4CESA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cesA00
4Z4FA 2WOMA 2Z1HA 3P1GA 4J2DA 2ZD1A 1Q9YA 4NCAA 3OYCA 4CGDA 5HRRA 1UOCA 1JLBA 4GW6A 4CJKA 1LW2A 4H8KA 1J54A 3SZ2A 4AHTA 1UA0A 3PO4A 2BANA 3CM6A 3K5LA 3F9KA 4FW2A 2DFEA 3ZCMA 3L2UA 4CEZA 1U49A 4B08A 2X78A 2IAJA 3OYLA 1D5AA 3OVNA 1VSJA 3AA5X 4ID5A 2QKKA 4FZXC 3TANA 1BQNA 2JLEA 2D0AA 3L2VA 2IDOA 3MEEA 4DTMA 2D0BA 1T8EA 1FKOA 4NYFA 4CEDA 4FJ8A 3ISNC 4FLTA 5C25A 3KK1A 5CZ1A 3DLGA 3KKRA 4CJQA 4E7IA 1U47A 4DFKA 3RMDA 4DFPA 3O3FA 3OJSA 3VA3A 3PX0A 1X9SA 4NYNA 2KFZA 4O5BA 2YNIA 3O3GA 3L3VA 4W5RA 3LWLA 1XWLA 2HHVA 3HSTB 2GUIA 4KRFA 3HPHA 4CEAA 3V81A 4B9MA 3V1OA 3EYZA 1IH7A 1JLQA 3PO5A 1S1WA 1RILA 1C1CA 3VQQA 3AO5A 4FLZA 4CK1A 4W5QA 1IG9A 4DSJA 4EZ6A 3I0RA 4FYDA 4FJGA 4KKOA 1WLJA 3T19A 4FCYA 4W5NA 4J2BA 3OS2A 4CF1A 4AHSA 1BCOA 2YNGA 3AA4A 3ZSZA 4FJ7A 3MXIA 2ITGA 3NHGA 4HTUA 3TWHA 3SCXA 3KTQA 4BDPA 1S5JA 1WSJA 4HCCA 3RMCA 2RN2A 3VQEA 4Q5VA 2LSNA 1UA1A 1KRPA 1QQCA 4M3ZA 4IBNA 4FJLA 4NCGA 1RT2A 4KB0A 4M3RA 4FK2A 4B9LA 3VQPA 4F8RA 1BGXT 4DTOA 4FJ9A 3SUPA 2Z1GA 2KTQA 1MU2A 3DOLA 4M45A 4I2PA 4DFMA 1KVAA 1KSPA 3NE6A 4MQ3A 2KW4A 4BDZA 3PX4A 1UAXA 3B6PA 4CJSA 3OS1A 1TL3A 3KLFA 2PYJA 3TR8A 4EZ9A 1C6VA 3CQ8A 1QTMA 3TAEA 1SKSA 3KD1E 5KGWA 5HRNA 3QNOA 3QLHA 2JGUA 5FRMA 3TAMA 3OS0A 5DK5A 3K5NA 3HVTA 1NK7A 4XIUA 5D3GA 3SUNA 4DMNA 1WNSA 4N41A 4LH5A 4JLHA 1NJZA 3SQ2A 2DY4A 1RBVA 2BE2A 1CZBA 1SL1A 3DI6A 2Q3SA 4LH4A 3AO2A 4BACA 3DRRA 1CZ9A 4GVMA 3WNFA 3RR7A 2HW3A 1HNIA 4CHZA 3G0ZA 3OYKA 4Z4GA 1EKEA 3LPUA 4UQGA 4FJXA 4CJEA 4FM2A 3AVBA 3OYJA 4DTNA 4KHQA 4KHWA 1ASWA 1QS4A 1IKVA 3V1QA 4OPKA 2O4IA 1HYZA 2QKBA 1A5WA 5DMRA 2E6MA 4C8NA 1RTIA 1KCFA 2HB5A 3DRSA 3NGIA 3VQDA 1J53A 4CJ4A 4EP5A 3AO1A 3K57A 3K5OA 3LANA 3NDKA 5I3UA 1JLFA 3TARA 1NK9A 3HP9A 4KHSA 3NF9A 2QK9A 1W9HA 2F8SA 3DYAA 4K8XA 3CM5A 1TAUA 3LP2A 2GBZA 2KQ2A 4ID1A 4E1NA 4KTWA 4HCBA 3NGZA 1FKPA 4KI4A 2HHSA 1S9GA 3CG7A 3LDSA 3BDPA 4H4MA 4E3SA 4J2AA 1KVCA 3C6TA 2Z1JA 1TAQA 2G8VA 1JLGA 1N5YA 4CFBA 3V4IA 2PYLA 4DQQA 4M42A 4CJLA 1ZYQA 2P5OA 5CY4A 2A1RA 1S1TA 1KFSA 1YT3A 1U45A 4AHRA 1CLQA 3LP3A 4RW9A 4CJPA 4IG3A 4AH9A 4OJRA 2XY5A 5J2MA 4DU1A 1T7PA 2YV0X 1TKZA 1F21A 3WNEA 3D0PA 3IS9A 3QEPA 4AILC 5HRPA 3ITHA 4B9VA 3LAMA 2Y1IA 3E01A 3DLBA 1J9AA 5FRNA 4LSNA 1VSIA 3MECA 4I9LA 5CZ2A 4DTSA 5J2PA 1L3TA 4N47A 2RKIA 4DF4A 3SUOA 3AVAA 3MXJA 3WNHA 3CFPA 2EX3A 4DFJA 4E19A 3KLHA 3LP0A 4FJNA 3L8BA 3KK3A 2YNHA 3V9ZA 1L3SA 1J5OA 3RRGA 3AVLA 1JLEA 4JRPA 2VG7A 5SWMA 4Z4HA 3OYEA 3S9HA 1EXQA 1IO2A 2P1JA 1NOYA 1D9DA 1BCMA 1KTQA 2E6LA 1WSIA 1ASUA 1BIUA 4OLAA 1VSHA 4F3OA 3M8RA 5HBMA 2VG5A 3LP1A 1LAVA 1IKWA 2XY7A 4E7LA 4E0DA 4O4GA 3C6UA 3JSMA 3HYFA 3NF8A 4JRQA 4ELVA 4BE2A 1HQEA 1ZBUA 3QIPA 3T3FA 4FK4A 2IGIA 3AVJA 3P83D 4K8ZA 1EP4A 2B4JA 4O0JA 4RG8A 3ZSYA 4JS5A 4FJMA 3OYIA 1JLCA 4N5SA 4KAZA 2IS3A 2R7YA 1RT3A 3OYNA 1TV6A 2BDPA 4M3YA 4IG0A 1KLMA 3HT3A 4M3XA 5FDLA 3VQ9A 5K14A 3AA3A 3FFIA 5KTQA 4DSEA 3L3UA 1R0AA 4L8RB 4W5TA 2D0CA 1T05A 3L2WA 1NKCA 3QINA 1QSLA 1BHLA 1VSKA 4B9SA 1IKXA 3SV4A 3AVGA 2YHBA 3RRHA 3SPYA 1K6YA 3RR8A 2ATQA 3BGRA 4OKJA 3OYBA 4CGHA 3OYAA 2P5GA 4F3TA 4QOZB 3ZSQA 4DTPA 3KKSA 4FLWA 4OGCA 3AVHA 4OKKA 3K59A 1TKDA 3A2FA 1RTHA 3NAEA 2HHWA 3TAGA 3VQBA 3B6OA 3QO9A 3ZSXA 5HROA 5KRSA 4F4KA 3AVNA 5JS2A 1HNVA 4R5PA 4OPJA 2DFFA 2I5JA 3DM2A 4AHUA 1D9FA 4DQIA 3SQ0A 4F2SA 1KFDA 1C0TA 1Q9XA 4CHPA 2F8TA 3HJFA 1HPZA 4KFBA 1VSMA 2KZMA 1TK0A 1SL0A 3P5JA 1C0MA 3K58A 3NH2A 2G8FA 1DTTA 4ELTA 4KB1A 2IC3A 3M8PA 4HUEA 4CCHA 3CYMA 1NK4A 2FBTA 1LV5A 2HMIA 1EX4A 4CJUA 3HK2A 4B3OA 3ZSRA 1X1PA 4QCLA 3HL8A 1NKEA 1VSEA 5E41A 1I3AA 1WSHA 4DTRA 2D5RA 3SNNA 4C8MA 3TAQA 5C24A 1XHXA 4DSLA 4FVMA 2RF2A 1SL2A 5C42A 3RMAA 2HNDA 3HM9A 4ZTFA 4KHNA 3DRPA 4YNQA 4LSLA 2O4GA 3G10A 3HO1A 3SPZA 3LZJA 3CFRA 4DTUA 3U6FA 5KRTA 4IDKA 3VN5A 4W5OA 4DTXA 4M3UA 4CEOA 3DMJA 3MEDA 4Y1DA 3OYHA 3QEIA 5JS1A 1NJXA 2FBYA 2RPIA 4WE1A 5EU7A 4N56A 4DF8A 1QE1A 2GV9A 1SKWA 3TI0A 4HVJA 3AVMA 3NH0A 1WSGA 2ETJA 3ZSOA 4DS5A 2KZZA 2OPSA 1X9WA 2HNYA 4Q0BA 1BI4A 1ITGA 2AJQA 3WNGA 1S6QA 3IG1A 1QSYA 1S1UA 2G8UA 1RBRA 3RTVA 3L2QA 1LWCA 3QIOA 3ALYA 4BE0A 4B8CA 4KTZA 1JXBA 4GMJB 3SQ4A 3AVIA 4ICLA 4OKEA 3SV3A 4KPYA 1NJYA 3OYDA 5J2QA 3PV8A 3I8DA 2PZSA 3DLRA 1NOZA 5J2NA 3TAPA 4KTQA 2OZSA 4E7KA 3QEXA 1W0HA 4O55A 3SQ1A 3ZT0A 4CF2A 3KK2A 1TGOA 2XY8A 1X9MA 1RTJA 3T1AA 3SJJA 4PWDA 4HUGA 4KV8A 2EHGA 3EZ5A 1TKTA 4CGFA 4CJFA 1NK0A 1B92A 2HVIA 1C1AA 3M8SA 3LWMA 1RT7A 3NCIA 4CIEA 1NK8A 4OVLA 3DLEA 4H4OA 5CYMA 1VRTA 1SV5A 1HYVA 3OY9A 1Q8IA 4FLXA 4PY5A 3KLGA 4B9TA 3NH1A 1RBTA 3ZSVA 1RT1A 1NK6A 4CJVA 4M3TA 3MXMA 3VQ6A 4DSKA 4CF0A 1GOBA 4Z4EA 4E7JA 1RBUA 4CF8A 1I39A 1WSEA 2W42A 1JXEA 3OYGA 2VWJA 1S1XA 3K2PA 1ZBIA 3KD5E 4KO0A 4RW6A 1ZBHA 4M41A 4HHTA 1LWEA 1QHTA 2E4LA 1U4BA 4Z4IA 1Z26A 4HUFA 4RW8A 3SUQA 1TK5A 2IOCA 2P51A 5KI6A 3U3GA 1NK5A 2F96A 1S1VA 4CJRA 2G8HA 1D8YA 3VQ5A 3DLKA 4CGJA 1EETA 1WSFA 2HHXA 3IAYA 1KLNA 3LAKA 5HRSA 2ZQBA 3VQ8A 4CGGA 4Z0UA 4I2QA 1XHZA 1C1BA 2X6SA 4DQRA 3QESA 3RMBA 2OPRA 2PY5A 4FXDA 3LPTA 3NFAA 3V9SA 3F73A 3AO4A 4I7FA 1JKHA 5CYQA 4FZYA 4E89A 1FXXA 3AVCA 4IFVA 4ELUA 3ZT3A 2FC0A 4CEQA 1RDCA 5T7BA 4DSIA 4CHNA 2DTUA 4O0IA 4TSXA 3ULDA 2VWKA 2X6NA 1Z25A 2Z1IA 4MFBA 4CK3A 4DSFA 1HYSA 4CGIA 3HXMA 2YKNA 1RDDA 3ZT4A 3ASMA 1JL2A 5FROA 3HP6A 4DTJA 5HP1A 4DWIA 4Z4CA 2FBXA 1UWBA 4CFCA 1CXQA 1VSLA 3C94A 4CJTA 4FJHA 4FLVA 3QERA 3THVA 1QSSA 3U3YA 2ZE2A 1S9EA 3NBPA 1L3VA 5SZTA 4FM1A 2OA8A 1LW0A 1WAFA 3CFOA 1HMVA 3ZSWA 1RCHA 4CE9A 4DQPA 2BGGA 2QXFA 4M3WA 4CFAA 3S3NA 1NJWA 4E1MA 4FM0A 3LALA 3KIOA 4DLEA 3M8QA 4FJIA 1G15A 4FZZA 3KJVA 1YTAA 4B9UA 1FK9A 2NUBA 2XHBA 1XC9A 4RW4A 2HHTA 4KI6A 4CIGA 3EY1A 1B9FA 4NCBA 2HNZA 4CEFA 1XI1A 3NF6A 4JS4A 1VSFA 1B9DA 2DFHA 4E7HA 4I9QA 1NKBA 3AA2A 4IKFA 4YFUA 4FJJA 4PUOA 3ZT2A 1JL1A 3K5MA 4CEBA 3O3HA 3NGYA 3PUFA 4ZHRA 1L5UA 3PY8A 4CEEA 3S3OA 3O4NA 1TVRA 2WONA 4DQSA 2Y1JA 2G8KA 1VRUA 4DG1A 2HHQA 4DS4A 1DLOA 4BWMA 4AHVA 3S3MA 4PQUA 1BISA 4DU4A 1ASVA 3OJUA 4EP4A 4CJ3A 4LY7A 4KREA 2XY6A 1U48A 2B5JA 1TK8A 1HRHA 5HLFA 3MAQA 3AV9A 2G8IA 3KLIA 1RT4A 1A5XA 4CHOA 3KLEA 3TAFA 3I0SA 3SYZA 4CF9A 3TABA 2G8WA 4B9NA 2A1SA 1VK0A 4FLYA 4FJ5A 3VQ4A 3IRXA 4N76A 4CJ5A 1HJRA 2OYQA 4BDYA 4OLBA 1REVA 3DOKA 3O4QA 2YNFA 1BQMA 3LZIA 1YTUA 3VA0A 1RBSA 2OPPA 1C0UA 4CERA 1U04A 4CESA 4ZTJA 3ZT1A 3MEGA 1KVBA 3QNNA 1JLAA 1N6QA 4BWJA 1O1WA 3AVFA 2VG6A 4LD0A 3OYMA 2XO7A 1GOAA 3QEWA 4OGEA 4FK0A 4DU3A 1WAJA 1RTDA 1GOCA 3V9WA 1YVUA 3L2RA 3AO3A 3QETA 2KFNA 3JYTA 1RNHA 1S6PA 2X74A 1T03A 1Y97A 5J1EA 3HPOA 1ZBFA 3D45A 3SI6A 4KHYA 4B8AB 4DLGA 4FW1A 3V9UA 2YKMA 3QEVA 3VQCA 3DLHA 1SKRA 1L3UA 4KHUA 3RWUA 2XRIA 4C8LA 4O44A 1TKXA 5I42A 1IKYA 1A5VA 4Y1CA 3VQ7A 1ZBLA 1DTQA 1HQUA 1WN7A 1RT6A 2B6AA 4FJKA 4CHYA 1RT5A 1LWFA 4CFDA 1TL1A 1CXUA 4C8KA 4F2RA 3V6DA 4BE1A 1RDAA 2FBVA 3NF7A 3OYFA 2HHUA 4CHQA 4FLUA 4CIFA 3H08A 1BIZA 1SUQA 3HPGA 5KGXA 3C95A 1VSDA 4G1QA 4IFYA 3UIQA 4CECA 4C8OA 2HVHA 4J2EA 3HVRA 4CK2A 3V9XA 1BL3A 1BI4B 4PA1A 3PX6A 4QAGA 4CJWA 2OZMA 1LAWA 1RDBA 2YHAA 2OPQA 3AVKA 3V1RA 3VQAA 4RW7A 4AHCA
chains in the Genus database with same CATH superfamily
4AM6A 4Z4FA 4X66K 4J2DA 1Q9YA 4KH5A 4J8FA 5C0YA 4H8KA 1J54A 3FZHA 3SZ2A 3PO4A 4JK7A 5AQJA 4BR5A 2DFEA 3ZCMA 1OH6A 3L2UA 4NXNK 4CEZA 1SQKA 2IAJA 4WFBL 3TANA 2JLEA 2UU9K 2IDOA 4B1UB 3CERA 4NYFA 4FLTA 4CJQA 3KKRA 3O9TA 4DFPA 2KFZA 3VTIA 3OTOK 4BC3A 3R8EA 4CEAA 4B9MA 1WOQA 3V1OA 3EYZA 1IH7A 1S1WA 3H1QA 4FLZA 1IG9A 2P9KB 3AO5A 3BEXA 3HOSA 2F7TA 4J2BA 1QQOA 4LF4K 3H3OB 2ZJPL 4JKHA 4JKDA 4GKKK 2WC9A 3MXIA 3KTQA 4HCCA 2YX6A 2RN2A 1UA1A 1Z6RA 1QQCA 3P38A 1NM1A 1RT2A 3FZLA 4WCEL 1NG9A 3VQPA 5GAGP 1VAZA 1BGXT 4NLBA 4JI2K 1KVAA 4OPHA 4BDZA 3DWLA 4WQ4C 1QTMA 5CHIA 5HRNA 3QNOA 5TKYA 1YHQN 4PKHA 1K8KA 5FRMA 5DK5A 5D3GA 3SUNA 4RWTA 1NJZA 3AY9A 1RBVA 3O9QA 1CZBA 3DI6A 1BA0A 4WQ4A 5GIPA 3CCRN 3RR7A 4GVMA 2HW3A 1S72N 1BWFO 4YOUA 4NXMK 4H0YB 3DXKB 2GEMA 4BRGA 5AQWA 4CJEA 3RSEA 3K9JA 4CJ7A 4KHQA 4KHWA 1YF5L 5KPZA 3L0QA 3WUHA 1QS4A 1NWKA 3J81O 1HYZA 2QKBA 1C0GA 3PLAA 2HB5A 3QFPA 3NGIA 1KQSM 3VQDA 2QWNA 4IZ9A 3R3LA 3TARA 5IT9O 3NF9A 3DYAA 4IOXA 1TAUA 2GBZA 2GWKA 3LDSA 4J2AA 4E3SA 1JCFA 2Z1JA 2G8VA 5FLXO 2QWPA 4BGAA 4CFBA 1N5YA 2QWRA 4FWMA 2PYLA 4JV5K 5AQFA 1U45A 1CLQA 3LP3A 4RW9A 3D2EA 4CJPA 3CCUN 4OJRA 4BC4A 3SAGA 2XY5A 1T7PA 3AAQA 4FWRA 2YV0X 2P9IA 3ITHA 2Y1IA 3CI5A 1HKCA 4A62A 1L3TA 3I55N 3SUOA 3AVAA 3KLHA 4FZZA 3L8BA 1V4SA 1L3SA 3AVLA 3WQUA 3TSUA 3CQXA 3OHRA 3OYEA 3S9HA 2P1JA 1IO2A 1NOYA 1KTQA 4OLAA 1ASUA 3CPEA 4F3OA 3M8RA 4K41A 2VG5A 4QS7A 1GLJO 1LAVA 2YHXA 3C6UA 3SBTA 4DV3K 5BR8K 1HQEA 3P83D 4O0JA 1I94K 2IS3A 3GOIA 4M3YA 4YOXA 3AA3A 5LL6Z 3L3UA 4L8RB 4B1ZA 4K25A 3CD6N 1H1VA 4B9SA 1HNWK 4DR3K 2P9KA 3SPYA 3RR8A 1IV0A 2ATQA 3BGRA 3OYAA 4MDAA 2VCPA 2ZWHA 5DM7L 2ASOA 4FPAA 4OKKA 3NAEA 4DB3A 3U8XA 4H0VB 3B6OA 