4CESA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cesA00
4Z4IA 5E41A 1ASUA 3ZSWA 3AO4A 1RBSA 4KTWA 4DTNA 1RDAA 4KPYA 3G0ZA 3NF9A 4E19A 3SCXA 3DOKA 1T8EA 4DSFA 3NFAA 3PV8A 4HCBA 3OYLA 3V81A 4I2PA 4I9LA 2YNHA 3OYIA 4DQRA 4BE1A 4ELVA 3NBPA 4BWMA 1S1WA 2Z1IA 2OPPA 4CJUA 3K5LA 3VQ8A 3OJUA 4RG8A 1UA0A 4OGEA 1NK4A 3PO4A 4FK4A 1RDBA 4ZTFA 1ZBFA 4ZHRA 2OPQA 1BL3A 2EX3A 3ZSYA 3HVRA 3PY8A 2F8SA 4OJRA 3RRHA 4IG3A 4CEAA 1DTTA 2IDOA 4IBNA 3M8QA 1ZBLA 3HP6A 5FRMA 4OKEA 2YNGA 1VSDA 1C1CA 3NAEA 4FLYA 3BDPA 4I9QA 2X6SA 1NK9A 2HB5A 3LPTA 4AH9A 4CJ4A 1TGOA 4CHQA 2XY6A 1X9WA 1IKYA 1TVRA 3OS2A 3OYEA 3QO9A 4FM1A 3V9XA 4B9LA 3ZSXA 3LP3A 3VN5A 3VQCA 3B6OA 5FRNA 3AA3A 4CK1A 4DFMA 3AVAA 3CYMA 4B9NA 1FK9A 2XRIA 3NGIA 1U48A 3IAYA 4M42A 2HHUA 2IAJA 3WNHA 4CEDA 3U3YA 4CERA 1QQCA 3AO2A 4DMNA 4KHUA 3HPHA 4B8AB 3CM5A 1I3AA 3FFIA 4CHYA 3HM9A 1U4BA 5C25A 4B9TA 3SV3A 3AVKA 1BQNA 3LAKA 2YHAA 4IDKA 3VQBA 4E7KA 1B92A 4RW8A 1LV5A 4B9SA 4CK3A 2OA8A 3DRSA 3KIOA 4CK2A 4DTOA 1VRTA 3VQDA 2D0AA 4FW2A 4CJFA 3SV4A 4LSNA 1ASVA 5SZTA 3TAPA 2P1JA 1IG9A 3DLEA 2QKBA 2PYJA 1O1WA 1LAWA 1TL1A 1DTQA 4C8LA 2X78A 3QEVA 4BE0A 4XIUA 3OS0A 1VSMA 3CM6A 4CFDA 4CEOA 4DTXA 3SPYA 1NOYA 4DQPA 3QIPA 4AHSA 4L8RB 3VA0A 4N41A 4OPKA 3OYMA 3RMCA 1J5OA 3C6UA 3OYKA 2KTQA 2P51A 1QSLA 2OYQA 2IGIA 3HO1A 3C6TA 4QOZB 1L5UA 3V9ZA 3K2PA 1MU2A 4JLHA 4OVLA 3ZT4A 2HVIA 4CJ5A 3QEIA 4EZ9A 4ID5A 1TAUA 1KVAA 3TARA 3NF7A 3SUNA 3O4QA 4KO0A 4KRFA 3HSTB 3QEWA 3OYFA 4F4KA 1KCFA 4O44A 4AHCA 3DRPA 5I3UA 4IFVA 1XWLA 4FZYA 2XY5A 3DLKA 3KKSA 1HJRA 3S9HA 1HQEA 4O4GA 4C8OA 2IS3A 1UA1A 1LAVA 2HHTA 1Y97A 3LALA 5DMRA 3L2WA 3O3HA 3PX6A 4FJLA 4N56A 3M8PA 4NYNA 1XHXA 4DTUA 4KHSA 4Z4FA 1J53A 4E0DA 3QNOA 1WAFA 2B6AA 4RW4A 1LWEA 3TABA 3QINA 4KHYA 1ZBIA 3KLGA 2HHSA 3KJVA 3T19A 1JL1A 1RT3A 4CIGA 4FM0A 3WNEA 4DTRA 2HNZA 1BCMA 1S6PA 1TAQA 1YVUA 4UQGA 4BACA 2FBTA 4LH5A 1Q8IA 3HVTA 3HPOA 3V4IA 3AA5X 1JLAA 3T1AA 3ZSOA 1JKHA 1RT1A 2RN2A 4BE2A 4O0IA 3P83D 1LWFA 3CQ8A 4M41A 4OPJA 2GV9A 2QKKA 1KVBA 3BGRA 4KFBA 3AA4A 4OGCA 4DS4A 4Y1DA 4OLAA 1QTMA 3AVNA 1XHZA 3DLBA 2WONA 4FCYA 3HYFA 2JGUA 1NK0A 4HHTA 3L2VA 2NUBA 4CEZA 2FBXA 2O4GA 3RMAA 1TL3A 1KRPA 1S9EA 2HHWA 3A2FA 4ELUA 1WNSA 4CJLA 3F73A 5HROA 1BI4A 2ATQA 3AVCA 4EP4A 3ZSQA 1QSSA 4DS5A 4J2BA 5JS2A 1EP4A 2YHBA 4KHWA 1YTUA 4FYDA 4M45A 4KAZA 4CJ3A 1T05A 4F2SA 5CYMA 1RTHA 3OJSA 3IG1A 3OY9A 3OVNA 4CESA 3DM2A 4FZXC 3C94A 2I5JA 5I42A 1ZBUA 1XC9A 1SL2A 1IKXA 1QS4A 1VSIA 1BIUA 1WLJA 3NF8A 4O5BA 3SYZA 4E7JA 1L3UA 3SUPA 3SI6A 1D8YA 2F8TA 2KZZA 5K14A 4AHUA 4FLWA 3QLHA 3L3VA 3VQEA 3K57A 1CZBA 3M8SA 4DF8A 3SJJA 1JLEA 5KGXA 3VQ6A 1VSKA 3VQ7A 4FJIA 1JXEA 1S5JA 4F3TA 4GW6A 3S3NA 3HJFA 4FLTA 4DFKA 4KKOA 3QERA 1EKEA 4W5RA 2P5GA 4DSJA 4M3ZA 4CEBA 1SKSA 4Z4EA 4CF9A 1NKCA 3L2QA 1RT2A 1CXQA 1J9AA 3MEDA 1VSJA 2VWKA 4CJVA 2OZMA 4PQUA 3V1QA 1ASWA 2Z1GA 4W5QA 3SUOA 4DF4A 4O55A 3IS9A 4GVMA 1T7PA 3ASMA 2YKMA 4ICLA 3LP2A 3NDKA 4FJKA 4DG1A 1C0UA 5KI6A 1S1UA 1HYVA 2DY4A 3S3OA 1SV5A 1WSHA 1JLCA 4Q5VA 4H4MA 1REVA 1RILA 2VG5A 3LDSA 2DFEA 3OYCA 1G15A 1TKZA 5FROA 4CF8A 1F21A 1SUQA 3C95A 3LP1A 3SQ0A 4IKFA 4BDPA 3EY1A 3I0RA 3TANA 3SUQA 2E4LA 1Z25A 3DYAA 3DLRA 3EZ5A 1WSFA 4HTUA 4DU4A 3ZSRA 1NJWA 2B5JA 4DU3A 5HRPA 1HYSA 4FK2A 4CHOA 2FBYA 4CEQA 1VK0A 4DQSA 3OYAA 4LSLA 4CIEA 3LAMA 2B4JA 1LWCA 2JLEA 2Z1HA 1RBTA 1A5VA 2D5RA 4B08A 4MFBA 4CFBA 4W5OA 4FJHA 3L3UA 4M3WA 5HRSA 4Z4CA 3RMDA 4Q0BA 4KB1A 1D9DA 3NE6A 2XHBA 2A1RA 1WSGA 2KFNA 1D9FA 4E89A 4E7LA 3DOLA 3CFRA 4E7HA 4RW9A 2OPSA 4IFYA 1JLBA 1HNIA 1U47A 2DTUA 3THVA 3RWUA 2R7YA 2W42A 3MXMA 3UIQA 1RBUA 4CJTA 1HPZA 1JXBA 3NH0A 4E1MA 3RR8A 1UOCA 4JRQA 4B9MA 1SKRA 4CJKA 4AILC 3TAEA 3I0SA 3QETA 1BCOA 3HXMA 3QIOA 3TWHA 4F8RA 1RNHA 4CJSA 2YNFA 3L2RA 1J54A 3RRGA 3OYDA 4AHRA 4CHNA 1RTJA 1HRHA 3D0PA 4Z4GA 5CZ1A 3V9UA 3HP9A 4CIFA 1NK7A 4E3SA 5HLFA 1TK5A 3PUFA 1TK0A 2PZSA 3LWLA 3LZIA 1L3TA 1SL0A 4HUGA 1VSHA 3WNFA 5J2QA 2Y1JA 1HMVA 1Q9XA 3ZT2A 4CGJA 1C0TA 3AO1A 4CF1A 3PX0A 1KLMA 5CY4A 3HL8A 3SQ1A 4DWIA 4KI6A 1JLQA 4FK0A 1CZ9A 2D0CA 3OYHA 3H08A 4HUEA 4FLVA 3T3FA 2QK9A 5HRNA 2HNDA 1NJXA 2HHXA 2A1SA 3K5NA 4RW6A 2FBVA 3ZSZA 2YV0X 5T7BA 4DQIA 4CF2A 1EETA 4KB0A 4FJ7A 4PA1A 3OYJA 4TSXA 5FDLA 2BE2A 4KTQA 1HQUA 1VSFA 1RBVA 1WN7A 4KREA 2ZQBA 2D0BA 4I7FA 5HRRA 1YTAA 4CHZA 3KTQA 2G8HA 1JLFA 3ZT1A 2KZMA 1VRUA 1S1VA 4CHPA 2RKIA 4C8MA 1QSYA 5KTQA 3E01A 4FXDA 2G8WA 4ID1A 4F2RA 3MAQA 4PUOA 2YKNA 4J2AA 1B9FA 3AO5A 4FJ9A 1SL1A 1TKTA 3AO3A 3P5JA 4N5SA 4BDYA 1NKBA 2VG6A 4QCLA 3JSMA 4LY7A 4B9UA 4ELTA 3VQPA 4CGIA 3JYTA 1Z26A 1S1TA 2VG7A 4PWDA 4KTZA 3AA2A 3U3GA 3HT3A 3TI0A 4N76A 1ZYQA 1C1AA 1D5AA 3O4NA 3KLIA 4DTJA 3TAQA 1N5YA 4FJJA 1ZBHA 1QE1A 1S1XA 4NCAA 1JL2A 4FZZA 2IOCA 4CJQA 1X1PA 2IC3A 4JS4A 1NOZA 4FLZA 3VA3A 2GUIA 4M3TA 4M3YA 2O4IA 4HUFA 4FVMA 3QESA 2X74A 4NCGA 3B6PA 5J2NA 4RW7A 3HPGA 2ZD1A 4MQ3A 5CYQA 3DI6A 3AVGA 3DMJA 4FLXA 3TAGA 1RDCA 3PO5A 2KFZA 5J1EA 4CJRA 4E7IA 1A5WA 4DTPA 2RPIA 4KHQA 4FJXA 2P5OA 4AHTA 3O3GA 1HNVA 1UAXA 3MEEA 3I8DA 3SPZA 4HCCA 5EU7A 1FKPA 3VQAA 1NJZA 3V9SA 4FJMA 3NGZA 4DLEA 1C1BA 4CJEA 3RTVA 1HYZA 4DSEA 4LD0A 1L3SA 3SQ4A 2F96A 3CFOA 4N47A 2BDPA 3KD5E 1CXUA 1UWBA 3LANA 3NH2A 3OYGA 2HW3A 2G8UA 1RT5A 2XY8A 3AVHA 2HHQA 1DLOA 1IO2A 1W9HA 1C6VA 3AVBA 4KV8A 3ZSVA 4FJNA 3RMBA 2X6NA 2Z1JA 1LW0A 1RBRA 3ISNC 4CECA 5KRSA 4DTSA 3V6DA 5SWMA 1KSPA 1QHTA 3DLHA 5HBMA 3TR8A 2WOMA 3NGYA 1X9SA 3MECA 1VSLA 3AVLA 3VQ9A 4QAGA 3O3FA 3K58A 3LZJA 2XY7A 4CCHA 1WSIA 2DFHA 2OZSA 4OKJA 4H8KA 4ZTJA 1RTIA 2G8FA 3NF6A 4CE9A 3K5MA 1SKWA 4DSKA 1KFDA 1X9MA 2G8VA 4LH4A 4AHVA 4BDZA 3QNNA 2Y1IA 3KK1A 3KD1E 3ULDA 4HVJA 4YFUA 1L3VA 4GMJB 2YNIA 4F3OA 3LPUA 3G10A 4C8KA 1FXXA 1GOBA 2HVHA 1BHLA 1S9GA 2FC0A 4O0JA 4CJWA 3OYNA 4DFPA 4CEFA 2VWJA 3S3MA 2PYLA 5KGWA 4JRPA 1TKXA 4CJPA 4NCBA 1EXQA 1A5XA 4IG0A 3MXIA 3SQ2A 1FKOA 3KKRA 2XO7A 4J2DA 2HHVA 1WAJA 3KK2A 3AVFA 4CGDA 1U45A 2Q3SA 1I39A 4FW1A 4C8NA 1BIZA 3KLHA 5J2MA 2ETJA 4JS5A 4CEEA 4K8XA 3ITHA 2BGGA 3CG7A 1U49A 1RT4A 2OPRA 3P1GA 4B3OA 5CZ2A 3L2UA 1RTDA 2G8IA 1BQMA 1K6YA 4DFJA 1R0AA 3RR7A 1C0MA 1RCHA 3M8RA 2HNYA 3D45A 4K8ZA 4G1QA 5C42A 1BGXT 2BANA 3L8BA 3DRRA 3NHGA 1NKEA 3EYZA 4PY5A 4FJGA 4DSLA 3VQ5A 4WE1A 3KK3A 3V9WA 1KFSA 4CGFA 3IRXA 4Z0UA 3AVMA 1TK8A 4EZ6A 3AV9A 3ZT3A 4W5TA 2GBZA 5HP1A 1XI1A 5D3GA 1NK6A 1N6QA 4M3UA 4B9VA 2AJQA 1CLQA 1WSEA 2RF2A 1IKWA 3U6FA 2G8KA 4CGGA 1TV6A 3TAMA 1LW2A 3ZT0A 3MEGA 1KLNA 1B9DA 1IKVA 1U04A 4R5PA 3OS1A 4DU1A 1KVCA 2ZE2A 3VQQA 4FJ5A 3KLEA 4W5NA 4DQQA 1Q9YA 5C24A 4YNQA 3QEXA 3SNNA 3WNGA 1RDDA 3DLGA 2EHGA 3AVJA 4Y1CA 1GOCA 2DFFA 4DLGA 2HMIA 3NCIA 3CFPA 3TAFA 3F9KA 1NK8A 2E6LA 4EP5A 5KRTA 3OYBA 4M3XA 3K59A 3LWMA 1RT7A 1WSJA 2KQ2A 3KLFA 1W0HA 3AVIA 1KTQA 1ITGA 5J2PA 3ALYA 2QXFA 3QEPA 1GOAA 1YT3A 4Z4HA 1TKDA 4FJ8A 1BISA 4BWJA 4CGHA 1RT6A 1NK5A 4E1NA 4NYFA 1T03A 3LP0A 2E6MA 4FLUA 1S6QA 4B8CA 4DTMA 1EX4A 1IH7A 2ITGA 3SZ2A 3PX4A 2LSNA 1BI4B 3NH1A 4CFAA 3HK2A 4M3RA 3ZCMA 1VSEA 3V1RA 3V1OA 4CFCA 4FM2A 4H4OA 4OLBA 4J2EA 4DSIA 3K5OA 4OKKA 3MXJA 4KHNA 2PY5A 1NJYA 5DK5A 5JS1A 4CF0A 3VQ4A 1JLGA 2KW4A 4I2QA 4KI4A
chains in the Genus database with same CATH superfamily
1ASUA 5AQYA 3NF9A 3SCXA 1OKJA 3DOKA 3NFAA 3OYLA 4I2PA 1JCEA 3VERA 1S1WA 2OPPA 4YOTA 1GLJO 3OJUA 1UA0A 4EHTA 1QQMA 5DM6L 1ZBFA 2PFUA 3VENA 2OPQA 3PY8A 3HVRA 1MWMA 4IG3A 1DTTA 4KBOA 4BROA 3M8QA 5AQFA 2F7TA 3CQYA 3LDQA 1KD1O 1C1CA 4E1JA 3K9KA 2X6SA 4AH9A 3E1YA 3TTDA 2XY6A 1X9WA 3OYEA 1XQSC 4KHPK 1J6ZA 3G71N 3ZSXA 3VQCA 2UXBK 4RCHA 4DFMA 3CYMA 1FK9A 4WQ5A 4JN4A 3WXKA 2HBLA 3WUHA 4X65K 3SV3A 1BQNA 2O8DA 2YHAA 4JD2A 4DR3K 1LV5A 4B9SA 4DTOA 5AQZA 3F5TA 1VRTA 3VQDA 2D0AA 4LC9B 5SZTA 4IOXA 1IG9A 3DLEA 4BE0A 2IVNA 1VSMA 2QM1A 3CM6A 1XC3A 4ISGA 4L8RB 3OYMA 1J5OA 1SZ2A 3VMFB 2IGIA 3HO1A 1IBMK 3HRGA 3ZT4A 2E2QA 3QEIA 4J8FA 1KVAA 3EKUA 5M1OA 4F4KA 1KCFA 4JI3K 3CMAN 2HBJA 3DLKA 1HJRA 5F2RA 1HQEA 3WXMB 5FLXO 4LFCK 4QS7A 4NYNA 3G6EN 3THYB 4KHSA 4Z4FA 4E0DA 1WAFA 4KHYA 2QXLA 3KLGA 3A8YA 2HHSA 3T19A 1YJ9N 4CIGA 3C6AA 3THWB 4FSVA 2HNZA 3R1XA 5EOYA 1S6PA 1TAQA 3THXB 4BACA 2FBTA 3V4IA 3HVTA 3AA5X 3M5RA 4BE2A 3ZSOA 4O0IA 5AR0A 4C1NK 3CQ8A 2QKKA 4KFBA 4OGCA 4OLAA 4FWRA 1T44A 3AVNA 1XHZA 3DLBA 3HM8A 5LMNK 3TSUA 3NVMA 3L2VA 2NUBA 4CEZA 1T6DA 2O4GA 4LF5K 3QFPA 2HHWA 4ELUA 1WNSA 5LY3A 3AARA 3F73A 2ATQA 4ILJA 4WQ4C 1QSSA 2FF3B 5AFUH 5JS2A 2YHBA 3CJBA 1V4TA 4DV3K 2DPNA 3C94A 1SL2A 1ZBUA 1D8YA 1IKXA 4LF8K 1BIUA 4O5BA 3BZKA 2F8TA 2OCEA 1E3MA 1BWFO 1DKGD 3L3VA 3M8SA 2E2NA 1VSKA 4F3TA 4GW6A 3ATVA 3A5MC 4CZMA 3CHWA 4GVEA 4CZJA 3S3NA 4FLTA 1K8KB 4DSJA 4A5AA 1CXQA 3ZX0A 4PQUA 4W5QA 3SUOA 4DF4A 3IS9A 3DAWA 3QICA 2YX6A 3ASMA 4DG1A 3FR0A 5KI6A 3PSFA 2QWPA 1K73O 1HYVA 2DY4A 3EO3A 5JICA 2VG5A 4WFNL 3CCSN 3C95A 3LP1A 4IKFA 3AGKA 5BN9A 3VGMA 3FZLA 2F4VK 4HTUA 4AQYK 4FK2A 4I6MA 3O4WA 3LAMA 1LWCA 4FWSA 1RBTA 4CFBA 4FJHA 4BRMA 4M3WA 