4CEFA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cefA00
5SZTA 5J2NA 4CJFA 2RPIA 4Z4GA 1RT1A 1LAWA 4AHVA 2DFFA 4DQPA 4F2SA 2A1SA 4IKFA 2WONA 3CFOA 4IG0A 4CJLA 3I0RA 2YNHA 4C8KA 3NBPA 1G15A 2RF2A 3DLHA 2VWKA 4AILC 4CEEA 2DFHA 5KTQA 2P5GA 5T7BA 2D5RA 1BCMA 4W5RA 4CEOA 3ITHA 2GBZA 3BGRA 1KCFA 4C8OA 1ZBIA 1CZ9A 2G8VA 2OPSA 3HP6A 1S6QA 1N6QA 4CHQA 3AO1A 4Z4IA 5HRSA 1T8EA 4CF0A 5J2MA 4B9LA 4RW8A 1A5VA 4FJHA 3LP2A 5CZ1A 3KJVA 1HJRA 1TAQA 4CJQA 3KK3A 1LW0A 3TABA 3LZIA 2W42A 4BE0A 1QSSA 1HQEA 3VN5A 4E7LA 3HVTA 1BQMA 4I2PA 1SKSA 4HCCA 3PY8A 3WNEA 4FLUA 5CY4A 4L8RB 2KZMA 1VSJA 4B9TA 4CK3A 4BE2A 2KFNA 3DLRA 3L8BA 1KVCA 4CF2A 4Z4EA 1IKYA 2YHAA 1HNVA 1LW2A 1RT7A 3IS9A 1U45A 4H4OA 4KHUA 1TKTA 1VSLA 3ISNC 3VQPA 1IG9A 4OJRA 1RTIA 4DU4A 2YNIA 1RDAA 1IKXA 3LAKA 3MXMA 3G0ZA 3ZT3A 3V81A 4W5TA 2G8FA 4M41A 1T03A 3V9ZA 3PO5A 4XIUA 4DF4A 1UWBA 1TKZA 3C95A 1TK5A 1IKVA 3K57A 5CYMA 4O55A 4FZYA 4W5OA 4KRFA 4FJMA 4QOZB 3SZ2A 4DSJA 3O3GA 1S5JA 3CQ8A 4DTOA 1RTDA 3QIPA 3THVA 1ZYQA 1RNHA 1QSYA 4KHSA 4JS4A 1REVA 4EZ6A 1CLQA 1UA0A 4CFBA 1J9AA 3AVMA 4ID1A 4DQIA 5FRNA 3OJUA 3ZSRA 4DS4A 3S9HA 4CJRA 3QEIA 1EX4A 4DSKA 3DI6A 4CGDA 3K5NA 2GUIA 1IO2A 1RT2A 3OYKA 4KREA 4F8RA 3OYEA 1L5UA 4FJJA 2Y1IA 3AVIA 3ZSWA 4O5BA 2HHTA 3RMDA 2DY4A 1S1TA 1NK5A 4G1QA 3OS2A 3SQ0A 2Z1JA 3HYFA 2VG7A 3QETA 4F4KA 3AVHA 3V9UA 3HP9A 2HNZA 1RBRA 2G8UA 2PZSA 4GVMA 1S1WA 3AVKA 4KB1A 3CM6A 3L2RA 4CGGA 2PY5A 4DTSA 5KI6A 3TAGA 4KHQA 4F2RA 4DSLA 1QSLA 4CEQA 1RBSA 1KTQA 2NUBA 2P5OA 1UOCA 2Z1GA 1KFDA 3RMAA 1JL1A 4I2QA 2Q3SA 2XY7A 4CF9A 2HVIA 4CF8A 4B8AB 2VG5A 2YKMA 4CJVA 4WE1A 3V4IA 2O4IA 2RN2A 3NF7A 4OPKA 1X9MA 3TR8A 3OYJA 1SL2A 4BWMA 4E1NA 3SJJA 1U49A 3A2FA 4KO0A 1ZBUA 3KKSA 3ZSZA 3KLIA 3QEWA 1KLMA 2XY5A 4UQGA 3AVLA 3O3FA 4NYFA 1B9DA 1LWFA 1MU2A 3AA2A 3F9KA 4AHUA 4DU1A 1JKHA 3MXIA 1Q9YA 3OYCA 1S1VA 3AVCA 3I0SA 3ZSVA 4CEBA 4J2BA 4OLBA 1TL1A 4IFYA 5SWMA 4KTQA 1QTMA 1KLNA 1BL3A 4RG8A 3MXJA 2F96A 4AHSA 5HLFA 3QLHA 3ZT0A 3RMBA 1N5YA 3HXMA 3T1AA 3K5OA 2FBVA 4O44A 3NHGA 1NJZA 4ELTA 1Q8IA 1WSEA 2GV9A 2YNGA 4RW9A 4FM1A 3DRRA 2Z1IA 3QO9A 4CJTA 5HBMA 4KB0A 1NKCA 4NCAA 1DTQA 4FXDA 4FJ9A 1U48A 3RR7A 5C24A 3PUFA 4CECA 1D9FA 3I8DA 2YV0X 3C94A 4DSEA 2HHXA 3NGIA 4KFBA 2JLEA 4O0IA 4CEAA 4DFKA 1WNSA 5KGWA 3AVBA 3NH0A 2PYJA 2HHVA 4KTZA 3EZ5A 4CIGA 4OPJA 4DSFA 2OZSA 4OLAA 3AA5X 4LH5A 1F21A 2IDOA 5HRNA 3K5LA 1WSIA 4EZ9A 3OVNA 3ZCMA 4FJXA 1R0AA 2OYQA 4KHYA 5JS1A 3SV3A 1CXQA 3AVGA 4ZTFA 1ZBLA 4HVJA 4YFUA 4FJIA 3SPZA 4CHOA 3RTVA 3OS0A 3VQ5A 1BIUA 2G8HA 4QAGA 3L2WA 3TAEA 2QXFA 4FJNA 1HYSA 4B9SA 5HP1A 3G10A 2XO7A 4Z0UA 1VSIA 2VWJA 1VRUA 3KD1E 1D5AA 1C1BA 4PA1A 3ZSYA 1HRHA 3OY9A 3SYZA 1UAXA 2Y1JA 4CEFA 3QEVA 3OYAA 2DTUA 1T7PA 1J5OA 2HHQA 4HUGA 3VQ6A 3U6FA 1NJWA 4OGCA 1IKWA 4DU3A 3K2PA 4DTXA 1UA1A 3MAQA 2XRIA 1NK9A 5D3GA 3OYDA 4CHPA 3CFPA 1C1CA 4B9UA 3TI0A 1A5WA 4CJ3A 1Q9XA 3C6UA 2KZZA 1X1PA 3DOLA 1TK8A 3HVRA 3NAEA 2D0AA 3QEPA 4FZXC 2B6AA 3DLEA 4CFAA 2P51A 4DFMA 4FVMA 4FZZA 5J2QA 3QIOA 4K8XA 2IOCA 1WSGA 2OPPA 1BI4A 4CHNA 4Q0BA 2IGIA 1NOZA 2YNFA 4ICLA 3OYHA 3KLGA 1LV5A 4M3WA 3AO2A 3ZSOA 1FKPA 3RMCA 1HYVA 1WLJA 4OKKA 3VQ7A 4NYNA 1S1XA 3ASMA 4CGJA 3KLFA 3L2UA 3RRHA 3K58A 4B3OA 3LALA 1J53A 4EP5A 5HROA 1T05A 2I5JA 1WAJA 4B08A 3VQQA 3ZT1A 3LWLA 4JRQA 1XI1A 4K8ZA 4N5SA 2HNYA 4BWJA 2BANA 2FBXA 3SUNA 3WNHA 3NCIA 4DF8A 4C8NA 4NCGA 3SQ2A 1L3TA 4CIFA 2KQ2A 3LP3A 2D0BA 3KTQA 2RKIA 1TV6A 3SCXA 4M45A 4AH9A 3SV4A 3KKRA 3QEXA 4CE9A 5J1EA 4B8CA 4F3TA 1U47A 1SL1A 4DTNA 4FJ8A 3LWMA 4DMNA 4N47A 2QK9A 2E6MA 4BDYA 1JLCA 1LAVA 3PX0A 1NK6A 1ZBHA 3HPHA 2WOMA 2Z1HA 1L3SA 3M8QA 4OVLA 4DLGA 4CJWA 4DWIA 4KI4A 4JS5A 1JLBA 3E01A 1RBUA 2VG6A 2A1RA 4FJ5A 5C42A 1WN7A 4FJLA 1C0TA 1NKBA 4FYDA 3MEDA 1YT3A 2FBYA 4E7JA 3U3YA 2G8WA 5DMRA 5C25A 3LPTA 3P5JA 1NK4A 3PV8A 3DLBA 2IC3A 3AVJA 4E1MA 5FDLA 1QQCA 3VQBA 3TAQA 1EXQA 1FK9A 3V9XA 1XHZA 5DK5A 4LY7A 4IFVA 3OYMA 3TAFA 1S9GA 4HHTA 4Z4CA 1JLAA 2HHUA 1D8YA 3DLGA 4E0DA 3WNGA 1ASUA 1BISA 4H4MA 1D9DA 1VK0A 1X9SA 1HYZA 1RBTA 1RT3A 4E7KA 1XWLA 4ID5A 4TSXA 3NGZA 4FLXA 4QCLA 2QKKA 1BIZA 3PO4A 4DFPA 3ZT2A 4FLZA 4ZTJA 4CJUA 3IAYA 2E6LA 4CJSA 1KRPA 3P1GA 3DYAA 1C6VA 4M3UA 4FJGA 4Z4HA 1RBVA 4LD0A 4DTRA 2HB5A 2BGGA 4OKEA 3VQCA 1Y97A 1BQNA 4FLVA 4FW2A 1U4BA 1S6PA 4CJPA 4BDZA 1NK8A 4E7HA 1L3UA 4DTMA 2P1JA 1KFSA 4KAZA 3LAMA 5CZ2A 3T19A 2BDPA 4CFCA 3LP1A 4BDPA 4J2AA 4PY5A 4DLEA 1QS4A 1VSEA 2ITGA 3IRXA 2HW3A 3SUOA 5HRPA 3NF6A 5EU7A 4PWDA 5I42A 1VSHA 3L2VA 4OKJA 1SKWA 5HRRA 4KPYA 1RDDA 4AHTA 3CYMA 3QESA 1JLQA 1CXUA 4CJ4A 4E3SA 1SKRA 3QNNA 4PQUA 2E4LA 4KHWA 3NH2A 4MFBA 3VQ8A 1JLEA 1FKOA 4LH4A 4FLYA 3P83D 3VQ9A 5KRSA 1W9HA 2G8KA 1RT6A 3AO3A 3H08A 3NGYA 3KK2A 4B9MA 2IS3A 5E41A 4AHRA 3HO1A 4IDKA 3MECA 4FJ7A 3SUPA 4DTPA 1ASWA 3QINA 1KSPA 4CGHA 3V1OA 4J2DA 1KVAA 1O1WA 1DTTA 5K14A 4DFJA 3F73A 1I39A 4CFDA 3L2QA 4HUFA 1NJXA 1TKXA 1ASVA 3M8PA 4M3RA 4DS5A 3UIQA 4YNQA 3HJFA 1ITGA 3C6TA 1WSHA 4RW7A 3HK2A 3AVNA 3AV9A 3KK1A 2KFZA 1GOAA 1XHXA 3TANA 4F3OA 3OS1A 1WAFA 4MQ3A 1EETA 5KRTA 4CJ5A 2QKBA 3OYGA 1VSFA 2ETJA 1JXEA 3LPUA 3U3GA 4N56A 4M3YA 3HSTB 5KGXA 3LDSA 1JLGA 3TAMA 4CEZA 1C1AA 4FK2A 3LP0A 2YKNA 3K59A 1IH7A 1S1UA 1TL3A 1GOCA 3K5MA 4B9NA 2KTQA 3M8RA 2ATQA 4I9LA 3LANA 2ZD1A 3AO5A 4Y1CA 3HPOA 4HTUA 1RDCA 4IBNA 1NK0A 1SUQA 1HQUA 1RTHA 3ZSQA 4CF1A 1C0MA 2R7YA 4ZHRA 3OYBA 1NJYA 4CERA 3M8SA 3NH1A 2F8SA 3L3UA 2XY8A 2AJQA 3QNOA 4H8KA 3CM5A 1LWCA 2HHWA 2B4JA 3VA0A 1BHLA 3VQAA 3HPGA 1GOBA 1RDBA 4FJKA 3S3OA 4CHZA 3S3NA 4O4GA 1WSFA 4FM0A 4GMJB 1TAUA 3HL8A 3L3VA 5CYQA 4Y1DA 3SUQA 3TAPA 1SV5A 4BACA 4KKOA 2HHSA 2EX3A 1XC9A 2ZQBA 3BDPA 3AVFA 1C0UA 1EP4A 1I3AA 1YTUA 4IG3A 1B9FA 2X78A 4KI6A 3HT3A 1HNIA 1TKDA 4B9VA 3V1QA 1RT4A 2X6NA 2OPQA 3AVAA 1J54A 1QE1A 4RW4A 4E89A 1BI4B 1YTAA 4CEDA 1TK0A 2F8TA 3NFAA 5FRMA 3SPYA 1HMVA 3EYZA 1X9WA 2FC0A 4CJKA 3KLHA 4C8LA 1TVRA 4W5QA 1DLOA 1RCHA 3RRGA 1A5XA 4OGEA 3VA3A 1JL2A 5J2PA 3PX4A 1BGXT 3ULDA 1RTJA 4CGIA 4EP4A 3V9WA 2HMIA 3OYLA 4FCYA 3KD5E 3D0PA 1FXXA 3ZSXA 3HM9A 2OPRA 3DRPA 3O4QA 2X74A 1LWEA 4CIEA 1HPZA 2O4GA 3AA3A 1B92A 1JLFA 3B6PA 3JYTA 1SL0A 2YHBA 2OA8A 4N41A 3LZJA 3CFRA 1L3VA 4CGFA 2KW4A 1BCOA 4CJEA 4Z4FA 4Q5VA 3AO4A 3MEGA 2BE2A 2D0CA 5I3UA 1KVBA 3RR8A 2OZMA 4N76A 4W5NA 2JGUA 1YVUA 3SI6A 1VRTA 3ZT4A 2PYLA 1TGOA 1U04A 4BE1A 1NKEA 3PX6A 3VQDA 3DLKA 3NE6A 4ELVA 4PUOA 3TARA 1JXBA 4GW6A 2G8IA 1Z25A 3D45A 4E7IA 2LSNA 2ZE2A 4O0JA 4KHNA 4RW6A 3T3FA 3OYNA 3TWHA 1VSMA 3WNFA 4DTJA 4DQSA 2IAJA 4AHCA 1VSDA 2EHGA 3IG1A 4KV8A 3SQ4A 1W0HA 3JSMA 3AA4A 2FBTA 3NF9A 4CESA 3NDKA 1NK7A 3KIOA 4CK2A 4HCBA 3EY1A 3RWUA 4I7FA 5FROA 3S3MA 4J2EA 3V1RA 4DTUA 2HNDA 3NF8A 4JLHA 1RILA 4DSIA 4M3TA 3DRSA 3VQEA 4FK0A 4HUEA 2HVHA 3CG7A 4R5PA 3KLEA 4DG1A 3OYFA 1NOYA 1K6YA 2B5JA 1Z26A 3VQ4A 3O3HA 5JS2A 4LSLA 3OYIA 3MEEA 3QERA 4M42A 1QHTA 4NCBA 3SNNA 4C8MA 4M3ZA 2XHBA 3OJSA 4FM2A 1EKEA 4CHYA 1S9EA 2DFEA 1WSJA 3ALYA 3DMJA 1RT5A 4DQRA 4JRPA 3B6OA 3DM2A 3DOKA 4LSNA 4FLWA 3SQ1A 4CK1A 4KTWA 3V9SA 3FFIA 1VSKA 1ZBFA 2X6SA 4E19A 4FLTA 4M3XA 4I9QA 4FK4A 4DQQA 4ELUA 4FW1A 4CCHA 2XY6A 3V6DA 1CZBA 3O4NA
chains in the Genus database with same CATH superfamily
1VQON 5SZTA 1T6DA 2A5XA 2RPIA 4BREA 2Q1NA 3TTCA 2A1SA 4BR9A 4C8KA 3NBPA 3R8EA 3PSFA 4AILC 3MX2A 3CHWA 3MCPA 4CI6A 4K25A 2GTDA 1GLFO 1S6QA 5AJ3K 3BZKA 3BF3A 4CZEA 5C12A 4JI0K 3E1YA 4WFBL 4CJQA 2VGNA 2W42A 4BE0A 1XNRK 1BQMA 4B1YB 1VQPN 2P9LA 3BP8A 2WFBA 5LMUK 3VEYA 3KWGA 2YHXA 4A2BA 1S3XA 4CK3A 4IO8A 3DLRA 4H5RA 3TTDA 3KK7A 4BR5A 4Z4EA 4I6MB 3IS9A 2ZJQL 1VSLA 3ISNC 1IG9A 1QVGM 1JCEA 2E2PA 3MXMA 5GINA 4IEEA 3PO5A 4XIUA 4DF4A 3ENBA 2HBLA 3E9OA 3K57A 2OTJN 4OX9K 4QOZB 1E3MA 4DSJA 1S5JA 4CZJA 4NB4A 2D1KA 1RNHA 1TYQB 1REVA 5FRNA 1J9AA 4ID1A 4MLHA 4JI2K 4CJRA 5C2FA 4CGDA 2GUIA 3OYKA 5JVGL 5KQDA 4KREA 4FJJA 2P9SA 4A5BA 2HHTA 2DY4A 4JD2B 4G1QA 3A0IX 2F7TA 3SQ0A 2Z1JA 3HYFA 3GL1A 2QTDA 1HR0K 4FO0A 2HNZA 1IBKK 3VF2A 2WC9A 4PKIA 3TAGA 4JHDA 4F2RA 3C6AA 4BQLA 4CEQA 3VEWA 3RMAA 4BRHA 1BOTO 1KAXA 4X62K 4B8AB 1V4SA 2RN2A 4OPKA 1YVNA 4UY8O 4BWMA 4E1NA 4DR4K 3KLIA 2XY5A 3O3FA 4NYFA 1B9DA 2CH5A 1MU2A 4AHUA 3F2KA 4CBXA 1JKHA 3ATUA 1NGAA 3OYCA 1YHQN 3ZLJA 4J2BA 3O9UA 5CHIA 1N34K 3RMBA 4BRIA 1N5YA 2FBVA 1NJZA 2GV9A 2YNGA 4RW9A 4FM1A 1NWKA 2OTLN 2Z1IA 3QO9A 4FL9A 4CJTA 5HBMA 5AQTA 4B1WB 4FJ9A 4JKGB 3J7YP 3SBTA 2O8FA 3C94A 2HHXA 4KFBA 2HHVA 2OZSA 3P38A 2E2NA 2IDOA 1VQ8N 1WSIA 4EZ9A 4ILJA 3T1HK 3AVGA 5TKWA 3WXKA 4X65K 3IMXA 3VTHA 1HYSA 5FLXO 2O8CA 1J6ZA 3G10A 2XO7A 4DR6K 2YX6A 1VRUA 3ZSYA 1SS6A 4DHYA 3SYZA 1RFQA 3VQ6A 3ENOA 4FOEA 3ZETA 1NJWA 4OGCA 4DU3A 2RHKA 2XRIA 3OYDA 1C1CA 4B9UA 1A5WA 2A41A 3VESA 5B8HA 3WXMB 1TK8A 3NAEA 2E1ZA 4FZXC 3DLEA 4DFMA 3C65A 3HBTA 2IOCA 3KLGA 1QQMA 3AO2A 2F4VK 1FKPA 5HL7L 1D4XA 3LDQA 2AA4A 3ID8A 1WOQA 4IOAL 1WAJA 3VQQA 3ZT1A 1XI1A 1NLVA 3ATVA 2HNYA 2W6KA 4JI3K 1XNQK 3WNHA 3F9MA 1OVQA 