TAGA 3LANA 5CZ1A 4BDZA 4LSLA 3VQBA 1IG9A 4FJ5A 4M3XA 4FW2A 4E19A 4BE2A 3AVLA 2G8IA 3AVKA
chains in the Genus database with same CATH superfamily
3THYB 5EXWA 1HYSA 4RW9A 3CQXA 1U6ZA 5M1PA 1M1KO 2GWJA 1U04A 4JHDB 3PX4A 4JI8K 4GKJK 5AJ3K 4CZLA 1JLBA 3OW2M 4OLBA 3LL3A 3B6PA 4C23A 4LC9B 3CJ7A 3THWA 2Q1NA 3PIPL 2HVHA 2QXFA 3MXIA 3VEOA 2ZJQL 3SV3A 3V9XA 3DI6A 2ETJA 1VSJA 3SAHA 3CPWM 3V81A 3HRGA 4FVMA 3OYDA 5EVZA 1Q9XA 1RBUA 1S6PA 2GUPA 5JLHA 1NK4A 2BE2A 5CYMA 1XQSC 3KLGA 5BN8A 5AQVA 5GAGP 3OYCA 3QNNA 4CEFA 1D9DA 4DTSA 2QM1A 1YXQA 1NGDA 1GOCA 1IG8A 4B8AB 1N34K 3H3NO 4QAGA 1WBDA 4C8NA 4OPJA 4W5NA 3O08A 2JWKA 2YNIA 4M7YA 3P83D 3WQTA 4OJRA 3PY8A 2QWRA 2NRZA 3HPHA 4BR7A 3K58A 1S1WA 3THYA 2HBJA 1WN7A 3L4QA 4I9LA 4CHOA 5T7BA 4CBWA 4FJLA 1KRPA 4MLHA 1I39A 3MEDA 3ZT3A 3ZX2A 1G15A 2NLXA 4Q5VA 4JI5K 5CY4A 1IKVA 5AQNA 3N4QA 3VQAA 3O3FA 2GV9A 3SQ1A 1QVGM 3AA2A 5AQPA 4A57A 1YJ9N 3D2EA 4YOWA 3MK6A 1FXXA 4H4MA 4BR0A 2V7YA 4OO1J 4CZIA 1JLAA 3D2EB 4DFPA 3AO4A 4HTUA 1X9MA 1OH6A 3HP9A 4KKOA 2KQ2A 4FLZA 3L2QA 2G8VA 4H0PA 5FRMA 3IMXA 3RMBA 2UUAK 1OH5A 3O8MA 4H5RA 4WQ5A 4CBUA 5BPLA 1SL1A 2GELA 2YHYA 3HO1A 4CBXA 2UUCK 2WBNA 4IXCA 4F2RA 2Q0UA 3U8XA 1K9MO 3CXCM 1VQLN 2NRVA 2NRXA 4I2PA 3BZCA 3QERA 5E41A 1KFSA 4FWNA 4CZEA 2O8FA 4ID1A 3BUZB 4HCCA 1ZC6A 4HUFA 3THXA 1WSIA 4CJQA 5AQRA 4DSEA 4K41A 4FW1A 2HNZA 4DSJA 1ZBIA 2D0AA 4CGJA 3ULEA 5MLCQ 1SKSA 4IJAA 3M5RA 4GVEA 1BIUA 1RT3A 4DV7K 2KFZA 5EOYA 3QEWA 4KHSA 3G0ZA 4M45A 4FXDA 1TK8A 4CW7B 4YOTA 2FF6A 4MDBA 4LY7A 2P9UA 3O4QA 3M8QA 3T69A 3J7ZO 2Z1IA 1SQKA 3ZT2A 2W6LA 4Z0UA 4B9QA 3OYHA 3DAWA 2FBVA 1HJRA 2QWLA 3CJCA 2ITGA 1C1BA 3SYZA 3A5MC 4BRFA 3LDPA 2O8EA 3LP2A 5SWMA 3HBTA 1BG3A 3D6RA 3DM2A 1Q9YA 4LFBK 1QVFM 3MXMA 2ZE2A 3V4IA 4CF2A 4Z4CA 1U4BA 3DRRA 2ZM6K 4AHVA 3KLIA 2XY5A 1MDUB 4BGAA 2IIRA 4O8KA 1O13A 1X1PA 1MU2A 3OYEA 3RSEA 1K8AO 2PYLA 4BROA 2HVIA 1VSHA 3ZCMA 2CH6A 1XI1A 4DR2K 4LH4A 4F8RA 1RT4A 2P5GA 3V1QA 1GLDG 3LWMA 1J5OA 1JCGA 3IRXA 1RTHA 4KTZA 4J2AA 1D9FA 1Z25A 2P9NA 5ADXH 5FLXO 2P9SB 3IFRA 4DSKA 2HMPA 4E1NA 1NGBA 4NYFA 1VQ5N 3SNNA 1NGJA 2YNHA 1WSFA 4FWPA 2XHBA 5C10A 4E7HA 5HRRA 1IBMK 4N5SA 1RT5A 4CF0A 2HHXA 2IVNA 2Q36A 3K5MA 4CZGA 2D0OA 1U2VA 3EEQA 3CCMN 1XWLA 3EKUA 4WQ4A 5EX5A 1RDUA 1QS4A 2E2QA 2P9IB 5KQDA 3DRPA 1NK6A 4CERA 4BGBA 3EO3A 2B5JA 3FZFA 3O9QA 3CMEN 3VQ9A 3L3VA 1VQ7N 3O9TA 4LSNA 1KD1O 5TKWA 5JMVA 3DOKA 1GOAA 5AQSA 2O8BB 4M3UA 1BUPA 2GUIA 4DTJA 3THVA 4FLXA 3E9PA 3TAPA 4KH5A 1IBLK 4IKFA 3OJSA 3AVAA 3TAFA 4FK2A 1S9GA 2QA4N 3MWTA 4FJGA 4CFCA 3L2WA 3FLCO 4LFCK 4BRGA 3U9DA 4HUGA 3C7NB 1R0AA 4CJRA 2D5RA 3UE5A 3LPUA 5HBMA 4B9NA 5KGWA 4PKGA 1TVRA 1BDGA 3CERA 1VAZA 3VEZA 3CQ8A 1RT7A 3JAMO 1JXEA 1BCOA 1HLUA 4EP4A 4AM7A 3TSPA 1TL1A 2YI1A 3VEXA 5I3UA 3AGRA 3HTVA 3VQEA 1Q7YO 4CEDA 3OVNA 4H5NA 3D45A 1IKWA 1Z26A 3D2FB 3CQYA 1VSIA 2O4IA 1UA1A 3GG4A 1WSEA 4O5FA 3WXIA 4EHTA 3OY9A 4PKIA 1J54A 4C8KA 3GL1A 3M8RA 3HOSA 1ZBFA 3KKSA 4IEEA 1HMVA 3ASMA 3NE6A 3PV8A 2UU9K 3H3OB 3HOTA 3VF6A 3JYTA 1RTDA 1LAWA 3QO9A 4FSVA 4MFBA 3ZSXA 4KHWA 3DWLA 2P1JA 3O3HA 3HPOA 3VERA 4GV6A 3WUHA 5JLFA 3KTQA 4JI4K 2V51B 2HHUA 5AFUA 1E4FT 3EE9A 3LDOA 3A5LC 3HM9A 2E6MA 5ELZA 5BRFA 3BF3A 3HVTA 3CFRA 3GE1A 4RTFD 1WUAA 4K8XA 4WE1A 4B1ZA 3C0BA 4DQ8A 3WNGA 5AR0A 1XMQK 2YHAA 4MO4A 4JS4A 4JYAK 4BACA 4DTRA 3LDLA 1NJXA 1QQCA 2QWMA 2BTFA 4BQZA 5KPRA 3ZETB 4FLUA 2VQEK 2YHXA 4CGIA 4BWJA 1RDWX 4ZHRA 4AHCA 3A5NC 3BZKA 4K42A 4FJMA 4B9LA 3HZ6A 3CMAN 4FWMA 3NH0A 4I7FA 5KPZA 3ATVA 2W6KA 1ASVA 3RMDA 1HQEA 3GBTA 4EIAA 4F9OA 3V9WA 4FZYA 1I3AA 3NVMA 2E1ZA 4EP5A 1ZBSA 4H0OA 1EP4A 1JCEA 1HR0K 1C0FA 5FROA 4B3OA 4DR7K 3WEEB 3ZSWA 2G8KA 2NNWA 3OS1A 1YVNA 1VHXA 3SCXA 1NK0A 1RNHA 1S6QA 1TK0A 1GLCG 5M1OA 3DLKA 1BI4B 4A5BA 4FJKA 4L3QA 1ESVA 1QQNA 4CEOA 3K9JA 5KI6A 3VTHA 4RWTA 3FFIA 4BDZA 1KC8O 4LSLA 3VQBA 3THXB 1NM1A 1KAZA 4X65K 2DFEA 3UKRB 1BOTO 3HK2A 2IDOA 5GAEP 3ZT4A 3SMPA 5SZTA 4CJLA 2HBLA 1TKTA 4H0XB 4QS8A 4DWIA 3P31A 3K5NA 3AVFA 3I33A 4ISFA 3VEVA 1YF5L 2HW3A 4O55A 4JAXA 3M3ZA 1EETA 4M3RA 2WUSA 1MWKA 1YVUA 1REVA 3L8BA 4B9TA 4QOZB 3TSQA 4KPYA 1EKEA 3W0LA 4CCHA 4FK4A 4Y1CA 2O8CA 1T7PA 1EX4A 2E20A 3M8PA 2W41A 1RT2A 4KH4A 4LF8K 3WNFA 4F3OA 4DR1K 3UIQA 4GY2B 4O44A 3UKUA 4LF5K 1NOZA 1SKRA 2FBXA 5E26A 2E1YA 3AVHA 3KJVA 4CFBA 5FDLA 4F4KA 3TAQA 1X3MA 3WXMB 2WOMA 3U9ZA 1KVBA 1BGXT 1SS6A 4HVJA 3OYMA 4CJFA 4JRPA 3NH1A 3GOIA 4DTMA 4FJ8A 2HF4A 2X74A 3KD1E 1ZBUA 4KB0A 4FOEA 2E6LA 1GOBA 3MX2A 4IOAL 1BA1A 4B9VA 4J8FA 5IWAK 4CHQA 3QINA 1TV6A 4I2QA 1JLQA 3PUFA 3K57A 3VA3A 5AQZA 2IGIA 2UYTA 2F96A 1BIZA 3VGLA 3FGUA 4DQSA 1LW0A 1J9AA 2XY8A 2H3GX 4DR6K 3T19A 3SBTA 2KKZA 4DMNA 1NMNA 3NGIA 3RRHA 1EXQA 2P51A 4E7IA 5HLFA 2CGKA 3AA4A 1NK8A 1T44A 1ILYA 4OGEA 1KTQA 3I0SA 5JS2A 3M8SA 1S72N 4WQ4C 3T3FA 3AVBA 3H46O 4HTLA 4CJKA 1CLQA 1GLFO 3V1RA 1TK5A 1WSHA 2KHOA 4DQQA 3M6GA 4KHNA 4GV9A 1T3VA 1J5EK 5I9EB 1JLGA 3MN7A 4LH5A 4CZJA 4WFBL 3NF7A 5AFUH 3UKUB 3EZWA 4BY9C 1VK0A 5AQGA 1VRTA 3C6AA 1TKXA 1P8ZA 2Q3SA 2FBYA 5LMUK 2Z1HA 3C6HA 4KV8A 4M7XA 4KAZA 5J2NA 3CC7N 3T7ZA 4NLCA 3CD6N 3L2RA 3A5OC 3HSCA 1NGAA 4JS5A 1ZYQA 3MCAB 1ATRA 3CM5A 4YDUC 5AQQA 5AZJA 4FCYA 3RWUA 4CESA 3FFKB 4LF7K 1NGHA 1RBRA 2HOEA 3QLHA 3Q7BA 4FWKA 1NKBA 1JLCA 2NRTA 4BR5A 4DHYA 5LJWA 3LAMA 3ID6A 4ICLA 4M41A 2OZMA 2Z1JA 5JICA 2HHSA 3QBWA 3FZHA 1S1XA 4JEPA 3OBWA 2PAVA 4B1XB 4B3TK 3CCRN 3Q7CA 2O8FB 3EE8A 3TSUA 3RSEB 1YHQN 4MQ3A 4KREA 3O4WA 4FLWA 4BR2A 3SQ0A 3QEXA 4PWDA 5HL7L 4DF4A 1RDAA 3V9ZA 2NRHA 1TYQB 3ZEUA 4ID5A 2NUBA 3LP3A 3IUCA 1WBBA 3LP1A 3VQDA 4G9ZA 1HKCA 5BR9A 4K43A 4LF6K 5AQHA 3PX6A 1T03A 3CFOA 1K6YA 1HNIA 5J2MA 3NVKA 4RG8A 4XEIA 3I56N 4KHQA 1XC3A 4CJWA 5C15A 2ZF5O 3SUPA 4JKBA 3HP6A 4E7KA 4EHUA 2ZD1A 4H0TB 3BF1A 3NDKA 2XO7A 4DU3A 4WQ5C 1FJGK 3P39A 4CIGA 3TI0A 4EZ9A 4DR3K 2A6AA 1CXQA 3ZSYA 3CHWA 2QEXN 3L4IA 4DUZK 1W7AA 3BDPA 4YNQA 3HPGA 1LWEA 1VSEA 3OYGA 4N41A 3H08A 3EKSA 3DXKB 1YITN 5DK5A 3VQ6A 4KI4A 1L3UA 3U3YA 4AQYK 2YV0X 4OLAA 3D7EO 3AV9A 2ZQBA 4DV1K 1KVAA 2QXLA 1BL3A 4I6MA 4DS5A 4NCBA 4NB4A 3WXKA 4EAHD 4LF4K 4CJ7A 1MA9B 3C6TA 3OBYA 4CIEA 4B1UB 4IFVA 3ZETA 1BI4A 3L2VA 3VN5A 4H5VA 4JKAA 4FWQA 1QE1A 2IOCA 3CIPA 3VOVA 2PY5A 3C6UA 3TARA 2HF3A 2G8UA 2NRWA 4IG3A 4OGCA 3TANA 2G8FA 1SAZA 4BE0A 1RBVA 1L5UA 3ZSRA 2QKKA 3FR0A 4CJ5A 5JVHL 1NMDA 4CZMA 1A5XA 3A0IX 1N6QA 3AA5X 2P9LB 2YNGA 3O5BA 4CZFA 2F9TA 4KHYA 2F8SA 4IO9L 1B9FA 3NGYA 1EWQA 1KLNA 1QZ6A 4IDKA 1N32K 1N8RO 3K2PA 4CFDA 1RDBA 2W42A 1K8KA 2QWQA 3VA0A 2LSNA 4BREA 4BVPA 3CC2N 2DFFA 1SL2A 3K5LA 2HHVA 4CJUA 2E5LK 3PO4A 1RFQA 4WF9L 5BRDA 3LM2A 3BGRA 2ZGYA 1W9HA 3ZT1A 4RW8A 2F7TA 3AA3A 1L3VA 1TGOA 4NXNK 4B1VA 1RGIA 4DR5K 1ZBLA 2DFHA 2XRIA 3DOLA 2VYPA 1NG9A 3QEIA 1OKJA 2CGJA 1DTQA 1KSPA 3VGKA 3G25A 5ADXA 3E1YA 2EX3A 1X9JA 4FK0A 4RW6A 1Q8IA 4QS7A 1TYQA 4E1JA 3SPYA 5AZIB 4B1WB 1RTIA 4FJJA 3KK3A 1HNZK 1NJIO 3TR8A 4O0JA 2QTDA 3B6OA 3DLLL 4N56A 3TABA 4CEEA 3SK3A 5HRNA 4DV2K 1DEJA 4CGHA 1TUYA 1Q18A 2ZJRL 4E3SA 4M3ZA 5AQYA 4RW4A 4NYNA 2J4RA 3BEXA 2E2NA 4DTUA 4ISEA 4BC5A 1JL1A 4EFHA 1ASWA 3ZSQA 2QWPA 5KRSA 3PLAA 3WXLA 4GW6A 4HUEA 4DS4A 3OYJA 1RDCA 4B3MK 4YOVA 2YX6A 1T05A 2P9IA 2PYJA 4E89A 1WOQA 1B92A 3BY5A 4IEIA 3CM6A 3QBXA 3C65A 4KHPK 1HRHA 3CCUN 2JWLA 3D2FA 2UUBK 2YJFA 2A5XA 1X9SA 3HL8A 4ELTA 2E8AA 5AQLA 4KB1A 2YHBA 3AVLA 3NMUA 3TAGA 4C1NK 5B8HA 4FJ5A 4M3XA 4BRKA 4QS9A 4BE2A 1YAGA 2G8IA 2D4WA 1E3MA 2QK9A 1OVQA 4JI1K 2A40A 5BRHA 1KFDA 1N5YA 2FC0A 4V19S 1IV0A 1VQ6N 1SL0A 1WB9A 3EY1A 3K0SA 3VF2A 1SUQA 4BRIA 1EWRA 3ZX3A 1R59O 4HHTA 4FJXA 4B9SA 2BH1A 4CF9A 4FJNA 4M3YA 1S1UA 1KAXA 2OA8A 4JRQA 1D8YA 2F9WA 4CK1A 3E01A 3TTDA 4B9UA 2KLAA 4BRNA 4FWRA 3OYLA 4OX9K 3H45C 2RN2A 2B4JA 1UAXA 4KBOA 1KVCA 3A2FA 4YY3K 4CJSA 4IFEA 3KWGA 2AA4A 3IDHA 3SI6A 2BDPA 1NK9A 1GLEG 3VENA 3PIOL 1FKPA 4BVOA 4J2DA 1D5AA 1T6CA 1TL3A 4TSXA 1OVYA 2FBTA 3AO2A 3MEEA 4BWMA 4DKWA 2VQFK 4FO0A 4JKGB 1BISA 1VSMA 2P9SA 2HBKA 3CJ9A 3ENOA 2HB5A 4GVMA 4ILJA 4MDAA 1Z05A 4H8KA 1UOCA 2Y1IA 4HCBA 2Q0RA 2VWJA 4F3TA 