4CEFA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cefA00
1JLFA 1YTAA 4N47A 3K5MA 4DF4A 4NCBA 4C8MA 4FVMA 4OLAA 3LPUA 2IGIA 3L3UA 2PYLA 4KTQA 1QS4A 1XHXA 4M45A 4CGHA 3O3GA 3SQ1A 3OYAA 4CEEA 3MXMA 4FXDA 5SWMA 3ZSXA 2QXFA 3ASMA 1ASVA 4NCGA 1KFSA 4J2DA 4HHTA 2RPIA 4KHQA 1RCHA 1ASUA 3QERA 1JL1A 1S1UA 4I9LA 3RRHA 3S3NA 1SKWA 3AVMA 1N6QA 4FK0A 4KI6A 4C8NA 3QEVA 1ZBLA 1NKBA 2D5RA 1C6VA 5CYQA 3TAMA 3TAEA 4JRQA 1JLCA 1RBUA 5JS2A 2F8SA 4CEBA 4E1NA 4CJRA 2HVIA 1NK4A 4AHUA 1JL2A 1UA0A 4KREA 1WAFA 4FJNA 3DLRA 4MQ3A 4FZZA 3ZSRA 3OS1A 4DS5A 4BDZA 3WNFA 4I7FA 3RMDA 2P5OA 4RW7A 1UA1A 3VQCA 1L3SA 2BGGA 3NDKA 1HNIA 1J53A 3AVAA 3VQQA 3ZSVA 4CJ3A 4FJGA 4FZXC 1RDDA 1TKTA 4FLXA 1BCMA 3OYCA 1NK0A 5CZ1A 2W42A 4DS4A 3SUNA 3SI6A 2HHQA 2FBYA 4CEAA 4OLBA 4N5SA 4Z4FA 4CEFA 3NCIA 2FBVA 2KZZA 4Z0UA 1Z26A 2OYQA 1W0HA 2VG6A 5HRRA 4CJVA 1ZBHA 3DM2A 1TK5A 1BQNA 4E19A 4ELTA 4RW6A 4CGFA 4KHNA 2ZQBA 1EP4A 3CFOA 4CE9A 1VSEA 3ZT4A 3HPHA 3HM9A 3RMBA 3OYNA 3NH0A 4HCBA 1TK8A 4RG8A 4CJKA 3DLBA 1KVBA 1RBRA 4NYFA 4DQIA 1RBVA 3IS9A 3SV4A 1S5JA 3LANA 3B6OA 5KRTA 3EYZA 3P1GA 2R7YA 3RTVA 1B92A 3AO1A 4Y1DA 4CHQA 3ZSOA 4KHUA 1TL3A 3L8BA 1W9HA 4N56A 3AVNA 5KGWA 2GUIA 4Z4CA 3DLEA 4CF9A 1ZBIA 5KGXA 4NYNA 1LWCA 3MXIA 2HHTA 3DLGA 4DMNA 1HQEA 4CHYA 4W5NA 4O0IA 3QLHA 3HL8A 5CZ2A 3KK2A 4M3ZA 4WE1A 3OS0A 1XI1A 2IS3A 1MU2A 4C8LA 1DTQA 2WOMA 4E1MA 2G8FA 3NGIA 1NK8A 4XIUA 3NF6A 2DFFA 2IOCA 3K58A 3QNOA 3SJJA 1KFDA 1QQCA 2YKMA 1A5VA 3VQ6A 5HP1A 4CGIA 1SV5A 4OPJA 4HUEA 5J2QA 2EHGA 4FW2A 3OYIA 1IO2A 2B5JA 3QNNA 1T05A 4FJIA 3WNGA 4R5PA 1TKDA 4M42A 2KZMA 2P5GA 2X74A 4KFBA 1RT7A 3P5JA 1CXUA 4BWJA 3T1AA 2LSNA 1LW2A 1GOBA 1WSFA 1KRPA 2WONA 1L5UA 4J2BA 2VWJA 3SQ4A 3AO4A 1IKWA 1D5AA 3G0ZA 5DMRA 3QEWA 3OYJA 4ELUA 1QHTA 2XO7A 3AVIA 3WNHA 4FLTA 4FJMA 1WSHA 1L3UA 1YTUA 1RT5A 2KTQA 4LSNA 1QSLA 4FJ8A 4OJRA 3CQ8A 1K6YA 3T3FA 3O3HA 1L3TA 3VQ4A 4DWIA 4FM1A 3AVLA 2A1RA 2HHUA 4B08A 4NCAA 1C0TA 4CJWA 2X6SA 1BI4B 1ZYQA 3QIOA 4DU1A 3HXMA 1NOYA 1D8YA 4CCHA 5KI6A 3ULDA 1BGXT 4IBNA 4HCCA 4B9SA 1UOCA 1RILA 1LWEA 3TAGA 3ZT1A 4FM0A 4RW9A 4CEZA 3HVRA 4F4KA 2Q3SA 3V9ZA 2PY5A 4EZ9A 2HVHA 2VG7A 3KLEA 4CJ5A 4OGEA 3MEEA 4AH9A 4CECA 1Z25A 3AA2A 4C8OA 3SQ0A 3S9HA 4KAZA 4O4GA 3HPOA 4CHZA 1IKVA 4GW6A 2XY6A 2HMIA 4IG3A 2E4LA 3PX4A 1VSJA 1C0UA 1TKZA 2IC3A 1RT4A 3RMAA 1I39A 3SQ2A 3U6FA 3NF8A 4O0JA 3I0RA 1CLQA 5D3GA 3NAEA 4DLGA 4FK4A 4ID5A 2DFHA 3ZT2A 4KB1A 4DSIA 2DTUA 3EY1A 3QEPA 3RR8A 1TGOA 1UAXA 1HJRA 1IG9A 1LW0A 4CJFA 3TAFA 4OKEA 3VA3A 4DTSA 1JXBA 2RN2A 4DQPA 3DRSA 3VQ9A 1X1PA 1NK5A 4PQUA 1WNSA 4LSLA 4W5TA 4IG0A 1XHZA 1C0MA 2OA8A 1BIUA 3K5LA 4FLUA 2G8HA 2ATQA 4BE2A 4KPYA 1QSYA 3JSMA 4B3OA 4DTOA 1EX4A 3DLKA 3HP9A 1U49A 3PY8A 3U3YA 1LWFA 4DTUA 1GOCA 3RRGA 4O44A 1ASWA 4LY7A 1L3VA 1KCFA 3DYAA 2ITGA 1QE1A 1FKPA 1JLQA 2BE2A 4CFCA 4B8AB 1X9MA 3H08A 3ZSZA 1WSGA 4BDYA 3PO4A 3EZ5A 3NFAA 3TABA 3C6UA 3VQ7A 2YKNA 1LV5A 2IAJA 2OPRA 3LP0A 3DRRA 2KFNA 4CEOA 2Y1IA 2O4GA 2AJQA 2ETJA 3OYEA 4E3SA 4JLHA 4RW4A 4DTXA 2OPPA 4CGGA 2QKBA 3V9XA 3V6DA 4E7LA 4HTUA 4DSEA 3VQ8A 4DTRA 3TAPA 4OPKA 3HJFA 1VSKA 1CZ9A 2XY8A 1NJXA 3BGRA 3AVHA 3PX0A 3PO5A 3M8PA 4B9VA 1VRTA 3LP3A 5JS1A 2XRIA 3PUFA 3C94A 4FLWA 3DLHA 2O4IA 2D0AA 2VWKA 3KK1A 3SNNA 4EP5A 4FLZA 4CJUA 4Z4EA 4RW8A 5SZTA 4E89A 3THVA 4L8RB 1J5OA 4CF2A 1JLGA 2DFEA 1O1WA 1TV6A 3S3OA 3L2VA 1FXXA 4CFDA 2YNGA 4KI4A 4FJ7A 4IKFA 2RKIA 1Q8IA 3OY9A 1HYSA 5KRSA 1RDCA 1JLAA 1N5YA 2HHXA 2E6LA 3AA5X 4I9QA 1RT3A 3HSTB 2JLEA 5C25A 3F9KA 1QSSA 3V81A 4CGDA 2E6MA 4KO0A 3O3FA 4IFYA 1WSEA 2Z1JA 4OKJA 4DTMA 1NOZA 5T7BA 1FKOA 4YNQA 1QTMA 4MFBA 4FW1A 4FJXA 2ZE2A 3LZJA 3V1OA 3P83D 4M41A 3K57A 1S6QA 2HNDA 4CERA 2X6NA 4CJPA 3ZT0A 2PZSA 4CHOA 1WN7A 5CY4A 4K8ZA 1VSHA 5FRMA 4ZTFA 1T8EA 2HB5A 4DQRA 1LAVA 3HYFA 1DLOA 4E7HA 5HLFA 4B9TA 1TAQA 3KK3A 3LAKA 4FJ9A 1B9FA 4OKKA 3OYFA 1BCOA 5EU7A 4CJLA 3LDSA 4HUFA 4CJTA 3TAQA 4FZYA 3KIOA 3A2FA 3NGZA 1S1WA 4LH5A 4JS4A 5J2NA 3OJUA 1NK6A 5CYMA 3VN5A 3VQDA 1GOAA 2FC0A 4DFPA 1RT1A 4F3TA 1RTDA 3V9UA 2G8VA 2HNZA 4PUOA 5FRNA 3ZSWA 1YVUA 1IH7A 3WNEA 3LAMA 1NJWA 4M3RA 3I0SA 3F73A 3RWUA 4CIFA 2HW3A 4CF1A 2Z1GA 4AHSA 3FFIA 4DFMA 3B6PA 3HVTA 4BDPA 4M3XA 3NF9A 1BHLA 3V9SA 1NJYA 4B9NA 3LP1A 1HYZA 3NBPA 1S9GA 1BISA 1XWLA 2Z1IA 4CFAA 5J2PA 5FROA 1D9DA 4AHVA 3S3MA 3OYHA 2GBZA 1A5WA 4E7JA 3V1RA 4DF8A 5I42A 4FJJA 3DMJA 4KKOA 3OYLA 5K14A 3MXJA 4M3WA 4EP4A 5C42A 2X78A 5HRSA 3V4IA 4ICLA 3TI0A 2F8TA 4ID1A 1LAWA 3AA4A 2OPQA 3ALYA 4AHCA 3PV8A 3TR8A 3LALA 1U45A 1TVRA 2YHAA 1KVCA 4Q0BA 3KD5E 3AV9A 3L2RA 3LPTA 1U47A 4BE0A 2G8UA 4KB0A 4FJHA 1VSFA 5HROA 1HMVA 3AO3A 3NF7A 3TARA 3KKRA 4FJKA 4DU3A 4JS5A 4GMJB 3BDPA 1VRUA 1NJZA 1WSIA 2OPSA 4DQSA 4BWMA 3L2QA 1UWBA 4M3TA 4CJ4A 3SYZA 1SKSA 3MEGA 1IKXA 1VSDA 3M8SA 4B9UA 4N76A 3RR7A 3OYGA 3VQAA 3AO5A 3CM6A 1SKRA 3NH1A 1X9WA 1JXEA 4GVMA 3DI6A 3NE6A 3IAYA 4FM2A 4EZ6A 3DOLA 4KTWA 3QINA 2P51A 5I3UA 1HRHA 1RDAA 4DSFA 1D9FA 1NKEA 2YV0X 1KSPA 3SCXA 4KHWA 4DTPA 4O55A 4CF0A 4UQGA 5HRNA 2OZSA 3AVGA 4TSXA 4F3OA 1REVA 1NK9A 5E41A 3E01A 4AHTA 3C6TA 3K5NA 4YFUA 1YT3A 1TKXA 1U48A 2P1JA 4KHYA 3KKSA 3K5OA 1EKEA 3HO1A 1RBTA 1CXQA 3HK2A 4IDKA 1B9DA 4HVJA 4ELVA 1EETA 1HNVA 1TK0A 4QOZB 1BQMA 1WSJA 3VQ5A 3QEIA 2XY7A 1J9AA 2Z1HA 1C1BA 2JGUA 4F8RA 4CJEA 3LP2A 1VSMA 3OYKA 2KW4A 2HHVA 3M8QA 3CFRA 4W5RA 3DRPA 4Y1CA 2YNHA 3SUQA 5J2MA 4M3UA 4CEDA 1WAJA 3NH2A 4E0DA 1RT2A 3K2PA 1T7PA 1XC9A 1ZBUA 4CIEA 2D0BA 3IG1A 4DQQA 1ZBFA 1NK7A 2PYJA 2VG5A 4F2RA 3NGYA 4Z4HA 3OYBA 1RBSA 3AA3A 3ZCMA 4BE1A 3ZT3A 3SUPA 3ISNC 1C1AA 1S9EA 3KLIA 3T19A 3KLHA 4KHSA 1SUQA 3ITHA 3MEDA 3SPYA 3D0PA 1EXQA 2F96A 3SPZA 3AVKA 3OVNA 1VSLA 3OJSA 3TWHA 3IRXA 3U3GA 3VQPA 1X9SA 1RNHA 3O4QA 2QKKA 4Z4IA 2FBTA 1KLNA 1JKHA 3LWLA 1KLMA 4CK2A 3TANA 3KD1E 4M3YA 3MECA 4CJQA 2I5JA 3L3VA 2XHBA 2BDPA 3VQEA 3CM5A 4AILC 4DFKA 4FYDA 3SZ2A 3ZSQA 4C8KA 3QIPA 5FDLA 1ITGA 4CJSA 1CZBA 3V9WA 4CHPA 3HT3A 1I3AA 1SL2A 2D0CA 4E7KA 1U4BA 1RTJA 1WLJA 1HYVA 4CFBA 3OYMA 4FLYA 1BIZA 1U04A 3AVBA 5C24A 3O4NA 3PX6A 3AVJA 1HQUA 1G15A 1S1TA 4QCLA 3QEXA 3ZSYA 2ZD1A 1TL1A 3MAQA 4ZHRA 4PY5A 3D45A 2G8WA 4HUGA 1JLEA 2NUBA 2DY4A 3LWMA 1BL3A 2B4JA 4G1QA 4CESA 3UIQA 1F21A 3AVCA 3OYDA 1A5XA 1SL0A 1FK9A 4CIGA 4CK1A 4BACA 1NKCA 2KQ2A 4DFJA 4B9LA 4J2AA 3SUOA 1Q9YA 3JYTA 3C95A 3L2UA 4CGJA 3NHGA 4KTZA 5HBMA 3HPGA 2GV9A 1S1XA 4OVLA 3VQBA 4CHNA 1TAUA 1C1CA 3KJVA 4H4MA 3AVFA 2HHWA 1RTHA 4I2QA 1IKYA 2EX3A 3CG7A 4LD0A 4B8CA 1J54A 5DK5A 2FBXA 2YNIA 4FLVA 1VK0A 4FJ5A 2RF2A 1T03A 4B9MA 2HHSA 1Q9XA 4FJLA 4H4OA 3SV3A 2YHBA 4DSJA 3I8DA 2OZMA 4Q5VA 3KTQA 1KTQA 2KFZA 4DSKA 4I2PA 3G10A 4O5BA 3KLGA 4KRFA 2HNYA 4KV8A 4DLEA 3AO2A 3QETA 3CFPA 3QESA 1VSIA 3DOKA 2QK9A 4OGCA 3CYMA 1RT6A 4PA1A 4DG1A 3L2WA 3LZIA 4CEQA 4W5OA 3VA0A 2B6AA 4JRPA 3QO9A 4DTNA 2G8KA 4CF8A 4LH4A 4DTJA 2YNFA 4QAGA 4IFVA 4ZTJA 1R0AA 1SL1A 4CK3A 3K59A 1Y97A 4E7IA 3OS2A 3V1QA 3RMCA 1S1VA 1RTIA 4FK2A 4AHRA 4W5QA 1BI4A 1S6PA 2BANA 2A1SA 2Y1JA 1DTTA 5KTQA 3KLFA 5HRPA 4FCYA 2G8IA 3M8RA 4DSLA 2XY5A 4N41A 3HP6A 4PWDA 5J1EA 4F2SA 1JLBA 2IDOA 1HPZA 4H8KA 4J2EA 4Z4GA 1RDBA 4K8XA 1KVAA 4DU4A
chains in the Genus database with same CATH superfamily
1Q82O 1ATSA 2O8CA 4BRNA 1W2BM 4JK9A 3L3UA 1QS4A 3SQ1A 3OYAA 3ASMA 1ASVA 2I7PA 4J2DA 3L4IA 1RCHA 1ASUA 3RRHA 4V19S 3TAEA 3TAMA 5CYQA 4H0PA 4JRQA 5JS2A 1E4FT 4JKDA 4CEBA 4CJRA 3GOIA 4AHUA 1UA0A 2O8DB 5EY4A 5C2FA 5CHIA 3FZMA 3OS1A 4DS5A 2D1KA 3VQCA 3NDKA 1EQYA 3F2KA 2V51B 2W42A 4N5SA 1Z26A 5MLCQ 1WBBA 1P90A 4JK8A 1BQNA 4RW6A 4KHNA 1EP4A 4PKIA 1VSEA 3ZT4A 3HPHA 5EX5A 3A5NC 3HM9A 3RMBA 4HCBA 3O9QA 4CJKA 3DLBA 4DQIA 1RBVA 1S5JA 3EKSA 3EYZA 5KRTA 2R7YA 3AO1A 4Y1DA 5KPRA 3ZSOA 1S72N 1TL3A 3CMAN 3CERA 5KGWA 4Z4CA 3DLEA 4LF4K 4NYNA 4BRHA 2HHTA 3DLGA 4W5NA 4O0IA 4H03B 3KK2A 4M3ZA 3D2EA 1XI1A 2ZM6K 1MU2A 4JV5K 1DTQA 3A5OC 3KHYA 3Q7BA 1MDUB 1C0FA 3CJ1A 2YKMA 1A5VA 4CGIA 1SV5A 4OPJA 3D2FB 4YORA 4FJIA 3WNGA 1DEJA 4DUYK 4M42A 4XH4A 2KZMA 2HSTA 3O08A 4KFBA 1YJ9N 2A6AA 4JI2K 2LSNA 4KH6A 4JN4A 3ULEB 1KQSM 4J2BA 3GE1A 3G0ZA 1VQON 1QHTA 2XO7A 4FLTA 1WSHA 3VESA 4FJ8A 4L3QA 4OJRA 1BDGA 4A61A 1C0TA 4CJWA 4CZGA 5FLXO 4ISGA 4FSVA 1QHAA 4HCCA 3ZEUA 4HWIA 3TAGA 5BR9A 4FM0A 4RW9A 1VQKN 3VETA 1IG8A 2OTLN 2VG7A 3O80A 3K9KA 2P9NB 4WCEL 3S9HA 4CHZA 4IG3A 4LF9K 5AQRA 3RMAA 1I39A 4B1ZA 3SQ2A 3NF8A 2QWMA 3K9JA 5D3GA 1CLQA 5A2QO 1W7AA 4KB1A 4O8UA 2IVNA 1LW0A 5AQZA 4BRCA 1ATNA 2H3GX 4DQPA 4KBOA 1X1PA 1NK5A 4LSLA 4IG0A 1C0MA 2VWBA 3K5LA 2ATQA 4KPYA 1QSYA 3G71N 1EX4A 3EE9A 3U3YA 3P38A 2FF6A 4O44A 1ASWA 1KCFA 3CCJN 4YOXA 3FZKA 1VHXA 3MDQA 1IBLK 3ZSZA 2UUAK 2FSKA 2E2NA 5FPNA 3ZX0A 1LV5A 2Y1IA 1EO1A 3OYEA 4DTXA 3CI5A 2QKBA 2WBNA 3V6DA 3H6EA 3CJCA 4HTUA 4OPKA 1NLVA 1CZ9A 1NJXA 4BQLA 3CHWA 3PX0A 3PO5A 4JI3K 3MN9A 5C2DA 2P9PA 4PL7A 4FLWA 3OBYA 3DLHA 3KK1A 4EP5A 4CJUA 3W0LA 3THVA 3WT0A 4E89A 4CF2A 1JLGA 2DFEA 2HBKA 1O1WA 1TV6A 3E9LA 