4C8NA 3SQ2A 1L3TA 3LP3A 1YI2N 3KTQA 3SCXA 4M45A 3SV4A 3KKRA 3OBWA 5AFUA 3ID6A 2QW9A 1G99A 4FJ8A 3LWMA 4OO1J 5LJVA 4GKKK 2E6MA 1LAVA 3PX0A 3VOVA 4L3QA 2WOMA 4KI4A 3E01A 2VG6A 4FJ5A 4BC2A 4E7JA 5DMRA 4E1MA 1E4FT 3VQBA 3TAQA 1FK9A 1GLJO 3ZX0A 3OYMA 1O13A 3H6EA 3VGMA 4HHTA 4Z4CA 3DLGA 4E0DA 3WNGA 4KH4A 1X9SA 1RBTA 1RT3A 4E7KA 4TSXA 4FLXA 3QBWA 3H46O 3ZT2A 4FLZA 4CJUA 2E6LA 3P1GA 4BRPA 4Z4HA 1W2BM 4LD0A 3VQCA 1NGDA 1NK8A 1BA1A 1C0GA 4KAZA 3LAMA 4PL8A 3T19A 4J2AA 1QS4A 5ELZA 4CD1A 1HNZK 1NM1A 3MMVA 5HRPA 3SUOA 4PWDA 5BPNA 3PLAA 4KPYA 2JWLA 4AHTA 1SKRA 1JLQA 1CXUA 3KWIA 4CJ4A 4KHWA 3VQ8A 1FKOA 4FLYA 2GWJA 3DXMA 5KRSA 1W9HA 1RT6A 4E1JA 3ZEUB 5F1XA 4B9MA 4B9QA 5E41A 4AHRA 5CR4A 3HO1A 1KVAA 1O1WA 4IOCL 1HJOA 3F73A 3H1QA 4HUFA 1EWRA 1NJXA 1ASVA 3ZYYX 3LDNA 4O5FA 3UIQA 2V7YA 4QS7A 3T69A 1YITN 2QA4N 1WSHA 3HK2A 1XHXA 3TANA 1FJGK 4MQ3A 3MN9A 3SK3A 3J80O 3FZLA 3LPUA 1NBWA 1QQOA 4FK2A 3K59A 2NRTA 1WUAA 3K5MA 3FZFA 3M8RA 2ATQA 4DQ8A 1KXPA 3LANA 4A61A 4H5WA 1SUQA 1HQUA 2QWOA 3T7ZA 4O8UA 2F8SA 2J4RA 3QNOA 4H8KA 4H0OA 3VQAA 4BVOA 1GOBA 3S3OA 4GMJB 1TAUA 3HL8A 3L3VA 5CYQA 4Y1DA 2VCPA 2RE2A 3EKSA 5AQHA 1EP4A 4IG3A 2E5LK 1HNIA 3NVKA 3V1QA 1RT4A 2X6NA 4RW4A 4E89A 2QKBA 5BREA 5FRMA 3O6WA 3EYZA 1MWMA 3RRGA 1TUUA 4WFNL 3UKUB 3FLCO 2GWKA 3GE1A 4BRAA 3QFPA 1RTJA 3SBGA 3OYLA 4FCYA 4YOUA 3J8AA 3J81O 3O4QA 4FSVA 4CIEA 3AA3A 2VGMA 3JYTA 4XEIA 4K42A 4YDUA 2NLXA 4AM7A 3SAFA 3LZJA 1XMQK 2KW4A 1Y64A 4Z4FA 3AO4A 3MEGA 1BU6O 5I3UA 2OZMA 3RR8A 3N4QA 5M1FA 3MWPA 3ZT4A 3PX6A 3VQDA 4IWVA 4PUOA 3M3ZA 3WQUA 4RW6A 3T3FA 3CCEN 1VSMA 4DTJA 2IAJA 2IVNA 3IG1A 3THXA 3SQ4A 1NGFA 3S41A 4O8KA 4HCBA 3EY1A 4I7FA 5FROA 3PIOL 4DR3K 5AQIA 1RILA 4DSIA 4B3MK 4HUEA 2KLAA 3CG7A 1K8KA 4DG1A 2V52B 4PL7A 3VQ4A 2B5JA 1Z26A 3OYIA 4NCBA 3SNNA 4FM2A 2DFEA 3ALYA 1WSJA 1U2VA 3CJ9A 1MDUB 2UXCK 3DOKA 3CQYA 4CK1A 3SAGA 2WTUA 3FFIA 1K73O 2X6SA 2O8DB 1W97L 4WF9L 1Q82O 4ELUA 4QS8A 2XY6A 3V6DA 3O4NA 1V4TA 3CIPA 3O4WA 4AHVA 1LAWA 2DFFA 4IKFA 3CFOA 4AF1A 2FSKA 5GADP 2VWKA 2CGJA 3MDQA 1NU0A 4CEEA 5KTQA 1BCMA 5F0XA 3ITHA 2OCEA 3CI5A 2OPSA 4Z4IA 4IZ9A 5J2MA 4B9LA 4RW8A 3KJVA 1HJRA 3EKUA 3KK3A 3TABA 2YJEA 4M7YA 4JNEA 1HQEA 4E7LA 5KPTA 2UYTA 3PY8A 3AGRA 5CY4A 4B9TA 4IOXA 3N4PA 1KVCA 5EVZA 5AQUA 4H4OA 4KHUA 1BG3A 1GLDG 4CZLA 4OJRA 1RTIA 1HX1A 2YNIA 4NLBA 1RDAA 4Y0WA 3G0ZA 3V81A 3R9PA 4CD3A 3D2EA 3V9ZA 1OKJA 1OH5A 3MN6A 1TK5A 2E8AA 2VWBA 4O55A 5LY3A 4W5OA 1BA0A 3THVA 4BR7A 4CBWA 4FPAA 1LOTB 4JS4A 1CLQA 5FPEA 4U7BA 3L6QA 3OJUA 4DS4A 1VQLN 3QEIA 4CJ7A 3ULEA 4F8RA 1L5UA 3WXIA 3ZSWA 4O5BA 3RMDA 1NK5A 1YJNN 2VG7A 3QETA 4F4KA 3AVHA 3HP9A 1Q7YO 1RBRA 4IJNA 2G8UA 3CCUN 4CGGA 2PY5A 4GNIA 4DTSA 5KI6A 4CZKA 1QSLA 4KH6A 1UOCA 1N32K 4HWIA 2XY7A 4FWRA 3V4IA 2O4IA 1TUYA 1SL2A 1X9MA 5AQRA 2P9KB 3FZKA 3SJJA 3A2FA 4KO0A 1ZBUA 3ZSZA 3RSEA 4EAHD 3MXIA 2NRXA 1P90A 4LF4K 4ILHA 3ZSVA 4OLBA 5SWMA 4IFYA 5EOYA 1VAZA 3UE5A 2F96A 3ZT0A 3C7NB 3K5OA 2HBKA 4BRCA 3VGKA 4KB0A 1NKCA 4NCAA 5C24A 3PUFA 2YV0X 4DSEA 3NGIA 4DV4K 3O80A 1WNSA 5HOOA 3NH0A 4BRFA 4OPJA 4BRGA 4FJXA 5FPMA 3OHRA 5AQXA 3W3DA 1NGEA 5JS1A 1CXQA 3L4IA 1ZBLA 4HVJA 3OS0A 3THYA 4QAGA 4FJNA 2QXFA 4YDUC 5HP1A 1XUPO 4JEPA 3KD1E 3VGLA 1T44A 4GV6A 3EL2A 3R6MA 5AQVA 1BUPA 3D2FA 3QEVA 3OYAA 1IKWA 3UB5A 5D3GA 3CFPA 4CJ3A 2W41A 2KZZA 3DOLA 2QM1A 3Q7CA 5F2RA 3QEPA 3DLLL 5JVHL 4CFAA 5AZJA 4H5TA 5GAEP 2NZTA 3QIOA 4K8XA 4CHNA 3QBXA 4B3RK 1BI4A 4Q0BA 2PFUA 5MLCQ 2IGIA 3A8YA 4ICLA 4M3WA 4IJAA 3IFRA 2A3ZA 3HRGA 4OKKA 3ASMA 5HROA 1J53A 4JRQA 2Q0RA 4BGAA 3LWLA 4BG9A 3SUNA 1RDUA 3O1WA 5ADXA 1T6CA 2I7NA 3TTFA 2KQ2A 1ATSA 2RKIA 2AP1A 4AH9A 1JCGA 1YAGA 4JKCA 4CE9A 4B8CA 4NXNK 3CJ1A 4G9ZA 1BWFO 4N47A 1ZBHA 3HPHA 1L3SA 4OVLA 4CJWA 4DWIA 4JS5A 1JLBA 1RBUA 2NRZA 4LF6K 1C0TA 2DPNA 2G8WA 3LPTA 3P5JA 3DLBA 2IC3A 3AVJA 1QQCA 4IXCA 4ISFA 4JKFA 3V9XA 3B8AX 1GLCG 4BC5A 3VEXA 2HHUA 1D8YA 2FF3B 3JAMO 1ASUA 1D9DA 2P9SB 3VEVA 3QMLA 3U4LA 4QCLA 4DUZK 1N8RO 3PO4A 4DFPA 4ZTJA 3DYAA 3WXLA 4FWOA 3BUZB 2HB5A 4JHDB 5BPLA 4FLVA 1BQNA 1L3UA 4DTMA 1KFSA 3CMEN 1VQ5N 2BDPA 4CFCA 3LP1A 4DLEA 1VSEA 3CMAN 1BO5O 5EU7A 5I42A 5C2DA 5KQ8A 2WUSA 5HRRA 4DV5K 1SKWA 1NGBA 4PQUA 3IKMA 4MFBA 1JLEA 4LH4A 3VQ9A 3G71N 3AO3A 3NGYA 3H08A 5BN8A 3MECA 4FJ7A 5AFUH 2QWRA 5CE3A 1KQSM 1ASWA 1KSPA 3V1OA 4J2DA 5K14A 3GDQA 4BR0A 1IBMK 1I39A 3SMSA 4CFDA 3L2QA 4M3RA 5JLFA 4DV1K 2O8FB 4DS5A 4YNQA 1ITGA 1HKGA 3C6TA 3AV9A 1Z6RA 4JI5K 2KFZA 1GOAA 1W7AA 1EETA 4YY3K 2F9WA 4JKAA 4M3YA 4N56A 1X3MA 2IVPA 1JLGA 2HBMA 3TAMA 4CEZA 1C1AA 1Q81O 4DR1K 3R3LA 5KPZA 1IH7A 4B9NA 1GOCA 1VQKN 2O8CB 1YF5L 2W6LA 4Y1CA 2ZD1A 3HPOA 1RDCA 2YJFA 1NK0A 4FWKA 3HI0A 3H3OB 2R7YA 3NH1A 1QZ6A 2IIRA 3CM5A 1LWCA 4DKWA 2B4JA 3ZETB 2FLOA 4OPAA 3S3NA 2FSNA 4O4GA 3I33A 1SV5A 4BACA 4KKOA 2HHSA 3SAHA 3GG4A 3BZCA 1YTUA 1C0UA 1B9FA 2X78A 4KI6A 2O8BA 2OPQA 3NFAA 4DV7K 5JMVA 1HMVA 1X9WA 3AARA 3KLHA 3O9TA 4CZIA 1DLOA 2HBJA 1A5XA 3C6HA 4OGEA 3ULDA 2P9IA 4CGIA 4EP4A 3V9WA 2P9UA 1FXXA 1GLLO 4NLCA 1HPZA 4RTFD 4LC9B 3B6PA 1K8AO 1SL0A 3UKRA 2YHBA 2OA8A 4K41A 2P9PA 1L3VA 4CGFA 4WQ5A 4CJEA 3MK6A 2BE2A 2D0CA 3P4IA 3GBTA 2NRVA 1YVUA 3SI6A 1NGGA 4H0XB 4BE1A 3OW2M 3NE6A 1QQNA 2LSNA 1VSDA 5JICA 1W0HA 3AA4A 2FBTA 5JLHA 3D6RA 3S3MA 4J2EA 3V1RA 2HNDA 1SQKA 3NF8A 1HNWK 4M3TA 1CZAN 3DRSA 3VQEA 3FZHA 4Z94A 2YHWA 1ZXOA 3SJHA 2CGLA 2KKZA 4C8MA 4M3ZA 2E2OA 2FF6A 1S9EA 4DB3A 5IT9O 1X3NA 3O8MA 3B6OA 4DR5K 3DM2A 4FLWA 2ASOA 4KTWA 3V9SA 4B1XB 4E19A 4M7XA 4DQQA 1NGIA 5J2NA 1ESVA 3TPQA 2VQFK 3VF4A 2HF4A 4Z4GA 1RT1A 4F2SA 2WONA 3I0RA 5GAGP 2RF2A 3DLHA 4CVNE 2P5GA 5T7BA 1FW6A 4W5RA 4CEOA 1NMNA 2GBZA 4GVEA 1X9JA 2Q0UA 4JKHA 4C8OA 1ZBIA 3FE1A 3DXMB 3HP6A 3TSUA 3JS6A 1N6QA 4CHQA 3AO1A 4A5AA 5HRSA 1T8EA 1A5VA 4FJHA 3FGUA 4BRDA 1LW0A 5BPMA 3LZIA 1EO1A 1SKSA 4LFAK 4I2PA 3CF5L 4CBUA 3FFKB 2HHHK 4A2AA 4L8RB 2KZMA 1VSJA 4BE2A 1R59O 2H3GX 1H1VA 5BR8K 3L8BA 1IKYA 2HOEA 1HNVA 1LW2A 3ZX3A 3VQPA 5LL6Z 4DU4A 4DR2K 1IKXA 1Q18A 4K0KK 3ZT3A 4W5TA 3H1VX 4M41A 1T03A 2GELA 4OPHA 4MLEA 1TKZA 4FWLA 3C95A 1DEJA 4ISGA 4FZYA 3CCQN 4KBOA 3SZ2A 3CQ8A 4BR4A 5AQMA 1QSYA 2O8EA 4KHSA 4CFBA 4DQIA 3S9HA 1NG9A 1EX4A 3DI6A 3K5NA 4YOTA 3OTOK 3OYEA 2Y1IA 1S1TA 5AZIA 2UUCK 5EY4A 2UXDK 4MDBA 3V9UA 2PZSA 2QWPA 4GVMA 4KB1A 3AVKA 3A5NC 3CM6A 2YCHA 4KHQA 4DSLA 1RBSA 2NUBA 3OA9A 1KFDA 1JL1A 1P8ZA 4I2QA 1VHXA 4V19S 4CF9A 1IV0A 4CJVA 2VG5A 2YKMA 3NF7A 3TR8A 1WBDA 3VENA 1S22A 2KFNA 4DU1A 3F9KA 4DV3K 1S1VA 4ISEA 4CEBA 1DT9A 4KTQA 3DAWA 1QTMA 1KLNA 1Z05A 4XH1A 1BL3A 4RG8A 3MXJA 4AHSA 4BRNA 3QLHA 3HXMA 3T1AA 3NHGA 4YORA 2HMPA 3BF1A 4YOYA 4FWSA 4FXDA 1DTQA 2KHOA 3NMUA 1U48A 3RR7A 3THXB 3I8DA 1KD1O 1IG8A 4DFKA 1NMDA 3WUHA 3AVBA 2PYJA 1N36K 4PKHA 3EZ5A 4CIGA 4OLAA 3AA5X 4LH5A 5M1KA 5TKYA 3K5LA 4BVPA 2D0PA 3TSPA 1K8KB 3M1FA 1R0AA 3KHYA 4FJIA 1U6ZA 4YFUA 3SPZA 2NRWA 3MN5A 4CHOA 3VQ5A 1BIUA 3RTVA 4EFHA 1J5EK 3TAEA 4B9SA 1U2VB 5AQLA 5GAHP 3E66A 4WQ5C 1VSIA 5AQGA 3VEZA 1D5AA 5BR9A 1HRHA 3OY9A 2DTUA 2HHQA 1J5OA 4JKDA 3CCMN 3MAQA 1QVFM 3TI0A 3CCRN 5E84A 1Q9XA 3C6UA 1M90O 3HVRA 2GUPA 2D0AA 3HOSA 3AAQA 2P51A 3M5RA 1GLEG 1EQYA 5J2QA 5C0YA 2OPPA 2VYPA 2YNFA 3M6GA 2E2QA 4YHHK 2YHYA 3OYHA 1LV5A 2P9NA 2QWQA 3ZSOA 3GOIA 3JXUA 1WLJA 3VQ7A 3KLFA 4CGJA 3K9KA 3RRHA 4LF5K 3K58A 3LALA 2GEMA 2I5JA 4B08A 4N5SA 4BWJA 2BANA 2FBXA 3EE8A 3NCIA 4DF8A 1I94K 5H1SQ 1TV6A 3K0SA 4MDAA 3QEXA 5J1EA 5LJWA 4F3TA 3THWA 1IBLK 2F9TA 4BGBA 3VMFB 4BDYA 3D2EB 4GV3A 2Z1HA 4DV2K 4B3TK 4DLGA 2A1RA 5C42A 1WN7A 1NKBA 3MEDA 4WYBA 3F5TA 4WQ4A 3U3YA 4DR7K 1IJJA 1NK4A 1XMOK 5FDLA 1NGHA 1EXQA 4JI6K 1XHZA 4IFVA 4GKJK 1S9GA 3WEEA 1OH7A 1JLAA 3ULEB 1VK0A 4GY2B 3HOTA 5GIOA 3LL3A 3NGZA 3CJ7A 2ITMA 1BIZA 3IAYA 1KRPA 1C6VA 4FJGA 3BY5A 1RBVA 4DTRA 1JCFA 4OKEA 3DXKA 4CZFA 3NVMA 5AQJA 2ITGA 4J8FA 3NF6A 2V7ZA 3RSEB 3L2VA 3O1BA 4OKJA 2CGKA 4DV6K 3QESA 1YJ9N 2E4LA 3NH2A 1QHAA 4JKEA 2QXLA 3P83D 5ADXH 4PHTX 2G8KA 3KK2A 2IS3A 4H0YB 3IDHA 3T1YK 3QINA 3LM9A 2ZJRL 3HSCA 5M1NA 3U8XA 1M1KO 3L0QA 1DTTA 4FPBA 4DFJA 1TKXA 3M8PA 1MA9B 4IO9L 4JK7A 3AVNA 3KK1A 5DM6L 4YOVA 4I6MA 3OS1A 4LF7K 1VSFA 5AQNA 3U3GA 3HSTB 5KGXA 1VQ7N 3O08A 3O5BA 4FOIA 5DM7L 3THYB 1KAYA 2EWSA 2ASMA 3A5OC 4I9LA 3AO5A 3AY9A 4A62A 4RWTA 2E88A 4CF1A 3ZSQA 1NJIO 2HSTA 4JV5K 4ZHRA 3OYBA 1NJYA 3M8SA 1TYQA 2XY8A 3D2FB 2AJQA 2HHWA 3VA0A 1ILYA 3DJCA 2P9LB 2ZF5O 1RDBA 4FJKA 4X64K 1GLAG 3SMPA 4FM0A 1WSFA 3QICA 3SUQA 1DKGD 4JD2A 1XC9A 2ZQBA 3BDPA 4IEIA 5AZJB 3HT3A 2BH1A 4B9VA 5EXWA 1J54A 1QE1A 1BI4B 1YTAA 1TK0A 1HLUA 1NNEA 4CJKA 1RCHA 3VA3A 1JL2A 5J2PA 3PX4A 1BGXT 3KD5E 3O9QA 2HMIA 1GLBG 1RGIA 2CH6A 3HM9A 1VQNN 3WQTA 1B92A 5AQPA 1YJWN 3DWLA 4BQZA 2QWNA 4AM6A 4Q5VA 4N76A 2UXBK 4FWNA 2JGUA 3D7EO 1VRTA 1TGOA 1U04A 1NKEA 5FPDA 4BRMA 3DLKA 4ELVA 3TARA 1JXBA 4BROA 4H03B 4KHNA 3OYNA 3TWHA 4JKGA 3CPWM 3WNFA 3HM8A 3AAPA 4AHCA 2EHGA 4KV8A 3NDKA 3NF9A 4CESA 1NK7A 3KIOA 4CK2A 4JKBA 1JJ2M 