3HZ6A 4KB1A 2KFNA 2XHBA 2WBNA 1QQOA 5AQWA 1ILYA 3DOLA 1QZ5A 1JLBA 2DTUA 4K42A 2NLXA 3CCLN 3UIQA 1YJWN 4B3RK 3WXLA 3IUCA 3NH0A 4E1MA 4JRQA 1NU0A 3QETA 3CQXA 3QIOA 3CJ7A 5CHIA 4X64K 4CJSA 2ASOA 2P9UB 3L2RA 1P8ZA 4H5TA 5HLFA 3PUFA 1TK0A 2PZSA 4JYAK 3J7YP 1DEJA 3A0IX 3LZIA 1HMVA 5AQQA 1C0TA 1VQLN 3PX0A 1NGDA 1KLMA 4DWIA 1CZ9A 3T3FA 2QK9A 3D6RA 2UUCK 1P90A 5HRNA 2A1SA 1HJOA 4KTQA 1HQUA 4DKWA 4I7FA 4CHZA 1JLFA 1VRUA 3SMSA 3VF2A 2RKIA 1JCFA 4JKCA 3S41A 3RVCA 4BR5A 2YKNA 1EQYA 4J2AA 1B9FA 5GAGP 3THWA 3P5JA 4BDYA 4BG8A 2VG6A 4QCLA 3ENOA 3UKUB 4BQZA 4ELTA 4CZKA 5AQSA 1Z26A 2VG7A 3AA2A 4N76A 3O4NA 3KLIA 4DTJA 4OPHA 2IOCA 4CJQA 2IC3A 1IBLK 3UB5A 5EX5A 4HUFA 4NCGA 3TAGA 3HPGA 2ZD1A 3AVGA 2KFZA 3OBWA 2O8BB 1A5WA 4FL9A 4KHQA 1UAXA 3DXMA 2IVOA 4DLEA 1KAZA 3U9ZA 5FPMA 3ZEUB 3QBXA 1NGFA 3TU5A 1YAGA 4CVNE 1BA1A 3KD5E 3UKRA 1UWBA 3OYGA 2HW3A 2G8UA 2XY8A 1K8KA 4FJNA 1O13A 4DTSA 3ISNC 1KSPA 5KRSA 3I56N 3DLHA 3K58A 2XY7A 4CCHA 3CJ9A 3KZBA 4OKJA 4DCHA 4ZTJA 1HNZK 3NF6A 2Q1NA 4B1ZA 5IWAK 3QNNA 4HVJA 4YFUA 2UUBK 5BR9A 2E1YA 3VEZA 2IIRA 5C2DA 3OYNA 4V19S 3U9DA 3W0LA 2PYLA 3MCPA 5KGWA 4NCBA 1EXQA 1A5XA 4IG0A 3SQ2A 1NGCA 2XO7A 4B3MK 4BC2A 2HHVA 1WAJA 1U45A 3CJCA 4FW1A 1QVGM 4ISEA 2D1KA 2V7ZA 4AM6A 5CZ2A 1RTDA 1BQMA 1K6YA 4B1WB 1C0MA 1RCHA 2WTUA 2P9SB 2HNYA 3H1VX 4G1QA 4K8ZA 5C42A 3O6WA 3EYZA 4PY5A 4DSLA 3VQ5A 3DWLA 4WE1A 1KFSA 2OTJN 1TK8A 3IRXA 1XI1A 4M3UA 4H0TB 4JKGB 4LF7K 1IKVA 2PBDA 1ATRA 4R5PA 3SK3A 4MDAA 4DV0K 4JI0K 1EO1A 2QWQA 4ISFA 1RDDA 1M90O 1RDUA 3DLGA 2HMIA 3NCIA 3TAFA 5KRTA 3OYBA 1NGGA 3MWTA 2KQ2A 4PKHA 3AVIA 1KTQA 3QEPA 2QXFA 4H0VB 4YORA 4CBWA 4EFHA 2P9SA 4RWTA 2ITMA 1T03A 4JKHA 4NB4A 4JHDA 4B8CA 4DTMA 5ADXA 3SZ2A 2H3GX 2WUSA 4BRHA 3NH1A 1E4FT 5AQPA 3ZCMA 4K25A 1VQKN 3V1RA 3V1OA 4H4OA 4JI1K 3CXCM 3MK6A 2NRZA 1HLUA 3MXJA 4KHNA 4IO8A 1V4SA 2GUPA 1RBSA 4KPYA 1RDAA 2NZTA 4DV1K 3G0ZA 4E19A 3TTFA 1EWRA 3V81A 4DQRA 2YNHA 1VQ5N 4DR1K 1S72N 5AQOA 2Z1IA 4ELVA 3VQ8A 4RG8A 4OGEA 4DV6K 3ENHA 5LL6Z 1TUYA 4ZHRA 3ZSYA 2EX3A 3HOTA 1JJ2M 2F8SA 3OW2M 2YHYA 3RRHA 1NLVA 2IDOA 2EWSA 5I9EB 1VSDA 3NAEA 1VQMN 2AA4A 3LPTA 4CHQA 3CPWM 3NVKA 1IKYA 1TVRA 3OS2A 4FM1A 3V9XA 3O9RA 4PL7A 3LDPA 4WQ5C 3EEQA 3AVAA 2XRIA 3NGIA 3IAYA 3WNHA 3UE5A 2E5LK 3AO2A 3HPHA 1IBKK 4WFAL 4CHYA 3AVKA 1X3MA 2ZJQL 4IDKA 4FWQA 3VESA 4CK3A 3DRSA 3KIOA 4CD1A 3JS6A 4FW2A 3TAPA 1IJJA 4KH5A 2P1JA 3PIOL 2QKBA 4QS9A 2W41A 1DTQA 4C8LA 1C0FA 4XIUA 4CFDA 5EY4A 4CEOA 4DQPA 3VA0A 1JCGA 2FF6A 3V9ZA 2HHHK 2QWOA 3K2PA 4JLHA 1EWQA 4CJ5A 4EZ9A 3HSTB 1HKCA 4F9OA 3OYFA 3WXIA 4O44A 4IWVA 2VCPA 2QW9A 2QWMA 2GELA 3S9HA 2IS3A 4JD2B 3CC4N 1Y97A 3L2WA 2O8FA 1LWEA 3QINA 1NMNA 4MO5A 1ZBIA 1SS6A 1JL1A 1NNEA 2P9KB 3WNEA 1BCMA 4LH5A 2P9NB 5AQKA 3T1AA 3SV4A 2RN2A 3BF3A 3P83D 5AJ3K 1OH8A 1QTMA 2Q0UA 3HYFA 2JGUA 1NK0A 4HHTA 2FBXA 1TL3A 1KRPA 4Y0WA 1S9EA 1BI4A 1QZ6A 4JI8K 3ZSQA 3TTCA 1T6CA 4DS5A 4H5VA 2O8BA 4FYDA 1YTUA 4WYBA 4CZIA 4KAZA 1T05A 2O8EA 5CYMA 1RTHA 4CESA 3DM2A 2I5JA 4E7JA 1L3UA 3CCMN 3SYZA 2E2PA 2RE2A 3SUPA 3SI6A 4CBUA 5K14A 3K57A 4DF8A 2V52B 3EN9A 3SJJA 1JLEA 4H0YB 4H5WA 4JI4K 1ATNA 5KGXA 1JXEA 2ZWHA 4JI2K 3FZFA 4KKOA 1EKEA 4W5RA 5LMUK 4CEBA 3MEDA 1QVFM 1ZBSA 4H0PA 2Z1GA 4BREA 4GVMA 1T7PA 2YKMA 3LP2A 5E26A 3FLCO 1C0UA 3ATUA 4GKKK 2V51B 4DR5K 3S3OA 1SV5A 2UYTA 4FWMA 3QMLA 3O9UA 1REVA 3O9TA 5FPEA 3CJAA 1SUQA 3D2EB 3SQ0A 4BDPA 2JWKA 3I0RA 4KH4A 3SUQA 3DLRA 3EZ5A 3L6QA 1NJWA 5HRPA 4CHOA 4CEQA 4DQSA 1YJNN 4DV4K 3T1YK 2Z1HA 2D5RA 1A5VA 2A42A 3RMDA 4JEPA 1TUUA 4O8UA 2OTLN 3NE6A 1WSGA 4E89A 3QBWA 4E7LA 2KHOA 4RW9A 2OPSA 4IFYA 3R8EA 1HNIA 3THVA 3Q7BA 1JXBA 3N4PA 3CI5A 4IEIA 3G4SN 3RR8A 4LF4K 4GKJK 4B9MA 1SKRA 4CJKA 3R6MA 4BRIA 4LF9K 2UXDK 4U67L 1J54A 4BY9C 4BRFA 4JI6K 1RTJA 3MDQA 3OBYA 3HP9A 4E3SA 3AGRA 5KPRA 4HUGA 1VSHA 2Y1JA 1OVYA 3ZT2A 4CGJA 3AO1A 4KI6A 1JLQA 1NGAA 4FK0A 2D0CA 5HOOA 3EE8A 4FLVA 5M1FA 3O8MA 4RW6A 2FBVA 1KQSM 2YV0X 3C65A 4FJ7A 1H1VA 4DUZK 5FDLA 2BE2A 1VSFA 1RBVA 4JKBA 4JNEA 2D0BA 5HRRA 2NRXA 2KZMA 4FWLA 2VGMA 3EZWA 4C8MA 3HBTA 4PUOA 1K8AO 2KLAA 3AO5A 1U6ZA 4N5SA 2P9LA 4CI6A 2UUAK 3JYTA 2GEMA 3HT3A 2RHKA 1ZBHA 1QE1A 2QI2A 1S1XA 4NCAA 4BGAA 4FLZA 2O4IA 1GLLO 1NOZA 4M3TA 4M3YA 1BA0A 4FVMA 3GBTA 3CCUN 5J2NA 4JI5K 1N5YA 3DMJA 4M63C 1RDCA 1NJIO 5GADP 3FZHA 1VQ9N 2I7PA 2W6LA 4IJAA 5MLCQ 3O3GA 3I8DA 1HX1A 1NJZA 3VEOA 1C1BA 4CJEA 3DLLL 3CCJN 2AP1A 3CFOA 1CXUA 2GTDA 3LANA 3SLCA 1ZXOA 1BOTO 1RT5A 4MO4A 3AVHA 1W9HA 1C6VA 4JKGA 2X6NA 2Z1JA 3V6DA 4JK7A 4BC5A 5DM7L 1QHTA 1RDWX 1YVNA 1XNRK 1HKGA 2WOMA 3MECA 3AVLA 4FOEA 3LZJA 2OZSA 1VQ4N 2E20A 1VAZA 4CE9A 3M6GA 1IV0A 4EIAA 3TSQA 1X9MA 2G8VA 1HNWK 1L3VA 2FXUA 4F3OA 5JLFA 4C8KA 2HVHA 1S9GA 3S3MA 4O0JA 2VGNA 3HSCA 4CJPA 1BO5O 3LDNA 5BPNA 2Q36A 3DXKA 4B1UB 1VQ7N 3CF5L 4K43A 3AVFA 5BRHA 2O8CB 3BZCA 1BIZA 3KLHA 2ETJA 4JS5A 3ITHA 1YI2N 4JKEA 2E1ZA 1FW6A 3ZX3A 3MN6A 3RR7A 1HKBA 4YOXA 3D45A 1FJGK 3L8BA 3NHGA 1NKEA 4FJGA 2P9IA 3MMVA 3KK3A 4Z0UA 3AVMA 3AV9A 3ZT3A 3N4QA 2GBZA 3OA9A 4W5TA 1NK6A 1N6QA 1CLQA 5JLHA 3U6FA 4MLEA 3TAMA 3BF1A 1KAXA 1LW2A 1KLNA 2VQEK 4W5NA 2A41A 3IKMA 3O9QA 3WNGA 5BRFA 1LOTB 4RTFD 3CFPA 2OANA 1NK8A 4FWNA 2E6LA 3ULEA 4XEIA 1XMQK 4GV9A 3O08A 3KLFA 5EVZA 3RSEA 3L4QA 5BPMA 4IDHA 1NGEA 4BRQA 2A3ZA 1N36K 3CC2N 4PKGA 3PIPL 4NYFA 2W6KA 3M1FA 5M1PA 1S6QA 1VQPN 1IH7A 2ITGA 3TPQA 3LDOA 2O8EB 3PX4A 2LSNA 2VYPA 5BREA 3HK2A 4H5RA 4ILGB 3J8AA 1NJYA 1RGIA 4ZTFA 4OJRA 1JLGA 2KW4A 4KI4A 4H0OA 5E41A 3ZSWA 4DTNA 3ID6A 4DSFA 2WC9A 3TSPA 1W7AA 1GLCG 3K5LA 4DV5K 4DB3A 1NK4A 2Q31A 1WUAA 3PO4A 4BR9A 4FK4A 3HP6A 3OHRA 5FRMA 1ESVA 4OKEA 1ATSA 1SQKA 2YNGA 3VEXA 3VF4A 4I9QA 5C12A 2A6AA 3QO9A 1YF5L 2YHXA 4B9LA 3VN5A 4BVOA 3B6OA 1OH6A 4CK1A 2IVPA 3HI0A 3AY9A 4UY8O 2IAJA 4B9QA 4CERA 1QQCA 4YOWA 4XH1A 4B8AB 3CM5A 1U4BA 2HOEA 3LAKA 4E7KA 3VQBA 5C2FA 3C7NA 2BUPA 2ZM6K 4PL8A 3WEEB 4CK2A 4CJFA 4BRLA 1O1WA 1HR0K 3A5OC 1LAWA 1KAYA 1TYQA 2X78A 5CR4A 1VHXA 3H1QA 3OS0A 2F9WA 2Q97A 1KC8O 3SPYA 5BN8A 3CERA 3QIPA 2ZF5O 4AHSA 3CCQN 5GIPA 4PKIA 4N41A 3RMCA 3WQUA 3C6UA 3OYKA 4BRKA 2P51A 2KTQA 2OYQA 2P9UA 1MU2A 4OVLA 3LM9A 4KH6A 2CGJA 3GOIA 1GLFO 4ID5A 1TAUA 3VTIA 3NF7A 3SUNA 3F2KA 4WQ4A 4KRFA 3QEWA 1VQ8N 2FSKA 3DRPA 4K41A 3K9JA 4FZYA 3KKSA 4O4GA 1HPMA 1LAVA 2HHTA 5ADXH 3O3HA 3PX6A 4DTUA 1XHXA 5FPNA 1J53A 3QNOA 3TABA 4RW4A 3AAQA 3O1WA 3MN7A 1RT3A 5GAHP 4DTRA 3MWPA 1YVUA 3IFRA 1JLAA 1JKHA 3ZYYX 4OPJA 3AA4A 2VWBA 4JKDA 5KPZA 3HTVA 1NM1A 3RMAA 1OVQA 2I7NA 4IEEA 3A2FA 5AQVA 3ZLJA 4CJLA 5HROA 4WFBL 1M1KO 1EP4A 4CJ3A 3BEXA 4F2SA 3IG1A 1W2BM 3OY9A 4IJNA 2CH5A 3OVNA 4FZXC 1WLJA 2E8AA 4AHUA 3F9MA 4NXMK 3VQ6A 3MX2A 4FJIA 5EXWA 3HJFA 4YDUA 4YOVA 3QERA 2GX9A 2P5GA 5LJVA 4M3ZA 1NKCA 3L2QA 1J9AA 2BTFA 3FGUA 4FPBA 5JMVA 4O55A 3CMEN 3NDKA 4ICLA 4FJKA 3CETA 3O5BA 5M1KA 2YHWA 4QS8A 4Q5VA 1RILA 2DFEA 1G15A 1TKZA 4MDBA 4IO9L 1F21A 3CIPA 2BH1A 4GV3A 2VQFK 4H0XB 2E4LA 1Z25A 3DYAA 5CE3A 1K9MO 1BG3A 1WSFA 4DU4A 1HYSA 2B5JA 3E9LA 3GDQA 1Q18A 1VK0A 3OYAA 5A2QO 4LSLA 4CIEA 2B4JA 2O8CA 2JLEA 4B08A 4OX9K 4MFBA 4YY3K 4B1VA 4CD3A 4Z4CA 4Q0BA 2QEXN 4M7XA 2A1RA 3J81O 1D9FA 1WOQA 3C7NB 1Q86O 2ASPA 2W42A 1RBUA 1HPZA 1UOCA 1J5EK 2QTDA 4BRNA 3I0SA 1BCOA 3HXMA 2KKZA 3TWHA 4A57A 1RNHA 4F8RA 1IG8A 4HWIA 3OYDA 4CHNA 3E66A 5CZ1A 1NK7A 1TK5A 1LCUA 3UKUA 3LWLA 1SL0A 3CCEN 1Q9XA 4JHDB 5AQUA 1Q82O 4CF1A 2QWRA 5CY4A 3H08A 4HUEA 2HNDA 3VETA 5KQ8A 4FVUA 2HHXA 1YXQA 3ZSZA 3P31A 5AFUA 5T7BA 4CF2A 3VTHA 4KB0A 3IDHA 5C0YA 5AZJB 2G8HA 3ZT1A 1YIJN 1GLBG 1S1VA 4CHPA 5FPDA 4FWPA 2A40A 4JKAA 4BVPA 4O8KA 1SL1A 1TKTA 2Q2RA 4GY2B 5F1XA 3UKRB 3VQPA 4YOUA 4PWDA 4BRPA 4KTZA 3U3GA 3TI0A 1ZYQA 1D5AA 2ZGYA 2P9KA 3CCVN 4FZZA 3THYA 1X1PA 3BY5A 2CH6A 5C10A 2GUIA 4YDUC 2X74A 5CYQA 3DI6A 3EKSA 2PAVA 1WB9A 2HF3A 4DTPA 2RPIA 4FJXA 4AHTA 1HNVA 3MEEA 5EU7A 3VQAA 3SBGA 3E9OA 3L0QA 3P38A 3MX5A 5AQRA 3NGZA 3V9SA 4FOIA 4FJMA 4DSEA 1L3SA 1QHAA 3SQ4A 4CJ7A 4BRCA 2F96A 4N47A 2BDPA 3NH2A 1ZC6A 5F0XA 5AQGA 3K0SA 1DLOA 1IO2A 3ZSVA 3BP8A 4CECA 1DT9A 5SWMA 4CZGA 5GINA 2JWLA 3G25A 1VSLA 1WBBA 4QAGA 4BRGA 3SMPA 3O3FA 2DFHA 3ULEB 2G8FA 4DSKA 1KFDA 4LH4A 4BDZA 4DHYA 3KK1A 3KD1E 5BR8K 3LPUA 4G9ZA 1BHLA 1NKBA 2FC0A 4CJWA 4DFPA 3RWUA 4CEFA 3U8XA 4BR2A 1XUPO 1TYQB 4DR7K 1FKOA 4J2DA 4BQLA 3JXUA 4CGDA 4JK8A 4BG9A 4C8NA 4C1NI 5JVHL 2BGGA 3CG7A 1U49A 1RT4A 2OPRA 3P1GA 4B3OA 2O8FB 3L2UA 4DFJA 3M8RA 1BGXT 1GLEG 2BANA 3DRRA 2HMPA 1VQON 3V9WA 2FSNA 3P39A 3L4IA 4CGFA 4EZ6A 4A2AA 1S3XA 4I6MB 5AQNA 5D3GA 1T3VA 4DQ8A 2AJQA 1WSEA 1IKWA 1MA9B 3MN5A 2W40A 1B9DA 1U04A 3VOVA 1KVCA 2YI1A 3SNNA 4BC3A 2V7YA 4BR4A 2EHGA 3AVJA 5KPTA 3DXKB 4DLGA 3F9KA 4EP5A 2QA4N 4M3XA 4WF9L 3K59A 4IOCL 3LWMA 1WSJA 3O9SA 4R79A 1ITGA 5J2PA 3ALYA 1N34K 1GOAA 2Q0RA 5B8HA 1BISA 4BWJA 4CGHA 1RT6A 1NK5A 4E1NA 4FO0A 3LP0A 4JK9A 4DR4K 4FLUA 1EX4A 1DGKN 4NO7A 1BI4B 3VPZA 4CFAA 3B8AX 3NMUA 2ZJRL 1VSEA 1NBWA 4OLBA 4FM2A 4J2EA 