4CERA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cerA00
1EETA 1RBRA 1RILA 3AVMA 4FVMA 4W5NA 2XY8A 2OPQA 1BQMA 1JL2A 3CM5A 3T1AA 4CJKA 3L2RA 4ELTA 1Z26A 3WNEA 1ASWA 3K5MA 3HK2A 3RR7A 3NGYA 4AHTA 1HNIA 1TV6A 1TAQA 1WN7A 3DRPA 2KFZA 3OYDA 3SYZA 3KK2A 1G15A 1LAWA 2ZD1A 4LSNA 4O4GA 4HUEA 3SQ2A 5HRNA 2XY5A 2HVIA 4E0DA 1ZBUA 4YFUA 2VG6A 2E6LA 3SQ1A 3SI6A 4CEEA 1B92A 2OPRA 1C0UA 1TL3A 4CEAA 5K14A 3K5NA 2BDPA 2OPPA 1RNHA 3LDSA 4KRFA 3LPUA 5I3UA 1JXBA 1VRUA 1VSDA 3VQBA 3S9HA 3CYMA 5KTQA 3ALYA 3DLKA 3V9XA 3S3OA 3O4NA 2VWJA 1LWCA 4HUFA 4CHOA 1S9EA 3NF7A 3V1QA 2I5JA 4LD0A 3L2QA 4F8RA 3OYHA 3L2UA 4KAZA 3SQ0A 4FJMA 3K58A 3LWMA 4Y1DA 1SV5A 1TKXA 1UAXA 2RN2A 3LAMA 4KB1A 3K59A 4CHYA 4BDPA 3U6FA 4FYDA 1J5OA 2OZMA 4RW7A 3V9SA 1Q8IA 1U4BA 3EYZA 4B9SA 4W5QA 4CFCA 3QEIA 2XY6A 1VSIA 4KFBA 4HCBA 4Q0BA 1SKWA 4ZTJA 2KTQA 1QSSA 4CF8A 4CJVA 4FJXA 3NAEA 5JS2A 4CESA 1RT5A 2IDOA 1U49A 4KHSA 2KW4A 4KV8A 2HW3A 4DU4A 5HBMA 4AHSA 1RBUA 3SPZA 3HVTA 1IKYA 1NK8A 4N47A 5FRMA 4ELVA 3VQ6A 3KK3A 1BI4A 4DQRA 1HRHA 4CJ3A 3IG1A 3MXJA 3ZSRA 1JLCA 1GOAA 3DLRA 4G1QA 3VQ4A 4BDZA 3NF6A 4DU1A 3OYGA 4CECA 3FFIA 2RKIA 3SUNA 3SPYA 3HT3A 1T03A 4B9UA 4CCHA 3PX6A 2DFEA 2EHGA 2ETJA 2ZE2A 4CEQA 4JS5A 3I0SA 5CYQA 1RDAA 4B9VA 1B9FA 1NJWA 1RCHA 4FJJA 4DQSA 3T3FA 4PY5A 1KCFA 3SV3A 3RRHA 3VQDA 1C6VA 3KD5E 1KFDA 3LP1A 4E89A 3TABA 2GBZA 1BHLA 3C6TA 3ZSZA 2OPSA 3QESA 2G8HA 1VSHA 1WAFA 4WE1A 1RT7A 2QXFA 4CF9A 4O55A 3LALA 3D0PA 4M3RA 1TK8A 4I2PA 3KLFA 3RMBA 3E01A 4CJSA 4OJRA 3QEWA 1J54A 4Z0UA 2HHUA 4RW9A 4FJ5A 1JLGA 2D5RA 3SZ2A 3U3YA 3OYMA 4CHNA 1HQEA 1S5JA 1KSPA 4CJPA 4DWIA 3NFAA 2RF2A 3LP0A 4O0IA 1FKPA 1MU2A 1LW0A 2KZMA 1VSKA 1HPZA 4J2EA 4FXDA 4DTSA 3AV9A 3C95A 3S3NA 1L3TA 3HPGA 3F73A 2HB5A 1NKEA 1TGOA 3QLHA 1JXEA 2ZQBA 4CJUA 3RMAA 1LAVA 3MEEA 5C24A 3AVAA 4FW1A 1RBSA 4GW6A 3ZSQA 3ISNC 1RDDA 5HRRA 4F3OA 3PUFA 1K6YA 4LSLA 3SJJA 3B6PA 1NKCA 4Z4EA 3S3MA 3L3UA 4CHQA 3NH0A 3HPHA 4NCAA 3IS9A 1RT2A 4OGCA 2Q3SA 4H8KA 1XHXA 4M3XA 1ZYQA 3MEGA 5DK5A 2FBTA 3EZ5A 5C42A 4AHRA 1BI4B 4B9MA 4Z4FA 4FLXA 3KJVA 4CE9A 3AO3A 3K2PA 4BWMA 3WNGA 5KGXA 3O3FA 4DS5A 1VSLA 3LAKA 1NK6A 3NF8A 1Y97A 1X9SA 2Z1HA 3V1OA 1IKXA 4AHCA 3JYTA 4CIGA 4E7HA 3B6OA 4DU3A 4J2DA 3H08A 3OS0A 4FZYA 2B4JA 3LPTA 4L8RB 4N5SA 1BQNA 4B9NA 3AVHA 2Z1JA 1FXXA 4KHWA 5FROA 1REVA 3NH2A 1QS4A 3SCXA 1SL1A 4CK3A 1TK0A 1RT3A 5KRSA 4IFVA 4KREA 2PYJA 2D0AA 3QEVA 4PQUA 4OKKA 4KTWA 3AVJA 3NDKA 1XC9A 4KI4A 2KQ2A 4OKJA 3AO2A 2G8FA 4M3UA 2HHWA 1HJRA 4DFJA 1N6QA 3TARA 2YV0X 4DFPA 2X6NA 5J2PA 4CJQA 2YNGA 3DOKA 3VQ5A 2DTUA 2NUBA 1GOBA 3SV4A 4GVMA 4LH4A 5E41A 4AH9A 4F2SA 4JLHA 4KHUA 2R7YA 4CIFA 3CM6A 2YNFA 5HROA 4DLEA 3KKRA 4CGGA 4RW4A 4BDYA 4FJIA 4KTQA 2FC0A 2GV9A 3ZT2A 4E19A 3KTQA 4EP5A 2QKKA 1TKDA 3KLGA 1CXQA 3CG7A 4DS4A 2Z1IA 2F96A 3AVNA 4DFKA 5J2MA 4DSLA 1SKRA 3ZT1A 4IKFA 3VQQA 1I39A 4CJLA 4HVJA 2G8IA 1SUQA 2JLEA 4H4MA 3VQAA 1J9AA 3UIQA 3DLBA 3U3GA 2PY5A 2AJQA 4OGEA 2DFHA 3NH1A 4DTPA 3OYJA 5J2NA 5T7BA 4CFDA 1A5XA 4BE0A 1TK5A 3PO4A 3NF9A 3RMDA 4TSXA 1IKWA 3O3GA 1ASVA 3TANA 4Y1CA 4FW2A 3P5JA 3RR8A 5HRPA 2BE2A 1R0AA 1U48A 3WNFA 4HUGA 1S1UA 4FLTA 4DTRA 3QIOA 1S1TA 1NK0A 3IAYA 3KLHA 2HHTA 1C1CA 3PX4A 4FJ8A 3V4IA 3A2FA 2G8UA 1YTUA 2KFNA 2OZSA 3L8BA 3VQ9A 1CXUA 3TAFA 1CZBA 1UWBA 1RDCA 2HNZA 3SNNA 3OJUA 4HTUA 4PWDA 2IS3A 3ZT4A 1T8EA 1ZBLA 4Z4IA 3PY8A 4E7KA 1JL1A 4ID5A 2QKBA 1XWLA 4CGHA 4BE2A 3SUOA 4CGFA 1NJXA 2YKNA 1BIZA 1HYVA 5CY4A 4CJ4A 4ZHRA 4PUOA 3DLGA 3MEDA 4CEBA 4LY7A 3TAEA 3PX0A 4M45A 4Q5VA 1KLMA 4DSJA 2X6SA 3V6DA 1B9DA 4KPYA 1SL0A 1YT3A 4I2QA 3HM9A 4DSIA 4Z4GA 4W5RA 2HMIA 2F8TA 2XY7A 1W0HA 5HRSA 3HO1A 4FJ9A 2DFFA 3DM2A 4FM2A 4B9LA 4AILC 1D8YA 4M41A 3NE6A 3L2WA 2E4LA 4NYFA 5KI6A 3TR8A 2G8VA 4IDKA 4DG1A 1L5UA 4J2BA 1BL3A 3ASMA 1HQUA 4H4OA 3LZIA 1KTQA 2HNYA 3EY1A 4EP4A 2XRIA 1NJZA 4KKOA 1U47A 1FK9A 1YVUA 3OYAA 4JRQA 3F9KA 1QE1A 3TAMA 4FJHA 4ICLA 4DTNA 4PA1A 1VSFA 1W9HA 4N76A 1GOCA 4FLVA 1NJYA 3KK1A 1U04A 4EZ9A 1JLQA 1RTHA 3THVA 3RWUA 2DY4A 3VQPA 4B08A 3DRSA 2WOMA 1VSMA 3QIPA 4CJ5A 3OY9A 3CQ8A 4C8LA 4FJGA 4DQPA 3P83D 4O44A 3TI0A 2P5GA 2VG7A 3AA3A 3KLIA 4CEDA 3LWLA 3VN5A 4CHZA 4FK4A 4QOZB 3NBPA 4AHVA 2W42A 1RTDA 2HHSA 5HP1A 3LZJA 5J1EA 4F3TA 4B8CA 1KVCA 2FBXA 1IH7A 5J2QA 2XHBA 4ELUA 4KI6A 2BGGA 1O1WA 4OPKA 5FRNA 2O4GA 2GUIA 4MQ3A 5CZ1A 3KKSA 1IKVA 1WSGA 3AVKA 3ZSWA 3OS2A 4M3TA 1QSLA 4HHTA 4B9TA 5DMRA 3L2VA 2IC3A 1RT6A 3PV8A 1NOZA 4W5OA 4OKEA 1VSJA 4DQIA 3LP2A 3WNHA 2OYQA 2FBYA 4GMJB 3VQ7A 3AVIA 1WNSA 3ULDA 3AA2A 1WSHA 2P1JA 3I0RA 2E6MA 4E7JA 4DSFA 1UA1A 1S9GA 1N5YA 4KB0A 2LSNA 3VQCA 4CERA 4N56A 3NGIA 1C0TA 4DTMA 1UA0A 1SKSA 4FJLA 5SZTA 4CFAA 3SQ4A 2YHAA 4MFBA 2ITGA 2X74A 1NK5A 4FK2A 1BGXT 1J53A 3ITHA 3OYEA 3SUQA 3VQEA 1TKTA 3TAQA 3MXIA 4FM1A 4FZZA 4FJKA 4M42A 3OJSA 1WSJA 3ZT0A 2BANA 3NGZA 1NK9A 4CGIA 4K8XA 3ZSOA 3AVCA 1YTAA 1QSYA 3RMCA 4DTXA 1UOCA 3K5OA 3M8QA 3OYIA 4FLUA 4CFBA 3PO5A 4O5BA 4QCLA 3DLEA 3ZT3A 2IGIA 1RTIA 3HJFA 5D3GA 4ZTFA 2P5OA 2D0CA 3V1RA 3M8PA 1ZBIA 4CIEA 5KGWA 2Y1JA 3VQ8A 3OYBA 2KZZA 4OVLA 1EX4A 3O4QA 2HVHA 4CEZA 1Q9YA 4C8OA 2HHQA 4Z4CA 1D9DA 1A5WA 3G0ZA 1BCMA 2Z1GA 2IAJA 3HSTB 3CFOA 2EX3A 1LV5A 2D0BA 4CJTA 4XIUA 3CFPA 1X9MA 2XO7A 1S6QA 4HCCA 4DTJA 3AVLA 1XHZA 3VA3A 4E1NA 3AVGA 1TKZA 3HL8A 4KHNA 5EU7A 4B3OA 2ATQA 4DMNA 3M8SA 2OA8A 4CEOA 3OYCA 4FCYA 1VRTA 1ASUA 4IFYA 1DLOA 3LANA 4J2AA 4DF4A 1NOYA 4AHUA 1HMVA 3BGRA 3KIOA 3G10A 1ZBHA 5CYMA 4R5PA 4E7LA 4BE1A 1IG9A 3BDPA 1DTQA 1C0MA 2IOCA 4E1MA 1RT4A 1SL2A 3HXMA 4I7FA 2F8SA 3RTVA 3K5LA 1L3VA 3ZSVA 1KFSA 1LW2A 4F2RA 3QNOA 3SUPA 1VSEA 1TVRA 4OPJA 3TAGA 4DLGA 2X78A 4DQQA 5JS1A 4CJEA 4DSKA 2FBVA 1A5VA 4N41A 1HNVA 4BWJA 1WSIA 1EKEA 4W5TA 3DMJA 3AA5X 3K57A 4KHQA 2YKMA 1RTJA 4QAGA 4RG8A 4CGDA 1JLAA 1S1WA 4RW6A 3QEXA 4JS4A 3KD1E 1VK0A 3DI6A 4YNQA 4E7IA 3OYFA 1S1XA 3AVBA 3AO5A 3DOLA 1JLFA 1EP4A 2JGUA 4CJRA 3AO4A 3MAQA 1ZBFA 3V9WA 3HP9A 4ID1A 4CK2A 3V9ZA 4CK1A 4DFMA 2A1RA 1X9WA 4OLBA 2G8WA 3T19A 4IBNA 4Z4HA 3VA0A 4DTOA 3L3VA 1S6PA 1ITGA 4IG3A 1JLBA 3O3HA 3AA4A 3AO1A 2HHVA 1TAUA 3RRGA 3NHGA 4IG0A 4FJNA 2PYLA 4CGJA 3HVRA 3TAPA 4CF1A 2A1SA 4FLWA 1U45A 4C8MA 1NK4A 1DTTA 1KVAA 4NCGA 4FM0A 3QERA 3TWHA 1QHTA 1KVBA 1XI1A 3JSMA 4KTZA 2WONA 1D9FA 1S1VA 4JRPA 4DSEA 1WSFA 4BACA 1T05A 5KRTA 1WSEA 3KLEA 1RBVA 1RBTA 1EXQA 3DLHA 4CJWA 3IRXA 3OYLA 3OS1A 3AVFA 1IO2A 2VWKA 1CLQA 4FZXC 1WLJA 2P51A 1C1BA 2VG5A 3ZSYA 4CF0A 1FKOA 5FDLA 1L3UA 2B5JA 4CJFA 4CF2A 4I9QA 3HYFA 3DYAA 5CZ2A 1LWFA 2YNIA 1HYZA 4I9LA 4FJ7A 1D5AA 3QO9A 4CHPA 3NCIA 3HPOA 3OYNA 3QETA 4F4KA 3MXMA 3V9UA 1RDBA 1Z25A 3OYKA 1C1AA 3ZCMA 5C25A 2QK9A 4E3SA 4NYNA 1BCOA 3OVNA 2HNDA 2RPIA 3DRRA 3MECA 3V81A 1F21A 3CFRA 3QINA 1CZ9A 4O0JA 1Q9XA 2G8KA 1HYSA 1T7PA 4EZ6A 1WAJA 4B8AB 3M8RA 4M3WA 3LP3A 3C94A 1X1PA 4DTUA 4M3YA 3HP6A 4FLYA 4KO0A 4DF8A 4FLZA 1JKHA 2Y1IA 3I8DA 5HLFA 4NCBA 1QTMA 1I3AA 4UQGA 3C6UA 3ZSXA 3QNNA 1NK7A 1NKBA 2YNHA 2YHBA 1TL1A 1KLNA 1RT1A 3D45A 4LH5A 1L3SA 2O4IA 4KHYA 4C8NA 4C8KA 4OLAA 1KRPA 4K8ZA 1BIUA 4RW8A 5SWMA 1JLEA 2HHXA 1LWEA 3P1GA 3QEPA 4CEFA 4FK0A 5I42A 1BISA 2PZSA 1QQCA 4M3ZA 2B6AA
chains in the Genus database with same CATH superfamily
1EETA 4WQ5C 4W5NA 4A5BA 4IZ9A 3D2EA 1JL2A 3T1AA 3L2RA 3K5MA 1ASWA 3HK2A 1TV6A 1TAQA 4JNEA 2KFZA 2D0OA 3KK2A 1G15A 1HKGA 2ZD1A 2ZWHA 4LF8K 5AQVA 2IVPA 3I8BA 3ID6A 3IDHA 4CEEA 3WXIA 1B92A 1C0UA 2E2QA 2JWLA 2OPPA 3D2FB 4IOXA 1JXBA 1VRUA 1VSDA 4H0VB 3S9HA 3ALYA 2VWJA 1YF5L 3DJCA 3NF7A 5AZJB 4F8RA 4KAZA 1QVGM 4YOYA 1SV5A 4GKJK 3LAMA 3K59A 3MWTA 1Q8IA 1U4BA 3EYZA 4W5QA 3E9LA 1OVYA 4ZTJA 4CF8A 4CJVA 4G9ZA 2IDOA 1NMDA 4DU4A 1GLJO 4BC5A 5HBMA 1OH7A 5FRMA 4ELVA 2O8BA 3IG1A 4BDZA 1JLCA 4DU1A 3TARA 3NF6A 3FFIA 2I7NA 2RKIA 2Q0UA 3AY9A 3D2EB 3CPWM 2EHGA 4JI3K 4BG8A 2CH5A 1NJWA 3K9JA 4JKBA 4YORA 2FSJA 3RRHA 4U67L 2UUAK 3H46O 2ZGYA 4E89A 3QESA 3ZSZA 1VSHA 4H0PA 1TYQA 1RT7A 2QXFA 4CF9A 3R9PA 4O55A 4EFHA 2HHUA 1VHXA 3OYMA 4FL9A 3CCRN 3EZWA 2RF2A 3EE9A 3LP0A 2A6AA 4J2EA 4IXCA 3C95A 3ZETA 2CH6A 2OTLN 2HB5A 4FWQA 5M1KA 3RMAA 1LAVA 5C24A 4B9QA 3AVAA 1RBSA 3ZSQA 3PUFA 3B6PA 1NKCA 2IVOA 2A40A 4CHQA 3NH0A 3HPHA 4OGCA 1RT2A 4DUZK 1OKJA 4M3XA 2A42A 4MLEA 4OX9K 5C42A 2A3ZA 1NM1A 1E3MA 4B9MA 4FLXA 2O8BB 5EX5A 5KGXA 1HKCA 4BWMA 3O3FA 3LAKA 3CCMN 3DLLL 3B6OA 4L8RB 3LPTA 5LMNK 4B9NA 2VGNA 1FXXA 2E5LK 3A5NC 5AQHA 5FROA 5BRFA 4WQ4A 1REVA 4FSVA 1SL1A 2EWSA 1RT3A 2P9NA 4KREA 2D0AA 1TYQB 3CCQN 4JV5K 4YOWA 3DAWA 4KI4A 3AO2A 3WXKA 3T69A 2YV0X 4AQYK 4DFPA 4CJQA 3DOKA 4GVMA 4KHUA 3CM6A 3KKRA 4CGGA 3VOVA 4KTQA 2GV9A 3ZETB 1TKDA 1N36K 1CXQA 3EEQA 2F96A 4DSLA 4IKFA 3SBGA 2G8IA 1I39A 1HLUA 3VQAA 1J9AA 3UIQA 2PY5A 2DFHA 3OYJA 5J2NA 4XH5A 1K9MO 3L4IA 4PL8A 1KC8O 5FPDA 5HRPA 1HUXA 1U48A 1NK0A 4FLTA 1V4SA 1S1TA 3CCVN 1C1CA 5EOYA 2KFNA 1EO1A 1N32K 2YI1A 3KVGA 1CZBA 4CZEA 1RDCA 3SNNA 4NLCA 1SZ2A 4HTUA 4Z4IA 1Y64A 1ZBLA 2P9NB 3E66A 4BE2A 