3LDOA 3J7ZO 3CQXA 3E9PA 4DTUA 5KPRA 4JK8A 4JI1K 4FK0A 1VQ6N 2HVHA 4R5PA 1NOYA 1K6YA 2W40A 1MWKA 5JS2A 3QFUA 3O3HA 1HNXK 1QHTA 3ENHA 4CHYA 1RT5A 3O9SA 4DQRA 2YI1A 4JRPA 4BRLA 1LCUA 2ZJPL 4X66K 4H0TB 4M3XA 2JWKA 4KH5A 4CJFA 4DQPA 4WFAL 4IG0A 4WQ4C 4CJLA 2YNHA 1G15A 4EIAA 2DFHA 2D5RA 3A5MC 3CPEA 2FSJA 3BGRA 1KCFA 3AGKA 1CZ9A 2G8VA 3LM2A 4ILGB 4BC4A 4CF0A 2A42A 3LP2A 5CZ1A 1TAQA 1QSSA 3VN5A 3HVTA 3P39A 3CERA 1WBBA 4HCCA 4BG8A 3WNEA 4FLUA 3U9DA 4LF9K 4EHUA 1ZBSA 3H45C 4CF2A 2BUPA 2YHAA 1RT7A 5EX5A 1U45A 1TKTA 2UUAK 3LAKA 2G8FA 5I9EB 2FXUA 1UWBA 4H0VB 4C1NK 1IKVA 5CYMA 1ATRA 2E1YA 4KRFA 4FJMA 1NGCA 3O3GA 4DTOA 1RTDA 3QIPA 1VQ9N 4M63C 1ZYQA 4EHTA 4EZ6A 1UA0A 3AVMA 3FZMA 3ZSRA 3PIPL 4DSKA 1HPMA 1IO2A 5M1OA 1RT2A 1HKBA 3AVIA 4JN4A 3OS2A 3HTVA 3SLCA 3CXCM 1S1WA 2O8BB 3L2RA 2HF3A 2I7PA 3P31A 3CCLN 4CZGA 1KTQA 2P5OA 2Z1GA 2Q3SA 2HVIA 4CF8A 4WE1A 2P9IB 4DUYK 3OYJA 2P9UB 3EN9A 1U49A 3KKSA 2NRRA 4AQYK 3QEWA 1YIJN 1S72N 1KLMA 2PAVA 4UQGA 3AVLA 4XH5A 2Q31A 4MO4A 1LWFA 1YXQA 3AA2A 3UKRB 1Q9YA 1XQSC 3LDLA 3AVCA 3I0SA 1TL1A 3CETA 2P9PB 3ZEUA 4BR2A 5HLFA 4BRQA 4O44A 4ELTA 1Q8IA 1WSEA 3VETA 3DRRA 1RDWX 3H3NO 4KHPK 2Q97A 3WXJA 3TU5A 4CECA 1D9FA 2JLEA 4O0IA 4CEAA 5KGWA 4KTZA 4DSFA 1F21A 5HRNA 1OVYA 4WCEL 3OVNA 5AQQA 4U67L 3ZCMA 3EEQA 2OYQA 4KHYA 3SV3A 4ZTFA 4YOWA 1N33K 2G8HA 3L2WA 4DCHA 3BEXA 1C0FA 4Z0UA 5M1QA 2VWJA 1ZC6A 1C1BA 4PA1A 1QZ5A 2Y1JA 1UAXA 1YUWA 4CEFA 2ASPA 1T7PA 4HUGA 3U6FA 2NNWA 5AQSA 3K2PA 4DTXA 1UA1A 3CJBA 1NK9A 3R1XA 4B1VA 4CHPA 4NO7A 4LF8K 3CD6N 1T3VA 1X1PA 2B6AA 4FVMA 4FZZA 1WSGA 3I56N 1NOZA 4R79A 3RMCA 1HYVA 4B3OA 1WB9A 4NYNA 1S1XA 3L2UA 3G6EN 3UKUA 3IUCA 4EP5A 1T05A 2D4WA 4K8ZA 2D0OA 3E9LA 4H0PA 3VEOA 5FPNA 2QEXN 4NCGA 3QDKA 4CIFA 2D0BA 2UU9K 4LFBK 3EZWA 4CW7B 5A2QO 1U47A 1SL1A 4DTNA 2OANA 2V51B 4A57A 1BDGA 4DMNA 4YOXA 2QK9A 1JLCA 1NK6A 3J7AP 3M8QA 4A59A 3K9JA 3MCAB 5BRFA 4FJLA 4FYDA 1YT3A 2FBYA 2ZGZA 5C25A 3PV8A 1HUXA 4QS9A 4HTLA 2O8EB 4BY9C 2QWMA 5DK5A 4LY7A 5AQKA 3TAFA 3RVCA 3L4QA 4RCHA 3KVGA 5AQFA 1BISA 2A6AA 4H4MA 2E20A 1HYZA 3CC4N 1KAZA 3CCVN 3O9RA 3VPZA 1XWLA 4ID5A 2ZWHA 5AZIB 4H5VA 2QKKA 4FWMA 2IVOA 4CJSA 4FWQA 3VTIA 4M3UA 2BGGA 3QB0A 2O8DA 1Y97A 1U4BA 4FW2A 1S6PA 4CJPA 4BDZA 4IDHA 3FR0A 1Q86O 3A5LC 4E7HA 2P1JA 5CZ2A 3EE9A 4BDPA 4PY5A 5GIPA 3IRXA 4FVUA 2HW3A 1KC8O 1VSHA 2VQEK 2PBDA 5AQZA 1RDDA 3CYMA 5M1PA 4CZHA 4E3SA 3QNNA 5BRHA 4GV9A 4JI7K 2A40A 1E4GT 4IDKA 4CZMA 3SUPA 3W0LA 4DTPA 4C1NI 3MX5A 4CGHA 2GX9A 3CJCA 4C23A 3HJFA 5AQYA 3HZ6A 4RW7A 4F9OA 3MWTA 1OH8A 4F3OA 1DGKN 1VQMN 1OH6A 1WAFA 5KRTA 4CJ5A 3OYGA 2ETJA 1JXEA 3VERA 3LDSA 4PKGA 4LFCK 5BN9A 4NXMK 3LP0A 2YKNA 4CCHA 3G4SN 1S1UA 1TL3A 2KTQA 4HTUA 4IBNA 1ATNA 5C10A 1RTHA 1C0MA 4CERA 3LDPA 4H5NA 3L3UA 5AQOA 2UUBK 2Q36A 5E26A 3I55N 1BHLA 3CJAA 3HPGA 4CHZA 4B3SK 3TAPA 2EX3A 5BRDA 3AVFA 1I3AA 4JAXA 2ZGYA 3AVAA 1TKDA 1VQ4N 2F8TA 4CEDA 5AQWA 2P9NB 3SPYA 2FC0A 2WBNA 4C8LA 1TVRA 4W5QA 1SAZA 5IWAK 4JK9A 4IFEA 2P9KA 3ZSXA 3D0PA 2OPRA 2ZM6K 3DRPA 4JI8K 3PSIA 2X74A 1LWEA 2O4GA 2QWLA 1JLFA 3TSQA 3EO3A 4B1ZA 4BC3A 4N41A 2BTFA 3CFRA 3Q7BA 4K43A 1BCOA 3THWB 1KVBA 4FWPA 1EWQA 4W5NA 2NRHA 3C7NA 2PYLA 3U9ZA 3KZBA 4DV0K 3C0BA 4B1UB 4GW6A 2G8IA 1Z25A 3D45A 4E7IA 2ZE2A 5AR0A 3VF6A 4O0JA 5C15A 3CCSN 3WT0A 4DQSA 3JSMA 4MO5A 3RWUA 3OBYA 3G25A 4JLHA 4XH4A 3CCJN 3WEEB 2Q2RA 4BRKA 3KLEA 1NGJA 3OYFA 3QERA 3I8BA 3ZX2A 4M42A 4LSLA 3MEEA 1K9MO 2XHBA 3OJSA 3CC2N 1EKEA 3DMJA 3CC7N 3SQ1A 4LSNA 3MN7A 4JYAK 1VSKA 1ZBFA 4FLTA 2QI2A 1SZ2A 4I9QA 3DXKB 4FK4A 1XC3A 4FW1A 5LMNK 4JI4K 1HKCA 1CZBA
chains in the Genus database with same CATH topology
5SZTA 5J2NA 4CJFA 2RPIA 4Z4GA 1RT1A 1LAWA 4AHVA 2DFFA 4DQPA 4F2SA 2A1SA 4IKFA 2WONA 3CFOA 4IG0A 4CJLA 3I0RA 2YNHA 4C8KA 3NBPA 1G15A 2RF2A 3DLHA 2VWKA 4AILC 4CEEA 2DFHA 5KTQA 2P5GA 5T7BA 2D5RA 1BCMA 4W5RA 4CEOA 3ITHA 2GBZA 3BGRA 1KCFA 4C8OA 1ZBIA 1CZ9A 2G8VA 2OPSA 3HP6A 1S6QA 1N6QA 4CHQA 3AO1A 4Z4IA 5HRSA 1T8EA 4CF0A 5J2MA 4B9LA 4RW8A 1A5VA 4FJHA 3LP2A 5CZ1A 3KJVA 1HJRA 1TAQA 4CJQA 3KK3A 1LW0A 3TABA 3LZIA 2W42A 4BE0A 1QSSA 1HQEA 3VN5A 4E7LA 3HVTA 1BQMA 4I2PA 1SKSA 4HCCA 3PY8A 3WNEA 4FLUA 5CY4A 4L8RB 2KZMA 1VSJA 4B9TA 4CK3A 4BE2A 2KFNA 3DLRA 3L8BA 1KVCA 4CF2A 4Z4EA 1IKYA 2YHAA 1HNVA 1LW2A 1RT7A 3IS9A 1U45A 4H4OA 4KHUA 1TKTA 1VSLA 3ISNC 3VQPA 1IG9A 4OJRA 1RTIA 4DU4A 2YNIA 1RDAA 1IKXA 3LAKA 3MXMA 3G0ZA 3ZT3A 3V81A 4W5TA 2G8FA 4M41A 1T03A 3V9ZA 3PO5A 4XIUA 4DF4A 1UWBA 1TKZA 3C95A 1TK5A 1IKVA 3K57A 5CYMA 4O55A 4FZYA 4W5OA 4KRFA 4FJMA 4QOZB 3SZ2A 4DSJA 3O3GA 1S5JA 3CQ8A 4DTOA 1RTDA 3QIPA 3THVA 1ZYQA 1RNHA 1QSYA 4KHSA 4JS4A 1REVA 4EZ6A 1CLQA 1UA0A 4CFBA 1J9AA 3AVMA 4ID1A 4DQIA 5FRNA 3OJUA 3ZSRA 4DS4A 3S9HA 4CJRA 3QEIA 1EX4A 4DSKA 3DI6A 4CGDA 3K5NA 2GUIA 1IO2A 1RT2A 3OYKA 4KREA 4F8RA 3OYEA 1L5UA 4FJJA 2Y1IA 3AVIA 3ZSWA 4O5BA 2HHTA 3RMDA 2DY4A 1S1TA 1NK5A 4G1QA 3OS2A 3SQ0A 2Z1JA 3HYFA 2VG7A 3QETA 4F4KA 3AVHA 3V9UA 3HP9A 2HNZA 1RBRA 2G8UA 2PZSA 4GVMA 1S1WA 3AVKA 4KB1A 3CM6A 3L2RA 4CGGA 2PY5A 4DTSA 5KI6A 3TAGA 4KHQA 4F2RA 4DSLA 1QSLA 4CEQA 1RBSA 1KTQA 2NUBA 2P5OA 1UOCA 2Z1GA 1KFDA 3RMAA 1JL1A 4I2QA 2Q3SA 2XY7A 4CF9A 2HVIA 4CF8A 4B8AB 2VG5A 2YKMA 4CJVA 4WE1A 3V4IA 2O4IA 2RN2A 3NF7A 4OPKA 1X9MA 3TR8A 3OYJA 1SL2A 4BWMA 4E1NA 3SJJA 1U49A 3A2FA 4KO0A 1ZBUA 3KKSA 3ZSZA 3KLIA 3QEWA 1KLMA 2XY5A 4UQGA 3AVLA 3O3FA 4NYFA 1B9DA 1LWFA 1MU2A 3AA2A 3F9KA 4AHUA 4DU1A 1JKHA 3MXIA 1Q9YA 3OYCA 1S1VA 3AVCA 3I0SA 3ZSVA 4CEBA 4J2BA 4OLBA 1TL1A 4IFYA 5SWMA 4KTQA 1QTMA 1KLNA 1BL3A 4RG8A 3MXJA 2F96A 4AHSA 5HLFA 3QLHA 3ZT0A 3RMBA 1N5YA 3HXMA 3T1AA 3K5OA 2FBVA 4O44A 3NHGA 1NJZA 4ELTA 1Q8IA 1WSEA 2GV9A 2YNGA 4RW9A 4FM1A 3DRRA 2Z1IA 3QO9A 4CJTA 5HBMA 4KB0A 1NKCA 4NCAA 1DTQA 4FXDA 4FJ9A 1U48A 3RR7A 5C24A 3PUFA 4CECA 1D9FA 3I8DA 2YV0X 3C94A 4DSEA 2HHXA 3NGIA 4KFBA 2JLEA 4O0IA 4CEAA 4DFKA 1WNSA 5KGWA 3AVBA 3NH0A 2PYJA 2HHVA 4KTZA 3EZ5A 4CIGA 4OPJA 4DSFA 2OZSA 4OLAA 3AA5X 4LH5A 1F21A 2IDOA 5HRNA 3K5LA 1WSIA 4EZ9A 3OVNA 3ZCMA 4FJXA 1R0AA 2OYQA 4KHYA 5JS1A 3SV3A 1CXQA 3AVGA 4ZTFA 1ZBLA 4HVJA 4YFUA 4FJIA 3SPZA 4CHOA 3RTVA 3OS0A 3VQ5A 1BIUA 2G8HA 4QAGA 3L2WA 3TAEA 2QXFA 4FJNA 1HYSA 4B9SA 5HP1A 3G10A 2XO7A 4Z0UA 1VSIA 2VWJA 1VRUA 3KD1E 1D5AA 1C1BA 4PA1A 3ZSYA 1HRHA 3OY9A 3SYZA 1UAXA 2Y1JA 4CEFA 3QEVA 3OYAA 2DTUA 1T7PA 1J5OA 2HHQA 4HUGA 3VQ6A 3U6FA 1NJWA 4OGCA 1IKWA 4DU3A 3K2PA 4DTXA 1UA1A 3MAQA 2XRIA 1NK9A 5D3GA 3OYDA 4CHPA 3CFPA 1C1CA 4B9UA 3TI0A 1A5WA 4CJ3A 1Q9XA 3C6UA 2KZZA 1X1PA 3DOLA 1TK8A 3HVRA 3NAEA 2D0AA 3QEPA 4FZXC 2B6AA 3DLEA 4CFAA 2P51A 4DFMA 4FVMA 4FZZA 5J2QA 3QIOA 4K8XA 2IOCA 1WSGA 2OPPA 1BI4A 4CHNA 4Q0BA 2IGIA 1NOZA 2YNFA 4ICLA 3OYHA 3KLGA 1LV5A 4M3WA 3AO2A 3ZSOA 1FKPA 3RMCA 1HYVA 1WLJA 4OKKA 3VQ7A 4NYNA 1S1XA 3ASMA 4CGJA 3KLFA 3L2UA 3RRHA 3K58A 4B3OA 3LALA 1J53A 4EP5A 5HROA 1T05A 2I5JA 1WAJA 4B08A 3VQQA 3ZT1A 3LWLA 4JRQA 1XI1A 4K8ZA 4N5SA 2HNYA 4BWJA 2BANA 2FBXA 3SUNA 3WNHA 3NCIA 4DF8A 4C8NA 4NCGA 3SQ2A 1L3TA 4CIFA 2KQ2A 3LP3A 2D0BA 3KTQA 2RKIA 1TV6A 3SCXA 4M45A 4AH9A 3SV4A 3KKRA 3QEXA 4CE9A 5J1EA 4B8CA 4F3TA 1U47A 1SL1A 4DTNA 4FJ8A 3LWMA 4DMNA 4N47A 2QK9A 2E6MA 4BDYA 1JLCA 1LAVA 3PX0A 1NK6A 1ZBHA 3HPHA 2WOMA 2Z1HA 1L3SA 3M8QA 4OVLA 4DLGA 4CJWA 4DWIA 4KI4A 4JS5A 1JLBA 3E01A 1RBUA 2VG6A 2A1RA 4FJ5A 5C42A 1WN7A 4FJLA 1C0TA 1NKBA 4FYDA 3MEDA 1YT3A 2FBYA 4E7JA 3U3YA 2G8WA 5DMRA 5C25A 3LPTA 3P5JA 1NK4A 3PV8A 3DLBA 2IC3A 3AVJA 4E1MA 5FDLA 1QQCA 3VQBA 3TAQA 1EXQA 1FK9A 3V9XA 1XHZA 5DK5A 4LY7A 4IFVA 3OYMA 3TAFA 1S9GA 4HHTA 4Z4CA 1JLAA 2HHUA 1D8YA 3DLGA 4E0DA 3WNGA 1ASUA 1BISA 4H4MA 1D9DA 1VK0A 1X9SA 1HYZA 1RBTA 1RT3A 4E7KA 1XWLA 4ID5A 4TSXA 3NGZA 4FLXA 4QCLA 2QKKA 1BIZA 3PO4A 4DFPA 3ZT2A 4FLZA 4ZTJA 4CJUA 3IAYA 2E6LA 4CJSA 1KRPA 3P1GA 3DYAA 1C6VA 4M3UA 4FJGA 4Z4HA 1RBVA 4LD0A 4DTRA 2HB5A 2BGGA 4OKEA 3VQCA 1Y97A 1BQNA 4FLVA 4FW2A 1U4BA 1S6PA 4CJPA 4BDZA 1NK8A 4E7HA 1L3UA 4DTMA 2P1JA 1KFSA 4KAZA 3LAMA 5CZ2A 3T19A 2BDPA 4CFCA 3LP1A 4BDPA 4J2AA 4PY5A 4DLEA 1QS4A 1VSEA 2ITGA 3IRXA 2HW3A 3SUOA 5HRPA 3NF6A 5EU7A 4PWDA 5I42A 1VSHA 3L2VA 4OKJA 1SKWA 5HRRA 4KPYA 1RDDA 4AHTA 3CYMA 3QESA 1JLQA 1CXUA 4CJ4A 4E3SA 1SKRA 3QNNA 4PQUA 2E4LA 4KHWA 3NH2A 4MFBA 3VQ8A 1JLEA 1FKOA 4LH4A 4FLYA 3P83D 3VQ9A 5KRSA 1W9HA 2G8KA 1RT6A 3AO3A 3H08A 3NGYA 3KK2A 4B9MA 2IS3A 5E41A 4AHRA 3HO1A 4IDKA 3MECA 4FJ7A 3SUPA 4DTPA 1ASWA 3QINA 1KSPA 4CGHA 3V1OA 4J2DA 1KVAA 1O1WA 1DTTA 5K14A 4DFJA 3F73A 1I39A 4CFDA 3L2QA 4HUFA 1NJXA 1TKXA 1ASVA 3M8PA 4M3RA 4DS5A 3UIQA 4YNQA 3HJFA 1ITGA 3C6TA 1WSHA 4RW7A 3HK2A 3AVNA 3AV9A 3KK1A 2KFZA 1GOAA 1XHXA 3TANA 4F3OA 3OS1A 1WAFA 4MQ3A 1EETA 5KRTA 4CJ5A 2QKBA 3OYGA 1VSFA 2ETJA 1JXEA 3LPUA 3U3GA 4N56A 4M3YA 3HSTB 5KGXA 3LDSA 1JLGA 3TAMA 4CEZA 1C1AA 4FK2A 3LP0A 2YKNA 3K59A 1IH7A 1S1UA 1TL3A 1GOCA 3K5MA 4B9NA 2KTQA 3M8RA 2ATQA 4I9LA 3LANA 2ZD1A 3AO5A 4Y1CA 3HPOA 4HTUA 1RDCA 4IBNA 1NK0A 1SUQA 