3K5OA 5JS1A 5DK5A 3QFUA 4CF0A 3VQ4A 3H6EA 4Z4IA 3AO4A 4KTWA 1T8EA 4NLCA 3PV8A 4XH5A 4HCBA 4I9LA 4A61A 1NMDA 3OYIA 4FWOA 4BE1A 4OO1J 5AQHA 3NBPA 4BWMA 4CJUA 4XH4A 3JAMO 1BU6O 1RDBA 3KWGA 3QDKA 3VGKA 1BL3A 3H3OB 4CEAA 5AZIB 4IBNA 1ZBLA 4AM7A 4X62K 3R3LA 4FLYA 3BDPA 1NK9A 2HB5A 3I33A 4CJ4A 1TGOA 3J80O 3LP3A 5FRNA 3I55N 3AA3A 4IZ9A 1G99A 4B9NA 3D2EA 4M42A 1U48A 3FZMA 2HHUA 4A62A 4CEDA 3U3YA 3SAGA 1X3NA 3FE1A 4DMNA 4KHUA 1I3AA 3FFIA 3HM9A 1Y64A 5C25A 4B9TA 2ZJPL 1VQNN 3C0BA 2NRTA 3T1HK 4MLHA 1B92A 4RW8A 4H03B 2OA8A 2E2OA 4DUYK 1NG9A 4LSNA 1ASVA 3BUZB 2PYJA 3PLAA 1TL1A 1QQNA 3QEVA 3A5LC 5TKWA 4EAHD 4YOYA 4U7BA 4DTXA 4DV2K 1NOYA 3MCAB 2FLOA 3ZETA 3AAPA 2NRRA 4OPKA 4CZHA 5C15A 1QSLA 4QOZB 3C6TA 3KWIA 1L5UA 2HVIA 3HOSA 4JKFA 3TARA 3O4QA 4KO0A 2O8DB 4AHCA 5I3UA 4B3TK 4IFVA 1Q7YO 1XWLA 2XY5A 4BGBA 4C8OA 5AQIA 1UA1A 5HL7L 3LALA 5DMRA 4FJLA 4N56A 3M8PA 2B6AA 4AF1A 4EHUA 4B1YB 3KJVA 4FM0A 2YJEA 5E84A 4UQGA 3HPOA 1Q8IA 1RT1A 1LWFA 4M41A 2GV9A 1KVBA 4YHHK 3BGRA 4DS4A 4Y1DA 2NRHA 4X66K 4A2BA 1I94K 2WONA 4FCYA 4CZLA 2P9LB 4K0KK 3KHYA 4FWKA 5LJWA 4GV6A 1OH5A 3AVCA 1D4XA 3GG4A 3WXJA 3ZEUA 4EP4A 5GAEP 5AQTA 1N32K 3H45C 1Q81O 4J2BA 1MDUB 4KHWA 4M45A 4B1XB 2CGLA 3OJSA 4GNIA 3T69A 1YHQN 5I42A 3WQTA 3CCRN 1XC9A 1QS4A 3NF8A 1VSIA 2KZZA 3FFKB 4BRAA 4FLWA 3QLHA 3DXMB 3VQEA 1CZBA 1W97L 5AQJA 3WT0A 4BR0A 3VQ7A 1S5JA 2WFBA 3U4LA 3OTOK 3SAFA 1VQ6N 4DFKA 4A59A 1SKSA 4Z4EA 4CF9A 1RT2A 3SJHA 1SAZA 1VSJA 2GWKA 1RFQA 2VWKA 4CJVA 2OZMA 3V1QA 1ASWA 3A5NC 2D4WA 2HBMA 4B3SK 3ZX2A 1S1UA 5AZJA 1WSHA 1NGIA 2NNWA 1JLCA 3PSIA 2ASMA 4H4MA 3LDSA 3OYCA 5FROA 4CF8A 1YITN 3EY1A 3CC7N 2J4RA 5BRDA 1NWKA 3TANA 4H5NA 5AZIA 3LM2A 3ZSRA 4DU3A 1NGJA 3D7EO 2FBYA 4C23A 4M7YA 3WEEA 4W5OA 3L3UA 2QWNA 5HRSA 4WCEL 5ELZA 5TKYA 1GLAG 4DR2K 1D9DA 5JVGL 1N33K 3CFRA 4E7HA 3I8BA 1WBDA 3VF6A 1U47A 4JAXA 2R7YA 3MXMA 4CJTA 4BR7A 4CW7B 2QWLA 4AILC 3TAEA 2YNFA 3RRGA 4AHRA 1HRHA 3D0PA 4Z4GA 3V9UA 4BC4A 4CIFA 2CGKA 3VEVA 1L3TA 5J2QA 3WNFA 1NGBA 4LFAK 5GIOA 3HL8A 3J7ZO 3SQ1A 4O5FA 3OYHA 3ZETB 1NJXA 3K5NA 2ZGZA 2D0OA 4DQIA 4L3QA 1EETA 4PA1A 3OYJA 3Q7CA 4TSXA 3O1BA 3LL3A 1WN7A 5M1NA 4KREA 2ZQBA 4IOAL 1YTAA 3KTQA 3RSEB 1QSYA 5KTQA 3E01A 4FXDA 2G8WA 4FPAA 4ID1A 2NRWA 3MAQA 4F2RA 2GWJA 4FJ9A 4LFBK 3AO3A 1U2VA 4Z94A 4LF6K 3CD6N 3GL1A 1GLDG 3THXA 3SAHA 3JSMA 1E4GT 4LY7A 4B9UA 5AQMA 1HUXA 1XNQK 2P9PB 4CGIA 1S1TA 1C1AA 1X9JA 3KK7A 3TAQA 3VGLA 4FJJA 1YUWA 1JL2A 3SBTA 5IT9O 4BRDA 4JS4A 3VA3A 4NXNK 3E9PA 3VEWA 3QESA 3B6PA 4RW7A 4FLXA 4MQ3A 2UXCK 1C0GA 3PO5A 5J1EA 4CJRA 4E7IA 3CJ1A 2P5OA 3GE1A 4CBXA 3SPZA 4HCCA 2FSJA 1FKPA 5KQDA 3RTVA 1HYZA 4LD0A 4IXCA 2NRVA 3LDLA 3W3DA 1U2VB 2HHQA 3AVBA 4KV8A 3RMBA 1LW0A 1RBRA 2HSTA 2P9PA 3VEYA 5HBMA 3TR8A 1X9SA 3NGYA 3VQ9A 4A5BA 1WSIA 4CZEA 4IFEA 4H8KA 1Z6RA 1RTIA 3K5MA 1SKWA 3ID8A 4AHVA 2Y1IA 1KXPA 3C6HA 3ULDA 4GMJB 2YNIA 3J7AP 2HF4A 4ILHA 3G10A 1FXXA 1GOBA 3H3NO 4JV5K 2VWJA 3KVGA 4HTLA 4PHTX 4JRPA 1TKXA 4JI7K 4NLBA 1MWKA 3MXIA 1BUPA 3KKRA 3D2FB 5BPLA 1S22A 3KK2A 1OH7A 3M3ZA 2A5XA 2Q3SA 1I39A 5J2MA 3QB0A 5AQXA 3O80A 4CEEA 4K8XA 3CPEA 2G8IA 1R0AA 3R9PA 3P4IA 4DV7K 2YCHA 1BDGA 2YJFA 5HP1A 2P9NA 3H46O 4B9VA 2RF2A 2G8KA 4CGGA 1TV6A 5AQLA 3ZT0A 2UU9K 3MEGA 3OS1A 4DU1A 3VQQA 2ZE2A 4FJ5A 3KLEA 4DQQA 1Q9YA 5C24A 1CZAN 3EE9A 4YNQA 3QEXA 2F9TA 4Y1CA 1GOCA 1NGHA 2DFFA 4CZFA 2HBKA 1RT7A 1HNXK 1W0HA 1N8RO 3ENBA 1YT3A 1R59O 4Z4HA 1TKDA 3MN9A 3T7ZA 4FJ8A 2P9IB 1XMOK 3IMXA 2E6MA 5M1QA 1Z05A 4DR6K 3D2FA 4M3RA 3EL2A 4OPAA 4CFCA 3DJCA 2D0PA 4DSIA 2E88A 5H1SQ 4OKKA 2PY5A 3FZKA 4I2QA
chains in the Genus database with same CATH topology
4Z4IA 5E41A 1ASUA 3ZSWA 3AO4A 1RBSA 4KTWA 4DTNA 1RDAA 4KPYA 3G0ZA 3NF9A 4E19A 3SCXA 3DOKA 1T8EA 4DSFA 3NFAA 3PV8A 4HCBA 3OYLA 3V81A 4I2PA 4I9LA 2YNHA 3OYIA 4DQRA 4BE1A 4ELVA 3NBPA 4BWMA 1S1WA 2Z1IA 2OPPA 4CJUA 3K5LA 3VQ8A 3OJUA 4RG8A 1UA0A 4OGEA 1NK4A 3PO4A 4FK4A 1RDBA 4ZTFA 1ZBFA 4ZHRA 2OPQA 1BL3A 2EX3A 3ZSYA 3HVRA 3PY8A 2F8SA 4OJRA 3RRHA 4IG3A 4CEAA 1DTTA 2IDOA 4IBNA 3M8QA 1ZBLA 3HP6A 5FRMA 4OKEA 2YNGA 1VSDA 1C1CA 3NAEA 4FLYA 3BDPA 4I9QA 2X6SA 1NK9A 2HB5A 3LPTA 4AH9A 4CJ4A 1TGOA 4CHQA 2XY6A 1X9WA 1IKYA 1TVRA 3OS2A 3OYEA 3QO9A 4FM1A 3V9XA 4B9LA 3ZSXA 3LP3A 3VN5A 3VQCA 3B6OA 5FRNA 3AA3A 4CK1A 4DFMA 3AVAA 3CYMA 4B9NA 1FK9A 2XRIA 3NGIA 1U48A 3IAYA 4M42A 2HHUA 2IAJA 3WNHA 4CEDA 3U3YA 4CERA 1QQCA 3AO2A 4DMNA 4KHUA 3HPHA 4B8AB 3CM5A 1I3AA 3FFIA 4CHYA 3HM9A 1U4BA 5C25A 4B9TA 3SV3A 3AVKA 1BQNA 3LAKA 2YHAA 4IDKA 3VQBA 4E7KA 1B92A 4RW8A 1LV5A 4B9SA 4CK3A 2OA8A 3DRSA 3KIOA 4CK2A 4DTOA 1VRTA 3VQDA 2D0AA 4FW2A 4CJFA 3SV4A 4LSNA 1ASVA 5SZTA 3TAPA 2P1JA 1IG9A 3DLEA 2QKBA 2PYJA 1O1WA 1LAWA 1TL1A 1DTQA 4C8LA 2X78A 3QEVA 4BE0A 4XIUA 3OS0A 1VSMA 3CM6A 4CFDA 4CEOA 4DTXA 3SPYA 1NOYA 4DQPA 3QIPA 4AHSA 4L8RB 3VA0A 4N41A 4OPKA 3OYMA 3RMCA 1J5OA 3C6UA 3OYKA 2KTQA 2P51A 1QSLA 2OYQA 2IGIA 3HO1A 3C6TA 4QOZB 1L5UA 3V9ZA 3K2PA 1MU2A 4JLHA 4OVLA 3ZT4A 2HVIA 4CJ5A 3QEIA 4EZ9A 4ID5A 1TAUA 1KVAA 3TARA 3NF7A 3SUNA 3O4QA 4KO0A 4KRFA 3HSTB 3QEWA 3OYFA 4F4KA 1KCFA 4O44A 4AHCA 3DRPA 5I3UA 4IFVA 1XWLA 4FZYA 2XY5A 3DLKA 3KKSA 1HJRA 3S9HA 1HQEA 4O4GA 4C8OA 2IS3A 1UA1A 1LAVA 2HHTA 1Y97A 3LALA 5DMRA 3L2WA 3O3HA 3PX6A 4FJLA 4N56A 3M8PA 4NYNA 1XHXA 4DTUA 4KHSA 4Z4FA 1J53A 4E0DA 3QNOA 1WAFA 2B6AA 4RW4A 1LWEA 3TABA 3QINA 4KHYA 1ZBIA 3KLGA 2HHSA 3KJVA 3T19A 1JL1A 1RT3A 4CIGA 4FM0A 3WNEA 4DTRA 2HNZA 1BCMA 1S6PA 1TAQA 1YVUA 4UQGA 4BACA 2FBTA 4LH5A 1Q8IA 3HVTA 3HPOA 3V4IA 3AA5X 1JLAA 3T1AA 3ZSOA 1JKHA 1RT1A 2RN2A 4BE2A 4O0IA 3P83D 1LWFA 3CQ8A 4M41A 4OPJA 2GV9A 2QKKA 1KVBA 3BGRA 4KFBA 3AA4A 4OGCA 4DS4A 4Y1DA 4OLAA 1QTMA 3AVNA 1XHZA 3DLBA 2WONA 4FCYA 3HYFA 2JGUA 1NK0A 4HHTA 3L2VA 2NUBA 4CEZA 2FBXA 2O4GA 3RMAA 1TL3A 1KRPA 1S9EA 2HHWA 3A2FA 4ELUA 1WNSA 4CJLA 3F73A 5HROA 1BI4A 2ATQA 3AVCA 4EP4A 3ZSQA 1QSSA 4DS5A 4J2BA 5JS2A 1EP4A 2YHBA 4KHWA 1YTUA 4FYDA 4M45A 4KAZA 4CJ3A 1T05A 4F2SA 5CYMA 1RTHA 3OJSA 3IG1A 3OY9A 3OVNA 4CESA 3DM2A 4FZXC 3C94A 2I5JA 5I42A 1ZBUA 1XC9A 1SL2A 1IKXA 1QS4A 1VSIA 1BIUA 1WLJA 3NF8A 4O5BA 3SYZA 4E7JA 1L3UA 3SUPA 3SI6A 1D8YA 2F8TA 2KZZA 5K14A 4AHUA 4FLWA 3QLHA 3L3VA 3VQEA 3K57A 1CZBA 3M8SA 4DF8A 3SJJA 1JLEA 5KGXA 3VQ6A 1VSKA 3VQ7A 4FJIA 1JXEA 1S5JA 4F3TA 4GW6A 3S3NA 3HJFA 4FLTA 4DFKA 4KKOA 3QERA 1EKEA 4W5RA 2P5GA 4DSJA 4M3ZA 4CEBA 1SKSA 4Z4EA 4CF9A 1NKCA 3L2QA 1RT2A 1CXQA 1J9AA 3MEDA 1VSJA 2VWKA 4CJVA 2OZMA 4PQUA 3V1QA 1ASWA 2Z1GA 4W5QA 3SUOA 4DF4A 4O55A 3IS9A 4GVMA 1T7PA 3ASMA 2YKMA 4ICLA 3LP2A 3NDKA 4FJKA 4DG1A 1C0UA 5KI6A 1S1UA 1HYVA 2DY4A 3S3OA 1SV5A 1WSHA 1JLCA 4Q5VA 4H4MA 1REVA 1RILA 2VG5A 3LDSA 2DFEA 3OYCA 1G15A 1TKZA 5FROA 4CF8A 1F21A 1SUQA 3C95A 3LP1A 3SQ0A 4IKFA 4BDPA 3EY1A 3I0RA 3TANA 3SUQA 2E4LA 1Z25A 3DYAA 3DLRA 3EZ5A 1WSFA 4HTUA 4DU4A 3ZSRA 1NJWA 2B5JA 4DU3A 5HRPA 1HYSA 4FK2A 4CHOA 2FBYA 4CEQA 1VK0A 4DQSA 3OYAA 4LSLA 4CIEA 3LAMA 2B4JA 1LWCA 2JLEA 2Z1HA 1RBTA 1A5VA 2D5RA 4B08A 4MFBA 4CFBA 4W5OA 4FJHA 3L3UA 4M3WA 5HRSA 4Z4CA 3RMDA 4Q0BA 4KB1A 1D9DA 3NE6A 2XHBA 2A1RA 1WSGA 2KFNA 1D9FA 4E89A 4E7LA 3DOLA 3CFRA 4E7HA 4RW9A 2OPSA 4IFYA 1JLBA 1HNIA 1U47A 2DTUA 3THVA 3RWUA 2R7YA 2W42A 3MXMA 3UIQA 1RBUA 4CJTA 1HPZA 1JXBA 3NH0A 4E1MA 3RR8A 1UOCA 4JRQA 4B9MA 1SKRA 4CJKA 4AILC 3TAEA 3I0SA 3QETA 1BCOA 3HXMA 3QIOA 3TWHA 4F8RA 1RNHA 4CJSA 2YNFA 3L2RA 1J54A 3RRGA 3OYDA 4AHRA 4CHNA 1RTJA 1HRHA 3D0PA 4Z4GA 5CZ1A 3V9UA 3HP9A 4CIFA 1NK7A 4E3SA 5HLFA 1TK5A 3PUFA 1TK0A 2PZSA 3LWLA 3LZIA 1L3TA 1SL0A 4HUGA 1VSHA 3WNFA 5J2QA 2Y1JA 1HMVA 1Q9XA 3ZT2A 4CGJA 1C0TA 3AO1A 4CF1A 3PX0A 1KLMA 5CY4A 3HL8A 3SQ1A 4DWIA 4KI6A 1JLQA 4FK0A 1CZ9A 2D0CA 3OYHA 3H08A 4HUEA 4FLVA 3T3FA 2QK9A 5HRNA 2HNDA 1NJXA 2HHXA 2A1SA 3K5NA 4RW6A 2FBVA 3ZSZA 2YV0X 5T7BA 4DQIA 4CF2A 1EETA 4KB0A 4FJ7A 4PA1A 3OYJA 4TSXA 5FDLA 2BE2A 4KTQA 1HQUA 1VSFA 1RBVA 1WN7A 4KREA 2ZQBA 2D0BA 4I7FA 5HRRA 1YTAA 4CHZA 3KTQA 2G8HA 1JLFA 3ZT1A 2KZMA 1VRUA 1S1VA 4CHPA 2RKIA 4C8MA 1QSYA 5KTQA 3E01A 4FXDA 2G8WA 4ID1A 4F2RA 3MAQA 4PUOA 2YKNA 4J2AA 1B9FA 3AO5A 4FJ9A 1SL1A 1TKTA 3AO3A 3P5JA 4N5SA 4BDYA 1NKBA 2VG6A 4QCLA 3JSMA 4LY7A 4B9UA 4ELTA 3VQPA 4CGIA 3JYTA 1Z26A 1S1TA 2VG7A 4PWDA 4KTZA 3AA2A 3U3GA 3HT3A 3TI0A 4N76A 1ZYQA 1C1AA 1D5AA 3O4NA 3KLIA 4DTJA 3TAQA 1N5YA 4FJJA 1ZBHA 1QE1A 1S1XA 4NCAA 1JL2A 4FZZA 2IOCA 4CJQA 1X1PA 2IC3A 4JS4A 1NOZA 4FLZA 3VA3A 2GUIA 4M3TA 4M3YA 2O4IA 4HUFA 4FVMA 3QESA 2X74A 4NCGA 3B6PA 5J2NA 4RW7A 3HPGA 2ZD1A 4MQ3A 5CYQA 3DI6A 3AVGA 3DMJA 4FLXA 3TAGA 1RDCA 3PO5A 2KFZA 5J1EA 4CJRA 4E7IA 1A5WA 4DTPA 2RPIA 4KHQA 4FJXA 2P5OA 4AHTA 3O3GA 1HNVA 1UAXA 3MEEA 3I8DA 3SPZA 4HCCA 5EU7A 1FKPA 3VQAA 1NJZA 3V9SA 4FJMA 3NGZA 4DLEA 1C1BA 4CJEA 3RTVA 1HYZA 4DSEA 4LD0A 1L3SA 3SQ4A 2F96A 3CFOA 4N47A 2BDPA 3KD5E 1CXUA 1UWBA 3LANA 3NH2A 3OYGA 2HW3A 2G8UA 1RT5A 2XY8A 3AVHA 2HHQA 1DLOA 1IO2A 1W9HA 1C6VA 3AVBA 4KV8A 3ZSVA 4FJNA 3RMBA 2X6NA 