1NJXA 2HBJA 2YKNA 1HYVA 5CY4A 5M1OA 3CJ7A 3DLGA 3MEDA 2Q36A 3PX0A 4Q5VA 1K8AO 2WTUA 3T1YK 3FZFA 4BRMA 2X6SA 4Z94A 4J8FA 1SL0A 2KLAA 1YT3A 3HM9A 2P9SA 2XY7A 1W0HA 4BRDA 3NE6A 3R8EA 3L2WA 3LDPA 1BDGA 4J2BA 4ISGA 4JI7K 3OW2M 3ATUA 1U47A 5AFUA 4CBUA 5EVZA 5HOOA 3HBTA 3G4SN 3Q7BA 4PA1A 1VSFA 4A62A 4N76A 4FLVA 3L6QA 3KK1A 1U04A 2QEXN 3CQXA 3GG4A 3THVA 3RWUA 2DY4A 4A2BA 1VSMA 2UU9K 4DQPA 3C6HA 3CXCM 3CHWA 4CEDA 1KAXA 1YI2N 4CHZA 4FK4A 4AHVA 3C6AA 4B8CA 2FBXA 5CR4A 1NGGA 4EAHD 2XHBA 4KI6A 2FXUA 3QB0A 2BGGA 1O1WA 4MQ3A 2GUIA 4BRPA 1IKVA 2KHOA 3ZSWA 1QSLA 3EKUA 4HHTA 4B3TK 4H5RA 5DMRA 3CC7N 1GLEG 5DM6L 3LP2A 2FBYA 3I0RA 4DSFA 2LSNA 3TSPA 1C0TA 1ILYA 1VQ7N 3MN6A 4FK2A 4FM1A 2P9SB 1LCUA 3ZT0A 3CC4N 4XH1A 1QSYA 4DTXA 3M8QA 3PO5A 4BGBA 4EIAA 3DLEA 2IGIA 4X64K 3HJFA 1M90O 4DV7K 1VQ9N 1XUPO 1VQ8N 3S41A 2W41A 4RWTA 2D0CA 3V1RA 3MMVA 3OYBA 2CGKA 1EX4A 1J6ZA 2HVHA 3CPEA 4BRFA 1D9DA 5AQRA 5JICA 3CFPA 1X9MA 1XNQK 4HCCA 4DTJA 3HL8A 3WQUA 4LFAK 3M8SA 3LDQA 3OYCA 1ASUA 1DLOA 2V51B 3J7YP 1ATSA 3BDPA 1DTQA 1C0MA 1RT4A 4I7FA 2F8SA 3RTVA 1L3VA 3ZSVA 1LW2A 4GV9A 1I94K 1OVQA 3IMXA 4IEIA 3TAGA 5MLCQ 4BRCA 3GOIA 2D4WA 5JS1A 4DSKA 2FBVA 4BQZA 5CE3A 1HNVA 3BF1A 1EKEA 4W5TA 3ID8A 1MDUB 1RTJA 4QAGA 4CGDA 3QEXA 1WB9A 3OBYA 3KD1E 3SAGA 3AVBA 4DV2K 2JGUA 3AGKA 4CJRA 3AO4A 3V9WA 3ZEUA 4OLBA 3NMUA 3L3VA 4YOVA 4FWNA 3O3HA 4PL7A 4CGJA 2V7ZA 2A1SA 1DTTA 4FO0A 1XNRK 3CERA 3OBWA 4DUYK 5EXWA 4KTZA 2UUBK 4K41A 5KRTA 1WSEA 3KLEA 1RBVA 2FLOA 1RBTA 5GAGP 2D1KA 3UKRA 3IRXA 4CJWA 1IO2A 1WLJA 3ZSYA 5FDLA 1VQ6N 3HYFA 4KH4A 3WUHA 5BR8K 4I9LA 3NCIA 3OYNA 3MXMA 3WQTA 1RDBA 1Z25A 1NBWA 2QK9A 1DGKN 4NYNA 3OVNA 3DRRA 3MECA 1F21A 2G8KA 3QINA 5LJVA 3H3NO 3N4QA 3P39A 2ZGZA 3C94A 2Q0RA 4CW7B 3UB5A 1JKHA 5HLFA 3I8DA 4UQGA 4B3OA 4YDUA 1EWRA 4LH5A 1L3SA 4NXNK 2ZF5O 3ZEUB 4BGAA 4C8KA 3EE8A 3GE1A 1X9JA 3L4QA 4RW8A 3VENA 3CCLN 3QBWA 3WEEA 4FK0A 4YDUC 3J8AA 4FPBA 2B6AA 3SUPA 4FVMA 3TSUA 2OPQA 1BQMA 5EY4A 3RR7A 3NGYA 4JKHA 1HNIA 3M1FA 3OYDA 4H03B 3VEOA 4LSNA 4HUEA 2V52B 2XY5A 1ZBUA 4JI6K 4YFUA 2OPRA 1TL3A 1Q18A 3UKRB 4KBOA 4AM6A 1RNHA 5C0YA 3LPUA 3IFRA 5KTQA 3DLKA 4H5VA 5AJ3K 3VTHA 3S3OA 3IKMA 4HUFA 3VF2A 4CHOA 4GV6A 1S9EA 3V1QA 1WUAA 4WFAL 3LWMA 4Y1DA 1X3NA 1UAXA 4H0YB 2RN2A 3PLAA 2GUPA 5AQUA 4CHYA 4BDPA 1J5OA 4BVPA 4RW7A 3A5MC 2ITMA 4B9SA 4CFCA 3QEIA 4KFBA 4Q0BA 1SKWA 2P9PA 3C65A 2KTQA 3NAEA 4CESA 1U49A 4BRQA 4KHSA 3LDNA 3W0LA 3F5TA 3O8MA 1RBUA 3HVTA 1IKYA 5BPNA 2GELA 4N47A 1NK8A 3PSFA 1BI4A 4DQRA 1HRHA 3VEVA 3WEEB 4JI0K 1T03A 3SUNA 2DFEA 4JS5A 4A57A 4PY5A 1RCHA 4DQSA 1KCFA 2RE2A 3SV3A 4FOIA 5KPTA 1K8KA 2QI2A 3KD5E 1KFDA 3LP1A 4CZLA 2GBZA 1BHLA 3C6TA 2G8HA 1WAFA 4NXMK 4BC4A 3KK7A 4I2PA 1C0GA 4CJSA 1J54A 2Q97A 4FJ5A 3U3YA 2F9WA 2HMPA 4YOXA 4LF7K 1HQEA 4CJPA 4C23A 4FOEA 4CZHA 2KZMA 1G99A 2YHWA 3NVKA 2FSKA 2YJEA 2ZM6K 3S3NA 3HPGA 1TGOA 2ZQBA 3D7EO 3MEEA 1RDDA 4PHTX 1K6YA 4LSLA 3SJJA 4Z4EA 5C2FA 4M63C 2JWKA 3L3UA 4BRKA 4NCAA 1CZAN 1N8RO 5DK5A 4B1XB 4AHRA 4H5WA 1BI4B 4Z4FA 1GLFO 2Q2RA 1Y97A 1X9SA 4IJAA 3FR0A 1IKXA 2PFUA 4DU3A 4FZYA 3R3LA 1KD1O 3P38A 1NG9A 3NH2A 1K8KB 3H1QA 5KRSA 3AARA 3QEVA 4IO9L 4PQUA 4OKKA 5GAHP 2D0PA 4JEPA 2KQ2A 4OKJA 2G8FA 1NNEA 3P4IA 4DFJA 1BU6O 1VQ4N 3BUZB 2X6NA 3J7ZO 5BR9A 5J2PA 5AQSA 1OH6A 1W97L 2NUBA 1GOBA 3SV4A 4LH4A 2E88A 4AH9A 3H6EA 4F2SA 4FWRA 2P9LA 2HF4A 3KLGA 3FZMA 1YUWA 2Z1IA 4DFKA 1SKRA 4CJLA 2VQFK 4HVJA 2UUCK 2JLEA 1KAZA 1A5XA 3NF9A 3RMDA 1IKWA 1SS6A 3J80O 4FW2A 5DM7L 3RR8A 2BE2A 1R0AA 4HUGA 3QIOA 2VYPA 4JI5K 3O6WA 3A2FA 3V4IA 1YTUA 4B1UB 3VQ9A 1GLCG 3SAFA 4X66K 2UYTA 3TAFA 2YHXA 3DXKA 3OJUA 3GBTA 2W40A 3PY8A 3LM2A 4GNIA 1JL1A 4E7KA 1XWLA 4CGHA 3SUOA 1X3MA 2QWOA 1OH5A 4R79A 4PUOA 4LY7A 4M45A 4QS8A 3JAMO 1KLMA 3CF5L 3V6DA 4DSIA 1VQLN 4Y0WA 2F8TA 4CBXA 3HO1A 5HRSA 2PBDA 3DM2A 3ZYYX 5HL7L 4M41A 1HQUA 4H4OA 5TKWA 1KTQA 4KHPK 4RCHA 2HNYA 4A59A 4EP4A 2XRIA 1YAGA 3OYAA 2P9LB 4BRGA 3LL3A 1QE1A 3TAMA 4CZJA 1W9HA 1GOCA 4BRLA 4EZ9A 1FJGK 4B08A 3OY9A 3QIPA 3P83D 4O44A 2VG7A 2W6KA 3KLIA 4BC3A 5JLHA 4CVNE 4F9OA 4B3SK 4F3TA 1KVCA 4C1NK 2V7YA 1HNXK 4K25A 4YOUA 5LJWA 4ISFA 2H3GX 3KKSA 3U9ZA 3AVKA 3OS2A 2F7TA 4B9TA 1SQKA 1YJ9N 3MWPA 3DXKB 1RDUA 3VESA 1NOZA 4DQIA 4A2AA 2OCEA 1UA1A 2E6MA 2ASPA 1SKSA 2WFBA 5H1SQ 5SZTA 4CFAA 3SQ4A 2YHAA 1NK5A 2ITGA 1BGXT 3SUQA 3ITHA 4FZZA 4M42A 4FJKA 3SJHA 2BANA 1ESVA 1O13A 3ZSOA 1YTAA 1UOCA 5AQXA 4GKKK 4O5BA 1Q82O 1RTIA 4FWLA 5CHIA 2KZZA 4PKIA 1YIJN 5AZIA 1LOTB 4CEZA 4DR6K 4FWPA 5AQWA 3J7AP 3CETA 3H1VX 3HSTB 2EX3A 3AVLA 1S3XA 1XHZA 1TKZA 5AQTA 2A5XA 4CEOA 3MN9A 4FCYA 4IFYA 4B3RK 4J2AA 2HBLA 3BGRA 3UKUA 4E7LA 1RFQA 4R5PA 4BE1A 2IOCA 4E1MA 4H5TA 3SMPA 1SL2A 2A41A 4F2RA 3E1YA 4CJ7A 4OPJA 2QA4N 5LY3A 1QZ6A 1TUUA 3MCPA 5C2DA 2YKMA 4RG8A 2QM1A 4YNQA 4E7IA 3MX2A 3MAQA 4IJNA 4CK2A 1W7AA 4OPHA 4H5NA 3GDQA 4IBNA 3VA0A 4DTOA 3VEXA 1Q86O 2FSNA 2DPNA 4IG3A 5AZIB 3AO1A 4BRAA 1NGFA 4CF1A 1BA0A 3KZBA 4NCGA 4FM0A 3TWHA 3VGKA 1KVBA 2WONA 4JRPA 4BRHA 4BACA 1T05A 1HX1A 1CLQA 1N34K 3AVFA 4FZXC 2VG5A 2P51A 1C1BA 4YOTA 2WUSA 3UKUB 1L3UA 2NRRA 3R6MA 5AQOA 5CZ2A 3M6GA 4FJ7A 1D5AA 3QO9A 4CHPA 1NWKA 3OYKA 3E9OA 2VQEK 3VMFB 1SAZA 1ZC6A 1GLAG 1CZ9A 1VQMN 4EZ6A 4B8AB 4DTUA 4M3YA 4IOAL 4FLYA 3PIPL 4FLZA 4BRNA 4JK7A 1T6CA 5AQPA 3ZSXA 2YNHA 1HPMA 2O4IA 4C8NA 2UXBK 1BIUA 4CD1A 1JLEA 2E1ZA 3VGLA 3QEPA 4CEFA 3LDSA 4JKGA 2GTDA 1RILA 2XY8A 2J4RA 3CM5A 4CJKA 4ELTA 1KXPA 1Z26A 3WNEA 4H0XB 1EWQA 3DRPA 1WN7A 3Q7CA 3UE5A 3WT0A 4O4GA 3SQ2A 4E0DA 3HI0A 2E6LA 3SI6A 4CEAA 5K14A 1XQSC 2BDPA 2Q1NA 4OPAA 3ZX2A 5I3UA 4BR2A 4IO8A 2HBKA 3L2QA 3L2UA 3G71N 4FJMA 3SQ0A 4CZKA 1WOQA 4DV0K 2BH1A 2OZMA 4DV1K 3O9SA 5AQLA 4EHUA 2YCHA 2CGJA 2XY6A 5KPZA 5JS2A 1RT5A 2QWPA 3FLCO 2OTJN 1VQ5N 4JYAK 3ATVA 5KQDA 3SPZA 3WXMB 4KH6A 3VQ6A 3J81O 3KK3A 3ZSRA 3DLRA 1J5EK 3VQ4A 3JXUA 4B9UA 4CECA 3HZ6A 4JKGB 5B8HA 3HT3A 4CCHA 2ZE2A 4CEQA 3I0SA 4WFBL 1HNWK 1RDAA 2RHKA 4FJJA 1B9FA 3T3FA 4IOCL 1FW6A 3VQDA 1C6VA 1JCFA 3TABA 1VQPN 2OPSA 5C10A 4WE1A 2NNWA 1TK8A 3E01A 4OJRA 3QEWA 4RW9A 4XH4A 3KHYA 4NB4A 3CJ9A 3F2KA 5AQIA 1BA1A 4CHNA 1S5JA 3O5BA 3K9KA 1KSPA 3NFAA 3HOSA 1HPZA 3HTVA 4FXDA 4DTSA 3AV9A 3A5LC 3QLHA 3QDKA 1JXEA 3THYA 4CJUA 5LMUK 4FW1A 3O1WA 4F3OA 4UY8O 1NGHA 1MA9B 1T3VA 4H8KA 3MEGA 2FBTA 3EZ5A 4AF1A 2IIRA 3I56N 3QMLA 2NRTA 4CE9A 4DS5A 1DT9A 4B3MK 4E7HA 3JYTA 3OS0A 2B4JA 4LF6K 5KPRA 4JI2K 2HHHK 5AR0A 3H3OB 3N4PA 4IFVA 1HJOA 4LF5K 4O5FA 4KTWA 3AVJA 1Z6RA 4HWIA 3NDKA 1JJ2M 4M3UA 2HHWA 3U9DA 1HJRA 5GINA 2YNGA 3ENBA 3VQ5A 3R1XA 3BZKA 4JLHA 2R7YA 2ZJRL 5HROA 4DLEA 4BDYA 4FJIA 2FC0A 4B1WB 3ZT2A 4E19A 3CQYA 3KTQA 5GIOA 3CG7A 4DS4A 3AVNA 3THYB 3ZT1A 4C1NI 1SUQA 4H4MA 1IBLK 3VEYA 1IBMK 3A8YA 3U3GA 2AJQA 4OGEA 3NH1A 4XEIA 4CFDA 3BZCA 3PO4A 4BE0A 1TK5A 3O3GA 4JHDA 1V4TA 4Y1CA 4GV3A 3O80A 4JKAA 4DTRA 2YJFA 4FJ8A 5I9EB 2OZSA 2NRXA 1TUYA 5F2RA 4ID5A 2QKBA 3I55N 4CGFA 1BIZA 1NGAA 4ZHRA 2Q31A 3TAEA 1B9DA 2IVNA 4I2QA 4Z4GA 3CD6N 5ADXH 3LDOA 2DFFA 1D8YA 2O8CA 2E4LA 2G8VA 4IDKA 4DG1A 1BL3A 3ASMA 4HTLA 4JK8A 3LZIA 3EY1A 1NJZA 1FK9A 4JRQA 4PKGA 4LC9B 4ICLA 2WC9A 4DTNA 1NJYA 3M3ZA 5AQJA 1JLQA 3VQPA 4IWVA 3DRSA 2WOMA 4CJ5A 4FJGA 4DV6K 4C8LA 3TI0A 1WBBA 3MK6A 2P9PB 4MO5A 3O4WA 4JHDB 3VN5A 3LWLA 4QOZB 2P9IA 1RTDA 4ELUA 4OPKA 2O4GA 5CZ1A 3VETA 4M3TA 3IUCA 4BY9C 3O9QA 3F9MA 2P9KA 3L2VA 2IC3A 5AQMA 1RT6A 2P9UA 3PV8A 4U7BA 2E2PA 2O8DA 3FE1A 3WNHA 5ELZA 2OYQA 3ULDA 3AVIA 1WNSA 1WSHA 2P1JA 4KB0A 1QQNA 3T1HK 1S9GA 4N56A 3VPZA 3VQCA 4CERA 4FWSA 5FLXO 4MFBA 5BRDA 2X74A 4FWKA 3SK3A 2QTDA 3MXIA 3OJSA 1NK9A 4WFNL 4K8XA 4CGIA 3MN5A 2O8CB 3K5OA 3OYIA 2VCPA 4CFBA 3ZT3A 4LF9K 5D3GA 2NLXA 5FPNA 4DR3K 3CJCA 1T6DA 3VQ8A 2Y1JA 3A5OC 4DB3A 4C8OA 1Q9YA 3QBXA 2HHQA 3QFPA 1A5WA 3G0ZA 3AGRA 3PIOL 2E1YA 3EL2A 3CFOA 2QXLA 2D0BA 1LV5A 2E2OA 2P9IB 1S6QA 2XO7A 2F9TA 2CGLA 2ATQA 4WCEL 1YJWN 1VRTA 4KH5A 1BWFO 3LANA 1MWMA 1NOYA 1YHQN 3KIOA 3KWIA 3G10A 5CYMA 1IG9A 2P9KB 5JMVA 2P9UB 4E1JA 4QS9A 3OA9A 2O8DB 3K5LA 1KFSA 3MN7A 1VSEA 1TVRA 3P31A 4DLGA 2E2NA 2X78A 4CJEA 4CZMA 1A5VA 1WSIA 1S22A 3AA5X 1U6ZA 4BREA 1S1WA 4RW6A 4MLHA 4JS4A 2ASMA 1VK0A 3ZX0A 1EP4A 3CJBA 1ZBFA 1ZBSA 4BR7A 2G8WA 3T19A 4Z4HA 3U8XA 1S6PA 3SAHA 3AA4A 5JVHL 4FVUA 3VERA 3NHGA 4IG0A 4FJNA 2GWJA 4H0OA 3TAPA 1NGDA 4FLWA 1U45A 4C8MA 1NK4A 4JI8K 1QHTA 3L0QA 4B1YB 3JSMA 3PSIA 4CBWA 2KKZA 4JAXA 1D9FA 1S1VA 4DSEA 3W3DA 3RVCA 5A2QO 4DR4K 1BUPA 5AQNA 3DLHA 4CF0A 1FKOA 2B5JA 4CF2A 3MCAB 4K0KK 3VEZA 3DYAA 1LWFA 2YNIA 4FPAA 1VQON 4MO4A 1YVNA 2VWBA 3V9UA 4FWMA 3ENOA 3M5RA 4I6MA 1C1AA 3ZCMA 5C25A 4BR4A 4E3SA 1QHAA 1BCOA 2HNDA 2RPIA 3V81A 3CFRA 4O0JA 1HYSA 1NGIA 1T7PA 1WAJA 3CIPA 3ZX3A 3RSEA 1Q7YO 4GVEA 4DF8A 2Y1IA 3WXJA 1NGEA 2VGMA 1IBKK 3C6UA 3QNNA 1NKBA 2YHBA 1TL1A 1BG3A 1RT1A 2W6LA 3D45A 4KHYA 4DR5K 4OLAA 1KRPA 4ILJA 5SWMA 2FF6A 3P1GA 2BTFA 1BISA 2HSTA 2PZSA 1QQCA 1RBRA 3AVMA 3CCSN 2PAVA 4L3QA 4BRIA 4AHTA 