1NGGA 3L2VA 3CPWM 3VGMA 2YHXA 1KAYA 4H0XB 5KRSA 3QICA 2GUPA 1FW6A 1Z6RA 4DV5K 1QSSA 2CH5A 1WSEA 1NOZA 1FKOA 3VEYA 3SJHA 5JLFA 4WFNL 1OKJA 3LZJA 3P83D 3K57A 1S6QA 4CHOA 5CY4A 3WXIA 4ZTFA 4OKKA 4JI5K 3LDSA 4HUFA 4CJTA 4FZYA 2GX9A 1ZXOA 3KIOA 3LL3A 1NK6A 5J2NA 5CYMA 1O13A 4B3RK 4PUOA 5FRNA 2O8BB 1GLBG 3LAMA 3I0SA 3F73A 4AHSA 3BZCA 2NRWA 1BHLA 3LP1A 3NBPA 1BISA 4QS8A 4IZ9A 3S3MA 3OYHA 3CJAA 3H45C 4A5BA 1YHQN 4CZFA 4E7JA 5I42A 4DR7K 4GVEA 4DR5K 3V4IA 2X78A 5GINA 4ID1A 3AA4A 4BC2A 2A3ZA 3LALA 4BRFA 1TVRA 1KVCA 5KPZA 2BUPA 3AO3A 4AM7A 3NF7A 2QI2A 2I7NA 4JS5A 3BDPA 1NJZA 1N34K 4OPHA 1UWBA 1T3VA 2E5LK 4B9UA 4R79A 4A5AA 3NH1A 1JXEA 2RHKA 4YOWA 3IAYA 3KK7A 3DOLA 4PKHA 4XH1A 4KTWA 1HRHA 2NRRA 3ZETA 4O55A 4CF0A 4F3OA 1REVA 1XMOK 4JD2A 4H5TA 4AHTA 3K5NA 4YFUA 1TKXA 1VQNN 2E1ZA 2P1JA 5BR8K 1Q86O 1XMQK 4H0YB 2YHWA 5AQUA 1EETA 1WSJA 3KWGA 1P8ZA 2P9NA 3QMLA 2XY7A 1VAZA 2Z1HA 4EFHA 1VQ5N 4KHPK 3HZ6A 3LP2A 1VSMA 4CJEA 2HHVA 3J80O 3VEWA 3DRPA 4M3UA 1WAJA 4E0DA 2A41A 2CH6A 3VEOA 2NRZA 2UUBK 2GELA 4B1VA 3HM8A 3IDHA 3CPEA 4JKGA 1RBSA 3AA3A 3ZT3A 1VQMN 1C1AA 4H5WA 3KLHA 3T19A 3ITHA 3SPYA 3CCUN 1VSLA 3OJSA 3CMEN 3O4QA 2E2QA 3DXMA 4Z4IA 2FBTA 1BA0A 1D4XA 3LWLA 1KLMA 3TANA 3KD1E 3L3VA 2VQEK 4JKHA 4A57A 3CM5A 1NMDA 3PSIA 5FDLA 1N33K 1I3AA 4BROA 4E7KA 1HYVA 3PX6A 1BIZA 3AVBA 3O4NA 2O8CB 1TL1A 2PFUA 4ZHRA 1JCGA 3D45A 3MAQA 1IBKK 2DY4A 1QQNA 1A5XA 1SL0A 5E84A 4BRAA 2KQ2A 2ASOA 2P9SB 3BF3A 4K25A 2Q0RA 4BC5A 3HPGA 3VQBA 4CHNA 1TAUA 2A42A 1RTHA 2YJFA 4B8CA 5DK5A 2FBXA 1VK0A 4FJ5A 4AQYK 1Q9XA 1KTQA 3E1YA 3G10A 4KRFA 3PIPL 1R59O 4FWRA 1VSIA 3DOKA 2YCHA 3LZIA 3THYB 4FWKA 4CEQA 4W5OA 4CF8A 4IFVA 1SL1A 3OS2A 5M1KA 4AHRA 4M63C 5AQKA 2E2OA 2RE2A 4CZKA 1K8KB 2G8IA 3KLFA 5HRPA 3SK3A 4GKKK 2NRVA 1MWMA 5AQWA 4CD1A 4F2SA 3MX2A 4BRLA 1RDBA 4DU4A 3GL1A 4J8FA 2NZTA 4NCBA 4JI4K 4OLAA 2PYLA 4NLBA 3OTOK 1XHXA 4CEEA 3OHRA 4YOTA 5AQYA 5LMNK 3VERA 4HHTA 1JL1A 3R8EA 1GLLO 5M1QA 3QEVA 1ZBLA 3FR0A 2CGLA 3D2FA 1S22A 1RBUA 2HVIA 1XC3A 3DLRA 4FZZA 4I7FA 4RW7A 1M1KO 4BREA 3AVAA 3ZSVA 4FJGA 1TKTA 3EZWA 3OYCA 4CEAA 3O6WA 4BC4A 3N4PA 2UXBK 2GTDA 4CEFA 4Z0UA 2ZJPL 2OYQA 3TSUA 2VG6A 4QS9A 4JHDA 1ZBHA 1YF5L 3DM2A 4E19A 4ELTA 4NB4A 4CGFA 3CFOA 3CC2N 4GV9A 3NH0A 4RG8A 1RBRA 4NYFA 4B1WB 3SV4A 4JKFA 2VGMA 2A5XA 3P1GA 4IEIA 4IO8A 3CF5L 3CC7N 4KH5A 1W9HA 5EXWA 4DV7K 4CZJA 3TU5A 3MXIA 1LCUA 4DMNA 1HQEA 3O9RA 4ISFA 3KVGA 4DR2K 2IS3A 5AFUA 5AQOA 2ZGYA 4C8LA 1NGJA 2G8FA 1NK8A 4LC9B 3I55N 1NGEA 2DFFA 3QNOA 3K58A 3HRGA 3SJJA 1KFDA 1HKCA 1QQCA 3ENOA 2GWKA 5HL7L 3CCMN 3NMUA 3HBTA 3QNNA 5LJVA 3OYIA 1IO2A 4FVUA 1TKDA 4IOCL 2X74A 4BWJA 3T1AA 3C6HA 1GOBA 1L5UA 3SQ4A 2Q36A 2YI1A 2O8BA 1T6DA 1D5AA 1NU0A 4ELUA 3QEWA 4FJMA 3OYJA 3AVIA 2W40A 1RT5A 2KTQA 4LSNA 4F9OA 3T3FA 1L3TA 4IFEA 4YDUA 3O3HA 4K0KK 2A1RA 4NCAA 3EL2A 4PHTX 5AQPA 3HXMA 4JK7A 5H1SQ 3ULDA 4IBNA 5HOOA 1RILA 3ULEA 3D2EB 3ZT1A 3T1HK 4F4KA 1X3NA 3V9ZA 1JJ2M 3O9UA 4CJ5A 3MEEA 1Z25A 3SQ0A 3HPOA 2XY6A 2HMIA 2FXUA 4MO5A 1VSJA 2IC3A 1NG9A 5TKYA 2HBMA 3U6FA 3NAEA 3WQTA 3SBTA 4ID5A 5AQLA 2HMPA 4DSIA 2JWLA 1NGBA 3A5LC 4OKEA 4DTSA 3SMPA 4CBUA 5GAGP 1JXBA 4K41A 4PQUA 1BIUA 4FLUA 2G8HA 4BE2A 1NGIA 1OH7A 4B3OA 3H3NO 3HP9A 2QA4N 3AY9A 4A62A 4MLHA 1HNXK 2HOEA 4LF8K 3DYAA 2ITGA 1QE1A 3CXCM 3RVCA 1Q18A 3F5TA 1WSGA 5CR4A 4IXCA 1JCFA 3NFAA 2UU9K 2Q97A 3C6UA 2YKNA 2IAJA 2OPRA 3DRRA 3U9ZA 2O4GA 2AJQA 2QWQA 3J7YP 2V7ZA 1HX1A 2ETJA 3QBWA 3H46O 4JLHA 2OPPA 2WC9A 1IJJA 3K0SA 3VQ8A 4DSEA 3SAFA 4DTRA 3TAPA 2ZJRL 1VSKA 4B1YB 2XY8A 3BGRA 2XRIA 3PUFA 4JI6K 5AJ3K 3TTFA 4RW8A 3S3OA 1FXXA 4CFDA 3RSEA 4DV0K 4FJ7A 3TSQA 4CW7B 1N5YA 2HHXA 4A2AA 3QFUA 4I9QA 3AA5X 1RT3A 5C25A 1OVQA 2YX6A 2E6MA 3O1BA 1YAGA 4FL9A 4YNQA 5LY3A 1QTMA 5BREA 4FW1A 4MDBA 4IEEA 1BUPA 2UXDK 2HNDA 5C0YA 2PZSA 5BRFA 4DQ8A 3C65A 5F0XA 3VMFB 2E8AA 2QM1A 3IKMA 3VF6A 4JS4A 3NGZA 1S1WA 3FFKB 3EKUA 1RTDA 2G8VA 3E9PA 3ZSWA 1DGKN 3HSCA 3RWUA 3CCEN 1NJWA 1ILYA 4CIFA 4BRGA 5AQFA 4BDPA 2UYTA 3B6PA 4M3XA 3NF9A 3V9SA 1NJYA 1XWLA 2BTFA 3DAWA 2QWLA 5J2PA 3QBXA 1ZBSA 4NXMK 1A5WA 2ZJQL 3V1RA 4BRKA 4DF8A 4FJJA 3DMJA 4CBXA 3OYLA 4WFAL 2O8DA 4EHTA 4EP4A 5HRSA 4LF7K 2F8TA 4M3TA 4AHCA 3TR8A 5AZIA 4Q0BA 3AV9A 3LPTA 4BE0A 5LL6Z 4KB0A 4FJHA 1VSFA 3QDKA 5M1PA 3TARA 1HR0K 3JS6A 1C0GA 4FJKA 3MMVA 4DB3A 4CJ4A 3SYZA 1IKXA 3M8SA 3RR7A 3AO5A 2NRXA 3O1WA 4BR0A 4FM2A 4EZ6A 5BPMA 5I3UA 2GWJA 4A2BA 4KHWA 4DTPA 3BEXA 1RGIA 5HRNA 2QXLA 4PL8A 4TSXA 3KKSA 3SLCA 3K5OA 5F1XA 3AAPA 5C12A 1U2VA 2Q0UA 1BQMA 3VQ5A 3QEIA 1C1BA 5J2MA 4B3TK 1RT2A 3K2PA 3SBGA 2ASMA 1ZBUA 4BR7A 4CIEA 2D0BA 1NK7A 4F2RA 2VG5A 4JAXA 4Z4HA 3OYBA 5BN9A 4K43A 4BE1A 3T1YK 3KLIA 4KHSA 4RTFD 4NXNK 3U8XA 3AAQA 3U3GA 3VQPA 1J6ZA 4H5NA 3CD6N 1JKHA 3EEQA 3LM9A 3MECA 4CJQA 2BDPA 2UUCK 3VQEA 4WQ5A 3ZSQA 2IVPA 3WXMB 1NM1A 3SZ2A 1KD1O 3NVKA 4B3SK 3OYMA 4CFBA 4C23A 1U04A 2V52B 3C7NA 3AVJA 1S1TA 1G15A 4X65K 3D6RA 4PY5A 3LM2A 1BL3A 2B4JA 4CESA 3UIQA 3OYDA 4CIGA 2FF3B 4CK1A 4BACA 1NKCA 4DFJA 3L2UA 4O5FA 1S1XA 4OVLA 1U6ZA 3H1QA 3BF1A 5JICA 3MWTA 3KJVA 4H4MA 3MK6A 4JKEA 2HHWA 1IKYA 1SQKA 4LD0A 2YNIA 1T03A 4B9MA 4DV6K 3DXMB 3SV3A 4OPAA 4DV3K 2A40A 1HNWK 1WB9A 2P9LA 4DSKA 3VTHA 4JKCA 4O5BA 3AO2A 1HLUA 4OGCA 3CYMA 1RT6A 4PA1A 4BG8A 4BG9A 4LF6K 4Z94A 4JRPA 4DTNA 2G8KA 1T6CA 4DTJA 4DV4K 4CK3A 4E7IA 3V1QA 1S1VA 1RTIA 4FK2A 4W5QA 1BI4A 1S6PA 2BANA 2A1SA 3VGLA 5KTQA 4FCYA 3VENA 3M8RA 3BP8A 3OA9A 1BWFO 3FGUA 3PIOL 5J1EA 4PWDA 1HPZA 5GIPA 4Z4GA 3VQ7A 4C1NI 3MCPA 4N47A 4DF4A 4BR4A 4C8MA 4FVMA 1XUPO 3I33A 2UXCK 4M45A 4CGHA 4FXDA 5SWMA 4NCGA 1KFSA 3CCVN 3G6EN 2RPIA 3QERA 1S1UA 4I9LA 1N6QA 3AVMA 1I94K 4FK0A 4BRPA 4KI6A 1QQMA 3O9SA 4H0TB 4I6MA 4IO9L 4JEPA 1NK4A 4KREA 4B1UB 4FJNA 3UE5A 4BDZA 1NGFA 3CCLN 2P5OA 1UA1A 1L3SA 3EN9A 2BGGA 2D0OA 5IWAK 1J53A 3UKRB 3R3LA 4FLXA 1BCMA 2V7YA 1OH6A 4DS4A 4BC3A 3SUNA 2HHQA 2FBYA 4AM6A 1E4GT 1QQOA 1NGAA 4DR3K 4Z4FA 1SAZA 2FBVA 5HRRA 2HBJA 5AFUH 1T44A 1J5EK 2ZQBA 4CE9A 1TK8A 3J8AA 3WQUA 4EHUA 3IS9A 4FWLA 3RTVA 1B92A 4CHQA 5GIOA 1X9JA 3AVNA 2QTDA 2GUIA 2F9WA 3GDQA 3ZETB 4CF9A 1ZBIA 1LWCA 2OANA 5AQNA 3ATVA 1N36K 2EWSA 2F7TA 5FPDA 3NGIA 3NF6A 2IOCA 5ADXH 3VTIA 5HP1A 4HUEA 5J2QA 4FW2A 2B5JA 1K73O 4R5PA 4RCHA 4CZEA 4RWTA 2P5GA 3P5JA 1CXUA 5BRHA 3FZLA 1LW2A 4JKAA 3O4WA 2VWJA 1IKWA 2D0PA 5JLHA 4KHUA 3WXJA 1YTUA 3WNHA 3A5MC 1QSLA 1TYQA 1K6YA 1HNZK 3VQ4A 4FM1A 3AVLA 4B08A 2X6SA 2E20A 1BI4B 1ZYQA 4DU1A 2E1YA 4CCHA 5KI6A 1BGXT 1LWEA 4GV3A 4CEZA 3HVRA 1G99A 2Q3SA 3FE1A 4BVPA 5AQSA 4O8KA 4EZ9A 3ZX3A 5TKWA 1TYQB 4OGEA 1M90O 3SMSA 5F2RA 4AH9A 3AA2A 4CECA 3CCRN 3THXB 4O4GA 1H1VA 4GW6A 3EO3A 2E4LA 4DR1K 5GADP 1C0UA 1HPMA 2P9KB 3LDOA 5AQMA 4OO1J 4O0JA 3A0IX 3U9DA 4LF5K 4B9QA 4FK4A 4QS7A 3RR8A 3O5BA 3MCAB 1IG9A 4CJFA 3TAFA 3VA3A 2JWKA 1GLAG 1WNSA 4PKGA 1XHZA 2OA8A 1SZ2A 3VF4A 4A59A 3JSMA 3OW2M 3FLCO 5AQIA 3DLKA 3PY8A 3C6AA 1LWFA 4DTUA 4WQ4C 1L3VA 3FZFA 1FKPA 1JLQA 4CFCA 1GLCG 1U2VB 2P9IB 2W41A 3H08A 4H0VB 1X3MA 4CD3A 3TABA 4E3SA 4DHYA 2VYPA 4RW4A 5IT9O 4NLCA 4KH4A 3V9XA 4FWPA 1MWKA 4E7LA 3Q7CA 3HJFA 3GBTA 3M8PA 4CZIA 4B9VA 3P4IA 4IWVA 2O4IA 2D0AA 2VWKA 2ZGZA 3W3DA 4Z4EA 4L8RB 2F4VK 2HHHK 1Q8IA 1KC8O 3L0QA 1NJIO 5M1OA 3V81A 4IJNA 4CGDA 4BGAA 4KO0A 3O3FA 4JD2B 4WQ5C 5T7BA 4MFBA 4FJXA 3O9TA 5JMVA 5BPNA 3VEVA 1QVGM 3N4QA 5FRMA 1T8EA 4DQRA 1LAVA 4B9TA 3KK3A 3LAKA 1BCOA 4CJLA 2BH1A 1VQ7N 4JYAK 3DJCA 3ID8A 3A2FA 4FPBA 3OJUA 1GOAA 4DFPA 1NWKA 1BG3A 1RT1A 4F3TA 3V9UA 4WQ4A 3TPQA 1ATRA 1IH7A 2HW3A 4CF1A 2Z1GA 3FFIA 3DXKB 1HYZA 1KVAA 2Z1IA 4LFAK 3KZBA 3EE8A 3ENHA 5M1NA 1D9DA 2HF3A 2GBZA 2PBDA 4K42A 3TTDA 4I6MB 5K14A 3MXJA 4BRIA 4M3WA 4BRDA 5C42A 4WF9L 2OTJN 4FO0A 3ALYA 3PV8A 3L2RA 4UY8O 2G8UA 1U47A 2HBLA 5HROA 1HMVA 4CJ7A 3KKRA 3F9MA 1VRUA 4GY2B 1WSIA 2OPSA 2VQFK 4BWMA 3L2QA 1NGCA 4XH5A 4FWMA 4EIAA 1VSDA 3P39A 3VQAA 2KKZA 3CM6A 1WBDA 3NE6A 4GVMA 5BRDA 2QW9A 2O8EA 3QINA 2P51A 2P9IA 1CZAN 4DSFA 5JVGL 1D9FA 2YV0X 3BUZB 4UQGA 1OH8A 2DPNA 3AVGA 1NK9A 3R9PA 2P9UA 3E01A 2QWRA 3UB5A 1EKEA 1RBTA 1CXQA 2F9TA 3HK2A 1B9DA 4HVJA 2P9SA 4QOZB 1TK0A 3NVMA 3DLLL 1J9AA 2JGUA 4F8RA 3OYKA 2KW4A 3M8QA 3CFRA 4CEDA 4U7BA 3THWB 3SAGA 1DT9A 4DQQA 1ZBFA 2PYJA 3NGYA 4JI0K 3LDQA 3ZCMA 3SUPA 3ISNC 1S9EA 1YIJN 3MEDA 4IOXA 2F96A 3D0PA 3M6GA 2CGJA 5CE3A 2O8EB 1IBMK 3IRXA 2VGNA 4GNIA 1RNHA 1KLNA 4BRMA 1V4SA 2I5JA 4BY9C 2WFBA 3J7AP 4IJAA 4AILC 4C8KA 2O8FB 1ITGA 1CZBA 1SL2A 3HT3A 3G25A 2D0CA 1U4BA 1WLJA 4ILHA 5AZJA 1HQUA 4QCLA 3QEXA 5I9EB 2ZD1A 2G8WA 1JLEA 4YY3K 1TUUA 2ZWHA 4G1QA 4YOYA 1F21A 3AVCA 1FK9A 4B9LA 1VQ4N 3SUOA 4J2AA 1DKGD 3D7EO 4CGJA 3MWPA 4B1XB 3NHGA 4KTZA 1HKGA 1C1CA 2IIRA 3AVFA 2W6KA 3CG7A 1J54A 4FLVA 3ID6A 3UKRA 4FJLA 5C15A 4DSJA 1HUXA 4Q5VA 3KTQA 2HNYA 4KV8A 4IOAL 3MN7A 3QESA 4E1JA 3M3ZA 3TTCA 2B6AA 3QO9A 4LH4A 1R0AA 2YNFA 3K59A 5KQDA 3WXKA 3RMCA 4WYBA 5GAEP 1K9MO 2FSNA 1YJWN 2Y1JA 1DTTA 5FPEA 3WXLA 5DM7L 4N41A 