2Z1JA 1LW0A 1RBRA 3ISNC 4CECA 5KRSA 4DTSA 3V6DA 5SWMA 1KSPA 1QHTA 3DLHA 5HBMA 3TR8A 2WOMA 3NGYA 1X9SA 3MECA 1VSLA 3AVLA 3VQ9A 4QAGA 3O3FA 3K58A 3LZJA 2XY7A 4CCHA 1WSIA 2DFHA 2OZSA 4OKJA 4H8KA 4ZTJA 1RTIA 2G8FA 3NF6A 4CE9A 3K5MA 1SKWA 4DSKA 1KFDA 1X9MA 2G8VA 4LH4A 4AHVA 4BDZA 3QNNA 2Y1IA 3KK1A 3KD1E 3ULDA 4HVJA 4YFUA 1L3VA 4GMJB 2YNIA 4F3OA 3LPUA 3G10A 4C8KA 1FXXA 1GOBA 2HVHA 1BHLA 1S9GA 2FC0A 4O0JA 4CJWA 3OYNA 4DFPA 4CEFA 2VWJA 3S3MA 2PYLA 5KGWA 4JRPA 1TKXA 4CJPA 4NCBA 1EXQA 1A5XA 4IG0A 3MXIA 3SQ2A 1FKOA 3KKRA 2XO7A 4J2DA 2HHVA 1WAJA 3KK2A 3AVFA 4CGDA 1U45A 2Q3SA 1I39A 4FW1A 4C8NA 1BIZA 3KLHA 5J2MA 2ETJA 4JS5A 4CEEA 4K8XA 3ITHA 2BGGA 3CG7A 1U49A 1RT4A 2OPRA 3P1GA 4B3OA 5CZ2A 3L2UA 1RTDA 2G8IA 1BQMA 1K6YA 4DFJA 1R0AA 3RR7A 1C0MA 1RCHA 3M8RA 2HNYA 3D45A 4K8ZA 4G1QA 5C42A 1BGXT 2BANA 3L8BA 3DRRA 3NHGA 1NKEA 3EYZA 4PY5A 4FJGA 4DSLA 3VQ5A 4WE1A 3KK3A 3V9WA 1KFSA 4CGFA 3IRXA 4Z0UA 3AVMA 1TK8A 4EZ6A 3AV9A 3ZT3A 4W5TA 2GBZA 5HP1A 1XI1A 5D3GA 1NK6A 1N6QA 4M3UA 4B9VA 2AJQA 1CLQA 1WSEA 2RF2A 1IKWA 3U6FA 2G8KA 4CGGA 1TV6A 3TAMA 1LW2A 3ZT0A 3MEGA 1KLNA 1B9DA 1IKVA 1U04A 4R5PA 3OS1A 4DU1A 1KVCA 2ZE2A 3VQQA 4FJ5A 3KLEA 4W5NA 4DQQA 1Q9YA 5C24A 4YNQA 3QEXA 3SNNA 3WNGA 1RDDA 3DLGA 2EHGA 3AVJA 4Y1CA 1GOCA 2DFFA 4DLGA 2HMIA 3NCIA 3CFPA 3TAFA 3F9KA 1NK8A 2E6LA 4EP5A 5KRTA 3OYBA 4M3XA 3K59A 3LWMA 1RT7A 1WSJA 2KQ2A 3KLFA 1W0HA 3AVIA 1KTQA 1ITGA 5J2PA 3ALYA 2QXFA 3QEPA 1GOAA 1YT3A 4Z4HA 1TKDA 4FJ8A 1BISA 4BWJA 4CGHA 1RT6A 1NK5A 4E1NA 4NYFA 1T03A 3LP0A 2E6MA 4FLUA 1S6QA 4B8CA 4DTMA 1EX4A 1IH7A 2ITGA 3SZ2A 3PX4A 2LSNA 1BI4B 3NH1A 4CFAA 3HK2A 4M3RA 3ZCMA 1VSEA 3V1RA 3V1OA 4CFCA 4FM2A 4H4OA 4OLBA 4J2EA 4DSIA 3K5OA 4OKKA 3MXJA 4KHNA 2PY5A 1NJYA 5DK5A 5JS1A 4CF0A 3VQ4A 1JLGA 2KW4A 4I2QA 4KI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4I A;  5E41 A;  1ASU A;  3ZSW A;  3AO4 A;  1RBS A;  4KTW A;  4DTN A;  1RDA A;  4KPY A;  3G0Z A;  3NF9 A;  4E19 A;  3SCX A;  3DOK A;  1T8E A;  4DSF A;  3NFA A;  3PV8 A;  4HCB A;  3OYL A;  3V81 A;  4I2P A;  4I9L A;  2YNH A;  3OYI A;  4DQR A;  4BE1 A;  4ELV A;  3NBP A;  4BWM A;  1S1W A;  2Z1I A;  2OPP A;  4CJU A;  3K5L A;  3VQ8 A;  3OJU A;  4RG8 A;  1UA0 A;  4OGE A;  1NK4 A;  3PO4 A;  4FK4 A;  1RDB A;  4ZTF A;  1ZBF A;  4ZHR A;  2OPQ A;  1BL3 A;  2EX3 A;  3ZSY A;  3HVR A;  3PY8 A;  2F8S A;  4OJR A;  3RRH A;  4IG3 A;  4CEA A;  1DTT A;  2IDO A;  4IBN A;  3M8Q A;  1ZBL A;  3HP6 A;  5FRM A;  4OKE A;  2YNG A;  1VSD A;  1C1C A;  3NAE A;  4FLY A;  3BDP A;  4I9Q A;  2X6S A;  1NK9 A;  2HB5 A;  3LPT A;  4AH9 A;  4CJ4 A;  1TGO A;  4CHQ A;  2XY6 A;  1X9W A;  1IKY A;  1TVR A;  3OS2 A;  3OYE A;  3QO9 A;  4FM1 A;  3V9X A;  4B9L A;  3ZSX A;  3LP3 A;  3VN5 A;  3VQC A;  3B6O A;  5FRN A;  3AA3 A;  4CK1 A;  4DFM A;  3AVA A;  3CYM A;  4B9N A;  1FK9 A;  2XRI A;  3NGI A;  1U48 A;  3IAY A;  4M42 A;  2HHU A;  2IAJ A;  3WNH A;  4CED A;  3U3Y A;  4CER A;  1QQC A;  3AO2 A;  4DMN A;  4KHU A;  3HPH A;  4B8A B;  3CM5 A;  1I3A A;  3FFI A;  4CHY A;  3HM9 A;  1U4B A;  5C25 A;  4B9T A;  3SV3 A;  3AVK A;  1BQN A;  3LAK A;  2YHA A;  4IDK A;  3VQB A;  4E7K A;  1B92 A;  4RW8 A;  1LV5 A;  4B9S A;  4CK3 A;  2OA8 A;  3DRS A;  3KIO A;  4CK2 A;  4DTO A;  1VRT A;  3VQD A;  2D0A A;  4FW2 A;  4CJF A;  3SV4 A;  4LSN A;  1ASV A;  5SZT A;  3TAP A;  2P1J A;  1IG9 A;  3DLE A;  2QKB A;  2PYJ A;  1O1W A;  1LAW A;  1TL1 A;  1DTQ A;  4C8L A;  2X78 A;  3QEV A;  4BE0 A;  4XIU A;  3OS0 A;  1VSM A;  3CM6 A;  4CFD A;  4CEO A;  4DTX A;  3SPY A;  1NOY A;  4DQP A;  3QIP A;  4AHS A;  4L8R B;  3VA0 A;  4N41 A;  4OPK A;  3OYM A;  3RMC A;  1J5O A;  3C6U A;  3OYK A;  2KTQ A;  2P51 A;  1QSL A;  2OYQ A;  2IGI A;  3HO1 A;  3C6T A;  4QOZ B;  1L5U A;  3V9Z A;  3K2P A;  1MU2 A;  4JLH A;  4OVL A;  3ZT4 A;  2HVI A;  4CJ5 A;  3QEI A;  4EZ9 A;  4ID5 A;  1TAU A;  1KVA A;  3TAR A;  3NF7 A;  3SUN A;  3O4Q A;  4KO0 A;  4KRF A;  3HST B;  3QEW A;  3OYF A;  4F4K A;  1KCF A;  4O44 A;  4AHC A;  3DRP A;  5I3U A;  4IFV A;  1XWL A;  4FZY A;  2XY5 A;  3DLK A;  3KKS A;  1HJR A;  3S9H A;  1HQE A;  4O4G A;  4C8O A;  2IS3 A;  1UA1 A;  1LAV A;  2HHT A;  1Y97 A;  3LAL A;  5DMR A;  3L2W A;  3O3H A;  3PX6 A;  4FJL A;  4N56 A;  3M8P A;  4NYN A;  1XHX A;  4DTU A;  4KHS A;  4Z4F A;  1J53 A;  4E0D A;  3QNO A;  1WAF A;  2B6A A;  4RW4 A;  1LWE A;  3TAB A;  3QIN A;  4KHY A;  1ZBI A;  3KLG A;  2HHS A;  3KJV A;  3T19 A;  1JL1 A;  1RT3 A;  4CIG A;  4FM0 A;  3WNE A;  4DTR A;  2HNZ A;  1BCM A;  1S6P A;  1TAQ A;  1YVU A;  4UQG A;  4BAC A;  2FBT A;  4LH5 A;  1Q8I A;  3HVT A;  3HPO A;  3V4I A;  3AA5 X;  1JLA A;  3T1A A;  3ZSO A;  1JKH A;  1RT1 A;  2RN2 A;  4BE2 A;  4O0I A;  3P83 D;  1LWF A;  3CQ8 A;  4M41 A;  4OPJ A;  2GV9 A;  2QKK A;  1KVB A;  3BGR A;  4KFB A;  3AA4 A;  4OGC A;  4DS4 A;  4Y1D A;  4OLA A;  1QTM A;  3AVN A;  1XHZ A;  3DLB A;  2WON A;  4FCY A;  3HYF A;  2JGU A;  1NK0 A;  4HHT A;  3L2V A;  2NUB A;  4CEZ A;  2FBX A;  2O4G A;  3RMA A;  1TL3 A;  1KRP A;  1S9E A;  2HHW A;  3A2F A;  4ELU A;  1WNS A;  4CJL A;  3F73 A;  5HRO A;  1BI4 A;  2ATQ A;  3AVC A;  4EP4 A;  3ZSQ A;  1QSS A;  4DS5 A;  4J2B A;  5JS2 A;  1EP4 A;  2YHB A;  4KHW A;  1YTU A;  4FYD A;  4M45 A;  4KAZ A;  4CJ3 A;  1T05 A;  4F2S A;  5CYM A;  1RTH A;  3OJS A;  3IG1 A;  3OY9 A;  3OVN A;  4CES A;  3DM2 A;  4FZX C;  3C94 A;  2I5J A;  5I42 A;  1ZBU A;  1XC9 A;  1SL2 A;  1IKX A;  1QS4 A;  1VSI A;  1BIU A;  1WLJ A;  3NF8 A;  4O5B A;  3SYZ A;  4E7J A;  1L3U A;  3SUP A;  3SI6 A;  1D8Y A;  2F8T A;  2KZZ A;  5K14 A;  4AHU A;  4FLW A;  3QLH A;  3L3V A;  3VQE A;  3K57 A;  1CZB A;  3M8S A;  4DF8 A;  3SJJ A;  1JLE A;  5KGX A;  3VQ6 A;  1VSK A;  3VQ7 A;  4FJI A;  1JXE A;  1S5J A;  4F3T A;  4GW6 A;  3S3N A;  3HJF A;  4FLT A;  4DFK A;  4KKO A;  3QER A;  1EKE A;  4W5R A;  2P5G A;  4DSJ A;  4M3Z A;  4CEB A;  1SKS A;  4Z4E A;  4CF9 A;  1NKC A;  3L2Q A;  1RT2 A;  1CXQ A;  1J9A A;  3MED A;  1VSJ A;  2VWK A;  4CJV A;  2OZM A;  4PQU A;  3V1Q A;  1ASW A;  2Z1G A;  4W5Q A;  3SUO A;  4DF4 A;  4O55 A;  3IS9 A;  4GVM A;  1T7P A;  3ASM A;  2YKM A;  4ICL A;  3LP2 A;  3NDK A;  4FJK A;  4DG1 A;  1C0U A;  5KI6 A;  1S1U A;  1HYV A;  2DY4 A;  3S3O A;  1SV5 A;  1WSH A;  1JLC A;  4Q5V A;  4H4M A;  1REV A;  1RIL A;  2VG5 A;  3LDS A;  2DFE A;  3OYC A;  1G15 A;  1TKZ A;  5FRO A;  4CF8 A;  1F21 A;  1SUQ A;  3C95 A;  3LP1 A;  3SQ0 A;  4IKF A;  4BDP A;  3EY1 A;  3I0R A;  3TAN A;  3SUQ A;  2E4L A;  1Z25 A;  3DYA A;  3DLR A;  3EZ5 A;  1WSF A;  4HTU A;  4DU4 A;  3ZSR A;  1NJW A;  2B5J A;  4DU3 A;  5HRP A;  1HYS A;  4FK2 A;  4CHO A;  2FBY A;  4CEQ A;  1VK0 A;  4DQS A;  3OYA A;  4LSL A;  4CIE A;  3LAM A;  2B4J A;  1LWC A;  2JLE A;  2Z1H A;  1RBT A;  1A5V A;  2D5R A;  4B08 A;  4MFB A;  4CFB A;  4W5O A;  4FJH A;  3L3U A;  4M3W A;  5HRS A;  4Z4C A;  3RMD A;  4Q0B A;  4KB1 A;  1D9D A;  3NE6 A;  2XHB A;  2A1R A;  1WSG A;  2KFN A;  1D9F A;  4E89 A;  4E7L A;  3DOL A;  3CFR A;  4E7H A;  4RW9 A;  2OPS A;  4IFY A;  1JLB A;  1HNI A;  1U47 A;  2DTU A;  3THV A;  3RWU A;  2R7Y A;  2W42 A;  3MXM A;  3UIQ A;  1RBU A;  4CJT A;  1HPZ A;  1JXB A;  3NH0 A;  4E1M A;  3RR8 A;  1UOC A;  4JRQ A;  4B9M A;  1SKR A;  4CJK A;  4AIL C;  3TAE A;  3I0S A;  3QET A;  1BCO A;  3HXM A;  3QIO A;  3TWH A;  4F8R A;  1RNH A;  4CJS A;  2YNF A;  3L2R A;  1J54 A;  3RRG A;  3OYD A;  4AHR A;  4CHN A;  1RTJ A;  1HRH A;  3D0P A;  4Z4G A;  5CZ1 A;  3V9U A;  3HP9 A;  4CIF A;  1NK7 A;  4E3S A;  5HLF A;  1TK5 A;  3PUF A;  1TK0 A;  2PZS A;  3LWL A;  3LZI A;  1L3T A;  1SL0 A;  4HUG A;  1VSH A;  3WNF A;  5J2Q A;  2Y1J A;  1HMV A;  1Q9X A;  3ZT2 A;  4CGJ A;  1C0T A;  3AO1 A;  4CF1 A;  3PX0 A;  1KLM A;  5CY4 A;  3HL8 A;  3SQ1 A;  4DWI A;  4KI6 A;  1JLQ A;  4FK0 A;  1CZ9 A;  2D0C A;  3OYH A;  3H08 A;  4HUE A;  4FLV A;  3T3F A;  2QK9 A;  5HRN A;  2HND A;  1NJX A;  2HHX A;  2A1S A;  3K5N A;  4RW6 A;  2FBV A;  3ZSZ A;  2YV0 X;  5T7B A;  4DQI A;  4CF2 A;  1EET A;  4KB0 A;  4FJ7 A;  4PA1 A;  3OYJ A;  4TSX A;  5FDL A;  2BE2 A;  4KTQ A;  1HQU A;  1VSF A;  1RBV A;  1WN7 A;  4KRE A;  2ZQB A;  2D0B A;  4I7F A;  5HRR A;  1YTA A;  4CHZ A;  3KTQ A;  2G8H A;  1JLF A;  3ZT1 A;  2KZM A;  1VRU A;  1S1V A;  4CHP A;  2RKI A;  4C8M A;  1QSY A;  5KTQ A;  3E01 A;  4FXD A;  2G8W A;  4ID1 A;  4F2R A;  3MAQ A;  4PUO A;  2YKN A;  4J2A A;  1B9F A;  3AO5 A;  4FJ9 A;  1SL1 A;  1TKT A;  3AO3 A;  3P5J A;  4N5S A;  4BDY A;  1NKB A;  2VG6 A;  4QCL A;  3JSM A;  4LY7 A;  4B9U A;  4ELT A;  3VQP A;  4CGI A;  3JYT A;  1Z26 A;  1S1T A;  2VG7 A;  4PWD A;  4KTZ A;  3AA2 A;  3U3G A;  3HT3 A;  3TI0 A;  4N76 A;  1ZYQ A;  1C1A A;  1D5A A;  3O4N A;  3KLI A;  4DTJ A;  3TAQ A;  1N5Y A;  4FJJ A;  1ZBH A;  1QE1 A;  1S1X A;  4NCA A;  1JL2 A;  4FZZ A;  2IOC A;  4CJQ A;  1X1P A;  2IC3 A;  