1HNZK 3SYZA 4LFCK 1LAWA 4WQ4C 5HRNA 2HVIA 2HOEA 2VG6A 3G25A 3SQ1A 2F4VK 3KWGA 3K5NA 1MWKA 3DXMA 4KRFA 2I7PA 5C15A 2GWKA 3VQBA 1N33K 3CYMA 3V9XA 5GADP 3O4NA 1LWCA 2I5JA 4LD0A 1IG8A 3OYHA 4WF9L 3K58A 4I6MB 1TKXA 4KB1A 5BPLA 3GL1A 4CI6A 3U6FA 4FYDA 1RDWX 5BN9A 4QS7A 3V9SA 1XMQK 3RSEB 1VSIA 2YHYA 4HCBA 1QSSA 4OO1J 4YY3K 4FJXA 5E26A 2NRVA 3NVMA 2KW4A 3MDQA 5AQQA 4KV8A 3TTFA 2HW3A 4NO7A 4AHSA 1C0FA 1D4XA 3THWA 2ASOA 1Q81O 4CJ3A 3MXJA 3ULEA 4G1QA 1GOAA 3SPYA 3OYGA 3PX6A 2ETJA 4MDBA 5CYQA 1WBDA 3K0SA 4B9VA 4NLBA 3TU5A 3BY5A 2QWNA 3DXMB 3LALA 3D0PA 3FZKA 4M3RA 1JCEA 4RTFD 4A61A 3KLFA 5F1XA 3RMBA 3JS6A 4FWOA 4Z0UA 3OHRA 1JLGA 2D5RA 3SZ2A 4LFBK 2ZJQL 1QZ5A 4DWIA 3H45C 5M1NA 4O0IA 4JKCA 1FKPA 5AQFA 1MU2A 1LW0A 4BROA 5IT9O 1VSKA 5JLFA 4JN4A 1L3TA 3F73A 1NKEA 3BEXA 3FGUA 1EQYA 5AQGA 3C7NA 5M1QA 4GW6A 3ISNC 5HRRA 3ENHA 1NU0A 3S3MA 3IS9A 4JI1K 2Q3SA 2QW9A 1XHXA 1NGCA 4H0TB 2NRHA 1ZYQA 1GLBG 3THWB 4DV5K 3KJVA 3ULEB 1QVFM 3AO3A 3K2PA 3WNGA 1NK6A 1VSLA 3NF8A 2Z1HA 3V1OA 4AHCA 3E9PA 4CIGA 4J2DA 3H08A 1BOTO 4WYBA 4N5SA 1BQNA 4DKWA 3AVHA 2Z1JA 4KHWA 2QWLA 4CZFA 2HF3A 1QS4A 3SCXA 4CK3A 1TK0A 2ZJPL 2PYJA 2QWQA 1Z05A 4JD2A 1XC9A 3LDLA 5AFUH 1N6QA 4PKHA 3B8AX 2DTUA 4DQ8A 1OH8A 5E41A 4CIFA 2YNFA 1IV0A 2HBMA 3SLCA 4RW4A 1U2VA 3VF6A 4EP5A 5FPMA 2QKKA 3C0BA 5J2MA 3C7NB 3VQQA 1NMNA 3DWLA 2AP1A 2QWMA 4M7XA 3DLBA 2NZTA 4DTPA 5T7BA 2O8EA 3CCEN 4TSXA 1ASVA 3TANA 1E4FT 3P5JA 3WNFA 1S1UA 3IAYA 3KLHA 2HHTA 3PX4A 4BVOA 2G8UA 5TKYA 3L8BA 1R59O 1CXUA 2E20A 1UWBA 4K42A 2HNZA 4PWDA 3CJ1A 2IS3A 3ZT4A 1T8EA 4DR2K 3CC2N 3O1BA 4CJ4A 3THXA 4CEBA 4JD2B 4MDAA 4AM7A 4DSJA 4KPYA 4DR1K 1YITN 3EKSA 1ZXOA 4W5RA 2HMIA 3CJAA 2E8AA 5BRHA 4FJ9A 4FM2A 4B9LA 4AILC 1IJJA 5KI6A 4NYFA 3TR8A 1HR0K 1L5UA 1M1KO 4O8UA 1U2VB 4KKOA 1YVUA 2GEMA 4B1VA 3QICA 2WBNA 4A5AA 1P8ZA 3F9KA 4FJHA 1NGBA 5AQKA 1KAYA 1RTHA 4ISEA 3CQ8A 4B1ZA 2P5GA 4JKFA 3AA3A 3A0IX 3O9TA 4ILGB 3U4LA 3QFUA 2O8EB 3NBPA 4GY2B 2W42A 3CMAN 5HP1A 3LZJA 2HHSA 5J1EA 1IH7A 5J2QA 3TSQA 5FRNA 2O8FA 1WSGA 2GX9A 1W2BM 4JKDA 3FZHA 2QWRA 4W5OA 3O08A 4OKEA 1VSJA 3O9UA 4GMJB 3VQ7A 4X65K 3AA2A 4E7JA 4BC2A 3THXB 1N5YA 4M7YA 3TTCA 3NGIA 4DTMA 4FJLA 1UA0A 1HKBA 1ATNA 1J53A 1S72N 5BPMA 3I33A 3VQEA 1TKTA 3OYEA 3TAQA 5M1FA 1WSJA 2NRWA 3NGZA 3AVCA 3LM9A 4DCHA 3HRGA 3RMCA 4FLUA 4QCLA 5C12A 1NGJA 5BREA 4ZTFA 3CCJN 2P5OA 1VAZA 3ZLJA 4BG9A 3M8PA 1ZBIA 4CIEA 2UXDK 5KGWA 5ADXA 4OVLA 1GLLO 1XMOK 3O4QA 4Z4CA 5AQZA 1VQKN 1BCMA 2Z1GA 2IAJA 5AQYA 3MX5A 3CI5A 4CJTA 4XIUA 4DV3K 4V19S 1JCGA 4O8KA 3VA3A 4E1NA 3AVGA 4KHNA 5EU7A 4BR0A 4DMNA 2OA8A 2O8FB 3HOTA 5F0XA 5KQ8A 4DF4A 1XC3A 3HSCA 4AHUA 1HMVA 3O9RA 3HM8A 1ZBHA 3VEWA 3SMSA 3HXMA 3BF3A 1K73O 4JI4K 3EN9A 3QNOA 1ATRA 1P90A 5LL6Z 4DHYA 2OANA 4DQQA 4IEEA 2FF3B 3VGMA 4N41A 3SBTA 4BQLA 4BWJA 1H1VA 4JK9A 3DMJA 3K57A 4KHQA 1GLDG 3TTDA 5JVGL 1NJIO 1DEJA 1JLAA 4CZGA 3DI6A 5IWAK 3OYFA 1S1XA 3AO5A 4IDHA 3DOLA 1JLFA 4JKEA 3VTIA 5M1PA 2BUPA 3G6EN 3HP9A 4ID1A 4DFMA 3V9ZA 4CK1A 2A1RA 1X9WA 1KQSM 1RGIA 4EHTA 1ITGA 1NLVA 1BO5O 1JLBA 3CMEN 2HHVA 1TAUA 3RRGA 1YXQA 2PYLA 4CZIA 3HVRA 1E4GT 1KVAA 3QERA 3FZLA 4ILHA 1XI1A 4DR7K 3BP8A 3WXLA 3T7ZA 1T44A 2AA4A 1YJNN 1WSFA 4CD3A 5GIPA 1EXQA 4BR9A 3OYLA 4DV4K 3VF4A 3OS1A 2VWKA 4LF4K 3D2FA 4BR5A 5BN8A 4CJFA 4I9QA 5E84A 5FPEA 1HYZA 1QQMA 5AZJA 3HPOA 3QETA 4F4KA 3EO3A 2UXCK 1VQNN 3FFKB 1QQOA 1Q9XA 2NRZA 2YX6A 4IFEA 4M3WA 3M8RA 3LP3A 1X1PA 3HP6A 3CCUN 1DKGD 4KO0A 4X62K 3TPQA 4NCBA 1QTMA 4K43A 1I3AA 1NK7A 1KLNA 5GAEP 3D6RA 4WQ5A 3AAPA 4K8ZA 3OTOK 2HHXA 3AAQA 1LWEA 4YHHK 5I42A 4M3ZA
chains in the Genus database with same CATH topology
1EETA 1RBRA 1RILA 3AVMA 4FVMA 4W5NA 2XY8A 2OPQA 1BQMA 1JL2A 3CM5A 3T1AA 4CJKA 3L2RA 4ELTA 1Z26A 3WNEA 1ASWA 3K5MA 3HK2A 3RR7A 3NGYA 4AHTA 1HNIA 1TV6A 1TAQA 1WN7A 3DRPA 2KFZA 3OYDA 3SYZA 3KK2A 1G15A 1LAWA 2ZD1A 4LSNA 4O4GA 4HUEA 3SQ2A 5HRNA 2XY5A 2HVIA 4E0DA 1ZBUA 4YFUA 2VG6A 2E6LA 3SQ1A 3SI6A 4CEEA 1B92A 2OPRA 1C0UA 1TL3A 4CEAA 5K14A 3K5NA 2BDPA 2OPPA 1RNHA 3LDSA 4KRFA 3LPUA 5I3UA 1JXBA 1VRUA 1VSDA 3VQBA 3S9HA 3CYMA 5KTQA 3ALYA 3DLKA 3V9XA 3S3OA 3O4NA 2VWJA 1LWCA 4HUFA 4CHOA 1S9EA 3NF7A 3V1QA 2I5JA 4LD0A 3L2QA 4F8RA 3OYHA 3L2UA 4KAZA 3SQ0A 4FJMA 3K58A 3LWMA 4Y1DA 1SV5A 1TKXA 1UAXA 2RN2A 3LAMA 4KB1A 3K59A 4CHYA 4BDPA 3U6FA 4FYDA 1J5OA 2OZMA 4RW7A 3V9SA 1Q8IA 1U4BA 3EYZA 4B9SA 4W5QA 4CFCA 3QEIA 2XY6A 1VSIA 4KFBA 4HCBA 4Q0BA 1SKWA 4ZTJA 2KTQA 1QSSA 4CF8A 4CJVA 4FJXA 3NAEA 5JS2A 4CESA 1RT5A 2IDOA 1U49A 4KHSA 2KW4A 4KV8A 2HW3A 4DU4A 5HBMA 4AHSA 1RBUA 3SPZA 3HVTA 1IKYA 1NK8A 4N47A 5FRMA 4ELVA 3VQ6A 3KK3A 1BI4A 4DQRA 1HRHA 4CJ3A 3IG1A 3MXJA 3ZSRA 1JLCA 1GOAA 3DLRA 4G1QA 3VQ4A 4BDZA 3NF6A 4DU1A 3OYGA 4CECA 3FFIA 2RKIA 3SUNA 3SPYA 3HT3A 1T03A 4B9UA 4CCHA 3PX6A 2DFEA 2EHGA 2ETJA 2ZE2A 4CEQA 4JS5A 3I0SA 5CYQA 1RDAA 4B9VA 1B9FA 1NJWA 1RCHA 4FJJA 4DQSA 3T3FA 4PY5A 1KCFA 3SV3A 3RRHA 3VQDA 1C6VA 3KD5E 1KFDA 3LP1A 4E89A 3TABA 2GBZA 1BHLA 3C6TA 3ZSZA 2OPSA 3QESA 2G8HA 1VSHA 1WAFA 4WE1A 1RT7A 2QXFA 4CF9A 4O55A 3LALA 3D0PA 4M3RA 1TK8A 4I2PA 3KLFA 3RMBA 3E01A 4CJSA 4OJRA 3QEWA 1J54A 4Z0UA 2HHUA 4RW9A 4FJ5A 1JLGA 2D5RA 3SZ2A 3U3YA 3OYMA 4CHNA 1HQEA 1S5JA 1KSPA 4CJPA 4DWIA 3NFAA 2RF2A 3LP0A 4O0IA 1FKPA 1MU2A 1LW0A 2KZMA 1VSKA 1HPZA 4J2EA 4FXDA 4DTSA 3AV9A 3C95A 3S3NA 1L3TA 3HPGA 3F73A 2HB5A 1NKEA 1TGOA 3QLHA 1JXEA 2ZQBA 4CJUA 3RMAA 1LAVA 3MEEA 5C24A 3AVAA 4FW1A 1RBSA 4GW6A 3ZSQA 3ISNC 1RDDA 5HRRA 4F3OA 3PUFA 1K6YA 4LSLA 3SJJA 3B6PA 1NKCA 4Z4EA 3S3MA 3L3UA 4CHQA 3NH0A 3HPHA 4NCAA 3IS9A 1RT2A 4OGCA 2Q3SA 4H8KA 1XHXA 4M3XA 1ZYQA 3MEGA 5DK5A 2FBTA 3EZ5A 5C42A 4AHRA 1BI4B 4B9MA 4Z4FA 4FLXA 3KJVA 4CE9A 3AO3A 3K2PA 4BWMA 3WNGA 5KGXA 3O3FA 4DS5A 1VSLA 3LAKA 1NK6A 3NF8A 1Y97A 1X9SA 2Z1HA 3V1OA 1IKXA 4AHCA 3JYTA 4CIGA 4E7HA 3B6OA 4DU3A 4J2DA 3H08A 3OS0A 4FZYA 2B4JA 3LPTA 4L8RB 4N5SA 1BQNA 4B9NA 3AVHA 2Z1JA 1FXXA 4KHWA 5FROA 1REVA 3NH2A 1QS4A 3SCXA 1SL1A 4CK3A 1TK0A 1RT3A 5KRSA 4IFVA 4KREA 2PYJA 2D0AA 3QEVA 4PQUA 4OKKA 4KTWA 3AVJA 3NDKA 1XC9A 4KI4A 2KQ2A 4OKJA 3AO2A 2G8FA 4M3UA 2HHWA 1HJRA 4DFJA 1N6QA 3TARA 2YV0X 4DFPA 2X6NA 5J2PA 4CJQA 2YNGA 3DOKA 3VQ5A 2DTUA 2NUBA 1GOBA 3SV4A 4GVMA 4LH4A 5E41A 4AH9A 4F2SA 4JLHA 4KHUA 2R7YA 4CIFA 3CM6A 2YNFA 5HROA 4DLEA 3KKRA 4CGGA 4RW4A 4BDYA 4FJIA 4KTQA 2FC0A 2GV9A 3ZT2A 4E19A 3KTQA 4EP5A 2QKKA 1TKDA 3KLGA 1CXQA 3CG7A 4DS4A 2Z1IA 2F96A 3AVNA 4DFKA 5J2MA 4DSLA 1SKRA 3ZT1A 4IKFA 3VQQA 1I39A 4CJLA 4HVJA 2G8IA 1SUQA 2JLEA 4H4MA 3VQAA 1J9AA 3UIQA 3DLBA 3U3GA 2PY5A 2AJQA 4OGEA 2DFHA 3NH1A 4DTPA 3OYJA 5J2NA 5T7BA 4CFDA 1A5XA 4BE0A 1TK5A 3PO4A 3NF9A 3RMDA 4TSXA 1IKWA 3O3GA 1ASVA 3TANA 4Y1CA 4FW2A 3P5JA 3RR8A 5HRPA 2BE2A 1R0AA 1U48A 3WNFA 4HUGA 1S1UA 4FLTA 4DTRA 3QIOA 1S1TA 1NK0A 3IAYA 3KLHA 2HHTA 1C1CA 3PX4A 4FJ8A 3V4IA 3A2FA 2G8UA 1YTUA 2KFNA 2OZSA 3L8BA 3VQ9A 1CXUA 3TAFA 1CZBA 1UWBA 1RDCA 2HNZA 3SNNA 3OJUA 4HTUA 4PWDA 2IS3A 3ZT4A 1T8EA 1ZBLA 4Z4IA 3PY8A 4E7KA 1JL1A 4ID5A 2QKBA 1XWLA 4CGHA 4BE2A 3SUOA 4CGFA 1NJXA 2YKNA 1BIZA 1HYVA 5CY4A 4CJ4A 4ZHRA 4PUOA 3DLGA 3MEDA 4CEBA 4LY7A 3TAEA 3PX0A 4M45A 4Q5VA 1KLMA 4DSJA 2X6SA 3V6DA 1B9DA 4KPYA 1SL0A 1YT3A 4I2QA 3HM9A 4DSIA 4Z4GA 4W5RA 2HMIA 2F8TA 2XY7A 1W0HA 5HRSA 3HO1A 4FJ9A 2DFFA 3DM2A 4FM2A 4B9LA 4AILC 1D8YA 4M41A 3NE6A 3L2WA 2E4LA 4NYFA 5KI6A 3TR8A 2G8VA 4IDKA 4DG1A 1L5UA 4J2BA 1BL3A 3ASMA 1HQUA 4H4OA 3LZIA 1KTQA 2HNYA 3EY1A 4EP4A 2XRIA 1NJZA 4KKOA 1U47A 1FK9A 1YVUA 3OYAA 4JRQA 3F9KA 1QE1A 3TAMA 4FJHA 4ICLA 4DTNA 4PA1A 1VSFA 1W9HA 4N76A 1GOCA 4FLVA 1NJYA 3KK1A 1U04A 4EZ9A 1JLQA 1RTHA 3THVA 3RWUA 2DY4A 3VQPA 4B08A 3DRSA 2WOMA 1VSMA 3QIPA 4CJ5A 3OY9A 3CQ8A 4C8LA 4FJGA 4DQPA 3P83D 4O44A 3TI0A 2P5GA 2VG7A 3AA3A 3KLIA 4CEDA 3LWLA 3VN5A 4CHZA 4FK4A 4QOZB 3NBPA 4AHVA 2W42A 1RTDA 2HHSA 5HP1A 3LZJA 5J1EA 4F3TA 4B8CA 1KVCA 2FBXA 1IH7A 5J2QA 2XHBA 4ELUA 4KI6A 2BGGA 1O1WA 4OPKA 5FRNA 2O4GA 2GUIA 4MQ3A 5CZ1A 3KKSA 1IKVA 1WSGA 3AVKA 3ZSWA 3OS2A 4M3TA 1QSLA 4HHTA 4B9TA 5DMRA 3L2VA 2IC3A 1RT6A 3PV8A 1NOZA 4W5OA 4OKEA 1VSJA 4DQIA 3LP2A 3WNHA 2OYQA 2FBYA 4GMJB 3VQ7A 3AVIA 1WNSA 3ULDA 3AA2A 1WSHA 2P1JA 3I0RA 2E6MA 4E7JA 4DSFA 1UA1A 1S9GA 1N5YA 4KB0A 2LSNA 3VQCA 4CERA 4N56A 3NGIA 1C0TA 4DTMA 1UA0A 1SKSA 4FJLA 5SZTA 4CFAA 3SQ4A 2YHAA 4MFBA 2ITGA 2X74A 1NK5A 4FK2A 1BGXT 1J53A 3ITHA 3OYEA 3SUQA 3VQEA 1TKTA 3TAQA 3MXIA 4FM1A 4FZZA 4FJKA 4M42A 3OJSA 1WSJA 3ZT0A 2BANA 3NGZA 1NK9A 4CGIA 4K8XA 3ZSOA 3AVCA 1YTAA 1QSYA 3RMCA 4DTXA 1UOCA 3K5OA 3M8QA 3OYIA 4FLUA 4CFBA 3PO5A 4O5BA 4QCLA 3DLEA 3ZT3A 2IGIA 1RTIA 3HJFA 5D3GA 4ZTFA 2P5OA 2D0CA 3V1RA 3M8PA 1ZBIA 4CIEA 5KGWA 2Y1JA 3VQ8A 3OYBA 2KZZA 4OVLA 1EX4A 3O4QA 2HVHA 4CEZA 1Q9YA 4C8OA 2HHQA 4Z4CA 1D9DA 1A5WA 3G0ZA 1BCMA 2Z1GA 2IAJA 3HSTB 3CFOA 2EX3A 1LV5A 2D0BA 4CJTA 4XIUA 3CFPA 1X9MA 2XO7A 1S6QA 4HCCA 4DTJA 3AVLA 1XHZA 3VA3A 4E1NA 3AVGA 1TKZA 3HL8A 4KHNA 5EU7A 4B3OA 2ATQA 4DMNA 