1HQUA 1RTHA 3ZSQA 4CF1A 1C0MA 2R7YA 4ZHRA 3OYBA 1NJYA 4CERA 3M8SA 3NH1A 2F8SA 3L3UA 2XY8A 2AJQA 3QNOA 4H8KA 3CM5A 1LWCA 2HHWA 2B4JA 3VA0A 1BHLA 3VQAA 3HPGA 1GOBA 1RDBA 4FJKA 3S3OA 4CHZA 3S3NA 4O4GA 1WSFA 4FM0A 4GMJB 1TAUA 3HL8A 3L3VA 5CYQA 4Y1DA 3SUQA 3TAPA 1SV5A 4BACA 4KKOA 2HHSA 2EX3A 1XC9A 2ZQBA 3BDPA 3AVFA 1C0UA 1EP4A 1I3AA 1YTUA 4IG3A 1B9FA 2X78A 4KI6A 3HT3A 1HNIA 1TKDA 4B9VA 3V1QA 1RT4A 2X6NA 2OPQA 3AVAA 1J54A 1QE1A 4RW4A 4E89A 1BI4B 1YTAA 4CEDA 1TK0A 2F8TA 3NFAA 5FRMA 3SPYA 1HMVA 3EYZA 1X9WA 2FC0A 4CJKA 3KLHA 4C8LA 1TVRA 4W5QA 1DLOA 1RCHA 3RRGA 1A5XA 4OGEA 3VA3A 1JL2A 5J2PA 3PX4A 1BGXT 3ULDA 1RTJA 4CGIA 4EP4A 3V9WA 2HMIA 3OYLA 4FCYA 3KD5E 3D0PA 1FXXA 3ZSXA 3HM9A 2OPRA 3DRPA 3O4QA 2X74A 1LWEA 4CIEA 1HPZA 2O4GA 3AA3A 1B92A 1JLFA 3B6PA 3JYTA 1SL0A 2YHBA 2OA8A 4N41A 3LZJA 3CFRA 1L3VA 4CGFA 2KW4A 1BCOA 4CJEA 4Z4FA 4Q5VA 3AO4A 3MEGA 2BE2A 2D0CA 5I3UA 1KVBA 3RR8A 2OZMA 4N76A 4W5NA 2JGUA 1YVUA 3SI6A 1VRTA 3ZT4A 2PYLA 1TGOA 1U04A 4BE1A 1NKEA 3PX6A 3VQDA 3DLKA 3NE6A 4ELVA 4PUOA 3TARA 1JXBA 4GW6A 2G8IA 1Z25A 3D45A 4E7IA 2LSNA 2ZE2A 4O0JA 4KHNA 4RW6A 3T3FA 3OYNA 3TWHA 1VSMA 3WNFA 4DTJA 4DQSA 2IAJA 4AHCA 1VSDA 2EHGA 3IG1A 4KV8A 3SQ4A 1W0HA 3JSMA 3AA4A 2FBTA 3NF9A 4CESA 3NDKA 1NK7A 3KIOA 4CK2A 4HCBA 3EY1A 3RWUA 4I7FA 5FROA 3S3MA 4J2EA 3V1RA 4DTUA 2HNDA 3NF8A 4JLHA 1RILA 4DSIA 4M3TA 3DRSA 3VQEA 4FK0A 4HUEA 2HVHA 3CG7A 4R5PA 3KLEA 4DG1A 3OYFA 1NOYA 1K6YA 2B5JA 1Z26A 3VQ4A 3O3HA 5JS2A 4LSLA 3OYIA 3MEEA 3QERA 4M42A 1QHTA 4NCBA 3SNNA 4C8MA 4M3ZA 2XHBA 3OJSA 4FM2A 1EKEA 4CHYA 1S9EA 2DFEA 1WSJA 3ALYA 3DMJA 1RT5A 4DQRA 4JRPA 3B6OA 3DM2A 3DOKA 4LSNA 4FLWA 3SQ1A 4CK1A 4KTWA 3V9SA 3FFIA 1VSKA 1ZBFA 2X6SA 4E19A 4FLTA 4M3XA 4I9QA 4FK4A 4DQQA 4ELUA 4FW1A 4CCHA 2XY6A 3V6DA 1CZBA 3O4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SZT A;  5J2N A;  4CJF A;  2RPI A;  4Z4G A;  1RT1 A;  1LAW A;  4AHV A;  2DFF A;  4DQP A;  4F2S A;  2A1S A;  4IKF A;  2WON A;  3CFO A;  4IG0 A;  4CJL A;  3I0R A;  2YNH A;  4C8K A;  3NBP A;  1G15 A;  2RF2 A;  3DLH A;  2VWK A;  4AIL C;  4CEE A;  2DFH A;  5KTQ A;  2P5G A;  5T7B A;  2D5R A;  1BCM A;  4W5R A;  4CEO A;  3ITH A;  2GBZ A;  3BGR A;  1KCF A;  4C8O A;  1ZBI A;  1CZ9 A;  2G8V A;  2OPS A;  3HP6 A;  1S6Q A;  1N6Q A;  4CHQ A;  3AO1 A;  4Z4I A;  5HRS A;  1T8E A;  4CF0 A;  5J2M A;  4B9L A;  4RW8 A;  1A5V A;  4FJH A;  3LP2 A;  5CZ1 A;  3KJV A;  1HJR A;  1TAQ A;  4CJQ A;  3KK3 A;  1LW0 A;  3TAB A;  3LZI A;  2W42 A;  4BE0 A;  1QSS A;  1HQE A;  3VN5 A;  4E7L A;  3HVT A;  1BQM A;  4I2P A;  1SKS A;  4HCC A;  3PY8 A;  3WNE A;  4FLU A;  5CY4 A;  4L8R B;  2KZM A;  1VSJ A;  4B9T A;  4CK3 A;  4BE2 A;  2KFN A;  3DLR A;  3L8B A;  1KVC A;  4CF2 A;  4Z4E A;  1IKY A;  2YHA A;  1HNV A;  1LW2 A;  1RT7 A;  3IS9 A;  1U45 A;  4H4O A;  4KHU A;  1TKT A;  1VSL A;  3ISN C;  3VQP A;  1IG9 A;  4OJR A;  1RTI A;  4DU4 A;  2YNI A;  1RDA A;  1IKX A;  3LAK A;  3MXM A;  3G0Z A;  3ZT3 A;  3V81 A;  4W5T A;  2G8F A;  4M41 A;  1T03 A;  3V9Z A;  3PO5 A;  4XIU A;  4DF4 A;  1UWB A;  1TKZ A;  3C95 A;  1TK5 A;  1IKV A;  3K57 A;  5CYM A;  4O55 A;  4FZY A;  4W5O A;  4KRF A;  4FJM A;  4QOZ B;  3SZ2 A;  4DSJ A;  3O3G A;  1S5J A;  3CQ8 A;  4DTO A;  1RTD A;  3QIP A;  3THV A;  1ZYQ A;  1RNH A;  1QSY A;  4KHS A;  4JS4 A;  1REV A;  4EZ6 A;  1CLQ A;  1UA0 A;  4CFB A;  1J9A A;  3AVM A;  4ID1 A;  4DQI A;  5FRN A;  3OJU A;  3ZSR A;  4DS4 A;  3S9H A;  4CJR A;  3QEI A;  1EX4 A;  4DSK A;  3DI6 A;  4CGD A;  3K5N A;  2GUI A;  1IO2 A;  1RT2 A;  3OYK A;  4KRE A;  4F8R A;  3OYE A;  1L5U A;  4FJJ A;  2Y1I A;  3AVI A;  3ZSW A;  4O5B A;  2HHT A;  3RMD A;  2DY4 A;  1S1T A;  1NK5 A;  4G1Q A;  3OS2 A;  3SQ0 A;  2Z1J A;  3HYF A;  2VG7 A;  3QET A;  4F4K A;  3AVH A;  3V9U A;  3HP9 A;  2HNZ A;  1RBR A;  2G8U A;  2PZS A;  4GVM A;  1S1W A;  3AVK A;  4KB1 A;  3CM6 A;  3L2R A;  4CGG A;  2PY5 A;  4DTS A;  5KI6 A;  3TAG A;  4KHQ A;  4F2R A;  4DSL A;  1QSL A;  4CEQ A;  1RBS A;  1KTQ A;  2NUB A;  2P5O A;  1UOC A;  2Z1G A;  1KFD A;  3RMA A;  1JL1 A;  4I2Q A;  2Q3S A;  2XY7 A;  4CF9 A;  2HVI A;  4CF8 A;  4B8A B;  2VG5 A;  2YKM A;  4CJV A;  4WE1 A;  3V4I A;  2O4I A;  2RN2 A;  3NF7 A;  4OPK A;  1X9M A;  3TR8 A;  3OYJ A;  1SL2 A;  4BWM A;  4E1N A;  3SJJ A;  1U49 A;  3A2F A;  4KO0 A;  1ZBU A;  3KKS A;  3ZSZ A;  3KLI A;  3QEW A;  1KLM A;  2XY5 A;  4UQG A;  3AVL A;  3O3F A;  4NYF A;  1B9D A;  1LWF A;  1MU2 A;  3AA2 A;  3F9K A;  4AHU A;  4DU1 A;  1JKH A;  3MXI A;  1Q9Y A;  3OYC A;  1S1V A;  3AVC A;  3I0S A;  3ZSV A;  4CEB A;  4J2B A;  4OLB A;  1TL1 A;  4IFY A;  5SWM A;  4KTQ A;  1QTM A;  1KLN A;  1BL3 A;  4RG8 A;  3MXJ A;  2F96 A;  4AHS A;  5HLF A;  3QLH A;  3ZT0 A;  3RMB A;  1N5Y A;  3HXM A;  3T1A A;  3K5O A;  2FBV A;  4O44 A;  3NHG A;  1NJZ A;  4ELT A;  1Q8I A;  1WSE A;  2GV9 A;  2YNG A;  4RW9 A;  4FM1 A;  3DRR A;  2Z1I A;  3QO9 A;  4CJT A;  5HBM A;  4KB0 A;  1NKC A;  4NCA A;  1DTQ A;  4FXD A;  4FJ9 A;  1U48 A;  3RR7 A;  5C24 A;  3PUF A;  4CEC A;  1D9F A;  3I8D A;  2YV0 X;  3C94 A;  4DSE A;  2HHX A;  3NGI A;  4KFB A;  2JLE A;  4O0I A;  4CEA A;  4DFK A;  1WNS A;  5KGW A;  3AVB A;  3NH0 A;  2PYJ A;  2HHV A;  4KTZ A;  3EZ5 A;  4CIG A;  4OPJ A;  4DSF A;  2OZS A;  4OLA A;  3AA5 X;  4LH5 A;  1F21 A;  2IDO A;  5HRN A;  3K5L A;  1WSI A;  4EZ9 A;  3OVN A;  3ZCM A;  4FJX A;  1R0A A;  2OYQ A;  4KHY A;  5JS1 A;  3SV3 A;  1CXQ A;  3AVG A;  4ZTF A;  1ZBL A;  4HVJ A;  4YFU A;  4FJI A;  3SPZ A;  4CHO A;  3RTV A;  3OS0 A;  3VQ5 A;  1BIU A;  2G8H A;  4QAG A;  3L2W A;  3TAE A;  2QXF A;  4FJN A;  1HYS A;  4B9S A;  5HP1 A;  3G10 A;  2XO7 A;  4Z0U A;  1VSI A;  2VWJ A;  1VRU A;  3KD1 E;  1D5A A;  1C1B A;  4PA1 A;  3ZSY A;  1HRH A;  3OY9 A;  3SYZ A;  1UAX A;  2Y1J A;  4CEF A;  3QEV A;  3OYA A;  2DTU A;  1T7P A;  1J5O A;  2HHQ A;  4HUG A;  3VQ6 A;  3U6F A;  1NJW A;  4OGC A;  1IKW A;  4DU3 A;  3K2P A;  4DTX A;  1UA1 A;  3MAQ A;  2XRI A;  1NK9 A;  5D3G A;  3OYD A;  4CHP A;  3CFP A;  1C1C A;  4B9U A;  3TI0 A;  1A5W A;  4CJ3 A;  1Q9X A;  3C6U A;  2KZZ A;  1X1P A;  3DOL A;  1TK8 A;  3HVR A;  3NAE A;  2D0A A;  3QEP A;  4FZX C;  2B6A A;  3DLE A;  4CFA A;  2P51 A;  4DFM A;  4FVM A;  4FZZ A;  5J2Q A;  3QIO A;  4K8X A;  2IOC A;  1WSG A;  2OPP A;  1BI4 A;  4CHN A;  4Q0B A;  2IGI A;  1NOZ A;  2YNF A;  4ICL A;  3OYH A;  3KLG A;  1LV5 A;  4M3W A;  3AO2 A;  3ZSO A;  1FKP A;  3RMC A;  1HYV A;  1WLJ A;  4OKK A;  3VQ7 A;  4NYN A;  1S1X A;  3ASM A;  4CGJ A;  3KLF A;  3L2U A;  3RRH A;  3K58 A;  4B3O A;  3LAL A;  1J53 A;  4EP5 A;  5HRO A;  1T05 A;  2I5J A;  1WAJ A;  4B08 A;  3VQQ A;  3ZT1 A;  3LWL A;  4JRQ A;  1XI1 A;  4K8Z A;  4N5S A;  2HNY A;  4BWJ A;  2BAN A;  2FBX A;  3SUN A;  3WNH A;  3NCI A;  4DF8 A;  4C8N A;  4NCG A;  3SQ2 A;  1L3T A;  4CIF A;  2KQ2 A;  3LP3 A;  2D0B A;  3KTQ A;  2RKI A;  1TV6 A;  3SCX A;  4M45 A;  4AH9 A;  3SV4 A;  3KKR A;  3QEX A;  4CE9 A;  5J1E A;  4B8C A;  4F3T A;  1U47 A;  1SL1 A;  4DTN A;  4FJ8 A;  3LWM A;  4DMN A;  4N47 A;  2QK9 A;  2E6M A;  4BDY A;  1JLC A;  1LAV A;  3PX0 A;  1NK6 A;  1ZBH A;  3HPH A;  2WOM A;  2Z1H A;  1L3S A;  3M8Q A;  4OVL A;  4DLG A;  4CJW A;  4DWI A;  4KI4 A;  4JS5 A;  1JLB A;  3E01 A;  1RBU A;  2VG6 A;  2A1R A;  4FJ5 A;  5C42 A;  1WN7 A;  4FJL A;  1C0T A;  1NKB A;  4FYD A;  3MED A;  1YT3 A;  2FBY A;  4E7J A;  3U3Y A;  2G8W A;  5DMR A;  5C25 A;  3LPT A;  3P5J A;  1NK4 A;  3PV8 A;  3DLB A;  2IC3 A;  3AVJ A;  4E1M A;  5FDL A;  1QQC A;  3VQB A;  3TAQ A;  1EXQ A;  1FK9 A;  3V9X A;  1XHZ A;  5DK5 A;  4LY7 A;  4IFV A;  3OYM A;  3TAF A;  1S9G A;  4HHT A;  4Z4C A;  1JLA A;  2HHU A;  1D8Y A;  3DLG A;  4E0D A;  3WNG A;  1ASU A;  1BIS A;  4H4M A;  1D9D A;  1VK0 A;  1X9S A;  1HYZ A;  1RBT A;  1RT3 A;  4E7K A;  1XWL A;  4ID5 A;  4TSX A;  3NGZ A;  4FLX A;  4QCL A;  2QKK A;  1BIZ A;  3PO4 A;  4DFP A;  3ZT2 A;  4FLZ A;  4ZTJ A;  4CJU A;  3IAY A;  2E6L A;  4CJS A;  1KRP A;  3P1G A;  3DYA A;  1C6V A;  4M3U A;  4FJG A;  4Z4H A;  1RBV A;  4LD0 A;  4DTR A;  2HB5 A;  2BGG A;  4OKE A;  3VQC A;  1Y97 A;  1BQN A;  4FLV A;  4FW2 A;  1U4B A;  1S6P A;  4CJP A;  4BDZ A;  1NK8 A;  4E7H A;  1L3U A;  4DTM A;  2P1J A;  1KFS A;  4KAZ A;  3LAM A;  5CZ2 A;  3T19 A;  2BDP A;  4CFC A;  3LP1 A;  4BDP A;  4J2A A;  4PY5 A;  4DLE A;  1QS4 A;  1VSE A;  2ITG A;  3IRX A;  2HW3 A;  3SUO A;  5HRP A;  3NF6 A;  5EU7 A;  4PWD A;  5I42 A;  1VSH A;  3L2V A;  4OKJ A;  1SKW A;  5HRR A;  4KPY A;  1RDD A;  4AHT A;  3CYM A;  3QES A;  1JLQ A;  1CXU A;  4CJ4 A;  4E3S A;  1SKR A;  3QNN A;  4PQU A;  2E4L A;  4KHW A;  3NH2 A;  4MFB A;  3VQ8 A;  1JLE A;  1FKO A;  4LH4 A;  4FLY A;  3P83 D;  3VQ9 A;  5KRS A;  1W9H A;  2G8K A;  1RT6 A;  3AO3 A;  3H08 A;  3NGY A;  3KK2 A;  4B9M A;  2IS3 A;  5E41 A;  4AHR A;  3HO1 A;  4IDK A;  3MEC A;  