4JS4 A;  1NOZ A;  4FLZ A;  3VA3 A;  2GUI A;  4M3T A;  4M3Y A;  2O4I A;  4HUF A;  4FVM A;  3QES A;  2X74 A;  4NCG A;  3B6P A;  5J2N A;  4RW7 A;  3HPG A;  2ZD1 A;  4MQ3 A;  5CYQ A;  3DI6 A;  3AVG A;  3DMJ A;  4FLX A;  3TAG A;  1RDC A;  3PO5 A;  2KFZ A;  5J1E A;  4CJR A;  4E7I A;  1A5W A;  4DTP A;  2RPI A;  4KHQ A;  4FJX A;  2P5O A;  4AHT A;  3O3G A;  1HNV A;  1UAX A;  3MEE A;  3I8D A;  3SPZ A;  4HCC A;  5EU7 A;  1FKP A;  3VQA A;  1NJZ A;  3V9S A;  4FJM A;  3NGZ A;  4DLE A;  1C1B A;  4CJE A;  3RTV A;  1HYZ A;  4DSE A;  4LD0 A;  1L3S A;  3SQ4 A;  2F96 A;  3CFO A;  4N47 A;  2BDP A;  3KD5 E;  1CXU A;  1UWB A;  3LAN A;  3NH2 A;  3OYG A;  2HW3 A;  2G8U A;  1RT5 A;  2XY8 A;  3AVH A;  2HHQ A;  1DLO A;  1IO2 A;  1W9H A;  1C6V A;  3AVB A;  4KV8 A;  3ZSV A;  4FJN A;  3RMB A;  2X6N A;  2Z1J A;  1LW0 A;  1RBR A;  3ISN C;  4CEC A;  5KRS A;  4DTS A;  3V6D A;  5SWM A;  1KSP A;  1QHT A;  3DLH A;  5HBM A;  3TR8 A;  2WOM A;  3NGY A;  1X9S A;  3MEC A;  1VSL A;  3AVL A;  3VQ9 A;  4QAG A;  3O3F A;  3K58 A;  3LZJ A;  2XY7 A;  4CCH A;  1WSI A;  2DFH A;  2OZS A;  4OKJ A;  4H8K A;  4ZTJ A;  1RTI A;  2G8F A;  3NF6 A;  4CE9 A;  3K5M A;  1SKW A;  4DSK A;  1KFD A;  1X9M A;  2G8V A;  4LH4 A;  4AHV A;  4BDZ A;  3QNN A;  2Y1I A;  3KK1 A;  3KD1 E;  3ULD A;  4HVJ A;  4YFU A;  1L3V A;  4GMJ B;  2YNI A;  4F3O A;  3LPU A;  3G10 A;  4C8K A;  1FXX A;  1GOB A;  2HVH A;  1BHL A;  1S9G A;  2FC0 A;  4O0J A;  4CJW A;  3OYN A;  4DFP A;  4CEF A;  2VWJ A;  3S3M A;  2PYL A;  5KGW A;  4JRP A;  1TKX A;  4CJP A;  4NCB A;  1EXQ A;  1A5X A;  4IG0 A;  3MXI A;  3SQ2 A;  1FKO A;  3KKR A;  2XO7 A;  4J2D A;  2HHV A;  1WAJ A;  3KK2 A;  3AVF A;  4CGD A;  1U45 A;  2Q3S A;  1I39 A;  4FW1 A;  4C8N A;  1BIZ A;  3KLH A;  5J2M A;  2ETJ A;  4JS5 A;  4CEE A;  4K8X A;  3ITH A;  2BGG A;  3CG7 A;  1U49 A;  1RT4 A;  2OPR A;  3P1G A;  4B3O A;  5CZ2 A;  3L2U A;  1RTD A;  2G8I A;  1BQM A;  1K6Y A;  4DFJ A;  1R0A A;  3RR7 A;  1C0M A;  1RCH A;  3M8R A;  2HNY A;  3D45 A;  4K8Z A;  4G1Q A;  5C42 A;  1BGX T;  2BAN A;  3L8B A;  3DRR A;  3NHG A;  1NKE A;  3EYZ A;  4PY5 A;  4FJG A;  4DSL A;  3VQ5 A;  4WE1 A;  3KK3 A;  3V9W A;  1KFS A;  4CGF A;  3IRX A;  4Z0U A;  3AVM A;  1TK8 A;  4EZ6 A;  3AV9 A;  3ZT3 A;  4W5T A;  2GBZ A;  5HP1 A;  1XI1 A;  5D3G A;  1NK6 A;  1N6Q A;  4M3U A;  4B9V A;  2AJQ A;  1CLQ A;  1WSE A;  2RF2 A;  1IKW A;  3U6F A;  2G8K A;  4CGG A;  1TV6 A;  3TAM A;  1LW2 A;  3ZT0 A;  3MEG A;  1KLN A;  1B9D A;  1IKV A;  1U04 A;  4R5P A;  3OS1 A;  4DU1 A;  1KVC A;  2ZE2 A;  3VQQ A;  4FJ5 A;  3KLE A;  4W5N A;  4DQQ A;  1Q9Y A;  5C24 A;  4YNQ A;  3QEX A;  3SNN A;  3WNG A;  1RDD A;  3DLG A;  2EHG A;  3AVJ A;  4Y1C A;  1GOC A;  2DFF A;  4DLG A;  2HMI A;  3NCI A;  3CFP A;  3TAF A;  3F9K A;  1NK8 A;  2E6L A;  4EP5 A;  5KRT A;  3OYB A;  4M3X A;  3K59 A;  3LWM A;  1RT7 A;  1WSJ A;  2KQ2 A;  3KLF A;  1W0H A;  3AVI A;  1KTQ A;  1ITG A;  5J2P A;  3ALY A;  2QXF A;  3QEP A;  1GOA A;  1YT3 A;  4Z4H A;  1TKD A;  4FJ8 A;  1BIS A;  4BWJ A;  4CGH A;  1RT6 A;  1NK5 A;  4E1N A;  4NYF A;  1T03 A;  3LP0 A;  2E6M A;  4FLU A;  1S6Q A;  4B8C A;  4DTM A;  1EX4 A;  1IH7 A;  2ITG A;  3SZ2 A;  3PX4 A;  2LSN A;  1BI4 B;  3NH1 A;  4CFA A;  3HK2 A;  4M3R A;  3ZCM A;  1VSE A;  3V1R A;  3V1O A;  4CFC A;  4FM2 A;  4H4O A;  4OLB A;  4J2E A;  4DSI A;  3K5O A;  4OKK A;  3MXJ A;  4KHN A;  2PY5 A;  1NJY A;  5DK5 A;  5JS1 A;  4CF0 A;  3VQ4 A;  1JLG A;  2KW4 A;  4I2Q A;  4KI4 A; 
#chains in the Genus database with same CATH topology
 1ASU A;  5AQY A;  3NF9 A;  3SCX A;  1OKJ A;  3DOK A;  3NFA A;  3OYL A;  4I2P A;  1JCE A;  3VER A;  1S1W A;  2OPP A;  4YOT A;  1GLJ O;  3OJU A;  1UA0 A;  4EHT A;  1QQM A;  5DM6 L;  1ZBF A;  2PFU A;  3VEN A;  2OPQ A;  3PY8 A;  3HVR A;  1MWM A;  4IG3 A;  1DTT A;  4KBO A;  4BRO A;  3M8Q A;  5AQF A;  2F7T A;  3CQY A;  3LDQ A;  1KD1 O;  1C1C A;  4E1J A;  3K9K A;  2X6S A;  4AH9 A;  3E1Y A;  3TTD A;  2XY6 A;  1X9W A;  3OYE A;  1XQS C;  4KHP K;  1J6Z A;  3G71 N;  3ZSX A;  3VQC A;  2UXB K;  4RCH A;  4DFM A;  3CYM A;  1FK9 A;  4WQ5 A;  4JN4 A;  3WXK A;  2HBL A;  3WUH A;  4X65 K;  3SV3 A;  1BQN A;  2O8D A;  2YHA A;  4JD2 A;  4DR3 K;  1LV5 A;  4B9S A;  4DTO A;  5AQZ A;  3F5T A;  1VRT A;  3VQD A;  2D0A A;  4LC9 B;  5SZT A;  4IOX A;  1IG9 A;  3DLE A;  4BE0 A;  2IVN A;  1VSM A;  2QM1 A;  3CM6 A;  1XC3 A;  4ISG A;  4L8R B;  3OYM A;  1J5O A;  1SZ2 A;  3VMF B;  2IGI A;  3HO1 A;  1IBM K;  3HRG A;  3ZT4 A;  2E2Q A;  3QEI A;  4J8F A;  1KVA A;  3EKU A;  5M1O A;  4F4K A;  1KCF A;  4JI3 K;  3CMA N;  2HBJ A;  3DLK A;  1HJR A;  5F2R A;  1HQE A;  3WXM B;  5FLX O;  4LFC K;  4QS7 A;  4NYN A;  3G6E N;  3THY B;  4KHS A;  4Z4F A;  4E0D A;  1WAF A;  4KHY A;  2QXL A;  3KLG A;  3A8Y A;  2HHS A;  3T19 A;  1YJ9 N;  4CIG A;  3C6A A;  3THW B;  4FSV A;  2HNZ A;  3R1X A;  5EOY A;  1S6P A;  1TAQ A;  3THX B;  4BAC A;  2FBT A;  3V4I A;  3HVT A;  3AA5 X;  3M5R A;  4BE2 A;  3ZSO A;  4O0I A;  5AR0 A;  4C1N K;  3CQ8 A;  2QKK A;  4KFB A;  4OGC A;  4OLA A;  4FWR A;  1T44 A;  3AVN A;  1XHZ A;  3DLB A;  3HM8 A;  5LMN K;  3TSU A;  3NVM A;  3L2V A;  2NUB A;  4CEZ A;  1T6D A;  2O4G A;  4LF5 K;  3QFP A;  2HHW A;  4ELU A;  1WNS A;  5LY3 A;  3AAR A;  3F73 A;  2ATQ A;  4ILJ A;  4WQ4 C;  1QSS A;  2FF3 B;  5AFU H;  5JS2 A;  2YHB A;  3CJB A;  1V4T A;  4DV3 K;  2DPN A;  3C94 A;  1SL2 A;  1ZBU A;  1D8Y A;  1IKX A;  4LF8 K;  1BIU A;  4O5B A;  3BZK A;  2F8T A;  2OCE A;  1E3M A;  1BWF O;  1DKG D;  3L3V A;  3M8S A;  2E2N A;  1VSK A;  4F3T A;  4GW6 A;  3ATV A;  3A5M C;  4CZM A;  3CHW A;  4GVE A;  4CZJ A;  3S3N A;  4FLT A;  1K8K B;  4DSJ A;  4A5A A;  1CXQ A;  3ZX0 A;  4PQU A;  4W5Q A;  3SUO A;  4DF4 A;  3IS9 A;  3DAW A;  3QIC A;  2YX6 A;  3ASM A;  4DG1 A;  3FR0 A;  5KI6 A;  3PSF A;  2QWP A;  1K73 O;  1HYV A;  2DY4 A;  3EO3 A;  5JIC A;  2VG5 A;  4WFN L;  3CCS N;  3C95 A;  3LP1 A;  4IKF A;  3AGK A;  5BN9 A;  3VGM A;  3FZL A;  2F4V K;  4HTU A;  4AQY K;  4FK2 A;  4I6M A;  3O4W A;  3LAM A;  1LWC A;  4FWS A;  1RBT A;  4CFB A;  4FJH A;  4BRM A;  4M3W A;  3HZ6 A;  4KB1 A;  2KFN A;  2XHB A;  2WBN A;  1QQO A;  5AQW A;  1ILY A;  3DOL A;  1QZ5 A;  1JLB A;  2DTU A;  4K42 A;  2NLX A;  3CCL N;  3UIQ A;  1YJW N;  4B3R K;  3WXL A;  3IUC A;  3NH0 A;  4E1M A;  4JRQ A;  1NU0 A;  3QET A;  3CQX A;  3QIO A;  3CJ7 A;  5CHI A;  4X64 K;  4CJS A;  2ASO A;  2P9U B;  3L2R A;  1P8Z A;  4H5T A;  5HLF A;  3PUF A;  1TK0 A;  2PZS A;  4JYA K;  3J7Y P;  1DEJ A;  3A0I X;  3LZI A;  1HMV A;  5AQQ A;  1C0T A;  1VQL N;  3PX0 A;  1NGD A;  1KLM A;  4DWI A;  1CZ9 A;  3T3F A;  2QK9 A;  3D6R A;  2UUC K;  1P90 A;  5HRN A;  2A1S A;  1HJO A;  4KTQ A;  1HQU A;  4DKW A;  4I7F A;  4CHZ A;  1JLF A;  1VRU A;  3SMS A;  3VF2 A;  2RKI A;  1JCF A;  4JKC A;  3S41 A;  3RVC A;  4BR5 A;  2YKN A;  1EQY A;  4J2A A;  1B9F A;  5GAG P;  3THW A;  3P5J A;  4BDY A;  4BG8 A;  2VG6 A;  4QCL A;  3ENO A;  3UKU B;  4BQZ A;  4ELT A;  4CZK A;  5AQS A;  1Z26 A;  2VG7 A;  3AA2 A;  4N76 A;  3O4N A;  3KLI A;  4DTJ A;  4OPH A;  2IOC A;  4CJQ A;  2IC3 A;  1IBL K;  3UB5 A;  5EX5 A;  4HUF A;  4NCG A;  3TAG A;  3HPG A;  2ZD1 A;  3AVG A;  2KFZ A;  3OBW A;  2O8B B;  1A5W A;  4FL9 A;  4KHQ A;  1UAX A;  3DXM A;  2IVO A;  4DLE A;  1KAZ A;  3U9Z A;  5FPM A;  3ZEU B;  3QBX A;  1NGF A;  3TU5 A;  1YAG A;  4CVN E;  1BA1 A;  3KD5 E;  3UKR A;  1UWB A;  3OYG A;  2HW3 A;  2G8U A;  2XY8 A;  1K8K A;  4FJN A;  1O13 A;  4DTS A;  3ISN C;  1KSP A;  5KRS A;  3I56 N;  3DLH A;  3K58 A;  2XY7 A;  4CCH A;  3CJ9 A;  3KZB A;  4OKJ A;  4DCH A;  4ZTJ A;  1HNZ K;  3NF6 A;  2Q1N A;  4B1Z A;  5IWA K;  3QNN A;  4HVJ A;  4YFU A;  2UUB K;  5BR9 A;  2E1Y A;  3VEZ A;  2IIR A;  5C2D A;  3OYN A;  4V19 S;  3U9D A;  3W0L A;  2PYL A;  3MCP A;  5KGW A;  4NCB A;  1EXQ A;  1A5X A;  4IG0 A;  3SQ2 A;  1NGC A;  2XO7 A;  4B3M K;  4BC2 A;  2HHV A;  1WAJ A;  1U45 A;  3CJC A;  4FW1 A;  1QVG M;  4ISE A;  2D1K A;  2V7Z A;  4AM6 A;  5CZ2 A;  1RTD A;  1BQM A;  1K6Y A;  4B1W B;  1C0M A;  1RCH A;  2WTU A;  2P9S B;  2HNY A;  3H1V X;  4G1Q A;  4K8Z A;  5C42 A;  3O6W A;  3EYZ A;  4PY5 A;  4DSL A;  3VQ5 A;  3DWL A;  4WE1 A;  1KFS A;  2OTJ N;  1TK8 A;  3IRX A;  1XI1 A;  4M3U A;  4H0T B;  4JKG B;  4LF7 K;  1IKV A;  2PBD A;  1ATR A;  4R5P A;  3SK3 A;  4MDA A;  4DV0 K;  4JI0 K;  1EO1 A;  2QWQ A;  4ISF A;  1RDD A;  1M90 O;  1RDU A;  3DLG A;  2HMI A;  3NCI A;  3TAF A;  5KRT A;  3OYB A;  1NGG A;  3MWT A;  2KQ2 A;  4PKH A;  3AVI A;  1KTQ A;  3QEP A;  2QXF A;  4H0V B;  4YOR A;  4CBW A;  4EFH A;  2P9S A;  4RWT A;  2ITM A;  1T03 A;  4JKH A;  4NB4 A;  4JHD A;  4B8C A;  4DTM A;  5ADX A;  3SZ2 A;  2H3G X;  2WUS A;  4BRH A;  3NH1 A;  1E4F T;  5AQP A;  3ZCM A;  4K25 A;  1VQK N;  3V1R A;  3V1O A;  4H4O A;  4JI1 K;  3CXC