3M8SA 2OA8A 4CEOA 3OYCA 4FCYA 1VRTA 1ASUA 4IFYA 1DLOA 3LANA 4J2AA 4DF4A 1NOYA 4AHUA 1HMVA 3BGRA 3KIOA 3G10A 1ZBHA 5CYMA 4R5PA 4E7LA 4BE1A 1IG9A 3BDPA 1DTQA 1C0MA 2IOCA 4E1MA 1RT4A 1SL2A 3HXMA 4I7FA 2F8SA 3RTVA 3K5LA 1L3VA 3ZSVA 1KFSA 1LW2A 4F2RA 3QNOA 3SUPA 1VSEA 1TVRA 4OPJA 3TAGA 4DLGA 2X78A 4DQQA 5JS1A 4CJEA 4DSKA 2FBVA 1A5VA 4N41A 1HNVA 4BWJA 1WSIA 1EKEA 4W5TA 3DMJA 3AA5X 3K57A 4KHQA 2YKMA 1RTJA 4QAGA 4RG8A 4CGDA 1JLAA 1S1WA 4RW6A 3QEXA 4JS4A 3KD1E 1VK0A 3DI6A 4YNQA 4E7IA 3OYFA 1S1XA 3AVBA 3AO5A 3DOLA 1JLFA 1EP4A 2JGUA 4CJRA 3AO4A 3MAQA 1ZBFA 3V9WA 3HP9A 4ID1A 4CK2A 3V9ZA 4CK1A 4DFMA 2A1RA 1X9WA 4OLBA 2G8WA 3T19A 4IBNA 4Z4HA 3VA0A 4DTOA 3L3VA 1S6PA 1ITGA 4IG3A 1JLBA 3O3HA 3AA4A 3AO1A 2HHVA 1TAUA 3RRGA 3NHGA 4IG0A 4FJNA 2PYLA 4CGJA 3HVRA 3TAPA 4CF1A 2A1SA 4FLWA 1U45A 4C8MA 1NK4A 1DTTA 1KVAA 4NCGA 4FM0A 3QERA 3TWHA 1QHTA 1KVBA 1XI1A 3JSMA 4KTZA 2WONA 1D9FA 1S1VA 4JRPA 4DSEA 1WSFA 4BACA 1T05A 5KRTA 1WSEA 3KLEA 1RBVA 1RBTA 1EXQA 3DLHA 4CJWA 3IRXA 3OYLA 3OS1A 3AVFA 1IO2A 2VWKA 1CLQA 4FZXC 1WLJA 2P51A 1C1BA 2VG5A 3ZSYA 4CF0A 1FKOA 5FDLA 1L3UA 2B5JA 4CJFA 4CF2A 4I9QA 3HYFA 3DYAA 5CZ2A 1LWFA 2YNIA 1HYZA 4I9LA 4FJ7A 1D5AA 3QO9A 4CHPA 3NCIA 3HPOA 3OYNA 3QETA 4F4KA 3MXMA 3V9UA 1RDBA 1Z25A 3OYKA 1C1AA 3ZCMA 5C25A 2QK9A 4E3SA 4NYNA 1BCOA 3OVNA 2HNDA 2RPIA 3DRRA 3MECA 3V81A 1F21A 3CFRA 3QINA 1CZ9A 4O0JA 1Q9XA 2G8KA 1HYSA 1T7PA 4EZ6A 1WAJA 4B8AB 3M8RA 4M3WA 3LP3A 3C94A 1X1PA 4DTUA 4M3YA 3HP6A 4FLYA 4KO0A 4DF8A 4FLZA 1JKHA 2Y1IA 3I8DA 5HLFA 4NCBA 1QTMA 1I3AA 4UQGA 3C6UA 3ZSXA 3QNNA 1NK7A 1NKBA 2YNHA 2YHBA 1TL1A 1KLNA 1RT1A 3D45A 4LH5A 1L3SA 2O4IA 4KHYA 4C8NA 4C8KA 4OLAA 1KRPA 4K8ZA 1BIUA 4RW8A 5SWMA 1JLEA 2HHXA 1LWEA 3P1GA 3QEPA 4CEFA 4FK0A 5I42A 1BISA 2PZSA 1QQCA 4M3ZA 2B6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EET A;  1RBR A;  1RIL A;  3AVM A;  4FVM A;  4W5N A;  2XY8 A;  2OPQ A;  1BQM A;  1JL2 A;  3CM5 A;  3T1A A;  4CJK A;  3L2R A;  4ELT A;  1Z26 A;  3WNE A;  1ASW A;  3K5M A;  3HK2 A;  3RR7 A;  3NGY A;  4AHT A;  1HNI A;  1TV6 A;  1TAQ A;  1WN7 A;  3DRP A;  2KFZ A;  3OYD A;  3SYZ A;  3KK2 A;  1G15 A;  1LAW A;  2ZD1 A;  4LSN A;  4O4G A;  4HUE A;  3SQ2 A;  5HRN A;  2XY5 A;  2HVI A;  4E0D A;  1ZBU A;  4YFU A;  2VG6 A;  2E6L A;  3SQ1 A;  3SI6 A;  4CEE A;  1B92 A;  2OPR A;  1C0U A;  1TL3 A;  4CEA A;  5K14 A;  3K5N A;  2BDP A;  2OPP A;  1RNH A;  3LDS A;  4KRF A;  3LPU A;  5I3U A;  1JXB A;  1VRU A;  1VSD A;  3VQB A;  3S9H A;  3CYM A;  5KTQ A;  3ALY A;  3DLK A;  3V9X A;  3S3O A;  3O4N A;  2VWJ A;  1LWC A;  4HUF A;  4CHO A;  1S9E A;  3NF7 A;  3V1Q A;  2I5J A;  4LD0 A;  3L2Q A;  4F8R A;  3OYH A;  3L2U A;  4KAZ A;  3SQ0 A;  4FJM A;  3K58 A;  3LWM A;  4Y1D A;  1SV5 A;  1TKX A;  1UAX A;  2RN2 A;  3LAM A;  4KB1 A;  3K59 A;  4CHY A;  4BDP A;  3U6F A;  4FYD A;  1J5O A;  2OZM A;  4RW7 A;  3V9S A;  1Q8I A;  1U4B A;  3EYZ A;  4B9S A;  4W5Q A;  4CFC A;  3QEI A;  2XY6 A;  1VSI A;  4KFB A;  4HCB A;  4Q0B A;  1SKW A;  4ZTJ A;  2KTQ A;  1QSS A;  4CF8 A;  4CJV A;  4FJX A;  3NAE A;  5JS2 A;  4CES A;  1RT5 A;  2IDO A;  1U49 A;  4KHS A;  2KW4 A;  4KV8 A;  2HW3 A;  4DU4 A;  5HBM A;  4AHS A;  1RBU A;  3SPZ A;  3HVT A;  1IKY A;  1NK8 A;  4N47 A;  5FRM A;  4ELV A;  3VQ6 A;  3KK3 A;  1BI4 A;  4DQR A;  1HRH A;  4CJ3 A;  3IG1 A;  3MXJ A;  3ZSR A;  1JLC A;  1GOA A;  3DLR A;  4G1Q A;  3VQ4 A;  4BDZ A;  3NF6 A;  4DU1 A;  3OYG A;  4CEC A;  3FFI A;  2RKI A;  3SUN A;  3SPY A;  3HT3 A;  1T03 A;  4B9U A;  4CCH A;  3PX6 A;  2DFE A;  2EHG A;  2ETJ A;  2ZE2 A;  4CEQ A;  4JS5 A;  3I0S A;  5CYQ A;  1RDA A;  4B9V A;  1B9F A;  1NJW A;  1RCH A;  4FJJ A;  4DQS A;  3T3F A;  4PY5 A;  1KCF A;  3SV3 A;  3RRH A;  3VQD A;  1C6V A;  3KD5 E;  1KFD A;  3LP1 A;  4E89 A;  3TAB A;  2GBZ A;  1BHL A;  3C6T A;  3ZSZ A;  2OPS A;  3QES A;  2G8H A;  1VSH A;  1WAF A;  4WE1 A;  1RT7 A;  2QXF A;  4CF9 A;  4O55 A;  3LAL A;  3D0P A;  4M3R A;  1TK8 A;  4I2P A;  3KLF A;  3RMB A;  3E01 A;  4CJS A;  4OJR A;  3QEW A;  1J54 A;  4Z0U A;  2HHU A;  4RW9 A;  4FJ5 A;  1JLG A;  2D5R A;  3SZ2 A;  3U3Y A;  3OYM A;  4CHN A;  1HQE A;  1S5J A;  1KSP A;  4CJP A;  4DWI A;  3NFA A;  2RF2 A;  3LP0 A;  4O0I A;  1FKP A;  1MU2 A;  1LW0 A;  2KZM A;  1VSK A;  1HPZ A;  4J2E A;  4FXD A;  4DTS A;  3AV9 A;  3C95 A;  3S3N A;  1L3T A;  3HPG A;  3F73 A;  2HB5 A;  1NKE A;  1TGO A;  3QLH A;  1JXE A;  2ZQB A;  4CJU A;  3RMA A;  1LAV A;  3MEE A;  5C24 A;  3AVA A;  4FW1 A;  1RBS A;  4GW6 A;  3ZSQ A;  3ISN C;  1RDD A;  5HRR A;  4F3O A;  3PUF A;  1K6Y A;  4LSL A;  3SJJ A;  3B6P A;  1NKC A;  4Z4E A;  3S3M A;  3L3U A;  4CHQ A;  3NH0 A;  3HPH A;  4NCA A;  3IS9 A;  1RT2 A;  4OGC A;  2Q3S A;  4H8K A;  1XHX A;  4M3X A;  1ZYQ A;  3MEG A;  5DK5 A;  2FBT A;  3EZ5 A;  5C42 A;  4AHR A;  1BI4 B;  4B9M A;  4Z4F A;  4FLX A;  3KJV A;  4CE9 A;  3AO3 A;  3K2P A;  4BWM A;  3WNG A;  5KGX A;  3O3F A;  4DS5 A;  1VSL A;  3LAK A;  1NK6 A;  3NF8 A;  1Y97 A;  1X9S A;  2Z1H A;  3V1O A;  1IKX A;  4AHC A;  3JYT A;  4CIG A;  4E7H A;  3B6O A;  4DU3 A;  4J2D A;  3H08 A;  3OS0 A;  4FZY A;  2B4J A;  3LPT A;  4L8R B;  4N5S A;  1BQN A;  4B9N A;  3AVH A;  2Z1J A;  1FXX A;  4KHW A;  5FRO A;  1REV A;  3NH2 A;  1QS4 A;  3SCX A;  1SL1 A;  4CK3 A;  1TK0 A;  1RT3 A;  5KRS A;  4IFV A;  4KRE A;  2PYJ A;  2D0A A;  3QEV A;  4PQU A;  4OKK A;  4KTW A;  3AVJ A;  3NDK A;  1XC9 A;  4KI4 A;  2KQ2 A;  4OKJ A;  3AO2 A;  2G8F A;  4M3U A;  2HHW A;  1HJR A;  4DFJ A;  1N6Q A;  3TAR A;  2YV0 X;  4DFP A;  2X6N A;  5J2P A;  4CJQ A;  2YNG A;  3DOK A;  3VQ5 A;  2DTU A;  2NUB A;  1GOB A;  3SV4 A;  4GVM A;  4LH4 A;  5E41 A;  4AH9 A;  4F2S A;  4JLH A;  4KHU A;  2R7Y A;  4CIF A;  3CM6 A;  2YNF A;  5HRO A;  4DLE A;  3KKR A;  4CGG A;  4RW4 A;  4BDY A;  4FJI A;  4KTQ A;  2FC0 A;  2GV9 A;  3ZT2 A;  4E19 A;  3KTQ A;  4EP5 A;  2QKK A;  1TKD A;  3KLG A;  1CXQ A;  3CG7 A;  4DS4 A;  2Z1I A;  2F96 A;  3AVN A;  4DFK A;  5J2M A;  4DSL A;  1SKR A;  3ZT1 A;  4IKF A;  3VQQ A;  1I39 A;  4CJL A;  4HVJ A;  2G8I A;  1SUQ A;  2JLE A;  4H4M A;  3VQA A;  1J9A A;  3UIQ A;  3DLB A;  3U3G A;  2PY5 A;  2AJQ A;  4OGE A;  2DFH A;  3NH1 A;  4DTP A;  3OYJ A;  5J2N A;  5T7B A;  4CFD A;  1A5X A;  4BE0 A;  1TK5 A;  3PO4 A;  3NF9 A;  3RMD A;  4TSX A;  1IKW A;  3O3G A;  1ASV A;  3TAN A;  4Y1C A;  4FW2 A;  3P5J A;  3RR8 A;  5HRP A;  2BE2 A;  1R0A A;  1U48 A;  3WNF A;  4HUG A;  1S1U A;  4FLT A;  4DTR A;  3QIO A;  1S1T A;  1NK0 A;  3IAY A;  3KLH A;  2HHT A;  1C1C A;  3PX4 A;  4FJ8 A;  3V4I A;  3A2F A;  2G8U A;  1YTU A;  2KFN A;  2OZS A;  3L8B A;  3VQ9 A;  1CXU A;  3TAF A;  1CZB A;  1UWB A;  1RDC A;  2HNZ A;  3SNN A;  3OJU A;  4HTU A;  4PWD A;  2IS3 A;  3ZT4 A;  1T8E A;  1ZBL A;  4Z4I A;  3PY8 A;  4E7K A;  1JL1 A;  4ID5 A;  2QKB A;  1XWL A;  4CGH A;  4BE2 A;  3SUO A;  4CGF A;  1NJX A;  2YKN A;  1BIZ A;  1HYV A;  5CY4 A;  4CJ4 A;  4ZHR A;  4PUO A;  3DLG A;  3MED A;  4CEB A;  4LY7 A;  3TAE A;  3PX0 A;  4M45 A;  4Q5V A;  1KLM A;  4DSJ A;  2X6S A;  3V6D A;  1B9D A;  4KPY A;  1SL0 A;  1YT3 A;  4I2Q A;  3HM9 A;  4DSI A;  4Z4G A;  4W5R A;  2HMI A;  2F8T A;  2XY7 A;  1W0H A;  5HRS A;  3HO1 A;  4FJ9 A;  2DFF A;  3DM2 A;  4FM2 A;  4B9L A;  4AIL C;  1D8Y A;  4M41 A;  3NE6 A;  3L2W A;  2E4L A;  4NYF A;  5KI6 A;  3TR8 A;  2G8V A;  4IDK A;  4DG1 A;  1L5U A;  4J2B A;  1BL3 A;  3ASM A;  1HQU A;  4H4O A;  3LZI A;  1KTQ A;  2HNY A;  3EY1 A;  4EP4 A;  2XRI A;  1NJZ A;  4KKO A;  1U47 A;  1FK9 A;  1YVU A;  3OYA A;  4JRQ A;  3F9K A;  1QE1 A;  3TAM A;  4FJH A;  4ICL A;  4DTN A;  4PA1 A;  1VSF A;  1W9H A;  4N76 A;  1GOC A;  4FLV A;  1NJY A;  3KK1 A;  1U04 A;  4EZ9 A;  1JLQ A;  1RTH A;  3THV A;  3RWU A;  2DY4 A;  3VQP A;  4B08 A;  3DRS A;  2WOM A;  1VSM A;  3QIP A;  4CJ5 A;  3OY9 A;  3CQ8 A;  4C8L A;  4FJG A;  4DQP A;  3P83 D;  4O44 A;  3TI0 A;  2P5G A;  2VG7 A;  3AA3 A;  3KLI A;  4CED A;  3LWL A;  3VN5 A;  4CHZ A;  4FK4 A;  4QOZ B;  3NBP A;  4AHV A;  2W42 A;  1RTD A;  2HHS A;  5HP1 A;  3LZJ A;  5J1E A;  4F3T A;  4B8C A;  1KVC A;  2FBX A;  1IH7 A;  5J2Q A;  2XHB A;  4ELU A;  4KI6 A;  2BGG A;  1O1W A;  4OPK A;  5FRN A;  2O4G A;  2GUI A;  4MQ3 A;  5CZ1 A;  3KKS A;  1IKV A;  1WSG A;  3AVK A;  3ZSW A;  3OS2 A;  4M3T A;  1QSL A;  4HHT A;  4B9T A;  5DMR A;  3L2V A;  2IC3 A;  1RT6 A;  3PV8 A;  1NOZ A;  4W5O A;  4OKE A;  1VSJ A;  4DQI A;  3LP2 A;  3WNH A;  2OYQ A;  2FBY A;  4GMJ B;  3VQ7 A;  3AVI A;  1WNS A;  3ULD A;  3AA2 A;  1WSH A;  2P1J A;  3I0R A;  2E6M A;  4E7J A;  4DSF A;  1UA1 A;  1S9G A;  1N5Y A;  4KB0 A;  2LSN A;  3VQC A;  4CER A;  4N56 A;  3NGI A;  1C0T A;  4DTM A;  1UA0 A;  1SKS A;  4FJL A;  5SZT A;  4CFA A;  3SQ4 A;  2YHA A;  4MFB A;  2ITG A;  2X74 A;  1NK5 A;  4FK2 A;  1BGX T;  1J53 A;  3ITH A;  3OYE A;  3SUQ A;  3VQE A;  1TKT A;  