3VQBA 5HROA 1HNVA 3BZKA 1D9FA 4IEIA 1NGJA 5ADXH 1C0TA 1Q9XA 4C1NK 3FLCO 2HSTA 4BRCA 4EHTA 2F8TA 3GL1A 3IMXA 3VTHA 3HTVA 3WT0A 1C0MA 2QWQA 3KHYA 4ISFA 1NK4A 2FBTA 1N34K 4K42A 4B3OA 2A5XA 1NGHA 1GLDG 2NRRA 4I6MA 1K8KB 5AQGA 5BPMA 3SNNA 5C24A 4FVMA 4JKEA 1Z05A 2HNDA 3HM9A 4KHNA 2O8BA 2O4GA 4FOEA 3O4WA 4DTUA 1TYQA 3DXKA 4CEOA 1NGDA 3QEIA 3VENA 2P9PA 1NU0A 4WE1A 2GV9A 4HVJA 1WUAA 2ETJA 2HBLA 2OPSA 2HNYA 4CBWA 3G4SN 1Q86O 2AJQA 4DV6K 1S6QA 3M1FA 1S1UA 5AQPA 2D0PA 3TSPA 1VQON 3C0BA 5LY3A 4CZMA 3AVIA 3UKRB 2J4RA 4JHDA 3VOVA 3DLRA 1NOZA 5J2NA 2I7NA 3TAPA 3ZT0A 2PBDA 4KV8A 4H0XB 3D2EB 3LWMA 3DLEA 4H4OA 1SV5A 1HYVA 1Q8IA 1YJ9N 4NB4A 1DT9A 3KLGA 1NK6A 1RT1A 2FSNA 1RBUA 4IWVA 3VEOA 1JCEA 4XH5A 3KD5E 4M41A 4HHTA 3CIPA 3IUCA 1Z26A 5JLHA 3UB5A 1TK5A 5KI6A 3CJAA 2G8HA 1D8YA 3LAKA 2A6AA 2ZQBA 5HRSA 1BDGA 4LC9B 4DQRA 2X6SA 3QESA 4FO0A 3NMUA 3H46O 3PIPL 4B3SK 5CYQA 2UXCK 3VEVA 1NGGA 3ZT3A 2DTUA 1ZC6A 1Z25A 5KQ8A 4CK3A 3ASMA 5HP1A 4DWIA 4YORA 3L4IA 1HX1A 3C94A 1K73O 4FJHA 3THVA 3U3YA 1L3VA 3MX5A 3ID6A 4DQPA 2QXFA 1BG3A 2O8CA 4DLEA 2Q2RA 1G15A 3CF5L 1SAZA 4DV4K 4RW4A 3KWGA 4CIGA 4KI6A 1B9FA 4YY3K 5AQVA 1XI1A 3NF6A 3QDKA 1B9DA 5EXWA 1NKBA 3K5MA 1JL1A 4DV5K 3SBGA 3HZ6A 3PUFA 2NRWA 5A2QO 1TVRA 2G8KA 5AJ3K 5FPEA 1DLOA 4O5FA 1BISA 3OJUA 4EP4A 4KREA 2Q0UA 1K8AO 1HR0K 2UUAK 4YOTA 1HRHA 3AV9A 2G8IA 3KLEA 1Q18A 3QBWA 4CF9A 2G8WA 2AP1A 5AQOA 4CJ5A 2OYQA 4OX9K 1BQMA 3LZIA 1IBKK 4L3QA 1RBSA 2E1ZA 4GY2B 3CXCM 1U04A 4PL8A 3MEGA 1N6QA 1OH8A 4JKGB 3OYMA 1XC3A 3QEWA 1GOAA 3MN9A 4OGEA 2VQFK 3U9DA 1IBMK 3QETA 1KXPA 4JHDB 3JYTA 1RDWX 5FPNA 1RNHA 2X74A 4H03B 2CGLA 4BVOA 4I6MB 5M1OA 4KHYA 4DCHA 3V9UA 2KHOA 5M1NA 4KH4A 4C8LA 4DUYK 2O8BB 1ZBLA 1IKYA 3VQ7A 4Y1CA 4FJKA 5AQTA 4CHYA 1TYQB 1RT5A 5JVGL 4C8KA 3V6DA 4CZJA 2FBVA 4CBXA 4BR0A 4CIFA 1NNEA 2Q1NA 4WQ5C 4G1QA 3SJHA 5AQZA 5HOOA 2QWMA 1NGAA 1LAWA 2NLXA 1YIJN 4LF5K 2Z1HA 4NCAA 5H1SQ 4DR5K 5HRRA 1JLBA 5AZJA 3P31A 4JKCA 1UA0A 1ATNA 3K5LA 4AM7A 5BRHA 2X78A 1RDUA 4FZXC 3OW2M 2D0AA 1KAXA 3C65A 1FKOA 4LFBK 1Y64A 2A40A 3BP8A 3DLGA 2GTDA 3A0IX 3O3FA 3OJSA 3JS6A 3PX0A 4O5BA 3L3VA 4W5RA 3RVCA 2HF3A 4KRFA 3V81A 4BR9A 4A61A 1RILA 1C1CA 3CMAN 2GWJA 1XUPO 4FYDA 4FOIA 2V7ZA 4KKOA 3EZWA 3T19A 4FCYA 4RTFD 3OS2A 5E84A 4BC2A 1BCOA 2YNGA 4KBOA 5EY4A 3ZSZA 2ITGA 2E2QA 4BDPA 1S5JA 5EOYA 5GINA 1KRPA 4M3ZA 3ATUA 4IBNA 5BRDA 2OTLN 4KB0A 4M3RA 4B9LA 3ULEA 2ASPA 4F8RA 3FR0A 4DTOA 3THYA 4F9OA 1MU2A 2W6LA 3BY5A 3NE6A 5I9EB 3UKRA 3E1YA 1TL3A 3TR8A 3E9PA 5C2FA 3T69A 3B8AX 2JGUA 4M63C 3TAMA 4DMNA 4N41A 4LH5A 4JLHA 2DY4A 2BE2A 2JWLA 3AO2A 5CR4A 1HNIA 4Z4GA 1EKEA 4UQGA 5EVZA 2FF3B 4YDUC 5DM6L 4FM2A 3G6EN 4WYBA 1E4FT 3V1QA 2NRHA 5ELZA 2E6MA 4C8NA 2QEXN 1RTIA 3DRSA 3IFRA 5BN9A 3MMVA 3HI0A 1J53A 4CJ4A 4KH6A 1BUPA 1NK9A 1JLFA 3CCEN 4KTWA 5GADP 3NGZA 4KI4A 2HHSA 4K0KK 1VQMN 4H4MA 1KVCA 5AQHA 1QZ5A 4YOYA 1TAQA 1EWRA 4DQQA 5AQKA 4AHRA 4AH9A 4JK9A 1HKGA 2WBNA 4AILC 3LAMA 3DLBA 2KKZA 4LSNA 1VSIA 4CZEA 5FRNA 2F4VK 2RKIA 4BC5A 4DF4A 4RCHA 3WNHA 3CFPA 4FJNA 4E19A 3MK6A 3R6MA 1J5OA 3KK3A 2P9LA 2YNHA 1EO1A 4FWOA 1JLEA 5SWMA 3R9PA 4PHTX 1EXQA 3M3ZA 5HBMA 2O8CB 4BRFA 4BROA 1IKWA 1HLUA 4JI3K 3KZBA 4O4GA 3BUZB 3A5NC 3NF8A 3QIPA 1MWMA 1IG8A 1LOTB 4K8ZA 1EP4A 2A3ZA 4RG8A 3SMPA 4FJMA 1NGCA 2NRZA 1RT3A 3J7AP 3VQ9A 5K14A 3FFIA 4DSEA 2IVNA 4W5TA 1T6DA 3EEQA 3L2WA 1BHLA 5ADXA 1IKXA 1VQ5N 5LJWA 1K6YA 3ZEUA 2O8EB 3OYBA 4OKJA 1MA9B 4DTPA 5AZJB 3BF3A 2UXDK 4HWIA 3AVHA 3EO3A 2HHWA 1TKDA 3A2FA 1SZ2A 3TAGA 5KRSA 4F4KA 3AVNA 1O13A 5AQQA 2DFFA 3DM2A 4DQIA 3SQ0A 4F2SA 3HJFA 4XEIA 5C2DA 4KFBA 4JKGA 3P5JA 2BUPA 1DTTA 2PFUA 4ELTA 2IC3A 1EX4A 4QCLA 5E41A 1WSHA 3LM9A 2E88A 4DR2K 1XHXA 4DSLA 2RF2A 3RMAA 3HSCA 4ZTFA 2UXBK 3DRPA 3TU5A 4BRNA 3HO1A 3SPZA 3LZJA 5AQRA 3VN5A 3ZX3A 1KC8O 4DTXA 2A42A 3K0SA 3ENHA 3MEDA 4A59A 2FBYA 2RPIA 4N56A 1SKWA 1QE1A 4FWPA 2FLOA 3AVMA 1WSGA 3VETA 3ZSOA 5KPRA 4Q0BA 1ITGA 3IG1A 3VEWA 2FSJA 4YOVA 3F9MA 3THYB 2G8UA 3RTVA 2NNWA 1LWCA 4GMJB 4ICLA 4KPYA 3OYDA 5J2QA 3I8DA 4KTQA 4E7KA 1W0HA 4O55A 3KK2A 1TGOA 2XY8A 5AFUA 4PKIA 3SJJA 4HUGA 3EZ5A 4CGFA 2HVIA 1RT7A 4CIEA 1EQYA 1U2VA 4OVLA 5BREA 5CYMA 4FLXA 4PY5A 2ZF5O 3ZX2A 3NH1A 3ZSVA 1S3XA 3MXMA 3VQ6A 1GOBA 2ZJRL 4JKAA 1BU6O 1GLFO 5GAHP 1WSEA 2W42A 1JXEA 1P90A 3OYGA 1NMDA 2VWJA 3CC2N 3K2PA 1ZBIA 4KO0A 4RW6A 4NO7A 1HNXK 2W6KA 3SUQA 1C0FA 1NK5A 2F96A 4CJRA 1EETA 1WSFA 4B1WB 4PL7A 3ENBA 1KLNA 3VQ8A 4CGGA 4Z0UA 4I2QA 1XHZA 3LPTA 3NFAA 3CPWM 3FZKA 4CBUA 3V9SA 2WFBA 3AO4A 4I7FA 4BG8A 3AVCA 2FC0A 2V51B 1RDCA 4DSIA 4CHNA 1N33K 4TSXA 3ULEB 3ULDA 2VWKA 2Z1IA 1W7AA 1HYSA 1YI2N 4Z94A 1RDDA 3ZT4A 3J7YP 5FROA 4CVNE 3HP6A 2ZJQL 4U7BA 4Z4CA 4BRKA 3FE1A 3EN9A 4CJTA 4FLVA 3QERA 1JCGA 2ZE2A 3ZEUB 4OO1J 2P9LB 2O8EA 3UKUA 5SZTA 4DV2K 1WAFA 3P39A 2FSKA 4C1NI 3ZSWA 4QS9A 4H0PA 2BGGA 4CD1A 3M5RA 3O1BA 1NJWA 3MWTA 3VESA 3LALA 2E8AA 3M8QA 4FJIA 1YTAA 4B9UA 1FK9A 2XHBA 1XC9A 2HHTA 3T1HK 4JKFA 4CEFA 4JI0K 1T6CA 4JS4A 2DFHA 4I9QA 4YFUA 4PUOA 3EE9A 4CEBA 3O3HA 3NGYA 3ZETB 4CEEA 2ZM6K 3ZYYX 4DQSA 2Y1JA 1VRUA 2HHQA 5GAEP 3P4IA 3S3MA 2VQEK 4OPAA 1N8RO 1ASVA 4CJ3A 1Q81O 4JEPA 1U48A 1TK8A 5HLFA 3MAQA 3O6WA 4CHOA 3CC4N 1ATRA 2A1SA 4FLYA 2YHYA 4FJ5A 3VQ4A 1HJRA 4BDYA 1REVA 3DOKA 3O4QA 3VA0A 2OPPA 1C0UA 1KVBA 4BWJA 3AVFA 3SAHA 4CD3A 2AA4A 4CZLA 4DU3A 1GOCA 1YVUA 3Q7BA 3EKSA 1S6PA 1T03A 5J1EA 3HPOA 1ZBFA 3D45A 4DLGA 4LFAK 3VQCA 4BR2A 3THXA 4KHUA 4H5RA 3RWUA 2XRIA 1TKXA 5I42A 1KSPA 1CZAN 4XH1A 3F2KA 1WN7A 1E4GT 3DAWA 5LMNK 4BGBA 1U2VB 4CFDA 4F2RA 1RDAA 1RGIA 4CHQA 4FLUA 3H08A 2O8DA 1VSDA 4IFYA 3GG4A 4H5WA 4JI4K 4JI7K 1YAGA 4CK2A 4K43A 4PA1A 2OZMA 1RDBA 2YHAA 3O1WA 4JAXA 1Q7YO 1ZBSA 3V1RA 4RW7A 3EL2A 3QICA 3G71N 1OVYA 4CGDA 1UOCA 4BRLA 4CJKA 1XNRK 4CZIA 1LW2A 4X62K 3F9KA 4FW2A 1U49A 4B08A 3OYLA 2QKKA 3OVNA 4ID5A 4DR6K 5AR0A 2D0BA 4CZFA 1T8EA 3WQTA 4CEDA 3DJCA 3AARA 3HM8A 3ISNC 5C25A 3KK1A 1K9MO 4GV6A 1U47A 4DFKA 1VQPN 4NYNA 3CCVN 3VEZA 3O3GA 3HSTB 2GUIA 3HPHA 1WBDA 2E5LK 4BY9C 2GELA 4WFNL 4YHHK 2O8FA 3PO5A 3VF4A 1FW6A 4EZ6A 1FJGK 4EHUA 3I0RA 4BRPA 1WLJA 4W5NA 4CF1A 4AHSA 4FJ7A 3SCXA 4IOCL 3RMCA 3VQEA 4Q5VA 4FJLA 4A2AA 2QA4N 4FK2A 3H6EA 4X65K 5BN8A 4FJ9A 1Q82O 3DOLA 2Q36A 4DFMA 5BPLA 3LDOA 4A5AA 2KW4A 3A5MC 3O9UA 1UAXA 4CJSA 3MN5A 3KLFA 3DLLL 2PYJA 4EZ9A 3CQ8A 1SKSA 3KD1E 1JJ2M 2RHKA 4B1VA 4JD2B 1VHXA 2QWOA 3OS0A 1QVGM 3HVTA 3CCSN 4XIUA 1NK7A 4H5TA 1WNSA 1VQ6N 1OH7A 3LL3A 3DRRA 4BACA 3H3NO 4CHZA 3G0ZA 3OYKA 3J80O 5C12A 4FJXA 2GX9A 2Q31A 2P9NA 3R1XA 3VGMA 3GBTA 2GUPA 1ZXOA 4OPKA 2O4IA 2NZTA 5DMRA 2HBMA 1KCFA 5M1FA 3AO1A 3TPQA 3K5OA 3K57A 3LANA 3OA9A 3NDKA 5I3UA 3HP9A 2EWSA 1W9HA 2F8SA 2HBKA 3CCQN 2KQ2A 4U67L 4LF8K 4E1NA 3TSQA 1FKPA 1NJIO 3CG7A 2P9UB 5AZIA 5F2RA 4EIAA 1ZYQA 4LF9K 4DR4K 1S1TA 1KFSA 1YT3A 4MDBA 3JXUA 5M1QA 5J2MA 3PSFA 1NGEA 3D0PA 2O8DB 2YJEA 3IS9A 3CETA 3QEPA 5HRPA 1VQ8N 3E01A 5CZ2A 4I9LA 5J2PA 4DTSA 5MLCQ 4N47A 5BR9A 2EX3A 4DFJA 3LP0A 3QFUA 4B1XB 3RRGA 3UKUB 4JRPA 2VG7A 3EKUA 4Z4HA 2HOEA 3PIOL 1BCMA 2E6LA 3BZCA 4MO5A 1M90O 2HHHK 3O80A 2JWKA 3E66A 4BR7A 3HYFA 4ELVA 4BE2A 2IGIA 2E2OA 2B4JA 4CZHA 3OYIA 1JLCA 4N5SA 4BQLA 2BDPA 1TV6A 2Q97A 5AQNA 3ZETA 4M3XA 4BVPA 5FDLA 1R0AA 3QB0A 3C6HA 4DKWA 1QSLA 4UY8O 3VEXA 2P5GA 4CGHA 4F3TA 4H5VA 3KKSA 3E9LA 3VMFB 4OGCA 1W97L 1V4TA 1NBWA 3J8AA 3QO9A 1VQ7N 4AHUA 4IJNA 1KFDA 4CHPA 3CCMN 1HPZA 1VSMA 4WF9L 3NH2A 3K58A 4JI6K 4KB1A 3C6AA 4CCHA 3CYMA 3QMLA 3FZFA 4NLCA 4DV0K 2V7YA 3MWPA 3D2FB 1VSEA 5LMUK 4JD2A 2D5RA 4C8MA 3N4PA 4CZGA 5C42A 1WB9A 2VWBA 3MCPA 1N32K 2BTFA 4LSLA 3FGUA 3G10A 3CFRA 5AQYA 2ITMA 1QZ6A 2P9NB 3DMJA 1NJXA 5EU7A 4DF8A 2CGKA 2KZZA 4DS5A 5C10A 1X9WA 1X9JA 3WNGA 1QSYA 1VQNN 3L2QA 2V52B 4B8CA 4KTZA 3SQ4A 4OKEA 3MN6A 1QQMA 3VPZA 3PV8A 4DV1K 3CJ1A 4ISGA 5AZIB 3ID8A 3QEXA 1TUYA 4CF2A 3VEYA 1X9MA 3T1AA 4PWDA 1TKTA 4XH4A 3JAMO 1B92A 1KAYA 1NK0A 1NK8A 1P8ZA 1VRTA 3OY9A 1VQLN 4B9TA 1RBTA 2UYTA 4EAHD 4Z4EA 4E7JA 3AGRA 4BR4A 4CF8A 1S1XA 1R59O 1QHTA 1U4BA 4B3TK 4Z4IA 3VF6A 4HUFA 2P51A 3U3GA 3K9KA 1S1VA 3VQ5A 4CGJA 3IAYA 1OKJA 4JK8A 2PY5A 4FXDA 3F73A 2VYPA 1W2BM 1JKHA 4FZYA 4E89A 1VQ9N 4ELUA 3W3DA 4CEQA 5KPTA 4IO8A 4O0IA 4DSFA 4CGIA 3HXMA 1G99A 2YKNA 3TTDA 5AQUA 1UWBA 3LDPA 4CFCA 1CXQA 1VSLA 3U4LA 1QSSA 5F1XA 3NBPA 4FM1A 2VGMA 4DHYA 3CFOA 1HMVA 1RCHA 2PAVA 3WXKA 4M3WA 4CFAA 2IVOA 4E1MA 4M7XA 1VQ4N 4JKBA 3KIOA 3CJCA 5LJVA 3KJVA 2NUBA 4FWNA 3EY1A 3H1VX 4NCBA 2HNZA 1YITN 4B1YB 3TTCA 1VSFA 4E7HA 4JYAK 2CH5A 3AA2A 4FJJA 4ZHRA 1L5UA 4A2BA 1KAZA 2WONA 1YUWA 5M1PA 3C7NB 2QWLA 4BWMA 4AHVA 3MX2A 4PQUA 3FZMA 4DU4A 3OBWA 2XY6A 1SS6A 1S22A 2D0OA 2BH1A 1RT4A 3GE1A 1E3MA 3TAFA 2HBJA 3TABA 4B9NA 3MN7A 1VK0A 2ASMA 3TTFA 4OLBA 3O9RA 2W41A 4R79A 1ILYA 3Q7CA 1DKGD 3SAFA 3ZT1A 2CGJA 1XMOK 2VG6A 4LD0A 2E20A 2XO7A 4FK0A 1RTDA 3L2RA 1QVFM 1Y97A 3CCJN 4B8AB 3QEVA 3DLHA 1SKRA 4ILHA 4O44A 4FWKA 1GLCG 1HQUA 1OVQA 1YJNN 1LWFA 