4IBNA 3J80O 3K9KA 1IBKK 1VQKN 1SZ2A 3R3LA 2ASMA 4Z4GA 5D3GA 3QEVA 4KH6A 4CVNE 1B9DA 1DKGD 4JHDA 2HHHK 5HP1A 2WFBA 1C0UA 4DTNA 4WCEL 1FKOA 5E84A 4DLEA 4DSLA 4OKJA 3VQ4A 4N76A 1IKXA 1IH7A 4CHNA 4RW7A 5J2PA 3AVMA 4F2SA 2KZMA 3I55N 1TAUA 3WXJA 2IC3A 4FM0A 4Y0WA 3MN6A 3TTCA 4M42A 3PO5A 1NBWA 2HHTA 3AO5A 2PFUA 2OTLN 4JD2B 2FSKA 1Q81O 3BP8A 5FRNA 3E66A 4E7LA 3SAGA 5FPDA 3RR8A 4DTOA 1NGCA 4M3WA 3KVGA 3WT0A 3S3NA 4JN4A 4DFMA 3FZLA 4W5QA 5CR4A 1TUUA 3MDQA 2QI2A 2EWSA 4PL7A 4B8CA 1RBTA 2D1KA 5GINA 3G71N 5AQUA 3A8YA 3B8AX 1QQOA 5AQWA 3N4PA 3R8EA 2PZSA 5LY3A 4E0DA 3P1GA 4X62K 4B3RK 4ILHA 1CZ9A 2KZZA 4CF8A 1OH7A 2HHQA 4AHTA 4OPKA 2FXUA 3LALA 1WLJA 1NGEA 4FYDA 1KCFA 4DSFA 1BHLA 4CD1A 4BG9A 4CEBA 1KQSM 1QSSA 4H5WA 2VWKA 2E4LA 4NLBA 4JNEA 1CZBA 3O9UA 3EN9A 5DM7L 5FPNA 5IT9O 5BN9A 1SV5A 1F21A 1VQNN 1IO2A 1U47A 4WFAL 4KHUA 3VTIA 2QWNA 5KRTA 1QTMA 4B9MA 3QEPA 4JK7A 4BE1A 4PY5A 4A61A 2OPSA 3CCSN 1HJOA 3AVIA 2IVOA 2DPNA 4O0IA 2OTJN 3AO1A 4A62A 2GEMA 4CE9A 4JKDA 1M90O 5C25A 3ISNC 4YOXA 3J7YP 1WAFA 3L3UA 4O8UA 3HVRA 4K0KK 4Z4FA 3KK7A 4CJ3A 5LL6Z 2WC9A 4DFJA 1IJJA 4B3SK 4I6MB 4JI3K 3TPQA 3U4LA 1C1CA 1FK9A 4GMJB 3DLGA 5A2QO 4CECA 2P9NB 4FPAA 2HNYA 4K25A 4FM2A 4C1NI 3TWHA 1NLVA 4KO0A 5F2RA 3CCLN 1NNEA 3ATUA 3DYAA 3AAPA 4ELUA 3VESA 4BRPA 1TKZA 3F2KA 1NKEA 3MX5A 3OYKA 3QB0A 4GNIA 4UQGA 4W5RA 4E7JA 1K8KB 5DM6L 3C94A 2O8DA 4IWVA 2UXCK 3KWIA 1VQ9N 3CCJN 1WSGA 4JI7K 1VSLA 1ZXOA 4QCLA 3O1BA 3CYMA 3G4SN 4YOYA 4DG1A 4Y1DA 3NBPA 4Z94A 4CJ4A 1JJ2M 3WEEA 4PKHA 3LDNA 3SUOA 3RMCA 1J6ZA 4Q0BA 4FJ7A 4CFAA 3CFPA 5HROA 5J2QA 2PBDA 1YI2N 1HUXA 1CXUA 4BR9A 1NGFA 3MMVA 5EU7A 2CGLA 4AHUA 3QDKA 3ULEB 1CZAN 3SV4A 1EO1A 3P5JA 1Q82O 2HNDA 3SAFA 3VPZA 1MWMA 4U67L 2X6NA 2ZGZA 3I8DA 4YDUA 4NCAA 2JGUA 2VG6A 4AILC 4ISGA 3VETA 4AHRA 1LOTB 3AVGA 3OTOK 3RVCA 2OPPA 5M1NA 1HPZA 4U7BA 3KLFA 4MO5A 4BR4A 4Z4EA 2E2PA 4DV5K 1YJWN 1VRUA 4H0VB 3SBGA 2YCHA 3O80A 4H0YB 1QHAA 1V4TA 4FLTA 3I0RA 4CK3A 1NU0A 3E9OA 5CHIA 1GLLO 2E2OA 1BO5O 4O5BA 4CJVA 4YFUA 1HYVA 4A5AA 3QICA 2KW4A 1Y64A 3VMFB 4C8OA 4FZZA 5M1FA 4K8ZA 3AGKA 1VQPN 4AF1A 3RTVA 1GLJO 2BANA 3TAEA 4H4OA 3KD5E 1A5WA 4X64K 5GIOA 4OPAA 3SPZA 4DLGA 2O8EB 3U6FA 1N33K 1FW6A 2ASOA 4KI6A 3I8BA 2KTQA 3AVNA 4WYBA 4WFNL 3SQ4A 5K14A 5FPMA 2A1SA 4KTWA 3AVCA 4JLHA 4AH9A 3HXMA 2NZTA 4IO8A 1WSJA 4MLEA 1LW2A 3AARA 4BRCA 1QSYA 4DQIA 2WONA 3TTFA 3RRGA 4XH5A 4DFKA 3WQUA 3V9UA 4CI6A 4CZKA 3F5TA 3DXMB 4A59A 2BGGA 4H5TA 4BRHA 4DQRA 1BQMA 1OH8A 3R6MA 3RMAA 2QKBA 3G10A 2RKIA 3QIPA 3ALYA 2A3ZA 4JKCA 4DV6K 2A42A 2XY6A 1XNQK 1HKGA 2HMIA 2V52B 3JXUA 3WNHA 4I9QA 4KFBA 5LMNK 5KTQA 3F9KA 2AP1A 2YJEA 1HNWK 1JL2A 3W3DA 1U2VB 3CJBA 4FWLA 3LANA 4E19A 3AVKA 2OANA 4LF9K 1Z6RA 4CJTA 1HNVA 3C95A 2D0BA 5F1XA 5C0YA 5JS1A 1I94K 3MAQA 2YKMA 3V6DA 2ATQA 5EY4A 4JI6K 2IAJA 5AZJB 3VQQA 3S3MA 3ULDA 3CCQN 3ITHA 4IFYA 4G1QA 4XH4A 3LP0A 3NF9A 5AQTA 4FVUA 3KLHA 4JKFA 2HSTA 3T1YK 2O8CB 1W97L 3VQPA 3TU5A 2QW9A 3ZLJA 2VWBA 1ATNA 4JK9A 2I5JA 2P9UB 1RILA 2FF3B 3ZX0A 4B08A 1JKHA 1YTUA 3KK1A 4DV0K 4CGFA 1BU6O 3OS2A 3VGMA 4DSIA 1XMOK 1VQ4N 1GLBG 2P9PA 1HQUA 4KRFA 1HYZA 2R7YA 3QETA 2ASPA 3HJFA 2O4GA 3QIOA 3VEWA 4KTQA 5AQIA 3IS9A 3NGZA 3L6QA 1Y97A 3IG1A 3CCVN 1SKWA 3T1AA 2AJQA 4FJIA 1E4GT 3ZSOA 3GDQA 1S22A 3OYBA 5JVGL 3QFUA 3CCEN 4BRLA 3K59A 1NK7A 4CEZA 4LFAK 4X66K 3CPEA 1KAYA 3OYNA 4JI0K 1JXBA 3CJ1A 2OPRA 1LV5A 1X3NA 2IVPA 3DRSA 4CJEA 4AM6A 4J2EA 2KFNA 1EQYA 3VF4A 4BC4A 1W2BM 5BPMA 1XHZA 4R79A 1LAVA 3KLEA 4BDPA 2O8DB 3OYAA 1NJWA 2GX9A 4O4GA 3QNOA 4ZTJA 4UY8O 4PQUA 4W5OA 3DLEA 5AQXA 2DY4A 3DXMA 4C8LA 4Z4IA 5GIPA 3CI5A 1NGGA 3O4NA 2V7ZA 1JLEA 1HKBA 2G8WA 3ZEUB 5AQFA 1U49A 2FSNA 1ZBHA 2P9KB 1KLMA 4FM1A 1HX1A 3OYFA 4IOCL 5I42A 3RR7A 2ZJPL 3PX0A 3PSIA 3HT3A 3DLBA 3FZMA 1W0HA 4IG0A 4CZHA 5DMRA 3C7NA 4W5TA 1BA0A 1LWCA 2F4VK 5M1QA 4BRMA 1U45A 1YT3A 1T8EA 4PHTX 3QESA 4DTXA 2VGMA 5F0XA 4DTPA 2HHWA 1DGKN 2D0CA 3R9PA 3HYFA 1LCUA 4FOIA 1RT6A 4R5PA 3LDSA 1S9EA 3VQ8A 1VSKA 3ZYYX 4HWIA 3OJUA 3J81O 1P90A 4AHSA 4BDYA 1H1VA 4CHYA 1BQNA 1BWFO 2HBMA 1IKYA 5AQKA 4JV5K 1TKDA 3SLCA 2Q31A 1S3XA 1GLAG 3DMJA 3IAYA 3U3GA 2BUPA 1NWKA 3LZJA 3PSFA 1UWBA 4ELVA 2OCEA 3MCPA 1S1TA 3FZKA 4DB3A 1C0MA 1NKCA 5C42A 3NCIA 3CC4N 1VQON 4YORA 3KIOA 4IDHA 5C24A 4OVLA 3CJAA 5C2FA 5KPTA 3H1VX 4JKHA 4PL8A 5GAHP 3OYIA 4FJ9A 4A2AA 4FLVA 4DCHA 4OKEA 1RBSA 4CK2A 3CG7A 1J53A 2P9KA 2ITMA 4PUOA 5AQOA 1NGIA 2D0PA 3UB5A 4BQLA 1C1AA 2RE2A 4FZXC 3ZT0A 2VGNA 5M1KA 4YOUA 3SQ2A 1NK5A 4CHPA 2Q97A 1RCHA 4FWOA 2P9LA 3FE1A 2E88A 3SJHA 5TKYA 3DLHA 3EZ5A 5CE3A 3O3GA 2XY7A 4EZ6A 4BRDA 1DT9A 3LZIA 1YJNN 3H1QA 3O9SA 2OYQA 4CHZA 1QQMA 3ZSVA 4NXMK 3L2UA 2I7NA 4CEAA 4ILGB 5CYQA 1VQMN 1XNRK 4JKEA 5BR8K 3THWB 5FPEA 1D4XA 3IKMA 3JS6A 3NHGA 4JD2A 2YNFA 3V9SA 3WNEA 1NJZA 1WNSA 1VQ8N 4NO7A 3DXKA 4N47A 4YHHK 2IS3A 4CGGA 5BPNA 2UXDK 1QZ5A 3ID8A 2OPQA 1BCMA 1TAQA 3VQ5A 3NF8A 2WTUA 3O6WA 1ATSA 1WAJA 4DU1A 2GTDA 4XIUA 5AQJA 3H6EA 2VCPA 3EL2A 2B6AA 4GV3A 2P5OA 4DU4A 3ZSZA 3MECA 5KGXA 1QSLA 4BRQA 4NCGA 1A5VA 3CF5L 1S1VA 2Q2RA 3J8AA 1YTAA 4XH1A 2A41A 3OS0A 4BC2A 1XC9A 3LDQA 4IJNA 2GWKA 3E9LA 4FLYA 3DLRA 4IZ9A 1YIJN 3AO3A 3NH2A 1DTTA 4IOXA 2F8TA 4DF8A 1N36K 5J1EA 3OA9A 3LM9A 3P4IA 3MN9A 2GBZA 5H1SQ 4CJPA 3K5OA 2CH5A 3SMSA 1NJYA 2YKNA 2DTUA 3S9HA 3F73A 1V4SA 2EHGA 2RF2A 4CF1A 1JLFA 2VG5A 3LAKA 3KKRA 3HI0A 2OZSA 1C0GA 4E1MA 2A1RA 2G8HA 1U48A 5BREA 3O9RA 1S5JA 3V1OA 1DLOA 1JCFA 3VQ7A 4CEQA 2JLEA 2RHKA 3JSMA 3CETA 2X78A 1ITGA 5HOOA 2X6SA 4FL9A 1Q86O 4JKGA 4FPBA 2Z1GA 3G6EN 3KZBA 4FWSA 2UXBK 3QFPA 5GADP 1XHXA 4M3TA 4A2BA 3S3OA 1RT1A 1QHTA 3AY9A 3VEYA 2FSJA 3O1WA 2P9PB 3SUNA 2RPIA 3KHYA 3HSTB 3SZ2A 4DV3K 3R1XA 4JK8A 3AAQA 5C2DA 3SJJA 3D0PA 3NF6A 4CIFA 1HPMA 1C0TA 2QWOA 3P38A 4CD3A 3UKRA 4BG8A 3TAMA 1RTJA 4L8RB 2W40A 5AZIA 4H03B 1VSDA 4CGDA 4J2BA 1L3TA 5CZ2A 4OPHA 5HRPA 2I7PA 3L0QA 3NFAA 3VQCA 3M1FA 3LWLA 3DJCA 1G99A 2FLOA 4LD0A 4RCHA 4BC3A 1KXPA 1ASUA 4DQPA 1C6VA 1T6DA 3EYZA 1K73O 3SUQA 3HM8A 3AVJA 3ENHA 4DV4K 2YHWA 2VG7A 3KK2A 1L3SA 5C12A 4BRAA 4FJHA 1XUPO 3NAEA 3QMLA 1O1WA 4DUYK 3MXJA 3ENBA 5HRSA 4DR4K 1YUWA 4Z4HA 5KQ8A 2O8BA 2NRRA 3LPTA 3MWPA 3J7AP 3MN5A 2Y1JA 1VSFA 4PA1A 1RDDA 3T1HK 1UA0A 4GKKK 4ZTFA 2ZWHA 4C8MA 1X9WA 5AQMA 4B1YB 5LJVA 1LWFA 3S41A 4OKKA 1HNXK 3F9MA 1NOYA 3OHRA 5CZ1A 4JI2K 1IG9A 4FW2A 4M63C 3MEGA
chains in the Genus database with same CATH topology
2QK9A 4CJTA 1HNVA 1HYSA 1KFDA 2DFEA 2D0BA 3C95A 4RW9A 1N5YA 5JS1A 3HK2A 2IDOA 2FC0A 3ZT4A 1U04A 5SZTA 4CJLA 1TKTA 3MAQA 2YKMA 1SL0A 3EY1A 3PX4A 4DWIA 3V6DA 3K5NA 2ATQA 3AVFA 2HW3A 2IAJA 4O55A 1SUQA 1JLBA 3VQQA 4HHTA 3S3MA 1EETA 3ULDA 4FJXA 3B6PA 4OLBA 4M3RA 3ITHA 4B9SA 4IFYA 4G1QA 1YVUA 4CF9A 4FJNA 4M3YA 1REVA 1S1UA 3LP0A 3NF9A 3L8BA 2OA8A 4B9TA 4JRQA 1D8YA 4QOZB 3KLHA 4KPYA 1EKEA 4CK1A 4CCHA 4FK4A 3E01A 2HVHA 4Y1CA 1T7PA 2QXFA 4B9UA 1EX4A 3MXIA 3VQPA 3SV3A 3V9XA 3DI6A 2ETJA 1VSJA 3OYLA 3M8PA 3V81A 2RN2A 4FVMA 2I5JA 1RILA 3OYDA 1Q9XA 1RBUA 1S6PA 1RT2A 2B4JA 4B08A 1JKHA 1UAXA 3WNFA 4F3OA 1YTUA 1KVCA 3A2FA 3KK1A 1NK4A 2BE2A 5CYMA 4CGFA 4CJSA 3OS2A 3UIQA 4O44A 4DSIA 3KLGA 1NOZA 1HQUA 1SKRA 3MEGA 2FBXA 2BDPA 3SI6A 4KRFA 1HYZA 3OYCA 2R7YA 1NK9A 3QNNA 4CEFA 3QETA 3AVHA 1D9DA 3KJVA 4CFBA 1FKPA 4DTSA 3HJFA 1GOCA 5FDLA 4F4KA 4J2DA 1D5AA 3TAQA 2O4GA 4B8AB 1TL3A 2WOMA 4TSXA 3AO2A 2FBTA 3MEEA 3QIOA 1KVBA 4QAGA 4BWMA 1BGXT 4C8NA 3IS9A 4HVJA 4OPJA 3NGZA 3OYMA 4KTQA 4CJFA 4JRPA 3NH1A 2YNIA 1BISA 1VSMA 3P83D 4DTMA 1Y97A 3IG1A 1SKWA 4GVMA 4OJRA 3T1AA 2HB5A 4FJIA 3PY8A 4FJ8A 2AJQA 2X74A 3KD1E 1ZBUA 3HPHA 4H8KA 3ZSOA 4KB0A 1UOCA 2Y1IA 2E6LA 1GOBA 1S1WA 3K58A 4HCBA 3OYBA 2VWJA 4F3TA 1WN7A 4IBNA 4I9LA 4CHOA 5T7BA 4B9VA 3K59A 4FJLA 1NK7A 1KRPA 4Z4GA 4CEZA 4CHQA 3QINA 5D3GA 1TV6A 1I39A 3MEDA 4I2QA 3QEVA 1B9DA 1JLQA 3PUFA 3ZT3A 1G15A 3K57A 3OYNA 3VA3A 5HP1A 2IGIA 2F96A 1BIZA 1C0UA 1JXBA 4DTNA 2OPRA 1FKOA 4Q5VA 4DLEA 4DQSA 1LW0A 5CY4A 4DSLA 1IKVA 1LV5A 1J9AA 2XY8A 3DRSA 4CJEA 3VQAA 3O3FA 2GV9A 4OKJA 3SQ1A 3AA2A 3T19A 3VQ4A 