4CESA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cesA00
1UAXA 3OYFA 1NKBA 1RTDA 3B6PA 1TV6A 4H8KA 5HRPA 1QS4A 3IS9A 3ZT4A 1YTUA 4CF1A 4CEDA 3H08A 1TKDA 2XO7A 4M3XA 1EKEA 1BI4B 4DLGA 4W5RA 2HHQA 3VQDA 3OS1A 3D0PA 3KK1A 1C0UA 4CFAA 2D5RA 3OS0A 5J2QA 1BI4A 3KLGA 3BGRA 2KZMA 4E19A 4FJKA 1VSDA 3ISNC 2F8TA 1WSFA 4AH9A 1WSJA 2YNHA 4KKOA 1WLJA 4NYFA 4N47A 4CFBA 4EZ9A 1NJYA 4C8KA 4O44A 2HVIA 1BQNA 2YNFA 1SV5A 1F21A 2G8FA 4CGFA 1VRUA 3T1AA 4B08A 1KVAA 3NF9A 5HLFA 3HL8A 4CJ4A 4HHTA 1S1WA 1IO2A 1A5WA 2DFFA 4IBNA 3VQ6A 2O4GA 4EP4A 3ZSVA 4DSIA 3LP1A 1R0AA 4DTPA 2VG6A 4CJUA 4NCAA 1S6PA 1RT5A 4FLZA 4FVMA 3P83D 3AVGA 5HRRA 4OJRA 3AO1A 4CESA 3NGZA 3OYGA 4HUFA 1SL2A 4FK4A 3QIPA 4M45A 1NOZA 3KKSA 3KK3A 3I0RA 4JRPA 4E7HA 3HPHA 2E6LA 2BANA 4QAGA 3O3HA 4DQIA 3LP3A 4CEOA 5HRNA 3SUPA 1SKSA 1XHZA 2RPIA 4CGDA 3SUNA 4NCGA 5JS1A 1QHTA 1XI1A 3RMBA 4O5BA 2OPRA 4FJGA 4J2DA 4KRFA 3VQ4A 3HP9A 2ZQBA 2F96A 4F4KA 3NCIA 1ASUA 5HP1A 5CYMA 3BDPA 3QINA 3SCXA 5KRSA 1NK5A 3LP2A 4CJRA 2DY4A 4OGCA 4O55A 1C6VA 4CF2A 5DK5A 4M42A 2QXFA 5KI6A 2IC3A 4AHVA 3NH0A 1IG9A 1KVCA 1CZ9A 3L2WA 1REVA 1VSHA 1BIZA 4Q5VA 1NK4A 4K8ZA 4DLEA 3DOLA 4CJTA 4RG8A 4ID1A 4F2SA 1U47A 2LSNA 1XWLA 4JLHA 4RW6A 3CYMA 3P5JA 3G0ZA 3OS2A 4CJKA 3TAQA 1X9MA 4C8LA 1KRPA 3SQ4A 2IS3A 3OVNA 4OPKA 4HCBA 1FKPA 1JXBA 4AHTA 4PQUA 2W42A 2FBYA 3DOKA 4CHNA 1WSEA 1BCOA 3AVMA 4HVJA 1VK0A 3CG7A 4FZYA 1HQEA 4CK3A 4DSEA 4CE9A 4FJ8A 1GOCA 4B9TA 2YHBA 4CJSA 2PYJA 3RMDA 3QEVA 2Q3SA 2YKMA 3JYTA 1TVRA 3SZ2A 4DTNA 1JLEA 3DI6A 3OYDA 2BGGA 4BWJA 1RT6A 3JSMA 2YNGA 3M8QA 2WOMA 1S1VA 3P1GA 1S1TA 1KCFA 1W0HA 4FLTA 1C1CA 4DFPA 1CXQA 4IDKA 3T19A 3VN5A 4JRQA 3MEGA 3NAEA 1MU2A 3O3GA 2P5OA 4YNQA 1D9FA 1VSFA 1HPZA 3SPZA 1D9DA 4B9LA 4DSJA 3SUQA 1SUQA 3AA4A 3E01A 4CEBA 4AHCA 3ZSXA 