M;  3MK6 A;  2NRZ A;  1HLU A;  3MXJ A;  4KHN A;  4IO8 A;  1V4S A;  2GUP A;  1RBS A;  4KPY A;  1RDA A;  2NZT A;  4DV1 K;  3G0Z A;  4E19 A;  3TTF A;  1EWR A;  3V81 A;  4DQR A;  2YNH A;  1VQ5 N;  4DR1 K;  1S72 N;  5AQO A;  2Z1I A;  4ELV A;  3VQ8 A;  4RG8 A;  4OGE A;  4DV6 K;  3ENH A;  5LL6 Z;  1TUY A;  4ZHR A;  3ZSY A;  2EX3 A;  3HOT A;  1JJ2 M;  2F8S A;  3OW2 M;  2YHY A;  3RRH A;  1NLV A;  2IDO A;  2EWS A;  5I9E B;  1VSD A;  3NAE A;  1VQM N;  2AA4 A;  3LPT A;  4CHQ A;  3CPW M;  3NVK A;  1IKY A;  1TVR A;  3OS2 A;  4FM1 A;  3V9X A;  3O9R A;  4PL7 A;  3LDP A;  4WQ5 C;  3EEQ A;  3AVA A;  2XRI A;  3NGI A;  3IAY A;  3WNH A;  3UE5 A;  2E5L K;  3AO2 A;  3HPH A;  1IBK K;  4WFA L;  4CHY A;  3AVK A;  1X3M A;  2ZJQ L;  4IDK A;  4FWQ A;  3VES A;  4CK3 A;  3DRS A;  3KIO A;  4CD1 A;  3JS6 A;  4FW2 A;  3TAP A;  1IJJ A;  4KH5 A;  2P1J A;  3PIO L;  2QKB A;  4QS9 A;  2W41 A;  1DTQ A;  4C8L A;  1C0F A;  4XIU A;  4CFD A;  5EY4 A;  4CEO A;  4DQP A;  3VA0 A;  1JCG A;  2FF6 A;  3V9Z A;  2HHH K;  2QWO A;  3K2P A;  4JLH A;  1EWQ A;  4CJ5 A;  4EZ9 A;  3HST B;  1HKC A;  4F9O A;  3OYF A;  3WXI A;  4O44 A;  4IWV A;  2VCP A;  2QW9 A;  2QWM A;  2GEL A;  3S9H A;  2IS3 A;  4JD2 B;  3CC4 N;  1Y97 A;  3L2W A;  2O8F A;  1LWE A;  3QIN A;  1NMN A;  4MO5 A;  1ZBI A;  1SS6 A;  1JL1 A;  1NNE A;  2P9K B;  3WNE A;  1BCM A;  4LH5 A;  2P9N B;  5AQK A;  3T1A A;  3SV4 A;  2RN2 A;  3BF3 A;  3P83 D;  5AJ3 K;  1OH8 A;  1QTM A;  2Q0U A;  3HYF A;  2JGU A;  1NK0 A;  4HHT A;  2FBX A;  1TL3 A;  1KRP A;  4Y0W A;  1S9E A;  1BI4 A;  1QZ6 A;  4JI8 K;  3ZSQ A;  3TTC A;  1T6C A;  4DS5 A;  4H5V A;  2O8B A;  4FYD A;  1YTU A;  4WYB A;  4CZI A;  4KAZ A;  1T05 A;  2O8E A;  5CYM A;  1RTH A;  4CES A;  3DM2 A;  2I5J A;  4E7J A;  1L3U A;  3CCM N;  3SYZ A;  2E2P A;  2RE2 A;  3SUP A;  3SI6 A;  4CBU A;  5K14 A;  3K57 A;  4DF8 A;  2V52 B;  3EN9 A;  3SJJ A;  1JLE A;  4H0Y B;  4H5W A;  4JI4 K;  1ATN A;  5KGX A;  1JXE A;  2ZWH A;  4JI2 K;  3FZF A;  4KKO A;  1EKE A;  4W5R A;  5LMU K;  4CEB A;  3MED A;  1QVF M;  1ZBS A;  4H0P A;  2Z1G A;  4BRE A;  4GVM A;  1T7P A;  2YKM A;  3LP2 A;  5E26 A;  3FLC O;  1C0U A;  3ATU A;  4GKK K;  2V51 B;  4DR5 K;  3S3O A;  1SV5 A;  2UYT A;  4FWM A;  3QML A;  3O9U A;  1REV A;  3O9T A;  5FPE A;  3CJA A;  1SUQ A;  3D2E B;  3SQ0 A;  4BDP A;  2JWK A;  3I0R A;  4KH4 A;  3SUQ A;  3DLR A;  3EZ5 A;  3L6Q A;  1NJW A;  5HRP A;  4CHO A;  4CEQ A;  4DQS A;  1YJN N;  4DV4 K;  3T1Y K;  2Z1H A;  2D5R A;  1A5V A;  2A42 A;  3RMD A;  4JEP A;  1TUU A;  4O8U A;  2OTL N;  3NE6 A;  1WSG A;  4E89 A;  3QBW A;  4E7L A;  2KHO A;  4RW9 A;  2OPS A;  4IFY A;  3R8E A;  1HNI A;  3THV A;  3Q7B A;  1JXB A;  3N4P A;  3CI5 A;  4IEI A;  3G4S N;  3RR8 A;  4LF4 K;  4GKJ K;  4B9M A;  1SKR A;  4CJK A;  3R6M A;  4BRI A;  4LF9 K;  2UXD K;  4U67 L;  1J54 A;  4BY9 C;  4BRF A;  4JI6 K;  1RTJ A;  3MDQ A;  3OBY A;  3HP9 A;  4E3S A;  3AGR A;  5KPR A;  4HUG A;  1VSH A;  2Y1J A;  1OVY A;  3ZT2 A;  4CGJ A;  3AO1 A;  4KI6 A;  1JLQ A;  1NGA A;  4FK0 A;  2D0C A;  5HOO A;  3EE8 A;  4FLV A;  5M1F A;  3O8M A;  4RW6 A;  2FBV A;  1KQS M;  2YV0 X;  3C65 A;  4FJ7 A;  1H1V A;  4DUZ K;  5FDL A;  2BE2 A;  1VSF A;  1RBV A;  4JKB A;  4JNE A;  2D0B A;  5HRR A;  2NRX A;  2KZM A;  4FWL A;  2VGM A;  3EZW A;  4C8M A;  3HBT A;  4PUO A;  1K8A O;  2KLA A;  3AO5 A;  1U6Z A;  4N5S A;  2P9L A;  4CI6 A;  2UUA K;  3JYT A;  2GEM A;  3HT3 A;  2RHK A;  1ZBH A;  1QE1 A;  2QI2 A;  1S1X A;  4NCA A;  4BGA A;  4FLZ A;  2O4I A;  1GLL O;  1NOZ A;  4M3T A;  4M3Y A;  1BA0 A;  4FVM A;  3GBT A;  3CCU N;  5J2N A;  4JI5 K;  1N5Y A;  3DMJ A;  4M63 C;  1RDC A;  1NJI O;  5GAD P;  3FZH A;  1VQ9 N;  2I7P A;  2W6L A;  4IJA A;  5MLC Q;  3O3G A;  3I8D A;  1HX1 A;  1NJZ A;  3VEO A;  1C1B A;  4CJE A;  3DLL L;  3CCJ N;  2AP1 A;  3CFO A;  1CXU A;  2GTD A;  3LAN A;  3SLC A;  1ZXO A;  1BOT O;  1RT5 A;  4MO4 A;  3AVH A;  1W9H A;  1C6V A;  4JKG A;  2X6N A;  2Z1J A;  3V6D A;  4JK7 A;  4BC5 A;  5DM7 L;  1QHT A;  1RDW X;  1YVN A;  1XNR K;  1HKG A;  2WOM A;  3MEC A;  3AVL A;  4FOE A;  3LZJ A;  2OZS A;  1VQ4 N;  2E20 A;  1VAZ A;  4CE9 A;  3M6G A;  1IV0 A;  4EIA A;  3TSQ A;  1X9M A;  2G8V A;  1HNW K;  1L3V A;  2FXU A;  4F3O A;  5JLF A;  4C8K A;  2HVH A;  1S9G A;  3S3M A;  4O0J A;  2VGN A;  3HSC A;  4CJP A;  1BO5 O;  3LDN A;  5BPN A;  2Q36 A;  3DXK A;  4B1U B;  1VQ7 N;  3CF5 L;  4K43 A;  3AVF A;  5BRH A;  2O8C B;  3BZC A;  1BIZ A;  3KLH A;  2ETJ A;  4JS5 A;  3ITH A;  1YI2 N;  4JKE A;  2E1Z A;  1FW6 A;  3ZX3 A;  3MN6 A;  3RR7 A;  1HKB A;  4YOX A;  3D45 A;  1FJG K;  3L8B A;  3NHG A;  1NKE A;  4FJG A;  2P9I A;  3MMV A;  3KK3 A;  4Z0U A;  3AVM A;  3AV9 A;  3ZT3 A;  3N4Q A;  2GBZ A;  3OA9 A;  4W5T A;  1NK6 A;  1N6Q A;  1CLQ A;  5JLH A;  3U6F A;  4MLE A;  3TAM A;  3BF1 A;  1KAX A;  1LW2 A;  1KLN A;  2VQE K;  4W5N A;  2A41 A;  3IKM A;  3O9Q A;  3WNG A;  5BRF A;  1LOT B;  4RTF D;  3CFP A;  2OAN A;  1NK8 A;  4FWN A;  2E6L A;  3ULE A;  4XEI A;  1XMQ K;  4GV9 A;  3O08 A;  3KLF A;  5EVZ A;  3RSE A;  3L4Q A;  5BPM A;  4IDH A;  1NGE A;  4BRQ A;  2A3Z A;  1N36 K;  3CC2 N;  4PKG A;  3PIP L;  4NYF A;  2W6K A;  3M1F A;  5M1P A;  1S6Q A;  1VQP N;  1IH7 A;  2ITG A;  3TPQ A;  3LDO A;  2O8E B;  3PX4 A;  2LSN A;  2VYP A;  5BRE A;  3HK2 A;  4H5R A;  4ILG B;  3J8A A;  1NJY A;  1RGI A;  4ZTF A;  4OJR A;  1JLG A;  2KW4 A;  4KI4 A;  4H0O A;  5E41 A;  3ZSW A;  4DTN A;  3ID6 A;  4DSF A;  2WC9 A;  3TSP A;  1W7A A;  1GLC G;  3K5L A;  4DV5 K;  4DB3 A;  1NK4 A;  2Q31 A;  1WUA A;  3PO4 A;  4BR9 A;  4FK4 A;  3HP6 A;  3OHR A;  5FRM A;  1ESV A;  4OKE A;  1ATS A;  1SQK A;  2YNG A;  3VEX A;  3VF4 A;  4I9Q A;  5C12 A;  2A6A A;  3QO9 A;  1YF5 L;  2YHX A;  4B9L A;  3VN5 A;  4BVO A;  3B6O A;  1OH6 A;  4CK1 A;  2IVP A;  3HI0 A;  3AY9 A;  4UY8 O;  2IAJ A;  4B9Q A;  4CER A;  1QQC A;  4YOW A;  4XH1 A;  4B8A B;  3CM5 A;  1U4B A;  2HOE A;  3LAK A;  4E7K A;  3VQB A;  5C2F A;  3C7N A;  2BUP A;  2ZM6 K;  4PL8 A;  3WEE B;  4CK2 A;  4CJF A;  4BRL A;  1O1W A;  1HR0 K;  3A5O C;  1LAW A;  1KAY A;  1TYQ A;  2X78 A;  5CR4 A;  1VHX A;  3H1Q A;  3OS0 A;  2F9W A;  2Q97 A;  1KC8 O;  3SPY A;  5BN8 A;  3CER A;  3QIP A;  2ZF5 O;  4AHS A;  3CCQ N;  5GIP A;  4PKI A;  4N41 A;  3RMC A;  3WQU A;  3C6U A;  3OYK A;  4BRK A;  2P51 A;  2KTQ A;  2OYQ A;  2P9U A;  1MU2 A;  4OVL A;  3LM9 A;  4KH6 A;  2CGJ A;  3GOI A;  1GLF O;  4ID5 A;  1TAU A;  3VTI A;  3NF7 A;  3SUN A;  3F2K A;  4WQ4 A;  4KRF A;  3QEW A;  1VQ8 N;  2FSK A;  3DRP A;  4K41 A;  3K9J A;  4FZY A;  3KKS A;  4O4G A;  1HPM A;  1LAV A;  2HHT A;  5ADX H;  3O3H A;  3PX6 A;  4DTU A;  1XHX A;  5FPN A;  1J53 A;  3QNO A;  3TAB A;  4RW4 A;  3AAQ A;  3O1W A;  3MN7 A;  1RT3 A;  5GAH P;  4DTR A;  3MWP A;  1YVU A;  3IFR A;  1JLA A;  1JKH A;  3ZYY X;  4OPJ A;  3AA4 A;  2VWB A;  4JKD A;  5KPZ A;  3HTV A;  1NM1 A;  3RMA A;  1OVQ A;  2I7N A;  4IEE A;  3A2F A;  5AQV A;  3ZLJ A;  4CJL A;  5HRO A;  4WFB L;  1M1K O;  1EP4 A;  4CJ3 A;  3BEX A;  4F2S A;  3IG1 A;  1W2B M;  3OY9 A;  4IJN A;  2CH5 A;  3OVN A;  4FZX C;  1WLJ A;  2E8A A;  4AHU A;  3F9M A;  4NXM K;  3VQ6 A;  3MX2 A;  4FJI A;  5EXW A;  3HJF A;  4YDU A;  4YOV A;  3QER A;  2GX9 A;  2P5G A;  5LJV A;  4M3Z A;  1NKC A;  3L2Q A;  1J9A A;  2BTF A;  3FGU A;  4FPB A;  5JMV A;  4O55 A;  3CME N;  3NDK A;  4ICL A;  4FJK A;  3CET A;  3O5B A;  5M1K A;  2YHW A;  4QS8 A;  4Q5V A;  1RIL A;  2DFE A;  1G15 A;  1TKZ A;  4MDB A;  4IO9 L;  1F21 A;  3CIP A;  2BH1 A;  4GV3 A;  2VQF K;  4H0X B;  2E4L A;  1Z25 A;  3DYA A;  5CE3 A;  1K9M O;  1BG3 A;  1WSF A;  4DU4 A;  1HYS A;  2B5J A;  3E9L A;  3GDQ A;  1Q18 A;  1VK0 A;  3OYA A;  5A2Q O;  4LSL A;  4CIE A;  2B4J A;  2O8C A;  2JLE A;  4B08 A;  4OX9 K;  4MFB A;  4YY3 K;  4B1V A;  4CD3 A;  4Z4C A;  4Q0B A;  2QEX N;  4M7X A;  2A1R A;  3J81 O;  1D9F A;  1WOQ A;  3C7N B;  1Q86 O;  2ASP A;  2W42 A;  1RBU A;  1HPZ A;  1UOC A;  1J5E K;  2QTD A;  4BRN A;  3I0S A;  1BCO A;  3HXM A;  2KKZ A;  3TWH A;  4A57 A;  1RNH A;  4F8R A;  1IG8 A;  4HWI A;  3OYD A;  4CHN A;  3E66 A;  5CZ1 A;  1NK7 A;  1TK5 A;  1LCU A;  3UKU A;  3LWL A;  1SL0 A;  3CCE N;  1Q9X A;  4JHD B;  5AQU A;  1Q82 O;  4CF1 A;  2QWR A;  5CY4 A;  3H08 A;  4HUE A;  2HND A;  3VET A;  5KQ8 A;  4FVU A;  2HHX A;  1YXQ A;  3ZSZ A;  3P31 A;  5AFU A;  5T7B A;  4CF2 A;  3VTH A;  4KB0 A;  3IDH A;  5C0Y A;  5AZJ B;  2G8H A;  3ZT1 A;  1YIJ N;  1GLB G;  1S1V A;  4CHP A;  5FPD A;  4FWP A;  2A40 A;  4JKA A;  4BVP A;  4O8K A;  1SL1 A;  1TKT A;  2Q2R A;  4GY2 B;  5F1X A;  3UKR B;  3VQP A;  4YOU A;  4PWD A;  4BRP A;  4KTZ A;  3U3G A;  3TI0 A;  1ZYQ A;  1D5A A;  2ZGY A;  2P9K A;  3CCV N;  4FZZ A;  3THY A;  1X1P A;  3BY5 A;  2CH6 A;  5C10 A;  2GUI A;  4YDU C;  2X74 A;  5CYQ A;  3DI6 A;  3EKS A;  2PAV