3TAQ A;  3MXI A;  4FM1 A;  4FZZ A;  4FJK A;  4M42 A;  3OJS A;  1WSJ A;  3ZT0 A;  2BAN A;  3NGZ A;  1NK9 A;  4CGI A;  4K8X A;  3ZSO A;  3AVC A;  1YTA A;  1QSY A;  3RMC A;  4DTX A;  1UOC A;  3K5O A;  3M8Q A;  3OYI A;  4FLU A;  4CFB A;  3PO5 A;  4O5B A;  4QCL A;  3DLE A;  3ZT3 A;  2IGI A;  1RTI A;  3HJF A;  5D3G A;  4ZTF A;  2P5O A;  2D0C A;  3V1R A;  3M8P A;  1ZBI A;  4CIE A;  5KGW A;  2Y1J A;  3VQ8 A;  3OYB A;  2KZZ A;  4OVL A;  1EX4 A;  3O4Q A;  2HVH A;  4CEZ A;  1Q9Y A;  4C8O A;  2HHQ A;  4Z4C A;  1D9D A;  1A5W A;  3G0Z A;  1BCM A;  2Z1G A;  2IAJ A;  3HST B;  3CFO A;  2EX3 A;  1LV5 A;  2D0B A;  4CJT A;  4XIU A;  3CFP A;  1X9M A;  2XO7 A;  1S6Q A;  4HCC A;  4DTJ A;  3AVL A;  1XHZ A;  3VA3 A;  4E1N A;  3AVG A;  1TKZ A;  3HL8 A;  4KHN A;  5EU7 A;  4B3O A;  2ATQ A;  4DMN A;  3M8S A;  2OA8 A;  4CEO A;  3OYC A;  4FCY A;  1VRT A;  1ASU A;  4IFY A;  1DLO A;  3LAN A;  4J2A A;  4DF4 A;  1NOY A;  4AHU A;  1HMV A;  3BGR A;  3KIO A;  3G10 A;  1ZBH A;  5CYM A;  4R5P A;  4E7L A;  4BE1 A;  1IG9 A;  3BDP A;  1DTQ A;  1C0M A;  2IOC A;  4E1M A;  1RT4 A;  1SL2 A;  3HXM A;  4I7F A;  2F8S A;  3RTV A;  3K5L A;  1L3V A;  3ZSV A;  1KFS A;  1LW2 A;  4F2R A;  3QNO A;  3SUP A;  1VSE A;  1TVR A;  4OPJ A;  3TAG A;  4DLG A;  2X78 A;  4DQQ A;  5JS1 A;  4CJE A;  4DSK A;  2FBV A;  1A5V A;  4N41 A;  1HNV A;  4BWJ A;  1WSI A;  1EKE A;  4W5T A;  3DMJ A;  3AA5 X;  3K57 A;  4KHQ A;  2YKM A;  1RTJ A;  4QAG A;  4RG8 A;  4CGD A;  1JLA A;  1S1W A;  4RW6 A;  3QEX A;  4JS4 A;  3KD1 E;  1VK0 A;  3DI6 A;  4YNQ A;  4E7I A;  3OYF A;  1S1X A;  3AVB A;  3AO5 A;  3DOL A;  1JLF A;  1EP4 A;  2JGU A;  4CJR A;  3AO4 A;  3MAQ A;  1ZBF A;  3V9W A;  3HP9 A;  4ID1 A;  4CK2 A;  3V9Z A;  4CK1 A;  4DFM A;  2A1R A;  1X9W A;  4OLB A;  2G8W A;  3T19 A;  4IBN A;  4Z4H A;  3VA0 A;  4DTO A;  3L3V A;  1S6P A;  1ITG A;  4IG3 A;  1JLB A;  3O3H A;  3AA4 A;  3AO1 A;  2HHV A;  1TAU A;  3RRG A;  3NHG A;  4IG0 A;  4FJN A;  2PYL A;  4CGJ A;  3HVR A;  3TAP A;  4CF1 A;  2A1S A;  4FLW A;  1U45 A;  4C8M A;  1NK4 A;  1DTT A;  1KVA A;  4NCG A;  4FM0 A;  3QER A;  3TWH A;  1QHT A;  1KVB A;  1XI1 A;  3JSM A;  4KTZ A;  2WON A;  1D9F A;  1S1V A;  4JRP A;  4DSE A;  1WSF A;  4BAC A;  1T05 A;  5KRT A;  1WSE A;  3KLE A;  1RBV A;  1RBT A;  1EXQ A;  3DLH A;  4CJW A;  3IRX A;  3OYL A;  3OS1 A;  3AVF A;  1IO2 A;  2VWK A;  1CLQ A;  4FZX C;  1WLJ A;  2P51 A;  1C1B A;  2VG5 A;  3ZSY A;  4CF0 A;  1FKO A;  5FDL A;  1L3U A;  2B5J A;  4CJF A;  4CF2 A;  4I9Q A;  3HYF A;  3DYA A;  5CZ2 A;  1LWF A;  2YNI A;  1HYZ A;  4I9L A;  4FJ7 A;  1D5A A;  3QO9 A;  4CHP A;  3NCI A;  3HPO A;  3OYN A;  3QET A;  4F4K A;  3MXM A;  3V9U A;  1RDB A;  1Z25 A;  3OYK A;  1C1A A;  3ZCM A;  5C25 A;  2QK9 A;  4E3S A;  4NYN A;  1BCO A;  3OVN A;  2HND A;  2RPI A;  3DRR A;  3MEC A;  3V81 A;  1F21 A;  3CFR A;  3QIN A;  1CZ9 A;  4O0J A;  1Q9X A;  2G8K A;  1HYS A;  1T7P A;  4EZ6 A;  1WAJ A;  4B8A B;  3M8R A;  4M3W A;  3LP3 A;  3C94 A;  1X1P A;  4DTU A;  4M3Y A;  3HP6 A;  4FLY A;  4KO0 A;  4DF8 A;  4FLZ A;  1JKH A;  2Y1I A;  3I8D A;  5HLF A;  4NCB A;  1QTM A;  1I3A A;  4UQG A;  3C6U A;  3ZSX A;  3QNN A;  1NK7 A;  1NKB A;  2YNH A;  2YHB A;  1TL1 A;  1KLN A;  1RT1 A;  3D45 A;  4LH5 A;  1L3S A;  2O4I A;  4KHY A;  4C8N A;  4C8K A;  4OLA A;  1KRP A;  4K8Z A;  1BIU A;  4RW8 A;  5SWM A;  1JLE A;  2HHX A;  1LWE A;  3P1G A;  3QEP A;  4CEF A;  4FK0 A;  5I42 A;  1BIS A;  2PZS A;  1QQC A;  4M3Z A;  2B6A A; 
#chains in the Genus database with same CATH topology
 1EET A;  4WQ5 C;  4W5N A;  4A5B A;  4IZ9 A;  3D2E A;  1JL2 A;  3T1A A;  3L2R A;  3K5M A;  1ASW A;  3HK2 A;  1TV6 A;  1TAQ A;  4JNE A;  2KFZ A;  2D0O A;  3KK2 A;  1G15 A;  1HKG A;  2ZD1 A;  2ZWH A;  4LF8 K;  5AQV A;  2IVP A;  3I8B A;  3ID6 A;  3IDH A;  4CEE A;  3WXI A;  1B92 A;  1C0U A;  2E2Q A;  2JWL A;  2OPP A;  3D2F B;  4IOX A;  1JXB A;  1VRU A;  1VSD A;  4H0V B;  3S9H A;  3ALY A;  2VWJ A;  1YF5 L;  3DJC A;  3NF7 A;  5AZJ B;  4F8R A;  4KAZ A;  1QVG M;  4YOY A;  1SV5 A;  4GKJ K;  3LAM A;  3K59 A;  3MWT A;  1Q8I A;  1U4B A;  3EYZ A;  4W5Q A;  3E9L A;  1OVY A;  4ZTJ A;  4CF8 A;  4CJV A;  4G9Z A;  2IDO A;  1NMD A;  4DU4 A;  1GLJ O;  4BC5 A;  5HBM A;  1OH7 A;  5FRM A;  4ELV A;  2O8B A;  3IG1 A;  4BDZ A;  1JLC A;  4DU1 A;  3TAR A;  3NF6 A;  3FFI A;  2I7N A;  2RKI A;  2Q0U A;  3AY9 A;  3D2E B;  3CPW M;  2EHG A;  4JI3 K;  4BG8 A;  2CH5 A;  1NJW A;  3K9J A;  4JKB A;  4YOR A;  2FSJ A;  3RRH A;  4U67 L;  2UUA K;  3H46 O;  2ZGY A;  4E89 A;  3QES A;  3ZSZ A;  1VSH A;  4H0P A;  1TYQ A;  1RT7 A;  2QXF A;  4CF9 A;  3R9P A;  4O55 A;  4EFH A;  2HHU A;  1VHX A;  3OYM A;  4FL9 A;  3CCR N;  3EZW A;  2RF2 A;  3EE9 A;  3LP0 A;  2A6A A;  4J2E A;  4IXC A;  3C95 A;  3ZET A;  2CH6 A;  2OTL N;  2HB5 A;  4FWQ A;  5M1K A;  3RMA A;  1LAV A;  5C24 A;  4B9Q A;  3AVA A;  1RBS A;  3ZSQ A;  3PUF A;  3B6P A;  1NKC A;  2IVO A;  2A40 A;  4CHQ A;  3NH0 A;  3HPH A;  4OGC A;  1RT2 A;  4DUZ K;  1OKJ A;  4M3X A;  2A42 A;  4MLE A;  4OX9 K;  5C42 A;  2A3Z A;  1NM1 A;  1E3M A;  4B9M A;  4FLX A;  2O8B B;  5EX5 A;  5KGX A;  1HKC A;  4BWM A;  3O3F A;  3LAK A;  3CCM N;  3DLL L;  3B6O A;  4L8R B;  3LPT A;  5LMN K;  4B9N A;  2VGN A;  1FXX A;  2E5L K;  3A5N C;  5AQH A;  5FRO A;  5BRF A;  4WQ4 A;  1REV A;  4FSV A;  1SL1 A;  2EWS A;  1RT3 A;  2P9N A;  4KRE A;  2D0A A;  1TYQ B;  3CCQ N;  4JV5 K;  4YOW A;  3DAW A;  4KI4 A;  3AO2 A;  3WXK A;  3T69 A;  2YV0 X;  4AQY K;  4DFP A;  4CJQ A;  3DOK A;  4GVM A;  4KHU A;  3CM6 A;  3KKR A;  4CGG A;  3VOV A;  4KTQ A;  2GV9 A;  3ZET B;  1TKD A;  1N36 K;  1CXQ A;  3EEQ A;  2F96 A;  4DSL A;  4IKF A;  3SBG A;  2G8I A;  1I39 A;  1HLU A;  3VQA A;  1J9A A;  3UIQ A;  2PY5 A;  2DFH A;  3OYJ A;  5J2N A;  4XH5 A;  1K9M O;  3L4I A;  4PL8 A;  1KC8 O;  5FPD A;  5HRP A;  1HUX A;  1U48 A;  1NK0 A;  4FLT A;  1V4S A;  1S1T A;  3CCV N;  1C1C A;  5EOY A;  2KFN A;  1EO1 A;  1N32 K;  2YI1 A;  3KVG A;  1CZB A;  4CZE A;  1RDC A;  3SNN A;  4NLC A;  1SZ2 A;  4HTU A;  4Z4I A;  1Y64 A;  1ZBL A;  2P9N B;  3E66 A;  4BE2 A;  1NJX A;  2HBJ A;  2YKN A;  1HYV A;  5CY4 A;  5M1O A;  3CJ7 A;  3DLG A;  3MED A;  2Q36 A;  3PX0 A;  4Q5V A;  1K8A O;  2WTU A;  3T1Y K;  3FZF A;  4BRM A;  2X6S A;  4Z94 A;  4J8F A;  1SL0 A;  2KLA A;  1YT3 A;  3HM9 A;  2P9S A;  2XY7 A;  1W0H A;  4BRD A;  3NE6 A;  3R8E A;  3L2W A;  3LDP A;  1BDG A;  4J2B A;  4ISG A;  4JI7 K;  3OW2 M;  3ATU A;  1U47 A;  5AFU A;  4CBU A;  5EVZ A;  5HOO A;  3HBT A;  3G4S N;  3Q7B A;  4PA1 A;  1VSF A;  4A62 A;  4N76 A;  4FLV A;  3L6Q A;  3KK1 A;  1U04 A;  2QEX N;  3CQX A;  3GG4 A;  3THV A;  3RWU A;  2DY4 A;  4A2B A;  1VSM A;  2UU9 K;  4DQP A;  3C6H A;  3CXC M;  3CHW A;  4CED A;  1KAX A;  1YI2 N;  4CHZ A;  4FK4 A;  4AHV A;  3C6A A;  4B8C A;  2FBX A;  5CR4 A;  1NGG A;  4EAH D;  2XHB A;  4KI6 A;  2FXU A;  3QB0 A;  2BGG A;  1O1W A;  4MQ3 A;  2GUI A;  4BRP A;  1IKV A;  2KHO A;  3ZSW A;  1QSL A;  3EKU A;  4HHT A;  4B3T K;  4H5R A;  5DMR A;  3CC7 N;  1GLE G;  5DM6 L;  3LP2 A;  2FBY A;  3I0R A;  4DSF A;  2LSN A;  3TSP A;  1C0T A;  1ILY A;  1VQ7 N;  3MN6 A;  4FK2 A;  4FM1 A;  2P9S B;  1LCU A;  3ZT0 A;  3CC4 N;  4XH1 A;  1QSY A;  4DTX A;  3M8Q A;  3PO5 A;  4BGB A;  4EIA A;  3DLE A;  2IGI A;  4X64 K;  3HJF A;  1M90 O;  4DV7 K;  1VQ9 N;  1XUP O;  1VQ8 N;  3S41 A;  2W41 A;  4RWT A;  2D0C A;  3V1R A;  3MMV A;  3OYB A;  2CGK A;  1EX4 A;  1J6Z A;  2HVH A;  3CPE A;  4BRF A;  1D9D A;  5AQR A;  5JIC A;  3CFP A;  1X9M A;  1XNQ K;  4HCC A;  4DTJ A;  3HL8 A;  3WQU A;  4LFA K;  3M8S A;  3LDQ A;  3OYC A;  1ASU A;  1DLO A;  2V51 B;  3J7Y P;  1ATS A;  3BDP A;  1DTQ A;  1C0M A;  1RT4 A;  4I7F A;  2F8S A;  3RTV A;  1L3V A;  3ZSV A;  1LW2 A;  4GV9 A;  1I94 K;  1OVQ A;  3IMX A;  4IEI A;  3TAG A;  5MLC Q;  4BRC A;  3GOI A;  2D4W A;  5JS1 A;  4DSK A;  2FBV A;  4BQZ A;  5CE3 A;  1HNV A;  3BF1 A;  1EKE A;  4W5T A;  3ID8 A;  1MDU B;  1RTJ A;  4QAG A;  4CGD A;  3QEX A;  1WB9 A;  3OBY A;  3KD1 E;  3SAG A;  3AVB A;  4DV2 K;  2JGU A;  3AGK A;  4CJR A;  3AO4 A;  3V9W A;  3ZEU A;  4OLB A;  3NMU A;  3L3V A;  4YOV A;  4FWN A;  3O3H A;  4PL7 A;  4CGJ A;  2V7Z A;  2A1S A;  1DTT A;  4FO0 A;  1XNR K;  3CER A;  3OBW A;  4DUY K;  5EXW A;  4KTZ A;  2UUB K;  4K41 A;  5KRT A;  1WSE A;  3KLE A;  1RBV A;  2FLO A;  1RBT A;  5GAG P;  2D1K A;  3UKR A;  3IRX A;  4CJW A;  1IO2 A;  1WLJ A;  3ZSY A;  5FDL A;  1VQ6 N;  3HYF A;  4KH4 A;  3WUH A;  5BR8 K;  4I9L A;  3NCI A;  3OYN A;  3MXM A;  3WQT A;  1RDB A;  1Z25 A;  1NBW A;  2QK9 A;  1DGK N;  4NYN A;  3OVN A;  3DRR A;  3MEC A;  1F21 A;  2G8K A;  3QIN A;  5LJV A;  3H3N O;  3N4Q A;  3P39 A;  2ZGZ A;  3C94 A;  2Q0R A;  4CW7 B;  3UB5 A;  1JKH A;  5HLF A;  3I8D A;  4UQG A;  4B3O A;  4YDU A;  1EWR A;  4LH5 