4OLAA 1RTHA 2HHWA 4E7KA 3QNOA 4QOZB 1X9WA 1VRTA 4DQQA 2KFZA 5SWMA 1LWEA 3CM5A 3DMJA 3HSTB 3SV4A 1J9AA 1ZYQA 2JGUA 4KO0A 4DTSA 3OY9A 1HMVA 1LWFA 3KTQA 4Q0BA 1Z26A 1EETA 1O1WA 3K5OA 4LSLA 1JL1A 5E41A 4CIGA 1C1AA 4AHUA 3QIOA 3EY1A 3S3MA 2D0AA 1YVUA 3VQ5A 1G15A 1BCMA 1VSIA 4KAZA 1LV5A 3VQ9A 4EP5A 3V9SA 3MXIA 3KKRA 1KFDA 1RBSA 1Q8IA 2VWKA 4LD0A 3I8DA 4CEAA 3OYNA 4I2PA 3MAQA 2XY6A 1TKXA 3VQPA 4EZ6A 4DTXA 1IKWA 4CGJA 1NJZA 1NKCA 4F3TA 4J2BA 1NOYA 4KHQA 3K5MA 3C6UA 3PO5A 2VG7A 3NDKA 3RMAA 1UA0A 1TL1A 4RW7A 5KGWA 4ZTFA 2HHVA 1C0MA 3OYIA 4CCHA 2QKBA 4CEZA 3K59A 3PY8A 4KPYA 3QLHA 1RILA 3PX6A 4GVMA 4CHQA 4ZTJA 5FRNA 3U3YA 1WSHA 5CZ2A 4N56A 1NK0A 4C8MA 4RW9A 3UIQA 1JL2A 4K8XA 3TAEA 1S1UA 4N5SA 3AVFA 4CK1A 4DTUA 1IH7A 3DRPA 4CFDA 4E3SA 3D45A 4DFKA 2G8VA 2QKKA 4IKFA 4KHSA 4AILC 1SL1A 2OZSA 2XY7A 3AA2A 3ZCMA 4AHSA 3V9UA 1YT3A 1BGXT 1J54A 3VQQA 1XC9A 3AVIA 1RBUA 3HPGA 2ETJA 3AVHA 2VWJA 1QQCA 3NF8A 5D3GA 3DM2A 4KHWA 3NBPA 1HYVA 3DLGA 1BL3A 3I0SA 4DQRA 1HNIA 2Z1JA 2GUIA 3MXMA 3ZSQA 2D0BA 3ULDA 2HNZA 2R7YA 4HTUA 1TKZA 2ATQA 3KLIA 5KGXA 4CJLA 3HVRA 4BDYA 1ZBLA 1QSLA 3NHGA 3V6DA 3THVA 1S9GA 3V9ZA 3HM9A 4R5PA 2OYQA 3AVNA 2GV9A 2DFEA 3IRXA 4CIEA 3HT3A 4I9QA 3WNHA 3LANA 3ZT0A 3RRHA 3TAGA 4FJJA 4C8OA 3RMCA 3PX4A 3OYJA 1WSGA 4OVLA 1A5VA 3TABA 1NJXA 1WNSA 4G1QA 2HNYA 4DS4A 2IGIA 4FJIA 5KTQA 3TANA 3VQCA 4LH4A 4CJ3A 2X6SA 3AVAA 1LWCA 3DLRA 1JLQA 3V1RA 3ASMA 3RTVA 3AV9A 4MFBA 2OPSA 1BQMA 1KSPA 2G8UA 2EHGA 1JLAA 4IFYA 3NGIA 4FLWA 1NKEA 3KLEA 1EX4A 3DRRA 4M3TA 2HHTA 2VG5A 3DLKA 4KFBA 4B8AB 2A1SA 1HNVA 3OJUA 1RT7A 5DMRA 4PA1A 4XIUA 1KLNA 4FYDA 1C0TA 4KHNA 4B9VA 4Z4EA 3B6OA 1L3UA 2KQ2A 4DF4A 1UOCA 1RBRA 2IAJA 4I9LA 3KK2A 5K14A 1X1PA 3LPUA 3MXJA 1QSSA 2HHXA 4HCCA 1VSKA 4FM2A 5SZTA 3AVJA 3MEEA 4E0DA 1RNHA 3HK2A 