4FJ7 A;  3SUP A;  4DTP A;  1ASW A;  3QIN A;  1KSP A;  4CGH A;  3V1O A;  4J2D A;  1KVA A;  1O1W A;  1DTT A;  5K14 A;  4DFJ A;  3F73 A;  1I39 A;  4CFD A;  3L2Q A;  4HUF A;  1NJX A;  1TKX A;  1ASV A;  3M8P A;  4M3R A;  4DS5 A;  3UIQ A;  4YNQ A;  3HJF A;  1ITG A;  3C6T A;  1WSH A;  4RW7 A;  3HK2 A;  3AVN A;  3AV9 A;  3KK1 A;  2KFZ A;  1GOA A;  1XHX A;  3TAN A;  4F3O A;  3OS1 A;  1WAF A;  4MQ3 A;  1EET A;  5KRT A;  4CJ5 A;  2QKB A;  3OYG A;  1VSF A;  2ETJ A;  1JXE A;  3LPU A;  3U3G A;  4N56 A;  4M3Y A;  3HST B;  5KGX A;  3LDS A;  1JLG A;  3TAM A;  4CEZ A;  1C1A A;  4FK2 A;  3LP0 A;  2YKN A;  3K59 A;  1IH7 A;  1S1U A;  1TL3 A;  1GOC A;  3K5M A;  4B9N A;  2KTQ A;  3M8R A;  2ATQ A;  4I9L A;  3LAN A;  2ZD1 A;  3AO5 A;  4Y1C A;  3HPO A;  4HTU A;  1RDC A;  4IBN A;  1NK0 A;  1SUQ A;  1HQU A;  1RTH A;  3ZSQ A;  4CF1 A;  1C0M A;  2R7Y A;  4ZHR A;  3OYB A;  1NJY A;  4CER A;  3M8S A;  3NH1 A;  2F8S A;  3L3U A;  2XY8 A;  2AJQ A;  3QNO A;  4H8K A;  3CM5 A;  1LWC A;  2HHW A;  2B4J A;  3VA0 A;  1BHL A;  3VQA A;  3HPG A;  1GOB A;  1RDB A;  4FJK A;  3S3O A;  4CHZ A;  3S3N A;  4O4G A;  1WSF A;  4FM0 A;  4GMJ B;  1TAU A;  3HL8 A;  3L3V A;  5CYQ A;  4Y1D A;  3SUQ A;  3TAP A;  1SV5 A;  4BAC A;  4KKO A;  2HHS A;  2EX3 A;  1XC9 A;  2ZQB A;  3BDP A;  3AVF A;  1C0U A;  1EP4 A;  1I3A A;  1YTU A;  4IG3 A;  1B9F A;  2X78 A;  4KI6 A;  3HT3 A;  1HNI A;  1TKD A;  4B9V A;  3V1Q A;  1RT4 A;  2X6N A;  2OPQ A;  3AVA A;  1J54 A;  1QE1 A;  4RW4 A;  4E89 A;  1BI4 B;  1YTA A;  4CED A;  1TK0 A;  2F8T A;  3NFA A;  5FRM A;  3SPY A;  1HMV A;  3EYZ A;  1X9W A;  2FC0 A;  4CJK A;  3KLH A;  4C8L A;  1TVR A;  4W5Q A;  1DLO A;  1RCH A;  3RRG A;  1A5X A;  4OGE A;  3VA3 A;  1JL2 A;  5J2P A;  3PX4 A;  1BGX T;  3ULD A;  1RTJ A;  4CGI A;  4EP4 A;  3V9W A;  2HMI A;  3OYL A;  4FCY A;  3KD5 E;  3D0P A;  1FXX A;  3ZSX A;  3HM9 A;  2OPR A;  3DRP A;  3O4Q A;  2X74 A;  1LWE A;  4CIE A;  1HPZ A;  2O4G A;  3AA3 A;  1B92 A;  1JLF A;  3B6P A;  3JYT A;  1SL0 A;  2YHB A;  2OA8 A;  4N41 A;  3LZJ A;  3CFR A;  1L3V A;  4CGF A;  2KW4 A;  1BCO A;  4CJE A;  4Z4F A;  4Q5V A;  3AO4 A;  3MEG A;  2BE2 A;  2D0C A;  5I3U A;  1KVB A;  3RR8 A;  2OZM A;  4N76 A;  4W5N A;  2JGU A;  1YVU A;  3SI6 A;  1VRT A;  3ZT4 A;  2PYL A;  1TGO A;  1U04 A;  4BE1 A;  1NKE A;  3PX6 A;  3VQD A;  3DLK A;  3NE6 A;  4ELV A;  4PUO A;  3TAR A;  1JXB A;  4GW6 A;  2G8I A;  1Z25 A;  3D45 A;  4E7I A;  2LSN A;  2ZE2 A;  4O0J A;  4KHN A;  4RW6 A;  3T3F A;  3OYN A;  3TWH A;  1VSM A;  3WNF A;  4DTJ A;  4DQS A;  2IAJ A;  4AHC A;  1VSD A;  2EHG A;  3IG1 A;  4KV8 A;  3SQ4 A;  1W0H A;  3JSM A;  3AA4 A;  2FBT A;  3NF9 A;  4CES A;  3NDK A;  1NK7 A;  3KIO A;  4CK2 A;  4HCB A;  3EY1 A;  3RWU A;  4I7F A;  5FRO A;  3S3M A;  4J2E A;  3V1R A;  4DTU A;  2HND A;  3NF8 A;  4JLH A;  1RIL A;  4DSI A;  4M3T A;  3DRS A;  3VQE A;  4FK0 A;  4HUE A;  2HVH A;  3CG7 A;  4R5P A;  3KLE A;  4DG1 A;  3OYF A;  1NOY A;  1K6Y A;  2B5J A;  1Z26 A;  3VQ4 A;  3O3H A;  5JS2 A;  4LSL A;  3OYI A;  3MEE A;  3QER A;  4M42 A;  1QHT A;  4NCB A;  3SNN A;  4C8M A;  4M3Z A;  2XHB A;  3OJS A;  4FM2 A;  1EKE A;  4CHY A;  1S9E A;  2DFE A;  1WSJ A;  3ALY A;  3DMJ A;  1RT5 A;  4DQR A;  4JRP A;  3B6O A;  3DM2 A;  3DOK A;  4LSN A;  4FLW A;  3SQ1 A;  4CK1 A;  4KTW A;  3V9S A;  3FFI A;  1VSK A;  1ZBF A;  2X6S A;  4E19 A;  4FLT A;  4M3X A;  4I9Q A;  4FK4 A;  4DQQ A;  4ELU A;  4FW1 A;  4CCH A;  2XY6 A;  3V6D A;  1CZB A;  3O4N A; 
#chains in the Genus database with same CATH topology
 1VQO N;  5SZT A;  1T6D A;  2A5X A;  2RPI A;  4BRE A;  2Q1N A;  3TTC A;  2A1S A;  4BR9 A;  4C8K A;  3NBP A;  3R8E A;  3PSF A;  4AIL C;  3MX2 A;  3CHW A;  3MCP A;  4CI6 A;  4K25 A;  2GTD A;  1GLF O;  1S6Q A;  5AJ3 K;  3BZK A;  3BF3 A;  4CZE A;  5C12 A;  4JI0 K;  3E1Y A;  4WFB L;  4CJQ A;  2VGN A;  2W42 A;  4BE0 A;  1XNR K;  1BQM A;  4B1Y B;  1VQP N;  2P9L A;  3BP8 A;  2WFB A;  5LMU K;  3VEY A;  3KWG A;  2YHX A;  4A2B A;  1S3X A;  4CK3 A;  4IO8 A;  3DLR A;  4H5R A;  3TTD A;  3KK7 A;  4BR5 A;  4Z4E A;  4I6M B;  3IS9 A;  2ZJQ L;  1VSL A;  3ISN C;  1IG9 A;  1QVG M;  1JCE A;  2E2P A;  3MXM A;  5GIN A;  4IEE A;  3PO5 A;  4XIU A;  4DF4 A;  3ENB A;  2HBL A;  3E9O A;  3K57 A;  2OTJ N;  4OX9 K;  4QOZ B;  1E3M A;  4DSJ A;  1S5J A;  4CZJ A;  4NB4 A;  2D1K A;  1RNH A;  1TYQ B;  1REV A;  5FRN A;  1J9A A;  4ID1 A;  4MLH A;  4JI2 K;  4CJR A;  5C2F A;  4CGD A;  2GUI A;  3OYK A;  5JVG L;  5KQD A;  4KRE A;  4FJJ A;  2P9S A;  4A5B A;  2HHT A;  2DY4 A;  4JD2 B;  4G1Q A;  3A0I X;  2F7T A;  3SQ0 A;  2Z1J A;  3HYF A;  3GL1 A;  2QTD A;  1HR0 K;  4FO0 A;  2HNZ A;  1IBK K;  3VF2 A;  2WC9 A;  4PKI A;  3TAG A;  4JHD A;  4F2R A;  3C6A A;  4BQL A;  4CEQ A;  3VEW A;  3RMA A;  4BRH A;  1BOT O;  1KAX A;  4X62 K;  4B8A B;  1V4S A;  2RN2 A;  4OPK A;  1YVN A;  4UY8 O;  4BWM A;  4E1N A;  4DR4 K;  3KLI A;  2XY5 A;  3O3F A;  4NYF A;  1B9D A;  2CH5 A;  1MU2 A;  4AHU A;  3F2K A;  4CBX A;  1JKH A;  3ATU A;  1NGA A;  3OYC A;  1YHQ N;  3ZLJ A;  4J2B A;  3O9U A;  5CHI A;  1N34 K;  3RMB A;  4BRI A;  1N5Y A;  2FBV A;  1NJZ A;  2GV9 A;  2YNG A;  4RW9 A;  4FM1 A;  1NWK A;  2OTL N;  2Z1I A;  3QO9 A;  4FL9 A;  4CJT A;  5HBM A;  5AQT A;  4B1W B;  4FJ9 A;  4JKG B;  3J7Y P;  3SBT A;  2O8F A;  3C94 A;  2HHX A;  4KFB A;  2HHV A;  2OZS A;  3P38 A;  2E2N A;  2IDO A;  1VQ8 N;  1WSI A;  4EZ9 A;  4ILJ A;  3T1H K;  3AVG A;  5TKW A;  3WXK A;  4X65 K;  3IMX A;  3VTH A;  1HYS A;  5FLX O;  2O8C A;  1J6Z A;  3G10 A;  2XO7 A;  4DR6 K;  2YX6 A;  1VRU A;  3ZSY A;  1SS6 A;  4DHY A;  3SYZ A;  1RFQ A;  3VQ6 A;  3ENO A;  4FOE A;  3ZET A;  1NJW A;  4OGC A;  4DU3 A;  2RHK A;  2XRI A;  3OYD A;  1C1C A;  4B9U A;  1A5W A;  2A41 A;  3VES A;  5B8H A;  3WXM B;  1TK8 A;  3NAE A;  2E1Z A;  4FZX C;  3DLE A;  4DFM A;  3C65 A;  3HBT A;  2IOC A;  3KLG A;  1QQM A;  3AO2 A;  2F4V K;  1FKP A;  5HL7 L;  1D4X A;  3LDQ A;  2AA4 A;  3ID8 A;  1WOQ A;  4IOA L;  1WAJ A;  3VQQ A;  3ZT1 A;  1XI1 A;  1NLV A;  3ATV A;  2HNY A;  2W6K A;  4JI3 K;  1XNQ K;  3WNH A;  3F9M A;  1OVQ A;  4C8N A;  3SQ2 A;  1L3T A;  3LP3 A;  1YI2 N;  3KTQ A;  3SCX A;  4M45 A;  3SV4 A;  3KKR A;  3OBW A;  5AFU A;  3ID6 A;  2QW9 A;  1G99 A;  4FJ8 A;  3LWM A;  4OO1 J;  5LJV A;  4GKK K;  2E6M A;  1LAV A;  3PX0 A;  3VOV A;  4L3Q A;  2WOM A;  4KI4 A;  3E01 A;  2VG6 A;  4FJ5 A;  4BC2 A;  4E7J A;  5DMR A;  4E1M A;  1E4F T;  3VQB A;  3TAQ A;  1FK9 A;  1GLJ O;  3ZX0 A;  3OYM A;  1O13 A;  3H6E A;  3VGM A;  4HHT A;  4Z4C A;  3DLG A;  4E0D A;  3WNG A;  4KH4 A;  1X9S A;  1RBT A;  1RT3 A;  4E7K A;  4TSX A;  4FLX A;  3QBW A;  3H46 O;  3ZT2 A;  4FLZ A;  4CJU A;  2E6L A;  3P1G A;  4BRP A;  4Z4H A;  1W2B M;  4LD0 A;  3VQC A;  1NGD A;  1NK8 A;  1BA1 A;  1C0G A;  4KAZ A;  3LAM A;  4PL8 A;  3T19 A;  4J2A A;  1QS4 A;  5ELZ A;  4CD1 A;  1HNZ K;  1NM1 A;  3MMV A;  5HRP A;  3SUO A;  4PWD A;  5BPN A;  3PLA A;  4KPY A;  2JWL A;  4AHT A;  1SKR A;  1JLQ A;  1CXU A;  3KWI A;  4CJ4 A;  4KHW A;  3VQ8 A;  1FKO A;  4FLY A;  2GWJ A;  3DXM A;  5KRS A;  1W9H A;  1RT6 A;  4E1J A;  3ZEU B;  5F1X A;  4B9M A;  4B9Q A;  5E41 A;  4AHR A;  5CR4 A;  3HO1 A;  1KVA A;  1O1W A;  4IOC L;  1HJO A;  3F73 A;  3H1Q A;  4HUF A;  1EWR A;  1NJX A;  1ASV A;  3ZYY X;  3LDN A;  4O5F A;  3UIQ A;  2V7Y A;  4QS7 A;  3T69 A;  1YIT N;  2QA4 N;  1WSH A;  3HK2 A;  1XHX A;  3TAN A;  1FJG K;  4MQ3 A;  3MN9 A;  3SK3 A;  3J80 O;  3FZL A;  3LPU A;  1NBW A;  1QQO A;  4FK2 A;  3K59 A;  2NRT A;  1WUA A;  3K5M A;  3FZF A;  3M8R A;  2ATQ A;  4DQ8 A;  1KXP A;  3LAN A;  4A61 A;  4H5W A;  1SUQ A;  1HQU A;  2QWO A;  3T7Z A;  4O8U A;  2F8S A;  2J4R A;  3QNO A;  4H8K A;  4H0O A;  3VQA A;  4BVO A;  1GOB A;  3S3O A;  4GMJ B;  1TAU A;  3HL8 A;  3L3V A;  5CYQ A;  4Y1D A;  2VCP A;  2RE2 A;  3EKS A;  5AQH A;  1EP4 A;  4IG3 A;  2E5L K;  1HNI A;  3NVK A;  3V1Q A;  1RT4 A;  2X6N A;  4RW4 A;  4E89 A;  2QKB A;  5BRE A;  5FRM A;  3O6W A;  3EYZ A;  1MWM A;  3RRG A;  1TUU A;  4WFN L;  3UKU B;  3FLC O;  2GWK A;  3GE1 A;  4BRA A;  3QFP A;  1RTJ A;  3SBG A;  3OYL A;  4FCY A;  4YOU A;  3J8A A;  3J81 O;  3O4Q A;  4FSV A;  4CIE A;  3AA3 A;  2VGM A;  3JYT A;  4XEI A;  4K42 A;  4YDU A;  2NLX A;  4AM7 A;  3SAF A;  3LZJ A;  1XMQ K;  2KW4 A;  1Y64 A;  4Z4F A;  3AO4 A;  3MEG A;  1BU6 O;  5I3U A;  2OZM A;  3RR8 A;  3N4Q A;  5M1F A;  3MWP A;  3ZT4 A;  3PX6 A;  3VQD A;  4IWV A;  4PUO A;  3M3Z A;  3WQU A;  4RW6 A;  3T3F A;  3CCE N;  1VSM A;  4DTJ A;  2IAJ A;  2IVN A;  3IG1 A;  3THX A;  3SQ4 A;  1NGF A;  3S41 A;  4O8K A;  4HCB A;  3EY1 A;  4I7F A;  5FRO A;  3PIO L;  4DR3 K;  5AQI A;  1RIL A;  4DSI A;  4B3M K;  4HUE A;  2KLA A;  3CG7 A;  1K8K A;  4DG1 A;  2V52 B;  4PL7 A;  3VQ4 A;  2B5J A;  1Z26 A;  3OYI A;  4NCB A;  3SNN A;  4FM2 