1TL1A 1CXUA 4IDHA 4BE1A 1YVNA 5AQIA 2HHUA 5HL7L 3LDLA 4JNEA 3UE5A 3A5LC 1SUQA 5KGXA 5JVHL 4LF6K 2FXUA 4CECA 4C8OA 2P9IB 1YJWN 3CQYA 4J2EA 1IBLK 3VGKA 3V9XA 1BA1A 3PX6A 2OPQA 2OTJN 3VQAA 4MLHA 1HKBA 2WOMA 3ZX0A 3WXLA 3P1GA 2ZD1A 3OYCA 4GW6A 4DV7K 4DQ8A 4AHTA 2BANA 3CM6A 3HRGA 3KK7A 3VERA 3CJ7A 1D5AA 1VSJA 2QW9A 3AA5X 1DEJA 5AQXA 1BQNA 3A8YA 3L2VA 3MEEA 1RFQA 4DTMA 2FF6A 4FJ8A 1GLEG 5CZ1A 4E7IA 3RMDA 3VA3A 1X9SA 2YNIA 3CMEN 3LWLA 1XWLA 4BRQA 2HHVA 2QI2A 4H5NA 5AQSA 1JLQA 4BREA 4DSJA 3VQQA 4CK1A 4W5QA 3VGLA 5AFUH 4FJGA 4GKJK 1QQNA 1NMNA 3AA4A 3O9SA 3NHGA 4HTUA 3TWHA 1WSJA 2QM1A 4BRIA 2LSNA 4ILGB 4NCGA 2UUBK 1ESVA 3CJBA 3LDQA 4JI5K 1OH5A 3SUPA 3HOTA 2Z1GA 4M45A 4I2PA 2YJFA 4MQ3A 3PX4A 1N36K 3B6PA 2H3GX 3OS1A 1C6VA 3TAEA 5KGWA 1NGFA 3QLHA 3K5NA 3DXMB 2CH6A 4YOWA 3SQ2A 3AAPA 1XNQK 4WQ5A 5BPNA 1SL1A 2Q3SA 4LH4A 1CZ9A 5CE3A 3WNFA 4C23A 4BRHA 3LPUA 3IDHA 4GVEA 3AVBA 3OYJA 4DTNA 5EX5A 2P9PB 1ASWA 1IKVA 4CI6A 3THWB 5GIOA 1A5WA 2HMPA 2IVPA 4YDUA 4EP5A 5JICA 2F9TA 4MLEA 3QBXA 3WEEA 2QK9A 4KHSA 4K8XA 3CM5A 3LP2A 3SMSA 4ID1A 4HCBA 4BQZA 1S9GA 3THXB 3BDPA 3C6TA 3CC7N 1JLGA 3V4IA 4LF7K 4CJLA 4M42A 2YI1A 2P5OA 5CY4A 2A1RA 1YXQA 4IG3A 4CZKA 4M7YA 4DU1A 1J5EK 3CHWA 3A5OC 1TKZA 4GV9A 1F21A 3ENOA 3WNEA 4H0OA 4B9VA 4G9ZA 2D1KA 1J9AA 1EWQA 3MECA 3O08A 4H0TB 4BRDA 3MXJA 1GLBG 3V9ZA 1D9DA 3N4QA 3I8BA 1WSIA 1BIUA 3LM2A 1VSHA 3LDNA 3WXMB 4KHPK 3WXIA 3LP1A 3L6QA 2XY7A 4E7LA 4E0DA 3JSMA 4JRQA 1HJOA 3WXJA 1ZBUA 3T3FA 4FK4A 3AVJA 2QTDA 4AF1A 3ZLJA 4JS5A 3ZSYA 3NVKA 3G25A 4KAZA 2R7YA 3OYNA 4IG0A 1KLMA 3HT3A 3SK3A 5KTQA 2D0CA 1T05A 3C7NA 1NKCA 3QINA 3ATVA 3CCLN 2O8FB 1VSKA 3SV4A 3S41A 3AVGA 2YHBA 2WTUA 3RRHA 2QXLA 1D4XA 4QOZB 4O8UA 3F5TA 2P9SB 3ZSQA 2Q0RA 5C15A 4FLWA 3K59A 1RTHA 3KVGA 3ZSXA 2RE2A 4A5BA 5JS2A 5AQLA 4R5PA 1NGIA 4OPJA 2I5JA 4BRMA 2E2PA 1GLLO 4E1JA 1T44A 2KZMA 1T3VA 1TK0A 1SL0A 3CJ9A 1MDUB 2G8FA 3M8PA 4HUEA 2HMIA 4IOAL 1NGBA 1LV5A 1TUUA 2W40A 3M6GA 4CJUA 3HK2A 3ZSRA 1X1PA 3HL8A 4GV3A 1I3AA 4DTRA 4DUZK 3TAQA 1SL2A 4IXCA 3E9OA 4DR7K 4DR1K 4YNQA 3W0LA 3T1YK 5KRTA 3U6FA 4IDKA 4W5OA 4M3UA 4Y1DA 3OYHA 4GNIA 5JS1A 4WFAL 4QS8A 3TI0A 3NH0A 3THWA 5IWAK 1BI4A 2YCHA 4IFEA 1RBRA 3QIOA 3ALYA 4BE0A 1NKEA 1JXBA 3HBTA 3SV3A 1NJYA 4FSVA 4FWQA 3FFKB 2PZSA 3GDQA 2P9UA 2NRVA 2OZSA 3SQ1A 3DXMA 4JN4A 1RTJA 1X3MA 2EHGA 1HPMA 4CJFA 1C1AA 3M8SA 3NCIA 5FPMA 3MDQA 5B8HA 3OBYA 1XQSC 4M3TA 3H45C 4CJVA 4DSKA 4B3MK 1VQKN 4CF0A 2NRTA 1I39A 2E2NA 2ZGYA 1ZBHA 1BO5O 1LWEA 5KQDA 2E4LA 5BRFA 3WEEB 2IIRA 4RW8A 2IOCA 4AQYK 5JLFA 3T7ZA 3DLKA 2HHXA 1M1KO 1C1BA 3RMBA 2OPRA 2E1YA 4FPBA 2ZGZA 3MCAB 1BOTO 3KWIA 5JMVA 1FXXA 4IFVA 4B9QA 4A57A 5T7BA 1LCUA 2X6NA 4MFBA 3O5BA 4HTLA 1JL2A 4DTJA 3J7ZO 2FBXA 4FWLA 3AGKA 5AQMA 5E26A 1S9EA 3D6RA 2OA8A 1LW0A 4FWSA 4CE9A 5FPDA 3NVMA 1X3NA 1HUXA 3S3NA 2KLAA 4FM0A 1HNZK 4PKGA 2OANA 2WUSA 2UUCK 4Y0WA 3O8MA 2DPNA 1KD1O 2NRXA 1XMQK 1U6ZA 4IJAA 2KTQA 4IKFA 3ZT2A 3D7EO 3PY8A 3VF2A 3S3OA 3O4NA 4JI1K 3D2FA 4DG1A 2A41A 3PSIA 4DS4A 4LY7A 4O8KA 2I7PA 2B5JA 2P9SA 3KLIA 1A5XA 2VGNA 3I0SA 2HF4A 5TKWA 3SLCA 3SYZA 4FL9A 3I56N 3U9ZA 4N76A 3IRXA 3BF1A 4CW7B 4BRAA 4JI8K 2YNFA 1YTUA 1DGKN 3EE8A 3RSEB 4MO4A 4CERA 4LFCK 4X64K 4CESA 4IO9L 4ZTJA 3QNNA 1JLAA 4ISEA 1O1WA 5F0XA 3IKMA 2OCEA 1WAJA 3V9WA 3AO3A 2YHWA 2KFNA 2D4WA 1ATSA 3SI6A 3L4QA 4BG9A 4FW1A 4IEEA 1WBBA 4V19S 1QHAA 2YKMA 4FVUA 1L3UA 1MWKA 5M1KA 1A5VA 1DTQA 1RT6A 2B6AA 1NLVA 4B3RK 1IJJA 3NF7A 3OYFA 3I33A 1GLAG 1BIZA 3HPGA 4EFHA 3C95A 3UIQA 2HVHA 3HVRA 1BL3A 1BI4B 4QAGA 4CJWA 1J6ZA 3AVKA 2F9WA 4ILJA 4AHCA
chains in the Genus database with same CATH topology
4Z4FA 2WOMA 2Z1HA 3P1GA 4J2DA 2ZD1A 1Q9YA 4NCAA 3OYCA 4CGDA 5HRRA 1UOCA 1JLBA 4GW6A 4CJKA 1LW2A 4H8KA 1J54A 3SZ2A 4AHTA 1UA0A 3PO4A 2BANA 3CM6A 3K5LA 3F9KA 4FW2A 2DFEA 3ZCMA 3L2UA 4CEZA 1U49A 4B08A 2X78A 2IAJA 3OYLA 1D5AA 3OVNA 1VSJA 3AA5X 4ID5A 2QKKA 4FZXC 3TANA 1BQNA 2JLEA 2D0AA 3L2VA 2IDOA 3MEEA 4DTMA 2D0BA 1T8EA 1FKOA 4NYFA 4CEDA 4FJ8A 3ISNC 4FLTA 5C25A 3KK1A 5CZ1A 3DLGA 3KKRA 4CJQA 4E7IA 1U47A 4DFKA 3RMDA 4DFPA 3O3FA 3OJSA 3VA3A 3PX0A 1X9SA 4NYNA 2KFZA 4O5BA 2YNIA 3O3GA 3L3VA 4W5RA 3LWLA 1XWLA 2HHVA 3HSTB 2GUIA 4KRFA 3HPHA 4CEAA 3V81A 4B9MA 3V1OA 3EYZA 1IH7A 1JLQA 3PO5A 1S1WA 1RILA 1C1CA 3VQQA 3AO5A 4FLZA 4CK1A 4W5QA 1IG9A 4DSJA 4EZ6A 3I0RA 4FYDA 4FJGA 4KKOA 1WLJA 3T19A 4FCYA 4W5NA 4J2BA 3OS2A 4CF1A 4AHSA 1BCOA 2YNGA 3AA4A 3ZSZA 4FJ7A 3MXIA 2ITGA 3NHGA 4HTUA 3TWHA 3SCXA 3KTQA 4BDPA 1S5JA 1WSJA 4HCCA 3RMCA 2RN2A 3VQEA 4Q5VA 2LSNA 1UA1A 1KRPA 1QQCA 4M3ZA 4IBNA 4FJLA 4NCGA 1RT2A 4KB0A 4M3RA 4FK2A 4B9LA 3VQPA 4F8RA 1BGXT 4DTOA 4FJ9A 3SUPA 2Z1GA 2KTQA 1MU2A 3DOLA 4M45A 4I2PA 4DFMA 1KVAA 1KSPA 3NE6A 4MQ3A 2KW4A 4BDZA 3PX4A 1UAXA 3B6PA 4CJSA 3OS1A 1TL3A 3KLFA 2PYJA 3TR8A 4EZ9A 1C6VA 3CQ8A 1QTMA 3TAEA 1SKSA 3KD1E 5KGWA 5HRNA 3QNOA 3QLHA 2JGUA 5FRMA 3TAMA 3OS0A 5DK5A 3K5NA 3HVTA 1NK7A 4XIUA 5D3GA 3SUNA 4DMNA 1WNSA 4N41A 4LH5A 4JLHA 1NJZA 3SQ2A 2DY4A 1RBVA 2BE2A 1CZBA 1SL1A 3DI6A 2Q3SA 4LH4A 3AO2A 4BACA 3DRRA 1CZ9A 4GVMA 3WNFA 3RR7A 2HW3A 1HNIA 4CHZA 3G0ZA 3OYKA 4Z4GA 1EKEA 3LPUA 4UQGA 4FJXA 4CJEA 4FM2A 3AVBA 3OYJA 4DTNA 4KHQA 4KHWA 1ASWA 1QS4A 1IKVA 3V1QA 4OPKA 2O4IA 1HYZA 2QKBA 1A5WA 5DMRA 2E6MA 4C8NA 1RTIA 1KCFA 2HB5A 3DRSA 3NGIA 3VQDA 1J53A 4CJ4A 4EP5A 3AO1A 3K57A 3K5OA 3LANA 3NDKA 5I3UA 1JLFA 3TARA 1NK9A 3HP9A 4KHSA 3NF9A 2QK9A 1W9HA 2F8SA 3DYAA 4K8XA 3CM5A 1TAUA 3LP2A 2GBZA 2KQ2A 4ID1A 4E1NA 4KTWA 4HCBA 3NGZA 1FKPA 4KI4A 2HHSA 1S9GA 3CG7A 3LDSA 3BDPA 4H4MA 4E3SA 4J2AA 1KVCA 3C6TA 2Z1JA 1TAQA 2G8VA 1JLGA 1N5YA 4CFBA 3V4IA 2PYLA 4DQQA 4M42A 4CJLA 1ZYQA 2P5OA 5CY4A 2A1RA 1S1TA 1KFSA 1YT3A 1U45A 4AHRA 1CLQA 3LP3A 4RW9A 4CJPA 4IG3A 4AH9A 4OJRA 2XY5A 5J2MA 4DU1A 1T7PA 2YV0X 1TKZA 1F21A 3WNEA 3D0PA 3IS9A 3QEPA 4AILC 5HRPA 3ITHA 4B9VA 3LAMA 2Y1IA 3E01A 3DLBA 1J9AA 5FRNA 4LSNA 1VSIA 3MECA 4I9LA 5CZ2A 4DTSA 5J2PA 1L3TA 4N47A 2RKIA 4DF4A 3SUOA 3AVAA 3MXJA 3WNHA 3CFPA 2EX3A 4DFJA 4E19A 3KLHA 3LP0A 4FJNA 3L8BA 3KK3A 2YNHA 3V9ZA 1L3SA 1J5OA 3RRGA 3AVLA 1JLEA 4JRPA 2VG7A 5SWMA 4Z4HA 3OYEA 3S9HA 1EXQA 1IO2A 2P1JA 1NOYA 1D9DA 1BCMA 1KTQA 2E6LA 1WSIA 1ASUA 1BIUA 4OLAA 1VSHA 4F3OA 3M8RA 5HBMA 2VG5A 3LP1A 1LAVA 1IKWA 2XY7A 4E7LA 4E0DA 4O4GA 3C6UA 3JSMA 3HYFA 3NF8A 4JRQA 4ELVA 4BE2A 1HQEA 1ZBUA 3QIPA 3T3FA 4FK4A 2IGIA 3AVJA 3P83D 4K8ZA 1EP4A 2B4JA 4O0JA 4RG8A 3ZSYA 4JS5A 4FJMA 3OYIA 1JLCA 4N5SA 4KAZA 2IS3A 2R7YA 1RT3A 3OYNA 1TV6A 2BDPA 4M3YA 4IG0A 1KLMA 3HT3A 4M3XA 5FDLA 3VQ9A 5K14A 3AA3A 3FFIA 5KTQA 4DSEA 3L3UA 1R0AA 4L8RB 4W5TA 2D0CA 1T05A 3L2WA 1NKCA 3QINA 1QSLA 1BHLA 1VSKA 4B9SA 1IKXA 3SV4A 3AVGA 2YHBA 3RRHA 3SPYA 1K6YA 3RR8A 2ATQA 3BGRA 4OKJA 3OYBA 4CGHA 3OYAA 2P5GA 4F3TA 4QOZB 3ZSQA 4DTPA 3KKSA 4FLWA 4OGCA 3AVHA 4OKKA 3K59A 1TKDA 3A2FA 1RTHA 3NAEA 2HHWA 3TAGA 3VQBA 3B6OA 3QO9A 3ZSXA 5HROA 5KRSA 4F4KA 3AVNA 5JS2A 1HNVA 4R5PA 4OPJA 2DFFA 2I5JA 3DM2A 4AHUA 1D9FA 4DQIA 3SQ0A 4F2SA 1KFDA 1C0TA 1Q9XA 4CHPA 2F8TA 3HJFA 1HPZA 4KFBA 1VSMA 2KZMA 1TK0A 1SL0A 3P5JA 1C0MA 3K58A 3NH2A 2G8FA 1DTTA 4ELTA 4KB1A 2IC3A 3M8PA 4HUEA 4CCHA 3CYMA 1NK4A 2FBTA 1LV5A 2HMIA 1EX4A 4CJUA 3HK2A 4B3OA 3ZSRA 1X1PA 4QCLA 3HL8A 1NKEA 1VSEA 5E41A 1I3AA 1WSHA 4DTRA 2D5RA 3SNNA 4C8MA 3TAQA 5C24A 1XHXA 4DSLA 4FVMA 2RF2A 1SL2A 5C42A 3RMAA 2HNDA 3HM9A 4ZTFA 4KHNA 3DRPA 4YNQA 4LSLA 2O4GA 3G10A 3HO1A 3SPZA 3LZJA 3CFRA 4DTUA 3U6FA 5KRTA 4IDKA 3VN5A 4W5OA 4DTXA 4M3UA 4CEOA 3DMJA 3MEDA 4Y1DA 3OYHA 3QEIA 5JS1A 1NJXA 2FBYA 2RPIA 4WE1A 5EU7A 4N56A 4DF8A 1QE1A 2GV9A 1SKWA 3TI0A 4HVJA 3AVMA 3NH0A 1WSGA 2ETJA 3ZSOA 4DS5A 2KZZA 2OPSA 1X9WA 2HNYA 4Q0BA 1BI4A 1ITGA 2AJQA 3WNGA 1S6QA 3IG1A 1QSYA 1S1UA 2G8UA 1RBRA 3RTVA 3L2QA 1LWCA 3QIOA 3ALYA 4BE0A 4B8CA 4KTZA 1JXBA 4GMJB 3SQ4A 3AVIA 4ICLA 4OKEA 3SV3A 4KPYA 1NJYA 3OYDA 5J2QA 3PV8A 3I8DA 2PZSA 3DLRA 1NOZA 5J2NA 3TAPA 4KTQA 2OZSA 4E7KA 3QEXA 1W0HA 4O55A 3SQ1A 3ZT0A 4CF2A 3KK2A 1TGOA 2XY8A 1X9MA 1RTJA 3T1AA 3SJJA 4PWDA 4HUGA 4KV8A 2EHGA 3EZ5A 1TKTA 4CGFA 4CJFA 1NK0A 1B92A 2HVIA 1C1AA 3M8SA 3LWMA 1RT7A 3NCIA 4CIEA 1NK8A 4OVLA 3DLEA 4H4OA 5CYMA 1VRTA 1SV5A 1HYVA 3OY9A 1Q8IA 4FLXA 4PY5A 3KLGA 4B9TA 3NH1A 1RBTA 3ZSVA 1RT1A 1NK6A 4CJVA 4M3TA 3MXMA 3VQ6A 4DSKA 4CF0A 1GOBA 4Z4EA 4E7JA 1RBUA 4CF8A 1I39A 1WSEA 2W42A 1JXEA 3OYGA 2VWJA 1S1XA 3K2PA 1ZBIA 3KD5E 4KO0A 4RW6A 1ZBHA 4M41A 4HHTA 1LWEA 1QHTA 2E4LA 1U4BA 4Z4IA 1Z26A 4HUFA 4RW8A 3SUQA 1TK5A 2IOCA 2P51A 5KI6A 3U3GA 1NK5A 2F96A 1S1VA 4CJRA 2G8HA 1D8YA 3VQ5A 3DLKA 4CGJA 1EETA 1WSFA 2HHXA 3IAYA 1KLNA 3LAKA 5HRSA 2ZQBA 3VQ8A 4CGGA 4Z0UA 4I2QA 1XHZA 1C1BA 2X6SA 4DQRA 3QESA 3RMBA 2OPRA 2PY5A 4FXDA 3LPTA 3NFAA 3V9SA 3F73A 3AO4A 4I7FA 1JKHA 5CYQA 4FZYA 4E89A 1FXXA 3AVCA 4IFVA 4ELUA 3ZT3A 2FC0A 4CEQA 1RDCA 5T7BA 4DSIA 4CHNA 2DTUA 4O0IA 4TSXA 3ULDA 2VWKA 2X6NA 1Z25A 2Z1IA 4MFBA 4CK3A 4DSFA 1HYSA 4CGIA 3HXMA 2YKNA 1RDDA 3ZT4A 