3NE6A 4DQSA 4LSNA 2FBTA 4E7IA 4OKKA 3IG1A 1X9SA 4M3WA 3ZSRA 4W5NA 1JLBA 4W5OA 3HO1A 1Z25A 3V81A 1NK6A 4KB0A 1S1XA 3SNNA 3S3NA 4M41A 4N41A 4GW6A 5T7BA 4FJ5A 3NFAA 1A5XA 2HNDA 1IKYA 2OPQA 3K57A 1XHXA 2B6AA 4LY7A 4CJ5A 3NH2A 1IKVA 1D5AA 5FRMA 2RF2A 2XY8A 3AVBA 4CJPA 3OYAA 2FBXA 4IG0A 3G10A 1NK7A 2WONA 1I3AA 1SL0A 2RN2A 2PZSA 4PWDA 3LPTA 4BE2A 4CJQA 3ALYA 1TL3A 3V9XA 1EP4A 5J2MA 1N5YA 3SQ0A 4H4MA 3QETA 5HBMA 1T05A 2PY5A 1S9EA 2XRIA 1CXUA 3O3FA 4FK0A 4DS5A 3FFIA 3QEIA 5HROA 4YFUA 3CFPA 4FJNA 1U48A 3LAMA 3SQ1A 5C24A 4I7FA 3L2QA 1ASVA 3V1QA 4CHZA 4FZZA 3C94A 4B8CA 4PUOA 4FJMA 4FZXC 1Q9XA 3AO2A 1LAWA 4KI4A 2OZMA 1RT3A 1QE1A 2X74A 4W5QA 4IG3A 3SV3A 2DTUA 1VSEA 3HJFA 1B9DA 2KTQA 5J1EA 4F3OA 2AJQA 4CEFA 3V4IA 3ZSYA 3K5LA 1U49A 1CZBA 3AA3A 2BE2A 4I2QA 3WNFA 4FW1A 4CERA 4E7LA 1TAQA 1NJWA 1N6QA 2PYLA 1TAUA 2E4LA 5JS2A 1TK0A 3QNNA 1U4BA 4KI6A 1CLQA 3CQ8A 3QEPA 3OJSA 1Q9YA 3CFOA 4KHYA 2BDPA 3LDSA 1ITGA 1JKHA 1HYZA 4AHRA 3PUFA 2HB5A 4DG1A 3L3UA 4MQ3A 4CEQA 1NK8A 3S3OA 1FKOA 1HQUA 1BIUA 4M3UA 4CEEA 2JLEA 4H4OA 1LAVA 1RCHA 4CJEA 3QO9A 1C1BA 1RTIA 4CF8A 2XHBA 3SJJA 1T03A 4DSLA 4FJLA 4NCBA 3SPYA 4FLUA 3CM6A 4DFMA 4M3YA 1WAJA 3AO4A 1LW2A 3ZT3A 4O4GA 4KHUA 1L3TA 1Y97A 4CIFA 3OYLA 3T3FA 2GBZA 4F2RA 3KLHA 4M3ZA 1TK5A 3NF6A 1SKRA 4CF9A 5CYQA 1NK9A 4DSKA 4J2AA 3LAKA 2OPPA 3M8PA 3VQAA 2HHSA 2Y1JA 3ZT2A 3A2FA 1L5UA 4DQPA 2IOCA 3HYFA 3NGYA 5HRSA 4DTOA 1T8EA 4J2EA 3NF7A 4TSXA 2OA8A 3C95A 3L3VA 3LZIA 4BDPA 3KIOA 3O4NA 3RR8A 3SQ2A 4F8RA 2Z1HA 1WAFA 1BHLA 4CFCA 4E89A 4BE0A 3ZSWA 1TGOA 4DTJA 1GOAA 1K6YA 3VQ8A 3SI6A 1RDDA 1UA1A 4FM1A 1L3VA 2NUBA 2HVHA 1RDCA 4KB1A 4B9MA 4B3OA 3L2RA 4CGHA 1W9HA 3L2VA 4M3RA 2G8IA 2KZZA 4ELVA 3HXMA 3L2UA 4O0IA 3CFRA 1RT2A 1GOBA 1VSMA 3VQEA 2P1JA 3NH1A 5J2PA 3TAFA 3OYKA 4CHOA 4FJXA 