4YOUA 4JI7K 3AGRA 5AQQA 1JLBA 4H8KA 4K8XA 1JLFA 1YTAA 3K5MA 1SS6A 2W6LA 3LPUA 2IGIA 4KTQA 3THXA 5JVHL 4NO7A 3WEEA 3O3GA 5AR0A 1Q7YO 3MXMA 3ZSXA 2QXFA 4KHQA 3S3NA 4WFBL 1SKWA 4C8NA 1NKBA 3QB0A 2D5RA 1C6VA 1JLCA 2F8SA 1NNEA 1HKBA 4E1NA 1JL2A 3S41A 2HF4A 2PAVA 2Q1NA 1WAFA 4MQ3A 3ZSRA 3WNFA 3RMDA 2J4RA 2WTUA 5AQXA 3IUCA 1HNIA 3VQQA 4CJ3A 4FZXC 1RDDA 1KAZA 1S3XA 1NK0A 5CZ1A 3SI6A 4OLBA 4ILGB 3BZKA 3DXKA 1Q81O 3NCIA 2KZZA 3TSPA 1W0HA 4CJVA 2ITMA 2QWNA 1TK5A 4H5RA 4BQZA 3PSFA 3OYNA 1BU6O 3I56N 1KVBA 2YJEA 2P9LB 4BR5A 3LANA 3B6OA 5AQJA 3R6MA 5AQTA 4HTLA 3L8BA 4N56A 2ASPA 4C1NK 1VQ9N 5KGXA 3LDPA 4CHYA 3QLHA 3HL8A 5CZ2A 4WE1A 3OS0A 4DR6K 3P31A 3GG4A 2WOMA 2FSJA 2P9KA 4E1MA 4XIUA 1VQLN 1QVFM 2E2PA 3VQ6A 1T05A 2EHGA 4JI1K 5GAHP 4ILJA 2OCEA 4CZHA 1KAXA 5B8HA 5FPMA 1RT7A 3CJ9A 3ZLJA 3VOVA 3M5RA 1WSFA 1KRPA 2WONA 3AO4A 4FWSA 1VQ8N 5DMRA 5AQHA 1L3UA 1N8RO 3CQ8A 1TUYA 4DWIA 2HHUA 5BPLA 2QWPA 4Y0WA 1XNRK 3UKUA 4BR2A 2E88A 4CZLA 3QIOA 1NOYA 1D8YA 5LJWA 1Y64A 1QZ6A 3IMXA 4B9SA 1UOCA 3G4SN 4B3MK 1N32K 2PY5A 2HVHA 1NMNA 3KLEA 4CBWA 2NLXA 4DCHA 4C8OA 3R1XA 5KQ8A 4KAZA 1IKVA 3HOSA 4X66K 3PX4A 1TKZA 1RT4A 3I0RA 4DLGA 3THYA 2DFHA 3ZT2A 2DTUA 3EY1A 3AGKA 3QEPA 1TGOA 1UAXA 4M7XA 1HJRA 3CIPA 3HOTA 2RN2A 3DRSA 3VQ9A 1RDWX 4W5TA 5DM6L 3ZEUB 1K8KA 2P9UB 4BRQA 4DTOA 1U49A 1FJGK 1GOCA 3RRGA 4LFCK 3H1VX 4LY7A 2BE2A 4IDHA 3QFPA 4B8AB 1X9MA 3PO4A 4BDYA 3VPZA 3EZ5A 3IFRA 2P9PB 3LP0A 3UKUB 4BGBA 2KFNA 3I8BA 4CEOA 4CGGA 4X62K 1GLEG 4JHDB 1ESVA 1W97L 3T7ZA 5AQGA 1GLFO 3AVHA 4JKBA 1VRTA 3LP3A 5JS1A 1NGHA 3CCQN 3C94A 1BO5O 3SNNA 3VGKA 1HJOA 4YOVA 4FLZA 4DKWA 2VCPA 5SZTA 1J5OA 3ZX2A 4DUZK 3A8YA 4M7YA 1WUAA 4FPAA 2YNGA 4KI4A 3HTVA 4IKFA 2RKIA 3OY9A 1HYSA 1RDCA 1JLAA 3L4QA 2E6LA 3HSTB 2JLEA 3F9KA 5KPTA 3MX5A 2YHYA 4IFYA 2Z1JA 1QZ5A 4OKJA 4MLEA 4DTMA 1Z05A 3E66A 3B8AX 1OH5A 4DV2K 2ZE2A 4CI6A 3V1OA 2NNWA 1BA1A 4M41A 3MN6A 4CERA 2X6NA 3DWLA 3ZT0A 4CJPA 2FLOA 4JKGB 1WN7A 4K8ZA 2NRTA 4ISEA 5LMUK 1VSHA 4G9ZA 2HB5A 5AQVA 3HYFA 1DLOA 4E7HA 5AZJB 5HLFA 1TAQA 4FJ9A 1B9FA 3OYFA 4XEIA 5EU7A 3CC4N 3TAQA 1XNQK 4LH5A 3VN5A 3VQDA 2FC0A 3MN5A 1GLJO 1YI2N 2HNZA 1YVUA 3WNEA 4M3RA 3C7NB 3KWIA 1MA9B 2KLAA 4DFMA 3HVTA 4B9NA 1S9GA 1IV0A 4CFAA 5FROA 4AHVA 4X64K 2WUSA 5ELZA 1EWRA 3FZHA 4KKOA 1VQPN 3TI0A 4ICLA 1LAWA 5C10A 2OPQA 4YHHK 3CJ7A 2YHAA 1U45A 3KD5E 3ENBA 3JXUA 4AF1A 4DU3A 4GMJB 1LOTB 4FWQA 4DQSA 4FWNA 2AA4A 4MO4A 1SKSA 3MEGA 4N76A 3OYGA 4FWOA 1SKRA 1X9WA 3DI6A 1RDAA 1NKEA 1KSPA 1YITN 3SCXA 2OZSA 3WEEB 4U67L 3VEZA 5E41A 4YDUC 3C6TA 1YT3A 4FOIA 1U48A 4JI8K 4KHYA 2D4WA 3H3OB 1BOTO 3HO1A 4GV6A 4LFBK 4IDKA 4H0OA 1NGDA 1HNVA 4ELVA 3ZYYX 3BY5A 4FOEA 1OVYA 4W5RA 5EVZA 4Y1CA 3CCSN 2YNHA 5E26A 3SUQA 3CETA 3ATUA 3NH2A 4GKJK 1T7PA 1XC9A 3IG1A 1V4TA 3AARA 1WOQA 5ADXA 4CZMA 2Q2RA 1SUQA 3CQXA 3HI0A 5AZIB 1EXQA 3O8MA 3SPZA 3SAHA 3AVKA 3OVNA 5EOYA 3TWHA 1JCEA 1X9SA 2GEMA 2QKKA 4JNEA 4CK2A 5BN8A 1RFQA 4M3YA 2NRHA 3RSEB 2XHBA 3LDLA 1YXQA 3T69A 4CVNE 4DFKA 4FYDA 3WUHA 1XQSC 2Q31A 3QIPA 4CJSA 3J7ZO 3V9WA 4CHPA 1RTJA 4FLYA 5C24A 3LDNA 3ZSYA 1K8AO 4HUGA 1NBWA 2NUBA 3LWMA 4BR9A 3THWA 1GLDG 4DR4K 2QEXN 4OX9K 1Q9YA 3JYTA 3C95A 3PLAA 1YUWA 3CQYA 3CJBA 5HBMA 2AP1A 2GV9A 3L6QA 1ZC6A 4DV1K 3VEXA 5M1FA 3JAMO 1VQ6N 4I2QA 2EX3A 1YVNA 3J81O 1EWQA 2HHSA 2RF2A 4H5VA 4H4OA 2YHBA 4EAHD 3I8DA 2OZMA 2KFZA 4I2PA 3KLGA 4DLEA 3QETA 3CFPA 2QK9A 3L2WA 4DG1A 2IVOA 2CGKA 3VA0A 2O8FA 3VF2A 1E3MA 4QAGA 4ZTJA 1RDUA 1Y97A 2QWOA 3M1FA 3C0BA 2ZF5O 2KHOA 3U4LA 4DSLA 2XY5A 3HP6A 1YJNN 2IDOA 3E9OA 1KXPA 4BVOA 4MDAA 4J2EA 3OBWA
chains in the Genus database with same CATH topology
1JLFA 1YTAA 4N47A 3K5MA 4DF4A 4NCBA 4C8MA 4FVMA 4OLAA 3LPUA 2IGIA 3L3UA 2PYLA 4KTQA 1QS4A 1XHXA 4M45A 4CGHA 3O3GA 3SQ1A 3OYAA 4CEEA 3MXMA 4FXDA 5SWMA 3ZSXA 2QXFA 3ASMA 1ASVA 4NCGA 1KFSA 4J2DA 4HHTA 2RPIA 4KHQA 1RCHA 1ASUA 3QERA 1JL1A 1S1UA 4I9LA 3RRHA 3S3NA 1SKWA 3AVMA 1N6QA 4FK0A 4KI6A 4C8NA 3QEVA 1ZBLA 1NKBA 2D5RA 1C6VA 5CYQA 3TAMA 3TAEA 4JRQA 1JLCA 1RBUA 5JS2A 2F8SA 4CEBA 4E1NA 4CJRA 2HVIA 1NK4A 4AHUA 1JL2A 1UA0A 4KREA 1WAFA 4FJNA 3DLRA 4MQ3A 4FZZA 3ZSRA 3OS1A 4DS5A 4BDZA 3WNFA 4I7FA 3RMDA 2P5OA 4RW7A 1UA1A 3VQCA 1L3SA 2BGGA 3NDKA 1HNIA 1J53A 3AVAA 3VQQA 3ZSVA 4CJ3A 4FJGA 4FZXC 1RDDA 1TKTA 4FLXA 1BCMA 3OYCA 1NK0A 5CZ1A 2W42A 4DS4A 3SUNA 3SI6A 2HHQA 2FBYA 4CEAA 4OLBA 4N5SA 4Z4FA 4CEFA 3NCIA 2FBVA 2KZZA 4Z0UA 1Z26A 2OYQA 1W0HA 2VG6A 5HRRA 4CJVA 1ZBHA 3DM2A 1TK5A 1BQNA 4E19A 4ELTA 4RW6A 4CGFA 4KHNA 2ZQBA 1EP4A 3CFOA 4CE9A 1VSEA 3ZT4A 3HPHA 3HM9A 3RMBA 3OYNA 3NH0A 4HCBA 1TK8A 4RG8A 4CJKA 3DLBA 1KVBA 1RBRA 4NYFA 4DQIA 1RBVA 3IS9A 3SV4A 1S5JA 3LANA 3B6OA 5KRTA 3EYZA 3P1GA 2R7YA 3RTVA 1B92A 3AO1A 4Y1DA 4CHQA 3ZSOA 4KHUA 1TL3A 3L8BA 1W9HA 4N56A 3AVNA 5KGWA 2GUIA 4Z4CA 3DLEA 4CF9A 1ZBIA 5KGXA 4NYNA 1LWCA 3MXIA 2HHTA 3DLGA 4DMNA 1HQEA 4CHYA 4W5NA 4O0IA 3QLHA 3HL8A 5CZ2A 3KK2A 4M3ZA 4WE1A 3OS0A 1XI1A 2IS3A 1MU2A 4C8LA 1DTQA 2WOMA 4E1MA 2G8FA 3NGIA 1NK8A 4XIUA 3NF6A 2DFFA 2IOCA 3K58A 3QNOA 3SJJA 1KFDA 1QQCA 2YKMA 1A5VA 3VQ6A 5HP1A 4CGIA 1SV5A 4OPJA 4HUEA 5J2QA 2EHGA 4FW2A 3OYIA 1IO2A 2B5JA 3QNNA 1T05A 4FJIA 3WNGA 4R5PA 1TKDA 4M42A 2KZMA 2P5GA 2X74A 4KFBA 1RT7A 3P5JA 1CXUA 4BWJA 3T1AA 2LSNA 1LW2A 1GOBA 1WSFA 1KRPA 2WONA 1L5UA 4J2BA 2VWJA 3SQ4A 3AO4A 1IKWA 1D5AA 3G0ZA 5DMRA 3QEWA 3OYJA 4ELUA 1QHTA 2XO7A 3AVIA 3WNHA 4FLTA 4FJMA 1WSHA 1L3UA 1YTUA 1RT5A 2KTQA 4LSNA 1QSLA 4FJ8A 4OJRA 3CQ8A 1K6YA 3T3FA 3O3HA 1L3TA 3VQ4A 4DWIA 4FM1A 3AVLA 2A1RA 2HHUA 4B08A 4NCAA 1C0TA 4CJWA 2X6SA 1BI4B 1ZYQA 3QIOA 4DU1A 3HXMA 1NOYA 1D8YA 4CCHA 5KI6A 3ULDA 1BGXT 4IBNA 4HCCA 4B9SA 1UOCA 1RILA 1LWEA 3TAGA 3ZT1A 4FM0A 4RW9A 4CEZA 3HVRA 4F4KA 2Q3SA 3V9ZA 2PY5A 4EZ9A 2HVHA 2VG7A 3KLEA 4CJ5A 4OGEA 3MEEA 4AH9A 4CECA 1Z25A 3AA2A 4C8OA 3SQ0A 3S9HA 4KAZA 4O4GA 3HPOA 4CHZA 1IKVA 4GW6A 2XY6A 2HMIA 4IG3A 2E4LA 3PX4A 1VSJA 1C0UA 1TKZA 2IC3A 1RT4A 3RMAA 1I39A 3SQ2A 3U6FA 3NF8A 4O0JA 3I0RA 1CLQA 5D3GA 3NAEA 4DLGA 4FK4A 4ID5A 2DFHA 3ZT2A 4KB1A 4DSIA 2DTUA 3EY1A 3QEPA 3RR8A 1TGOA 1UAXA 1HJRA 1IG9A 1LW0A 4CJFA 3TAFA 4OKEA 3VA3A 4DTSA 1JXBA 2RN2A 4DQPA 3DRSA 3VQ9A 1X1PA 1NK5A 4PQUA 1WNSA 4LSLA 4W5TA 4IG0A 1XHZA 1C0MA 2OA8A 1BIUA 3K5LA 4FLUA 2G8HA 2ATQA 4BE2A 4KPYA 1QSYA 3JSMA 4B3OA 4DTOA 1EX4A 3DLKA 3HP9A 1U49A 3PY8A 3U3YA 1LWFA 4DTUA 1GOCA 3RRGA 4O44A 1ASWA 4LY7A 1L3VA 1KCFA 3DYAA 2ITGA 1QE1A 1FKPA 1JLQA 2BE2A 4CFCA 4B8AB 1X9MA 3H08A 3ZSZA 1WSGA 4BDYA 3PO4A 3EZ5A 3NFAA 3TABA 3C6UA 3VQ7A 2YKNA 1LV5A 2IAJA 2OPRA 3LP0A 3DRRA 2KFNA 4CEOA 2Y1IA 2O4GA 2AJQA 2ETJA 3OYEA 4E3SA 4JLHA 4RW4A 4DTXA 2OPPA 4CGGA 2QKBA 3V9XA 3V6DA 4E7LA 4HTUA 4DSEA 3VQ8A 4DTRA 3TAPA 4OPKA 3HJFA 1VSKA 1CZ9A 2XY8A 1NJXA 3BGRA 3AVHA 3PX0A 3PO5A 3M8PA 4B9VA 1VRTA 3LP3A 5JS1A 2XRIA 3PUFA 3C94A 4FLWA 3DLHA 2O4IA 2D0AA 2VWKA 3KK1A 3SNNA 4EP5A 4FLZA 4CJUA 4Z4EA 4RW8A 5SZTA 4E89A 3THVA 4L8RB 1J5OA 4CF2A 1JLGA 2DFEA 1O1WA 1TV6A 3S3OA 3L2VA 1FXXA 4CFDA 2YNGA 4KI4A 4FJ7A 4IKFA 2RKIA 1Q8IA 3OY9A 1HYSA 5KRSA 1RDCA 1JLAA 1N5YA 2HHXA 2E6LA 3AA5X 4I9QA 1RT3A 3HSTB 2JLEA 5C25A 3F9KA 1QSSA 3V81A 4CGDA 2E6MA 4KO0A 3O3FA 4IFYA 1WSEA 2Z1JA 4OKJA 4DTMA 1NOZA 5T7BA 1FKOA 4YNQA 1QTMA 4MFBA 4FW1A 4FJXA 2ZE2A 3LZJA 3V1OA 3P83D 4M41A 3K57A 1S6QA 2HNDA 4CERA 2X6NA 4CJPA 3ZT0A 2PZSA 4CHOA 1WN7A 5CY4A 4K8ZA 1VSHA 5FRMA 4ZTFA 1T8EA 2HB5A 4DQRA 1LAVA 3HYFA 1DLOA 4E7HA 5HLFA 4B9TA 1TAQA 3KK3A 3LAKA 4FJ9A 1B9FA 4OKKA 3OYFA 1BCOA 5EU7A 4CJLA 3LDSA 4HUFA 4CJTA 3TAQA 4FZYA 3KIOA 3A2FA 3NGZA 1S1WA 4LH5A 4JS4A 5J2NA 3OJUA 1NK6A 5CYMA 3VN5A 3VQDA 1GOAA 2FC0A 4DFPA 1RT1A 4F3TA 1RTDA 3V9UA 2G8VA 2HNZA 4PUOA 5FRNA 3ZSWA 1YVUA 1IH7A 3WNEA 3LAMA 1NJWA 4M3RA 3I0SA 3F73A 3RWUA 4CIFA 2HW3A 4CF1A 2Z1GA 4AHSA 3FFIA 4DFMA 3B6PA 3HVTA 4BDPA 4M3XA 3NF9A 1BHLA 3V9SA 1NJYA 4B9NA 3LP1A 1HYZA 3NBPA 1S9GA 1BISA 1XWLA 2Z1IA 4CFAA 5J2PA 5FROA 1D9DA 4AHVA 3S3MA 3OYHA 2GBZA 1A5WA 4E7JA 3V1RA 4DF8A 5I42A 4FJJA 3DMJA 4KKOA 3OYLA 5K14A 3MXJA 4M3WA 4EP4A 5C42A 2X78A 5HRSA 3V4IA 4ICLA 3TI0A 2F8TA 4ID1A 1LAWA 3AA4A 2OPQA 3ALYA 4AHCA 3PV8A 3TR8A 3LALA 1U45A 1TVRA 2YHAA 1KVCA 4Q0BA 3KD5E 3AV9A 3L2RA 3LPTA 1U47A 4BE0A 2G8UA 4KB0A 4FJHA 1VSFA 5HROA 1HMVA 3AO3A 3NF7A 3TARA 3KKRA 4FJKA 4DU3A 4JS5A 4GMJB 3BDPA 1VRUA 1NJZA 1WSIA 2OPSA 4DQSA 4BWMA 3L2QA 1UWBA 4M3TA 4CJ4A 3SYZA 1SKSA 3MEGA 1IKXA 1VSDA 3M8SA 4B9UA 4N76A 3RR7A 3OYGA 3VQAA 3AO5A 3CM6A 1SKRA 3NH1A 1X9WA 1JXEA 4GVMA 3DI6A 3NE6A 3IAYA 4FM2A 4EZ6A 3DOLA 4KTWA 3QINA 2P51A 5I3UA 1HRHA 1RDAA 4DSFA 1D9FA 1NKEA 2YV0X 1KSPA 3SCXA 4KHWA 4DTPA 4O55A 4CF0A 4UQGA 5HRNA 2OZSA 3AVGA 4TSXA 4F3OA 1REVA 1NK9A 5E41A 3E01A 4AHTA 3C6TA 3K5NA 4YFUA 1YT3A 1TKXA 1U48A 2P1JA 4KHYA 3KKSA 3K5OA 1EKEA 3HO1A 1RBTA 1CXQA 3HK2A 4IDKA 1B9DA 4HVJA 4ELVA 1EETA 1HNVA 1TK0A 4QOZB 1BQMA 1WSJA 3VQ5A 3QEIA 2XY7A 1J9AA 2Z1HA 1C1BA 2JGUA 4F8RA 4CJEA 3LP2A 1VSMA 3OYKA 2KW4A 2HHVA 