3ASMA 1JL2A 5FROA 3HP6A 4DTJA 5HP1A 4DWIA 4Z4CA 2FBXA 1UWBA 4CFCA 1CXQA 1VSLA 3C94A 4CJTA 4FJHA 4FLVA 3QERA 3THVA 1QSSA 3U3YA 2ZE2A 1S9EA 3NBPA 1L3VA 5SZTA 4FM1A 2OA8A 1LW0A 1WAFA 3CFOA 1HMVA 3ZSWA 1RCHA 4CE9A 4DQPA 2BGGA 2QXFA 4M3WA 4CFAA 3S3NA 1NJWA 4E1MA 4FM0A 3LALA 3KIOA 4DLEA 3M8QA 4FJIA 1G15A 4FZZA 3KJVA 1YTAA 4B9UA 1FK9A 2NUBA 2XHBA 1XC9A 4RW4A 2HHTA 4KI6A 4CIGA 3EY1A 1B9FA 4NCBA 2HNZA 4CEFA 1XI1A 3NF6A 4JS4A 1VSFA 1B9DA 2DFHA 4E7HA 4I9QA 1NKBA 3AA2A 4IKFA 4YFUA 4FJJA 4PUOA 3ZT2A 1JL1A 3K5MA 4CEBA 3O3HA 3NGYA 3PUFA 4ZHRA 1L5UA 3PY8A 4CEEA 3S3OA 3O4NA 1TVRA 2WONA 4DQSA 2Y1JA 2G8KA 1VRUA 4DG1A 2HHQA 4DS4A 1DLOA 4BWMA 4AHVA 3S3MA 4PQUA 1BISA 4DU4A 1ASVA 3OJUA 4EP4A 4CJ3A 4LY7A 4KREA 2XY6A 1U48A 2B5JA 1TK8A 1HRHA 5HLFA 3MAQA 3AV9A 2G8IA 3KLIA 1RT4A 1A5XA 4CHOA 3KLEA 3TAFA 3I0SA 3SYZA 4CF9A 3TABA 2G8WA 4B9NA 2A1SA 1VK0A 4FLYA 4FJ5A 3VQ4A 3IRXA 4N76A 4CJ5A 1HJRA 2OYQA 4BDYA 4OLBA 1REVA 3DOKA 3O4QA 2YNFA 1BQMA 3LZIA 1YTUA 3VA0A 1RBSA 2OPPA 1C0UA 4CERA 1U04A 4CESA 4ZTJA 3ZT1A 3MEGA 1KVBA 3QNNA 1JLAA 1N6QA 4BWJA 1O1WA 3AVFA 2VG6A 4LD0A 3OYMA 2XO7A 1GOAA 3QEWA 4OGEA 4FK0A 4DU3A 1WAJA 1RTDA 1GOCA 3V9WA 1YVUA 3L2RA 3AO3A 3QETA 2KFNA 3JYTA 1RNHA 1S6PA 2X74A 1T03A 1Y97A 5J1EA 3HPOA 1ZBFA 3D45A 3SI6A 4KHYA 4B8AB 4DLGA 4FW1A 3V9UA 2YKMA 3QEVA 3VQCA 3DLHA 1SKRA 1L3UA 4KHUA 3RWUA 2XRIA 4C8LA 4O44A 1TKXA 5I42A 1IKYA 1A5VA 4Y1CA 3VQ7A 1ZBLA 1DTQA 1HQUA 1WN7A 1RT6A 2B6AA 4FJKA 4CHYA 1RT5A 1LWFA 4CFDA 1TL1A 1CXUA 4C8KA 4F2RA 3V6DA 4BE1A 1RDAA 2FBVA 3NF7A 3OYFA 2HHUA 4CHQA 4FLUA 4CIFA 3H08A 1BIZA 1SUQA 3HPGA 5KGXA 3C95A 1VSDA 4G1QA 4IFYA 3UIQA 4CECA 4C8OA 2HVHA 4J2EA 3HVRA 4CK2A 3V9XA 1BL3A 1BI4B 4PA1A 3PX6A 4QAGA 4CJWA 2OZMA 1LAWA 1RDBA 2YHAA 2OPQA 3AVKA 3V1RA 3VQAA 4RW7A 4AHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4F A;  2WOM A;  2Z1H A;  3P1G A;  4J2D A;  2ZD1 A;  1Q9Y A;  4NCA A;  3OYC A;  4CGD A;  5HRR A;  1UOC A;  1JLB A;  4GW6 A;  4CJK A;  1LW2 A;  4H8K A;  1J54 A;  3SZ2 A;  4AHT A;  1UA0 A;  3PO4 A;  2BAN A;  3CM6 A;  3K5L A;  3F9K A;  4FW2 A;  2DFE A;  3ZCM A;  3L2U A;  4CEZ A;  1U49 A;  4B08 A;  2X78 A;  2IAJ A;  3OYL A;  1D5A A;  3OVN A;  1VSJ A;  3AA5 X;  4ID5 A;  2QKK A;  4FZX C;  3TAN A;  1BQN A;  2JLE A;  2D0A A;  3L2V A;  2IDO A;  3MEE A;  4DTM A;  2D0B A;  1T8E A;  1FKO A;  4NYF A;  4CED A;  4FJ8 A;  3ISN C;  4FLT A;  5C25 A;  3KK1 A;  5CZ1 A;  3DLG A;  3KKR A;  4CJQ A;  4E7I A;  1U47 A;  4DFK A;  3RMD A;  4DFP A;  3O3F A;  3OJS A;  3VA3 A;  3PX0 A;  1X9S A;  4NYN A;  2KFZ A;  4O5B A;  2YNI A;  3O3G A;  3L3V A;  4W5R A;  3LWL A;  1XWL A;  2HHV A;  3HST B;  2GUI A;  4KRF A;  3HPH A;  4CEA A;  3V81 A;  4B9M A;  3V1O A;  3EYZ A;  1IH7 A;  1JLQ A;  3PO5 A;  1S1W A;  1RIL A;  1C1C A;  3VQQ A;  3AO5 A;  4FLZ A;  4CK1 A;  4W5Q A;  1IG9 A;  4DSJ A;  4EZ6 A;  3I0R A;  4FYD A;  4FJG A;  4KKO A;  1WLJ A;  3T19 A;  4FCY A;  4W5N A;  4J2B A;  3OS2 A;  4CF1 A;  4AHS A;  1BCO A;  2YNG A;  3AA4 A;  3ZSZ A;  4FJ7 A;  3MXI A;  2ITG A;  3NHG A;  4HTU A;  3TWH A;  3SCX A;  3KTQ A;  4BDP A;  1S5J A;  1WSJ A;  4HCC A;  3RMC A;  2RN2 A;  3VQE A;  4Q5V A;  2LSN A;  1UA1 A;  1KRP A;  1QQC A;  4M3Z A;  4IBN A;  4FJL A;  4NCG A;  1RT2 A;  4KB0 A;  4M3R A;  4FK2 A;  4B9L A;  3VQP A;  4F8R A;  1BGX T;  4DTO A;  4FJ9 A;  3SUP A;  2Z1G A;  2KTQ A;  1MU2 A;  3DOL A;  4M45 A;  4I2P A;  4DFM A;  1KVA A;  1KSP A;  3NE6 A;  4MQ3 A;  2KW4 A;  4BDZ A;  3PX4 A;  1UAX A;  3B6P A;  4CJS A;  3OS1 A;  1TL3 A;  3KLF A;  2PYJ A;  3TR8 A;  4EZ9 A;  1C6V A;  3CQ8 A;  1QTM A;  3TAE A;  1SKS A;  3KD1 E;  5KGW A;  5HRN A;  3QNO A;  3QLH A;  2JGU A;  5FRM A;  3TAM A;  3OS0 A;  5DK5 A;  3K5N A;  3HVT A;  1NK7 A;  4XIU A;  5D3G A;  3SUN A;  4DMN A;  1WNS A;  4N41 A;  4LH5 A;  4JLH A;  1NJZ A;  3SQ2 A;  2DY4 A;  1RBV A;  2BE2 A;  1CZB A;  1SL1 A;  3DI6 A;  2Q3S A;  4LH4 A;  3AO2 A;  4BAC A;  3DRR A;  1CZ9 A;  4GVM A;  3WNF A;  3RR7 A;  2HW3 A;  1HNI A;  4CHZ A;  3G0Z A;  3OYK A;  4Z4G A;  1EKE A;  3LPU A;  4UQG A;  4FJX A;  4CJE A;  4FM2 A;  3AVB A;  3OYJ A;  4DTN A;  4KHQ A;  4KHW A;  1ASW A;  1QS4 A;  1IKV A;  3V1Q A;  4OPK A;  2O4I A;  1HYZ A;  2QKB A;  1A5W A;  5DMR A;  2E6M A;  4C8N A;  1RTI A;  1KCF A;  2HB5 A;  3DRS A;  3NGI A;  3VQD A;  1J53 A;  4CJ4 A;  4EP5 A;  3AO1 A;  3K57 A;  3K5O A;  3LAN A;  3NDK A;  5I3U A;  1JLF A;  3TAR A;  1NK9 A;  3HP9 A;  4KHS A;  3NF9 A;  2QK9 A;  1W9H A;  2F8S A;  3DYA A;  4K8X A;  3CM5 A;  1TAU A;  3LP2 A;  2GBZ A;  2KQ2 A;  4ID1 A;  4E1N A;  4KTW A;  4HCB A;  3NGZ A;  1FKP A;  4KI4 A;  2HHS A;  1S9G A;  3CG7 A;  3LDS A;  3BDP A;  4H4M A;  4E3S A;  4J2A A;  1KVC A;  3C6T A;  2Z1J A;  1TAQ A;  2G8V A;  1JLG A;  1N5Y A;  4CFB A;  3V4I A;  2PYL A;  4DQQ A;  4M42 A;  4CJL A;  1ZYQ A;  2P5O A;  5CY4 A;  2A1R A;  1S1T A;  1KFS A;  1YT3 A;  1U45 A;  4AHR A;  1CLQ A;  3LP3 A;  4RW9 A;  4CJP A;  4IG3 A;  4AH9 A;  4OJR A;  2XY5 A;  5J2M A;  4DU1 A;  1T7P A;  2YV0 X;  1TKZ A;  1F21 A;  3WNE A;  3D0P A;  3IS9 A;  3QEP A;  4AIL C;  5HRP A;  3ITH A;  4B9V A;  3LAM A;  2Y1I A;  3E01 A;  3DLB A;  1J9A A;  5FRN A;  4LSN A;  1VSI A;  3MEC A;  4I9L A;  5CZ2 A;  4DTS A;  5J2P A;  1L3T A;  4N47 A;  2RKI A;  4DF4 A;  3SUO A;  3AVA A;  3MXJ A;  3WNH A;  3CFP A;  2EX3 A;  4DFJ A;  4E19 A;  3KLH A;  3LP0 A;  4FJN A;  3L8B A;  3KK3 A;  2YNH A;  3V9Z A;  1L3S A;  1J5O A;  3RRG A;  3AVL A;  1JLE A;  4JRP A;  2VG7 A;  5SWM A;  4Z4H A;  3OYE A;  3S9H A;  1EXQ A;  1IO2 A;  2P1J A;  1NOY A;  1D9D A;  1BCM A;  1KTQ A;  2E6L A;  1WSI A;  1ASU A;  1BIU A;  4OLA A;  1VSH A;  4F3O A;  3M8R A;  5HBM A;  2VG5 A;  3LP1 A;  1LAV A;  1IKW A;  2XY7 A;  4E7L A;  4E0D A;  4O4G A;  3C6U A;  3JSM A;  3HYF A;  3NF8 A;  4JRQ A;  4ELV A;  4BE2 A;  1HQE A;  1ZBU A;  3QIP A;  3T3F A;  4FK4 A;  2IGI A;  3AVJ A;  3P83 D;  4K8Z A;  1EP4 A;  2B4J A;  4O0J A;  4RG8 A;  3ZSY A;  4JS5 A;  4FJM A;  3OYI A;  1JLC A;  4N5S A;  4KAZ A;  2IS3 A;  2R7Y A;  1RT3 A;  3OYN A;  1TV6 A;  2BDP A;  4M3Y A;  4IG0 A;  1KLM A;  3HT3 A;  4M3X A;  5FDL A;  3VQ9 A;  5K14 A;  3AA3 A;  3FFI A;  5KTQ A;  4DSE A;  3L3U A;  1R0A A;  4L8R B;  4W5T A;  2D0C A;  1T05 A;  3L2W A;  1NKC A;  3QIN A;  1QSL A;  1BHL A;  1VSK A;  4B9S A;  1IKX A;  3SV4 A;  3AVG A;  2YHB A;  3RRH A;  3SPY A;  1K6Y A;  3RR8 A;  2ATQ A;  3BGR A;  4OKJ A;  3OYB A;  4CGH A;  3OYA A;  2P5G A;  4F3T A;  4QOZ B;  3ZSQ A;  4DTP A;  3KKS A;  4FLW A;  4OGC A;  3AVH A;  4OKK A;  3K59 A;  1TKD A;  3A2F A;  1RTH A;  3NAE A;  2HHW A;  3TAG A;  3VQB A;  3B6O A;  3QO9 A;  3ZSX A;  5HRO A;  5KRS A;  4F4K A;  3AVN A;  5JS2 A;  1HNV A;  4R5P A;  4OPJ A;  2DFF A;  2I5J A;  3DM2 A;  4AHU A;  1D9F A;  4DQI A;  3SQ0 A;  4F2S A;  1KFD A;  1C0T A;  1Q9X A;  4CHP A;  2F8T A;  3HJF A;  1HPZ A;  4KFB A;  1VSM A;  2KZM A;  1TK0 A;  1SL0 A;  3P5J A;  1C0M A;  3K58 A;  3NH2 A;  2G8F A;  1DTT A;  4ELT A;  4KB1 A;  2IC3 A;  3M8P A;  4HUE A;  4CCH A;  3CYM A;  1NK4 A;  2FBT A;  1LV5 A;  2HMI A;  1EX4 A;  4CJU A;  3HK2 A;  4B3O A;  3ZSR A;  1X1P A;  4QCL A;  3HL8 A;  1NKE A;  1VSE A;  5E41 A;  1I3A A;  1WSH A;  4DTR A;  2D5R A;  3SNN A;  4C8M A;  3TAQ A;  5C24 A;  1XHX A;  4DSL A;  4FVM A;  2RF2 A;  1SL2 A;  5C42 A;  3RMA A;  2HND A;  3HM9 A;  4ZTF A;  4KHN A;  3DRP A;  4YNQ A;  4LSL A;  2O4G A;  3G10 A;  3HO1 A;  3SPZ A;  3LZJ A;  3CFR A;  4DTU A;  3U6F A;  5KRT A;  4IDK A;  3VN5 A;  4W5O A;  4DTX A;  4M3U A;  4CEO A;  3DMJ A;  3MED A;  4Y1D A;  3OYH A;  3QEI A;  5JS1 A;  1NJX A;  2FBY A;  2RPI A;  4WE1 A;  5EU7 A;  4N56 A;  4DF8 A;  1QE1 A;  2GV9 A;  1SKW A;  3TI0 A;  4HVJ A;  3AVM A;  3NH0 A;  1WSG A;  2ETJ A;  3ZSO A;  4DS5 A;  2KZZ A;  2OPS A;  1X9W A;  2HNY A;  4Q0B A;  1BI4 A;  1ITG A;  2AJQ A;  3WNG A;  1S6Q A;  3IG1 A;  1QSY A;  1S1U A;  2G8U A;  1RBR A;  3RTV A;  3L2Q A;  1LWC A;  3QIO A;  3ALY A;  4BE0 A;  4B8C A;  4KTZ A;  1JXB A;  4GMJ B;  3SQ4 A;  3AVI A;  4ICL A;  4OKE A;  3SV3 A;  4KPY A;  1NJY A;  3OYD A;  5J2Q A;  3PV8 A;  3I8D A;  2PZS A;  3DLR A;  1NOZ A;  5J2N A;  3TAP A;  4KTQ A;  2OZS A;  4E7K A;  3QEX A;  1W0H A;  4O55 A;  3SQ1 A;  3ZT0 A;  4CF2 A;  3KK2 A;  1TGO A;  2XY8 A;  1X9M A;  1RTJ A;  3T1A A;  3SJJ A;  4PWD A;  4HUG A;  4KV8 A;  2EHG A;  3EZ5 A;  1TKT A;  4CGF A;  4CJF A;  1NK0 A;  1B92 A;  2HVI A;  1C1A A;  3M8S A;  3LWM A;  1RT7 A;  3NCI A;  4CIE A;  1NK8 A;  4OVL A;  3DLE A;  4H4O A;  5CYM A;  1VRT A;  1SV5 A;  1HYV A;  3OY9 A;  1Q8I A;  4FLX A;  4PY5 A;  3KLG A;  4B9T A;  3NH1 A;  1RBT A;  3ZSV A;  1RT1 A;  1NK6 A;  4CJV A;  4M3T A;  3MXM A;  3VQ6 A;  4DSK A;  4CF0 A;  1GOB A;  4Z4E A;  4E7J A;  1RBU A;  4CF8 A;  1I39 A;  1WSE A;  2W42 A;  1JXE A;  3OYG A;  2VWJ A;  1S1X A;  3K2P A;  1ZBI A;  3KD5 E;  