A;  2DFE A;  3ALY A;  1WSJ A;  1U2V A;  3CJ9 A;  1MDU B;  2UXC K;  3DOK A;  3CQY A;  4CK1 A;  3SAG A;  2WTU A;  3FFI A;  1K73 O;  2X6S A;  2O8D B;  1W97 L;  4WF9 L;  1Q82 O;  4ELU A;  4QS8 A;  2XY6 A;  3V6D A;  3O4N A;  1V4T A;  3CIP A;  3O4W A;  4AHV A;  1LAW A;  2DFF A;  4IKF A;  3CFO A;  4AF1 A;  2FSK A;  5GAD P;  2VWK A;  2CGJ A;  3MDQ A;  1NU0 A;  4CEE A;  5KTQ A;  1BCM A;  5F0X A;  3ITH A;  2OCE A;  3CI5 A;  2OPS A;  4Z4I A;  4IZ9 A;  5J2M A;  4B9L A;  4RW8 A;  3KJV A;  1HJR A;  3EKU A;  3KK3 A;  3TAB A;  2YJE A;  4M7Y A;  4JNE A;  1HQE A;  4E7L A;  5KPT A;  2UYT A;  3PY8 A;  3AGR A;  5CY4 A;  4B9T A;  4IOX A;  3N4P A;  1KVC A;  5EVZ A;  5AQU A;  4H4O A;  4KHU A;  1BG3 A;  1GLD G;  4CZL A;  4OJR A;  1RTI A;  1HX1 A;  2YNI A;  4NLB A;  1RDA A;  4Y0W A;  3G0Z A;  3V81 A;  3R9P A;  4CD3 A;  3D2E A;  3V9Z A;  1OKJ A;  1OH5 A;  3MN6 A;  1TK5 A;  2E8A A;  2VWB A;  4O55 A;  5LY3 A;  4W5O A;  1BA0 A;  3THV A;  4BR7 A;  4CBW A;  4FPA A;  1LOT B;  4JS4 A;  1CLQ A;  5FPE A;  4U7B A;  3L6Q A;  3OJU A;  4DS4 A;  1VQL N;  3QEI A;  4CJ7 A;  3ULE A;  4F8R A;  1L5U A;  3WXI A;  3ZSW A;  4O5B A;  3RMD A;  1NK5 A;  1YJN N;  2VG7 A;  3QET A;  4F4K A;  3AVH A;  3HP9 A;  1Q7Y O;  1RBR A;  4IJN A;  2G8U A;  3CCU N;  4CGG A;  2PY5 A;  4GNI A;  4DTS A;  5KI6 A;  4CZK A;  1QSL A;  4KH6 A;  1UOC A;  1N32 K;  4HWI A;  2XY7 A;  4FWR A;  3V4I A;  2O4I A;  1TUY A;  1SL2 A;  1X9M A;  5AQR A;  2P9K B;  3FZK A;  3SJJ A;  3A2F A;  4KO0 A;  1ZBU A;  3ZSZ A;  3RSE A;  4EAH D;  3MXI A;  2NRX A;  1P90 A;  4LF4 K;  4ILH A;  3ZSV A;  4OLB A;  5SWM A;  4IFY A;  5EOY A;  1VAZ A;  3UE5 A;  2F96 A;  3ZT0 A;  3C7N B;  3K5O A;  2HBK A;  4BRC A;  3VGK A;  4KB0 A;  1NKC A;  4NCA A;  5C24 A;  3PUF A;  2YV0 X;  4DSE A;  3NGI A;  4DV4 K;  3O80 A;  1WNS A;  5HOO A;  3NH0 A;  4BRF A;  4OPJ A;  4BRG A;  4FJX A;  5FPM A;  3OHR A;  5AQX A;  3W3D A;  1NGE A;  5JS1 A;  1CXQ A;  3L4I A;  1ZBL A;  4HVJ A;  3OS0 A;  3THY A;  4QAG A;  4FJN A;  2QXF A;  4YDU C;  5HP1 A;  1XUP O;  4JEP A;  3KD1 E;  3VGL A;  1T44 A;  4GV6 A;  3EL2 A;  3R6M A;  5AQV A;  1BUP A;  3D2F A;  3QEV A;  3OYA A;  1IKW A;  3UB5 A;  5D3G A;  3CFP A;  4CJ3 A;  2W41 A;  2KZZ A;  3DOL A;  2QM1 A;  3Q7C A;  5F2R A;  3QEP A;  3DLL L;  5JVH L;  4CFA A;  5AZJ A;  4H5T A;  5GAE P;  2NZT A;  3QIO A;  4K8X A;  4CHN A;  3QBX A;  4B3R K;  1BI4 A;  4Q0B A;  2PFU A;  5MLC Q;  2IGI A;  3A8Y A;  4ICL A;  4M3W A;  4IJA A;  3IFR A;  2A3Z A;  3HRG A;  4OKK A;  3ASM A;  5HRO A;  1J53 A;  4JRQ A;  2Q0R A;  4BGA A;  3LWL A;  4BG9 A;  3SUN A;  1RDU A;  3O1W A;  5ADX A;  1T6C A;  2I7N A;  3TTF A;  2KQ2 A;  1ATS A;  2RKI A;  2AP1 A;  4AH9 A;  1JCG A;  1YAG A;  4JKC A;  4CE9 A;  4B8C A;  4NXN K;  3CJ1 A;  4G9Z A;  1BWF O;  4N47 A;  1ZBH A;  3HPH A;  1L3S A;  4OVL A;  4CJW A;  4DWI A;  4JS5 A;  1JLB A;  1RBU A;  2NRZ A;  4LF6 K;  1C0T A;  2DPN A;  2G8W A;  3LPT A;  3P5J A;  3DLB A;  2IC3 A;  3AVJ A;  1QQC A;  4IXC A;  4ISF A;  4JKF A;  3V9X A;  3B8A X;  1GLC G;  4BC5 A;  3VEX A;  2HHU A;  1D8Y A;  2FF3 B;  3JAM O;  1ASU A;  1D9D A;  2P9S B;  3VEV A;  3QML A;  3U4L A;  4QCL A;  4DUZ K;  1N8R O;  3PO4 A;  4DFP A;  4ZTJ A;  3DYA A;  3WXL A;  4FWO A;  3BUZ B;  2HB5 A;  4JHD B;  5BPL A;  4FLV A;  1BQN A;  1L3U A;  4DTM A;  1KFS A;  3CME N;  1VQ5 N;  2BDP A;  4CFC A;  3LP1 A;  4DLE A;  1VSE A;  3CMA N;  1BO5 O;  5EU7 A;  5I42 A;  5C2D A;  5KQ8 A;  2WUS A;  5HRR A;  4DV5 K;  1SKW A;  1NGB A;  4PQU A;  3IKM A;  4MFB A;  1JLE A;  4LH4 A;  3VQ9 A;  3G71 N;  3AO3 A;  3NGY A;  3H08 A;  5BN8 A;  3MEC A;  4FJ7 A;  5AFU H;  2QWR A;  5CE3 A;  1KQS M;  1ASW A;  1KSP A;  3V1O A;  4J2D A;  5K14 A;  3GDQ A;  4BR0 A;  1IBM K;  1I39 A;  3SMS A;  4CFD A;  3L2Q A;  4M3R A;  5JLF A;  4DV1 K;  2O8F B;  4DS5 A;  4YNQ A;  1ITG A;  1HKG A;  3C6T A;  3AV9 A;  1Z6R A;  4JI5 K;  2KFZ A;  1GOA A;  1W7A A;  1EET A;  4YY3 K;  2F9W A;  4JKA A;  4M3Y A;  4N56 A;  1X3M A;  2IVP A;  1JLG A;  2HBM A;  3TAM A;  4CEZ A;  1C1A A;  1Q81 O;  4DR1 K;  3R3L A;  5KPZ A;  1IH7 A;  4B9N A;  1GOC A;  1VQK N;  2O8C B;  1YF5 L;  2W6L A;  4Y1C A;  2ZD1 A;  3HPO A;  1RDC A;  2YJF A;  1NK0 A;  4FWK A;  3HI0 A;  3H3O B;  2R7Y A;  3NH1 A;  1QZ6 A;  2IIR A;  3CM5 A;  1LWC A;  4DKW A;  2B4J A;  3ZET B;  2FLO A;  4OPA A;  3S3N A;  2FSN A;  4O4G A;  3I33 A;  1SV5 A;  4BAC A;  4KKO A;  2HHS A;  3SAH A;  3GG4 A;  3BZC A;  1YTU A;  1C0U A;  1B9F A;  2X78 A;  4KI6 A;  2O8B A;  2OPQ A;  3NFA A;  4DV7 K;  5JMV A;  1HMV A;  1X9W A;  3AAR A;  3KLH A;  3O9T A;  4CZI A;  1DLO A;  2HBJ A;  1A5X A;  3C6H A;  4OGE A;  3ULD A;  2P9I A;  4CGI A;  4EP4 A;  3V9W A;  2P9U A;  1FXX A;  1GLL O;  4NLC A;  1HPZ A;  4RTF D;  4LC9 B;  3B6P A;  1K8A O;  1SL0 A;  3UKR A;  2YHB A;  2OA8 A;  4K41 A;  2P9P A;  1L3V A;  4CGF A;  4WQ5 A;  4CJE A;  3MK6 A;  2BE2 A;  2D0C A;  3P4I A;  3GBT A;  2NRV A;  1YVU A;  3SI6 A;  1NGG A;  4H0X B;  4BE1 A;  3OW2 M;  3NE6 A;  1QQN A;  2LSN A;  1VSD A;  5JIC A;  1W0H A;  3AA4 A;  2FBT A;  5JLH A;  3D6R A;  3S3M A;  4J2E A;  3V1R A;  2HND A;  1SQK A;  3NF8 A;  1HNW K;  4M3T A;  1CZA N;  3DRS A;  3VQE A;  3FZH A;  4Z94 A;  2YHW A;  1ZXO A;  3SJH A;  2CGL A;  2KKZ A;  4C8M A;  4M3Z A;  2E2O A;  2FF6 A;  1S9E A;  4DB3 A;  5IT9 O;  1X3N A;  3O8M A;  3B6O A;  4DR5 K;  3DM2 A;  4FLW A;  2ASO A;  4KTW A;  3V9S A;  4B1X B;  4E19 A;  4M7X A;  4DQQ A;  1NGI A;  5J2N A;  1ESV A;  3TPQ A;  2VQF K;  3VF4 A;  2HF4 A;  4Z4G A;  1RT1 A;  4F2S A;  2WON A;  3I0R A;  5GAG P;  2RF2 A;  3DLH A;  4CVN E;  2P5G A;  5T7B A;  1FW6 A;  4W5R A;  4CEO A;  1NMN A;  2GBZ A;  4GVE A;  1X9J A;  2Q0U A;  4JKH A;  4C8O A;  1ZBI A;  3FE1 A;  3DXM B;  3HP6 A;  3TSU A;  3JS6 A;  1N6Q A;  4CHQ A;  3AO1 A;  4A5A A;  5HRS A;  1T8E A;  1A5V A;  4FJH A;  3FGU A;  4BRD A;  1LW0 A;  5BPM A;  3LZI A;  1EO1 A;  1SKS A;  4LFA K;  4I2P A;  3CF5 L;  4CBU A;  3FFK B;  2HHH K;  4A2A A;  4L8R B;  2KZM A;  1VSJ A;  4BE2 A;  1R59 O;  2H3G X;  1H1V A;  5BR8 K;  3L8B A;  1IKY A;  2HOE A;  1HNV A;  1LW2 A;  3ZX3 A;  3VQP A;  5LL6 Z;  4DU4 A;  4DR2 K;  1IKX A;  1Q18 A;  4K0K K;  3ZT3 A;  4W5T A;  3H1V X;  4M41 A;  1T03 A;  2GEL A;  4OPH A;  4MLE A;  1TKZ A;  4FWL A;  3C95 A;  1DEJ A;  4ISG A;  4FZY A;  3CCQ N;  4KBO A;  3SZ2 A;  3CQ8 A;  4BR4 A;  5AQM A;  1QSY A;  2O8E A;  4KHS A;  4CFB A;  4DQI A;  3S9H A;  1NG9 A;  1EX4 A;  3DI6 A;  3K5N A;  4YOT A;  3OTO K;  3OYE A;  2Y1I A;  1S1T A;  5AZI A;  2UUC K;  5EY4 A;  2UXD K;  4MDB A;  3V9U A;  2PZS A;  2QWP A;  4GVM A;  4KB1 A;  3AVK A;  3A5N C;  3CM6 A;  2YCH A;  4KHQ A;  4DSL A;  1RBS A;  2NUB A;  3OA9 A;  1KFD A;  1JL1 A;  1P8Z A;  4I2Q A;  1VHX A;  4V19 S;  4CF9 A;  1IV0 A;  4CJV A;  2VG5 A;  2YKM A;  3NF7 A;  3TR8 A;  1WBD A;  3VEN A;  1S22 A;  2KFN A;  4DU1 A;  3F9K A;  4DV3 K;  1S1V A;  4ISE A;  4CEB A;  1DT9 A;  4KTQ A;  3DAW A;  1QTM A;  1KLN A;  1Z05 A;  4XH1 A;  1BL3 A;  4RG8 A;  3MXJ A;  4AHS A;  4BRN A;  3QLH A;  3HXM A;  3T1A A;  3NHG A;  4YOR A;  2HMP A;  3BF1 A;  4YOY A;  4FWS A;  4FXD A;  1DTQ A;  2KHO A;  3NMU A;  1U48 A;  3RR7 A;  3THX B;  3I8D A;  1KD1 O;  1IG8 A;  4DFK A;  1NMD A;  3WUH A;  3AVB A;  2PYJ A;  1N36 K;  4PKH A;  3EZ5 A;  4CIG A;  4OLA A;  3AA5 X;  4LH5 A;  5M1K A;  5TKY A;  3K5L A;  4BVP A;  2D0P A;  3TSP A;  1K8K B;  3M1F A;  1R0A A;  3KHY A;  4FJI A;  1U6Z A;  4YFU A;  3SPZ A;  2NRW A;  3MN5 A;  4CHO A;  3VQ5 A;  1BIU A;  3RTV A;  4EFH A;  1J5E K;  3TAE A;  4B9S A;  1U2V B;  5AQL A;  5GAH P;  3E66 A;  4WQ5 C;  1VSI A;  5AQG A;  3VEZ A;  1D5A A;  5BR9 A;  1HRH A;  3OY9 A;  2DTU A;  2HHQ A;  1J5O A;  4JKD A;  3CCM N;  3MAQ A;  1QVF M;  3TI0 A;  3CCR N;  5E84 A;  1Q9X A;  3C6U A;  1M90 O;  3HVR A;  2GUP A;  2D0A A;  3HOS A;  3AAQ A;  2P51 A;  3M5R A;  1GLE G;  1EQY A;  5J2Q A;  5C0Y A;  2OPP A;  2VYP A;  2YNF A;  3M6G A;  2E2Q A;  4YHH K;  2YHY A;  3OYH A;  1LV5 A;  2P9N A;  2QWQ A;  3ZSO A;  3GOI A;  3JXU A;  1WLJ A;  3VQ7 A;  3KLF A;  4CGJ A;  3K9K A;  3RRH A;  4LF5 K;  3K58 A;  3LAL A;  2GEM A;  2I5J A;  4B08 A;  4N5S A;  4BWJ A;  2BAN A;  2FBX A;  3EE8 A;  3NCI A;  4DF8 A;  1I94 K;  5H1S Q;  1TV6 A;  3K0S A;  4MDA A;  3QEX A;  5J1E A;  5LJW A;  4F3T A;  3THW A;  1IBL K;  2F9T A;  4BGB A;  3VMF B;  4BDY A;  3D2E B;  4GV3 A;  2Z1H A;  4DV2 K;  4B3T K;  4DLG A;  2A1R A;  5C42 A;  1WN7 A;  1NKB A;  3MED A;  4WYB A;  3F5T A;  4WQ4 A;  3U3Y A;  4DR7 K;  1IJJ A;  1NK4 A;  1XMO K;  5FDL A;  1NGH A;  1EXQ A;  4JI6 K;  1XHZ A;  4IFV A;  4GKJ K;  1S9G A;  3WEE A;  1OH7 A;  1JLA A;  3ULE B;  1VK0 A;  4GY2 B;  3HOT A;  5GIO A;  3LL3 A;  3NGZ A;  3CJ7 A;  2ITM A;  1BIZ A;  3IAY A;  1KRP A;  1C6V A;  4FJG A;  3BY5 A;  1RBV A;  4DTR A;  1JCF A;  4OKE A;  3DXK