A;  1WB9 A;  2HF3 A;  4DTP A;  2RPI A;  4FJX A;  4AHT A;  1HNV A;  3MEE A;  5EU7 A;  3VQA A;  3SBG A;  3E9O A;  3L0Q A;  3P38 A;  3MX5 A;  5AQR A;  3NGZ A;  3V9S A;  4FOI A;  4FJM A;  4DSE A;  1L3S A;  1QHA A;  3SQ4 A;  4CJ7 A;  4BRC A;  2F96 A;  4N47 A;  2BDP A;  3NH2 A;  1ZC6 A;  5F0X A;  5AQG A;  3K0S A;  1DLO A;  1IO2 A;  3ZSV A;  3BP8 A;  4CEC A;  1DT9 A;  5SWM A;  4CZG A;  5GIN A;  2JWL A;  3G25 A;  1VSL A;  1WBB A;  4QAG A;  4BRG A;  3SMP A;  3O3F A;  2DFH A;  3ULE B;  2G8F A;  4DSK A;  1KFD A;  4LH4 A;  4BDZ A;  4DHY A;  3KK1 A;  3KD1 E;  5BR8 K;  3LPU A;  4G9Z A;  1BHL A;  1NKB A;  2FC0 A;  4CJW A;  4DFP A;  3RWU A;  4CEF A;  3U8X A;  4BR2 A;  1XUP O;  1TYQ B;  4DR7 K;  1FKO A;  4J2D A;  4BQL A;  3JXU A;  4CGD A;  4JK8 A;  4BG9 A;  4C8N A;  4C1N I;  5JVH L;  2BGG A;  3CG7 A;  1U49 A;  1RT4 A;  2OPR A;  3P1G A;  4B3O A;  2O8F B;  3L2U A;  4DFJ A;  3M8R A;  1BGX T;  1GLE G;  2BAN A;  3DRR A;  2HMP A;  1VQO N;  3V9W A;  2FSN A;  3P39 A;  3L4I A;  4CGF A;  4EZ6 A;  4A2A A;  1S3X A;  4I6M B;  5AQN A;  5D3G A;  1T3V A;  4DQ8 A;  2AJQ A;  1WSE A;  1IKW A;  1MA9 B;  3MN5 A;  2W40 A;  1B9D A;  1U04 A;  3VOV A;  1KVC A;  2YI1 A;  3SNN A;  4BC3 A;  2V7Y A;  4BR4 A;  2EHG A;  3AVJ A;  5KPT A;  3DXK B;  4DLG A;  3F9K A;  4EP5 A;  2QA4 N;  4M3X A;  4WF9 L;  3K59 A;  4IOC L;  3LWM A;  1WSJ A;  3O9S A;  4R79 A;  1ITG A;  5J2P A;  3ALY A;  1N34 K;  1GOA A;  2Q0R A;  5B8H A;  1BIS A;  4BWJ A;  4CGH A;  1RT6 A;  1NK5 A;  4E1N A;  4FO0 A;  3LP0 A;  4JK9 A;  4DR4 K;  4FLU A;  1EX4 A;  1DGK N;  4NO7 A;  1BI4 B;  3VPZ A;  4CFA A;  3B8A X;  3NMU A;  2ZJR L;  1VSE A;  1NBW A;  4OLB A;  4FM2 A;  4J2E A;  3K5O A;  5JS1 A;  5DK5 A;  3QFU A;  4CF0 A;  3VQ4 A;  3H6E A;  4Z4I A;  3AO4 A;  4KTW A;  1T8E A;  4NLC A;  3PV8 A;  4XH5 A;  4HCB A;  4I9L A;  4A61 A;  1NMD A;  3OYI A;  4FWO A;  4BE1 A;  4OO1 J;  5AQH A;  3NBP A;  4BWM A;  4CJU A;  4XH4 A;  3JAM O;  1BU6 O;  1RDB A;  3KWG A;  3QDK A;  3VGK A;  1BL3 A;  3H3O B;  4CEA A;  5AZI B;  4IBN A;  1ZBL A;  4AM7 A;  4X62 K;  3R3L A;  4FLY A;  3BDP A;  1NK9 A;  2HB5 A;  3I33 A;  4CJ4 A;  1TGO A;  3J80 O;  3LP3 A;  5FRN A;  3I55 N;  3AA3 A;  4IZ9 A;  1G99 A;  4B9N A;  3D2E A;  4M42 A;  1U48 A;  3FZM A;  2HHU A;  4A62 A;  4CED A;  3U3Y A;  3SAG A;  1X3N A;  3FE1 A;  4DMN A;  4KHU A;  1I3A A;  3FFI A;  3HM9 A;  1Y64 A;  5C25 A;  4B9T A;  2ZJP L;  1VQN N;  3C0B A;  2NRT A;  3T1H K;  4MLH A;  1B92 A;  4RW8 A;  4H03 B;  2OA8 A;  2E2O A;  4DUY K;  1NG9 A;  4LSN A;  1ASV A;  3BUZ B;  2PYJ A;  3PLA A;  1TL1 A;  1QQN A;  3QEV A;  3A5L C;  5TKW A;  4EAH D;  4YOY A;  4U7B A;  4DTX A;  4DV2 K;  1NOY A;  3MCA B;  2FLO A;  3ZET A;  3AAP A;  2NRR A;  4OPK A;  4CZH A;  5C15 A;  1QSL A;  4QOZ B;  3C6T A;  3KWI A;  1L5U A;  2HVI A;  3HOS A;  4JKF A;  3TAR A;  3O4Q A;  4KO0 A;  2O8D B;  4AHC A;  5I3U A;  4B3T K;  4IFV A;  1Q7Y O;  1XWL A;  2XY5 A;  4BGB A;  4C8O A;  5AQI A;  1UA1 A;  5HL7 L;  3LAL A;  5DMR A;  4FJL A;  4N56 A;  3M8P A;  2B6A A;  4AF1 A;  4EHU A;  4B1Y B;  3KJV A;  4FM0 A;  2YJE A;  5E84 A;  4UQG A;  3HPO A;  1Q8I A;  1RT1 A;  1LWF A;  4M41 A;  2GV9 A;  1KVB A;  4YHH K;  3BGR A;  4DS4 A;  4Y1D A;  2NRH A;  4X66 K;  4A2B A;  1I94 K;  2WON A;  4FCY A;  4CZL A;  2P9L B;  4K0K K;  3KHY A;  4FWK A;  5LJW A;  4GV6 A;  1OH5 A;  3AVC A;  1D4X A;  3GG4 A;  3WXJ A;  3ZEU A;  4EP4 A;  5GAE P;  5AQT A;  1N32 K;  3H45 C;  1Q81 O;  4J2B A;  1MDU B;  4KHW A;  4M45 A;  4B1X B;  2CGL A;  3OJS A;  4GNI A;  3T69 A;  1YHQ N;  5I42 A;  3WQT A;  3CCR N;  1XC9 A;  1QS4 A;  3NF8 A;  1VSI A;  2KZZ A;  3FFK B;  4BRA A;  4FLW A;  3QLH A;  3DXM B;  3VQE A;  1CZB A;  1W97 L;  5AQJ A;  3WT0 A;  4BR0 A;  3VQ7 A;  1S5J A;  2WFB A;  3U4L A;  3OTO K;  3SAF A;  1VQ6 N;  4DFK A;  4A59 A;  1SKS A;  4Z4E A;  4CF9 A;  1RT2 A;  3SJH A;  1SAZ A;  1VSJ A;  2GWK A;  1RFQ A;  2VWK A;  4CJV A;  2OZM A;  3V1Q A;  1ASW A;  3A5N C;  2D4W A;  2HBM A;  4B3S K;  3ZX2 A;  1S1U A;  5AZJ A;  1WSH A;  1NGI A;  2NNW A;  1JLC A;  3PSI A;  2ASM A;  4H4M A;  3LDS A;  3OYC A;  5FRO A;  4CF8 A;  1YIT N;  3EY1 A;  3CC7 N;  2J4R A;  5BRD A;  1NWK A;  3TAN A;  4H5N A;  5AZI A;  3LM2 A;  3ZSR A;  4DU3 A;  1NGJ A;  3D7E O;  2FBY A;  4C23 A;  4M7Y A;  3WEE A;  4W5O A;  3L3U A;  2QWN A;  5HRS A;  4WCE L;  5ELZ A;  5TKY A;  1GLA G;  4DR2 K;  1D9D A;  5JVG L;  1N33 K;  3CFR A;  4E7H A;  3I8B A;  1WBD A;  3VF6 A;  1U47 A;  4JAX A;  2R7Y A;  3MXM A;  4CJT A;  4BR7 A;  4CW7 B;  2QWL A;  4AIL C;  3TAE A;  2YNF A;  3RRG A;  4AHR A;  1HRH A;  3D0P A;  4Z4G A;  3V9U A;  4BC4 A;  4CIF A;  2CGK A;  3VEV A;  1L3T A;  5J2Q A;  3WNF A;  1NGB A;  4LFA K;  5GIO A;  3HL8 A;  3J7Z O;  3SQ1 A;  4O5F A;  3OYH A;  3ZET B;  1NJX A;  3K5N A;  2ZGZ A;  2D0O A;  4DQI A;  4L3Q A;  1EET A;  4PA1 A;  3OYJ A;  3Q7C A;  4TSX A;  3O1B A;  3LL3 A;  1WN7 A;  5M1N A;  4KRE A;  2ZQB A;  4IOA L;  1YTA A;  3KTQ A;  3RSE B;  1QSY A;  5KTQ A;  3E01 A;  4FXD A;  2G8W A;  4FPA A;  4ID1 A;  2NRW A;  3MAQ A;  4F2R A;  2GWJ A;  4FJ9 A;  4LFB K;  3AO3 A;  1U2V A;  4Z94 A;  4LF6 K;  3CD6 N;  3GL1 A;  1GLD G;  3THX A;  3SAH A;  3JSM A;  1E4G T;  4LY7 A;  4B9U A;  5AQM A;  1HUX A;  1XNQ K;  2P9P B;  4CGI A;  1S1T A;  1C1A A;  1X9J A;  3KK7 A;  3TAQ A;  3VGL A;  4FJJ A;  1YUW A;  1JL2 A;  3SBT A;  5IT9 O;  4BRD A;  4JS4 A;  3VA3 A;  4NXN K;  3E9P A;  3VEW A;  3QES A;  3B6P A;  4RW7 A;  4FLX A;  4MQ3 A;  2UXC K;  1C0G A;  3PO5 A;  5J1E A;  4CJR A;  4E7I A;  3CJ1 A;  2P5O A;  3GE1 A;  4CBX A;  3SPZ A;  4HCC A;  2FSJ A;  1FKP A;  5KQD A;  3RTV A;  1HYZ A;  4LD0 A;  4IXC A;  2NRV A;  3LDL A;  3W3D A;  1U2V B;  2HHQ A;  3AVB A;  4KV8 A;  3RMB A;  1LW0 A;  1RBR A;  2HST A;  2P9P A;  3VEY A;  5HBM A;  3TR8 A;  1X9S A;  3NGY A;  3VQ9 A;  4A5B A;  1WSI A;  4CZE A;  4IFE A;  4H8K A;  1Z6R A;  1RTI A;  3K5M A;  1SKW A;  3ID8 A;  4AHV A;  2Y1I A;  1KXP A;  3C6H A;  3ULD A;  4GMJ B;  2YNI A;  3J7A P;  2HF4 A;  4ILH A;  3G10 A;  1FXX A;  1GOB A;  3H3N O;  4JV5 K;  2VWJ A;  3KVG A;  4HTL A;  4PHT X;  4JRP A;  1TKX A;  4JI7 K;  4NLB A;  1MWK A;  3MXI A;  1BUP A;  3KKR A;  3D2F B;  5BPL A;  1S22 A;  3KK2 A;  1OH7 A;  3M3Z A;  2A5X A;  2Q3S A;  1I39 A;  5J2M A;  3QB0 A;  5AQX A;  3O80 A;  4CEE A;  4K8X A;  3CPE A;  2G8I A;  1R0A A;  3R9P A;  3P4I A;  4DV7 K;  2YCH A;  1BDG A;  2YJF A;  5HP1 A;  2P9N A;  3H46 O;  4B9V A;  2RF2 A;  2G8K A;  4CGG A;  1TV6 A;  5AQL A;  3ZT0 A;  2UU9 K;  3MEG A;  3OS1 A;  4DU1 A;  3VQQ A;  2ZE2 A;  4FJ5 A;  3KLE A;  4DQQ A;  1Q9Y A;  5C24 A;  1CZA N;  3EE9 A;  4YNQ A;  3QEX A;  2F9T A;  4Y1C A;  1GOC A;  1NGH A;  2DFF A;  4CZF A;  2HBK A;  1RT7 A;  1HNX K;  1W0H A;  1N8R O;  3ENB A;  1YT3 A;  1R59 O;  4Z4H A;  1TKD A;  3MN9 A;  3T7Z A;  4FJ8 A;  2P9I B;  1XMO K;  3IMX A;  2E6M A;  5M1Q A;  1Z05 A;  4DR6 K;  3D2F A;  4M3R A;  3EL2 A;  4OPA A;  4CFC A;  3DJC A;  2D0P A;  4DSI A;  2E88 A;  5H1S Q;  4OKK A;  2PY5 A;  3FZK A;  4I2Q A; 
#chains in the Genus database with same CATH homology
 4Z4I A;  5E41 A;  1ASU A;  3ZSW A;  3AO4 A;  1RBS A;  4KTW A;  4DTN A;  1RDA A;  4KPY A;  3G0Z A;  3NF9 A;  4E19 A;  3SCX A;  3DOK A;  1T8E A;  4DSF A;  3NFA A;  3PV8 A;  4HCB A;  3OYL A;  3V81 A;  4I2P A;  4I9L A;  2YNH A;  3OYI A;  4DQR A;  4BE1 A;  4ELV A;  3NBP A;  4BWM A;  1S1W A;  2Z1I A;  2OPP A;  4CJU A;  3K5L A;  3VQ8 A;  3OJU A;  4RG8 A;  1UA0 A;  4OGE A;  1NK4 A;  3PO4 A;  4FK4 A;  1RDB A;  4ZTF A;  1ZBF A;  4ZHR A;  2OPQ A;  1BL3 A;  2EX3 A;  3ZSY A;  3HVR A;  3PY8 A;  2F8S A;  4OJR A;  3RRH A;  4IG3 A;  4CEA A;  1DTT A;  2IDO A;  4IBN A;  3M8Q A;  1ZBL A;  3HP6 A;  5FRM A;  4OKE A;  2YNG A;  1VSD A;  1C1C A;  3NAE A;  4FLY A;  3BDP A;  4I9Q A;  2X6S A;  1NK9 A;  2HB5 A;  3LPT A;  4AH9 A;  4CJ4 A;  1TGO A;  4CHQ A;  2XY6 A;  1X9W A;  1IKY A;  1TVR A;  3OS2 A;  3OYE A;  3QO9 A;  4FM1 A;  3V9X A;  4B9L A;  3ZSX A;  3LP3 A;  3VN5 A;  3VQC A;  3B6O A;  5FRN A;  3AA3 A;  4CK1 A;  4DFM A;  3AVA A;  3CYM A;  4B9N A;  1FK9 A;  2XRI A;  3NGI A;  1U48 A;  3IAY A;  4M42 A;  2HHU A;  2IAJ A;  3WNH A;  4CED A;  3U3Y A;  4CER A;  1QQC A;  3AO2 A;  4DMN A;  4KHU A;  3HPH A;  4B8A B;  3CM5 A;  1I3A A;  3FFI A;  4CHY A;  3HM9 A;  1U4B A;  5C25 A;  4B9T A;  3SV3 A;  3AVK A;  1BQN A;  3LAK A;  2YHA A;  4IDK A;  3VQB A;  4E7K A;  1B92 A;  4RW8 A;  1LV5 A;  4B9S A;  4CK3 A;  2OA8 A;  3DRS A;  3KIO A;  4CK2 A;  4DTO A;  1VRT A;  3VQD A;  2D0A A;  4FW2 A;  4CJF A;  3SV4 A;  4LSN A;  1ASV A;  5SZT A;  3TAP A;  2P1J A;  1IG9 A;  3DLE A;  2QKB A;  2PYJ A;  1O1W A;  1LAW A;  1TL1 A;  1DTQ A;  4C8L A;  2X78 A;  3QEV A;  4BE0 A;  4XIU A;  3OS0 A;  1VSM A;  3CM6 A;  4CFD A;  4CEO A;  4DTX A;  3SPY A;  1NOY A;  4DQP A;  