4KO0 A;  4RW6 A;  1ZBH A;  4M41 A;  4HHT A;  1LWE A;  1QHT A;  2E4L A;  1U4B A;  4Z4I A;  1Z26 A;  4HUF A;  4RW8 A;  3SUQ A;  1TK5 A;  2IOC A;  2P51 A;  5KI6 A;  3U3G A;  1NK5 A;  2F96 A;  1S1V A;  4CJR A;  2G8H A;  1D8Y A;  3VQ5 A;  3DLK A;  4CGJ A;  1EET A;  1WSF A;  2HHX A;  3IAY A;  1KLN A;  3LAK A;  5HRS A;  2ZQB A;  3VQ8 A;  4CGG A;  4Z0U A;  4I2Q A;  1XHZ A;  1C1B A;  2X6S A;  4DQR A;  3QES A;  3RMB A;  2OPR A;  2PY5 A;  4FXD A;  3LPT A;  3NFA A;  3V9S A;  3F73 A;  3AO4 A;  4I7F A;  1JKH A;  5CYQ A;  4FZY A;  4E89 A;  1FXX A;  3AVC A;  4IFV A;  4ELU A;  3ZT3 A;  2FC0 A;  4CEQ A;  1RDC A;  5T7B A;  4DSI A;  4CHN A;  2DTU A;  4O0I A;  4TSX A;  3ULD A;  2VWK A;  2X6N A;  1Z25 A;  2Z1I A;  4MFB A;  4CK3 A;  4DSF A;  1HYS A;  4CGI A;  3HXM A;  2YKN A;  1RDD A;  3ZT4 A;  3ASM A;  1JL2 A;  5FRO A;  3HP6 A;  4DTJ A;  5HP1 A;  4DWI A;  4Z4C A;  2FBX A;  1UWB A;  4CFC A;  1CXQ A;  1VSL A;  3C94 A;  4CJT A;  4FJH A;  4FLV A;  3QER A;  3THV A;  1QSS A;  3U3Y A;  2ZE2 A;  1S9E A;  3NBP A;  1L3V A;  5SZT A;  4FM1 A;  2OA8 A;  1LW0 A;  1WAF A;  3CFO A;  1HMV A;  3ZSW A;  1RCH A;  4CE9 A;  4DQP A;  2BGG A;  2QXF A;  4M3W A;  4CFA A;  3S3N A;  1NJW A;  4E1M A;  4FM0 A;  3LAL A;  3KIO A;  4DLE A;  3M8Q A;  4FJI A;  1G15 A;  4FZZ A;  3KJV A;  1YTA A;  4B9U A;  1FK9 A;  2NUB A;  2XHB A;  1XC9 A;  4RW4 A;  2HHT A;  4KI6 A;  4CIG A;  3EY1 A;  1B9F A;  4NCB A;  2HNZ A;  4CEF A;  1XI1 A;  3NF6 A;  4JS4 A;  1VSF A;  1B9D A;  2DFH A;  4E7H A;  4I9Q A;  1NKB A;  3AA2 A;  4IKF A;  4YFU A;  4FJJ A;  4PUO A;  3ZT2 A;  1JL1 A;  3K5M A;  4CEB A;  3O3H A;  3NGY A;  3PUF A;  4ZHR A;  1L5U A;  3PY8 A;  4CEE A;  3S3O A;  3O4N A;  1TVR A;  2WON A;  4DQS A;  2Y1J A;  2G8K A;  1VRU A;  4DG1 A;  2HHQ A;  4DS4 A;  1DLO A;  4BWM A;  4AHV A;  3S3M A;  4PQU A;  1BIS A;  4DU4 A;  1ASV A;  3OJU A;  4EP4 A;  4CJ3 A;  4LY7 A;  4KRE A;  2XY6 A;  1U48 A;  2B5J A;  1TK8 A;  1HRH A;  5HLF A;  3MAQ A;  3AV9 A;  2G8I A;  3KLI A;  1RT4 A;  1A5X A;  4CHO A;  3KLE A;  3TAF A;  3I0S A;  3SYZ A;  4CF9 A;  3TAB A;  2G8W A;  4B9N A;  2A1S A;  1VK0 A;  4FLY A;  4FJ5 A;  3VQ4 A;  3IRX A;  4N76 A;  4CJ5 A;  1HJR A;  2OYQ A;  4BDY A;  4OLB A;  1REV A;  3DOK A;  3O4Q A;  2YNF A;  1BQM A;  3LZI A;  1YTU A;  3VA0 A;  1RBS A;  2OPP A;  1C0U A;  4CER A;  1U04 A;  4CES A;  4ZTJ A;  3ZT1 A;  3MEG A;  1KVB A;  3QNN A;  1JLA A;  1N6Q A;  4BWJ A;  1O1W A;  3AVF A;  2VG6 A;  4LD0 A;  3OYM A;  2XO7 A;  1GOA A;  3QEW A;  4OGE A;  4FK0 A;  4DU3 A;  1WAJ A;  1RTD A;  1GOC A;  3V9W A;  1YVU A;  3L2R A;  3AO3 A;  3QET A;  2KFN A;  3JYT A;  1RNH A;  1S6P A;  2X74 A;  1T03 A;  1Y97 A;  5J1E A;  3HPO A;  1ZBF A;  3D45 A;  3SI6 A;  4KHY A;  4B8A B;  4DLG A;  4FW1 A;  3V9U A;  2YKM A;  3QEV A;  3VQC A;  3DLH A;  1SKR A;  1L3U A;  4KHU A;  3RWU A;  2XRI A;  4C8L A;  4O44 A;  1TKX A;  5I42 A;  1IKY A;  1A5V A;  4Y1C A;  3VQ7 A;  1ZBL A;  1DTQ A;  1HQU A;  1WN7 A;  1RT6 A;  2B6A A;  4FJK A;  4CHY A;  1RT5 A;  1LWF A;  4CFD A;  1TL1 A;  1CXU A;  4C8K A;  4F2R A;  3V6D A;  4BE1 A;  1RDA A;  2FBV A;  3NF7 A;  3OYF A;  2HHU A;  4CHQ A;  4FLU A;  4CIF A;  3H08 A;  1BIZ A;  1SUQ A;  3HPG A;  5KGX A;  3C95 A;  1VSD A;  4G1Q A;  4IFY A;  3UIQ A;  4CEC A;  4C8O A;  2HVH A;  4J2E A;  3HVR A;  4CK2 A;  3V9X A;  1BL3 A;  1BI4 B;  4PA1 A;  3PX6 A;  4QAG A;  4CJW A;  2OZM A;  1LAW A;  1RDB A;  2YHA A;  2OPQ A;  3AVK A;  3V1R A;  3VQA A;  4RW7 A;  4AHC A; 
#chains in the Genus database with same CATH topology
 4AM6 A;  4Z4F A;  4X66 K;  4J2D A;  1Q9Y A;  4KH5 A;  4J8F A;  5C0Y A;  4H8K A;  1J54 A;  3FZH A;  3SZ2 A;  3PO4 A;  4JK7 A;  5AQJ A;  4BR5 A;  2DFE A;  3ZCM A;  1OH6 A;  3L2U A;  4NXN K;  4CEZ A;  1SQK A;  2IAJ A;  4WFB L;  3TAN A;  2JLE A;  2UU9 K;  2IDO A;  4B1U B;  3CER A;  4NYF A;  4FLT A;  4CJQ A;  3KKR A;  3O9T A;  4DFP A;  2KFZ A;  3VTI A;  3OTO K;  4BC3 A;  3R8E A;  4CEA A;  4B9M A;  1WOQ A;  3V1O A;  3EYZ A;  1IH7 A;  1S1W A;  3H1Q A;  4FLZ A;  1IG9 A;  2P9K B;  3AO5 A;  3BEX A;  3HOS A;  2F7T A;  4J2B A;  1QQO A;  4LF4 K;  3H3O B;  2ZJP L;  4JKH A;  4JKD A;  4GKK K;  2WC9 A;  3MXI A;  3KTQ A;  4HCC A;  2YX6 A;  2RN2 A;  1UA1 A;  1Z6R A;  1QQC A;  3P38 A;  1NM1 A;  1RT2 A;  3FZL A;  4WCE L;  1NG9 A;  3VQP A;  5GAG P;  1VAZ A;  1BGX T;  4NLB A;  4JI2 K;  1KVA A;  4OPH A;  4BDZ A;  3DWL A;  4WQ4 C;  1QTM A;  5CHI A;  5HRN A;  3QNO A;  5TKY A;  1YHQ N;  4PKH A;  1K8K A;  5FRM A;  5DK5 A;  5D3G A;  3SUN A;  4RWT A;  1NJZ A;  3AY9 A;  1RBV A;  3O9Q A;  1CZB A;  3DI6 A;  1BA0 A;  4WQ4 A;  5GIP A;  3CCR N;  3RR7 A;  4GVM A;  2HW3 A;  1S72 N;  1BWF O;  4YOU A;  4NXM K;  4H0Y B;  3DXK B;  2GEM A;  4BRG A;  5AQW A;  4CJE A;  3RSE A;  3K9J A;  4CJ7 A;  4KHQ A;  4KHW A;  1YF5 L;  5KPZ A;  3L0Q A;  3WUH A;  1QS4 A;  1NWK A;  3J81 O;  1HYZ A;  2QKB A;  1C0G A;  3PLA A;  2HB5 A;  3QFP A;  3NGI A;  1KQS M;  3VQD A;  2QWN A;  4IZ9 A;  3R3L A;  3TAR A;  5IT9 O;  3NF9 A;  3DYA A;  4IOX A;  1TAU A;  2GBZ A;  2GWK A;  3LDS A;  4J2A A;  4E3S A;  1JCF A;  2Z1J A;  2G8V A;  5FLX O;  2QWP A;  4BGA A;  4CFB A;  1N5Y A;  2QWR A;  4FWM A;  2PYL A;  4JV5 K;  5AQF A;  1U45 A;  1CLQ A;  3LP3 A;  4RW9 A;  3D2E A;  4CJP A;  3CCU N;  4OJR A;  4BC4 A;  3SAG A;  2XY5 A;  1T7P A;  3AAQ A;  4FWR A;  2YV0 X;  2P9I A;  3ITH A;  2Y1I A;  3CI5 A;  1HKC A;  4A62 A;  1L3T A;  3I55 N;  3SUO A;  3AVA A;  3KLH A;  4FZZ A;  3L8B A;  1V4S A;  1L3S A;  3AVL A;  3WQU A;  3TSU A;  3CQX A;  3OHR A;  3OYE A;  3S9H A;  2P1J A;  1IO2 A;  1NOY A;  1KTQ A;  4OLA A;  1ASU A;  3CPE A;  4F3O A;  3M8R A;  4K41 A;  2VG5 A;  4QS7 A;  1GLJ O;  1LAV A;  2YHX A;  3C6U A;  3SBT A;  4DV3 K;  5BR8 K;  1HQE A;  3P83 D;  4O0J A;  1I94 K;  2IS3 A;  3GOI A;  4M3Y A;  4YOX A;  3AA3 A;  5LL6 Z;  3L3U A;  4L8R B;  4B1Z A;  4K25 A;  3CD6 N;  1H1V A;  4B9S A;  1HNW K;  4DR3 K;  2P9K A;  3SPY A;  3RR8 A;  1IV0 A;  2ATQ A;  3BGR A;  3OYA A;  4MDA A;  2VCP A;  2ZWH A;  5DM7 L;  2ASO A;  4FPA A;  4OKK A;  3NAE A;  4DB3 A;  3U8X A;  4H0V B;  3B6O A;  3VQB A;  5HRO A;  1HNV A;  3BZK A;  1D9F A;  4IEI A;  1NGJ A;  5ADX H;  1C0T A;  1Q9X A;  4C1N K;  3FLC O;  2HST A;  4BRC A;  4EHT A;  2F8T A;  3GL1 A;  3IMX A;  3VTH A;  3HTV A;  3WT0 A;  1C0M A;  2QWQ A;  3KHY A;  4ISF A;  1NK4 A;  2FBT A;  1N34 K;  4K42 A;  4B3O A;  2A5X A;  1NGH A;  1GLD G;  2NRR A;  4I6M A;  1K8K B;  5AQG A;  5BPM A;  3SNN A;  5C24 A;  4FVM A;  4JKE A;  1Z05 A;  2HND A;  3HM9 A;  4KHN A;  2O8B A;  2O4G A;  4FOE A;  3O4W A;  4DTU A;  1TYQ A;  3DXK A;  4CEO A;  1NGD A;  3QEI A;  3VEN A;  2P9P A;  1NU0 A;  4WE1 A;  2GV9 A;  4HVJ A;  1WUA A;  2ETJ A;  2HBL A;  2OPS A;  2HNY A;  4CBW A;  3G4S N;  1Q86 O;  2AJQ A;  4DV6 K;  1S6Q A;  3M1F A;  1S1U A;  5AQP A;  2D0P A;  3TSP A;  1VQO N;  3C0B A;  5LY3 A;  4CZM A;  3AVI A;  3UKR B;  2J4R A;  4JHD A;  3VOV A;  3DLR A;  1NOZ A;  5J2N A;  2I7N A;  3TAP A;  3ZT0 A;  2PBD A;  4KV8 A;  4H0X B;  3D2E B;  3LWM A;  3DLE A;  4H4O A;  1SV5 A;  1HYV A;  1Q8I A;  1YJ9 N;  4NB4 A;  1DT9 A;  3KLG A;  1NK6 A;  1RT1 A;  2FSN A;  1RBU A;  4IWV A;  3VEO A;  1JCE A;  4XH5 A;  3KD5 E;  4M41 A;  4HHT A;  3CIP A;  3IUC A;  1Z26 A;  5JLH A;  3UB5 A;  1TK5 A;  5KI6 A;  3CJA A;  2G8H A;  1D8Y A;  3LAK A;  2A6A A;  2ZQB A;  5HRS A;  1BDG A;  4LC9 B;  4DQR A;  2X6S A;  3QES A;  4FO0 A;  3NMU A;  3H46 O;  3PIP L;  4B3S K;  5CYQ A;  2UXC K;  3VEV A;  1NGG A;  3ZT3 A;  2DTU A;  1ZC6 A;  1Z25 A;  5KQ8 A;  4CK3 A;  3ASM A;  5HP1 A;  4DWI A;  4YOR A;  3L4I A;  1HX1 A;  3C94 A;  1K73 O;  4FJH A;  3THV A;  3U3Y A;  1L3V A;  3MX5 A;  3ID6 A;  4DQP A;  2QXF A;  1BG3 A;  2O8C A;  4DLE A;  2Q2R A;  1G15 A;  3CF5 L;  1SAZ A;  4DV4 K;  4RW4 A;  3KWG A;  4CIG A;  4KI6 A;  1B9F A;  4YY3 K;  5AQV A;  1XI1 A;  3NF6 A;  3QDK A;  1B9D A;  5EXW A;  1NKB A;  3K5M A;  1JL1 A;  4DV5 K;  3SBG A;  3HZ6 A;  3PUF A;  2NRW A;  5A2Q O;  1TVR A;  2G8K A;  5AJ3 K;  5FPE A;  1DLO A;  4O5F A;  1BIS A;  3OJU A;  4EP4 A;  4KRE A;  2Q0U A;  1K8A O;  1HR0 K;  2UUA K;  4YOT A;  1HRH A;  3AV9 A;  2G8I A;  3KLE A;  1Q18 A;  3QBW A;  4CF9 A;  2G8W A;  2AP1 A;  5AQO A;  4CJ5 A;  2OYQ A;  4OX9 K;  1BQM A;  3LZI A;  1IBK K;  4L3Q A;  1RBS A;  2E1Z A;  4GY2 B;  3CXC M;  1U04 A;  4PL8 A;  3MEG A;  1N6Q A;  1OH8 A;  4JKG B;  3OYM A;  1XC3 A;  3QEW A;  1GOA A;  3MN9 A;  4OGE A;  2VQF K;  3U9D A;  1IBM K;  3QET A;  1KXP A;  4JHD B;  3JYT A;  1RDW X;  5FPN A;  1RNH A;  2X74 A;  4H03 B;  2CGL A;  4BVO A;  4I6M B;  5M1O A;  4KHY A;  4DCH A;  3V9U A;  2KHO A;  5M1N A;  4KH4 A;  4C8L A;  4DUY K;  2O8B B;  1ZBL A;  1IKY A;  3VQ7 A;  4Y1C A;  4FJK A;  5AQT A;  4CHY A;  1TYQ B;  1RT5 A;  5JVG L;  4C8K A;  3V6D A;  4CZJ A;  2FBV A;  4CBX