4KTZA 1VSJA 4NYNA 4BDZA 3HVTA 3U6FA 4B9NA 2YNIA 4JS4A 3SUOA 4FXDA 1ZBIA 1DTTA 3HPOA 1KVBA 2E6MA 2X78A 3VQ7A 4KTQA 4WE1A 4DSFA 4N76A 4DU4A 1RBVA 3TAPA 3RRGA 4BE1A 4UQGA 5C42A 2G8HA 2Y1IA 3LWMA 4KV8A 4CF0A 1B9FA 4FLYA 3VQBA 4Y1DA 2FBVA 3MECA 4Z4CA 4E7JA 4CGIA 3DLEA 4DTMA 1B92A 4QCLA 3ZSOA 4OLBA 1LW0A 4KREA 4FJHA 1QTMA 2ITGA 4PY5A 2EX3A 3ITHA 4RW4A 4BWMA 4CECA 4ZHRA 1T7PA 1EXQA 3M8SA 3EZ5A 4Z4FA 4RW8A 5EU7A 2A1RA 4ID5A 1U45A 4DWIA 2FC0A 3OYMA 4Z4GA 3KD5E 4FW2A 4FM0A 3SYZA 4JS5A 3RWUA 3KJVA 1RDBA 3KLFA 4FLVA 3DRSA 2G8WA 2HHUA 3LP0A 3OYBA 4KTWA 4CGGA 1IKXA 1YTAA 3C6TA 1JLFA 4O0JA 4DFJA 2F8SA 3RR7A 1J53A 1RBTA 3K2PA 5FDLA 1S6QA 2YKNA 1I39A 1UWBA 5CY4A 3M8RA 3F73A 3LZJA 3U3GA 4FCYA 2YHAA 2Z1IA 3DLHA 4L8RB 2KFNA 3KD1E 4Y1CA 3WNGA 1ZBHA 3L8BA 3VA3A 1WN7A 4Z0UA 5CZ1A 3AVLA 4CHPA 4DU1A 2Z1GA 2G8KA 3S9HA 5FROA 2HMIA 5J2NA 3K5NA 5C25A 4BACA 1U04A 1J5OA 2XY5A 3MEDA 4Z4IA 1L3SA 4FJ7A 3AO5A 3VA0A 4ICLA 4LH5A 5I3UA 1KFSA 4FJ9A 4E1NA 1TKTA 4E1MA 3OYEA 3O4QA 3QESA 2DFHA 4ELUA 3AA5X 1KTQA 3AVKA 4B9UA 4DF8A 4DU3A 3TI0A 3DLBA 3V9WA 1WSIA 1RT1A 3K58A 1VSLA 1KLMA 3V1OA 4Z4HA 1FXXA 4B9SA 1SKWA 2B4JA 2IDOA 3TWHA 2O4IA 3F9KA 3PV8A 4CK2A 2ZD1A 1ZBUA 4OKEA 2YV0X 1JXEA 2QK9A 3OYHA 3AVCA 3EYZA 4DMNA 1DLOA 3ZSZA 1RDAA 2P51A 3LALA 4FLXA 1RTJA 3TAMA 4CJVA 3QEWA 1HYSA 4ELTA 2ZE2A 3ZT1A 3LWLA 3TR8A 2KW4A 3PX0A 3TARA 1RT4A 1S5JA 4DTRA 3HP6A 4HUEA 5KRTA 4CJWA 3QERA 3AO3A 1ASWA 2HW3A 1ZBFA 4GMJB 4IFVA 2D0CA 3DYAA 1HJRA 4OKJA 1QSYA 4HUGA 1HRHA 4OGEA 2I5JA 3WNEA 1TK8A 1DTQA 3PO4A 4W5TA 1JLGA 4C8NA 3OYCA 2B5JA 2P5GA 1JLCA 2X6NA 4CJFA 4OPJA 5I42A 4FK2A 3QEXA 4CHYA 1D8YA 1BISA 2RKIA 3IAYA 1FK9A
chains in the Genus database with same CATH superfamily