3M8QA 3CFRA 4W5RA 3DRPA 4Y1CA 2YNHA 3SUQA 5J2MA 4M3UA 4CEDA 1WAJA 3NH2A 4E0DA 1RT2A 3K2PA 1T7PA 1XC9A 1ZBUA 4CIEA 2D0BA 3IG1A 4DQQA 1ZBFA 1NK7A 2PYJA 2VG5A 4F2RA 3NGYA 4Z4HA 3OYBA 1RBSA 3AA3A 3ZCMA 4BE1A 3ZT3A 3SUPA 3ISNC 1C1AA 1S9EA 3KLIA 3T19A 3KLHA 4KHSA 1SUQA 3ITHA 3MEDA 3SPYA 3D0PA 1EXQA 2F96A 3SPZA 3AVKA 3OVNA 1VSLA 3OJSA 3TWHA 3IRXA 3U3GA 3VQPA 1X9SA 1RNHA 3O4QA 2QKKA 4Z4IA 2FBTA 1KLNA 1JKHA 3LWLA 1KLMA 4CK2A 3TANA 3KD1E 4M3YA 3MECA 4CJQA 2I5JA 3L3VA 2XHBA 2BDPA 3VQEA 3CM5A 4AILC 4DFKA 4FYDA 3SZ2A 3ZSQA 4C8KA 3QIPA 5FDLA 1ITGA 4CJSA 1CZBA 3V9WA 4CHPA 3HT3A 1I3AA 1SL2A 2D0CA 4E7KA 1U4BA 1RTJA 1WLJA 1HYVA 4CFBA 3OYMA 4FLYA 1BIZA 1U04A 3AVBA 5C24A 3O4NA 3PX6A 3AVJA 1HQUA 1G15A 1S1TA 4QCLA 3QEXA 3ZSYA 2ZD1A 1TL1A 3MAQA 4ZHRA 4PY5A 3D45A 2G8WA 4HUGA 1JLEA 2NUBA 2DY4A 3LWMA 1BL3A 2B4JA 4G1QA 4CESA 3UIQA 1F21A 3AVCA 3OYDA 1A5XA 1SL0A 1FK9A 4CIGA 4CK1A 4BACA 1NKCA 2KQ2A 4DFJA 4B9LA 4J2AA 3SUOA 1Q9YA 3JYTA 3C95A 3L2UA 4CGJA 3NHGA 4KTZA 5HBMA 3HPGA 2GV9A 1S1XA 4OVLA 3VQBA 4CHNA 1TAUA 1C1CA 3KJVA 4H4MA 3AVFA 2HHWA 1RTHA 4I2QA 1IKYA 2EX3A 3CG7A 4LD0A 4B8CA 1J54A 5DK5A 2FBXA 2YNIA 4FLVA 1VK0A 4FJ5A 2RF2A 1T03A 4B9MA 2HHSA 1Q9XA 4FJLA 4H4OA 3SV3A 2YHBA 4DSJA 3I8DA 2OZMA 4Q5VA 3KTQA 1KTQA 2KFZA 4DSKA 4I2PA 3G10A 4O5BA 3KLGA 4KRFA 2HNYA 4KV8A 4DLEA 3AO2A 3QETA 3CFPA 3QESA 1VSIA 3DOKA 2QK9A 4OGCA 3CYMA 1RT6A 4PA1A 4DG1A 3L2WA 3LZIA 4CEQA 4W5OA 3VA0A 2B6AA 4JRPA 3QO9A 4DTNA 2G8KA 4CF8A 4LH4A 4DTJA 2YNFA 4QAGA 4IFVA 4ZTJA 1R0AA 1SL1A 4CK3A 3K59A 1Y97A 4E7IA 3OS2A 3V1QA 3RMCA 1S1VA 1RTIA 4FK2A 4AHRA 4W5QA 1BI4A 1S6PA 2BANA 2A1SA 2Y1JA 1DTTA 5KTQA 3KLFA 5HRPA 4FCYA 2G8IA 3M8RA 4DSLA 2XY5A 4N41A 3HP6A 4PWDA 5J1EA 4F2SA 1JLBA 2IDOA 1HPZA 4H8KA 4J2EA 4Z4GA 1RDBA 4K8XA 1KVAA 4DU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JLF A;  1YTA A;  4N47 A;  3K5M A;  4DF4 A;  4NCB A;  4C8M A;  4FVM A;  4OLA A;  3LPU A;  2IGI A;  3L3U A;  2PYL A;  4KTQ A;  1QS4 A;  1XHX A;  4M45 A;  4CGH A;  3O3G A;  3SQ1 A;  3OYA A;  4CEE A;  3MXM A;  4FXD A;  5SWM A;  3ZSX A;  2QXF A;  3ASM A;  1ASV A;  4NCG A;  1KFS A;  4J2D A;  4HHT A;  2RPI A;  4KHQ A;  1RCH A;  1ASU A;  3QER A;  1JL1 A;  1S1U A;  4I9L A;  3RRH A;  3S3N A;  1SKW A;  3AVM A;  1N6Q A;  4FK0 A;  4KI6 A;  4C8N A;  3QEV A;  1ZBL A;  1NKB A;  2D5R A;  1C6V A;  5CYQ A;  3TAM A;  3TAE A;  4JRQ A;  1JLC A;  1RBU A;  5JS2 A;  2F8S A;  4CEB A;  4E1N A;  4CJR A;  2HVI A;  1NK4 A;  4AHU A;  1JL2 A;  1UA0 A;  4KRE A;  1WAF A;  4FJN A;  3DLR A;  4MQ3 A;  4FZZ A;  3ZSR A;  3OS1 A;  4DS5 A;  4BDZ A;  3WNF A;  4I7F A;  3RMD A;  2P5O A;  4RW7 A;  1UA1 A;  3VQC A;  1L3S A;  2BGG A;  3NDK A;  1HNI A;  1J53 A;  3AVA A;  3VQQ A;  3ZSV A;  4CJ3 A;  4FJG A;  4FZX C;  1RDD A;  1TKT A;  4FLX A;  1BCM A;  3OYC A;  1NK0 A;  5CZ1 A;  2W42 A;  4DS4 A;  3SUN A;  3SI6 A;  2HHQ A;  2FBY A;  4CEA A;  4OLB A;  4N5S A;  4Z4F A;  4CEF A;  3NCI A;  2FBV A;  2KZZ A;  4Z0U A;  1Z26 A;  2OYQ A;  1W0H A;  2VG6 A;  5HRR A;  4CJV A;  1ZBH A;  3DM2 A;  1TK5 A;  1BQN A;  4E19 A;  4ELT A;  4RW6 A;  4CGF A;  4KHN A;  2ZQB A;  1EP4 A;  3CFO A;  4CE9 A;  1VSE A;  3ZT4 A;  3HPH A;  3HM9 A;  3RMB A;  3OYN A;  3NH0 A;  4HCB A;  1TK8 A;  4RG8 A;  4CJK A;  3DLB A;  1KVB A;  1RBR A;  4NYF A;  4DQI A;  1RBV A;  3IS9 A;  3SV4 A;  1S5J A;  3LAN A;  3B6O A;  5KRT A;  3EYZ A;  3P1G A;  2R7Y A;  3RTV A;  1B92 A;  3AO1 A;  4Y1D A;  4CHQ A;  3ZSO A;  4KHU A;  1TL3 A;  3L8B A;  1W9H A;  4N56 A;  3AVN A;  5KGW A;  2GUI A;  4Z4C A;  3DLE A;  4CF9 A;  1ZBI A;  5KGX A;  4NYN A;  1LWC A;  3MXI A;  2HHT A;  3DLG A;  4DMN A;  1HQE A;  4CHY A;  4W5N A;  4O0I A;  3QLH A;  3HL8 A;  5CZ2 A;  3KK2 A;  4M3Z A;  4WE1 A;  3OS0 A;  1XI1 A;  2IS3 A;  1MU2 A;  4C8L A;  1DTQ A;  2WOM A;  4E1M A;  2G8F A;  3NGI A;  1NK8 A;  4XIU A;  3NF6 A;  2DFF A;  2IOC A;  3K58 A;  3QNO A;  3SJJ A;  1KFD A;  1QQC A;  2YKM A;  1A5V A;  3VQ6 A;  5HP1 A;  4CGI A;  1SV5 A;  4OPJ A;  4HUE A;  5J2Q A;  2EHG A;  4FW2 A;  3OYI A;  1IO2 A;  2B5J A;  3QNN A;  1T05 A;  4FJI A;  3WNG A;  4R5P A;  1TKD A;  4M42 A;  2KZM A;  2P5G A;  2X74 A;  4KFB A;  1RT7 A;  3P5J A;  1CXU A;  4BWJ A;  3T1A A;  2LSN A;  1LW2 A;  1GOB A;  1WSF A;  1KRP A;  2WON A;  1L5U A;  4J2B A;  2VWJ A;  3SQ4 A;  3AO4 A;  1IKW A;  1D5A A;  3G0Z A;  5DMR A;  3QEW A;  3OYJ A;  4ELU A;  1QHT A;  2XO7 A;  3AVI A;  3WNH A;  4FLT A;  4FJM A;  1WSH A;  1L3U A;  1YTU A;  1RT5 A;  2KTQ A;  4LSN A;  1QSL A;  4FJ8 A;  4OJR A;  3CQ8 A;  1K6Y A;  3T3F A;  3O3H A;  1L3T A;  3VQ4 A;  4DWI A;  4FM1 A;  3AVL A;  2A1R A;  2HHU A;  4B08 A;  4NCA A;  1C0T A;  4CJW A;  2X6S A;  1BI4 B;  1ZYQ A;  3QIO A;  4DU1 A;  3HXM A;  1NOY A;  1D8Y A;  4CCH A;  5KI6 A;  3ULD A;  1BGX T;  4IBN A;  4HCC A;  4B9S A;  1UOC A;  1RIL A;  1LWE A;  3TAG A;  3ZT1 A;  4FM0 A;  4RW9 A;  4CEZ A;  3HVR A;  4F4K A;  2Q3S A;  3V9Z A;  2PY5 A;  4EZ9 A;  2HVH A;  2VG7 A;  3KLE A;  4CJ5 A;  4OGE A;  3MEE A;  4AH9 A;  4CEC A;  1Z25 A;  3AA2 A;  4C8O A;  3SQ0 A;  3S9H A;  4KAZ A;  4O4G A;  3HPO A;  4CHZ A;  1IKV A;  4GW6 A;  2XY6 A;  2HMI A;  4IG3 A;  2E4L A;  3PX4 A;  1VSJ A;  1C0U A;  1TKZ A;  2IC3 A;  1RT4 A;  3RMA A;  1I39 A;  3SQ2 A;  3U6F A;  3NF8 A;  4O0J A;  3I0R A;  1CLQ A;  5D3G A;  3NAE A;  4DLG A;  4FK4 A;  4ID5 A;  2DFH A;  3ZT2 A;  4KB1 A;  4DSI A;  2DTU A;  3EY1 A;  3QEP A;  3RR8 A;  1TGO A;  1UAX A;  1HJR A;  1IG9 A;  1LW0 A;  4CJF A;  3TAF A;  4OKE A;  3VA3 A;  4DTS A;  1JXB A;  2RN2 A;  4DQP A;  3DRS A;  3VQ9 A;  1X1P A;  1NK5 A;  4PQU A;  1WNS A;  4LSL A;  4W5T A;  4IG0 A;  1XHZ A;  1C0M A;  2OA8 A;  1BIU A;  3K5L A;  4FLU A;  2G8H A;  2ATQ A;  4BE2 A;  4KPY A;  1QSY A;  3JSM A;  4B3O A;  4DTO A;  1EX4 A;  3DLK A;  3HP9 A;  1U49 A;  3PY8 A;  3U3Y A;  1LWF A;  4DTU A;  1GOC A;  3RRG A;  4O44 A;  1ASW A;  4LY7 A;  1L3V A;  1KCF A;  3DYA A;  2ITG A;  1QE1 A;  1FKP A;  1JLQ A;  2BE2 A;  4CFC A;  4B8A B;  1X9M A;  3H08 A;  3ZSZ A;  1WSG A;  4BDY A;  3PO4 A;  3EZ5 A;  3NFA A;  3TAB A;  3C6U A;  3VQ7 A;  2YKN A;  1LV5 A;  2IAJ A;  2OPR A;  3LP0 A;  3DRR A;  2KFN A;  4CEO A;  2Y1I A;  2O4G A;  2AJQ A;  2ETJ A;  3OYE A;  4E3S A;  4JLH A;  4RW4 A;  4DTX A;  2OPP A;  4CGG A;  2QKB A;  3V9X A;  3V6D A;  4E7L A;  4HTU A;  4DSE A;  3VQ8 A;  4DTR A;  3TAP A;  4OPK A;  3HJF A;  1VSK A;  1CZ9 A;  2XY8 A;  1NJX A;  3BGR A;  3AVH A;  3PX0 A;  3PO5 A;  3M8P A;  4B9V A;  1VRT A;  3LP3 A;  5JS1 A;  2XRI A;  3PUF A;  3C94 A;  4FLW A;  3DLH A;  2O4I A;  2D0A A;  2VWK A;  3KK1 A;  3SNN A;  4EP5 A;  4FLZ A;  4CJU A;  4Z4E A;  4RW8 A;  5SZT A;  4E89 A;  3THV A;  4L8R B;  1J5O A;  4CF2 A;  1JLG A;  2DFE A;  1O1W A;  1TV6 A;  3S3O A;  3L2V A;  1FXX A;  4CFD A;  2YNG A;  4KI4 A;  4FJ7 A;  4IKF A;  2RKI A;  1Q8I A;  3OY9 A;  1HYS A;  5KRS A;  1RDC A;  1JLA A;  1N5Y A;  2HHX A;  2E6L A;  3AA5 X;  4I9Q A;  1RT3 A;  3HST B;  2JLE A;  5C25 A;  3F9K A;  1QSS A;  3V81 A;  4CGD A;  2E6M A;  4KO0 A;  3O3F A;  4IFY A;  1WSE A;  2Z1J A;  4OKJ A;  4DTM A;  1NOZ A;  5T7B A;  1FKO A;  4YNQ A;  1QTM A;  4MFB A;  4FW1 A;  4FJX A;  2ZE2 A;  3LZJ A;  3V1O A;  3P83 D;  4M41 A;  3K57 A;  1S6Q A;  2HND A;  4CER A;  2X6N A;  4CJP A;  3ZT0 A;  2PZS A;  4CHO A;  1WN7 A;  5CY4 A;  4K8Z A;  1VSH A;  5FRM A;  4ZTF A;  1T8E A;  2HB5 A;  4DQR A;  1LAV A;  3HYF A;  1DLO A;  4E7H A;  5HLF A;  4B9T A;  1TAQ A;  3KK3 A;  3LAK A;  4FJ9 A;  1B9F A;  4OKK A;  3OYF A;  1BCO A;  5EU7 A;  4CJL A;  3LDS A;  4HUF A;  4CJT A;  3TAQ A;  4FZY A;  3KIO A;  3A2F A;  3NGZ A;  1S1W A;  4LH5 A;  4JS4 A;  5J2N A;  3OJU A;  1NK6 A;  5CYM A;  3VN5 A;  3VQD A;  1GOA A;  2FC0 A;  4DFP A;  1RT1 A;  4F3T A;  1RTD A;  3V9U A;  2G8V A;  2HNZ A;  4PUO A;  5FRN A;  3ZSW A;  1YVU A;  1IH7 A;  3WNE A;  3LAM A;  1NJW A;  4M3R A;  3I0S A;  3F73 A;  3RWU A;  4CIF A;  2HW3 A;  4CF1 A;  2Z1G A;  4AHS A;  3FFI A;  4DFM A;  3B6P A;  3HVT A;  4BDP A;  4M3X A;  3NF9 A;  1BHL A;  3V9S A;  1NJY A;  4B9N A;  3LP1 A;  1HYZ A;  3NBP A;  1S9G A;  1BIS A;  1XWL A;  2Z1I A;  4CFA A;  5J2P A;  5FRO A;  1D9D A;  4AHV A;  3S3M A;  3OYH A;  2GBZ A;  1A5W A;  4E7J A;  3V1R A;  4DF8 A;  5I42 A;  4FJJ A;  3DMJ A;  4KKO A;  3OYL A;  5K14 A;  3MXJ A;  4M3W A;  4EP4 A;  5C42 A;  2X78 A;  5HRS A;  3V4I A;  4ICL A;  3TI0 A;  2F8T A;  4ID1 A;  1LAW A;  3AA4 A;  2OPQ A;  3ALY A;  4AHC A;  3PV8 A;  3TR8 A;  3LAL A;  1U45 A;  1TVR A;  2YHA A;  1KVC A;  4Q0B A;  3KD5 E;  3AV9 A;  3L2R A;  3LPT A;  1U47 A;  4BE0 A;  2G8U A;  4KB0 A;  4FJH A;  1VSF A;  5HRO A;  1HMV A;  3AO3 A;  3NF7 A;  3TAR A;  3KKR A;  4FJK A;  4DU3 A;  4JS5 A;  4GMJ B;  3BDP A;  1VRU A;  1NJZ A;  1WSI A;  2OPS A;  4DQS A;  4BWM A;  3L2Q A;  1UWB A;  4M3T A;  4CJ4 A;  3SYZ A;  1SKS A;  3MEG A;  