A;  4BR0 A;  4CIF A;  1NNE A;  2Q1N A;  4WQ5 C;  4G1Q A;  3SJH A;  5AQZ A;  5HOO A;  2QWM A;  1NGA A;  1LAW A;  2NLX A;  1YIJ N;  4LF5 K;  2Z1H A;  4NCA A;  5H1S Q;  4DR5 K;  5HRR A;  1JLB A;  5AZJ A;  3P31 A;  4JKC A;  1UA0 A;  1ATN A;  3K5L A;  4AM7 A;  5BRH A;  2X78 A;  1RDU A;  4FZX C;  3OW2 M;  2D0A A;  1KAX A;  3C65 A;  1FKO A;  4LFB K;  1Y64 A;  2A40 A;  3BP8 A;  3DLG A;  2GTD A;  3A0I X;  3O3F A;  3OJS A;  3JS6 A;  3PX0 A;  4O5B A;  3L3V A;  4W5R A;  3RVC A;  2HF3 A;  4KRF A;  3V81 A;  4BR9 A;  4A61 A;  1RIL A;  1C1C A;  3CMA N;  2GWJ A;  1XUP O;  4FYD A;  4FOI A;  2V7Z A;  4KKO A;  3EZW A;  3T19 A;  4FCY A;  4RTF D;  3OS2 A;  5E84 A;  4BC2 A;  1BCO A;  2YNG A;  4KBO A;  5EY4 A;  3ZSZ A;  2ITG A;  2E2Q A;  4BDP A;  1S5J A;  5EOY A;  5GIN A;  1KRP A;  4M3Z A;  3ATU A;  4IBN A;  5BRD A;  2OTL N;  4KB0 A;  4M3R A;  4B9L A;  3ULE A;  2ASP A;  4F8R A;  3FR0 A;  4DTO A;  3THY A;  4F9O A;  1MU2 A;  2W6L A;  3BY5 A;  3NE6 A;  5I9E B;  3UKR A;  3E1Y A;  1TL3 A;  3TR8 A;  3E9P A;  5C2F A;  3T69 A;  3B8A X;  2JGU A;  4M63 C;  3TAM A;  4DMN A;  4N41 A;  4LH5 A;  4JLH A;  2DY4 A;  2BE2 A;  2JWL A;  3AO2 A;  5CR4 A;  1HNI A;  4Z4G A;  1EKE A;  4UQG A;  5EVZ A;  2FF3 B;  4YDU C;  5DM6 L;  4FM2 A;  3G6E N;  4WYB A;  1E4F T;  3V1Q A;  2NRH A;  5ELZ A;  2E6M A;  4C8N A;  2QEX N;  1RTI A;  3DRS A;  3IFR A;  5BN9 A;  3MMV A;  3HI0 A;  1J53 A;  4CJ4 A;  4KH6 A;  1BUP A;  1NK9 A;  1JLF A;  3CCE N;  4KTW A;  5GAD P;  3NGZ A;  4KI4 A;  2HHS A;  4K0K K;  1VQM N;  4H4M A;  1KVC A;  5AQH A;  1QZ5 A;  4YOY A;  1TAQ A;  1EWR A;  4DQQ A;  5AQK A;  4AHR A;  4AH9 A;  4JK9 A;  1HKG A;  2WBN A;  4AIL C;  3LAM A;  3DLB A;  2KKZ A;  4LSN A;  1VSI A;  4CZE A;  5FRN A;  2F4V K;  2RKI A;  4BC5 A;  4DF4 A;  4RCH A;  3WNH A;  3CFP A;  4FJN A;  4E19 A;  3MK6 A;  3R6M A;  1J5O A;  3KK3 A;  2P9L A;  2YNH A;  1EO1 A;  4FWO A;  1JLE A;  5SWM A;  3R9P A;  4PHT X;  1EXQ A;  3M3Z A;  5HBM A;  2O8C B;  4BRF A;  4BRO A;  1IKW A;  1HLU A;  4JI3 K;  3KZB A;  4O4G A;  3BUZ B;  3A5N C;  3NF8 A;  3QIP A;  1MWM A;  1IG8 A;  1LOT B;  4K8Z A;  1EP4 A;  2A3Z A;  4RG8 A;  3SMP A;  4FJM A;  1NGC A;  2NRZ A;  1RT3 A;  3J7A P;  3VQ9 A;  5K14 A;  3FFI A;  4DSE A;  2IVN A;  4W5T A;  1T6D A;  3EEQ A;  3L2W A;  1BHL A;  5ADX A;  1IKX A;  1VQ5 N;  5LJW A;  1K6Y A;  3ZEU A;  2O8E B;  3OYB A;  4OKJ A;  1MA9 B;  4DTP A;  5AZJ B;  3BF3 A;  2UXD K;  4HWI A;  3AVH A;  3EO3 A;  2HHW A;  1TKD A;  3A2F A;  1SZ2 A;  3TAG A;  5KRS A;  4F4K A;  3AVN A;  1O13 A;  5AQQ A;  2DFF A;  3DM2 A;  4DQI A;  3SQ0 A;  4F2S A;  3HJF A;  4XEI A;  5C2D A;  4KFB A;  4JKG A;  3P5J A;  2BUP A;  1DTT A;  2PFU A;  4ELT A;  2IC3 A;  1EX4 A;  4QCL A;  5E41 A;  1WSH A;  3LM9 A;  2E88 A;  4DR2 K;  1XHX A;  4DSL A;  2RF2 A;  3RMA A;  3HSC A;  4ZTF A;  2UXB K;  3DRP A;  3TU5 A;  4BRN A;  3HO1 A;  3SPZ A;  3LZJ A;  5AQR A;  3VN5 A;  3ZX3 A;  1KC8 O;  4DTX A;  2A42 A;  3K0S A;  3ENH A;  3MED A;  4A59 A;  2FBY A;  2RPI A;  4N56 A;  1SKW A;  1QE1 A;  4FWP A;  2FLO A;  3AVM A;  1WSG A;  3VET A;  3ZSO A;  5KPR A;  4Q0B A;  1ITG A;  3IG1 A;  3VEW A;  2FSJ A;  4YOV A;  3F9M A;  3THY B;  2G8U A;  3RTV A;  2NNW A;  1LWC A;  4GMJ B;  4ICL A;  4KPY A;  3OYD A;  5J2Q A;  3I8D A;  4KTQ A;  4E7K A;  1W0H A;  4O55 A;  3KK2 A;  1TGO A;  2XY8 A;  5AFU A;  4PKI A;  3SJJ A;  4HUG A;  3EZ5 A;  4CGF A;  2HVI A;  1RT7 A;  4CIE A;  1EQY A;  1U2V A;  4OVL A;  5BRE A;  5CYM A;  4FLX A;  4PY5 A;  2ZF5 O;  3ZX2 A;  3NH1 A;  3ZSV A;  1S3X A;  3MXM A;  3VQ6 A;  1GOB A;  2ZJR L;  4JKA A;  1BU6 O;  1GLF O;  5GAH P;  1WSE A;  2W42 A;  1JXE A;  1P90 A;  3OYG A;  1NMD A;  2VWJ A;  3CC2 N;  3K2P A;  1ZBI A;  4KO0 A;  4RW6 A;  4NO7 A;  1HNX K;  2W6K A;  3SUQ A;  1C0F A;  1NK5 A;  2F96 A;  4CJR A;  1EET A;  1WSF A;  4B1W B;  4PL7 A;  3ENB A;  1KLN A;  3VQ8 A;  4CGG A;  4Z0U A;  4I2Q A;  1XHZ A;  3LPT A;  3NFA A;  3CPW M;  3FZK A;  4CBU A;  3V9S A;  2WFB A;  3AO4 A;  4I7F A;  4BG8 A;  3AVC A;  2FC0 A;  2V51 B;  1RDC A;  4DSI A;  4CHN A;  1N33 K;  4TSX A;  3ULE B;  3ULD A;  2VWK A;  2Z1I A;  1W7A A;  1HYS A;  1YI2 N;  4Z94 A;  1RDD A;  3ZT4 A;  3J7Y P;  5FRO A;  4CVN E;  3HP6 A;  2ZJQ L;  4U7B A;  4Z4C A;  4BRK A;  3FE1 A;  3EN9 A;  4CJT A;  4FLV A;  3QER A;  1JCG A;  2ZE2 A;  3ZEU B;  4OO1 J;  2P9L B;  2O8E A;  3UKU A;  5SZT A;  4DV2 K;  1WAF A;  3P39 A;  2FSK A;  4C1N I;  3ZSW A;  4QS9 A;  4H0P A;  2BGG A;  4CD1 A;  3M5R A;  3O1B A;  1NJW A;  3MWT A;  3VES A;  3LAL A;  2E8A A;  3M8Q A;  4FJI A;  1YTA A;  4B9U A;  1FK9 A;  2XHB A;  1XC9 A;  2HHT A;  3T1H K;  4JKF A;  4CEF A;  4JI0 K;  1T6C A;  4JS4 A;  2DFH A;  4I9Q A;  4YFU A;  4PUO A;  3EE9 A;  4CEB A;  3O3H A;  3NGY A;  3ZET B;  4CEE A;  2ZM6 K;  3ZYY X;  4DQS A;  2Y1J A;  1VRU A;  2HHQ A;  5GAE P;  3P4I A;  3S3M A;  2VQE K;  4OPA A;  1N8R O;  1ASV A;  4CJ3 A;  1Q81 O;  4JEP A;  1U48 A;  1TK8 A;  5HLF A;  3MAQ A;  3O6W A;  4CHO A;  3CC4 N;  1ATR A;  2A1S A;  4FLY A;  2YHY A;  4FJ5 A;  3VQ4 A;  1HJR A;  4BDY A;  1REV A;  3DOK A;  3O4Q A;  3VA0 A;  2OPP A;  1C0U A;  1KVB A;  4BWJ A;  3AVF A;  3SAH A;  4CD3 A;  2AA4 A;  4CZL A;  4DU3 A;  1GOC A;  1YVU A;  3Q7B A;  3EKS A;  1S6P A;  1T03 A;  5J1E A;  3HPO A;  1ZBF A;  3D45 A;  4DLG A;  4LFA K;  3VQC A;  4BR2 A;  3THX A;  4KHU A;  4H5R A;  3RWU A;  2XRI A;  1TKX A;  5I42 A;  1KSP A;  1CZA N;  4XH1 A;  3F2K A;  1WN7 A;  1E4G T;  3DAW A;  5LMN K;  4BGB A;  1U2V B;  4CFD A;  4F2R A;  1RDA A;  1RGI A;  4CHQ A;  4FLU A;  3H08 A;  2O8D A;  1VSD A;  4IFY A;  3GG4 A;  4H5W A;  4JI4 K;  4JI7 K;  1YAG A;  4CK2 A;  4K43 A;  4PA1 A;  2OZM A;  1RDB A;  2YHA A;  3O1W A;  4JAX A;  1Q7Y O;  1ZBS A;  3V1R A;  4RW7 A;  3EL2 A;  3QIC A;  3G71 N;  1OVY A;  4CGD A;  1UOC A;  4BRL A;  4CJK A;  1XNR K;  4CZI A;  1LW2 A;  4X62 K;  3F9K A;  4FW2 A;  1U49 A;  4B08 A;  3OYL A;  2QKK A;  3OVN A;  4ID5 A;  4DR6 K;  5AR0 A;  2D0B A;  4CZF A;  1T8E A;  3WQT A;  4CED A;  3DJC A;  3AAR A;  3HM8 A;  3ISN C;  5C25 A;  3KK1 A;  1K9M O;  4GV6 A;  1U47 A;  4DFK A;  1VQP N;  4NYN A;  3CCV N;  3VEZ A;  3O3G A;  3HST B;  2GUI A;  3HPH A;  1WBD A;  2E5L K;  4BY9 C;  2GEL A;  4WFN L;  4YHH K;  2O8F A;  3PO5 A;  3VF4 A;  1FW6 A;  4EZ6 A;  1FJG K;  4EHU A;  3I0R A;  4BRP A;  1WLJ A;  4W5N A;  4CF1 A;  4AHS A;  4FJ7 A;  3SCX A;  4IOC L;  3RMC A;  3VQE A;  4Q5V A;  4FJL A;  4A2A A;  2QA4 N;  4FK2 A;  3H6E A;  4X65 K;  5BN8 A;  4FJ9 A;  1Q82 O;  3DOL A;  2Q36 A;  4DFM A;  5BPL A;  3LDO A;  4A5A A;  2KW4 A;  3A5M C;  3O9U A;  1UAX A;  4CJS A;  3MN5 A;  3KLF A;  3DLL L;  2PYJ A;  4EZ9 A;  3CQ8 A;  1SKS A;  3KD1 E;  1JJ2 M;  2RHK A;  4B1V A;  4JD2 B;  1VHX A;  2QWO A;  3OS0 A;  1QVG M;  3HVT A;  3CCS N;  4XIU A;  1NK7 A;  4H5T A;  1WNS A;  1VQ6 N;  1OH7 A;  3LL3 A;  3DRR A;  4BAC A;  3H3N O;  4CHZ A;  3G0Z A;  3OYK A;  3J80 O;  5C12 A;  4FJX A;  2GX9 A;  2Q31 A;  2P9N A;  3R1X A;  3VGM A;  3GBT A;  2GUP A;  1ZXO A;  4OPK A;  2O4I A;  2NZT A;  5DMR A;  2HBM A;  1KCF A;  5M1F A;  3AO1 A;  3TPQ A;  3K5O A;  3K57 A;  3LAN A;  3OA9 A;  3NDK A;  5I3U A;  3HP9 A;  2EWS A;  1W9H A;  2F8S A;  2HBK A;  3CCQ N;  2KQ2 A;  4U67 L;  4LF8 K;  4E1N A;  3TSQ A;  1FKP A;  1NJI O;  3CG7 A;  2P9U B;  5AZI A;  5F2R A;  4EIA A;  1ZYQ A;  4LF9 K;  4DR4 K;  1S1T A;  1KFS A;  1YT3 A;  4MDB A;  3JXU A;  5M1Q A;  5J2M A;  3PSF A;  1NGE A;  3D0P A;  2O8D B;  2YJE A;  3IS9 A;  3CET A;  3QEP A;  5HRP A;  1VQ8 N;  3E01 A;  5CZ2 A;  4I9L A;  5J2P A;  4DTS A;  5MLC Q;  4N47 A;  5BR9 A;  2EX3 A;  4DFJ A;  3LP0 A;  3QFU A;  4B1X B;  3RRG A;  3UKU B;  4JRP A;  2VG7 A;  3EKU A;  4Z4H A;  2HOE A;  3PIO L;  1BCM A;  2E6L A;  3BZC A;  4MO5 A;  1M90 O;  2HHH K;  3O80 A;  2JWK A;  3E66 A;  4BR7 A;  3HYF A;  4ELV A;  4BE2 A;  2IGI A;  2E2O A;  2B4J A;  4CZH A;  3OYI A;  1JLC A;  4N5S A;  4BQL A;  2BDP A;  1TV6 A;  2Q97 A;  5AQN A;  3ZET A;  4M3X A;  4BVP A;  5FDL A;  1R0A A;  3QB0 A;  3C6H A;  4DKW A;  1QSL A;  4UY8 O;  3VEX A;  2P5G A;  4CGH A;  4F3T A;  4H5V A;  3KKS A;  3E9L A;  3VMF B;  4OGC A;  1W97 L;  1V4T A;  1NBW A;  3J8A A;  3QO9 A;  1VQ7 N;  4AHU A;  4IJN A;  1KFD A;  4CHP A;  3CCM N;  1HPZ A;  1VSM A;  4WF9 L;  3NH2 A;  3K58 A;  4JI6 K;  4KB1 A;  3C6A A;  4CCH A;  3CYM A;  3QML A;  3FZF A;  4NLC A;  4DV0 K;  2V7Y A;  3MWP A;  3D2F B;  1VSE A;  5LMU K;  4JD2 A;  2D5R A;  4C8M A;  3N4P A;  4CZG A;  5C42 A;  1WB9 A;  2VWB A;  3MCP A;  1N32 K;  2BTF A;  4LSL A;  3FGU A;  3G10 A;  3CFR A;  5AQY A;  2ITM A;  1QZ6 A;  2P9N B;  3DMJ A;  1NJX A;  5EU7 A;  4DF8 A;  2CGK A;  2KZZ A;  4DS5 A;  5C10 A;  1X9W A;  1X9J A;  3WNG A;  1QSY A;  1VQN N;  3L2Q A;  2V52 B;  4B8C A;  4KTZ A;  3SQ4 A;  4OKE A;  3MN6 A;  1QQM A;  3VPZ A;  3PV8 