A;  1L3S A;  4NXN K;  2ZF5 O;  3ZEU B;  4BGA A;  4C8K A;  3EE8 A;  3GE1 A;  1X9J A;  3L4Q A;  4RW8 A;  3VEN A;  3CCL N;  3QBW A;  3WEE A;  4FK0 A;  4YDU C;  3J8A A;  4FPB A;  2B6A A;  3SUP A;  4FVM A;  3TSU A;  2OPQ A;  1BQM A;  5EY4 A;  3RR7 A;  3NGY A;  4JKH A;  1HNI A;  3M1F A;  3OYD A;  4H03 B;  3VEO A;  4LSN A;  4HUE A;  2V52 B;  2XY5 A;  1ZBU A;  4JI6 K;  4YFU A;  2OPR A;  1TL3 A;  1Q18 A;  3UKR B;  4KBO A;  4AM6 A;  1RNH A;  5C0Y A;  3LPU A;  3IFR A;  5KTQ A;  3DLK A;  4H5V A;  5AJ3 K;  3VTH A;  3S3O A;  3IKM A;  4HUF A;  3VF2 A;  4CHO A;  4GV6 A;  1S9E A;  3V1Q A;  1WUA A;  4WFA L;  3LWM A;  4Y1D A;  1X3N A;  1UAX A;  4H0Y B;  2RN2 A;  3PLA A;  2GUP A;  5AQU A;  4CHY A;  4BDP A;  1J5O A;  4BVP A;  4RW7 A;  3A5M C;  2ITM A;  4B9S A;  4CFC A;  3QEI A;  4KFB A;  4Q0B A;  1SKW A;  2P9P A;  3C65 A;  2KTQ A;  3NAE A;  4CES A;  1U49 A;  4BRQ A;  4KHS A;  3LDN A;  3W0L A;  3F5T A;  3O8M A;  1RBU A;  3HVT A;  1IKY A;  5BPN A;  2GEL A;  4N47 A;  1NK8 A;  3PSF A;  1BI4 A;  4DQR A;  1HRH A;  3VEV A;  3WEE B;  4JI0 K;  1T03 A;  3SUN A;  2DFE A;  4JS5 A;  4A57 A;  4PY5 A;  1RCH A;  4DQS A;  1KCF A;  2RE2 A;  3SV3 A;  4FOI A;  5KPT A;  1K8K A;  2QI2 A;  3KD5 E;  1KFD A;  3LP1 A;  4CZL A;  2GBZ A;  1BHL A;  3C6T A;  2G8H A;  1WAF A;  4NXM K;  4BC4 A;  3KK7 A;  4I2P A;  1C0G A;  4CJS A;  1J54 A;  2Q97 A;  4FJ5 A;  3U3Y A;  2F9W A;  2HMP A;  4YOX A;  4LF7 K;  1HQE A;  4CJP A;  4C23 A;  4FOE A;  4CZH A;  2KZM A;  1G99 A;  2YHW A;  3NVK A;  2FSK A;  2YJE A;  2ZM6 K;  3S3N A;  3HPG A;  1TGO A;  2ZQB A;  3D7E O;  3MEE A;  1RDD A;  4PHT X;  1K6Y A;  4LSL A;  3SJJ A;  4Z4E A;  5C2F A;  4M63 C;  2JWK A;  3L3U A;  4BRK A;  4NCA A;  1CZA N;  1N8R O;  5DK5 A;  4B1X B;  4AHR A;  4H5W A;  1BI4 B;  4Z4F A;  1GLF O;  2Q2R A;  1Y97 A;  1X9S A;  4IJA A;  3FR0 A;  1IKX A;  2PFU A;  4DU3 A;  4FZY A;  3R3L A;  1KD1 O;  3P38 A;  1NG9 A;  3NH2 A;  1K8K B;  3H1Q A;  5KRS A;  3AAR A;  3QEV A;  4IO9 L;  4PQU A;  4OKK A;  5GAH P;  2D0P A;  4JEP A;  2KQ2 A;  4OKJ A;  2G8F A;  1NNE A;  3P4I A;  4DFJ A;  1BU6 O;  1VQ4 N;  3BUZ B;  2X6N A;  3J7Z O;  5BR9 A;  5J2P A;  5AQS A;  1OH6 A;  1W97 L;  2NUB A;  1GOB A;  3SV4 A;  4LH4 A;  2E88 A;  4AH9 A;  3H6E A;  4F2S A;  4FWR A;  2P9L A;  2HF4 A;  3KLG A;  3FZM A;  1YUW A;  2Z1I A;  4DFK A;  1SKR A;  4CJL A;  2VQF K;  4HVJ A;  2UUC K;  2JLE A;  1KAZ A;  1A5X A;  3NF9 A;  3RMD A;  1IKW A;  1SS6 A;  3J80 O;  4FW2 A;  5DM7 L;  3RR8 A;  2BE2 A;  1R0A A;  4HUG A;  3QIO A;  2VYP A;  4JI5 K;  3O6W A;  3A2F A;  3V4I A;  1YTU A;  4B1U B;  3VQ9 A;  1GLC G;  3SAF A;  4X66 K;  2UYT A;  3TAF A;  2YHX A;  3DXK A;  3OJU A;  3GBT A;  2W40 A;  3PY8 A;  3LM2 A;  4GNI A;  1JL1 A;  4E7K A;  1XWL A;  4CGH A;  3SUO A;  1X3M A;  2QWO A;  1OH5 A;  4R79 A;  4PUO A;  4LY7 A;  4M45 A;  4QS8 A;  3JAM O;  1KLM A;  3CF5 L;  3V6D A;  4DSI A;  1VQL N;  4Y0W A;  2F8T A;  4CBX A;  3HO1 A;  5HRS A;  2PBD A;  3DM2 A;  3ZYY X;  5HL7 L;  4M41 A;  1HQU A;  4H4O A;  5TKW A;  1KTQ A;  4KHP K;  4RCH A;  2HNY A;  4A59 A;  4EP4 A;  2XRI A;  1YAG A;  3OYA A;  2P9L B;  4BRG A;  3LL3 A;  1QE1 A;  3TAM A;  4CZJ A;  1W9H A;  1GOC A;  4BRL A;  4EZ9 A;  1FJG K;  4B08 A;  3OY9 A;  3QIP A;  3P83 D;  4O44 A;  2VG7 A;  2W6K A;  3KLI A;  4BC3 A;  5JLH A;  4CVN E;  4F9O A;  4B3S K;  4F3T A;  1KVC A;  4C1N K;  2V7Y A;  1HNX K;  4K25 A;  4YOU A;  5LJW A;  4ISF A;  2H3G X;  3KKS A;  3U9Z A;  3AVK A;  3OS2 A;  2F7T A;  4B9T A;  1SQK A;  1YJ9 N;  3MWP A;  3DXK B;  1RDU A;  3VES A;  1NOZ A;  4DQI A;  4A2A A;  2OCE A;  1UA1 A;  2E6M A;  2ASP A;  1SKS A;  2WFB A;  5H1S Q;  5SZT A;  4CFA A;  3SQ4 A;  2YHA A;  1NK5 A;  2ITG A;  1BGX T;  3SUQ A;  3ITH A;  4FZZ A;  4M42 A;  4FJK A;  3SJH A;  2BAN A;  1ESV A;  1O13 A;  3ZSO A;  1YTA A;  1UOC A;  5AQX A;  4GKK K;  4O5B A;  1Q82 O;  1RTI A;  4FWL A;  5CHI A;  2KZZ A;  4PKI A;  1YIJ N;  5AZI A;  1LOT B;  4CEZ A;  4DR6 K;  4FWP A;  5AQW A;  3J7A P;  3CET A;  3H1V X;  3HST B;  2EX3 A;  3AVL A;  1S3X A;  1XHZ A;  1TKZ A;  5AQT A;  2A5X A;  4CEO A;  3MN9 A;  4FCY A;  4IFY A;  4B3R K;  4J2A A;  2HBL A;  3BGR A;  3UKU A;  4E7L A;  1RFQ A;  4R5P A;  4BE1 A;  2IOC A;  4E1M A;  4H5T A;  3SMP A;  1SL2 A;  2A41 A;  4F2R A;  3E1Y A;  4CJ7 A;  4OPJ A;  2QA4 N;  5LY3 A;  1QZ6 A;  1TUU A;  3MCP A;  5C2D A;  2YKM A;  4RG8 A;  2QM1 A;  4YNQ A;  4E7I A;  3MX2 A;  3MAQ A;  4IJN A;  4CK2 A;  1W7A A;  4OPH A;  4H5N A;  3GDQ A;  4IBN A;  3VA0 A;  4DTO A;  3VEX A;  1Q86 O;  2FSN A;  2DPN A;  4IG3 A;  5AZI B;  3AO1 A;  4BRA A;  1NGF A;  4CF1 A;  1BA0 A;  3KZB A;  4NCG A;  4FM0 A;  3TWH A;  3VGK A;  1KVB A;  2WON A;  4JRP A;  4BRH A;  4BAC A;  1T05 A;  1HX1 A;  1CLQ A;  1N34 K;  3AVF A;  4FZX C;  2VG5 A;  2P51 A;  1C1B A;  4YOT A;  2WUS A;  3UKU B;  1L3U A;  2NRR A;  3R6M A;  5AQO A;  5CZ2 A;  3M6G A;  4FJ7 A;  1D5A A;  3QO9 A;  4CHP A;  1NWK A;  3OYK A;  3E9O A;  2VQE K;  3VMF B;  1SAZ A;  1ZC6 A;  1GLA G;  1CZ9 A;  1VQM N;  4EZ6 A;  4B8A B;  4DTU A;  4M3Y A;  4IOA L;  4FLY A;  3PIP L;  4FLZ A;  4BRN A;  4JK7 A;  1T6C A;  5AQP A;  3ZSX A;  2YNH A;  1HPM A;  2O4I A;  4C8N A;  2UXB K;  1BIU A;  4CD1 A;  1JLE A;  2E1Z A;  3VGL A;  3QEP A;  4CEF A;  3LDS A;  4JKG A;  2GTD A;  1RIL A;  2XY8 A;  2J4R A;  3CM5 A;  4CJK A;  4ELT A;  1KXP A;  1Z26 A;  3WNE A;  4H0X B;  1EWQ A;  3DRP A;  1WN7 A;  3Q7C A;  3UE5 A;  3WT0 A;  4O4G A;  3SQ2 A;  4E0D A;  3HI0 A;  2E6L A;  3SI6 A;  4CEA A;  5K14 A;  1XQS C;  2BDP A;  2Q1N A;  4OPA A;  3ZX2 A;  5I3U A;  4BR2 A;  4IO8 A;  2HBK A;  3L2Q A;  3L2U A;  3G71 N;  4FJM A;  3SQ0 A;  4CZK A;  1WOQ A;  4DV0 K;  2BH1 A;  2OZM A;  4DV1 K;  3O9S A;  5AQL A;  4EHU A;  2YCH A;  2CGJ A;  2XY6 A;  5KPZ A;  5JS2 A;  1RT5 A;  2QWP A;  3FLC O;  2OTJ N;  1VQ5 N;  4JYA K;  3ATV A;  5KQD A;  3SPZ A;  3WXM B;  4KH6 A;  3VQ6 A;  3J81 O;  3KK3 A;  3ZSR A;  3DLR A;  1J5E K;  3VQ4 A;  3JXU A;  4B9U A;  4CEC A;  3HZ6 A;  4JKG B;  5B8H A;  3HT3 A;  4CCH A;  2ZE2 A;  4CEQ A;  3I0S A;  4WFB L;  1HNW K;  1RDA A;  2RHK A;  4FJJ A;  1B9F A;  3T3F A;  4IOC L;  1FW6 A;  3VQD A;  1C6V A;  1JCF A;  3TAB A;  1VQP N;  2OPS A;  5C10 A;  4WE1 A;  2NNW A;  1TK8 A;  3E01 A;  4OJR A;  3QEW A;  4RW9 A;  4XH4 A;  3KHY A;  4NB4 A;  3CJ9 A;  3F2K A;  5AQI A;  1BA1 A;  4CHN A;  1S5J A;  3O5B A;  3K9K A;  1KSP A;  3NFA A;  3HOS A;  1HPZ A;  3HTV A;  4FXD A;  4DTS A;  3AV9 A;  3A5L C;  3QLH A;  3QDK A;  1JXE A;  3THY A;  4CJU A;  5LMU K;  4FW1 A;  3O1W A;  4F3O A;  4UY8 O;  1NGH A;  1MA9 B;  1T3V A;  4H8K A;  3MEG A;  2FBT A;  3EZ5 A;  4AF1 A;  2IIR A;  3I56 N;  3QML A;  2NRT A;  4CE9 A;  4DS5 A;  1DT9 A;  4B3M K;  4E7H A;  3JYT A;  3OS0 A;  2B4J A;  4LF6 K;  5KPR A;  4JI2 K;  2HHH K;  5AR0 A;  3H3O B;  3N4P A;  4IFV A;  1HJO A;  4LF5 K;  4O5F A;  4KTW A;  3AVJ A;  1Z6R A;  4HWI A;  3NDK A;  1JJ2 M;  4M3U A;  2HHW A;  3U9D A;  1HJR A;  5GIN A;  2YNG A;  3ENB A;  3VQ5 A;  3R1X A;  3BZK A;  4JLH A;  2R7Y A;  2ZJR L;  5HRO A;  4DLE A;  4BDY A;  4FJI A;  2FC0 A;  4B1W B;  3ZT2 A;  4E19 A;  3CQY A;  3KTQ A;  5GIO A;  3CG7 A;  4DS4 A;  3AVN A;  3THY B;  3ZT1 A;  4C1N I;  1SUQ A;  4H4M A;  1IBL K;  3VEY A;  1IBM K;  3A8Y A;  3U3G A;  2AJQ A;  4OGE A;  3NH1 A;  4XEI A;  4CFD A;  3BZC A;  3PO4 A;  4BE0 A;  1TK5 A;  3O3G A;  4JHD A;  1V4T A;  4Y1C A;  4GV3 A;  3O80 A;  4JKA A;  4DTR A;  2YJF A;  4FJ8 A;  5I9E B;  2OZS A;  2NRX A;  1TUY A;  5F2R A;  4ID5 A;  2QKB A;  3I55 N;  4CGF A;  1BIZ A;  1NGA A;  4ZHR A;  2Q31 A;  3TAE A;  1B9D A;  2IVN A;  4I2Q A;  4Z4G A;  3CD6 N;  5ADX H;  3LDO A;  2DFF A;  1D8Y A;  2O8C A;  2E4L A;  2G8V A;  4IDK A;  4DG1 A;  1BL3 A;  3ASM A;  4HTL A;  4JK8 A;  3LZI A;  3EY1 A;  1NJZ A;  1FK9 A;  4JRQ A;  4PKG A;  4LC9 B;  4ICL A;  2WC9 A;  4DTN A;  1NJY A;  3M3Z A;  5AQJ A;  1JLQ A;  3VQP A;  4IWV A;  3DRS A;  2WOM A;  4CJ5 A;  4FJG A;  4DV6 K;  4C8L A;  3TI0 A;  1WBB A;  3MK6 A;  2P9P B;  4MO5 A;  3O4W A;  4JHD B;  3VN5 A;  3LWL A;  4QOZ B;  2P9I A;  1RTD A;  4ELU A;  4OPK A;  2O4G A;  5CZ1 A;  3VET A;  4M3T A;  3IUC A;  4BY9 C;  3O9Q A;  3F9M A;  2P9K A;  3L2V A;  2IC3 A;  5AQM A;  1RT6 A;  2P9U A;  3PV8 A;  4U7B A;  2E2P A;  2O8D A;  3FE1 A;  3WNH A;  5ELZ A;  2OYQ A;  3ULD A;  3AVI A;  1WNS A;  1WSH A;  2P1J A;  4KB0 A;  1QQN A;  3T1H K;  1S9G A;  4N56 A;  3VPZ A;  3VQC A;  4CER A;  4FWS A;  5FLX O;  4MFB A;  5BRD A;  2X74 A;  4FWK A;  3SK3 A;  2QTD A;  3MXI A;  3OJS A;  1NK9 A;  4WFN L;  4K8X A;  4CGI A;  3MN5 A;  2O8C B;  3K5O A;  3OYI A;  2VCP A;  4CFB A;  3ZT3 A;  4LF9 K;  5D3G A;  2NLX A;  5FPN A;  4DR3 K;  3CJC A;  1T6D A;  3VQ8 A;  2Y1J A;  3A5O C;  4DB3 A;  4C8O A;  1Q9Y A;  3QBX A;  2HHQ A;  3QFP A;  1A5W A;  3G0Z A;  3AGR A;  3PIO