A;  4CZF A;  3NVM A;  5AQJ A;  2ITG A;  4J8F A;  3NF6 A;  2V7Z A;  3RSE B;  3L2V A;  3O1B A;  4OKJ A;  2CGK A;  4DV6 K;  3QES A;  1YJ9 N;  2E4L A;  3NH2 A;  1QHA A;  4JKE A;  2QXL A;  3P83 D;  5ADX H;  4PHT X;  2G8K A;  3KK2 A;  2IS3 A;  4H0Y B;  3IDH A;  3T1Y K;  3QIN A;  3LM9 A;  2ZJR L;  3HSC A;  5M1N A;  3U8X A;  1M1K O;  3L0Q A;  1DTT A;  4FPB A;  4DFJ A;  1TKX A;  3M8P A;  1MA9 B;  4IO9 L;  4JK7 A;  3AVN A;  3KK1 A;  5DM6 L;  4YOV A;  4I6M A;  3OS1 A;  4LF7 K;  1VSF A;  5AQN A;  3U3G A;  3HST B;  5KGX A;  1VQ7 N;  3O08 A;  3O5B A;  4FOI A;  5DM7 L;  3THY B;  1KAY A;  2EWS A;  2ASM A;  3A5O C;  4I9L A;  3AO5 A;  3AY9 A;  4A62 A;  4RWT A;  2E88 A;  4CF1 A;  3ZSQ A;  1NJI O;  2HST A;  4JV5 K;  4ZHR A;  3OYB A;  1NJY A;  3M8S A;  1TYQ A;  2XY8 A;  3D2F B;  2AJQ A;  2HHW A;  3VA0 A;  1ILY A;  3DJC A;  2P9L B;  2ZF5 O;  1RDB A;  4FJK A;  4X64 K;  1GLA G;  3SMP A;  4FM0 A;  1WSF A;  3QIC A;  3SUQ A;  1DKG D;  4JD2 A;  1XC9 A;  2ZQB A;  3BDP A;  4IEI A;  5AZJ B;  3HT3 A;  2BH1 A;  4B9V A;  5EXW A;  1J54 A;  1QE1 A;  1BI4 B;  1YTA A;  1TK0 A;  1HLU A;  1NNE A;  4CJK A;  1RCH A;  3VA3 A;  1JL2 A;  5J2P A;  3PX4 A;  1BGX T;  3KD5 E;  3O9Q A;  2HMI A;  1GLB G;  1RGI A;  2CH6 A;  3HM9 A;  1VQN N;  3WQT A;  1B92 A;  5AQP A;  1YJW N;  3DWL A;  4BQZ A;  2QWN A;  4AM6 A;  4Q5V A;  4N76 A;  2UXB K;  4FWN A;  2JGU A;  3D7E O;  1VRT A;  1TGO A;  1U04 A;  1NKE A;  5FPD A;  4BRM A;  3DLK A;  4ELV A;  3TAR A;  1JXB A;  4BRO A;  4H03 B;  4KHN A;  3OYN A;  3TWH A;  4JKG A;  3CPW M;  3WNF A;  3HM8 A;  3AAP A;  4AHC A;  2EHG A;  4KV8 A;  3NDK A;  3NF9 A;  4CES A;  1NK7 A;  3KIO A;  4CK2 A;  4JKB A;  1JJ2 M;  3LDO A;  3J7Z O;  3CQX A;  3E9P A;  4DTU A;  5KPR A;  4JK8 A;  4JI1 K;  4FK0 A;  1VQ6 N;  2HVH A;  4R5P A;  1NOY A;  1K6Y A;  2W40 A;  1MWK A;  5JS2 A;  3QFU A;  3O3H A;  1HNX K;  1QHT A;  3ENH A;  4CHY A;  1RT5 A;  3O9S A;  4DQR A;  2YI1 A;  4JRP A;  4BRL A;  1LCU A;  2ZJP L;  4X66 K;  4H0T B;  4M3X A;  2JWK A;  4KH5 A;  4CJF A;  4DQP A;  4WFA L;  4IG0 A;  4WQ4 C;  4CJL A;  2YNH A;  1G15 A;  4EIA A;  2DFH A;  2D5R A;  3A5M C;  3CPE A;  2FSJ A;  3BGR A;  1KCF A;  3AGK A;  1CZ9 A;  2G8V A;  3LM2 A;  4ILG B;  4BC4 A;  4CF0 A;  2A42 A;  3LP2 A;  5CZ1 A;  1TAQ A;  1QSS A;  3VN5 A;  3HVT A;  3P39 A;  3CER A;  1WBB A;  4HCC A;  4BG8 A;  3WNE A;  4FLU A;  3U9D A;  4LF9 K;  4EHU A;  1ZBS A;  3H45 C;  4CF2 A;  2BUP A;  2YHA A;  1RT7 A;  5EX5 A;  1U45 A;  1TKT A;  2UUA K;  3LAK A;  2G8F A;  5I9E B;  2FXU A;  1UWB A;  4H0V B;  4C1N K;  1IKV A;  5CYM A;  1ATR A;  2E1Y A;  4KRF A;  4FJM A;  1NGC A;  3O3G A;  4DTO A;  1RTD A;  3QIP A;  1VQ9 N;  4M63 C;  1ZYQ A;  4EHT A;  4EZ6 A;  1UA0 A;  3AVM A;  3FZM A;  3ZSR A;  3PIP L;  4DSK A;  1HPM A;  1IO2 A;  5M1O A;  1RT2 A;  1HKB A;  3AVI A;  4JN4 A;  3OS2 A;  3HTV A;  3SLC A;  3CXC M;  1S1W A;  2O8B B;  3L2R A;  2HF3 A;  2I7P A;  3P31 A;  3CCL N;  4CZG A;  1KTQ A;  2P5O A;  2Z1G A;  2Q3S A;  2HVI A;  4CF8 A;  4WE1 A;  2P9I B;  4DUY K;  3OYJ A;  2P9U B;  3EN9 A;  1U49 A;  3KKS A;  2NRR A;  4AQY K;  3QEW A;  1YIJ N;  1S72 N;  1KLM A;  2PAV A;  4UQG A;  3AVL A;  4XH5 A;  2Q31 A;  4MO4 A;  1LWF A;  1YXQ A;  3AA2 A;  3UKR B;  1Q9Y A;  1XQS C;  3LDL A;  3AVC A;  3I0S A;  1TL1 A;  3CET A;  2P9P B;  3ZEU A;  4BR2 A;  5HLF A;  4BRQ A;  4O44 A;  4ELT A;  1Q8I A;  1WSE A;  3VET A;  3DRR A;  1RDW X;  3H3N O;  4KHP K;  2Q97 A;  3WXJ A;  3TU5 A;  4CEC A;  1D9F A;  2JLE A;  4O0I A;  4CEA A;  5KGW A;  4KTZ A;  4DSF A;  1F21 A;  5HRN A;  1OVY A;  4WCE L;  3OVN A;  5AQQ A;  4U67 L;  3ZCM A;  3EEQ A;  2OYQ A;  4KHY A;  3SV3 A;  4ZTF A;  4YOW A;  1N33 K;  2G8H A;  3L2W A;  4DCH A;  3BEX A;  1C0F A;  4Z0U A;  5M1Q A;  2VWJ A;  1ZC6 A;  1C1B A;  4PA1 A;  1QZ5 A;  2Y1J A;  1UAX A;  1YUW A;  4CEF A;  2ASP A;  1T7P A;  4HUG A;  3U6F A;  2NNW A;  5AQS A;  3K2P A;  4DTX A;  1UA1 A;  3CJB A;  1NK9 A;  3R1X A;  4B1V A;  4CHP A;  4NO7 A;  4LF8 K;  3CD6 N;  1T3V A;  1X1P A;  2B6A A;  4FVM A;  4FZZ A;  1WSG A;  3I56 N;  1NOZ A;  4R79 A;  3RMC A;  1HYV A;  4B3O A;  1WB9 A;  4NYN A;  1S1X A;  3L2U A;  3G6E N;  3UKU A;  3IUC A;  4EP5 A;  1T05 A;  2D4W A;  4K8Z A;  2D0O A;  3E9L A;  4H0P A;  3VEO A;  5FPN A;  2QEX N;  4NCG A;  3QDK A;  4CIF A;  2D0B A;  2UU9 K;  4LFB K;  3EZW A;  4CW7 B;  5A2Q O;  1U47 A;  1SL1 A;  4DTN A;  2OAN A;  2V51 B;  4A57 A;  1BDG A;  4DMN A;  4YOX A;  2QK9 A;  1JLC A;  1NK6 A;  3J7A P;  3M8Q A;  4A59 A;  3K9J A;  3MCA B;  5BRF A;  4FJL A;  4FYD A;  1YT3 A;  2FBY A;  2ZGZ A;  5C25 A;  3PV8 A;  1HUX A;  4QS9 A;  4HTL A;  2O8E B;  4BY9 C;  2QWM A;  5DK5 A;  4LY7 A;  5AQK A;  3TAF A;  3RVC A;  3L4Q A;  4RCH A;  3KVG A;  5AQF A;  1BIS A;  2A6A A;  4H4M A;  2E20 A;  1HYZ A;  3CC4 N;  1KAZ A;  3CCV N;  3O9R A;  3VPZ A;  1XWL A;  4ID5 A;  2ZWH A;  5AZI B;  4H5V A;  2QKK A;  4FWM A;  2IVO A;  4CJS A;  4FWQ A;  3VTI A;  4M3U A;  2BGG A;  3QB0 A;  2O8D A;  1Y97 A;  1U4B A;  4FW2 A;  1S6P A;  4CJP A;  4BDZ A;  4IDH A;  3FR0 A;  1Q86 O;  3A5L C;  4E7H A;  2P1J A;  5CZ2 A;  3EE9 A;  4BDP A;  4PY5 A;  5GIP A;  3IRX A;  4FVU A;  2HW3 A;  1KC8 O;  1VSH A;  2VQE K;  2PBD A;  5AQZ A;  1RDD A;  3CYM A;  5M1P A;  4CZH A;  4E3S A;  3QNN A;  5BRH A;  4GV9 A;  4JI7 K;  2A40 A;  1E4G T;  4IDK A;  4CZM A;  3SUP A;  3W0L A;  4DTP A;  4C1N I;  3MX5 A;  4CGH A;  2GX9 A;  3CJC A;  4C23 A;  3HJF A;  5AQY A;  3HZ6 A;  4RW7 A;  4F9O A;  3MWT A;  1OH8 A;  4F3O A;  1DGK N;  1VQM N;  1OH6 A;  1WAF A;  5KRT A;  4CJ5 A;  3OYG A;  2ETJ A;  1JXE A;  3VER A;  3LDS A;  4PKG A;  4LFC K;  5BN9 A;  4NXM K;  3LP0 A;  2YKN A;  4CCH A;  3G4S N;  1S1U A;  1TL3 A;  2KTQ A;  4HTU A;  4IBN A;  1ATN A;  5C10 A;  1RTH A;  1C0M A;  4CER A;  3LDP A;  4H5N A;  3L3U A;  5AQO A;  2UUB K;  2Q36 A;  5E26 A;  3I55 N;  1BHL A;  3CJA A;  3HPG A;  4CHZ A;  4B3S K;  3TAP A;  2EX3 A;  5BRD A;  3AVF A;  1I3A A;  4JAX A;  2ZGY A;  3AVA A;  1TKD A;  1VQ4 N;  2F8T A;  4CED A;  5AQW A;  2P9N B;  3SPY A;  2FC0 A;  2WBN A;  4C8L A;  1TVR A;  4W5Q A;  1SAZ A;  5IWA K;  4JK9 A;  4IFE A;  2P9K A;  3ZSX A;  3D0P A;  2OPR A;  2ZM6 K;  3DRP A;  4JI8 K;  3PSI A;  2X74 A;  1LWE A;  2O4G A;  2QWL A;  1JLF A;  3TSQ A;  3EO3 A;  4B1Z A;  4BC3 A;  4N41 A;  2BTF A;  3CFR A;  3Q7B A;  4K43 A;  1BCO A;  3THW B;  1KVB A;  4FWP A;  1EWQ A;  4W5N A;  2NRH A;  3C7N A;  2PYL A;  3U9Z A;  3KZB A;  4DV0 K;  3C0B A;  4B1U B;  4GW6 A;  2G8I A;  1Z25 A;  3D45 A;  4E7I A;  2ZE2 A;  5AR0 A;  3VF6 A;  4O0J A;  5C15 A;  3CCS N;  3WT0 A;  4DQS A;  3JSM A;  4MO5 A;  3RWU A;  3OBY A;  3G25 A;  4JLH A;  4XH4 A;  3CCJ N;  3WEE B;  2Q2R A;  4BRK A;  3KLE A;  1NGJ A;  3OYF A;  3QER A;  3I8B A;  3ZX2 A;  4M42 A;  4LSL A;  3MEE A;  1K9M O;  2XHB A;  3OJS A;  3CC2 N;  1EKE A;  3DMJ A;  3CC7 N;  3SQ1 A;  4LSN A;  3MN7 A;  4JYA K;  1VSK A;  1ZBF A;  4FLT A;  2QI2 A;  1SZ2 A;  4I9Q A;  3DXK B;  4FK4 A;  1XC3 A;  4FW1 A;  5LMN K;  4JI4 K;  1HKC A;  1CZB A; 
#chains in the Genus database with same CATH homology
 5SZT A;  5J2N A;  4CJF A;  2RPI A;  4Z4G A;  1RT1 A;  1LAW A;  4AHV A;  2DFF A;  4DQP A;  4F2S A;  2A1S A;  4IKF A;  2WON A;  3CFO A;  4IG0 A;  4CJL A;  3I0R A;  2YNH A;  4C8K A;  3NBP A;  1G15 A;  2RF2 A;  3DLH A;  2VWK A;  4AIL C;  4CEE A;  2DFH A;  5KTQ A;  2P5G A;  5T7B A;  2D5R A;  1BCM A;  4W5R A;  4CEO A;  3ITH A;  2GBZ A;  3BGR A;  1KCF A;  4C8O A;  1ZBI A;  1CZ9 A;  2G8V A;  2OPS A;  3HP6 A;  1S6Q A;  1N6Q A;  4CHQ A;  3AO1 A;  4Z4I A;  5HRS A;  1T8E A;  4CF0 A;  5J2M A;  4B9L A;  4RW8 A;  1A5V A;  4FJH A;  3LP2 A;  5CZ1 A;  3KJV A;  1HJR A;  1TAQ A;  4CJQ A;  3KK3 A;  1LW0 A;  3TAB A;  3LZI A;  2W42 A;  4BE0 A;  1QSS A;  1HQE A;  3VN5 A;  4E7L A;  3HVT A;  1BQM A;  4I2P A;  1SKS A;  4HCC A;  3PY8 A;  3WNE A;  4FLU A;  5CY4 A;  4L8R B;  2KZM A;  1VSJ A;  4B9T A;  4CK3 A;  4BE2 A;  2KFN A;  3DLR A;  3L8B A;  1KVC A;  4CF2 A;  4Z4E A;  1IKY A;  2YHA A;  1HNV A;  1LW2 A;  1RT7 A;  3IS9 A;  1U45 A;  4H4O A;  4KHU A;  1TKT A;  1VSL A;  3ISN C;  3VQP A;  1IG9 A;  4OJR A;  1RTI A;  4DU4 A;  2YNI A;  1RDA A;  1IKX A;  3LAK A;  3MXM A;  3G0Z A;  3ZT3 A;  3V81 A;  4W5T A;  2G8F A;  4M41 A;  1T03 A;  3V9Z A;  3PO5 A;  4XIU A;  4DF4 A;  1UWB A;  1TKZ A;  3C95 A;  1TK5 A;  1IKV A;  3K57 A;  5CYM A;  4O55 A;  4FZY A;  4W5O A;  4KRF A;  4FJM A;  4QOZ B;  3SZ2 A;  4DSJ A;  3O3G A;  1S5J A;  3CQ8 A;  4DTO A;  1RTD A;  3QIP A;  3THV A;  1ZYQ A;  1RNH A;  1QSY A;  4KHS A;  4JS4 A;  1REV A;  4EZ6 A;  1CLQ A;  1UA0 A;  4CFB A;  1J9A A;  3AVM A;  4ID1 A;  4DQI A;  5FRN A;  3OJU A;  3ZSR A;  4DS4 A;  3S9H A;  4CJR A;  3QEI A;  1EX4 A;  4DSK A;  3DI6 A;  4CGD A;  3K5N A;  2GUI A;  1IO2 A;  1RT2 A;  3OYK A;  4KRE A;  