A;  4DV1 K;  3CJ1 A;  4ISG A;  5AZI B;  3ID8 A;  3QEX A;  1TUY A;  4CF2 A;  3VEY A;  1X9M A;  3T1A A;  4PWD A;  1TKT A;  4XH4 A;  3JAM O;  1B92 A;  1KAY A;  1NK0 A;  1NK8 A;  1P8Z A;  1VRT A;  3OY9 A;  1VQL N;  4B9T A;  1RBT A;  2UYT A;  4EAH D;  4Z4E A;  4E7J A;  3AGR A;  4BR4 A;  4CF8 A;  1S1X A;  1R59 O;  1QHT A;  1U4B A;  4B3T K;  4Z4I A;  3VF6 A;  4HUF A;  2P51 A;  3U3G A;  3K9K A;  1S1V A;  3VQ5 A;  4CGJ A;  3IAY A;  1OKJ A;  4JK8 A;  2PY5 A;  4FXD A;  3F73 A;  2VYP A;  1W2B M;  1JKH A;  4FZY A;  4E89 A;  1VQ9 N;  4ELU A;  3W3D A;  4CEQ A;  5KPT A;  4IO8 A;  4O0I A;  4DSF A;  4CGI A;  3HXM A;  1G99 A;  2YKN A;  3TTD A;  5AQU A;  1UWB A;  3LDP A;  4CFC A;  1CXQ A;  1VSL A;  3U4L A;  1QSS A;  5F1X A;  3NBP A;  4FM1 A;  2VGM A;  4DHY A;  3CFO A;  1HMV A;  1RCH A;  2PAV A;  3WXK A;  4M3W A;  4CFA A;  2IVO A;  4E1M A;  4M7X A;  1VQ4 N;  4JKB A;  3KIO A;  3CJC A;  5LJV A;  3KJV A;  2NUB A;  4FWN A;  3EY1 A;  3H1V X;  4NCB A;  2HNZ A;  1YIT N;  4B1Y B;  3TTC A;  1VSF A;  4E7H A;  4JYA K;  2CH5 A;  3AA2 A;  4FJJ A;  4ZHR A;  1L5U A;  4A2B A;  1KAZ A;  2WON A;  1YUW A;  5M1P A;  3C7N B;  2QWL A;  4BWM A;  4AHV A;  3MX2 A;  4PQU A;  3FZM A;  4DU4 A;  3OBW A;  2XY6 A;  1SS6 A;  1S22 A;  2D0O A;  2BH1 A;  1RT4 A;  3GE1 A;  1E3M A;  3TAF A;  2HBJ A;  3TAB A;  4B9N A;  3MN7 A;  1VK0 A;  2ASM A;  3TTF A;  4OLB A;  3O9R A;  2W41 A;  4R79 A;  1ILY A;  3Q7C A;  1DKG D;  3SAF A;  3ZT1 A;  2CGJ A;  1XMO K;  2VG6 A;  4LD0 A;  2E20 A;  2XO7 A;  4FK0 A;  1RTD A;  3L2R A;  1QVF M;  1Y97 A;  3CCJ N;  4B8A B;  3QEV A;  3DLH A;  1SKR A;  4ILH A;  4O44 A;  4FWK A;  1GLC G;  1HQU A;  1OVQ A;  1YJN N;  1LWF A;  1TL1 A;  1CXU A;  4IDH A;  4BE1 A;  1YVN A;  5AQI A;  2HHU A;  5HL7 L;  3LDL A;  4JNE A;  3UE5 A;  3A5L C;  1SUQ A;  5KGX A;  5JVH L;  4LF6 K;  2FXU A;  4CEC A;  4C8O A;  2P9I B;  1YJW N;  3CQY A;  4J2E A;  1IBL K;  3VGK A;  3V9X A;  1BA1 A;  3PX6 A;  2OPQ A;  2OTJ N;  3VQA A;  4MLH A;  1HKB A;  2WOM A;  3ZX0 A;  3WXL A;  3P1G A;  2ZD1 A;  3OYC A;  4GW6 A;  4DV7 K;  4DQ8 A;  4AHT A;  2BAN A;  3CM6 A;  3HRG A;  3KK7 A;  3VER A;  3CJ7 A;  1D5A A;  1VSJ A;  2QW9 A;  3AA5 X;  1DEJ A;  5AQX A;  1BQN A;  3A8Y A;  3L2V A;  3MEE A;  1RFQ A;  4DTM A;  2FF6 A;  4FJ8 A;  1GLE G;  5CZ1 A;  4E7I A;  3RMD A;  3VA3 A;  1X9S A;  2YNI A;  3CME N;  3LWL A;  1XWL A;  4BRQ A;  2HHV A;  2QI2 A;  4H5N A;  5AQS A;  1JLQ A;  4BRE A;  4DSJ A;  3VQQ A;  4CK1 A;  4W5Q A;  3VGL A;  5AFU H;  4FJG A;  4GKJ K;  1QQN A;  1NMN A;  3AA4 A;  3O9S A;  3NHG A;  4HTU A;  3TWH A;  1WSJ A;  2QM1 A;  4BRI A;  2LSN A;  4ILG B;  4NCG A;  2UUB K;  1ESV A;  3CJB A;  3LDQ A;  4JI5 K;  1OH5 A;  3SUP A;  3HOT A;  2Z1G A;  4M45 A;  4I2P A;  2YJF A;  4MQ3 A;  3PX4 A;  1N36 K;  3B6P A;  2H3G X;  3OS1 A;  1C6V A;  3TAE A;  5KGW A;  1NGF A;  3QLH A;  3K5N A;  3DXM B;  2CH6 A;  4YOW A;  3SQ2 A;  3AAP A;  1XNQ K;  4WQ5 A;  5BPN A;  1SL1 A;  2Q3S A;  4LH4 A;  1CZ9 A;  5CE3 A;  3WNF A;  4C23 A;  4BRH A;  3LPU A;  3IDH A;  4GVE A;  3AVB A;  3OYJ A;  4DTN A;  5EX5 A;  2P9P B;  1ASW A;  1IKV A;  4CI6 A;  3THW B;  5GIO A;  1A5W A;  2HMP A;  2IVP A;  4YDU A;  4EP5 A;  5JIC A;  2F9T A;  4MLE A;  3QBX A;  3WEE A;  2QK9 A;  4KHS A;  4K8X A;  3CM5 A;  3LP2 A;  3SMS A;  4ID1 A;  4HCB A;  4BQZ A;  1S9G A;  3THX B;  3BDP A;  3C6T A;  3CC7 N;  1JLG A;  3V4I A;  4LF7 K;  4CJL A;  4M42 A;  2YI1 A;  2P5O A;  5CY4 A;  2A1R A;  1YXQ A;  4IG3 A;  4CZK A;  4M7Y A;  4DU1 A;  1J5E K;  3CHW A;  3A5O C;  1TKZ A;  4GV9 A;  1F21 A;  3ENO A;  3WNE A;  4H0O A;  4B9V A;  4G9Z A;  2D1K A;  1J9A A;  1EWQ A;  3MEC A;  3O08 A;  4H0T B;  4BRD A;  3MXJ A;  1GLB G;  3V9Z A;  1D9D A;  3N4Q A;  3I8B A;  1WSI A;  1BIU A;  3LM2 A;  1VSH A;  3LDN A;  3WXM B;  4KHP K;  3WXI A;  3LP1 A;  3L6Q A;  2XY7 A;  4E7L A;  4E0D A;  3JSM A;  4JRQ A;  1HJO A;  3WXJ A;  1ZBU A;  3T3F A;  4FK4 A;  3AVJ A;  2QTD A;  4AF1 A;  3ZLJ A;  4JS5 A;  3ZSY A;  3NVK A;  3G25 A;  4KAZ A;  2R7Y A;  3OYN A;  4IG0 A;  1KLM A;  3HT3 A;  3SK3 A;  5KTQ A;  2D0C A;  1T05 A;  3C7N A;  1NKC A;  3QIN A;  3ATV A;  3CCL N;  2O8F B;  1VSK A;  3SV4 A;  3S41 A;  3AVG A;  2YHB A;  2WTU A;  3RRH A;  2QXL A;  1D4X A;  4QOZ B;  4O8U A;  3F5T A;  2P9S B;  3ZSQ A;  2Q0R A;  5C15 A;  4FLW A;  3K59 A;  1RTH A;  3KVG A;  3ZSX A;  2RE2 A;  4A5B A;  5JS2 A;  5AQL A;  4R5P A;  1NGI A;  4OPJ A;  2I5J A;  4BRM A;  2E2P A;  1GLL O;  4E1J A;  1T44 A;  2KZM A;  1T3V A;  1TK0 A;  1SL0 A;  3CJ9 A;  1MDU B;  2G8F A;  3M8P A;  4HUE A;  2HMI A;  4IOA L;  1NGB A;  1LV5 A;  1TUU A;  2W40 A;  3M6G A;  4CJU A;  3HK2 A;  3ZSR A;  1X1P A;  3HL8 A;  4GV3 A;  1I3A A;  4DTR A;  4DUZ K;  3TAQ A;  1SL2 A;  4IXC A;  3E9O A;  4DR7 K;  4DR1 K;  4YNQ A;  3W0L A;  3T1Y K;  5KRT A;  3U6F A;  4IDK A;  4W5O A;  4M3U A;  4Y1D A;  3OYH A;  4GNI A;  5JS1 A;  4WFA L;  4QS8 A;  3TI0 A;  3NH0 A;  3THW A;  5IWA K;  1BI4 A;  2YCH A;  4IFE A;  1RBR A;  3QIO A;  3ALY A;  4BE0 A;  1NKE A;  1JXB A;  3HBT A;  3SV3 A;  1NJY A;  4FSV A;  4FWQ A;  3FFK B;  2PZS A;  3GDQ A;  2P9U A;  2NRV A;  2OZS A;  3SQ1 A;  3DXM A;  4JN4 A;  1RTJ A;  1X3M A;  2EHG A;  1HPM A;  4CJF A;  1C1A A;  3M8S A;  3NCI A;  5FPM A;  3MDQ A;  5B8H A;  3OBY A;  1XQS C;  4M3T A;  3H45 C;  4CJV A;  4DSK A;  4B3M K;  1VQK N;  4CF0 A;  2NRT A;  1I39 A;  2E2N A;  2ZGY A;  1ZBH A;  1BO5 O;  1LWE A;  5KQD A;  2E4L A;  5BRF A;  3WEE B;  2IIR A;  4RW8 A;  2IOC A;  4AQY K;  5JLF A;  3T7Z A;  3DLK A;  2HHX A;  1M1K O;  1C1B A;  3RMB A;  2OPR A;  2E1Y A;  4FPB A;  2ZGZ A;  3MCA B;  1BOT O;  3KWI A;  5JMV A;  1FXX A;  4IFV A;  4B9Q A;  4A57 A;  5T7B A;  1LCU A;  2X6N A;  4MFB A;  3O5B A;  4HTL A;  1JL2 A;  4DTJ A;  3J7Z O;  2FBX A;  4FWL A;  3AGK A;  5AQM A;  5E26 A;  1S9E A;  3D6R A;  2OA8 A;  1LW0 A;  4FWS A;  4CE9 A;  5FPD A;  3NVM A;  1X3N A;  1HUX A;  3S3N A;  2KLA A;  4FM0 A;  1HNZ K;  4PKG A;  2OAN A;  2WUS A;  2UUC K;  4Y0W A;  3O8M A;  2DPN A;  1KD1 O;  2NRX A;  1XMQ K;  1U6Z A;  4IJA A;  2KTQ A;  4IKF A;  3ZT2 A;  3D7E O;  3PY8 A;  3VF2 A;  3S3O A;  3O4N A;  4JI1 K;  3D2F A;  4DG1 A;  2A41 A;  3PSI A;  4DS4 A;  4LY7 A;  4O8K A;  2I7P A;  2B5J A;  2P9S A;  3KLI A;  1A5X A;  2VGN A;  3I0S A;  2HF4 A;  5TKW A;  3SLC A;  3SYZ A;  4FL9 A;  3I56 N;  3U9Z A;  4N76 A;  3IRX A;  3BF1 A;  4CW7 B;  4BRA A;  4JI8 K;  2YNF A;  1YTU A;  1DGK N;  3EE8 A;  3RSE B;  4MO4 A;  4CER A;  4LFC K;  4X64 K;  4CES A;  4IO9 L;  4ZTJ A;  3QNN A;  1JLA A;  4ISE A;  1O1W A;  5F0X A;  3IKM A;  2OCE A;  1WAJ A;  3V9W A;  3AO3 A;  2YHW A;  2KFN A;  2D4W A;  1ATS A;  3SI6 A;  3L4Q A;  4BG9 A;  4FW1 A;  4IEE A;  1WBB A;  4V19 S;  1QHA A;  2YKM A;  4FVU A;  1L3U A;  1MWK A;  5M1K A;  1A5V A;  1DTQ A;  1RT6 A;  2B6A A;  1NLV A;  4B3R K;  1IJJ A;  3NF7 A;  3OYF A;  3I33 A;  1GLA G;  1BIZ A;  3HPG A;  4EFH A;  3C95 A;  3UIQ A;  2HVH A;  3HVR A;  1BL3 A;  1BI4 B;  4QAG A;  4CJW A;  1J6Z A;  3AVK A;  2F9W A;  4ILJ A;  4AHC A; 
#chains in the Genus database with same CATH homology
 4Z4F A;  2WOM A;  2Z1H A;  3P1G A;  4J2D A;  2ZD1 A;  1Q9Y A;  4NCA A;  3OYC A;  4CGD A;  5HRR A;  1UOC A;  1JLB A;  4GW6 A;  4CJK A;  1LW2 A;  4H8K A;  1J54 A;  3SZ2 A;  4AHT A;  1UA0 A;  3PO4 A;  2BAN A;  3CM6 A;  3K5L A;  3F9K A;  4FW2 A;  2DFE A;  3ZCM A;  3L2U A;  4CEZ A;  1U49 A;  4B08 A;  2X78 A;  2IAJ A;  3OYL A;  1D5A A;  3OVN A;  1VSJ A;  3AA5 X;  4ID5 A;  2QKK A;  4FZX C;  3TAN A;  1BQN A;  2JLE A;  2D0A A;  3L2V A;  2IDO A;  3MEE A;  4DTM A;  2D0B A;  1T8E A;  1FKO A;  4NYF A;  4CED A;  4FJ8 A;  3ISN C;  4FLT A;  5C25 A;  3KK1 A;  5CZ1 A;  3DLG A;  3KKR A;  4CJQ A;  4E7I A;  1U47 A;  4DFK A;  3RMD A;  4DFP A;  3O3F A;  3OJS A;  3VA3 A;  3PX0 A;  1X9S A;  4NYN A;  2KFZ A;  4O5B A;  2YNI A;  3O3G A;  3L3V A;  4W5R A;  3LWL A;  1XWL A;  2HHV A;  3HST B;  2GUI A;  4KRF A;  3HPH A;  4CEA A;  3V81 A;  4B9M A;  3V1O A;  3EYZ A;  1IH7 A;  1JLQ A;  3PO5 A;  1S1W A;  1RIL A;  1C1C A;  3VQQ A;  3AO5 A;  4FLZ A;  4CK1 A;  4W5Q A;  1IG9 A;  4DSJ A;  4EZ6 A;  3I0R A;  4FYD A;  4FJG A;  4KKO A;  1WLJ A;  3T19 A;  4FCY A;  4W5N A;  4J2B A;  3OS2 A;  4CF1 A;  4AHS A;  1BCO A;  2YNG A;  3AA4 A;  3ZSZ A;  4FJ7 A;  3MXI A;  2ITG A;  3NHG A;  4HTU A;  3TWH A;  3SCX A;  3KTQ A;  4BDP A;  1S5J A;  1WSJ A;  4HCC A;  3RMC A;  2RN2 A;  3VQE A;  4Q5V A;  2LSN A;  1UA1 A;  1KRP A;  1QQC A;  4M3Z A;  4IBN A;  4FJL A;  4NCG A;  1RT2 A;  4KB0 A;  4M3R A;  4FK2 A;  4B9L A;  3VQP A;  4F8R A;  1BGX T;  4DTO A;  4FJ9 A;  3SUP A;  2Z1G A;  2KTQ A;  1MU2 A;  3DOL A;  4M45 A;  4I2P A;  4DFM A;  1KVA A;  1KSP A;  3NE6 A;  4MQ3 A;  2KW4 A;  4BDZ A;  3PX4 A;  1UAX A;  3B6P A;  4CJS A;  3OS1 A;  1TL3 A;  3KLF A;  2PYJ A;  3TR8 A;  