1IKX A;  1VSD A;  3M8S A;  4B9U A;  4N76 A;  3RR7 A;  3OYG A;  3VQA A;  3AO5 A;  3CM6 A;  1SKR A;  3NH1 A;  1X9W A;  1JXE A;  4GVM A;  3DI6 A;  3NE6 A;  3IAY A;  4FM2 A;  4EZ6 A;  3DOL A;  4KTW A;  3QIN A;  2P51 A;  5I3U A;  1HRH A;  1RDA A;  4DSF A;  1D9F A;  1NKE A;  2YV0 X;  1KSP A;  3SCX A;  4KHW A;  4DTP A;  4O55 A;  4CF0 A;  4UQG A;  5HRN A;  2OZS A;  3AVG A;  4TSX A;  4F3O A;  1REV A;  1NK9 A;  5E41 A;  3E01 A;  4AHT A;  3C6T A;  3K5N A;  4YFU A;  1YT3 A;  1TKX A;  1U48 A;  2P1J A;  4KHY A;  3KKS A;  3K5O A;  1EKE A;  3HO1 A;  1RBT A;  1CXQ A;  3HK2 A;  4IDK A;  1B9D A;  4HVJ A;  4ELV A;  1EET A;  1HNV A;  1TK0 A;  4QOZ B;  1BQM A;  1WSJ A;  3VQ5 A;  3QEI A;  2XY7 A;  1J9A A;  2Z1H A;  1C1B A;  2JGU A;  4F8R A;  4CJE A;  3LP2 A;  1VSM A;  3OYK A;  2KW4 A;  2HHV A;  3M8Q A;  3CFR A;  4W5R A;  3DRP A;  4Y1C A;  2YNH A;  3SUQ A;  5J2M A;  4M3U A;  4CED A;  1WAJ A;  3NH2 A;  4E0D A;  1RT2 A;  3K2P A;  1T7P A;  1XC9 A;  1ZBU A;  4CIE A;  2D0B A;  3IG1 A;  4DQQ A;  1ZBF A;  1NK7 A;  2PYJ A;  2VG5 A;  4F2R A;  3NGY A;  4Z4H A;  3OYB A;  1RBS A;  3AA3 A;  3ZCM A;  4BE1 A;  3ZT3 A;  3SUP A;  3ISN C;  1C1A A;  1S9E A;  3KLI A;  3T19 A;  3KLH A;  4KHS A;  1SUQ A;  3ITH A;  3MED A;  3SPY A;  3D0P A;  1EXQ A;  2F96 A;  3SPZ A;  3AVK A;  3OVN A;  1VSL A;  3OJS A;  3TWH A;  3IRX A;  3U3G A;  3VQP A;  1X9S A;  1RNH A;  3O4Q A;  2QKK A;  4Z4I A;  2FBT A;  1KLN A;  1JKH A;  3LWL A;  1KLM A;  4CK2 A;  3TAN A;  3KD1 E;  4M3Y A;  3MEC A;  4CJQ A;  2I5J A;  3L3V A;  2XHB A;  2BDP A;  3VQE A;  3CM5 A;  4AIL C;  4DFK A;  4FYD A;  3SZ2 A;  3ZSQ A;  4C8K A;  3QIP A;  5FDL A;  1ITG A;  4CJS A;  1CZB A;  3V9W A;  4CHP A;  3HT3 A;  1I3A A;  1SL2 A;  2D0C A;  4E7K A;  1U4B A;  1RTJ A;  1WLJ A;  1HYV A;  4CFB A;  3OYM A;  4FLY A;  1BIZ A;  1U04 A;  3AVB A;  5C24 A;  3O4N A;  3PX6 A;  3AVJ A;  1HQU A;  1G15 A;  1S1T A;  4QCL A;  3QEX A;  3ZSY A;  2ZD1 A;  1TL1 A;  3MAQ A;  4ZHR A;  4PY5 A;  3D45 A;  2G8W A;  4HUG A;  1JLE A;  2NUB A;  2DY4 A;  3LWM A;  1BL3 A;  2B4J A;  4G1Q A;  4CES A;  3UIQ A;  1F21 A;  3AVC A;  3OYD A;  1A5X A;  1SL0 A;  1FK9 A;  4CIG A;  4CK1 A;  4BAC A;  1NKC A;  2KQ2 A;  4DFJ A;  4B9L A;  4J2A A;  3SUO A;  1Q9Y A;  3JYT A;  3C95 A;  3L2U A;  4CGJ A;  3NHG A;  4KTZ A;  5HBM A;  3HPG A;  2GV9 A;  1S1X A;  4OVL A;  3VQB A;  4CHN A;  1TAU A;  1C1C A;  3KJV A;  4H4M A;  3AVF A;  2HHW A;  1RTH A;  4I2Q A;  1IKY A;  2EX3 A;  3CG7 A;  4LD0 A;  4B8C A;  1J54 A;  5DK5 A;  2FBX A;  2YNI A;  4FLV A;  1VK0 A;  4FJ5 A;  2RF2 A;  1T03 A;  4B9M A;  2HHS A;  1Q9X A;  4FJL A;  4H4O A;  3SV3 A;  2YHB A;  4DSJ A;  3I8D A;  2OZM A;  4Q5V A;  3KTQ A;  1KTQ A;  2KFZ A;  4DSK A;  4I2P A;  3G10 A;  4O5B A;  3KLG A;  4KRF A;  2HNY A;  4KV8 A;  4DLE A;  3AO2 A;  3QET A;  3CFP A;  3QES A;  1VSI A;  3DOK A;  2QK9 A;  4OGC A;  3CYM A;  1RT6 A;  4PA1 A;  4DG1 A;  3L2W A;  3LZI A;  4CEQ A;  4W5O A;  3VA0 A;  2B6A A;  4JRP A;  3QO9 A;  4DTN A;  2G8K A;  4CF8 A;  4LH4 A;  4DTJ A;  2YNF A;  4QAG A;  4IFV A;  4ZTJ A;  1R0A A;  1SL1 A;  4CK3 A;  3K59 A;  1Y97 A;  4E7I A;  3OS2 A;  3V1Q A;  3RMC A;  1S1V A;  1RTI A;  4FK2 A;  4AHR A;  4W5Q A;  1BI4 A;  1S6P A;  2BAN A;  2A1S A;  2Y1J A;  1DTT A;  5KTQ A;  3KLF A;  5HRP A;  4FCY A;  2G8I A;  3M8R A;  4DSL A;  2XY5 A;  4N41 A;  3HP6 A;  4PWD A;  5J1E A;  4F2S A;  1JLB A;  2IDO A;  1HPZ A;  4H8K A;  4J2E A;  4Z4G A;  1RDB A;  4K8X A;  1KVA A;  4DU4 A; 
#chains in the Genus database with same CATH topology
 1Q82 O;  1ATS A;  2O8C A;  4BRN A;  1W2B M;  4JK9 A;  3L3U A;  1QS4 A;  3SQ1 A;  3OYA A;  3ASM A;  1ASV A;  2I7P A;  4J2D A;  3L4I A;  1RCH A;  1ASU A;  3RRH A;  4V19 S;  3TAE A;  3TAM A;  5CYQ A;  4H0P A;  4JRQ A;  5JS2 A;  1E4F T;  4JKD A;  4CEB A;  4CJR A;  3GOI A;  4AHU A;  1UA0 A;  2O8D B;  5EY4 A;  5C2F A;  5CHI A;  3FZM A;  3OS1 A;  4DS5 A;  2D1K A;  3VQC A;  3NDK A;  1EQY A;  3F2K A;  2V51 B;  2W42 A;  4N5S A;  1Z26 A;  5MLC Q;  1WBB A;  1P90 A;  4JK8 A;  1BQN A;  4RW6 A;  4KHN A;  1EP4 A;  4PKI A;  1VSE A;  3ZT4 A;  3HPH A;  5EX5 A;  3A5N C;  3HM9 A;  3RMB A;  4HCB A;  3O9Q A;  4CJK A;  3DLB A;  4DQI A;  1RBV A;  1S5J A;  3EKS A;  3EYZ A;  5KRT A;  2R7Y A;  3AO1 A;  4Y1D A;  5KPR A;  3ZSO A;  1S72 N;  1TL3 A;  3CMA N;  3CER A;  5KGW A;  4Z4C A;  3DLE A;  4LF4 K;  4NYN A;  4BRH A;  2HHT A;  3DLG A;  4W5N A;  4O0I A;  4H03 B;  3KK2 A;  4M3Z A;  3D2E A;  1XI1 A;  2ZM6 K;  1MU2 A;  4JV5 K;  1DTQ A;  3A5O C;  3KHY A;  3Q7B A;  1MDU B;  1C0F A;  3CJ1 A;  2YKM A;  1A5V A;  4CGI A;  1SV5 A;  4OPJ A;  3D2F B;  4YOR A;  4FJI A;  3WNG A;  1DEJ A;  4DUY K;  4M42 A;  4XH4 A;  2KZM A;  2HST A;  3O08 A;  4KFB A;  1YJ9 N;  2A6A A;  4JI2 K;  2LSN A;  4KH6 A;  4JN4 A;  3ULE B;  1KQS M;  4J2B A;  3GE1 A;  3G0Z A;  1VQO N;  1QHT A;  2XO7 A;  4FLT A;  1WSH A;  3VES A;  4FJ8 A;  4L3Q A;  4OJR A;  1BDG A;  4A61 A;  1C0T A;  4CJW A;  4CZG A;  5FLX O;  4ISG A;  4FSV A;  1QHA A;  4HCC A;  3ZEU A;  4HWI A;  3TAG A;  5BR9 A;  4FM0 A;  4RW9 A;  1VQK N;  3VET A;  1IG8 A;  2OTL N;  2VG7 A;  3O80 A;  3K9K A;  2P9N B;  4WCE L;  3S9H A;  4CHZ A;  4IG3 A;  4LF9 K;  5AQR A;  3RMA A;  1I39 A;  4B1Z A;  3SQ2 A;  3NF8 A;  2QWM A;  3K9J A;  5D3G A;  1CLQ A;  5A2Q O;  1W7A A;  4KB1 A;  4O8U A;  2IVN A;  1LW0 A;  5AQZ A;  4BRC A;  1ATN A;  2H3G X;  4DQP A;  4KBO A;  1X1P A;  1NK5 A;  4LSL A;  4IG0 A;  1C0M A;  2VWB A;  3K5L A;  2ATQ A;  4KPY A;  1QSY A;  3G71 N;  1EX4 A;  3EE9 A;  3U3Y A;  3P38 A;  2FF6 A;  4O44 A;  1ASW A;  1KCF A;  3CCJ N;  4YOX A;  3FZK A;  1VHX A;  3MDQ A;  1IBL K;  3ZSZ A;  2UUA K;  2FSK A;  2E2N A;  5FPN A;  3ZX0 A;  1LV5 A;  2Y1I A;  1EO1 A;  3OYE A;  4DTX A;  3CI5 A;  2QKB A;  2WBN A;  3V6D A;  3H6E A;  3CJC A;  4HTU A;  4OPK A;  1NLV A;  1CZ9 A;  1NJX A;  4BQL A;  3CHW A;  3PX0 A;  3PO5 A;  4JI3 K;  3MN9 A;  5C2D A;  2P9P A;  4PL7 A;  4FLW A;  3OBY A;  3DLH A;  3KK1 A;  4EP5 A;  4CJU A;  3W0L A;  3THV A;  3WT0 A;  4E89 A;  4CF2 A;  1JLG A;  2DFE A;  2HBK A;  1O1W A;  1TV6 A;  3E9L A;  1NGG A;  3L2V A;  3CPW M;  3VGM A;  2YHX A;  1KAY A;  4H0X B;  5KRS A;  3QIC A;  2GUP A;  1FW6 A;  1Z6R A;  4DV5 K;  1QSS A;  2CH5 A;  1WSE A;  1NOZ A;  1FKO A;  3VEY A;  3SJH A;  5JLF A;  4WFN L;  1OKJ A;  3LZJ A;  3P83 D;  3K57 A;  1S6Q A;  4CHO A;  5CY4 A;  3WXI A;  4ZTF A;  4OKK A;  4JI5 K;  3LDS A;  4HUF A;  4CJT A;  4FZY A;  2GX9 A;  1ZXO A;  3KIO A;  3LL3 A;  1NK6 A;  5J2N A;  5CYM A;  1O13 A;  4B3R K;  4PUO A;  5FRN A;  2O8B B;  1GLB G;  3LAM A;  3I0S A;  3F73 A;  4AHS A;  3BZC A;  2NRW A;  1BHL A;  3LP1 A;  3NBP A;  1BIS A;  4QS8 A;  4IZ9 A;  3S3M A;  3OYH A;  3CJA A;  3H45 C;  4A5B A;  1YHQ N;  4CZF A;  4E7J A;  5I42 A;  4DR7 K;  4GVE A;  4DR5 K;  3V4I A;  2X78 A;  5GIN A;  4ID1 A;  3AA4 A;  4BC2 A;  2A3Z A;  3LAL A;  4BRF A;  1TVR A;  1KVC A;  5KPZ A;  2BUP A;  3AO3 A;  4AM7 A;  3NF7 A;  2QI2 A;  2I7N A;  4JS5 A;  3BDP A;  1NJZ A;  1N34 K;  4OPH A;  1UWB A;  1T3V A;  2E5L K;  4B9U A;  4R79 A;  4A5A A;  3NH1 A;  1JXE A;  2RHK A;  4YOW A;  3IAY A;  3KK7 A;  3DOL A;  4PKH A;  4XH1 A;  4KTW A;  1HRH A;  2NRR A;  3ZET A;  4O55 A;  4CF0 A;  4F3O A;  1REV A;  1XMO K;  4JD2 A;  4H5T A;  4AHT A;  3K5N A;  4YFU A;  1TKX A;  1VQN N;  2E1Z A;  2P1J A;  5BR8 K;  1Q86 O;  1XMQ K;  4H0Y B;  2YHW A;  5AQU A;  1EET A;  1WSJ A;  3KWG A;  1P8Z A;  2P9N A;  3QML A;  2XY7 A;  1VAZ A;  2Z1H A;  4EFH A;  1VQ5 N;  4KHP K;  3HZ6 A;  3LP2 A;  1VSM A;  4CJE A;  2HHV A;  3J80 O;  3VEW A;  3DRP A;  4M3U A;  1WAJ A;  4E0D A;  2A41 A;  2CH6 A;  3VEO A;  2NRZ A;  2UUB K;  2GEL A;  4B1V A;  3HM8 A;  3IDH A;  3CPE A;  4JKG A;  1RBS A;  3AA3 A;  3ZT3 A;  1VQM N;  1C1A A;  4H5W A;  3KLH A;  3T19 A;  3ITH A;  3SPY A;  3CCU N;  1VSL A;  3OJS A;  3CME N;  3O4Q A;  2E2Q A;  3DXM A;  4Z4I A;  2FBT A;  1BA0 A;  1D4X A;  3LWL A;  1KLM A;  3TAN A;  3KD1 E;  3L3V A;  2VQE K;  4JKH A;  4A57 A;  3CM5 A;  1NMD A;  3PSI A;  5FDL A;  1N33 K;  1I3A A;  4BRO A;  4E7K A;  1HYV A;  3PX6 A;  1BIZ A;  3AVB A;  3O4N A;  2O8C B;  1TL1 A;  2PFU A;  4ZHR A;  1JCG A;  3D45 A;  3MAQ A;  1IBK K;  2DY4 A;  1QQN A;  1A5X A;  1SL0 A;  5E84 A;  4BRA A;  2KQ2 A;  2ASO A;  2P9S B;  3BF3 A;  4K25 A;  2Q0R A;  4BC5 A;  3HPG A;  3VQB A;  4CHN A;  1TAU A;  2A42 A;  1RTH A;  2YJF A;  4B8C A;  5DK5 A;  2FBX A;  1VK0 A;  4FJ5 A;  4AQY K;  1Q9X A;  1KTQ A;  3E1Y A;  3G10 A;  4KRF A;  3PIP L;  1R59 O;  4FWR A;  1VSI A;  3DOK A;  2YCH A;  3LZI A;  3THY B;  4FWK A;  4CEQ A;  4W5O A;  4CF8 A;  4IFV A;  1SL1 A;  3OS2 A;  5M1K A;  4AHR A;  4M63 C;  5AQK A;  2E2O A;  2RE2 A;  4CZK A;  1K8K B;  2G8I A;  3KLF A;  5HRP A;  3SK3 A;  4GKK K;  2NRV A;  1MWM A;  5AQW A;  4CD1 A;  4F2S A;  3MX2 