4DMNA 4J2EA 4N76A 2KFNA 1IKXA 1IH7A 3NGIA 4CHNA 4RW7A 5J2PA 1FXXA 4H4MA 3AVMA 3RRHA 4F2SA 2KZMA 1EXQA 1XHZA 1JLAA 2P51A 4E7IA 4DFPA 5HLFA 3AA4A 1TAUA 2IC3A 3AO4A 4HTUA 1NK8A 1X9MA 1LAVA 3KLEA 4FM0A 4BDPA 4OGEA 1KTQA 3HP9A 3I0SA 4KKOA 3OYAA 3PO5A 2KQ2A 5JS2A 3L2QA 3M8SA 4FLZA 1NJWA 2G8VA 4O4GA 5FRMA 3QNOA 4ZTJA 4PQUA 2HHTA 3AO5A 3RMBA 3T3FA 4W5OA 3DLEA 3AVBA 2DY4A 4CJKA 1CLQA 3V1RA 4C8LA 1SL1A 4W5NA 4Z4IA 1TK5A 5FRNA 3HO1A 1WSHA 3O4NA 1JLEA 4DQQA 4E7LA 2G8WA 3RR8A 4M3WA 4DTOA 4KHNA 4F2RA 3S3NA 1U49A 1JLGA 1ZBHA 4LH5A 3NF7A 4I2PA 4DFMA 1KLMA 1VK0A 4W5QA 4FM1A 1VRTA 3OYFA 3QERA 5E41A 1KFSA 1TKXA 2Q3SA 5I42A 2FBYA 4B8CA 3RR7A 1RBTA 2Z1HA 4ID1A 4KV8A 4HCCA 3PX0A 4HUFA 3HT3A 3DLBA 4KAZA 5J2NA 1WSIA 4CJQA 1W0HA 4IG0A 5DMRA 4DSEA 2PZSA 4W5TA 4FW1A 2HNZA 3L2RA 4DSJA 4E0DA 3P1GA 1LWCA 4JS5A 1ZYQA 2D0AA 4CGJA 1ZBIA 1SKSA 1CZ9A 1U45A 1YT3A 1T8EA 3QESA 4DTXA 4DTPA 2KZZA 3CM5A 4CF8A 2HHWA 4FCYA 4AHTA 4OPKA 3RWUA 2HHQA 2D0CA 1BIUA 1RT3A 3LALA 3HYFA 1WLJA 4R5PA 3LDSA 1RT6A 4CESA 1S9EA 3VQ8A 1VSKA 2KFZA 3QEWA 4FYDA 1KCFA 1RBRA 4KHSA 4DSFA 3G0ZA 1BHLA 3QLHA 4M45A 4CEBA 4FXDA 3OJUA 1NKBA 1QSSA 2VWKA 1JLCA 4AHSA 2E4LA 4BDYA 1TK8A 1CZBA 4CHYA 1BQNA 1IKYA 3LAMA 4ICLA 4LY7A 1TKDA 1SV5A 3O4QA 1F21A 3M8QA 2Z1IA 1IO2A 4M41A 1U47A 4KHUA 3DMJA 3IAYA 2OZMA 3U3GA 2Z1JA 3ZT2A 4Z0UA 3OYHA 5KRTA 3LZJA 2HHSA 2FBVA 1HJRA 1QTMA 4B9MA 1UWBA 4ELVA 1S1XA 2ITGA 3QEPA 1C1BA 3SYZA 1S1TA 3LP2A 4BE1A 5SWMA 4PY5A 1C0MA 3DM2A 1NKCA 2OPSA 5C42A 3NCIA 1Q9YA 3AVIA 3MXMA 2ZE2A 3V4IA 4O0IA 4CF2A 4Z4CA 1U4BA 3DRRA 3KIOA 4MQ3A 5C24A 4KREA 4OVLA 4FLWA 3SQ0A 3AO1A 3QEXA 4PWDA 4AHVA 4DF4A 3KLIA 1RDAA 4CE9A 3V9ZA 2XY5A 5C25A 3OYIA 4FJ9A 3ISNC 4FLVA 4OKEA 1RBSA 4CK2A 1WAFA 3CG7A 1J53A 4ID5A 2NUBA 1X1PA 3LP3A 3L3UA 4PUOA 1MU2A 3LP1A 3VQDA 3OYEA 3HVRA 2PYLA 4Z4FA 1C1AA 1VSHA 4FZXC 3ZT0A 3ZCMA 2HVIA 3PX6A 1XI1A 3CFOA 1T03A 1K6YA 4LH4A 1HNIA 4CJ3A 4F8RA 3SQ2A 1NK5A 4CHPA 1RT4A 1RCHA 4DFJA 5J2MA 2P5GA 3V1QA 4RG8A 4KHQA 4CJWA 1C1CA 3SUPA 3DLHA 3LWMA 3EZ5A 1FK9A 4GMJB 3O3GA 3HP6A 3DLGA 4E7KA 3IRXA 2XY7A 1J5OA 4EZ6A 2ZD1A 1RTHA 4KTZA 3LZIA 4CECA 3NDKA 2HNYA 4J2AA 1D9FA 1Z25A 2XO7A 4DU3A 4FM2A 4CHZA 3ZSVA 2OYQA 3TWHA 4CIGA 3TI0A 4EZ9A 4KO0A 4DSKA 3L2UA 4CEAA 4E1NA 5CYQA 3DYAA 4NYFA 4ELUA 3SNNA 1CXQA 3ZSYA 2YNHA 1WSFA 1TKZA 1NKEA 3BDPA 4YNQA 2XHBA 4E7HA 5HRRA 3OYKA 4N5SA 1RT5A 1LWEA 3HPGA 4CF0A 3NHGA 2HHXA 2YNFA 4UQGA 1VSEA 3OYGA 4W5RA 3WNEA 3V9SA 4E7JA 4N41A 3H08A 1NJZA 1WNSA 3K5MA 3C94A 4N47A 1XWLA 5DK5A 1WSGA 3VQ6A 2IS3A 4KI4A 4CGGA 1L3UA 1VSLA 1QS4A 4QCLA 3U3YA 3DRPA 1NK6A 2OPQA 4CERA 1BCMA 1TAQA 2B5JA 3CYMA 2YV0X 3NF8A 3VQ5A 3VQ9A 1WAJA 4OLAA 3L3VA 4DG1A 4Y1DA 4DU1A 4LSNA 3AV9A 4XIUA 2ZQBA 3NBPA 4CJ4A 2B6AA 1KVAA 1BL3A 3DOKA 1GOAA 3RMCA 3SUOA 2P5OA 4M3UA 4Q0BA 4DS5A 4FJ7A 2GUIA 4DTJA 3THVA 4CFAA 4FLXA 4NCBA 4DU4A 3TAPA 3ZSZA 3MECA 5KGXA 3CFPA 5HROA 5J2QA 4IKFA 3OJSA 1QSLA 3AVAA 3C6TA 3TAFA 4FK2A 4CIEA 1CXUA 1A5VA 1S9GA 4NCGA 4FJGA 4CFCA 1S1VA 5EU7A 4IFVA 3L2WA 1BI4A 3L2VA 3VN5A 1YTAA 4AHUA 3OS0A 1QE1A 2IOCA 1XC9A 3SV4A 4HUGA 3P5JA 2PY5A 1R0AA 3C6UA 2D5RA 2HNDA 4CJRA 3LPUA 4FLYA 3TARA 3DLRA 2G8UA 2X6NA 5HBMA 4B9NA 4IG3A 3AO3A 4OGCA 1DTTA 1TVRA 5KGWA 3NH2A 3I8DA 4DF8A 3TANA 2G8FA 4BE0A 1RBVA 2F8TA 5J1EA 3ZSRA 1L5UA 2QKKA 3CQ8A 4CJ5A 2GBZA 1RT7A 4CJPA 4NCAA 3K5OA 1JXEA 2JGUA 2VG6A 4AILC 1BCOA 1NJYA 1A5XA 4EP4A 1N6QA 3AA5X 2YKNA 3S9HA 4AHRA 3AVGA 2YNGA 1TL1A 3F73A 4M42A 2DTUA 2EHGA 2RF2A 2OPPA 4CF1A 5I3UA 1HPZA 4Z4EA 3KLFA 1JLFA 2VG5A 3LAKA 3KKRA 3VQEA 4CEDA 3OVNA 4KHYA 2F8SA 1B9FA 1VRUA 3NGYA 2OZSA 1KLNA 3D45A 4IDKA 4E1MA 1IKWA 1Z26A 2A1RA 3K2PA 1U48A 2G8HA 1VSIA 4CFDA 2O4IA 1RDBA 2W42A 1UA1A 4FLTA 1S5JA 3I0RA 1WSEA 1DLOA 3V1OA 4CK3A 3VA0A 3OY9A 3VQ7A 2LSNA 4CEQA 4O5BA 4CJVA 1J54A 4YFUA 2JLEA 4C8KA 3M8RA 3JSMA 1HYVA 1ZBFA 3KKSA 2X78A 2KW4A 1HMVA 1ITGA 2DFFA 3ASMA 3NE6A 3PV8A 1SL2A 3JYTA 3K5LA 2HHVA 4C8OA 4CJUA 3PO4A 2X6SA 4FZZA 1RTDA 1LAWA 4K8ZA 3QO9A 2Z1GA 3BGRA 4MFBA 3ZSXA 1W9HA 3ZT1A 3RTVA 4KHWA 2P1JA 4RW8A 3O3HA 3HPOA 3AA3A 1XHXA 2BANA 3TAEA 4H4OA 3S3OA 4M3TA 1RT1A 3KTQA 3KD5E 1L3VA 1A5WA 1TGOA 1QHTA 3SPZA 1ZBLA 4DLGA 3SUNA 2HHUA 2RPIA 2DFHA 2XRIA 3DOLA 3HSTB 3SZ2A 3U6FA 3HM9A 4KI6A 3QEIA 2E6MA 1DTQA 1KSPA 2KTQA 3SJJA 3D0PA 3NF6A 4CIFA 2EX3A 3AVNA 1C0TA 4FK0A 3HVTA 3CFRA 3TAMA 1RTJA 1Q8IA 4RW6A 5K14A 2A1SA 3SQ4A 4KTWA 4K8XA 4L8RB 3SPYA 3AVCA 4JLHA 4WE1A 1VSDA 4CGDA 4AH9A 1RTIA 4J2BA 3WNGA 1L3TA 4FJJA 5CZ2A 2YHAA 5HRPA 3KK3A 3HXMA 3TR8A 3B6OA 1WSJA 4O0JA 1LW2A 3NFAA 3VQCA 3LWLA 4JS4A 4BACA 2WONA 4N56A 4DTRA 4DQIA 3TABA 4CEEA 3RRGA 5HRNA 4LD0A 1NJXA 1QQCA 4DFKA 4CGHA 3V9UA 1ASUA 4DQPA 4FLUA 1C6VA 4E3SA 2BGGA 3EYZA 4M3ZA 4RW4A 4DQRA 4NYNA 3SUQA 1BQMA 4CGIA 4DTUA 3RMAA 2QKBA 3AVJA 4BWJA 4ZHRA 4AHCA 2VG7A 3G10A 3KK2A 1L3SA 2RKIA 3QIPA 4FJMA 1JL1A 1ASWA 4B9LA 3ALYA 3ZSQA 4FJHA 3NH0A 4I7FA 3NAEA 1ASVA 3RMDA 2XY6A 1HQEA 5KRSA 3V9WA 4GW6A 4FZYA 1O1WA 1I3AA 3MXJA 4HUEA 3OYJA 5HRSA 4DS4A 1QSYA 1RDCA 4EP5A 2HMIA 4Z4HA 1EP4A 1T05A 3WNHA 3LPTA 4B3OA 5FROA 2PYJA 4I9QA 4KFBA 3ZSWA 4E89A 2G8KA 3OS1A 2Y1JA 1VSFA 4PA1A 1RDDA 1B92A 1UA0A 5KTQA 3SCXA 1NK0A 1RNHA 3F9KA 1S6QA 4ZTFA 3CM6A 1TK0A 3DLKA 1HRHA 4C8MA 1X9WA 1BI4B 4FJKA 1X9SA 3HL8A 1JL2A 4ELTA 1LWFA 4KB1A 2YHBA 4CEOA 5KI6A 4OKKA 3FFIA 1NOYA 3TAGA 3LANA 5CZ1A 4BDZA 4LSLA 3VQBA 1IG9A 4FJ5A 4M3XA 4FW2A 4E19A 4BE2A 3AVLA 2G8IA 3AVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QK9 A;  4CJT A;  1HNV A;  1HYS A;  1KFD A;  2DFE A;  2D0B A;  3C95 A;  4RW9 A;  1N5Y A;  5JS1 A;  3HK2 A;  2IDO A;  2FC0 A;  3ZT4 A;  1U04 A;  5SZT A;  4CJL A;  1TKT A;  3MAQ A;  2YKM A;  1SL0 A;  3EY1 A;  3PX4 A;  4DWI A;  3V6D A;  3K5N A;  2ATQ A;  3AVF A;  2HW3 A;  2IAJ A;  4O55 A;  1SUQ A;  1JLB A;  3VQQ A;  4HHT A;  3S3M A;  1EET A;  3ULD A;  4FJX A;  3B6P A;  4OLB A;  4M3R A;  3ITH A;  4B9S A;  4IFY A;  4G1Q A;  1YVU A;  4CF9 A;  4FJN A;  4M3Y A;  1REV A;  1S1U A;  3LP0 A;  3NF9 A;  3L8B A;  2OA8 A;  4B9T A;  4JRQ A;  1D8Y A;  4QOZ B;  3KLH A;  4KPY A;  1EKE A;  4CK1 A;  4CCH A;  4FK4 A;  3E01 A;  2HVH A;  4Y1C A;  1T7P A;  2QXF A;  4B9U A;  1EX4 A;  3MXI A;  3VQP A;  3SV3 A;  3V9X A;  3DI6 A;  2ETJ A;  1VSJ A;  3OYL A;  3M8P A;  3V81 A;  2RN2 A;  4FVM A;  2I5J A;  1RIL A;  3OYD A;  1Q9X A;  1RBU A;  1S6P A;  1RT2 A;  2B4J A;  4B08 A;  1JKH A;  1UAX A;  3WNF A;  4F3O A;  1YTU A;  1KVC A;  3A2F A;  3KK1 A;  1NK4 A;  2BE2 A;  5CYM A;  4CGF A;  4CJS A;  3OS2 A;  3UIQ A;  4O44 A;  4DSI A;  3KLG A;  1NOZ A;  1HQU A;  1SKR A;  3MEG A;  2FBX A;  2BDP A;  3SI6 A;  4KRF A;  1HYZ A;  3OYC A;  2R7Y A;  1NK9 A;  3QNN A;  4CEF A;  3QET A;  3AVH A;  1D9D A;  3KJV A;  4CFB A;  1FKP A;  4DTS A;  3HJF A;  1GOC A;  5FDL A;  4F4K A;  4J2D A;  1D5A A;  3TAQ A;  2O4G A;  4B8A B;  1TL3 A;  2WOM A;  4TSX A;  3AO2 A;  2FBT A;  3MEE A;  3QIO A;  1KVB A;  4QAG A;  4BWM A;  1BGX T;  4C8N A;  3IS9 A;  4HVJ A;  4OPJ A;  3NGZ A;  3OYM A;  4KTQ A;  4CJF A;  4JRP A;  3NH1 A;  2YNI A;  1BIS A;  1VSM A;  3P83 D;  4DTM A;  1Y97 A;  3IG1 A;  1SKW A;  4GVM A;  4OJR A;  3T1A A;  2HB5 A;  4FJI A;  3PY8 A;  4FJ8 A;  2AJQ A;  2X74 A;  3KD1 E;  1ZBU A;  3HPH A;  4H8K A;  3ZSO A;  4KB0 A;  1UOC A;  2Y1I A;  2E6L A;  1GOB A;  1S1W A;  3K58 A;  4HCB A;  3OYB A;  2VWJ A;  4F3T A;  1WN7 A;  4IBN A;  4I9L A;  4CHO A;  5T7B A;  4B9V A;  3K59 A;  4FJL A;  1NK7 A;  1KRP A;  4Z4G A;  4CEZ A;  4CHQ A;  3QIN A;  5D3G A;  1TV6 A;  1I39 A;  3MED A;  4I2Q A;  3QEV A;  1B9D A;  1JLQ A;  3PUF A;  3ZT3 A;  1G15 A;  3K57 A;  3OYN A;  3VA3 A;  5HP1 A;  2IGI A;  2F96 A;  1BIZ A;  1C0U A;  1JXB A;  4DTN A;  2OPR A;  1FKO A;  4Q5V A;  4DLE A;  4DQS A;  1LW0 A;  5CY4 A;  4DSL A;  1IKV A;  1LV5 A;  1J9A A;  2XY8 A;  3DRS A;  4CJE A;  3VQA A;  3O3F A;  2GV9 A;  4OKJ A;  3SQ1 A;  3AA2 A;  3T19 A;  3VQ4 A;  4DMN A;  4J2E A;  4N76 A;  2KFN A;  1IKX A;  1IH7 A;  3NGI A;  4CHN A;  4RW7 A;  5J2P A;  1FXX A;  