L;  2E1Y A;  3EL2 A;  3CFO A;  2QXL A;  2D0B A;  1LV5 A;  2E2O A;  2P9I B;  1S6Q A;  2XO7 A;  2F9T A;  2CGL A;  2ATQ A;  4WCE L;  1YJW N;  1VRT A;  4KH5 A;  1BWF O;  3LAN A;  1MWM A;  1NOY A;  1YHQ N;  3KIO A;  3KWI A;  3G10 A;  5CYM A;  1IG9 A;  2P9K B;  5JMV A;  2P9U B;  4E1J A;  4QS9 A;  3OA9 A;  2O8D B;  3K5L A;  1KFS A;  3MN7 A;  1VSE A;  1TVR A;  3P31 A;  4DLG A;  2E2N A;  2X78 A;  4CJE A;  4CZM A;  1A5V A;  1WSI A;  1S22 A;  3AA5 X;  1U6Z A;  4BRE A;  1S1W A;  4RW6 A;  4MLH A;  4JS4 A;  2ASM A;  1VK0 A;  3ZX0 A;  1EP4 A;  3CJB A;  1ZBF A;  1ZBS A;  4BR7 A;  2G8W A;  3T19 A;  4Z4H A;  3U8X A;  1S6P A;  3SAH A;  3AA4 A;  5JVH L;  4FVU A;  3VER A;  3NHG A;  4IG0 A;  4FJN A;  2GWJ A;  4H0O A;  3TAP A;  1NGD A;  4FLW A;  1U45 A;  4C8M A;  1NK4 A;  4JI8 K;  1QHT A;  3L0Q A;  4B1Y B;  3JSM A;  3PSI A;  4CBW A;  2KKZ A;  4JAX A;  1D9F A;  1S1V A;  4DSE A;  3W3D A;  3RVC A;  5A2Q O;  4DR4 K;  1BUP A;  5AQN A;  3DLH A;  4CF0 A;  1FKO A;  2B5J A;  4CF2 A;  3MCA B;  4K0K K;  3VEZ A;  3DYA A;  1LWF A;  2YNI A;  4FPA A;  1VQO N;  4MO4 A;  1YVN A;  2VWB A;  3V9U A;  4FWM A;  3ENO A;  3M5R A;  4I6M A;  1C1A A;  3ZCM A;  5C25 A;  4BR4 A;  4E3S A;  1QHA A;  1BCO A;  2HND A;  2RPI A;  3V81 A;  3CFR A;  4O0J A;  1HYS A;  1NGI A;  1T7P A;  1WAJ A;  3CIP A;  3ZX3 A;  3RSE A;  1Q7Y O;  4GVE A;  4DF8 A;  2Y1I A;  3WXJ A;  1NGE A;  2VGM A;  1IBK K;  3C6U A;  3QNN A;  1NKB A;  2YHB A;  1TL1 A;  1BG3 A;  1RT1 A;  2W6L A;  3D45 A;  4KHY A;  4DR5 K;  4OLA A;  1KRP A;  4ILJ A;  5SWM A;  2FF6 A;  3P1G A;  2BTF A;  1BIS A;  2HST A;  2PZS A;  1QQC A;  1RBR A;  3AVM A;  3CCS N;  2PAV A;  4L3Q A;  4BRI A;  4AHT A;  1HNZ K;  3SYZ A;  4LFC K;  1LAW A;  4WQ4 C;  5HRN A;  2HVI A;  2HOE A;  2VG6 A;  3G25 A;  3SQ1 A;  2F4V K;  3KWG A;  3K5N A;  1MWK A;  3DXM A;  4KRF A;  2I7P A;  5C15 A;  2GWK A;  3VQB A;  1N33 K;  3CYM A;  3V9X A;  5GAD P;  3O4N A;  1LWC A;  2I5J A;  4LD0 A;  1IG8 A;  3OYH A;  4WF9 L;  3K58 A;  4I6M B;  1TKX A;  4KB1 A;  5BPL A;  3GL1 A;  4CI6 A;  3U6F A;  4FYD A;  1RDW X;  5BN9 A;  4QS7 A;  3V9S A;  1XMQ K;  3RSE B;  1VSI A;  2YHY A;  4HCB A;  1QSS A;  4OO1 J;  4YY3 K;  4FJX A;  5E26 A;  2NRV A;  3NVM A;  2KW4 A;  3MDQ A;  5AQQ A;  4KV8 A;  3TTF A;  2HW3 A;  4NO7 A;  4AHS A;  1C0F A;  1D4X A;  3THW A;  2ASO A;  1Q81 O;  4CJ3 A;  3MXJ A;  3ULE A;  4G1Q A;  1GOA A;  3SPY A;  3OYG A;  3PX6 A;  2ETJ A;  4MDB A;  5CYQ A;  1WBD A;  3K0S A;  4B9V A;  4NLB A;  3TU5 A;  3BY5 A;  2QWN A;  3DXM B;  3LAL A;  3D0P A;  3FZK A;  4M3R A;  1JCE A;  4RTF D;  4A61 A;  3KLF A;  5F1X A;  3RMB A;  3JS6 A;  4FWO A;  4Z0U A;  3OHR A;  1JLG A;  2D5R A;  3SZ2 A;  4LFB K;  2ZJQ L;  1QZ5 A;  4DWI A;  3H45 C;  5M1N A;  4O0I A;  4JKC A;  1FKP A;  5AQF A;  1MU2 A;  1LW0 A;  4BRO A;  5IT9 O;  1VSK A;  5JLF A;  4JN4 A;  1L3T A;  3F73 A;  1NKE A;  3BEX A;  3FGU A;  1EQY A;  5AQG A;  3C7N A;  5M1Q A;  4GW6 A;  3ISN C;  5HRR A;  3ENH A;  1NU0 A;  3S3M A;  3IS9 A;  4JI1 K;  2Q3S A;  2QW9 A;  1XHX A;  1NGC A;  4H0T B;  2NRH A;  1ZYQ A;  1GLB G;  3THW B;  4DV5 K;  3KJV A;  3ULE B;  1QVF M;  3AO3 A;  3K2P A;  3WNG A;  1NK6 A;  1VSL A;  3NF8 A;  2Z1H A;  3V1O A;  4AHC A;  3E9P A;  4CIG A;  4J2D A;  3H08 A;  1BOT O;  4WYB A;  4N5S A;  1BQN A;  4DKW A;  3AVH A;  2Z1J A;  4KHW A;  2QWL A;  4CZF A;  2HF3 A;  1QS4 A;  3SCX A;  4CK3 A;  1TK0 A;  2ZJP L;  2PYJ A;  2QWQ A;  1Z05 A;  4JD2 A;  1XC9 A;  3LDL A;  5AFU H;  1N6Q A;  4PKH A;  3B8A X;  2DTU A;  4DQ8 A;  1OH8 A;  5E41 A;  4CIF A;  2YNF A;  1IV0 A;  2HBM A;  3SLC A;  4RW4 A;  1U2V A;  3VF6 A;  4EP5 A;  5FPM A;  2QKK A;  3C0B A;  5J2M A;  3C7N B;  3VQQ A;  1NMN A;  3DWL A;  2AP1 A;  2QWM A;  4M7X A;  3DLB A;  2NZT A;  4DTP A;  5T7B A;  2O8E A;  3CCE N;  4TSX A;  1ASV A;  3TAN A;  1E4F T;  3P5J A;  3WNF A;  1S1U A;  3IAY A;  3KLH A;  2HHT A;  3PX4 A;  4BVO A;  2G8U A;  5TKY A;  3L8B A;  1R59 O;  1CXU A;  2E20 A;  1UWB A;  4K42 A;  2HNZ A;  4PWD A;  3CJ1 A;  2IS3 A;  3ZT4 A;  1T8E A;  4DR2 K;  3CC2 N;  3O1B A;  4CJ4 A;  3THX A;  4CEB A;  4JD2 B;  4MDA A;  4AM7 A;  4DSJ A;  4KPY A;  4DR1 K;  1YIT N;  3EKS A;  1ZXO A;  4W5R A;  2HMI A;  3CJA A;  2E8A A;  5BRH A;  4FJ9 A;  4FM2 A;  4B9L A;  4AIL C;  1IJJ A;  5KI6 A;  4NYF A;  3TR8 A;  1HR0 K;  1L5U A;  1M1K O;  4O8U A;  1U2V B;  4KKO A;  1YVU A;  2GEM A;  4B1V A;  3QIC A;  2WBN A;  4A5A A;  1P8Z A;  3F9K A;  4FJH A;  1NGB A;  5AQK A;  1KAY A;  1RTH A;  4ISE A;  3CQ8 A;  4B1Z A;  2P5G A;  4JKF A;  3AA3 A;  3A0I X;  3O9T A;  4ILG B;  3U4L A;  3QFU A;  2O8E B;  3NBP A;  4GY2 B;  2W42 A;  3CMA N;  5HP1 A;  3LZJ A;  2HHS A;  5J1E A;  1IH7 A;  5J2Q A;  3TSQ A;  5FRN A;  2O8F A;  1WSG A;  2GX9 A;  1W2B M;  4JKD A;  3FZH A;  2QWR A;  4W5O A;  3O08 A;  4OKE A;  1VSJ A;  3O9U A;  4GMJ B;  3VQ7 A;  4X65 K;  3AA2 A;  4E7J A;  4BC2 A;  3THX B;  1N5Y A;  4M7Y A;  3TTC A;  3NGI A;  4DTM A;  4FJL A;  1UA0 A;  1HKB A;  1ATN A;  1J53 A;  1S72 N;  5BPM A;  3I33 A;  3VQE A;  1TKT A;  3OYE A;  3TAQ A;  5M1F A;  1WSJ A;  2NRW A;  3NGZ A;  3AVC A;  3LM9 A;  4DCH A;  3HRG A;  3RMC A;  4FLU A;  4QCL A;  5C12 A;  1NGJ A;  5BRE A;  4ZTF A;  3CCJ N;  2P5O A;  1VAZ A;  3ZLJ A;  4BG9 A;  3M8P A;  1ZBI A;  4CIE A;  2UXD K;  5KGW A;  5ADX A;  4OVL A;  1GLL O;  1XMO K;  3O4Q A;  4Z4C A;  5AQZ A;  1VQK N;  1BCM A;  2Z1G A;  2IAJ A;  5AQY A;  3MX5 A;  3CI5 A;  4CJT A;  4XIU A;  4DV3 K;  4V19 S;  1JCG A;  4O8K A;  3VA3 A;  4E1N A;  3AVG A;  4KHN A;  5EU7 A;  4BR0 A;  4DMN A;  2OA8 A;  2O8F B;  3HOT A;  5F0X A;  5KQ8 A;  4DF4 A;  1XC3 A;  3HSC A;  4AHU A;  1HMV A;  3O9R A;  3HM8 A;  1ZBH A;  3VEW A;  3SMS A;  3HXM A;  3BF3 A;  1K73 O;  4JI4 K;  3EN9 A;  3QNO A;  1ATR A;  1P90 A;  5LL6 Z;  4DHY A;  2OAN A;  4DQQ A;  4IEE A;  2FF3 B;  3VGM A;  4N41 A;  3SBT A;  4BQL A;  4BWJ A;  1H1V A;  4JK9 A;  3DMJ A;  3K57 A;  4KHQ A;  1GLD G;  3TTD A;  5JVG L;  1NJI O;  1DEJ A;  1JLA A;  4CZG A;  3DI6 A;  5IWA K;  3OYF A;  1S1X A;  3AO5 A;  4IDH A;  3DOL A;  1JLF A;  4JKE A;  3VTI A;  5M1P A;  2BUP A;  3G6E N;  3HP9 A;  4ID1 A;  4DFM A;  3V9Z A;  4CK1 A;  2A1R A;  1X9W A;  1KQS M;  1RGI A;  4EHT A;  1ITG A;  1NLV A;  1BO5 O;  1JLB A;  3CME N;  2HHV A;  1TAU A;  3RRG A;  1YXQ A;  2PYL A;  4CZI A;  3HVR A;  1E4G T;  1KVA A;  3QER A;  3FZL A;  4ILH A;  1XI1 A;  4DR7 K;  3BP8 A;  3WXL A;  3T7Z A;  1T44 A;  2AA4 A;  1YJN N;  1WSF A;  4CD3 A;  5GIP A;  1EXQ A;  4BR9 A;  3OYL A;  4DV4 K;  3VF4 A;  3OS1 A;  2VWK A;  4LF4 K;  3D2F A;  4BR5 A;  5BN8 A;  4CJF A;  4I9Q A;  5E84 A;  5FPE A;  1HYZ A;  1QQM A;  5AZJ A;  3HPO A;  3QET A;  4F4K A;  3EO3 A;  2UXC K;  1VQN N;  3FFK B;  1QQO A;  1Q9X A;  2NRZ A;  2YX6 A;  4IFE A;  4M3W A;  3M8R A;  3LP3 A;  1X1P A;  3HP6 A;  3CCU N;  1DKG D;  4KO0 A;  4X62 K;  3TPQ A;  4NCB A;  1QTM A;  4K43 A;  1I3A A;  1NK7 A;  1KLN A;  5GAE P;  3D6R A;  4WQ5 A;  3AAP A;  4K8Z A;  3OTO K;  2HHX A;  3AAQ A;  1LWE A;  4YHH K;  5I42 A;  4M3Z A; 
#chains in the Genus database with same CATH homology
 1EET A;  1RBR A;  1RIL A;  3AVM A;  4FVM A;  4W5N A;  2XY8 A;  2OPQ A;  1BQM A;  1JL2 A;  3CM5 A;  3T1A A;  4CJK A;  3L2R A;  4ELT A;  1Z26 A;  3WNE A;  1ASW A;  3K5M A;  3HK2 A;  3RR7 A;  3NGY A;  4AHT A;  1HNI A;  1TV6 A;  1TAQ A;  1WN7 A;  3DRP A;  2KFZ A;  3OYD A;  3SYZ A;  3KK2 A;  1G15 A;  1LAW A;  2ZD1 A;  4LSN A;  4O4G A;  4HUE A;  3SQ2 A;  5HRN A;  2XY5 A;  2HVI A;  4E0D A;  1ZBU A;  4YFU A;  2VG6 A;  2E6L A;  3SQ1 A;  3SI6 A;  4CEE A;  1B92 A;  2OPR A;  1C0U A;  1TL3 A;  4CEA A;  5K14 A;  3K5N A;  2BDP A;  2OPP A;  1RNH A;  3LDS A;  4KRF A;  3LPU A;  5I3U A;  1JXB A;  1VRU A;  1VSD A;  3VQB A;  3S9H A;  3CYM A;  5KTQ A;  3ALY A;  3DLK A;  3V9X A;  3S3O A;  3O4N A;  2VWJ A;  1LWC A;  4HUF A;  4CHO A;  1S9E A;  3NF7 A;  3V1Q A;  2I5J A;  4LD0 A;  3L2Q A;  4F8R A;  3OYH A;  3L2U A;  4KAZ A;  3SQ0 A;  4FJM A;  3K58 A;  3LWM A;  4Y1D A;  1SV5 A;  1TKX A;  1UAX A;  2RN2 A;  3LAM A;  4KB1 A;  3K59 A;  4CHY A;  4BDP A;  3U6F A;  4FYD A;  1J5O A;  2OZM A;  4RW7 A;  3V9S A;  1Q8I A;  1U4B A;  3EYZ A;  4B9S A;  4W5Q A;  4CFC A;  3QEI A;  2XY6 A;  1VSI A;  4KFB A;  4HCB A;  4Q0B A;  1SKW A;  4ZTJ A;  2KTQ A;  1QSS A;  4CF8 A;  4CJV A;  4FJX A;  3NAE A;  5JS2 A;  4CES A;  1RT5 A;  2IDO A;  1U49 A;  4KHS A;  2KW4 A;  4KV8 A;  2HW3 A;  4DU4 A;  5HBM A;  4AHS A;  1RBU A;  3SPZ A;  3HVT A;  1IKY A;  1NK8 A;  4N47 A;  5FRM A;  4ELV A;  3VQ6 A;  3KK3 A;  1BI4 A;  4DQR A;  1HRH A;  4CJ3 A;  3IG1 A;  3MXJ A;  3ZSR A;  1JLC A;  1GOA A;  3DLR A;  4G1Q A;  3VQ4 A;  4BDZ A;  3NF6 A;  4DU1 A;  3OYG A;  4CEC A;  3FFI A;  2RKI A;  3SUN A;  3SPY A;  3HT3 A;  1T03 A;  4B9U A;  4CCH A;  3PX6 A;  2DFE A;  2EHG A;  2ETJ A;  