A;  4BRL A;  1RDB A;  4DU4 A;  3GL1 A;  4J8F A;  2NZT A;  4NCB A;  4JI4 K;  4OLA A;  2PYL A;  4NLB A;  3OTO K;  1XHX A;  4CEE A;  3OHR A;  4YOT A;  5AQY A;  5LMN K;  3VER A;  4HHT A;  1JL1 A;  3R8E A;  1GLL O;  5M1Q A;  3QEV A;  1ZBL A;  3FR0 A;  2CGL A;  3D2F A;  1S22 A;  1RBU A;  2HVI A;  1XC3 A;  3DLR A;  4FZZ A;  4I7F A;  4RW7 A;  1M1K O;  4BRE A;  3AVA A;  3ZSV A;  4FJG A;  1TKT A;  3EZW A;  3OYC A;  4CEA A;  3O6W A;  4BC4 A;  3N4P A;  2UXB K;  2GTD A;  4CEF A;  4Z0U A;  2ZJP L;  2OYQ A;  3TSU A;  2VG6 A;  4QS9 A;  4JHD A;  1ZBH A;  1YF5 L;  3DM2 A;  4E19 A;  4ELT A;  4NB4 A;  4CGF A;  3CFO A;  3CC2 N;  4GV9 A;  3NH0 A;  4RG8 A;  1RBR A;  4NYF A;  4B1W B;  3SV4 A;  4JKF A;  2VGM A;  2A5X A;  3P1G A;  4IEI A;  4IO8 A;  3CF5 L;  3CC7 N;  4KH5 A;  1W9H A;  5EXW A;  4DV7 K;  4CZJ A;  3TU5 A;  3MXI A;  1LCU A;  4DMN A;  1HQE A;  3O9R A;  4ISF A;  3KVG A;  4DR2 K;  2IS3 A;  5AFU A;  5AQO A;  2ZGY A;  4C8L A;  1NGJ A;  2G8F A;  1NK8 A;  4LC9 B;  3I55 N;  1NGE A;  2DFF A;  3QNO A;  3K58 A;  3HRG A;  3SJJ A;  1KFD A;  1HKC A;  1QQC A;  3ENO A;  2GWK A;  5HL7 L;  3CCM N;  3NMU A;  3HBT A;  3QNN A;  5LJV A;  3OYI A;  1IO2 A;  4FVU A;  1TKD A;  4IOC L;  2X74 A;  4BWJ A;  3T1A A;  3C6H A;  1GOB A;  1L5U A;  3SQ4 A;  2Q36 A;  2YI1 A;  2O8B A;  1T6D A;  1D5A A;  1NU0 A;  4ELU A;  3QEW A;  4FJM A;  3OYJ A;  3AVI A;  2W40 A;  1RT5 A;  2KTQ A;  4LSN A;  4F9O A;  3T3F A;  1L3T A;  4IFE A;  4YDU A;  3O3H A;  4K0K K;  2A1R A;  4NCA A;  3EL2 A;  4PHT X;  5AQP A;  3HXM A;  4JK7 A;  5H1S Q;  3ULD A;  4IBN A;  5HOO A;  1RIL A;  3ULE A;  3D2E B;  3ZT1 A;  3T1H K;  4F4K A;  1X3N A;  3V9Z A;  1JJ2 M;  3O9U A;  4CJ5 A;  3MEE A;  1Z25 A;  3SQ0 A;  3HPO A;  2XY6 A;  2HMI A;  2FXU A;  4MO5 A;  1VSJ A;  2IC3 A;  1NG9 A;  5TKY A;  2HBM A;  3U6F A;  3NAE A;  3WQT A;  3SBT A;  4ID5 A;  5AQL A;  2HMP A;  4DSI A;  2JWL A;  1NGB A;  3A5L C;  4OKE A;  4DTS A;  3SMP A;  4CBU A;  5GAG P;  1JXB A;  4K41 A;  4PQU A;  1BIU A;  4FLU A;  2G8H A;  4BE2 A;  1NGI A;  1OH7 A;  4B3O A;  3H3N O;  3HP9 A;  2QA4 N;  3AY9 A;  4A62 A;  4MLH A;  1HNX K;  2HOE A;  4LF8 K;  3DYA A;  2ITG A;  1QE1 A;  3CXC M;  3RVC A;  1Q18 A;  3F5T A;  1WSG A;  5CR4 A;  4IXC A;  1JCF A;  3NFA A;  2UU9 K;  2Q97 A;  3C6U A;  2YKN A;  2IAJ A;  2OPR A;  3DRR A;  3U9Z A;  2O4G A;  2AJQ A;  2QWQ A;  3J7Y P;  2V7Z A;  1HX1 A;  2ETJ A;  3QBW A;  3H46 O;  4JLH A;  2OPP A;  2WC9 A;  1IJJ A;  3K0S A;  3VQ8 A;  4DSE A;  3SAF A;  4DTR A;  3TAP A;  2ZJR L;  1VSK A;  4B1Y B;  2XY8 A;  3BGR A;  2XRI A;  3PUF A;  4JI6 K;  5AJ3 K;  3TTF A;  4RW8 A;  3S3O A;  1FXX A;  4CFD A;  3RSE A;  4DV0 K;  4FJ7 A;  3TSQ A;  4CW7 B;  1N5Y A;  2HHX A;  4A2A A;  3QFU A;  4I9Q A;  3AA5 X;  1RT3 A;  5C25 A;  1OVQ A;  2YX6 A;  2E6M A;  3O1B A;  1YAG A;  4FL9 A;  4YNQ A;  5LY3 A;  1QTM A;  5BRE A;  4FW1 A;  4MDB A;  4IEE A;  1BUP A;  2UXD K;  2HND A;  5C0Y A;  2PZS A;  5BRF A;  4DQ8 A;  3C65 A;  5F0X A;  3VMF B;  2E8A A;  2QM1 A;  3IKM A;  3VF6 A;  4JS4 A;  3NGZ A;  1S1W A;  3FFK B;  3EKU A;  1RTD A;  2G8V A;  3E9P A;  3ZSW A;  1DGK N;  3HSC A;  3RWU A;  3CCE N;  1NJW A;  1ILY A;  4CIF A;  4BRG A;  5AQF A;  4BDP A;  2UYT A;  3B6P A;  4M3X A;  3NF9 A;  3V9S A;  1NJY A;  1XWL A;  2BTF A;  3DAW A;  2QWL A;  5J2P A;  3QBX A;  1ZBS A;  4NXM K;  1A5W A;  2ZJQ L;  3V1R A;  4BRK A;  4DF8 A;  4FJJ A;  3DMJ A;  4CBX A;  3OYL A;  4WFA L;  2O8D A;  4EHT A;  4EP4 A;  5HRS A;  4LF7 K;  2F8T A;  4M3T A;  4AHC A;  3TR8 A;  5AZI A;  4Q0B A;  3AV9 A;  3LPT A;  4BE0 A;  5LL6 Z;  4KB0 A;  4FJH A;  1VSF A;  3QDK A;  5M1P A;  3TAR A;  1HR0 K;  3JS6 A;  1C0G A;  4FJK A;  3MMV A;  4DB3 A;  4CJ4 A;  3SYZ A;  1IKX A;  3M8S A;  3RR7 A;  3AO5 A;  2NRX A;  3O1W A;  4BR0 A;  4FM2 A;  4EZ6 A;  5BPM A;  5I3U A;  2GWJ A;  4A2B A;  4KHW A;  4DTP A;  3BEX A;  1RGI A;  5HRN A;  2QXL A;  4PL8 A;  4TSX A;  3KKS A;  3SLC A;  3K5O A;  5F1X A;  3AAP A;  5C12 A;  1U2V A;  2Q0U A;  1BQM A;  3VQ5 A;  3QEI A;  1C1B A;  5J2M A;  4B3T K;  1RT2 A;  3K2P A;  3SBG A;  2ASM A;  1ZBU A;  4BR7 A;  4CIE A;  2D0B A;  1NK7 A;  4F2R A;  2VG5 A;  4JAX A;  4Z4H A;  3OYB A;  5BN9 A;  4K43 A;  4BE1 A;  3T1Y K;  3KLI A;  4KHS A;  4RTF D;  4NXN K;  3U8X A;  3AAQ A;  3U3G A;  3VQP A;  1J6Z A;  4H5N A;  3CD6 N;  1JKH A;  3EEQ A;  3LM9 A;  3MEC A;  4CJQ A;  2BDP A;  2UUC K;  3VQE A;  4WQ5 A;  3ZSQ A;  2IVP A;  3WXM B;  1NM1 A;  3SZ2 A;  1KD1 O;  3NVK A;  4B3S K;  3OYM A;  4CFB A;  4C23 A;  1U04 A;  2V52 B;  3C7N A;  3AVJ A;  1S1T A;  1G15 A;  4X65 K;  3D6R A;  4PY5 A;  3LM2 A;  1BL3 A;  2B4J A;  4CES A;  3UIQ A;  3OYD A;  4CIG A;  2FF3 B;  4CK1 A;  4BAC A;  1NKC A;  4DFJ A;  3L2U A;  4O5F A;  1S1X A;  4OVL A;  1U6Z A;  3H1Q A;  3BF1 A;  5JIC A;  3MWT A;  3KJV A;  4H4M A;  3MK6 A;  4JKE A;  2HHW A;  1IKY A;  1SQK A;  4LD0 A;  2YNI A;  1T03 A;  4B9M A;  4DV6 K;  3DXM B;  3SV3 A;  4OPA A;  4DV3 K;  2A40 A;  1HNW K;  1WB9 A;  2P9L A;  4DSK A;  3VTH A;  4JKC A;  4O5B A;  3AO2 A;  1HLU A;  4OGC A;  3CYM A;  1RT6 A;  4PA1 A;  4BG8 A;  4BG9 A;  4LF6 K;  4Z94 A;  4JRP A;  4DTN A;  2G8K A;  1T6C A;  4DTJ A;  4DV4 K;  4CK3 A;  4E7I A;  3V1Q A;  1S1V A;  1RTI A;  4FK2 A;  4W5Q A;  1BI4 A;  1S6P A;  2BAN A;  2A1S A;  3VGL A;  5KTQ A;  4FCY A;  3VEN A;  3M8R A;  3BP8 A;  3OA9 A;  1BWF O;  3FGU A;  3PIO L;  5J1E A;  4PWD A;  1HPZ A;  5GIP A;  4Z4G A;  3VQ7 A;  4C1N I;  3MCP A;  4N47 A;  4DF4 A;  4BR4 A;  4C8M A;  4FVM A;  1XUP O;  3I33 A;  2UXC K;  4M45 A;  4CGH A;  4FXD A;  5SWM A;  4NCG A;  1KFS A;  3CCV N;  3G6E N;  2RPI A;  3QER A;  1S1U A;  4I9L A;  1N6Q A;  3AVM A;  1I94 K;  4FK0 A;  4BRP A;  4KI6 A;  1QQM A;  3O9S A;  4H0T B;  4I6M A;  4IO9 L;  4JEP A;  1NK4 A;  4KRE A;  4B1U B;  4FJN A;  3UE5 A;  4BDZ A;  1NGF A;  3CCL N;  2P5O A;  1UA1 A;  1L3S A;  3EN9 A;  2BGG A;  2D0O A;  5IWA K;  1J53 A;  3UKR B;  3R3L A;  4FLX A;  1BCM A;  2V7Y A;  1OH6 A;  4DS4 A;  4BC3 A;  3SUN A;  2HHQ A;  2FBY A;  4AM6 A;  1E4G T;  1QQO A;  1NGA A;  4DR3 K;  4Z4F A;  1SAZ A;  2FBV A;  5HRR A;  2HBJ A;  5AFU H;  1T44 A;  1J5E K;  2ZQB A;  4CE9 A;  1TK8 A;  3J8A A;  3WQU A;  4EHU A;  3IS9 A;  4FWL A;  3RTV A;  1B92 A;  4CHQ A;  5GIO A;  1X9J A;  3AVN A;  2QTD A;  2GUI A;  2F9W A;  3GDQ A;  3ZET B;  4CF9 A;  1ZBI A;  1LWC A;  2OAN A;  5AQN A;  3ATV A;  1N36 K;  2EWS A;  2F7T A;  5FPD A;  3NGI A;  3NF6 A;  2IOC A;  5ADX H;  3VTI A;  5HP1 A;  4HUE A;  5J2Q A;  4FW2 A;  2B5J A;  1K73 O;  4R5P A;  4RCH A;  4CZE A;  4RWT A;  2P5G A;  3P5J A;  1CXU A;  5BRH A;  3FZL A;  1LW2 A;  4JKA A;  3O4W A;  2VWJ A;  1IKW A;  2D0P A;  5JLH A;  4KHU A;  3WXJ A;  1YTU A;  3WNH A;  3A5M C;  1QSL A;  1TYQ A;  1K6Y A;  1HNZ K;  3VQ4 A;  4FM1 A;  3AVL A;  4B08 A;  2X6S A;  2E20 A;  1BI4 B;  1ZYQ A;  4DU1 A;  2E1Y A;  4CCH A;  5KI6 A;  1BGX T;  1LWE A;  4GV3 A;  4CEZ A;  3HVR A;  1G99 A;  2Q3S A;  3FE1 A;  4BVP A;  5AQS A;  4O8K A;  4EZ9 A;  3ZX3 A;  5TKW A;  1TYQ B;  4OGE A;  1M90 O;  3SMS A;  5F2R A;  4AH9 A;  3AA2 A;  4CEC A;  3CCR N;  3THX B;  4O4G A;  1H1V A;  4GW6 A;  3EO3 A;  2E4L A;  4DR1 K;  5GAD P;  1C0U A;  1HPM A;  2P9K B;  3LDO A;  5AQM A;  4OO1 J;  4O0J A;  3A0I X;  3U9D A;  4LF5 K;  4B9Q A;  4FK4 A;  4QS7 A;  3RR8 A;  3O5B A;  3MCA B;  1IG9 A;  4CJF A;  3TAF A;  3VA3 A;  2JWK A;  1GLA G;  1WNS A;  4PKG A;  1XHZ A;  2OA8 A;  1SZ2 A;  3VF4 A;  4A59 A;  3JSM A;  3OW2 M;  3FLC O;  5AQI A;  3DLK A;  3PY8 A;  3C6A A;  1LWF A;  4DTU A;  4WQ4 C;  1L3V A;  3FZF A;  1FKP A;  1JLQ A;  4CFC A;  1GLC G;  1U2V B;  2P9I B;  2W41 A;  3H08 A;  4H0V B;  1X3M A;  4CD3 A;  3TAB A;  4E3S A;  4DHY A;  2VYP A;  4RW4 A;  5IT9 O;  4NLC A;  4KH4 A;  3V9X A;  4FWP A;  1MWK A;  4E7L A;  3Q7C A;  3HJF A;  3GBT A;  3M8P A;  4CZI A;  4B9V A;  3P4I A;  4IWV A;  2O4I A;  2D0A A;  2VWK A;  2ZGZ A;  3W3D A;  4Z4E A;  4L8R B;  2F4V K;  2HHH K;  1Q8I A;  1KC8 O;  3L0Q A;  1NJI O;  5M1O A;  3V81 A;  4IJN A;  4CGD A;  4BGA A;  4KO0 A;  3O3F A;  4JD2 B;  4WQ5 C;  5T7B A;  4MFB A;  4FJX A;  3O9T A;  5JMV A;  5BPN A;  3VEV A;  1QVG M;  3N4Q A;  5FRM A;  1T8E A;  4DQR A;  1LAV A;  4B9T A;  3KK3 A;  3LAK A;  1BCO A;  4CJL A;  2BH1 A;  1VQ7 N;  4JYA K;  3DJC A;  3ID8 A;  3A2F A;  4FPB A;  3OJU A;  1GOA A;  4DFP A;  1NWK A;  1BG3 A;  1RT1 A;  4F3T A;  3V9U A;  4WQ4 A;  3TPQ A;  1ATR A;  1IH7 A;  2HW3 A;  4CF1 A;  2Z1G A;  3FFI A;  3DXK B;  1HYZ A;  1KVA A;  2Z1I A;  4LFA K;  3KZB A;  3EE8 A;  3ENH A;  5M1N A;  1D9D A;  2HF3 A;  2GBZ A;  2PBD A;  4K42 A;  3TTD A;  4I6M B;  5K14 A;  3MXJ A;  4BRI A;  4M3W A;  4BRD A;  5C42 A;  4WF9 L;  2OTJ N;  4FO0 A;  3ALY A;  3PV8 A;  3L2R A;  4UY8 O;  2G8U A;  1U47 A;  2HBL A;  5HRO A;  1HMV A;  4CJ7 A;  3KKR A;  3F9M A;  1VRU