4H4M A;  3AVM A;  3RRH A;  4F2S A;  2KZM A;  1EXQ A;  1XHZ A;  1JLA A;  2P51 A;  4E7I A;  4DFP A;  5HLF A;  3AA4 A;  1TAU A;  2IC3 A;  3AO4 A;  4HTU A;  1NK8 A;  1X9M A;  1LAV A;  3KLE A;  4FM0 A;  4BDP A;  4OGE A;  1KTQ A;  3HP9 A;  3I0S A;  4KKO A;  3OYA A;  3PO5 A;  2KQ2 A;  5JS2 A;  3L2Q A;  3M8S A;  4FLZ A;  1NJW A;  2G8V A;  4O4G A;  5FRM A;  3QNO A;  4ZTJ A;  4PQU A;  2HHT A;  3AO5 A;  3RMB A;  3T3F A;  4W5O A;  3DLE A;  3AVB A;  2DY4 A;  4CJK A;  1CLQ A;  3V1R A;  4C8L A;  1SL1 A;  4W5N A;  4Z4I A;  1TK5 A;  5FRN A;  3HO1 A;  1WSH A;  3O4N A;  1JLE A;  4DQQ A;  4E7L A;  2G8W A;  3RR8 A;  4M3W A;  4DTO A;  4KHN A;  4F2R A;  3S3N A;  1U49 A;  1JLG A;  1ZBH A;  4LH5 A;  3NF7 A;  4I2P A;  4DFM A;  1KLM A;  1VK0 A;  4W5Q A;  4FM1 A;  1VRT A;  3OYF A;  3QER A;  5E41 A;  1KFS A;  1TKX A;  2Q3S A;  5I42 A;  2FBY A;  4B8C A;  3RR7 A;  1RBT A;  2Z1H A;  4ID1 A;  4KV8 A;  4HCC A;  3PX0 A;  4HUF A;  3HT3 A;  3DLB A;  4KAZ A;  5J2N A;  1WSI A;  4CJQ A;  1W0H A;  4IG0 A;  5DMR A;  4DSE A;  2PZS A;  4W5T A;  4FW1 A;  2HNZ A;  3L2R A;  4DSJ A;  4E0D A;  3P1G A;  1LWC A;  4JS5 A;  1ZYQ A;  2D0A A;  4CGJ A;  1ZBI A;  1SKS A;  1CZ9 A;  1U45 A;  1YT3 A;  1T8E A;  3QES A;  4DTX A;  4DTP A;  2KZZ A;  3CM5 A;  4CF8 A;  2HHW A;  4FCY A;  4AHT A;  4OPK A;  3RWU A;  2HHQ A;  2D0C A;  1BIU A;  1RT3 A;  3LAL A;  3HYF A;  1WLJ A;  4R5P A;  3LDS A;  1RT6 A;  4CES A;  1S9E A;  3VQ8 A;  1VSK A;  2KFZ A;  3QEW A;  4FYD A;  1KCF A;  1RBR A;  4KHS A;  4DSF A;  3G0Z A;  1BHL A;  3QLH A;  4M45 A;  4CEB A;  4FXD A;  3OJU A;  1NKB A;  1QSS A;  2VWK A;  1JLC A;  4AHS A;  2E4L A;  4BDY A;  1TK8 A;  1CZB A;  4CHY A;  1BQN A;  1IKY A;  3LAM A;  4ICL A;  4LY7 A;  1TKD A;  1SV5 A;  3O4Q A;  1F21 A;  3M8Q A;  2Z1I A;  1IO2 A;  4M41 A;  1U47 A;  4KHU A;  3DMJ A;  3IAY A;  2OZM A;  3U3G A;  2Z1J A;  3ZT2 A;  4Z0U A;  3OYH A;  5KRT A;  3LZJ A;  2HHS A;  2FBV A;  1HJR A;  1QTM A;  4B9M A;  1UWB A;  4ELV A;  1S1X A;  2ITG A;  3QEP A;  1C1B A;  3SYZ A;  1S1T A;  3LP2 A;  4BE1 A;  5SWM A;  4PY5 A;  1C0M A;  3DM2 A;  1NKC A;  2OPS A;  5C42 A;  3NCI A;  1Q9Y A;  3AVI A;  3MXM A;  2ZE2 A;  3V4I A;  4O0I A;  4CF2 A;  4Z4C A;  1U4B A;  3DRR A;  3KIO A;  4MQ3 A;  5C24 A;  4KRE A;  4OVL A;  4FLW A;  3SQ0 A;  3AO1 A;  3QEX A;  4PWD A;  4AHV A;  4DF4 A;  3KLI A;  1RDA A;  4CE9 A;  3V9Z A;  2XY5 A;  5C25 A;  3OYI A;  4FJ9 A;  3ISN C;  4FLV A;  4OKE A;  1RBS A;  4CK2 A;  1WAF A;  3CG7 A;  1J53 A;  4ID5 A;  2NUB A;  1X1P A;  3LP3 A;  3L3U A;  4PUO A;  1MU2 A;  3LP1 A;  3VQD A;  3OYE A;  3HVR A;  2PYL A;  4Z4F A;  1C1A A;  1VSH A;  4FZX C;  3ZT0 A;  3ZCM A;  2HVI A;  3PX6 A;  1XI1 A;  3CFO A;  1T03 A;  1K6Y A;  4LH4 A;  1HNI A;  4CJ3 A;  4F8R A;  3SQ2 A;  1NK5 A;  4CHP A;  1RT4 A;  1RCH A;  4DFJ A;  5J2M A;  2P5G A;  3V1Q A;  4RG8 A;  4KHQ A;  4CJW A;  1C1C A;  3SUP A;  3DLH A;  3LWM A;  3EZ5 A;  1FK9 A;  4GMJ B;  3O3G A;  3HP6 A;  3DLG A;  4E7K A;  3IRX A;  2XY7 A;  1J5O A;  4EZ6 A;  2ZD1 A;  1RTH A;  4KTZ A;  3LZI A;  4CEC A;  3NDK A;  2HNY A;  4J2A A;  1D9F A;  1Z25 A;  2XO7 A;  4DU3 A;  4FM2 A;  4CHZ A;  3ZSV A;  2OYQ A;  3TWH A;  4CIG A;  3TI0 A;  4EZ9 A;  4KO0 A;  4DSK A;  3L2U A;  4CEA A;  4E1N A;  5CYQ A;  3DYA A;  4NYF A;  4ELU A;  3SNN A;  1CXQ A;  3ZSY A;  2YNH A;  1WSF A;  1TKZ A;  1NKE A;  3BDP A;  4YNQ A;  2XHB A;  4E7H A;  5HRR A;  3OYK A;  4N5S A;  1RT5 A;  1LWE A;  3HPG A;  4CF0 A;  3NHG A;  2HHX A;  2YNF A;  4UQG A;  1VSE A;  3OYG A;  4W5R A;  3WNE A;  3V9S A;  4E7J A;  4N41 A;  3H08 A;  1NJZ A;  1WNS A;  3K5M A;  3C94 A;  4N47 A;  1XWL A;  5DK5 A;  1WSG A;  3VQ6 A;  2IS3 A;  4KI4 A;  4CGG A;  1L3U A;  1VSL A;  1QS4 A;  4QCL A;  3U3Y A;  3DRP A;  1NK6 A;  2OPQ A;  4CER A;  1BCM A;  1TAQ A;  2B5J A;  3CYM A;  2YV0 X;  3NF8 A;  3VQ5 A;  3VQ9 A;  1WAJ A;  4OLA A;  3L3V A;  4DG1 A;  4Y1D A;  4DU1 A;  4LSN A;  3AV9 A;  4XIU A;  2ZQB A;  3NBP A;  4CJ4 A;  2B6A A;  1KVA A;  1BL3 A;  3DOK A;  1GOA A;  3RMC A;  3SUO A;  2P5O A;  4M3U A;  4Q0B A;  4DS5 A;  4FJ7 A;  2GUI A;  4DTJ A;  3THV A;  4CFA A;  4FLX A;  4NCB A;  4DU4 A;  3TAP A;  3ZSZ A;  3MEC A;  5KGX A;  3CFP A;  5HRO A;  5J2Q A;  4IKF A;  3OJS A;  1QSL A;  3AVA A;  3C6T A;  3TAF A;  4FK2 A;  4CIE A;  1CXU A;  1A5V A;  1S9G A;  4NCG A;  4FJG A;  4CFC A;  1S1V A;  5EU7 A;  4IFV A;  3L2W A;  1BI4 A;  3L2V A;  3VN5 A;  1YTA A;  4AHU A;  3OS0 A;  1QE1 A;  2IOC A;  1XC9 A;  3SV4 A;  4HUG A;  3P5J A;  2PY5 A;  1R0A A;  3C6U A;  2D5R A;  2HND A;  4CJR A;  3LPU A;  4FLY A;  3TAR A;  3DLR A;  2G8U A;  2X6N A;  5HBM A;  4B9N A;  4IG3 A;  3AO3 A;  4OGC A;  1DTT A;  1TVR A;  5KGW A;  3NH2 A;  3I8D A;  4DF8 A;  3TAN A;  2G8F A;  4BE0 A;  1RBV A;  2F8T A;  5J1E A;  3ZSR A;  1L5U A;  2QKK A;  3CQ8 A;  4CJ5 A;  2GBZ A;  1RT7 A;  4CJP A;  4NCA A;  3K5O A;  1JXE A;  2JGU A;  2VG6 A;  4AIL C;  1BCO A;  1NJY A;  1A5X A;  4EP4 A;  1N6Q A;  3AA5 X;  2YKN A;  3S9H A;  4AHR A;  3AVG A;  2YNG A;  1TL1 A;  3F73 A;  4M42 A;  2DTU A;  2EHG A;  2RF2 A;  2OPP A;  4CF1 A;  5I3U A;  1HPZ A;  4Z4E A;  3KLF A;  1JLF A;  2VG5 A;  3LAK A;  3KKR A;  3VQE A;  4CED A;  3OVN A;  4KHY A;  2F8S A;  1B9F A;  1VRU A;  3NGY A;  2OZS A;  1KLN A;  3D45 A;  4IDK A;  4E1M A;  1IKW A;  1Z26 A;  2A1R A;  3K2P A;  1U48 A;  2G8H A;  1VSI A;  4CFD A;  2O4I A;  1RDB A;  2W42 A;  1UA1 A;  4FLT A;  1S5J A;  3I0R A;  1WSE A;  1DLO A;  3V1O A;  4CK3 A;  3VA0 A;  3OY9 A;  3VQ7 A;  2LSN A;  4CEQ A;  4O5B A;  4CJV A;  1J54 A;  4YFU A;  2JLE A;  4C8K A;  3M8R A;  3JSM A;  1HYV A;  1ZBF A;  3KKS A;  2X78 A;  2KW4 A;  1HMV A;  1ITG A;  2DFF A;  3ASM A;  3NE6 A;  3PV8 A;  1SL2 A;  3JYT A;  3K5L A;  2HHV A;  4C8O A;  4CJU A;  3PO4 A;  2X6S A;  4FZZ A;  1RTD A;  1LAW A;  4K8Z A;  3QO9 A;  2Z1G A;  3BGR A;  4MFB A;  3ZSX A;  1W9H A;  3ZT1 A;  3RTV A;  4KHW A;  2P1J A;  4RW8 A;  3O3H A;  3HPO A;  3AA3 A;  1XHX A;  2BAN A;  3TAE A;  4H4O A;  3S3O A;  4M3T A;  1RT1 A;  3KTQ A;  3KD5 E;  1L3V A;  1A5W A;  1TGO A;  1QHT A;  3SPZ A;  1ZBL A;  4DLG A;  3SUN A;  2HHU A;  2RPI A;  2DFH A;  2XRI A;  3DOL A;  3HST B;  3SZ2 A;  3U6F A;  3HM9 A;  4KI6 A;  3QEI A;  2E6M A;  1DTQ A;  1KSP A;  2KTQ A;  3SJJ A;  3D0P A;  3NF6 A;  4CIF A;  2EX3 A;  3AVN A;  1C0T A;  4FK0 A;  3HVT A;  3CFR A;  3TAM A;  1RTJ A;  1Q8I A;  4RW6 A;  5K14 A;  2A1S A;  3SQ4 A;  4KTW A;  4K8X A;  4L8R B;  3SPY A;  3AVC A;  4JLH A;  4WE1 A;  1VSD A;  4CGD A;  4AH9 A;  1RTI A;  4J2B A;  3WNG A;  1L3T A;  4FJJ A;  5CZ2 A;  2YHA A;  5HRP A;  3KK3 A;  3HXM A;  3TR8 A;  3B6O A;  1WSJ A;  4O0J A;  1LW2 A;  3NFA A;  3VQC A;  3LWL A;  4JS4 A;  4BAC A;  2WON A;  4N56 A;  4DTR A;  4DQI A;  3TAB A;  4CEE A;  3RRG A;  5HRN A;  4LD0 A;  1NJX A;  1QQC A;  4DFK A;  4CGH A;  3V9U A;  1ASU A;  4DQP A;  4FLU A;  1C6V A;  4E3S A;  2BGG A;  3EYZ A;  4M3Z A;  4RW4 A;  4DQR A;  4NYN A;  3SUQ A;  1BQM A;  4CGI A;  4DTU A;  3RMA A;  2QKB A;  3AVJ A;  4BWJ A;  4ZHR A;  4AHC A;  2VG7 A;  3G10 A;  3KK2 A;  1L3S A;  2RKI A;  3QIP A;  4FJM A;  1JL1 A;  1ASW A;  4B9L A;  3ALY A;  3ZSQ A;  4FJH A;  3NH0 A;  4I7F A;  3NAE A;  1ASV A;  3RMD A;  2XY6 A;  1HQE A;  5KRS A;  3V9W A;  4GW6 A;  4FZY A;  1O1W A;  1I3A A;  3MXJ A;  4HUE A;  3OYJ A;  5HRS A;  4DS4 A;  1QSY A;  1RDC A;  4EP5 A;  2HMI A;  4Z4H A;  1EP4 A;  1T05 A;  3WNH A;  3LPT A;  4B3O A;  5FRO A;  2PYJ A;  4I9Q A;  4KFB A;  3ZSW A;  4E89 A;  2G8K A;  3OS1 A;  2Y1J A;  1VSF A;  4PA1 A;  1RDD A;  1B92 A;  1UA0 A;  5KTQ A;  3SCX A;  1NK0 A;  1RNH A;  3F9K A;  1S6Q A;  4ZTF A;  3CM6 A;  1TK0 A;  3DLK A;  1HRH A;  4C8M A;  1X9W A;  1BI4 B;  4FJK A;  1X9S A;  3HL8 A;  1JL2 A;  4ELT A;  1LWF A;  4KB1 A;  2YHB A;  4CEO A;  5KI6 A;  4OKK A;  3FFI A;  1NOY A;  3TAG A;  3LAN A;  5CZ1 A;  4BDZ A;  4LSL A;  3VQB A;  1IG9 A;  4FJ5 A;  4M3X A;  4FW2 A;  4E19 A;  4BE2 A;  3AVL A;  2G8I A;  3AVK A; 