2ZE2 A;  4CEQ A;  4JS5 A;  3I0S A;  5CYQ A;  1RDA A;  4B9V A;  1B9F A;  1NJW A;  1RCH A;  4FJJ A;  4DQS A;  3T3F A;  4PY5 A;  1KCF A;  3SV3 A;  3RRH A;  3VQD A;  1C6V A;  3KD5 E;  1KFD A;  3LP1 A;  4E89 A;  3TAB A;  2GBZ A;  1BHL A;  3C6T A;  3ZSZ A;  2OPS A;  3QES A;  2G8H A;  1VSH A;  1WAF A;  4WE1 A;  1RT7 A;  2QXF A;  4CF9 A;  4O55 A;  3LAL A;  3D0P A;  4M3R A;  1TK8 A;  4I2P A;  3KLF A;  3RMB A;  3E01 A;  4CJS A;  4OJR A;  3QEW A;  1J54 A;  4Z0U A;  2HHU A;  4RW9 A;  4FJ5 A;  1JLG A;  2D5R A;  3SZ2 A;  3U3Y A;  3OYM A;  4CHN A;  1HQE A;  1S5J A;  1KSP A;  4CJP A;  4DWI A;  3NFA A;  2RF2 A;  3LP0 A;  4O0I A;  1FKP A;  1MU2 A;  1LW0 A;  2KZM A;  1VSK A;  1HPZ A;  4J2E A;  4FXD A;  4DTS A;  3AV9 A;  3C95 A;  3S3N A;  1L3T A;  3HPG A;  3F73 A;  2HB5 A;  1NKE A;  1TGO A;  3QLH A;  1JXE A;  2ZQB A;  4CJU A;  3RMA A;  1LAV A;  3MEE A;  5C24 A;  3AVA A;  4FW1 A;  1RBS A;  4GW6 A;  3ZSQ A;  3ISN C;  1RDD A;  5HRR A;  4F3O A;  3PUF A;  1K6Y A;  4LSL A;  3SJJ A;  3B6P A;  1NKC A;  4Z4E A;  3S3M A;  3L3U A;  4CHQ A;  3NH0 A;  3HPH A;  4NCA A;  3IS9 A;  1RT2 A;  4OGC A;  2Q3S A;  4H8K A;  1XHX A;  4M3X A;  1ZYQ A;  3MEG A;  5DK5 A;  2FBT A;  3EZ5 A;  5C42 A;  4AHR A;  1BI4 B;  4B9M A;  4Z4F A;  4FLX A;  3KJV A;  4CE9 A;  3AO3 A;  3K2P A;  4BWM A;  3WNG A;  5KGX A;  3O3F A;  4DS5 A;  1VSL A;  3LAK A;  1NK6 A;  3NF8 A;  1Y97 A;  1X9S A;  2Z1H A;  3V1O A;  1IKX A;  4AHC A;  3JYT A;  4CIG A;  4E7H A;  3B6O A;  4DU3 A;  4J2D A;  3H08 A;  3OS0 A;  4FZY A;  2B4J A;  3LPT A;  4L8R B;  4N5S A;  1BQN A;  4B9N A;  3AVH A;  2Z1J A;  1FXX A;  4KHW A;  5FRO A;  1REV A;  3NH2 A;  1QS4 A;  3SCX A;  1SL1 A;  4CK3 A;  1TK0 A;  1RT3 A;  5KRS A;  4IFV A;  4KRE A;  2PYJ A;  2D0A A;  3QEV A;  4PQU A;  4OKK A;  4KTW A;  3AVJ A;  3NDK A;  1XC9 A;  4KI4 A;  2KQ2 A;  4OKJ A;  3AO2 A;  2G8F A;  4M3U A;  2HHW A;  1HJR A;  4DFJ A;  1N6Q A;  3TAR A;  2YV0 X;  4DFP A;  2X6N A;  5J2P A;  4CJQ A;  2YNG A;  3DOK A;  3VQ5 A;  2DTU A;  2NUB A;  1GOB A;  3SV4 A;  4GVM A;  4LH4 A;  5E41 A;  4AH9 A;  4F2S A;  4JLH A;  4KHU A;  2R7Y A;  4CIF A;  3CM6 A;  2YNF A;  5HRO A;  4DLE A;  3KKR A;  4CGG A;  4RW4 A;  4BDY A;  4FJI A;  4KTQ A;  2FC0 A;  2GV9 A;  3ZT2 A;  4E19 A;  3KTQ A;  4EP5 A;  2QKK A;  1TKD A;  3KLG A;  1CXQ A;  3CG7 A;  4DS4 A;  2Z1I A;  2F96 A;  3AVN A;  4DFK A;  5J2M A;  4DSL A;  1SKR A;  3ZT1 A;  4IKF A;  3VQQ A;  1I39 A;  4CJL A;  4HVJ A;  2G8I A;  1SUQ A;  2JLE A;  4H4M A;  3VQA A;  1J9A A;  3UIQ A;  3DLB A;  3U3G A;  2PY5 A;  2AJQ A;  4OGE A;  2DFH A;  3NH1 A;  4DTP A;  3OYJ A;  5J2N A;  5T7B A;  4CFD A;  1A5X A;  4BE0 A;  1TK5 A;  3PO4 A;  3NF9 A;  3RMD A;  4TSX A;  1IKW A;  3O3G A;  1ASV A;  3TAN A;  4Y1C A;  4FW2 A;  3P5J A;  3RR8 A;  5HRP A;  2BE2 A;  1R0A A;  1U48 A;  3WNF A;  4HUG A;  1S1U A;  4FLT A;  4DTR A;  3QIO A;  1S1T A;  1NK0 A;  3IAY A;  3KLH A;  2HHT A;  1C1C A;  3PX4 A;  4FJ8 A;  3V4I A;  3A2F A;  2G8U A;  1YTU A;  2KFN A;  2OZS A;  3L8B A;  3VQ9 A;  1CXU A;  3TAF A;  1CZB A;  1UWB A;  1RDC A;  2HNZ A;  3SNN A;  3OJU A;  4HTU A;  4PWD A;  2IS3 A;  3ZT4 A;  1T8E A;  1ZBL A;  4Z4I A;  3PY8 A;  4E7K A;  1JL1 A;  4ID5 A;  2QKB A;  1XWL A;  4CGH A;  4BE2 A;  3SUO A;  4CGF A;  1NJX A;  2YKN A;  1BIZ A;  1HYV A;  5CY4 A;  4CJ4 A;  4ZHR A;  4PUO A;  3DLG A;  3MED A;  4CEB A;  4LY7 A;  3TAE A;  3PX0 A;  4M45 A;  4Q5V A;  1KLM A;  4DSJ A;  2X6S A;  3V6D A;  1B9D A;  4KPY A;  1SL0 A;  1YT3 A;  4I2Q A;  3HM9 A;  4DSI A;  4Z4G A;  4W5R A;  2HMI A;  2F8T A;  2XY7 A;  1W0H A;  5HRS A;  3HO1 A;  4FJ9 A;  2DFF A;  3DM2 A;  4FM2 A;  4B9L A;  4AIL C;  1D8Y A;  4M41 A;  3NE6 A;  3L2W A;  2E4L A;  4NYF A;  5KI6 A;  3TR8 A;  2G8V A;  4IDK A;  4DG1 A;  1L5U A;  4J2B A;  1BL3 A;  3ASM A;  1HQU A;  4H4O A;  3LZI A;  1KTQ A;  2HNY A;  3EY1 A;  4EP4 A;  2XRI A;  1NJZ A;  4KKO A;  1U47 A;  1FK9 A;  1YVU A;  3OYA A;  4JRQ A;  3F9K A;  1QE1 A;  3TAM A;  4FJH A;  4ICL A;  4DTN A;  4PA1 A;  1VSF A;  1W9H A;  4N76 A;  1GOC A;  4FLV A;  1NJY A;  3KK1 A;  1U04 A;  4EZ9 A;  1JLQ A;  1RTH A;  3THV A;  3RWU A;  2DY4 A;  3VQP A;  4B08 A;  3DRS A;  2WOM A;  1VSM A;  3QIP A;  4CJ5 A;  3OY9 A;  3CQ8 A;  4C8L A;  4FJG A;  4DQP A;  3P83 D;  4O44 A;  3TI0 A;  2P5G A;  2VG7 A;  3AA3 A;  3KLI A;  4CED A;  3LWL A;  3VN5 A;  4CHZ A;  4FK4 A;  4QOZ B;  3NBP A;  4AHV A;  2W42 A;  1RTD A;  2HHS A;  5HP1 A;  3LZJ A;  5J1E A;  4F3T A;  4B8C A;  1KVC A;  2FBX A;  1IH7 A;  5J2Q A;  2XHB A;  4ELU A;  4KI6 A;  2BGG A;  1O1W A;  4OPK A;  5FRN A;  2O4G A;  2GUI A;  4MQ3 A;  5CZ1 A;  3KKS A;  1IKV A;  1WSG A;  3AVK A;  3ZSW A;  3OS2 A;  4M3T A;  1QSL A;  4HHT A;  4B9T A;  5DMR A;  3L2V A;  2IC3 A;  1RT6 A;  3PV8 A;  1NOZ A;  4W5O A;  4OKE A;  1VSJ A;  4DQI A;  3LP2 A;  3WNH A;  2OYQ A;  2FBY A;  4GMJ B;  3VQ7 A;  3AVI A;  1WNS A;  3ULD A;  3AA2 A;  1WSH A;  2P1J A;  3I0R A;  2E6M A;  4E7J A;  4DSF A;  1UA1 A;  1S9G A;  1N5Y A;  4KB0 A;  2LSN A;  3VQC A;  4CER A;  4N56 A;  3NGI A;  1C0T A;  4DTM A;  1UA0 A;  1SKS A;  4FJL A;  5SZT A;  4CFA A;  3SQ4 A;  2YHA A;  4MFB A;  2ITG A;  2X74 A;  1NK5 A;  4FK2 A;  1BGX T;  1J53 A;  3ITH A;  3OYE A;  3SUQ A;  3VQE A;  1TKT A;  3TAQ A;  3MXI A;  4FM1 A;  4FZZ A;  4FJK A;  4M42 A;  3OJS A;  1WSJ A;  3ZT0 A;  2BAN A;  3NGZ A;  1NK9 A;  4CGI A;  4K8X A;  3ZSO A;  3AVC A;  1YTA A;  1QSY A;  3RMC A;  4DTX A;  1UOC A;  3K5O A;  3M8Q A;  3OYI A;  4FLU A;  4CFB A;  3PO5 A;  4O5B A;  4QCL A;  3DLE A;  3ZT3 A;  2IGI A;  1RTI A;  3HJF A;  5D3G A;  4ZTF A;  2P5O A;  2D0C A;  3V1R A;  3M8P A;  1ZBI A;  4CIE A;  5KGW A;  2Y1J A;  3VQ8 A;  3OYB A;  2KZZ A;  4OVL A;  1EX4 A;  3O4Q A;  2HVH A;  4CEZ A;  1Q9Y A;  4C8O A;  2HHQ A;  4Z4C A;  1D9D A;  1A5W A;  3G0Z A;  1BCM A;  2Z1G A;  2IAJ A;  3HST B;  3CFO A;  2EX3 A;  1LV5 A;  2D0B A;  4CJT A;  4XIU A;  3CFP A;  1X9M A;  2XO7 A;  1S6Q A;  4HCC A;  4DTJ A;  3AVL A;  1XHZ A;  3VA3 A;  4E1N A;  3AVG A;  1TKZ A;  3HL8 A;  4KHN A;  5EU7 A;  4B3O A;  2ATQ A;  4DMN A;  3M8S A;  2OA8 A;  4CEO A;  3OYC A;  4FCY A;  1VRT A;  1ASU A;  4IFY A;  1DLO A;  3LAN A;  4J2A A;  4DF4 A;  1NOY A;  4AHU A;  1HMV A;  3BGR A;  3KIO A;  3G10 A;  1ZBH A;  5CYM A;  4R5P A;  4E7L A;  4BE1 A;  1IG9 A;  3BDP A;  1DTQ A;  1C0M A;  2IOC A;  4E1M A;  1RT4 A;  1SL2 A;  3HXM A;  4I7F A;  2F8S A;  3RTV A;  3K5L A;  1L3V A;  3ZSV A;  1KFS A;  1LW2 A;  4F2R A;  3QNO A;  3SUP A;  1VSE A;  1TVR A;  4OPJ A;  3TAG A;  4DLG A;  2X78 A;  4DQQ A;  5JS1 A;  4CJE A;  4DSK A;  2FBV A;  1A5V A;  4N41 A;  1HNV A;  4BWJ A;  1WSI A;  1EKE A;  4W5T A;  3DMJ A;  3AA5 X;  3K57 A;  4KHQ A;  2YKM A;  1RTJ A;  4QAG A;  4RG8 A;  4CGD A;  1JLA A;  1S1W A;  4RW6 A;  3QEX A;  4JS4 A;  3KD1 E;  1VK0 A;  3DI6 A;  4YNQ A;  4E7I A;  3OYF A;  1S1X A;  3AVB A;  3AO5 A;  3DOL A;  1JLF A;  1EP4 A;  2JGU A;  4CJR A;  3AO4 A;  3MAQ A;  1ZBF A;  3V9W A;  3HP9 A;  4ID1 A;  4CK2 A;  3V9Z A;  4CK1 A;  4DFM A;  2A1R A;  1X9W A;  4OLB A;  2G8W A;  3T19 A;  4IBN A;  4Z4H A;  3VA0 A;  4DTO A;  3L3V A;  1S6P A;  1ITG A;  4IG3 A;  1JLB A;  3O3H A;  3AA4 A;  3AO1 A;  2HHV A;  1TAU A;  3RRG A;  3NHG A;  4IG0 A;  4FJN A;  2PYL A;  4CGJ A;  3HVR A;  3TAP A;  4CF1 A;  2A1S A;  4FLW A;  1U45 A;  4C8M A;  1NK4 A;  1DTT A;  1KVA A;  4NCG A;  4FM0 A;  3QER A;  3TWH A;  1QHT A;  1KVB A;  1XI1 A;  3JSM A;  4KTZ A;  2WON A;  1D9F A;  1S1V A;  4JRP A;  4DSE A;  1WSF A;  4BAC A;  1T05 A;  5KRT A;  1WSE A;  3KLE A;  1RBV A;  1RBT A;  1EXQ A;  3DLH A;  4CJW A;  3IRX A;  3OYL A;  3OS1 A;  3AVF A;  1IO2 A;  2VWK A;  1CLQ A;  4FZX C;  1WLJ A;  2P51 A;  1C1B A;  2VG5 A;  3ZSY A;  4CF0 A;  1FKO A;  5FDL A;  1L3U A;  2B5J A;  4CJF A;  4CF2 A;  4I9Q A;  3HYF A;  3DYA A;  5CZ2 A;  1LWF A;  2YNI A;  1HYZ A;  4I9L A;  4FJ7 A;  1D5A A;  3QO9 A;  4CHP A;  3NCI A;  3HPO A;  3OYN A;  3QET A;  4F4K A;  3MXM A;  3V9U A;  1RDB A;  1Z25 A;  3OYK A;  1C1A A;  3ZCM A;  5C25 A;  2QK9 A;  4E3S A;  4NYN A;  1BCO A;  3OVN A;  2HND A;  2RPI A;  3DRR A;  3MEC A;  3V81 A;  1F21 A;  3CFR A;  3QIN A;  1CZ9 A;  4O0J A;  1Q9X A;  2G8K A;  1HYS A;  1T7P A;  4EZ6 A;  1WAJ A;  4B8A B;  3M8R A;  4M3W A;  3LP3 A;  3C94 A;  1X1P A;  4DTU A;  4M3Y A;  3HP6 A;  4FLY A;  4KO0 A;  4DF8 A;  4FLZ A;  1JKH A;  2Y1I A;  3I8D A;  5HLF A;  4NCB A;  1QTM A;  1I3A A;  4UQG A;  3C6U A;  3ZSX A;  3QNN A;  1NK7 A;  1NKB A;  2YNH A;  2YHB A;  1TL1 A;  1KLN A;  1RT1 A;  3D45 A;  4LH5 A;  1L3S A;  2O4I A;  4KHY A;  4C8N A;  4C8K A;  4OLA A;  1KRP A;  4K8Z A;  1BIU A;  4RW8 A;  5SWM A;  1JLE A;  2HHX A;  1LWE A;  3P1G A;  3QEP A;  4CEF A;  4FK0 A;  5I42 A;  1BIS A;  2PZS A;  1QQC A;  4M3Z A;  2B6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...