A;  4GY2 B;  1WSI A;  2OPS A;  2VQF K;  4BWM A;  3L2Q A;  1NGC A;  4XH5 A;  4FWM A;  4EIA A;  1VSD A;  3P39 A;  3VQA A;  2KKZ A;  3CM6 A;  1WBD A;  3NE6 A;  4GVM A;  5BRD A;  2QW9 A;  2O8E A;  3QIN A;  2P51 A;  2P9I A;  1CZA N;  4DSF A;  5JVG L;  1D9F A;  2YV0 X;  3BUZ B;  4UQG A;  1OH8 A;  2DPN A;  3AVG A;  1NK9 A;  3R9P A;  2P9U A;  3E01 A;  2QWR A;  3UB5 A;  1EKE A;  1RBT A;  1CXQ A;  2F9T A;  3HK2 A;  1B9D A;  4HVJ A;  2P9S A;  4QOZ B;  1TK0 A;  3NVM A;  3DLL L;  1J9A A;  2JGU A;  4F8R A;  3OYK A;  2KW4 A;  3M8Q A;  3CFR A;  4CED A;  4U7B A;  3THW B;  3SAG A;  1DT9 A;  4DQQ A;  1ZBF A;  2PYJ A;  3NGY A;  4JI0 K;  3LDQ A;  3ZCM A;  3SUP A;  3ISN C;  1S9E A;  1YIJ N;  3MED A;  4IOX A;  2F96 A;  3D0P A;  3M6G A;  2CGJ A;  5CE3 A;  2O8E B;  1IBM K;  3IRX A;  2VGN A;  4GNI A;  1RNH A;  1KLN A;  4BRM A;  1V4S A;  2I5J A;  4BY9 C;  2WFB A;  3J7A P;  4IJA A;  4AIL C;  4C8K A;  2O8F B;  1ITG A;  1CZB A;  1SL2 A;  3HT3 A;  3G25 A;  2D0C A;  1U4B A;  1WLJ A;  4ILH A;  5AZJ A;  1HQU A;  4QCL A;  3QEX A;  5I9E B;  2ZD1 A;  2G8W A;  1JLE A;  4YY3 K;  1TUU A;  2ZWH A;  4G1Q A;  4YOY A;  1F21 A;  3AVC A;  1FK9 A;  4B9L A;  1VQ4 N;  3SUO A;  4J2A A;  1DKG D;  3D7E O;  4CGJ A;  3MWP A;  4B1X B;  3NHG A;  4KTZ A;  1HKG A;  1C1C A;  2IIR A;  3AVF A;  2W6K A;  3CG7 A;  1J54 A;  4FLV A;  3ID6 A;  3UKR A;  4FJL A;  5C15 A;  4DSJ A;  1HUX A;  4Q5V A;  3KTQ A;  2HNY A;  4KV8 A;  4IOA L;  3MN7 A;  3QES A;  4E1J A;  3M3Z A;  3TTC A;  2B6A A;  3QO9 A;  4LH4 A;  1R0A A;  2YNF A;  3K59 A;  5KQD A;  3WXK A;  3RMC A;  4WYB A;  5GAE P;  1K9M O;  2FSN A;  1YJW N;  2Y1J A;  1DTT A;  5FPE A;  3WXL A;  5DM7 L;  4N41 A;  4YOU A;  4JI7 K;  3AGR A;  5AQQ A;  1JLB A;  4H8K A;  4K8X A;  1JLF A;  1YTA A;  3K5M A;  1SS6 A;  2W6L A;  3LPU A;  2IGI A;  4KTQ A;  3THX A;  5JVH L;  4NO7 A;  3WEE A;  3O3G A;  5AR0 A;  1Q7Y O;  3MXM A;  3ZSX A;  2QXF A;  4KHQ A;  3S3N A;  4WFB L;  1SKW A;  4C8N A;  1NKB A;  3QB0 A;  2D5R A;  1C6V A;  1JLC A;  2F8S A;  1NNE A;  1HKB A;  4E1N A;  1JL2 A;  3S41 A;  2HF4 A;  2PAV A;  2Q1N A;  1WAF A;  4MQ3 A;  3ZSR A;  3WNF A;  3RMD A;  2J4R A;  2WTU A;  5AQX A;  3IUC A;  1HNI A;  3VQQ A;  4CJ3 A;  4FZX C;  1RDD A;  1KAZ A;  1S3X A;  1NK0 A;  5CZ1 A;  3SI6 A;  4OLB A;  4ILG B;  3BZK A;  3DXK A;  1Q81 O;  3NCI A;  2KZZ A;  3TSP A;  1W0H A;  4CJV A;  2ITM A;  2QWN A;  1TK5 A;  4H5R A;  4BQZ A;  3PSF A;  3OYN A;  1BU6 O;  3I56 N;  1KVB A;  2YJE A;  2P9L B;  4BR5 A;  3LAN A;  3B6O A;  5AQJ A;  3R6M A;  5AQT A;  4HTL A;  3L8B A;  4N56 A;  2ASP A;  4C1N K;  1VQ9 N;  5KGX A;  3LDP A;  4CHY A;  3QLH A;  3HL8 A;  5CZ2 A;  4WE1 A;  3OS0 A;  4DR6 K;  3P31 A;  3GG4 A;  2WOM A;  2FSJ A;  2P9K A;  4E1M A;  4XIU A;  1VQL N;  1QVF M;  2E2P A;  3VQ6 A;  1T05 A;  2EHG A;  4JI1 K;  5GAH P;  4ILJ A;  2OCE A;  4CZH A;  1KAX A;  5B8H A;  5FPM A;  1RT7 A;  3CJ9 A;  3ZLJ A;  3VOV A;  3M5R A;  1WSF A;  1KRP A;  2WON A;  3AO4 A;  4FWS A;  1VQ8 N;  5DMR A;  5AQH A;  1L3U A;  1N8R O;  3CQ8 A;  1TUY A;  4DWI A;  2HHU A;  5BPL A;  2QWP A;  4Y0W A;  1XNR K;  3UKU A;  4BR2 A;  2E88 A;  4CZL A;  3QIO A;  1NOY A;  1D8Y A;  5LJW A;  1Y64 A;  1QZ6 A;  3IMX A;  4B9S A;  1UOC A;  3G4S N;  4B3M K;  1N32 K;  2PY5 A;  2HVH A;  1NMN A;  3KLE A;  4CBW A;  2NLX A;  4DCH A;  4C8O A;  3R1X A;  5KQ8 A;  4KAZ A;  1IKV A;  3HOS A;  4X66 K;  3PX4 A;  1TKZ A;  1RT4 A;  3I0R A;  4DLG A;  3THY A;  2DFH A;  3ZT2 A;  2DTU A;  3EY1 A;  3AGK A;  3QEP A;  1TGO A;  1UAX A;  4M7X A;  1HJR A;  3CIP A;  3HOT A;  2RN2 A;  3DRS A;  3VQ9 A;  1RDW X;  4W5T A;  5DM6 L;  3ZEU B;  1K8K A;  2P9U B;  4BRQ A;  4DTO A;  1U49 A;  1FJG K;  1GOC A;  3RRG A;  4LFC K;  3H1V X;  4LY7 A;  2BE2 A;  4IDH A;  3QFP A;  4B8A B;  1X9M A;  3PO4 A;  4BDY A;  3VPZ A;  3EZ5 A;  3IFR A;  2P9P B;  3LP0 A;  3UKU B;  4BGB A;  2KFN A;  3I8B A;  4CEO A;  4CGG A;  4X62 K;  1GLE G;  4JHD B;  1ESV A;  1W97 L;  3T7Z A;  5AQG A;  1GLF O;  3AVH A;  4JKB A;  1VRT A;  3LP3 A;  5JS1 A;  1NGH A;  3CCQ N;  3C94 A;  1BO5 O;  3SNN A;  3VGK A;  1HJO A;  4YOV A;  4FLZ A;  4DKW A;  2VCP A;  5SZT A;  1J5O A;  3ZX2 A;  4DUZ K;  3A8Y A;  4M7Y A;  1WUA A;  4FPA A;  2YNG A;  4KI4 A;  3HTV A;  4IKF A;  2RKI A;  3OY9 A;  1HYS A;  1RDC A;  1JLA A;  3L4Q A;  2E6L A;  3HST B;  2JLE A;  3F9K A;  5KPT A;  3MX5 A;  2YHY A;  4IFY A;  2Z1J A;  1QZ5 A;  4OKJ A;  4MLE A;  4DTM A;  1Z05 A;  3E66 A;  3B8A X;  1OH5 A;  4DV2 K;  2ZE2 A;  4CI6 A;  3V1O A;  2NNW A;  1BA1 A;  4M41 A;  3MN6 A;  4CER A;  2X6N A;  3DWL A;  3ZT0 A;  4CJP A;  2FLO A;  4JKG B;  1WN7 A;  4K8Z A;  2NRT A;  4ISE A;  5LMU K;  1VSH A;  4G9Z A;  2HB5 A;  5AQV A;  3HYF A;  1DLO A;  4E7H A;  5AZJ B;  5HLF A;  1TAQ A;  4FJ9 A;  1B9F A;  3OYF A;  4XEI A;  5EU7 A;  3CC4 N;  3TAQ A;  1XNQ K;  4LH5 A;  3VN5 A;  3VQD A;  2FC0 A;  3MN5 A;  1GLJ O;  1YI2 N;  2HNZ A;  1YVU A;  3WNE A;  4M3R A;  3C7N B;  3KWI A;  1MA9 B;  2KLA A;  4DFM A;  3HVT A;  4B9N A;  1S9G A;  1IV0 A;  4CFA A;  5FRO A;  4AHV A;  4X64 K;  2WUS A;  5ELZ A;  1EWR A;  3FZH A;  4KKO A;  1VQP N;  3TI0 A;  4ICL A;  1LAW A;  5C10 A;  2OPQ A;  4YHH K;  3CJ7 A;  2YHA A;  1U45 A;  3KD5 E;  3ENB A;  3JXU A;  4AF1 A;  4DU3 A;  4GMJ B;  1LOT B;  4FWQ A;  4DQS A;  4FWN A;  2AA4 A;  4MO4 A;  1SKS A;  3MEG A;  4N76 A;  3OYG A;  4FWO A;  1SKR A;  1X9W A;  3DI6 A;  1RDA A;  1NKE A;  1KSP A;  1YIT N;  3SCX A;  2OZS A;  3WEE B;  4U67 L;  3VEZ A;  5E41 A;  4YDU C;  3C6T A;  1YT3 A;  4FOI A;  1U48 A;  4JI8 K;  4KHY A;  2D4W A;  3H3O B;  1BOT O;  3HO1 A;  4GV6 A;  4LFB K;  4IDK A;  4H0O A;  1NGD A;  1HNV A;  4ELV A;  3ZYY X;  3BY5 A;  4FOE A;  1OVY A;  4W5R A;  5EVZ A;  4Y1C A;  3CCS N;  2YNH A;  5E26 A;  3SUQ A;  3CET A;  3ATU A;  3NH2 A;  4GKJ K;  1T7P A;  1XC9 A;  3IG1 A;  1V4T A;  3AAR A;  1WOQ A;  5ADX A;  4CZM A;  2Q2R A;  1SUQ A;  3CQX A;  3HI0 A;  5AZI B;  1EXQ A;  3O8M A;  3SPZ A;  3SAH A;  3AVK A;  3OVN A;  5EOY A;  3TWH A;  1JCE A;  1X9S A;  2GEM A;  2QKK A;  4JNE A;  4CK2 A;  5BN8 A;  1RFQ A;  4M3Y A;  2NRH A;  3RSE B;  2XHB A;  3LDL A;  1YXQ A;  3T69 A;  4CVN E;  4DFK A;  4FYD A;  3WUH A;  1XQS C;  2Q31 A;  3QIP A;  4CJS A;  3J7Z O;  3V9W A;  4CHP A;  1RTJ A;  4FLY A;  5C24 A;  3LDN A;  3ZSY A;  1K8A O;  4HUG A;  1NBW A;  2NUB A;  3LWM A;  4BR9 A;  3THW A;  1GLD G;  4DR4 K;  2QEX N;  4OX9 K;  1Q9Y A;  3JYT A;  3C95 A;  3PLA A;  1YUW A;  3CQY A;  3CJB A;  5HBM A;  2AP1 A;  2GV9 A;  3L6Q A;  1ZC6 A;  4DV1 K;  3VEX A;  5M1F A;  3JAM O;  1VQ6 N;  4I2Q A;  2EX3 A;  1YVN A;  3J81 O;  1EWQ A;  2HHS A;  2RF2 A;  4H5V A;  4H4O A;  2YHB A;  4EAH D;  3I8D A;  2OZM A;  2KFZ A;  4I2P A;  3KLG A;  4DLE A;  3QET A;  3CFP A;  2QK9 A;  3L2W A;  4DG1 A;  2IVO A;  2CGK A;  3VA0 A;  2O8F A;  3VF2 A;  1E3M A;  4QAG A;  4ZTJ A;  1RDU A;  1Y97 A;  2QWO A;  3M1F A;  3C0B A;  2ZF5 O;  2KHO A;  3U4L A;  4DSL A;  2XY5 A;  3HP6 A;  1YJN N;  2IDO A;  3E9O A;  1KXP A;  4BVO A;  4MDA A;  4J2E A;  3OBW A; 
#chains in the Genus database with same CATH homology
 1JLF A;  1YTA A;  4N47 A;  3K5M A;  4DF4 A;  4NCB A;  4C8M A;  4FVM A;  4OLA A;  3LPU A;  2IGI A;  3L3U A;  2PYL A;  4KTQ A;  1QS4 A;  1XHX A;  4M45 A;  4CGH A;  3O3G A;  3SQ1 A;  3OYA A;  4CEE A;  3MXM A;  4FXD A;  5SWM A;  3ZSX A;  2QXF A;  3ASM A;  1ASV A;  4NCG A;  1KFS A;  4J2D A;  4HHT A;  2RPI A;  4KHQ A;  1RCH A;  1ASU A;  3QER A;  1JL1 A;  1S1U A;  4I9L A;  3RRH A;  3S3N A;  1SKW A;  3AVM A;  1N6Q A;  4FK0 A;  4KI6 A;  4C8N A;  3QEV A;  1ZBL A;  1NKB A;  2D5R A;  1C6V A;  5CYQ A;  3TAM A;  3TAE A;  4JRQ A;  1JLC A;  1RBU A;  5JS2 A;  2F8S A;  4CEB A;  4E1N A;  4CJR A;  2HVI A;  1NK4 A;  4AHU A;  1JL2 A;  1UA0 A;  4KRE A;  1WAF A;  4FJN A;  3DLR A;  4MQ3 A;  4FZZ A;  3ZSR A;  3OS1 A;  4DS5 A;  4BDZ A;  3WNF A;  4I7F A;  3RMD A;  2P5O A;  4RW7 A;  1UA1 A;  3VQC A;  1L3S A;  2BGG A;  3NDK A;  1HNI A;  1J53 A;  3AVA A;  3VQQ A;  3ZSV A;  4CJ3 A;  4FJG A;  4FZX C;  1RDD A;  1TKT A;  4FLX A;  1BCM A;  3OYC A;  1NK0 A;  5CZ1 A;  2W42 A;  4DS4 A;  3SUN A;  3SI6 A;  2HHQ A;  2FBY A;  4CEA A;  4OLB A;  4N5S A;  4Z4F A;  4CEF A;  3NCI A;  2FBV A;  2KZZ A;  4Z0U A;  1Z26 A;  2OYQ A;  1W0H A;  2VG6 A;  5HRR A;  4CJV A;  1ZBH A;  3DM2 A;  1TK5 A;  1BQN A;  4E19 A;  4ELT A;  4RW6 A;  4CGF A;  4KHN A;  2ZQB A;  1EP4 A;  3CFO A;  4CE9 A;  1VSE A;  3ZT4 A;  3HPH A;  3HM9 A;  3RMB A;  3OYN A;  3NH0 A;  4HCB A;  1TK8 A;  4RG8 A;  4CJK A;  3DLB A;  1KVB A;  1RBR A;  4NYF A;  4DQI A;  1RBV A;  3IS9 A;  3SV4 A;  1S5J A;  3LAN A;  3B6O A;  5KRT A;  3EYZ A;  3P1G A;  2R7Y A;  3RTV A;  1B92 A;  3AO1 A;  4Y1D A;  4CHQ A;  3ZSO A;  4KHU A;  1TL3 A;  3L8B A;  1W9H A;  4N56 A;  3AVN A;  5KGW A;  2GUI A;  4Z4C A;  3DLE A;  