#chains in the Genus database with same CATH topology
 3THY B;  5EXW A;  1HYS A;  4RW9 A;  3CQX A;  1U6Z A;  5M1P A;  1M1K O;  2GWJ A;  1U04 A;  4JHD B;  3PX4 A;  4JI8 K;  4GKJ K;  5AJ3 K;  4CZL A;  1JLB A;  3OW2 M;  4OLB A;  3LL3 A;  3B6P A;  4C23 A;  4LC9 B;  3CJ7 A;  3THW A;  2Q1N A;  3PIP L;  2HVH A;  2QXF A;  3MXI A;  3VEO A;  2ZJQ L;  3SV3 A;  3V9X A;  3DI6 A;  2ETJ A;  1VSJ A;  3SAH A;  3CPW M;  3V81 A;  3HRG A;  4FVM A;  3OYD A;  5EVZ A;  1Q9X A;  1RBU A;  1S6P A;  2GUP A;  5JLH A;  1NK4 A;  2BE2 A;  5CYM A;  1XQS C;  3KLG A;  5BN8 A;  5AQV A;  5GAG P;  3OYC A;  3QNN A;  4CEF A;  1D9D A;  4DTS A;  2QM1 A;  1YXQ A;  1NGD A;  1GOC A;  1IG8 A;  4B8A B;  1N34 K;  3H3N O;  4QAG A;  1WBD A;  4C8N A;  4OPJ A;  4W5N A;  3O08 A;  2JWK A;  2YNI A;  4M7Y A;  3P83 D;  3WQT A;  4OJR A;  3PY8 A;  2QWR A;  2NRZ A;  3HPH A;  4BR7 A;  3K58 A;  1S1W A;  3THY A;  2HBJ A;  1WN7 A;  3L4Q A;  4I9L A;  4CHO A;  5T7B A;  4CBW A;  4FJL A;  1KRP A;  4MLH A;  1I39 A;  3MED A;  3ZT3 A;  3ZX2 A;  1G15 A;  2NLX A;  4Q5V A;  4JI5 K;  5CY4 A;  1IKV A;  5AQN A;  3N4Q A;  3VQA A;  3O3F A;  2GV9 A;  3SQ1 A;  1QVG M;  3AA2 A;  5AQP A;  4A57 A;  1YJ9 N;  3D2E A;  4YOW A;  3MK6 A;  1FXX A;  4H4M A;  4BR0 A;  2V7Y A;  4OO1 J;  4CZI A;  1JLA A;  3D2E B;  4DFP A;  3AO4 A;  4HTU A;  1X9M A;  1OH6 A;  3HP9 A;  4KKO A;  2KQ2 A;  4FLZ A;  3L2Q A;  2G8V A;  4H0P A;  5FRM A;  3IMX A;  3RMB A;  2UUA K;  1OH5 A;  3O8M A;  4H5R A;  4WQ5 A;  4CBU A;  5BPL A;  1SL1 A;  2GEL A;  2YHY A;  3HO1 A;  4CBX A;  2UUC K;  2WBN A;  4IXC A;  4F2R A;  2Q0U A;  3U8X A;  1K9M O;  3CXC M;  1VQL N;  2NRV A;  2NRX A;  4I2P A;  3BZC A;  3QER A;  5E41 A;  1KFS A;  4FWN A;  4CZE A;  2O8F A;  4ID1 A;  3BUZ B;  4HCC A;  1ZC6 A;  4HUF A;  3THX A;  1WSI A;  4CJQ A;  5AQR A;  4DSE A;  4K41 A;  4FW1 A;  2HNZ A;  4DSJ A;  1ZBI A;  2D0A A;  4CGJ A;  3ULE A;  5MLC Q;  1SKS A;  4IJA A;  3M5R A;  4GVE A;  1BIU A;  1RT3 A;  4DV7 K;  2KFZ A;  5EOY A;  3QEW A;  4KHS A;  3G0Z A;  4M45 A;  4FXD A;  1TK8 A;  4CW7 B;  4YOT A;  2FF6 A;  4MDB A;  4LY7 A;  2P9U A;  3O4Q A;  3M8Q A;  3T69 A;  3J7Z O;  2Z1I A;  1SQK A;  3ZT2 A;  2W6L A;  4Z0U A;  4B9Q A;  3OYH A;  3DAW A;  2FBV A;  1HJR A;  2QWL A;  3CJC A;  2ITG A;  1C1B A;  3SYZ A;  3A5M C;  4BRF A;  3LDP A;  2O8E A;  3LP2 A;  5SWM A;  3HBT A;  1BG3 A;  3D6R A;  3DM2 A;  1Q9Y A;  4LFB K;  1QVF M;  3MXM A;  2ZE2 A;  3V4I A;  4CF2 A;  4Z4C A;  1U4B A;  3DRR A;  2ZM6 K;  4AHV A;  3KLI A;  2XY5 A;  1MDU B;  4BGA A;  2IIR A;  4O8K A;  1O13 A;  1X1P A;  1MU2 A;  3OYE A;  3RSE A;  1K8A O;  2PYL A;  4BRO A;  2HVI A;  1VSH A;  3ZCM A;  2CH6 A;  1XI1 A;  4DR2 K;  4LH4 A;  4F8R A;  1RT4 A;  2P5G A;  3V1Q A;  1GLD G;  3LWM A;  1J5O A;  1JCG A;  3IRX A;  1RTH A;  4KTZ A;  4J2A A;  1D9F A;  1Z25 A;  2P9N A;  5ADX H;  5FLX O;  2P9S B;  3IFR A;  4DSK A;  2HMP A;  4E1N A;  1NGB A;  4NYF A;  1VQ5 N;  3SNN A;  1NGJ A;  2YNH A;  1WSF A;  4FWP A;  2XHB A;  5C10 A;  4E7H A;  5HRR A;  1IBM K;  4N5S A;  1RT5 A;  4CF0 A;  2HHX A;  2IVN A;  2Q36 A;  3K5M A;  4CZG A;  2D0O A;  1U2V A;  3EEQ A;  3CCM N;  1XWL A;  3EKU A;  4WQ4 A;  5EX5 A;  1RDU A;  1QS4 A;  2E2Q A;  2P9I B;  5KQD A;  3DRP A;  1NK6 A;  4CER A;  4BGB A;  3EO3 A;  2B5J A;  3FZF A;  3O9Q A;  3CME N;  3VQ9 A;  3L3V A;  1VQ7 N;  3O9T A;  4LSN A;  1KD1 O;  5TKW A;  5JMV A;  3DOK A;  1GOA A;  5AQS A;  2O8B B;  4M3U A;  1BUP A;  2GUI A;  4DTJ A;  3THV A;  4FLX A;  3E9P A;  3TAP A;  4KH5 A;  1IBL K;  4IKF A;  3OJS A;  3AVA A;  3TAF A;  4FK2 A;  1S9G A;  2QA4 N;  3MWT A;  4FJG A;  4CFC A;  3L2W A;  3FLC O;  4LFC K;  4BRG A;  3U9D A;  4HUG A;  3C7N B;  1R0A A;  4CJR A;  2D5R A;  3UE5 A;  3LPU A;  5HBM A;  4B9N A;  5KGW A;  4PKG A;  1TVR A;  1BDG A;  3CER A;  1VAZ A;  3VEZ A;  3CQ8 A;  1RT7 A;  3JAM O;  1JXE A;  1BCO A;  1HLU A;  4EP4 A;  4AM7 A;  3TSP A;  1TL1 A;  2YI1 A;  3VEX A;  5I3U A;  3AGR A;  3HTV A;  3VQE A;  1Q7Y O;  4CED A;  3OVN A;  4H5N A;  3D45 A;  1IKW A;  1Z26 A;  3D2F B;  3CQY A;  1VSI A;  2O4I A;  1UA1 A;  3GG4 A;  1WSE A;  4O5F A;  3WXI A;  4EHT A;  3OY9 A;  4PKI A;  1J54 A;  4C8K A;  3GL1 A;  3M8R A;  3HOS A;  1ZBF A;  3KKS A;  4IEE A;  1HMV A;  3ASM A;  3NE6 A;  3PV8 A;  2UU9 K;  3H3O B;  3HOT A;  3VF6 A;  3JYT A;  1RTD A;  1LAW A;  3QO9 A;  4FSV A;  4MFB A;  3ZSX A;  4KHW A;  3DWL A;  2P1J A;  3O3H A;  3HPO A;  3VER A;  4GV6 A;  3WUH A;  5JLF A;  3KTQ A;  4JI4 K;  2V51 B;  2HHU A;  5AFU A;  1E4F T;  3EE9 A;  3LDO A;  3A5L C;  3HM9 A;  2E6M A;  5ELZ A;  5BRF A;  3BF3 A;  3HVT A;  3CFR A;  3GE1 A;  4RTF D;  1WUA A;  4K8X A;  4WE1 A;  4B1Z A;  3C0B A;  4DQ8 A;  3WNG A;  5AR0 A;  1XMQ K;  2YHA A;  4MO4 A;  4JS4 A;  4JYA K;  4BAC A;  4DTR A;  3LDL A;  1NJX A;  1QQC A;  2QWM A;  2BTF A;  4BQZ A;  5KPR A;  3ZET B;  4FLU A;  2VQE K;  2YHX A;  4CGI A;  4BWJ A;  1RDW X;  4ZHR A;  4AHC A;  3A5N C;  3BZK A;  4K42 A;  4FJM A;  4B9L A;  3HZ6 A;  3CMA N;  4FWM A;  3NH0 A;  4I7F A;  5KPZ A;  3ATV A;  2W6K A;  1ASV A;  3RMD A;  1HQE A;  3GBT A;  4EIA A;  4F9O A;  3V9W A;  4FZY A;  1I3A A;  3NVM A;  2E1Z A;  4EP5 A;  1ZBS A;  4H0O A;  1EP4 A;  1JCE A;  1HR0 K;  1C0F A;  5FRO A;  4B3O A;  4DR7 K;  3WEE B;  3ZSW A;  2G8K A;  2NNW A;  3OS1 A;  1YVN A;  1VHX A;  3SCX A;  1NK0 A;  1RNH A;  1S6Q A;  1TK0 A;  1GLC G;  5M1O A;  3DLK A;  1BI4 B;  4A5B A;  4FJK A;  4L3Q A;  1ESV A;  1QQN A;  4CEO A;  3K9J A;  5KI6 A;  3VTH A;  4RWT A;  3FFI A;  4BDZ A;  1KC8 O;  4LSL A;  3VQB A;  3THX B;  1NM1 A;  1KAZ A;  4X65 K;  2DFE A;  3UKR B;  1BOT O;  3HK2 A;  2IDO A;  5GAE P;  3ZT4 A;  3SMP A;  5SZT A;  4CJL A;  2HBL A;  1TKT A;  4H0X B;  4QS8 A;  4DWI A;  3P31 A;  3K5N A;  3AVF A;  3I33 A;  4ISF A;  3VEV A;  1YF5 L;  2HW3 A;  4O55 A;  4JAX A;  3M3Z A;  1EET A;  4M3R A;  2WUS A;  1MWK A;  1YVU A;  1REV A;  3L8B A;  4B9T A;  4QOZ B;  3TSQ A;  4KPY A;  1EKE A;  3W0L A;  4CCH A;  4FK4 A;  4Y1C A;  2O8C A;  1T7P A;  1EX4 A;  2E20 A;  3M8P A;  2W41 A;  1RT2 A;  4KH4 A;  4LF8 K;  3WNF A;  4F3O A;  4DR1 K;  3UIQ A;  4GY2 B;  4O44 A;  3UKU A;  4LF5 K;  1NOZ A;  1SKR A;  2FBX A;  5E26 A;  2E1Y A;  3AVH A;  3KJV A;  4CFB A;  5FDL A;  4F4K A;  3TAQ A;  1X3M A;  3WXM B;  2WOM A;  3U9Z A;  1KVB A;  1BGX T;  1SS6 A;  4HVJ A;  3OYM A;  4CJF A;  4JRP A;  3NH1 A;  3GOI A;  4DTM A;  4FJ8 A;  2HF4 A;  2X74 A;  3KD1 E;  1ZBU A;  4KB0 A;  4FOE A;  2E6L A;  1GOB A;  3MX2 A;  4IOA L;  1BA1 A;  4B9V A;  4J8F A;  5IWA K;  4CHQ A;  3QIN A;  1TV6 A;  4I2Q A;  1JLQ A;  3PUF A;  3K57 A;  3VA3 A;  5AQZ A;  2IGI A;  2UYT A;  2F96 A;  1BIZ A;  3VGL A;  3FGU A;  4DQS A;  1LW0 A;  1J9A A;  2XY8 A;  2H3G X;  4DR6 K;  3T19 A;  3SBT A;  2KKZ A;  4DMN A;  1NMN A;  3NGI A;  3RRH A;  1EXQ A;  2P51 A;  4E7I A;  5HLF A;  2CGK A;  3AA4 A;  1NK8 A;  1T44 A;  1ILY A;  4OGE A;  1KTQ A;  3I0S A;  5JS2 A;  3M8S A;  1S72 N;  4WQ4 C;  3T3F A;  3AVB A;  3H46 O;  4HTL A;  4CJK A;  1CLQ A;  1GLF O;  3V1R A;  1TK5 A;  1WSH A;  2KHO A;  4DQQ A;  3M6G A;  4KHN A;  4GV9 A;  1T3V A;  1J5E K;  5I9E B;  1JLG A;  3MN7 A;  4LH5 A;  4CZJ A;  4WFB L;  3NF7 A;  5AFU H;  3UKU B;  3EZW A;  4BY9 C;  1VK0 A;  5AQG A;  1VRT A;  3C6A A;  1TKX A;  1P8Z A;  2Q3S A;  2FBY A;  5LMU K;  2Z1H A;  3C6H A;  4KV8 A;  4M7X A;  4KAZ A;  5J2N A;  3CC7 N;  3T7Z A;  4NLC A;  3CD6 N;  3L2R A;  3A5O C;  3HSC A;  1NGA A;  4JS5 A;  1ZYQ A;  3MCA B;  1ATR A;  3CM5 A;  4YDU C;  5AQQ A;  5AZJ A;  4FCY A;  3RWU A;  4CES A;  3FFK B;  4LF7 K;  1NGH A;  1RBR A;  2HOE A;  3QLH A;  3Q7B A;  4FWK A;  1NKB A;  1JLC A;  2NRT A;  4BR5 A;  4DHY A;  5LJW A;  3LAM A;  3ID6 A;  4ICL A;  4M41 A;  2OZM A;  2Z1J A;  5JIC A;  2HHS A;  3QBW A;  3FZH A;  1S1X A;  4JEP A;  3OBW A;  2PAV A;  4B1X B;  4B3T K;  3CCR N;  3Q7C A;  2O8F B;  3EE8 A;  3TSU A;  3RSE B;  1YHQ N;  4MQ3 A;  4KRE A;  3O4W A;  4FLW