4F8R A;  3OYE A;  1L5U A;  4FJJ A;  2Y1I A;  3AVI A;  3ZSW A;  4O5B A;  2HHT A;  3RMD A;  2DY4 A;  1S1T A;  1NK5 A;  4G1Q A;  3OS2 A;  3SQ0 A;  2Z1J A;  3HYF A;  2VG7 A;  3QET A;  4F4K A;  3AVH A;  3V9U A;  3HP9 A;  2HNZ A;  1RBR A;  2G8U A;  2PZS A;  4GVM A;  1S1W A;  3AVK A;  4KB1 A;  3CM6 A;  3L2R A;  4CGG A;  2PY5 A;  4DTS A;  5KI6 A;  3TAG A;  4KHQ A;  4F2R A;  4DSL A;  1QSL A;  4CEQ A;  1RBS A;  1KTQ A;  2NUB A;  2P5O A;  1UOC A;  2Z1G A;  1KFD A;  3RMA A;  1JL1 A;  4I2Q A;  2Q3S A;  2XY7 A;  4CF9 A;  2HVI A;  4CF8 A;  4B8A B;  2VG5 A;  2YKM A;  4CJV A;  4WE1 A;  3V4I A;  2O4I A;  2RN2 A;  3NF7 A;  4OPK A;  1X9M A;  3TR8 A;  3OYJ A;  1SL2 A;  4BWM A;  4E1N A;  3SJJ A;  1U49 A;  3A2F A;  4KO0 A;  1ZBU A;  3KKS A;  3ZSZ A;  3KLI A;  3QEW A;  1KLM A;  2XY5 A;  4UQG A;  3AVL A;  3O3F A;  4NYF A;  1B9D A;  1LWF A;  1MU2 A;  3AA2 A;  3F9K A;  4AHU A;  4DU1 A;  1JKH A;  3MXI A;  1Q9Y A;  3OYC A;  1S1V A;  3AVC A;  3I0S A;  3ZSV A;  4CEB A;  4J2B A;  4OLB A;  1TL1 A;  4IFY A;  5SWM A;  4KTQ A;  1QTM A;  1KLN A;  1BL3 A;  4RG8 A;  3MXJ A;  2F96 A;  4AHS A;  5HLF A;  3QLH A;  3ZT0 A;  3RMB A;  1N5Y A;  3HXM A;  3T1A A;  3K5O A;  2FBV A;  4O44 A;  3NHG A;  1NJZ A;  4ELT A;  1Q8I A;  1WSE A;  2GV9 A;  2YNG A;  4RW9 A;  4FM1 A;  3DRR A;  2Z1I A;  3QO9 A;  4CJT A;  5HBM A;  4KB0 A;  1NKC A;  4NCA A;  1DTQ A;  4FXD A;  4FJ9 A;  1U48 A;  3RR7 A;  5C24 A;  3PUF A;  4CEC A;  1D9F A;  3I8D A;  2YV0 X;  3C94 A;  4DSE A;  2HHX A;  3NGI A;  4KFB A;  2JLE A;  4O0I A;  4CEA A;  4DFK A;  1WNS A;  5KGW A;  3AVB A;  3NH0 A;  2PYJ A;  2HHV A;  4KTZ A;  3EZ5 A;  4CIG A;  4OPJ A;  4DSF A;  2OZS A;  4OLA A;  3AA5 X;  4LH5 A;  1F21 A;  2IDO A;  5HRN A;  3K5L A;  1WSI A;  4EZ9 A;  3OVN A;  3ZCM A;  4FJX A;  1R0A A;  2OYQ A;  4KHY A;  5JS1 A;  3SV3 A;  1CXQ A;  3AVG A;  4ZTF A;  1ZBL A;  4HVJ A;  4YFU A;  4FJI A;  3SPZ A;  4CHO A;  3RTV A;  3OS0 A;  3VQ5 A;  1BIU A;  2G8H A;  4QAG A;  3L2W A;  3TAE A;  2QXF A;  4FJN A;  1HYS A;  4B9S A;  5HP1 A;  3G10 A;  2XO7 A;  4Z0U A;  1VSI A;  2VWJ A;  1VRU A;  3KD1 E;  1D5A A;  1C1B A;  4PA1 A;  3ZSY A;  1HRH A;  3OY9 A;  3SYZ A;  1UAX A;  2Y1J A;  4CEF A;  3QEV A;  3OYA A;  2DTU A;  1T7P A;  1J5O A;  2HHQ A;  4HUG A;  3VQ6 A;  3U6F A;  1NJW A;  4OGC A;  1IKW A;  4DU3 A;  3K2P A;  4DTX A;  1UA1 A;  3MAQ A;  2XRI A;  1NK9 A;  5D3G A;  3OYD A;  4CHP A;  3CFP A;  1C1C A;  4B9U A;  3TI0 A;  1A5W A;  4CJ3 A;  1Q9X A;  3C6U A;  2KZZ A;  1X1P A;  3DOL A;  1TK8 A;  3HVR A;  3NAE A;  2D0A A;  3QEP A;  4FZX C;  2B6A A;  3DLE A;  4CFA A;  2P51 A;  4DFM A;  4FVM A;  4FZZ A;  5J2Q A;  3QIO A;  4K8X A;  2IOC A;  1WSG A;  2OPP A;  1BI4 A;  4CHN A;  4Q0B A;  2IGI A;  1NOZ A;  2YNF A;  4ICL A;  3OYH A;  3KLG A;  1LV5 A;  4M3W A;  3AO2 A;  3ZSO A;  1FKP A;  3RMC A;  1HYV A;  1WLJ A;  4OKK A;  3VQ7 A;  4NYN A;  1S1X A;  3ASM A;  4CGJ A;  3KLF A;  3L2U A;  3RRH A;  3K58 A;  4B3O A;  3LAL A;  1J53 A;  4EP5 A;  5HRO A;  1T05 A;  2I5J A;  1WAJ A;  4B08 A;  3VQQ A;  3ZT1 A;  3LWL A;  4JRQ A;  1XI1 A;  4K8Z A;  4N5S A;  2HNY A;  4BWJ A;  2BAN A;  2FBX A;  3SUN A;  3WNH A;  3NCI A;  4DF8 A;  4C8N A;  4NCG A;  3SQ2 A;  1L3T A;  4CIF A;  2KQ2 A;  3LP3 A;  2D0B A;  3KTQ A;  2RKI A;  1TV6 A;  3SCX A;  4M45 A;  4AH9 A;  3SV4 A;  3KKR A;  3QEX A;  4CE9 A;  5J1E A;  4B8C A;  4F3T A;  1U47 A;  1SL1 A;  4DTN A;  4FJ8 A;  3LWM A;  4DMN A;  4N47 A;  2QK9 A;  2E6M A;  4BDY A;  1JLC A;  1LAV A;  3PX0 A;  1NK6 A;  1ZBH A;  3HPH A;  2WOM A;  2Z1H A;  1L3S A;  3M8Q A;  4OVL A;  4DLG A;  4CJW A;  4DWI A;  4KI4 A;  4JS5 A;  1JLB A;  3E01 A;  1RBU A;  2VG6 A;  2A1R A;  4FJ5 A;  5C42 A;  1WN7 A;  4FJL A;  1C0T A;  1NKB A;  4FYD A;  3MED A;  1YT3 A;  2FBY A;  4E7J A;  3U3Y A;  2G8W A;  5DMR A;  5C25 A;  3LPT A;  3P5J A;  1NK4 A;  3PV8 A;  3DLB A;  2IC3 A;  3AVJ A;  4E1M A;  5FDL A;  1QQC A;  3VQB A;  3TAQ A;  1EXQ A;  1FK9 A;  3V9X A;  1XHZ A;  5DK5 A;  4LY7 A;  4IFV A;  3OYM A;  3TAF A;  1S9G A;  4HHT A;  4Z4C A;  1JLA A;  2HHU A;  1D8Y A;  3DLG A;  4E0D A;  3WNG A;  1ASU A;  1BIS A;  4H4M A;  1D9D A;  1VK0 A;  1X9S A;  1HYZ A;  1RBT A;  1RT3 A;  4E7K A;  1XWL A;  4ID5 A;  4TSX A;  3NGZ A;  4FLX A;  4QCL A;  2QKK A;  1BIZ A;  3PO4 A;  4DFP A;  3ZT2 A;  4FLZ A;  4ZTJ A;  4CJU A;  3IAY A;  2E6L A;  4CJS A;  1KRP A;  3P1G A;  3DYA A;  1C6V A;  4M3U A;  4FJG A;  4Z4H A;  1RBV A;  4LD0 A;  4DTR A;  2HB5 A;  2BGG A;  4OKE A;  3VQC A;  1Y97 A;  1BQN A;  4FLV A;  4FW2 A;  1U4B A;  1S6P A;  4CJP A;  4BDZ A;  1NK8 A;  4E7H A;  1L3U A;  4DTM A;  2P1J A;  1KFS A;  4KAZ A;  3LAM A;  5CZ2 A;  3T19 A;  2BDP A;  4CFC A;  3LP1 A;  4BDP A;  4J2A A;  4PY5 A;  4DLE A;  1QS4 A;  1VSE A;  2ITG A;  3IRX A;  2HW3 A;  3SUO A;  5HRP A;  3NF6 A;  5EU7 A;  4PWD A;  5I42 A;  1VSH A;  3L2V A;  4OKJ A;  1SKW A;  5HRR A;  4KPY A;  1RDD A;  4AHT A;  3CYM A;  3QES A;  1JLQ A;  1CXU A;  4CJ4 A;  4E3S A;  1SKR A;  3QNN A;  4PQU A;  2E4L A;  4KHW A;  3NH2 A;  4MFB A;  3VQ8 A;  1JLE A;  1FKO A;  4LH4 A;  4FLY A;  3P83 D;  3VQ9 A;  5KRS A;  1W9H A;  2G8K A;  1RT6 A;  3AO3 A;  3H08 A;  3NGY A;  3KK2 A;  4B9M A;  2IS3 A;  5E41 A;  4AHR A;  3HO1 A;  4IDK A;  3MEC A;  4FJ7 A;  3SUP A;  4DTP A;  1ASW A;  3QIN A;  1KSP A;  4CGH A;  3V1O A;  4J2D A;  1KVA A;  1O1W A;  1DTT A;  5K14 A;  4DFJ A;  3F73 A;  1I39 A;  4CFD A;  3L2Q A;  4HUF A;  1NJX A;  1TKX A;  1ASV A;  3M8P A;  4M3R A;  4DS5 A;  3UIQ A;  4YNQ A;  3HJF A;  1ITG A;  3C6T A;  1WSH A;  4RW7 A;  3HK2 A;  3AVN A;  3AV9 A;  3KK1 A;  2KFZ A;  1GOA A;  1XHX A;  3TAN A;  4F3O A;  3OS1 A;  1WAF A;  4MQ3 A;  1EET A;  5KRT A;  4CJ5 A;  2QKB A;  3OYG A;  1VSF A;  2ETJ A;  1JXE A;  3LPU A;  3U3G A;  4N56 A;  4M3Y A;  3HST B;  5KGX A;  3LDS A;  1JLG A;  3TAM A;  4CEZ A;  1C1A A;  4FK2 A;  3LP0 A;  2YKN A;  3K59 A;  1IH7 A;  1S1U A;  1TL3 A;  1GOC A;  3K5M A;  4B9N A;  2KTQ A;  3M8R A;  2ATQ A;  4I9L A;  3LAN A;  2ZD1 A;  3AO5 A;  4Y1C A;  3HPO A;  4HTU A;  1RDC A;  4IBN A;  1NK0 A;  1SUQ A;  1HQU A;  1RTH A;  3ZSQ A;  4CF1 A;  1C0M A;  2R7Y A;  4ZHR A;  3OYB A;  1NJY A;  4CER A;  3M8S A;  3NH1 A;  2F8S A;  3L3U A;  2XY8 A;  2AJQ A;  3QNO A;  4H8K A;  3CM5 A;  1LWC A;  2HHW A;  2B4J A;  3VA0 A;  1BHL A;  3VQA A;  3HPG A;  1GOB A;  1RDB A;  4FJK A;  3S3O A;  4CHZ A;  3S3N A;  4O4G A;  1WSF A;  4FM0 A;  4GMJ B;  1TAU A;  3HL8 A;  3L3V A;  5CYQ A;  4Y1D A;  3SUQ A;  3TAP A;  1SV5 A;  4BAC A;  4KKO A;  2HHS A;  2EX3 A;  1XC9 A;  2ZQB A;  3BDP A;  3AVF A;  1C0U A;  1EP4 A;  1I3A A;  1YTU A;  4IG3 A;  1B9F A;  2X78 A;  4KI6 A;  3HT3 A;  1HNI A;  1TKD A;  4B9V A;  3V1Q A;  1RT4 A;  2X6N A;  2OPQ A;  3AVA A;  1J54 A;  1QE1 A;  4RW4 A;  4E89 A;  1BI4 B;  1YTA A;  4CED A;  1TK0 A;  2F8T A;  3NFA A;  5FRM A;  3SPY A;  1HMV A;  3EYZ A;  1X9W A;  2FC0 A;  4CJK A;  3KLH A;  4C8L A;  1TVR A;  4W5Q A;  1DLO A;  1RCH A;  3RRG A;  1A5X A;  4OGE A;  3VA3 A;  1JL2 A;  5J2P A;  3PX4 A;  1BGX T;  3ULD A;  1RTJ A;  4CGI A;  4EP4 A;  3V9W A;  2HMI A;  3OYL A;  4FCY A;  3KD5 E;  3D0P A;  1FXX A;  3ZSX A;  3HM9 A;  2OPR A;  3DRP A;  3O4Q A;  2X74 A;  1LWE A;  4CIE A;  1HPZ A;  2O4G A;  3AA3 A;  1B92 A;  1JLF A;  3B6P A;  3JYT A;  1SL0 A;  2YHB A;  2OA8 A;  4N41 A;  3LZJ A;  3CFR A;  1L3V A;  4CGF A;  2KW4 A;  1BCO A;  4CJE A;  4Z4F A;  4Q5V A;  3AO4 A;  3MEG A;  2BE2 A;  2D0C A;  5I3U A;  1KVB A;  3RR8 A;  2OZM A;  4N76 A;  4W5N A;  2JGU A;  1YVU A;  3SI6 A;  1VRT A;  3ZT4 A;  2PYL A;  1TGO A;  1U04 A;  4BE1 A;  1NKE A;  3PX6 A;  3VQD A;  3DLK A;  3NE6 A;  4ELV A;  4PUO A;  3TAR A;  1JXB A;  4GW6 A;  2G8I A;  1Z25 A;  3D45 A;  4E7I A;  2LSN A;  2ZE2 A;  4O0J A;  4KHN A;  4RW6 A;  3T3F A;  3OYN A;  3TWH A;  1VSM A;  3WNF A;  4DTJ A;  4DQS A;  2IAJ A;  4AHC A;  1VSD A;  2EHG A;  3IG1 A;  4KV8 A;  3SQ4 A;  1W0H A;  3JSM A;  3AA4 A;  2FBT A;  3NF9 A;  4CES A;  3NDK A;  1NK7 A;  3KIO A;  4CK2 A;  4HCB A;  3EY1 A;  3RWU A;  4I7F A;  5FRO A;  3S3M A;  4J2E A;  3V1R A;  4DTU A;  2HND A;  3NF8 A;  4JLH A;  1RIL A;  4DSI A;  4M3T A;  3DRS A;  3VQE A;  4FK0 A;  4HUE A;  2HVH A;  3CG7 A;  4R5P A;  3KLE A;  4DG1 A;  3OYF A;  1NOY A;  1K6Y A;  2B5J A;  1Z26 A;  3VQ4 A;  3O3H A;  5JS2 A;  4LSL A;  3OYI A;  3MEE A;  3QER A;  4M42 A;  1QHT A;  4NCB A;  3SNN A;  4C8M A;  4M3Z A;  2XHB A;  3OJS A;  4FM2 A;  1EKE A;  4CHY A;  1S9E A;  2DFE A;  1WSJ A;  3ALY A;  3DMJ A;  1RT5 A;  4DQR A;  4JRP A;  3B6O A;  3DM2 A;  3DOK A;  4LSN A;  4FLW A;  3SQ1 A;  4CK1 A;  4KTW A;  3V9S A;  3FFI A;  1VSK A;  1ZBF A;  2X6S A;  4E19 A;  4FLT A;  4M3X A;  4I9Q A;  4FK4 A;  4DQQ A;  4ELU A;  4FW1 A;  4CCH A;  2XY6 A;  3V6D A;  1CZB A;  3O4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...