4CF9 A;  1ZBI A;  5KGX A;  4NYN A;  1LWC A;  3MXI A;  2HHT A;  3DLG A;  4DMN A;  1HQE A;  4CHY A;  4W5N A;  4O0I A;  3QLH A;  3HL8 A;  5CZ2 A;  3KK2 A;  4M3Z A;  4WE1 A;  3OS0 A;  1XI1 A;  2IS3 A;  1MU2 A;  4C8L A;  1DTQ A;  2WOM A;  4E1M A;  2G8F A;  3NGI A;  1NK8 A;  4XIU A;  3NF6 A;  2DFF A;  2IOC A;  3K58 A;  3QNO A;  3SJJ A;  1KFD A;  1QQC A;  2YKM A;  1A5V A;  3VQ6 A;  5HP1 A;  4CGI A;  1SV5 A;  4OPJ A;  4HUE A;  5J2Q A;  2EHG A;  4FW2 A;  3OYI A;  1IO2 A;  2B5J A;  3QNN A;  1T05 A;  4FJI A;  3WNG A;  4R5P A;  1TKD A;  4M42 A;  2KZM A;  2P5G A;  2X74 A;  4KFB A;  1RT7 A;  3P5J A;  1CXU A;  4BWJ A;  3T1A A;  2LSN A;  1LW2 A;  1GOB A;  1WSF A;  1KRP A;  2WON A;  1L5U A;  4J2B A;  2VWJ A;  3SQ4 A;  3AO4 A;  1IKW A;  1D5A A;  3G0Z A;  5DMR A;  3QEW A;  3OYJ A;  4ELU A;  1QHT A;  2XO7 A;  3AVI A;  3WNH A;  4FLT A;  4FJM A;  1WSH A;  1L3U A;  1YTU A;  1RT5 A;  2KTQ A;  4LSN A;  1QSL A;  4FJ8 A;  4OJR A;  3CQ8 A;  1K6Y A;  3T3F A;  3O3H A;  1L3T A;  3VQ4 A;  4DWI A;  4FM1 A;  3AVL A;  2A1R A;  2HHU A;  4B08 A;  4NCA A;  1C0T A;  4CJW A;  2X6S A;  1BI4 B;  1ZYQ A;  3QIO A;  4DU1 A;  3HXM A;  1NOY A;  1D8Y A;  4CCH A;  5KI6 A;  3ULD A;  1BGX T;  4IBN A;  4HCC A;  4B9S A;  1UOC A;  1RIL A;  1LWE A;  3TAG A;  3ZT1 A;  4FM0 A;  4RW9 A;  4CEZ A;  3HVR A;  4F4K A;  2Q3S A;  3V9Z A;  2PY5 A;  4EZ9 A;  2HVH A;  2VG7 A;  3KLE A;  4CJ5 A;  4OGE A;  3MEE A;  4AH9 A;  4CEC A;  1Z25 A;  3AA2 A;  4C8O A;  3SQ0 A;  3S9H A;  4KAZ A;  4O4G A;  3HPO A;  4CHZ A;  1IKV A;  4GW6 A;  2XY6 A;  2HMI A;  4IG3 A;  2E4L A;  3PX4 A;  1VSJ A;  1C0U A;  1TKZ A;  2IC3 A;  1RT4 A;  3RMA A;  1I39 A;  3SQ2 A;  3U6F A;  3NF8 A;  4O0J A;  3I0R A;  1CLQ A;  5D3G A;  3NAE A;  4DLG A;  4FK4 A;  4ID5 A;  2DFH A;  3ZT2 A;  4KB1 A;  4DSI A;  2DTU A;  3EY1 A;  3QEP A;  3RR8 A;  1TGO A;  1UAX A;  1HJR A;  1IG9 A;  1LW0 A;  4CJF A;  3TAF A;  4OKE A;  3VA3 A;  4DTS A;  1JXB A;  2RN2 A;  4DQP A;  3DRS A;  3VQ9 A;  1X1P A;  1NK5 A;  4PQU A;  1WNS A;  4LSL A;  4W5T A;  4IG0 A;  1XHZ A;  1C0M A;  2OA8 A;  1BIU A;  3K5L A;  4FLU A;  2G8H A;  2ATQ A;  4BE2 A;  4KPY A;  1QSY A;  3JSM A;  4B3O A;  4DTO A;  1EX4 A;  3DLK A;  3HP9 A;  1U49 A;  3PY8 A;  3U3Y A;  1LWF A;  4DTU A;  1GOC A;  3RRG A;  4O44 A;  1ASW A;  4LY7 A;  1L3V A;  1KCF A;  3DYA A;  2ITG A;  1QE1 A;  1FKP A;  1JLQ A;  2BE2 A;  4CFC A;  4B8A B;  1X9M A;  3H08 A;  3ZSZ A;  1WSG A;  4BDY A;  3PO4 A;  3EZ5 A;  3NFA A;  3TAB A;  3C6U A;  3VQ7 A;  2YKN A;  1LV5 A;  2IAJ A;  2OPR A;  3LP0 A;  3DRR A;  2KFN A;  4CEO A;  2Y1I A;  2O4G A;  2AJQ A;  2ETJ A;  3OYE A;  4E3S A;  4JLH A;  4RW4 A;  4DTX A;  2OPP A;  4CGG A;  2QKB A;  3V9X A;  3V6D A;  4E7L A;  4HTU A;  4DSE A;  3VQ8 A;  4DTR A;  3TAP A;  4OPK A;  3HJF A;  1VSK A;  1CZ9 A;  2XY8 A;  1NJX A;  3BGR A;  3AVH A;  3PX0 A;  3PO5 A;  3M8P A;  4B9V A;  1VRT A;  3LP3 A;  5JS1 A;  2XRI A;  3PUF A;  3C94 A;  4FLW A;  3DLH A;  2O4I A;  2D0A A;  2VWK A;  3KK1 A;  3SNN A;  4EP5 A;  4FLZ A;  4CJU A;  4Z4E A;  4RW8 A;  5SZT A;  4E89 A;  3THV A;  4L8R B;  1J5O A;  4CF2 A;  1JLG A;  2DFE A;  1O1W A;  1TV6 A;  3S3O A;  3L2V A;  1FXX A;  4CFD A;  2YNG A;  4KI4 A;  4FJ7 A;  4IKF A;  2RKI A;  1Q8I A;  3OY9 A;  1HYS A;  5KRS A;  1RDC A;  1JLA A;  1N5Y A;  2HHX A;  2E6L A;  3AA5 X;  4I9Q A;  1RT3 A;  3HST B;  2JLE A;  5C25 A;  3F9K A;  1QSS A;  3V81 A;  4CGD A;  2E6M A;  4KO0 A;  3O3F A;  4IFY A;  1WSE A;  2Z1J A;  4OKJ A;  4DTM A;  1NOZ A;  5T7B A;  1FKO A;  4YNQ A;  1QTM A;  4MFB A;  4FW1 A;  4FJX A;  2ZE2 A;  3LZJ A;  3V1O A;  3P83 D;  4M41 A;  3K57 A;  1S6Q A;  2HND A;  4CER A;  2X6N A;  4CJP A;  3ZT0 A;  2PZS A;  4CHO A;  1WN7 A;  5CY4 A;  4K8Z A;  1VSH A;  5FRM A;  4ZTF A;  1T8E A;  2HB5 A;  4DQR A;  1LAV A;  3HYF A;  1DLO A;  4E7H A;  5HLF A;  4B9T A;  1TAQ A;  3KK3 A;  3LAK A;  4FJ9 A;  1B9F A;  4OKK A;  3OYF A;  1BCO A;  5EU7 A;  4CJL A;  3LDS A;  4HUF A;  4CJT A;  3TAQ A;  4FZY A;  3KIO A;  3A2F A;  3NGZ A;  1S1W A;  4LH5 A;  4JS4 A;  5J2N A;  3OJU A;  1NK6 A;  5CYM A;  3VN5 A;  3VQD A;  1GOA A;  2FC0 A;  4DFP A;  1RT1 A;  4F3T A;  1RTD A;  3V9U A;  2G8V A;  2HNZ A;  4PUO A;  5FRN A;  3ZSW A;  1YVU A;  1IH7 A;  3WNE A;  3LAM A;  1NJW A;  4M3R A;  3I0S A;  3F73 A;  3RWU A;  4CIF A;  2HW3 A;  4CF1 A;  2Z1G A;  4AHS A;  3FFI A;  4DFM A;  3B6P A;  3HVT A;  4BDP A;  4M3X A;  3NF9 A;  1BHL A;  3V9S A;  1NJY A;  4B9N A;  3LP1 A;  1HYZ A;  3NBP A;  1S9G A;  1BIS A;  1XWL A;  2Z1I A;  4CFA A;  5J2P A;  5FRO A;  1D9D A;  4AHV A;  3S3M A;  3OYH A;  2GBZ A;  1A5W A;  4E7J A;  3V1R A;  4DF8 A;  5I42 A;  4FJJ A;  3DMJ A;  4KKO A;  3OYL A;  5K14 A;  3MXJ A;  4M3W A;  4EP4 A;  5C42 A;  2X78 A;  5HRS A;  3V4I A;  4ICL A;  3TI0 A;  2F8T A;  4ID1 A;  1LAW A;  3AA4 A;  2OPQ A;  3ALY A;  4AHC A;  3PV8 A;  3TR8 A;  3LAL A;  1U45 A;  1TVR A;  2YHA A;  1KVC A;  4Q0B A;  3KD5 E;  3AV9 A;  3L2R A;  3LPT A;  1U47 A;  4BE0 A;  2G8U A;  4KB0 A;  4FJH A;  1VSF A;  5HRO A;  1HMV A;  3AO3 A;  3NF7 A;  3TAR A;  3KKR A;  4FJK A;  4DU3 A;  4JS5 A;  4GMJ B;  3BDP A;  1VRU A;  1NJZ A;  1WSI A;  2OPS A;  4DQS A;  4BWM A;  3L2Q A;  1UWB A;  4M3T A;  4CJ4 A;  3SYZ A;  1SKS A;  3MEG A;  1IKX A;  1VSD A;  3M8S A;  4B9U A;  4N76 A;  3RR7 A;  3OYG A;  3VQA A;  3AO5 A;  3CM6 A;  1SKR A;  3NH1 A;  1X9W A;  1JXE A;  4GVM A;  3DI6 A;  3NE6 A;  3IAY A;  4FM2 A;  4EZ6 A;  3DOL A;  4KTW A;  3QIN A;  2P51 A;  5I3U A;  1HRH A;  1RDA A;  4DSF A;  1D9F A;  1NKE A;  2YV0 X;  1KSP A;  3SCX A;  4KHW A;  4DTP A;  4O55 A;  4CF0 A;  4UQG A;  5HRN A;  2OZS A;  3AVG A;  4TSX A;  4F3O A;  1REV A;  1NK9 A;  5E41 A;  3E01 A;  4AHT A;  3C6T A;  3K5N A;  4YFU A;  1YT3 A;  1TKX A;  1U48 A;  2P1J A;  4KHY A;  3KKS A;  3K5O A;  1EKE A;  3HO1 A;  1RBT A;  1CXQ A;  3HK2 A;  4IDK A;  1B9D A;  4HVJ A;  4ELV A;  1EET A;  1HNV A;  1TK0 A;  4QOZ B;  1BQM A;  1WSJ A;  3VQ5 A;  3QEI A;  2XY7 A;  1J9A A;  2Z1H A;  1C1B A;  2JGU A;  4F8R A;  4CJE A;  3LP2 A;  1VSM A;  3OYK A;  2KW4 A;  2HHV A;  3M8Q A;  3CFR A;  4W5R A;  3DRP A;  4Y1C A;  2YNH A;  3SUQ A;  5J2M A;  4M3U A;  4CED A;  1WAJ A;  3NH2 A;  4E0D A;  1RT2 A;  3K2P A;  1T7P A;  1XC9 A;  1ZBU A;  4CIE A;  2D0B A;  3IG1 A;  4DQQ A;  1ZBF A;  1NK7 A;  2PYJ A;  2VG5 A;  4F2R A;  3NGY A;  4Z4H A;  3OYB A;  1RBS A;  3AA3 A;  3ZCM A;  4BE1 A;  3ZT3 A;  3SUP A;  3ISN C;  1C1A A;  1S9E A;  3KLI A;  3T19 A;  3KLH A;  4KHS A;  1SUQ A;  3ITH A;  3MED A;  3SPY A;  3D0P A;  1EXQ A;  2F96 A;  3SPZ A;  3AVK A;  3OVN A;  1VSL A;  3OJS A;  3TWH A;  3IRX A;  3U3G A;  3VQP A;  1X9S A;  1RNH A;  3O4Q A;  2QKK A;  4Z4I A;  2FBT A;  1KLN A;  1JKH A;  3LWL A;  1KLM A;  4CK2 A;  3TAN A;  3KD1 E;  4M3Y A;  3MEC A;  4CJQ A;  2I5J A;  3L3V A;  2XHB A;  2BDP A;  3VQE A;  3CM5 A;  4AIL C;  4DFK A;  4FYD A;  3SZ2 A;  3ZSQ A;  4C8K A;  3QIP A;  5FDL A;  1ITG A;  4CJS A;  1CZB A;  3V9W A;  4CHP A;  3HT3 A;  1I3A A;  1SL2 A;  2D0C A;  4E7K A;  1U4B A;  1RTJ A;  1WLJ A;  1HYV A;  4CFB A;  3OYM A;  4FLY A;  1BIZ A;  1U04 A;  3AVB A;  5C24 A;  3O4N A;  3PX6 A;  3AVJ A;  1HQU A;  1G15 A;  1S1T A;  4QCL A;  3QEX A;  3ZSY A;  2ZD1 A;  1TL1 A;  3MAQ A;  4ZHR A;  4PY5 A;  3D45 A;  2G8W A;  4HUG A;  1JLE A;  2NUB A;  2DY4 A;  3LWM A;  1BL3 A;  2B4J A;  4G1Q A;  4CES A;  3UIQ A;  1F21 A;  3AVC A;  3OYD A;  1A5X A;  1SL0 A;  1FK9 A;  4CIG A;  4CK1 A;  4BAC A;  1NKC A;  2KQ2 A;  4DFJ A;  4B9L A;  4J2A A;  3SUO A;  1Q9Y A;  3JYT A;  3C95 A;  3L2U A;  4CGJ A;  3NHG A;  4KTZ A;  5HBM A;  3HPG A;  2GV9 A;  1S1X A;  4OVL A;  3VQB A;  4CHN A;  1TAU A;  1C1C A;  3KJV A;  4H4M A;  3AVF A;  2HHW A;  1RTH A;  4I2Q A;  1IKY A;  2EX3 A;  3CG7 A;  4LD0 A;  4B8C A;  1J54 A;  5DK5 A;  2FBX A;  2YNI A;  4FLV A;  1VK0 A;  4FJ5 A;  2RF2 A;  1T03 A;  4B9M A;  2HHS A;  1Q9X A;  4FJL A;  4H4O A;  3SV3 A;  2YHB A;  4DSJ A;  3I8D A;  2OZM A;  4Q5V A;  3KTQ A;  1KTQ A;  2KFZ A;  4DSK A;  4I2P A;  3G10 A;  4O5B A;  3KLG A;  4KRF A;  2HNY A;  4KV8 A;  4DLE A;  3AO2 A;  3QET A;  3CFP A;  3QES A;  1VSI A;  3DOK A;  2QK9 A;  4OGC A;  3CYM A;  1RT6 A;  4PA1 A;  4DG1 A;  3L2W A;  3LZI A;  4CEQ A;  4W5O A;  3VA0 A;  2B6A A;  4JRP A;  3QO9 A;  4DTN A;  2G8K A;  4CF8 A;  4LH4 A;  4DTJ A;  2YNF A;  4QAG A;  4IFV A;  4ZTJ A;  1R0A A;  1SL1 A;  4CK3 A;  3K59 A;  1Y97 A;  4E7I A;  3OS2 A;  3V1Q A;  3RMC A;  1S1V A;  1RTI A;  4FK2 A;  4AHR A;  4W5Q A;  1BI4 A;  1S6P A;  2BAN A;  2A1S A;  2Y1J A;  1DTT A;  5KTQ A;  3KLF A;  5HRP A;  4FCY A;  2G8I A;  3M8R A;  4DSL A;  2XY5 A;  4N41 A;  3HP6 A;  4PWD A;  5J1E A;  4F2S A;  1JLB A;  2IDO A;  1HPZ A;  4H8K A;  4J2E A;  4Z4G A;  1RDB A;  4K8X A;  1KVA A;  4DU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...