A;  4BR2 A;  3SQ0 A;  3QEX A;  4PWD A;  5HL7 L;  4DF4 A;  1RDA A;  3V9Z A;  2NRH A;  1TYQ B;  3ZEU A;  4ID5 A;  2NUB A;  3LP3 A;  3IUC A;  1WBB A;  3LP1 A;  3VQD A;  4G9Z A;  1HKC A;  5BR9 A;  4K43 A;  4LF6 K;  5AQH A;  3PX6 A;  1T03 A;  3CFO A;  1K6Y A;  1HNI A;  5J2M A;  3NVK A;  4RG8 A;  4XEI A;  3I56 N;  4KHQ A;  1XC3 A;  4CJW A;  5C15 A;  2ZF5 O;  3SUP A;  4JKB A;  3HP6 A;  4E7K A;  4EHU A;  2ZD1 A;  4H0T B;  3BF1 A;  3NDK A;  2XO7 A;  4DU3 A;  4WQ5 C;  1FJG K;  3P39 A;  4CIG A;  3TI0 A;  4EZ9 A;  4DR3 K;  2A6A A;  1CXQ A;  3ZSY A;  3CHW A;  2QEX N;  3L4I A;  4DUZ K;  1W7A A;  3BDP A;  4YNQ A;  3HPG A;  1LWE A;  1VSE A;  3OYG A;  4N41 A;  3H08 A;  3EKS A;  3DXK B;  1YIT N;  5DK5 A;  3VQ6 A;  4KI4 A;  1L3U A;  3U3Y A;  4AQY K;  2YV0 X;  4OLA A;  3D7E O;  3AV9 A;  2ZQB A;  4DV1 K;  1KVA A;  2QXL A;  1BL3 A;  4I6M A;  4DS5 A;  4NCB A;  4NB4 A;  3WXK A;  4EAH D;  4LF4 K;  4CJ7 A;  1MA9 B;  3C6T A;  3OBY A;  4CIE A;  4B1U B;  4IFV A;  3ZET A;  1BI4 A;  3L2V A;  3VN5 A;  4H5V A;  4JKA A;  4FWQ A;  1QE1 A;  2IOC A;  3CIP A;  3VOV A;  2PY5 A;  3C6U A;  3TAR A;  2HF3 A;  2G8U A;  2NRW A;  4IG3 A;  4OGC A;  3TAN A;  2G8F A;  1SAZ A;  4BE0 A;  1RBV A;  1L5U A;  3ZSR A;  2QKK A;  3FR0 A;  4CJ5 A;  5JVH L;  1NMD A;  4CZM A;  1A5X A;  3A0I X;  1N6Q A;  3AA5 X;  2P9L B;  2YNG A;  3O5B A;  4CZF A;  2F9T A;  4KHY A;  2F8S A;  4IO9 L;  1B9F A;  3NGY A;  1EWQ A;  1KLN A;  1QZ6 A;  4IDK A;  1N32 K;  1N8R O;  3K2P A;  4CFD A;  1RDB A;  2W42 A;  1K8K A;  2QWQ A;  3VA0 A;  2LSN A;  4BRE A;  4BVP A;  3CC2 N;  2DFF A;  1SL2 A;  3K5L A;  2HHV A;  4CJU A;  2E5L K;  3PO4 A;  1RFQ A;  4WF9 L;  5BRD A;  3LM2 A;  3BGR A;  2ZGY A;  1W9H A;  3ZT1 A;  4RW8 A;  2F7T A;  3AA3 A;  1L3V A;  1TGO A;  4NXN K;  4B1V A;  1RGI A;  4DR5 K;  1ZBL A;  2DFH A;  2XRI A;  3DOL A;  2VYP A;  1NG9 A;  3QEI A;  1OKJ A;  2CGJ A;  1DTQ A;  1KSP A;  3VGK A;  3G25 A;  5ADX A;  3E1Y A;  2EX3 A;  1X9J A;  4FK0 A;  4RW6 A;  1Q8I A;  4QS7 A;  1TYQ A;  4E1J A;  3SPY A;  5AZI B;  4B1W B;  1RTI A;  4FJJ A;  3KK3 A;  1HNZ K;  1NJI O;  3TR8 A;  4O0J A;  2QTD A;  3B6O A;  3DLL L;  4N56 A;  3TAB A;  4CEE A;  3SK3 A;  5HRN A;  4DV2 K;  1DEJ A;  4CGH A;  1TUY A;  1Q18 A;  2ZJR L;  4E3S A;  4M3Z A;  5AQY A;  4RW4 A;  4NYN A;  2J4R A;  3BEX A;  2E2N A;  4DTU A;  4ISE A;  4BC5 A;  1JL1 A;  4EFH A;  1ASW A;  3ZSQ A;  2QWP A;  5KRS A;  3PLA A;  3WXL A;  4GW6 A;  4HUE A;  4DS4 A;  3OYJ A;  1RDC A;  4B3M K;  4YOV A;  2YX6 A;  1T05 A;  2P9I A;  2PYJ A;  4E89 A;  1WOQ A;  1B92 A;  3BY5 A;  4IEI A;  3CM6 A;  3QBX A;  3C65 A;  4KHP K;  1HRH A;  3CCU N;  2JWL A;  3D2F A;  2UUB K;  2YJF A;  2A5X A;  1X9S A;  3HL8 A;  4ELT A;  2E8A A;  5AQL A;  4KB1 A;  2YHB A;  3AVL A;  3NMU A;  3TAG A;  4C1N K;  5B8H A;  4FJ5 A;  4M3X A;  4BRK A;  4QS9 A;  4BE2 A;  1YAG A;  2G8I A;  2D4W A;  1E3M A;  2QK9 A;  1OVQ A;  4JI1 K;  2A40 A;  5BRH A;  1KFD A;  1N5Y A;  2FC0 A;  4V19 S;  1IV0 A;  1VQ6 N;  1SL0 A;  1WB9 A;  3EY1 A;  3K0S A;  3VF2 A;  1SUQ A;  4BRI A;  1EWR A;  3ZX3 A;  1R59 O;  4HHT A;  4FJX A;  4B9S A;  2BH1 A;  4CF9 A;  4FJN A;  4M3Y A;  1S1U A;  1KAX A;  2OA8 A;  4JRQ A;  1D8Y A;  2F9W A;  4CK1 A;  3E01 A;  3TTD A;  4B9U A;  2KLA A;  4BRN A;  4FWR A;  3OYL A;  4OX9 K;  3H45 C;  2RN2 A;  2B4J A;  1UAX A;  4KBO A;  1KVC A;  3A2F A;  4YY3 K;  4CJS A;  4IFE A;  3KWG A;  2AA4 A;  3IDH A;  3SI6 A;  2BDP A;  1NK9 A;  1GLE G;  3VEN A;  3PIO L;  1FKP A;  4BVO A;  4J2D A;  1D5A A;  1T6C A;  1TL3 A;  4TSX A;  1OVY A;  2FBT A;  3AO2 A;  3MEE A;  4BWM A;  4DKW A;  2VQF K;  4FO0 A;  4JKG B;  1BIS A;  1VSM A;  2P9S A;  2HBK A;  3CJ9 A;  3ENO A;  2HB5 A;  4GVM A;  4ILJ A;  4MDA A;  1Z05 A;  4H8K A;  1UOC A;  2Y1I A;  4HCB A;  2Q0R A;  2VWJ A;  4F3T A;  4IBN A;  3J80 O;  3K9K A;  1IBK K;  1VQK N;  1SZ2 A;  3R3L A;  2ASM A;  4Z4G A;  5D3G A;  3QEV A;  4KH6 A;  4CVN E;  1B9D A;  1DKG D;  4JHD A;  2HHH K;  5HP1 A;  2WFB A;  1C0U A;  4DTN A;  4WCE L;  1FKO A;  5E84 A;  4DLE A;  4DSL A;  4OKJ A;  3VQ4 A;  4N76 A;  1IKX A;  1IH7 A;  4CHN A;  4RW7 A;  5J2P A;  3AVM A;  4F2S A;  2KZM A;  3I55 N;  1TAU A;  3WXJ A;  2IC3 A;  4FM0 A;  4Y0W A;  3MN6 A;  3TTC A;  4M42 A;  3PO5 A;  1NBW A;  2HHT A;  3AO5 A;  2PFU A;  2OTL N;  4JD2 B;  2FSK A;  1Q81 O;  3BP8 A;  5FRN A;  3E66 A;  4E7L A;  3SAG A;  5FPD A;  3RR8 A;  4DTO A;  1NGC A;  4M3W A;  3KVG A;  3WT0 A;  3S3N A;  4JN4 A;  4DFM A;  3FZL A;  4W5Q A;  5CR4 A;  1TUU A;  3MDQ A;  2QI2 A;  2EWS A;  4PL7 A;  4B8C A;  1RBT A;  2D1K A;  5GIN A;  3G71 N;  5AQU A;  3A8Y A;  3B8A X;  1QQO A;  5AQW A;  3N4P A;  3R8E A;  2PZS A;  5LY3 A;  4E0D A;  3P1G A;  4X62 K;  4B3R K;  4ILH A;  1CZ9 A;  2KZZ A;  4CF8 A;  1OH7 A;  2HHQ A;  4AHT A;  4OPK A;  2FXU A;  3LAL A;  1WLJ A;  1NGE A;  4FYD A;  1KCF A;  4DSF A;  1BHL A;  4CD1 A;  4BG9 A;  4CEB A;  1KQS M;  1QSS A;  4H5W A;  2VWK A;  2E4L A;  4NLB A;  4JNE A;  1CZB A;  3O9U A;  3EN9 A;  5DM7 L;  5FPN A;  5IT9 O;  5BN9 A;  1SV5 A;  1F21 A;  1VQN N;  1IO2 A;  1U47 A;  4WFA L;  4KHU A;  3VTI A;  2QWN A;  5KRT A;  1QTM A;  4B9M A;  3QEP A;  4JK7 A;  4BE1 A;  4PY5 A;  4A61 A;  2OPS A;  3CCS N;  1HJO A;  3AVI A;  2IVO A;  2DPN A;  4O0I A;  2OTJ N;  3AO1 A;  4A62 A;  2GEM A;  4CE9 A;  4JKD A;  1M90 O;  5C25 A;  3ISN C;  4YOX A;  3J7Y P;  1WAF A;  3L3U A;  4O8U A;  3HVR A;  4K0K K;  4Z4F A;  3KK7 A;  4CJ3 A;  5LL6 Z;  2WC9 A;  4DFJ A;  1IJJ A;  4B3S K;  4I6M B;  4JI3 K;  3TPQ A;  3U4L A;  1C1C A;  1FK9 A;  4GMJ B;  3DLG A;  5A2Q O;  4CEC A;  2P9N B;  4FPA A;  2HNY A;  4K25 A;  4FM2 A;  4C1N I;  3TWH A;  1NLV A;  4KO0 A;  5F2R A;  3CCL N;  1NNE A;  3ATU A;  3DYA A;  3AAP A;  4ELU A;  3VES A;  4BRP A;  1TKZ A;  3F2K A;  1NKE A;  3MX5 A;  3OYK A;  3QB0 A;  4GNI A;  4UQG A;  4W5R A;  4E7J A;  1K8K B;  5DM6 L;  3C94 A;  2O8D A;  4IWV A;  2UXC K;  3KWI A;  1VQ9 N;  3CCJ N;  1WSG A;  4JI7 K;  1VSL A;  1ZXO A;  4QCL A;  3O1B A;  3CYM A;  3G4S N;  4YOY A;  4DG1 A;  4Y1D A;  3NBP A;  4Z94 A;  4CJ4 A;  1JJ2 M;  3WEE A;  4PKH A;  3LDN A;  3SUO A;  3RMC A;  1J6Z A;  4Q0B A;  4FJ7 A;  4CFA A;  3CFP A;  5HRO A;  5J2Q A;  2PBD A;  1YI2 N;  1HUX A;  1CXU A;  4BR9 A;  1NGF A;  3MMV A;  5EU7 A;  2CGL A;  4AHU A;  3QDK A;  3ULE B;  1CZA N;  3SV4 A;  1EO1 A;  3P5J A;  1Q82 O;  2HND A;  3SAF A;  3VPZ A;  1MWM A;  4U67 L;  2X6N A;  2ZGZ A;  3I8D A;  4YDU A;  4NCA A;  2JGU A;  2VG6 A;  4AIL C;  4ISG A;  3VET A;  4AHR A;  1LOT B;  3AVG A;  3OTO K;  3RVC A;  2OPP A;  5M1N A;  1HPZ A;  4U7B A;  3KLF A;  4MO5 A;  4BR4 A;  4Z4E A;  2E2P A;  4DV5 K;  1YJW N;  1VRU A;  4H0V B;  3SBG A;  2YCH A;  3O80 A;  4H0Y B;  1QHA A;  1V4T A;  4FLT A;  3I0R A;  4CK3 A;  1NU0 A;  3E9O A;  5CHI A;  1GLL O;  2E2O A;  1BO5 O;  4O5B A;  4CJV A;  4YFU A;  1HYV A;  4A5A A;  3QIC A;  2KW4 A;  1Y64 A;  3VMF B;  4C8O A;  4FZZ A;  5M1F A;  4K8Z A;  3AGK A;  1VQP N;  4AF1 A;  3RTV A;  1GLJ O;  2BAN A;  3TAE A;  4H4O A;  3KD5 E;  1A5W A;  4X64 K;  5GIO A;  4OPA A;  3SPZ A;  4DLG A;  2O8E B;  3U6F A;  1N33 K;  1FW6 A;  2ASO A;  4KI6 A;  3I8B A;  2KTQ A;  3AVN A;  4WYB A;  4WFN L;  3SQ4 A;  5K14 A;  5FPM A;  2A1S A;  4KTW A;  3AVC A;  4JLH A;  4AH9 A;  3HXM A;  2NZT A;  4IO8 A;  1WSJ A;  4MLE A;  1LW2 A;  3AAR A;  4BRC A;  1QSY A;  4DQI A;  2WON A;  3TTF A;  3RRG A;  4XH5 A;  4DFK A;  3WQU A;  3V9U A;  4CI6 A;  4CZK A;  3F5T A;  3DXM B;  4A59 A;  2BGG A;  4H5T A;  4BRH A;  4DQR A;  1BQM A;  1OH8 A;  3R6M A;  3RMA A;  2QKB A;  3G10 A;  2RKI A;  3QIP A;  3ALY A;  2A3Z A;  4JKC A;  4DV6 K;  2A42 A;  2XY6 A;  1XNQ K;  1HKG A;  2HMI A;  2V52 B;  3JXU A;  3WNH A;  4I9Q A;  4KFB A;  5LMN K;  5KTQ A;  3F9K A;  2AP1 A;  2YJE A;  1HNW K;  1JL2 A;  3W3D A;  1U2V B;  3CJB A;  4FWL A;  3LAN A;  4E19 A;  3AVK A;  2OAN A;  4LF9 K;  1Z6R A;  4CJT A;  1HNV A;  3C95 A;  2D0B A;  5F1X A;  5C0Y A;  5JS1 