4EZ9 A;  1C6V A;  3CQ8 A;  1QTM A;  3TAE A;  1SKS A;  3KD1 E;  5KGW A;  5HRN A;  3QNO A;  3QLH A;  2JGU A;  5FRM A;  3TAM A;  3OS0 A;  5DK5 A;  3K5N A;  3HVT A;  1NK7 A;  4XIU A;  5D3G A;  3SUN A;  4DMN A;  1WNS A;  4N41 A;  4LH5 A;  4JLH A;  1NJZ A;  3SQ2 A;  2DY4 A;  1RBV A;  2BE2 A;  1CZB A;  1SL1 A;  3DI6 A;  2Q3S A;  4LH4 A;  3AO2 A;  4BAC A;  3DRR A;  1CZ9 A;  4GVM A;  3WNF A;  3RR7 A;  2HW3 A;  1HNI A;  4CHZ A;  3G0Z A;  3OYK A;  4Z4G A;  1EKE A;  3LPU A;  4UQG A;  4FJX A;  4CJE A;  4FM2 A;  3AVB A;  3OYJ A;  4DTN A;  4KHQ A;  4KHW A;  1ASW A;  1QS4 A;  1IKV A;  3V1Q A;  4OPK A;  2O4I A;  1HYZ A;  2QKB A;  1A5W A;  5DMR A;  2E6M A;  4C8N A;  1RTI A;  1KCF A;  2HB5 A;  3DRS A;  3NGI A;  3VQD A;  1J53 A;  4CJ4 A;  4EP5 A;  3AO1 A;  3K57 A;  3K5O A;  3LAN A;  3NDK A;  5I3U A;  1JLF A;  3TAR A;  1NK9 A;  3HP9 A;  4KHS A;  3NF9 A;  2QK9 A;  1W9H A;  2F8S A;  3DYA A;  4K8X A;  3CM5 A;  1TAU A;  3LP2 A;  2GBZ A;  2KQ2 A;  4ID1 A;  4E1N A;  4KTW A;  4HCB A;  3NGZ A;  1FKP A;  4KI4 A;  2HHS A;  1S9G A;  3CG7 A;  3LDS A;  3BDP A;  4H4M A;  4E3S A;  4J2A A;  1KVC A;  3C6T A;  2Z1J A;  1TAQ A;  2G8V A;  1JLG A;  1N5Y A;  4CFB A;  3V4I A;  2PYL A;  4DQQ A;  4M42 A;  4CJL A;  1ZYQ A;  2P5O A;  5CY4 A;  2A1R A;  1S1T A;  1KFS A;  1YT3 A;  1U45 A;  4AHR A;  1CLQ A;  3LP3 A;  4RW9 A;  4CJP A;  4IG3 A;  4AH9 A;  4OJR A;  2XY5 A;  5J2M A;  4DU1 A;  1T7P A;  2YV0 X;  1TKZ A;  1F21 A;  3WNE A;  3D0P A;  3IS9 A;  3QEP A;  4AIL C;  5HRP A;  3ITH A;  4B9V A;  3LAM A;  2Y1I A;  3E01 A;  3DLB A;  1J9A A;  5FRN A;  4LSN A;  1VSI A;  3MEC A;  4I9L A;  5CZ2 A;  4DTS A;  5J2P A;  1L3T A;  4N47 A;  2RKI A;  4DF4 A;  3SUO A;  3AVA A;  3MXJ A;  3WNH A;  3CFP A;  2EX3 A;  4DFJ A;  4E19 A;  3KLH A;  3LP0 A;  4FJN A;  3L8B A;  3KK3 A;  2YNH A;  3V9Z A;  1L3S A;  1J5O A;  3RRG A;  3AVL A;  1JLE A;  4JRP A;  2VG7 A;  5SWM A;  4Z4H A;  3OYE A;  3S9H A;  1EXQ A;  1IO2 A;  2P1J A;  1NOY A;  1D9D A;  1BCM A;  1KTQ A;  2E6L A;  1WSI A;  1ASU A;  1BIU A;  4OLA A;  1VSH A;  4F3O A;  3M8R A;  5HBM A;  2VG5 A;  3LP1 A;  1LAV A;  1IKW A;  2XY7 A;  4E7L A;  4E0D A;  4O4G A;  3C6U A;  3JSM A;  3HYF A;  3NF8 A;  4JRQ A;  4ELV A;  4BE2 A;  1HQE A;  1ZBU A;  3QIP A;  3T3F A;  4FK4 A;  2IGI A;  3AVJ A;  3P83 D;  4K8Z A;  1EP4 A;  2B4J A;  4O0J A;  4RG8 A;  3ZSY A;  4JS5 A;  4FJM A;  3OYI A;  1JLC A;  4N5S A;  4KAZ A;  2IS3 A;  2R7Y A;  1RT3 A;  3OYN A;  1TV6 A;  2BDP A;  4M3Y A;  4IG0 A;  1KLM A;  3HT3 A;  4M3X A;  5FDL A;  3VQ9 A;  5K14 A;  3AA3 A;  3FFI A;  5KTQ A;  4DSE A;  3L3U A;  1R0A A;  4L8R B;  4W5T A;  2D0C A;  1T05 A;  3L2W A;  1NKC A;  3QIN A;  1QSL A;  1BHL A;  1VSK A;  4B9S A;  1IKX A;  3SV4 A;  3AVG A;  2YHB A;  3RRH A;  3SPY A;  1K6Y A;  3RR8 A;  2ATQ A;  3BGR A;  4OKJ A;  3OYB A;  4CGH A;  3OYA A;  2P5G A;  4F3T A;  4QOZ B;  3ZSQ A;  4DTP A;  3KKS A;  4FLW A;  4OGC A;  3AVH A;  4OKK A;  3K59 A;  1TKD A;  3A2F A;  1RTH A;  3NAE A;  2HHW A;  3TAG A;  3VQB A;  3B6O A;  3QO9 A;  3ZSX A;  5HRO A;  5KRS A;  4F4K A;  3AVN A;  5JS2 A;  1HNV A;  4R5P A;  4OPJ A;  2DFF A;  2I5J A;  3DM2 A;  4AHU A;  1D9F A;  4DQI A;  3SQ0 A;  4F2S A;  1KFD A;  1C0T A;  1Q9X A;  4CHP A;  2F8T A;  3HJF A;  1HPZ A;  4KFB A;  1VSM A;  2KZM A;  1TK0 A;  1SL0 A;  3P5J A;  1C0M A;  3K58 A;  3NH2 A;  2G8F A;  1DTT A;  4ELT A;  4KB1 A;  2IC3 A;  3M8P A;  4HUE A;  4CCH A;  3CYM A;  1NK4 A;  2FBT A;  1LV5 A;  2HMI A;  1EX4 A;  4CJU A;  3HK2 A;  4B3O A;  3ZSR A;  1X1P A;  4QCL A;  3HL8 A;  1NKE A;  1VSE A;  5E41 A;  1I3A A;  1WSH A;  4DTR A;  2D5R A;  3SNN A;  4C8M A;  3TAQ A;  5C24 A;  1XHX A;  4DSL A;  4FVM A;  2RF2 A;  1SL2 A;  5C42 A;  3RMA A;  2HND A;  3HM9 A;  4ZTF A;  4KHN A;  3DRP A;  4YNQ A;  4LSL A;  2O4G A;  3G10 A;  3HO1 A;  3SPZ A;  3LZJ A;  3CFR A;  4DTU A;  3U6F A;  5KRT A;  4IDK A;  3VN5 A;  4W5O A;  4DTX A;  4M3U A;  4CEO A;  3DMJ A;  3MED A;  4Y1D A;  3OYH A;  3QEI A;  5JS1 A;  1NJX A;  2FBY A;  2RPI A;  4WE1 A;  5EU7 A;  4N56 A;  4DF8 A;  1QE1 A;  2GV9 A;  1SKW A;  3TI0 A;  4HVJ A;  3AVM A;  3NH0 A;  1WSG A;  2ETJ A;  3ZSO A;  4DS5 A;  2KZZ A;  2OPS A;  1X9W A;  2HNY A;  4Q0B A;  1BI4 A;  1ITG A;  2AJQ A;  3WNG A;  1S6Q A;  3IG1 A;  1QSY A;  1S1U A;  2G8U A;  1RBR A;  3RTV A;  3L2Q A;  1LWC A;  3QIO A;  3ALY A;  4BE0 A;  4B8C A;  4KTZ A;  1JXB A;  4GMJ B;  3SQ4 A;  3AVI A;  4ICL A;  4OKE A;  3SV3 A;  4KPY A;  1NJY A;  3OYD A;  5J2Q A;  3PV8 A;  3I8D A;  2PZS A;  3DLR A;  1NOZ A;  5J2N A;  3TAP A;  4KTQ A;  2OZS A;  4E7K A;  3QEX A;  1W0H A;  4O55 A;  3SQ1 A;  3ZT0 A;  4CF2 A;  3KK2 A;  1TGO A;  2XY8 A;  1X9M A;  1RTJ A;  3T1A A;  3SJJ A;  4PWD A;  4HUG A;  4KV8 A;  2EHG A;  3EZ5 A;  1TKT A;  4CGF A;  4CJF A;  1NK0 A;  1B92 A;  2HVI A;  1C1A A;  3M8S A;  3LWM A;  1RT7 A;  3NCI A;  4CIE A;  1NK8 A;  4OVL A;  3DLE A;  4H4O A;  5CYM A;  1VRT A;  1SV5 A;  1HYV A;  3OY9 A;  1Q8I A;  4FLX A;  4PY5 A;  3KLG A;  4B9T A;  3NH1 A;  1RBT A;  3ZSV A;  1RT1 A;  1NK6 A;  4CJV A;  4M3T A;  3MXM A;  3VQ6 A;  4DSK A;  4CF0 A;  1GOB A;  4Z4E A;  4E7J A;  1RBU A;  4CF8 A;  1I39 A;  1WSE A;  2W42 A;  1JXE A;  3OYG A;  2VWJ A;  1S1X A;  3K2P A;  1ZBI A;  3KD5 E;  4KO0 A;  4RW6 A;  1ZBH A;  4M41 A;  4HHT A;  1LWE A;  1QHT A;  2E4L A;  1U4B A;  4Z4I A;  1Z26 A;  4HUF A;  4RW8 A;  3SUQ A;  1TK5 A;  2IOC A;  2P51 A;  5KI6 A;  3U3G A;  1NK5 A;  2F96 A;  1S1V A;  4CJR A;  2G8H A;  1D8Y A;  3VQ5 A;  3DLK A;  4CGJ A;  1EET A;  1WSF A;  2HHX A;  3IAY A;  1KLN A;  3LAK A;  5HRS A;  2ZQB A;  3VQ8 A;  4CGG A;  4Z0U A;  4I2Q A;  1XHZ A;  1C1B A;  2X6S A;  4DQR A;  3QES A;  3RMB A;  2OPR A;  2PY5 A;  4FXD A;  3LPT A;  3NFA A;  3V9S A;  3F73 A;  3AO4 A;  4I7F A;  1JKH A;  5CYQ A;  4FZY A;  4E89 A;  1FXX A;  3AVC A;  4IFV A;  4ELU A;  3ZT3 A;  2FC0 A;  4CEQ A;  1RDC A;  5T7B A;  4DSI A;  4CHN A;  2DTU A;  4O0I A;  4TSX A;  3ULD A;  2VWK A;  2X6N A;  1Z25 A;  2Z1I A;  4MFB A;  4CK3 A;  4DSF A;  1HYS A;  4CGI A;  3HXM A;  2YKN A;  1RDD A;  3ZT4 A;  3ASM A;  1JL2 A;  5FRO A;  3HP6 A;  4DTJ A;  5HP1 A;  4DWI A;  4Z4C A;  2FBX A;  1UWB A;  4CFC A;  1CXQ A;  1VSL A;  3C94 A;  4CJT A;  4FJH A;  4FLV A;  3QER A;  3THV A;  1QSS A;  3U3Y A;  2ZE2 A;  1S9E A;  3NBP A;  1L3V A;  5SZT A;  4FM1 A;  2OA8 A;  1LW0 A;  1WAF A;  3CFO A;  1HMV A;  3ZSW A;  1RCH A;  4CE9 A;  4DQP A;  2BGG A;  2QXF A;  4M3W A;  4CFA A;  3S3N A;  1NJW A;  4E1M A;  4FM0 A;  3LAL A;  3KIO A;  4DLE A;  3M8Q A;  4FJI A;  1G15 A;  4FZZ A;  3KJV A;  1YTA A;  4B9U A;  1FK9 A;  2NUB A;  2XHB A;  1XC9 A;  4RW4 A;  2HHT A;  4KI6 A;  4CIG A;  3EY1 A;  1B9F A;  4NCB A;  2HNZ A;  4CEF A;  1XI1 A;  3NF6 A;  4JS4 A;  1VSF A;  1B9D A;  2DFH A;  4E7H A;  4I9Q A;  1NKB A;  3AA2 A;  4IKF A;  4YFU A;  4FJJ A;  4PUO A;  3ZT2 A;  1JL1 A;  3K5M A;  4CEB A;  3O3H A;  3NGY A;  3PUF A;  4ZHR A;  1L5U A;  3PY8 A;  4CEE A;  3S3O A;  3O4N A;  1TVR A;  2WON A;  4DQS A;  2Y1J A;  2G8K A;  1VRU A;  4DG1 A;  2HHQ A;  4DS4 A;  1DLO A;  4BWM A;  4AHV A;  3S3M A;  4PQU A;  1BIS A;  4DU4 A;  1ASV A;  3OJU A;  4EP4 A;  4CJ3 A;  4LY7 A;  4KRE A;  2XY6 A;  1U48 A;  2B5J A;  1TK8 A;  1HRH A;  5HLF A;  3MAQ A;  3AV9 A;  2G8I A;  3KLI A;  1RT4 A;  1A5X A;  4CHO A;  3KLE A;  3TAF A;  3I0S A;  3SYZ A;  4CF9 A;  3TAB A;  2G8W A;  4B9N A;  2A1S A;  1VK0 A;  4FLY A;  4FJ5 A;  3VQ4 A;  3IRX A;  4N76 A;  4CJ5 A;  1HJR A;  2OYQ A;  4BDY A;  4OLB A;  1REV A;  3DOK A;  3O4Q A;  2YNF A;  1BQM A;  3LZI A;  1YTU A;  3VA0 A;  1RBS A;  2OPP A;  1C0U A;  4CER A;  1U04 A;  4CES A;  4ZTJ A;  3ZT1 A;  3MEG A;  1KVB A;  3QNN A;  1JLA A;  1N6Q A;  4BWJ A;  1O1W A;  3AVF A;  2VG6 A;  4LD0 A;  3OYM A;  2XO7 A;  1GOA A;  3QEW A;  4OGE A;  4FK0 A;  4DU3 A;  1WAJ A;  1RTD A;  1GOC A;  3V9W A;  1YVU A;  3L2R A;  3AO3 A;  3QET A;  2KFN A;  3JYT A;  1RNH A;  1S6P A;  2X74 A;  1T03 A;  1Y97 A;  5J1E A;  3HPO A;  1ZBF A;  3D45 A;  3SI6 A;  4KHY A;  4B8A B;  4DLG A;  4FW1 A;  3V9U A;  2YKM A;  3QEV A;  3VQC A;  3DLH A;  1SKR A;  1L3U A;  4KHU A;  3RWU A;  2XRI A;  4C8L A;  4O44 A;  1TKX A;  5I42 A;  1IKY A;  1A5V A;  4Y1C A;  3VQ7 A;  1ZBL A;  1DTQ A;  1HQU A;  1WN7 A;  1RT6 A;  2B6A A;  4FJK A;  4CHY A;  1RT5 A;  1LWF A;  4CFD A;  1TL1 A;  1CXU A;  4C8K A;  4F2R A;  3V6D A;  4BE1 A;  1RDA A;  2FBV A;  3NF7 A;  3OYF A;  2HHU A;  4CHQ A;  4FLU A;  4CIF A;  3H08 A;  1BIZ A;  1SUQ A;  3HPG A;  5KGX A;  3C95 A;  1VSD A;  4G1Q A;  4IFY A;  3UIQ A;  4CEC A;  4C8O A;  2HVH A;  4J2E A;  3HVR A;  4CK2 A;  3V9X A;  1BL3 A;  1BI4 B;  4PA1 A;  3PX6 A;  4QAG A;  4CJW A;  2OZM A;  1LAW A;  1RDB A;  2YHA A;  2OPQ A;  3AVK A;  3V1R A;  3VQA A;  4RW7 A;  4AHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...