3QIP A;  4AHS A;  4L8R B;  3VA0 A;  4N41 A;  4OPK A;  3OYM A;  3RMC A;  1J5O A;  3C6U A;  3OYK A;  2KTQ A;  2P51 A;  1QSL A;  2OYQ A;  2IGI A;  3HO1 A;  3C6T A;  4QOZ B;  1L5U A;  3V9Z A;  3K2P A;  1MU2 A;  4JLH A;  4OVL A;  3ZT4 A;  2HVI A;  4CJ5 A;  3QEI A;  4EZ9 A;  4ID5 A;  1TAU A;  1KVA A;  3TAR A;  3NF7 A;  3SUN A;  3O4Q A;  4KO0 A;  4KRF A;  3HST B;  3QEW A;  3OYF A;  4F4K A;  1KCF A;  4O44 A;  4AHC A;  3DRP A;  5I3U A;  4IFV A;  1XWL A;  4FZY A;  2XY5 A;  3DLK A;  3KKS A;  1HJR A;  3S9H A;  1HQE A;  4O4G A;  4C8O A;  2IS3 A;  1UA1 A;  1LAV A;  2HHT A;  1Y97 A;  3LAL A;  5DMR A;  3L2W A;  3O3H A;  3PX6 A;  4FJL A;  4N56 A;  3M8P A;  4NYN A;  1XHX A;  4DTU A;  4KHS A;  4Z4F A;  1J53 A;  4E0D A;  3QNO A;  1WAF A;  2B6A A;  4RW4 A;  1LWE A;  3TAB A;  3QIN A;  4KHY A;  1ZBI A;  3KLG A;  2HHS A;  3KJV A;  3T19 A;  1JL1 A;  1RT3 A;  4CIG A;  4FM0 A;  3WNE A;  4DTR A;  2HNZ A;  1BCM A;  1S6P A;  1TAQ A;  1YVU A;  4UQG A;  4BAC A;  2FBT A;  4LH5 A;  1Q8I A;  3HVT A;  3HPO A;  3V4I A;  3AA5 X;  1JLA A;  3T1A A;  3ZSO A;  1JKH A;  1RT1 A;  2RN2 A;  4BE2 A;  4O0I A;  3P83 D;  1LWF A;  3CQ8 A;  4M41 A;  4OPJ A;  2GV9 A;  2QKK A;  1KVB A;  3BGR A;  4KFB A;  3AA4 A;  4OGC A;  4DS4 A;  4Y1D A;  4OLA A;  1QTM A;  3AVN A;  1XHZ A;  3DLB A;  2WON A;  4FCY A;  3HYF A;  2JGU A;  1NK0 A;  4HHT A;  3L2V A;  2NUB A;  4CEZ A;  2FBX A;  2O4G A;  3RMA A;  1TL3 A;  1KRP A;  1S9E A;  2HHW A;  3A2F A;  4ELU A;  1WNS A;  4CJL A;  3F73 A;  5HRO A;  1BI4 A;  2ATQ A;  3AVC A;  4EP4 A;  3ZSQ A;  1QSS A;  4DS5 A;  4J2B A;  5JS2 A;  1EP4 A;  2YHB A;  4KHW A;  1YTU A;  4FYD A;  4M45 A;  4KAZ A;  4CJ3 A;  1T05 A;  4F2S A;  5CYM A;  1RTH A;  3OJS A;  3IG1 A;  3OY9 A;  3OVN A;  4CES A;  3DM2 A;  4FZX C;  3C94 A;  2I5J A;  5I42 A;  1ZBU A;  1XC9 A;  1SL2 A;  1IKX A;  1QS4 A;  1VSI A;  1BIU A;  1WLJ A;  3NF8 A;  4O5B A;  3SYZ A;  4E7J A;  1L3U A;  3SUP A;  3SI6 A;  1D8Y A;  2F8T A;  2KZZ A;  5K14 A;  4AHU A;  4FLW A;  3QLH A;  3L3V A;  3VQE A;  3K57 A;  1CZB A;  3M8S A;  4DF8 A;  3SJJ A;  1JLE A;  5KGX A;  3VQ6 A;  1VSK A;  3VQ7 A;  4FJI A;  1JXE A;  1S5J A;  4F3T A;  4GW6 A;  3S3N A;  3HJF A;  4FLT A;  4DFK A;  4KKO A;  3QER A;  1EKE A;  4W5R A;  2P5G A;  4DSJ A;  4M3Z A;  4CEB A;  1SKS A;  4Z4E A;  4CF9 A;  1NKC A;  3L2Q A;  1RT2 A;  1CXQ A;  1J9A A;  3MED A;  1VSJ A;  2VWK A;  4CJV A;  2OZM A;  4PQU A;  3V1Q A;  1ASW A;  2Z1G A;  4W5Q A;  3SUO A;  4DF4 A;  4O55 A;  3IS9 A;  4GVM A;  1T7P A;  3ASM A;  2YKM A;  4ICL A;  3LP2 A;  3NDK A;  4FJK A;  4DG1 A;  1C0U A;  5KI6 A;  1S1U A;  1HYV A;  2DY4 A;  3S3O A;  1SV5 A;  1WSH A;  1JLC A;  4Q5V A;  4H4M A;  1REV A;  1RIL A;  2VG5 A;  3LDS A;  2DFE A;  3OYC A;  1G15 A;  1TKZ A;  5FRO A;  4CF8 A;  1F21 A;  1SUQ A;  3C95 A;  3LP1 A;  3SQ0 A;  4IKF A;  4BDP A;  3EY1 A;  3I0R A;  3TAN A;  3SUQ A;  2E4L A;  1Z25 A;  3DYA A;  3DLR A;  3EZ5 A;  1WSF A;  4HTU A;  4DU4 A;  3ZSR A;  1NJW A;  2B5J A;  4DU3 A;  5HRP A;  1HYS A;  4FK2 A;  4CHO A;  2FBY A;  4CEQ A;  1VK0 A;  4DQS A;  3OYA A;  4LSL A;  4CIE A;  3LAM A;  2B4J A;  1LWC A;  2JLE A;  2Z1H A;  1RBT A;  1A5V A;  2D5R A;  4B08 A;  4MFB A;  4CFB A;  4W5O A;  4FJH A;  3L3U A;  4M3W A;  5HRS A;  4Z4C A;  3RMD A;  4Q0B A;  4KB1 A;  1D9D A;  3NE6 A;  2XHB A;  2A1R A;  1WSG A;  2KFN A;  1D9F A;  4E89 A;  4E7L A;  3DOL A;  3CFR A;  4E7H A;  4RW9 A;  2OPS A;  4IFY A;  1JLB A;  1HNI A;  1U47 A;  2DTU A;  3THV A;  3RWU A;  2R7Y A;  2W42 A;  3MXM A;  3UIQ A;  1RBU A;  4CJT A;  1HPZ A;  1JXB A;  3NH0 A;  4E1M A;  3RR8 A;  1UOC A;  4JRQ A;  4B9M A;  1SKR A;  4CJK A;  4AIL C;  3TAE A;  3I0S A;  3QET A;  1BCO A;  3HXM A;  3QIO A;  3TWH A;  4F8R A;  1RNH A;  4CJS A;  2YNF A;  3L2R A;  1J54 A;  3RRG A;  3OYD A;  4AHR A;  4CHN A;  1RTJ A;  1HRH A;  3D0P A;  4Z4G A;  5CZ1 A;  3V9U A;  3HP9 A;  4CIF A;  1NK7 A;  4E3S A;  5HLF A;  1TK5 A;  3PUF A;  1TK0 A;  2PZS A;  3LWL A;  3LZI A;  1L3T A;  1SL0 A;  4HUG A;  1VSH A;  3WNF A;  5J2Q A;  2Y1J A;  1HMV A;  1Q9X A;  3ZT2 A;  4CGJ A;  1C0T A;  3AO1 A;  4CF1 A;  3PX0 A;  1KLM A;  5CY4 A;  3HL8 A;  3SQ1 A;  4DWI A;  4KI6 A;  1JLQ A;  4FK0 A;  1CZ9 A;  2D0C A;  3OYH A;  3H08 A;  4HUE A;  4FLV A;  3T3F A;  2QK9 A;  5HRN A;  2HND A;  1NJX A;  2HHX A;  2A1S A;  3K5N A;  4RW6 A;  2FBV A;  3ZSZ A;  2YV0 X;  5T7B A;  4DQI A;  4CF2 A;  1EET A;  4KB0 A;  4FJ7 A;  4PA1 A;  3OYJ A;  4TSX A;  5FDL A;  2BE2 A;  4KTQ A;  1HQU A;  1VSF A;  1RBV A;  1WN7 A;  4KRE A;  2ZQB A;  2D0B A;  4I7F A;  5HRR A;  1YTA A;  4CHZ A;  3KTQ A;  2G8H A;  1JLF A;  3ZT1 A;  2KZM A;  1VRU A;  1S1V A;  4CHP A;  2RKI A;  4C8M A;  1QSY A;  5KTQ A;  3E01 A;  4FXD A;  2G8W A;  4ID1 A;  4F2R A;  3MAQ A;  4PUO A;  2YKN A;  4J2A A;  1B9F A;  3AO5 A;  4FJ9 A;  1SL1 A;  1TKT A;  3AO3 A;  3P5J A;  4N5S A;  4BDY A;  1NKB A;  2VG6 A;  4QCL A;  3JSM A;  4LY7 A;  4B9U A;  4ELT A;  3VQP A;  4CGI A;  3JYT A;  1Z26 A;  1S1T A;  2VG7 A;  4PWD A;  4KTZ A;  3AA2 A;  3U3G A;  3HT3 A;  3TI0 A;  4N76 A;  1ZYQ A;  1C1A A;  1D5A A;  3O4N A;  3KLI A;  4DTJ A;  3TAQ A;  1N5Y A;  4FJJ A;  1ZBH A;  1QE1 A;  1S1X A;  4NCA A;  1JL2 A;  4FZZ A;  2IOC A;  4CJQ A;  1X1P A;  2IC3 A;  4JS4 A;  1NOZ A;  4FLZ A;  3VA3 A;  2GUI A;  4M3T A;  4M3Y A;  2O4I A;  4HUF A;  4FVM A;  3QES A;  2X74 A;  4NCG A;  3B6P A;  5J2N A;  4RW7 A;  3HPG A;  2ZD1 A;  4MQ3 A;  5CYQ A;  3DI6 A;  3AVG A;  3DMJ A;  4FLX A;  3TAG A;  1RDC A;  3PO5 A;  2KFZ A;  5J1E A;  4CJR A;  4E7I A;  1A5W A;  4DTP A;  2RPI A;  4KHQ A;  4FJX A;  2P5O A;  4AHT A;  3O3G A;  1HNV A;  1UAX A;  3MEE A;  3I8D A;  3SPZ A;  4HCC A;  5EU7 A;  1FKP A;  3VQA A;  1NJZ A;  3V9S A;  4FJM A;  3NGZ A;  4DLE A;  1C1B A;  4CJE A;  3RTV A;  1HYZ A;  4DSE A;  4LD0 A;  1L3S A;  3SQ4 A;  2F96 A;  3CFO A;  4N47 A;  2BDP A;  3KD5 E;  1CXU A;  1UWB A;  3LAN A;  3NH2 A;  3OYG A;  2HW3 A;  2G8U A;  1RT5 A;  2XY8 A;  3AVH A;  2HHQ A;  1DLO A;  1IO2 A;  1W9H A;  1C6V A;  3AVB A;  4KV8 A;  3ZSV A;  4FJN A;  3RMB A;  2X6N A;  2Z1J A;  1LW0 A;  1RBR A;  3ISN C;  4CEC A;  5KRS A;  4DTS A;  3V6D A;  5SWM A;  1KSP A;  1QHT A;  3DLH A;  5HBM A;  3TR8 A;  2WOM A;  3NGY A;  1X9S A;  3MEC A;  1VSL A;  3AVL A;  3VQ9 A;  4QAG A;  3O3F A;  3K58 A;  3LZJ A;  2XY7 A;  4CCH A;  1WSI A;  2DFH A;  2OZS A;  4OKJ A;  4H8K A;  4ZTJ A;  1RTI A;  2G8F A;  3NF6 A;  4CE9 A;  3K5M A;  1SKW A;  4DSK A;  1KFD A;  1X9M A;  2G8V A;  4LH4 A;  4AHV A;  4BDZ A;  3QNN A;  2Y1I A;  3KK1 A;  3KD1 E;  3ULD A;  4HVJ A;  4YFU A;  1L3V A;  4GMJ B;  2YNI A;  4F3O A;  3LPU A;  3G10 A;  4C8K A;  1FXX A;  1GOB A;  2HVH A;  1BHL A;  1S9G A;  2FC0 A;  4O0J A;  4CJW A;  3OYN A;  4DFP A;  4CEF A;  2VWJ A;  3S3M A;  2PYL A;  5KGW A;  4JRP A;  1TKX A;  4CJP A;  4NCB A;  1EXQ A;  1A5X A;  4IG0 A;  3MXI A;  3SQ2 A;  1FKO A;  3KKR A;  2XO7 A;  4J2D A;  2HHV A;  1WAJ A;  3KK2 A;  3AVF A;  4CGD A;  1U45 A;  2Q3S A;  1I39 A;  4FW1 A;  4C8N A;  1BIZ A;  3KLH A;  5J2M A;  2ETJ A;  4JS5 A;  4CEE A;  4K8X A;  3ITH A;  2BGG A;  3CG7 A;  1U49 A;  1RT4 A;  2OPR A;  3P1G A;  4B3O A;  5CZ2 A;  3L2U A;  1RTD A;  2G8I A;  1BQM A;  1K6Y A;  4DFJ A;  1R0A A;  3RR7 A;  1C0M A;  1RCH A;  3M8R A;  2HNY A;  3D45 A;  4K8Z A;  4G1Q A;  5C42 A;  1BGX T;  2BAN A;  3L8B A;  3DRR A;  3NHG A;  1NKE A;  3EYZ A;  4PY5 A;  4FJG A;  4DSL A;  3VQ5 A;  4WE1 A;  3KK3 A;  3V9W A;  1KFS A;  4CGF A;  3IRX A;  4Z0U A;  3AVM A;  1TK8 A;  4EZ6 A;  3AV9 A;  3ZT3 A;  4W5T A;  2GBZ A;  5HP1 A;  1XI1 A;  5D3G A;  1NK6 A;  1N6Q A;  4M3U A;  4B9V A;  2AJQ A;  1CLQ A;  1WSE A;  2RF2 A;  1IKW A;  3U6F A;  2G8K A;  4CGG A;  1TV6 A;  3TAM A;  1LW2 A;  3ZT0 A;  3MEG A;  1KLN A;  1B9D A;  1IKV A;  1U04 A;  4R5P A;  3OS1 A;  4DU1 A;  1KVC A;  2ZE2 A;  3VQQ A;  4FJ5 A;  3KLE A;  4W5N A;  4DQQ A;  1Q9Y A;  5C24 A;  4YNQ A;  3QEX A;  3SNN A;  3WNG A;  1RDD A;  3DLG A;  2EHG A;  3AVJ A;  4Y1C A;  1GOC A;  2DFF A;  4DLG A;  2HMI A;  3NCI A;  3CFP A;  3TAF A;  3F9K A;  1NK8 A;  2E6L A;  4EP5 A;  5KRT A;  3OYB A;  4M3X A;  3K59 A;  3LWM A;  1RT7 A;  1WSJ A;  2KQ2 A;  3KLF A;  1W0H A;  3AVI A;  1KTQ A;  1ITG A;  5J2P A;  3ALY A;  2QXF A;  3QEP A;  1GOA A;  1YT3 A;  4Z4H A;  1TKD A;  4FJ8 A;  1BIS A;  4BWJ A;  4CGH A;  1RT6 A;  1NK5 A;  4E1N A;  4NYF A;  1T03 A;  3LP0 A;  2E6M A;  4FLU A;  1S6Q A;  4B8C A;  4DTM A;  1EX4 A;  1IH7 A;  2ITG A;  3SZ2 A;  3PX4 A;  2LSN A;  1BI4 B;  3NH1 A;  4CFA A;  3HK2 A;  4M3R A;  3ZCM A;  1VSE A;  3V1R A;  3V1O A;  4CFC A;  4FM2 A;  4H4O A;  4OLB A;  4J2E A;  4DSI A;  3K5O A;  4OKK A;  3MXJ A;  4KHN A;  2PY5 A;  1NJY A;  5DK5 A;  5JS1 A;  4CF0 A;  3VQ4 A;  1JLG A;  2KW4 A;  4I2Q A;  4KI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...