A;  1I94 K;  3MAQ A;  2YKM A;  3V6D A;  2ATQ A;  5EY4 A;  4JI6 K;  2IAJ A;  5AZJ B;  3VQQ A;  3S3M A;  3ULD A;  3CCQ N;  3ITH A;  4IFY A;  4G1Q A;  4XH4 A;  3LP0 A;  3NF9 A;  5AQT A;  4FVU A;  3KLH A;  4JKF A;  2HST A;  3T1Y K;  2O8C B;  1W97 L;  3VQP A;  3TU5 A;  2QW9 A;  3ZLJ A;  2VWB A;  1ATN A;  4JK9 A;  2I5J A;  2P9U B;  1RIL A;  2FF3 B;  3ZX0 A;  4B08 A;  1JKH A;  1YTU A;  3KK1 A;  4DV0 K;  4CGF A;  1BU6 O;  3OS2 A;  3VGM A;  4DSI A;  1XMO K;  1VQ4 N;  1GLB G;  2P9P A;  1HQU A;  4KRF A;  1HYZ A;  2R7Y A;  3QET A;  2ASP A;  3HJF A;  2O4G A;  3QIO A;  3VEW A;  4KTQ A;  5AQI A;  3IS9 A;  3NGZ A;  3L6Q A;  1Y97 A;  3IG1 A;  3CCV N;  1SKW A;  3T1A A;  2AJQ A;  4FJI A;  1E4G T;  3ZSO A;  3GDQ A;  1S22 A;  3OYB A;  5JVG L;  3QFU A;  3CCE N;  4BRL A;  3K59 A;  1NK7 A;  4CEZ A;  4LFA K;  4X66 K;  3CPE A;  1KAY A;  3OYN A;  4JI0 K;  1JXB A;  3CJ1 A;  2OPR A;  1LV5 A;  1X3N A;  2IVP A;  3DRS A;  4CJE A;  4AM6 A;  4J2E A;  2KFN A;  1EQY A;  3VF4 A;  4BC4 A;  1W2B M;  5BPM A;  1XHZ A;  4R79 A;  1LAV A;  3KLE A;  4BDP A;  2O8D B;  3OYA A;  1NJW A;  2GX9 A;  4O4G A;  3QNO A;  4ZTJ A;  4UY8 O;  4PQU A;  4W5O A;  3DLE A;  5AQX A;  2DY4 A;  3DXM A;  4C8L A;  4Z4I A;  5GIP A;  3CI5 A;  1NGG A;  3O4N A;  2V7Z A;  1JLE A;  1HKB A;  2G8W A;  3ZEU B;  5AQF A;  1U49 A;  2FSN A;  1ZBH A;  2P9K B;  1KLM A;  4FM1 A;  1HX1 A;  3OYF A;  4IOC L;  5I42 A;  3RR7 A;  2ZJP L;  3PX0 A;  3PSI A;  3HT3 A;  3DLB A;  3FZM A;  1W0H A;  4IG0 A;  4CZH A;  5DMR A;  3C7N A;  4W5T A;  1BA0 A;  1LWC A;  2F4V K;  5M1Q A;  4BRM A;  1U45 A;  1YT3 A;  1T8E A;  4PHT X;  3QES A;  4DTX A;  2VGM A;  5F0X A;  4DTP A;  2HHW A;  1DGK N;  2D0C A;  3R9P A;  3HYF A;  1LCU A;  4FOI A;  1RT6 A;  4R5P A;  3LDS A;  1S9E A;  3VQ8 A;  1VSK A;  3ZYY X;  4HWI A;  3OJU A;  3J81 O;  1P90 A;  4AHS A;  4BDY A;  1H1V A;  4CHY A;  1BQN A;  1BWF O;  2HBM A;  1IKY A;  5AQK A;  4JV5 K;  1TKD A;  3SLC A;  2Q31 A;  1S3X A;  1GLA G;  3DMJ A;  3IAY A;  3U3G A;  2BUP A;  1NWK A;  3LZJ A;  3PSF A;  1UWB A;  4ELV A;  2OCE A;  3MCP A;  1S1T A;  3FZK A;  4DB3 A;  1C0M A;  1NKC A;  5C42 A;  3NCI A;  3CC4 N;  1VQO N;  4YOR A;  3KIO A;  4IDH A;  5C24 A;  4OVL A;  3CJA A;  5C2F A;  5KPT A;  3H1V X;  4JKH A;  4PL8 A;  5GAH P;  3OYI A;  4FJ9 A;  4A2A A;  4FLV A;  4DCH A;  4OKE A;  1RBS A;  4CK2 A;  3CG7 A;  1J53 A;  2P9K A;  2ITM A;  4PUO A;  5AQO A;  1NGI A;  2D0P A;  3UB5 A;  4BQL A;  1C1A A;  2RE2 A;  4FZX C;  3ZT0 A;  2VGN A;  5M1K A;  4YOU A;  3SQ2 A;  1NK5 A;  4CHP A;  2Q97 A;  1RCH A;  4FWO A;  2P9L A;  3FE1 A;  2E88 A;  3SJH A;  5TKY A;  3DLH A;  3EZ5 A;  5CE3 A;  3O3G A;  2XY7 A;  4EZ6 A;  4BRD A;  1DT9 A;  3LZI A;  1YJN N;  3H1Q A;  3O9S A;  2OYQ A;  4CHZ A;  1QQM A;  3ZSV A;  4NXM K;  3L2U A;  2I7N A;  4CEA A;  4ILG B;  5CYQ A;  1VQM N;  1XNR K;  4JKE A;  5BR8 K;  3THW B;  5FPE A;  1D4X A;  3IKM A;  3JS6 A;  3NHG A;  4JD2 A;  2YNF A;  3V9S A;  3WNE A;  1NJZ A;  1WNS A;  1VQ8 N;  4NO7 A;  3DXK A;  4N47 A;  4YHH K;  2IS3 A;  4CGG A;  5BPN A;  2UXD K;  1QZ5 A;  3ID8 A;  2OPQ A;  1BCM A;  1TAQ A;  3VQ5 A;  3NF8 A;  2WTU A;  3O6W A;  1ATS A;  1WAJ A;  4DU1 A;  2GTD A;  4XIU A;  5AQJ A;  3H6E A;  2VCP A;  3EL2 A;  2B6A A;  4GV3 A;  2P5O A;  4DU4 A;  3ZSZ A;  3MEC A;  5KGX A;  1QSL A;  4BRQ A;  4NCG A;  1A5V A;  3CF5 L;  1S1V A;  2Q2R A;  3J8A A;  1YTA A;  4XH1 A;  2A41 A;  3OS0 A;  4BC2 A;  1XC9 A;  3LDQ A;  4IJN A;  2GWK A;  3E9L A;  4FLY A;  3DLR A;  4IZ9 A;  1YIJ N;  3AO3 A;  3NH2 A;  1DTT A;  4IOX A;  2F8T A;  4DF8 A;  1N36 K;  5J1E A;  3OA9 A;  3LM9 A;  3P4I A;  3MN9 A;  2GBZ A;  5H1S Q;  4CJP A;  3K5O A;  2CH5 A;  3SMS A;  1NJY A;  2YKN A;  2DTU A;  3S9H A;  3F73 A;  1V4S A;  2EHG A;  2RF2 A;  4CF1 A;  1JLF A;  2VG5 A;  3LAK A;  3KKR A;  3HI0 A;  2OZS A;  1C0G A;  4E1M A;  2A1R A;  2G8H A;  1U48 A;  5BRE A;  3O9R A;  1S5J A;  3V1O A;  1DLO A;  1JCF A;  3VQ7 A;  4CEQ A;  2JLE A;  2RHK A;  3JSM A;  3CET A;  2X78 A;  1ITG A;  5HOO A;  2X6S A;  4FL9 A;  1Q86 O;  4JKG A;  4FPB A;  2Z1G A;  3G6E N;  3KZB A;  4FWS A;  2UXB K;  3QFP A;  5GAD P;  1XHX A;  4M3T A;  4A2B A;  3S3O A;  1RT1 A;  1QHT A;  3AY9 A;  3VEY A;  2FSJ A;  3O1W A;  2P9P B;  3SUN A;  2RPI A;  3KHY A;  3HST B;  3SZ2 A;  4DV3 K;  3R1X A;  4JK8 A;  3AAQ A;  5C2D A;  3SJJ A;  3D0P A;  3NF6 A;  4CIF A;  1HPM A;  1C0T A;  2QWO A;  3P38 A;  4CD3 A;  3UKR A;  4BG8 A;  3TAM A;  1RTJ A;  4L8R B;  2W40 A;  5AZI A;  4H03 B;  1VSD A;  4CGD A;  4J2B A;  1L3T A;  5CZ2 A;  4OPH A;  5HRP A;  2I7P A;  3L0Q A;  3NFA A;  3VQC A;  3M1F A;  3LWL A;  3DJC A;  1G99 A;  2FLO A;  4LD0 A;  4RCH A;  4BC3 A;  1KXP A;  1ASU A;  4DQP A;  1C6V A;  1T6D A;  3EYZ A;  1K73 O;  3SUQ A;  3HM8 A;  3AVJ A;  3ENH A;  4DV4 K;  2YHW A;  2VG7 A;  3KK2 A;  1L3S A;  5C12 A;  4BRA A;  4FJH A;  1XUP O;  3NAE A;  3QML A;  1O1W A;  4DUY K;  3MXJ A;  3ENB A;  5HRS A;  4DR4 K;  1YUW A;  4Z4H A;  5KQ8 A;  2O8B A;  2NRR A;  3LPT A;  3MWP A;  3J7A P;  3MN5 A;  2Y1J A;  1VSF A;  4PA1 A;  1RDD A;  3T1H K;  1UA0 A;  4GKK K;  4ZTF A;  2ZWH A;  4C8M A;  1X9W A;  5AQM A;  4B1Y B;  5LJV A;  1LWF A;  3S41 A;  4OKK A;  1HNX K;  3F9M A;  1NOY A;  3OHR A;  5CZ1 A;  4JI2 K;  1IG9 A;  4FW2 A;  4M63 C;  3MEG A; 
#chains in the Genus database with same CATH homology
 2QK9 A;  4CJT A;  1HNV A;  1HYS A;  1KFD A;  2DFE A;  2D0B A;  3C95 A;  4RW9 A;  1N5Y A;  5JS1 A;  3HK2 A;  2IDO A;  2FC0 A;  3ZT4 A;  1U04 A;  5SZT A;  4CJL A;  1TKT A;  3MAQ A;  2YKM A;  1SL0 A;  3EY1 A;  3PX4 A;  4DWI A;  3V6D A;  3K5N A;  2ATQ A;  3AVF A;  2HW3 A;  2IAJ A;  4O55 A;  1SUQ A;  1JLB A;  3VQQ A;  4HHT A;  3S3M A;  1EET A;  3ULD A;  4FJX A;  3B6P A;  4OLB A;  4M3R A;  3ITH A;  4B9S A;  4IFY A;  4G1Q A;  1YVU A;  4CF9 A;  4FJN A;  4M3Y A;  1REV A;  1S1U A;  3LP0 A;  3NF9 A;  3L8B A;  2OA8 A;  4B9T A;  4JRQ A;  1D8Y A;  4QOZ B;  3KLH A;  4KPY A;  1EKE A;  4CK1 A;  4CCH A;  4FK4 A;  3E01 A;  2HVH A;  4Y1C A;  1T7P A;  2QXF A;  4B9U A;  1EX4 A;  3MXI A;  3VQP A;  3SV3 A;  3V9X A;  3DI6 A;  2ETJ A;  1VSJ A;  3OYL A;  3M8P A;  3V81 A;  2RN2 A;  4FVM A;  2I5J A;  1RIL A;  3OYD A;  1Q9X A;  1RBU A;  1S6P A;  1RT2 A;  2B4J A;  4B08 A;  1JKH A;  1UAX A;  3WNF A;  4F3O A;  1YTU A;  1KVC A;  3A2F A;  3KK1 A;  1NK4 A;  2BE2 A;  5CYM A;  4CGF A;  4CJS A;  3OS2 A;  3UIQ A;  4O44 A;  4DSI A;  3KLG A;  1NOZ A;  1HQU A;  1SKR A;  3MEG A;  2FBX A;  2BDP A;  3SI6 A;  4KRF A;  1HYZ A;  3OYC A;  2R7Y A;  1NK9 A;  3QNN A;  4CEF A;  3QET A;  3AVH A;  1D9D A;  3KJV A;  4CFB A;  1FKP A;  4DTS A;  3HJF A;  1GOC A;  5FDL A;  4F4K A;  4J2D A;  1D5A A;  3TAQ A;  2O4G A;  4B8A B;  1TL3 A;  2WOM A;  4TSX A;  3AO2 A;  2FBT A;  3MEE A;  3QIO A;  1KVB A;  4QAG A;  4BWM A;  1BGX T;  4C8N A;  3IS9 A;  4HVJ A;  4OPJ A;  3NGZ A;  3OYM A;  4KTQ A;  4CJF A;  4JRP A;  3NH1 A;  2YNI A;  1BIS A;  1VSM A;  3P83 D;  4DTM A;  1Y97 A;  3IG1 A;  1SKW A;  4GVM A;  4OJR A;  3T1A A;  2HB5 A;  4FJI A;  3PY8 A;  4FJ8 A;  2AJQ A;  2X74 A;  3KD1 E;  1ZBU A;  3HPH A;  4H8K A;  3ZSO A;  4KB0 A;  1UOC A;  2Y1I A;  2E6L A;  1GOB A;  1S1W A;  3K58 A;  4HCB A;  3OYB A;  2VWJ A;  4F3T A;  1WN7 A;  4IBN A;  4I9L A;  4CHO A;  5T7B A;  4B9V A;  3K59 A;  4FJL A;  1NK7 A;  1KRP A;  4Z4G A;  4CEZ A;  4CHQ A;  3QIN A;  5D3G A;  1TV6 A;  1I39 A;  3MED A;  4I2Q A;  3QEV A;  1B9D A;  1JLQ A;  3PUF A;  3ZT3 A;  1G15 A;  3K57 A;  3OYN A;  3VA3 A;  5HP1 A;  2IGI A;  2F96 A;  1BIZ A;  1C0U A;  1JXB A;  4DTN A;  2OPR A;  1FKO A;  4Q5V A;  4DLE A;  4DQS A;  1LW0 A;  5CY4 A;  4DSL A;  1IKV A;  1LV5 A;  1J9A A;  2XY8 A;  3DRS A;  4CJE A;  3VQA A;  3O3F A;  2GV9 A;  4OKJ A;  3SQ1 A;  3AA2 A;  3T19 A;  3VQ4 A;  4DMN A;  4J2E A;  4N76 A;  2KFN A;  1IKX A;  1IH7 A;  3NGI A;  4CHN A;  4RW7 A;  5J2P A;  1FXX A;  4H4M A;  3AVM A;  3RRH A;  4F2S A;  2KZM A;  1EXQ A;  1XHZ A;  1JLA A;  2P51 A;  4E7I A;  4DFP A;  5HLF A;  3AA4 A;  1TAU A;  2IC3 A;  3AO4 A;  4HTU A;  1NK8 A;  1X9M A;  1LAV A;  3KLE A;  4FM0 A;  4BDP A;  4OGE A;  1KTQ A;  3HP9 A;  3I0S A;  4KKO A;  3OYA A;  3PO5 A;  2KQ2 A;  5JS2 A;  3L2Q A;  3M8S A;  4FLZ A;  1NJW A;  2G8V A;  4O4G A;  5FRM A;  3QNO A;  4ZTJ A;  4PQU A;  2HHT A;  3AO5 A;  3RMB A;  3T3F A;  4W5O A;  3DLE A;  3AVB A;  2DY4 A;  4CJK A;  1CLQ A;  3V1R A;  4C8L A;  1SL1 A;  4W5N A;  4Z4I A;  1TK5 A;  5FRN A;  3HO1 A;  1WSH A;  3O4N A;  1JLE A;  4DQQ A;  4E7L A;  2G8W A;  3RR8 A;  4M3W A;  4DTO A;  4KHN A;  4F2R A;  3S3N A;  1U49 A;  1JLG A;  1ZBH A;  4LH5 A;  3NF7 A;  4I2P A;  4DFM A;  1KLM A;  1VK0 A;  4W5Q A;  4FM1 A;  1VRT A;  3OYF A;  3QER A;  5E41 A;  1KFS A;  1TKX A;  2Q3S A;  5I42 A;  2FBY A;  4B8C A;  3RR7 A;  1RBT A;  2Z1H A;  4ID1 A;  4KV8 A;  4HCC A;  3PX0 A;  4HUF A;  3HT3 A;  3DLB A;  4KAZ A;  5J2N A;  1WSI A;  4CJQ A;  1W0H A;  4IG0 A;  5DMR A;  4DSE A;  2PZS A;  4W5T A;  4FW1 A;  2HNZ A;  3L2R A;  4DSJ A;  4E0D A;  3P1G A;  1LWC A;  4JS5 A;  1ZYQ A;  2D0A A;  4CGJ A;  1ZBI A;  1SKS A;  1CZ9 A;  1U45 A;  1YT3 A;  1T8E A;  3QES A;  4DTX A;  4DTP A;  2KZZ A;  3CM5 A;  4CF8 A;  2HHW A;  4FCY A;  4AHT A;  4OPK A;  3RWU A;  2HHQ A;  2D0C A;  1BIU A;  1RT3 A;  3LAL A;  3HYF A;  1WLJ A;  4R5P A;  3LDS A;  1RT6 A;  4CES A;  1S9E A;  3VQ8 A;  1VSK A;  2KFZ A;  3QEW A;  4FYD A;  1KCF A;  1RBR A;  4KHS A;  4DSF A;  3G0Z A;  1BHL A;  3QLH A;  4M45 A;  4CEB A;  4FXD A;  3OJU A;  1NKB A;  1QSS A;  2VWK A;  1JLC A;  4AHS A;  2E4L A;  4BDY A;  1TK8 A;  1CZB A;  4CHY A;  1BQN A;  1IKY A;  3LAM A;  4ICL A;  4LY7 A;  1TKD A;  1SV5 A;  3O4Q A;  1F21 A;  3M8Q A;  2Z1I A;  1IO2 A;  4M41 A;  1U47 A;  4KHU A;  3DMJ A;  3IAY A;  2OZM A;  3U3G A;  2Z1J A;  3ZT2 A;  4Z0U A;  3OYH A;  5KRT A;  3LZJ A;  2HHS A;  2FBV A;  1HJR A;  1QTM A;  4B9M A;  1UWB A;  4ELV A;  1S1X A;  2ITG A;  3QEP A;  1C1B A;  3SYZ A;  1S1T A;  3LP2 A;  4BE1 A;  5SWM A;  4PY5 A;  1C0M A;  3DM2 A;  1NKC A;  2OPS A;  5C42 A;  3NCI A;  1Q9Y A;  3AVI A;  3MXM A;  2ZE2 A;  3V4I A;  4O0I A;  4CF2 A;  4Z4C A;  1U4B A;  3DRR A;  3KIO A;  4MQ3 A;  5C24 A;  4KRE A;  4OVL A;  4FLW A;  3SQ0 A;  3AO1 A;  3QEX A;  4PWD A;  4AHV A;  4DF4 A;  3KLI A;  1RDA A;  4CE9 A;  3V9Z A;  2XY5 A;  5C25 A;  3OYI A;  4FJ9 A;  3ISN C;  4FLV A;  4OKE A;  1RBS A;  4CK2 A;  1WAF A;  3CG7 A;  1J53 A;  4ID5 A;  2NUB A;  1X1P A;  3LP3 A;  3L3U A;  4PUO A;  1MU2 A;  3LP1 A;  3VQD A;  3OYE A;  3HVR A;  2PYL A;  4Z4F A;  1C1A A;  1VSH A;  4FZX C;  3ZT0 A;  3ZCM A;  2HVI A;  3PX6 A;  1XI1 A;  3CFO A;  1T03 A;  1K6Y A;  4LH4 A;  1HNI A;  4CJ3 A;  4F8R A;  3SQ2 A;  1NK5 A;  4CHP A;  1RT4 A;  1RCH A;  4DFJ A;  5J2M A;  2P5G A;  3V1Q A;  4RG8 A;  4KHQ A;  4CJW A;  1C1C A;  3SUP A;  3DLH A;  3LWM A;  3EZ5 A;  1FK9 A;  4GMJ B;  3O3G A;  3HP6 A;  3DLG A;  4E7K A;  3IRX A;  2XY7 A;  1J5O A;  4EZ6 A;  2ZD1 A;  1RTH A;  4KTZ A;  3LZI A;  4CEC A;  3NDK A;  2HNY A;  4J2A A;  1D9F A;  1Z25 A;  2XO7 A;  4DU3 A;  4FM2 A;  4CHZ A;  3ZSV A;  2OYQ A;  3TWH A;  4CIG A;  3TI0 A;  4EZ9 A;  4KO0 A;  4DSK A;  3L2U A;  4CEA A;  4E1N A;  5CYQ A;  3DYA A;  4NYF A;  4ELU A;  3SNN A;  1CXQ A;  3ZSY A;  2YNH A;  1WSF A;  1TKZ A;  1NKE A;  3BDP A;  4YNQ A;  2XHB A;  4E7H A;  5HRR A;  3OYK A;  4N5S A;  1RT5 A;  1LWE A;  3HPG A;  4CF0 A;  3NHG A;  2HHX A;  2YNF A;  4UQG A;  1VSE A;  3OYG A;  4W5R A;  3WNE A;  3V9S A;  4E7J A;  4N41 A;  3H08 A;  1NJZ A;  1WNS A;  3K5M A;  3C94 A;  4N47 A;  1XWL A;  5DK5 A;  1WSG A;  3VQ6 A;  2IS3 A;  4KI4 A;  4CGG A;  1L3U A;  1VSL A;  1QS4 A;  4QCL A;  3U3Y A;  3DRP A;  1NK6 A;  2OPQ A;  4CER A;  1BCM A;  1TAQ A;  2B5J A;  3CYM A;  2YV0 X;  3NF8 A;  3VQ5 A;  3VQ9 A;  1WAJ A;  4OLA A;  3L3V A;  4DG1 A;  4Y1D A;  4DU1 A;  4LSN A;  3AV9 A;  4XIU A;  2ZQB A;  3NBP A;  4CJ4 A;  2B6A A;  1KVA A;  1BL3 A;  3DOK A;  1GOA A;  3RMC A;  3SUO A;  2P5O A;  4M3U A;  4Q0B A;  4DS5 A;  4FJ7 A;  2GUI A;  4DTJ A;  3THV A;  4CFA A;  4FLX A;  4NCB A;  4DU4 A;  3TAP A;  3ZSZ A;  3MEC A;  5KGX A;  3CFP A;  5HRO A;  5J2Q A;  4IKF A;  3OJS A;  1QSL A;  3AVA A;  3C6T A;  3TAF A;  4FK2 A;  4CIE A;  1CXU A;  1A5V A;  1S9G A;  4NCG A;  4FJG A;  4CFC A;  1S1V A;  5EU7 A;  4IFV A;  3L2W A;  1BI4 A;  3L2V A;  3VN5 A;  1YTA A;  4AHU A;  3OS0 A;  1QE1 A;  2IOC A;  1XC9 A;  3SV4 A;  4HUG A;  3P5J A;  2PY5 A;  1R0A A;  3C6U A;  2D5R A;  2HND A;  4CJR A;  3LPU A;  4FLY A;  3TAR A;  3DLR A;  2G8U A;  2X6N A;  5HBM A;  4B9N A;  4IG3 A;  3AO3 A;  4OGC A;  1DTT A;  1TVR A;  5KGW A;  3NH2 A;  3I8D A;  4DF8 A;  3TAN A;  2G8F A;  4BE0 A;  1RBV A;  2F8T A;  5J1E A;  3ZSR A;  1L5U A;  2QKK A;  3CQ8 A;  4CJ5 A;  2GBZ A;  1RT7 A;  4CJP A;  4NCA A;  3K5O A;  1JXE A;  2JGU A;  2VG6 A;  4AIL C;  1BCO A;  1NJY A;  1A5X A;  4EP4 A;  1N6Q A;  3AA5 X;  2YKN A;  3S9H A;  4AHR A;  3AVG A;  2YNG A;  1TL1 A;  3F73 A;  4M42 A;  2DTU A;  2EHG A;  2RF2 A;  2OPP A;  4CF1 A;  5I3U A;  1HPZ A;  4Z4E A;  3KLF A;  1JLF A;  2VG5 A;  3LAK A;  3KKR A;  3VQE A;  4CED A;  3OVN A;  4KHY A;  2F8S A;  1B9F A;  1VRU A;  3NGY A;  2OZS A;  1KLN A;  3D45 A;  4IDK A;  4E1M A;  1IKW A;  1Z26 A;  2A1R A;  3K2P A;  1U48 A;  2G8H A;  1VSI A;  4CFD A;  2O4I A;  1RDB A;  2W42 A;  1UA1 A;  4FLT A;  1S5J A;  3I0R A;  1WSE A;  1DLO A;  3V1O A;  4CK3 A;  3VA0 A;  3OY9 A;  3VQ7 A;  2LSN A;  4CEQ A;  4O5B A;  4CJV A;  1J54 A;  4YFU A;  2JLE A;  4C8K A;  3M8R A;  3JSM A;  1HYV A;  1ZBF A;  3KKS A;  2X78 A;  2KW4 A;  1HMV A;  1ITG A;  2DFF A;  3ASM A;  3NE6 A;  3PV8 A;  1SL2 A;  3JYT A;  3K5L A;  2HHV A;  4C8O A;  4CJU A;  3PO4 A;  2X6S A;  4FZZ A;  1RTD A;  1LAW A;  4K8Z A;  3QO9 A;  2Z1G A;  3BGR A;  4MFB A;  3ZSX A;  1W9H A;  3ZT1 A;  3RTV A;  4KHW A;  2P1J A;  4RW8 A;  3O3H A;  3HPO A;  3AA3 A;  1XHX A;  2BAN A;  3TAE A;  4H4O A;  3S3O A;  4M3T A;  1RT1 A;  3KTQ A;  3KD5 E;  1L3V A;  1A5W A;  1TGO A;  1QHT A;  3SPZ A;  1ZBL A;  4DLG A;  3SUN A;  2HHU A;  2RPI A;  2DFH A;  2XRI A;  3DOL A;  3HST B;  3SZ2 A;  3U6F A;  3HM9 A;  4KI6 A;  3QEI A;  2E6M A;  1DTQ A;  1KSP A;  2KTQ A;  3SJJ A;  3D0P A;  3NF6 A;  4CIF A;  2EX3 A;  3AVN A;  1C0T A;  4FK0 A;  3HVT A;  3CFR A;  3TAM A;  1RTJ A;  1Q8I A;  4RW6 A;  5K14 A;  2A1S A;  3SQ4 A;  4KTW A;  4K8X A;  4L8R B;  3SPY A;  3AVC A;  4JLH A;  4WE1 A;  1VSD A;  4CGD A;  4AH9 A;  1RTI A;  4J2B A;  3WNG A;  1L3T A;  4FJJ A;  5CZ2 A;  2YHA A;  5HRP A;  3KK3 A;  3HXM A;  3TR8 A;  3B6O A;  1WSJ A;  4O0J A;  1LW2 A;  3NFA A;  3VQC A;  3LWL A;  4JS4 A;  4BAC A;  2WON A;  4N56 A;  4DTR A;  4DQI A;  3TAB A;  4CEE A;  3RRG A;  5HRN A;  4LD0 A;  1NJX A;  1QQC A;  4DFK A;  4CGH A;  3V9U A;  1ASU A;  4DQP A;  4FLU A;  1C6V A;  4E3S A;  2BGG A;  3EYZ A;  4M3Z A;  4RW4 A;  4DQR A;  4NYN A;  3SUQ A;  1BQM A;  4CGI A;  4DTU A;  3RMA A;  2QKB A;  3AVJ A;  4BWJ A;  4ZHR A;  4AHC A;  2VG7 A;  3G10 A;  3KK2 A;  1L3S A;  2RKI A;  3QIP A;  4FJM A;  1JL1 A;  1ASW A;  4B9L A;  3ALY A;  3ZSQ A;  4FJH A;  3NH0 A;  4I7F A;  3NAE A;  1ASV A;  3RMD A;  2XY6 A;  1HQE A;  5KRS A;  3V9W A;  4GW6 A;  4FZY A;  1O1W A;  1I3A A;  3MXJ A;  4HUE A;  3OYJ A;  5HRS A;  4DS4 A;  1QSY A;  1RDC A;  4EP5 A;  2HMI A;  4Z4H A;  1EP4 A;  1T05 A;  3WNH A;  3LPT A;  4B3O A;  5FRO A;  2PYJ A;  4I9Q A;  4KFB A;  3ZSW A;  4E89 A;  2G8K A;  3OS1 A;  2Y1J A;  1VSF A;  4PA1 A;  1RDD A;  1B92 A;  1UA0 A;  5KTQ A;  3SCX A;  1NK0 A;  1RNH A;  3F9K A;  1S6Q A;  4ZTF A;  3CM6 A;  1TK0 A;  3DLK A;  1HRH A;  4C8M A;  1X9W A;  1BI4 B;  4FJK A;  1X9S A;  3HL8 A;  1JL2 A;  4ELT A;  1LWF A;  4KB1 A;  2YHB A;  4CEO A;  5KI6 A;  4OKK A;  3FFI A;  1NOY A;  3TAG A;  3LAN A;  5CZ1 A;  4BDZ A;  4LSL A;  3VQB A;  1IG9 A;  4FJ5 A;  4M3X A;  4FW2 A;  4E19 A;  4BE2 A;  3AVL A;  2G8I A;  3AVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...