3J7YP 3OYFA 1RTDA 3M6GA 1QS4A 1TKDA 3TU5A 4ILJA 3VQDA 3OS1A 5EOYA 4BRGA 3KK1A 1C0UA 5J2QA 5C2DA 3BGRA 2KZMA 3LDPA 2F8TA 4CBUA 4AH9A 4DHYA 2HHHK 4NYFA 3D6RA 2V7ZA 4O44A 5GAEP 5AQUA 3SMSA 2FSNA 4FWSA 4GV9A 4CGFA 3T1AA 4FWRA 5HLFA 4CJ4A 4HHTA 1A5WA 2O4GA 2QWMA 2W6LA 1GLBG 1YAGA 1R0AA 4DTPA 2VG6A 4GVEA 4CJUA 3LL3A 5ELZA 1RT5A 3O4WA 3I55N 3MWTA 3NGZA 1SL2A 5M1QA 3KK3A 2E6LA 4QAGA 1IBLK 3QICA 4CEOA 1XHZA 5M1KA 3ZEUB 4IO9L 4O5BA 4FJGA 4J2DA 4KRFA 3VQ4A 5E26A 2F96A 3NMUA 5KRSA 4O5FA 3A8YA 4LFBK 1U2VB 1C6VA 5DK5A 3M5RA 3O1WA 5KI6A 3L4IA 1W7AA 1KVCA 1REVA 4Q5VA 1BIZA 4A2AA 4RG8A 4YOYA 1U47A 5F2RA 1XWLA 3THYA 5JMVA 2OCEA 1KRPA 4F9OA 2IS3A 4OPKA 4U67L 2P9PB 3O9QA 4CHNA 1BDGA 5AQVA 3D2FA 1XC3A 2D1KA 4FZYA 4CK3A 3EEQA 3QEVA 3SMPA 3JYTA 4DTNA 1JLEA 3DI6A 5AQPA 4YY3K 3MN7A 3JSMA 1OH8A 2WOMA 2QWLA 2UXBK 1C1CA 3HOSA 3VN5A 4IDKA 3T19A 4C1NK 2UUCK 4JRQA 3NAEA 3ZX2A 5C10A 4GKJK 3F2KA 4B9LA 1SUQA 4CEBA 1NLVA 2P9LA 5BPMA 2KFZA 3CM5A 2YHXA 1J9AA 1SQKA 1EQYA 4JI7K 1OKJA 3GG4A 3K5OA 1JL1A 1K8KB 1C1AA 4AHUA 2P9NB 3VMFB 2QW9A 1G15A 1VSIA 3MXIA 1Q8IA 2O8CA 4LD0A 2CH5A 1OH6A 4BY9C 1VQLN 3A0IX 4NXMK 3O80A 1KC8O 3CPEA 1CZAN 5ADXH 2HBJA 1IKWA 4KHQA 5AZIA 4CEZA 3K59A 1RILA 3PX6A 4GVMA 5FRNA 5CZ2A 1JL2A 3AVFA 4CK1A 1QQNA 1IH7A 3DRPA 4KH5A 3IKMA 1SL1A 2OZSA 4DR3K 2XY7A 4LF4K 5CHIA 4IZ9A 4WQ5C 2NRXA 1J54A 3VTIA 4NO7A 3HPGA 4C1NI 3AVHA 4CZIA 5D3GA 1QZ5A 1BA0A 3I0SA 1HNIA 1QHAA 5BR9A 2HNZA 4HTUA 3CJBA 2D4WA 1NMDA 1QSLA 4H5NA 3V6DA 3V9ZA 3SJHA 3HT3A 2GV9A 3VF4A 5GINA 2YJFA 3ZT0A 3TAGA 1VQNN 3RMCA 3PX4A 1WSGA 3AARA 4DUZK 3WXJA 2HNYA 4DS4A 4QS8A 2PAVA 5KTQA 3VQCA 4CJ3A 1T3VA 5C0YA 3NGIA 1NKEA 2HHTA 2VG5A 4FOIA 3DLKA 1Y64A 3OJUA 4UY8O 5DMRA 4PA1A 4BGAA 3OTOK 4FYDA 1C0TA 3I33A 3B6OA 1L3UA 2KQ2A 1RBRA 3P4IA 3UKUB 5K14A 3H46O 1OH5A 2P9IA 1IJJA 4BR9A 1TYQB 1S22A 4HCCA 4FM2A 5SZTA 3AVJA 4HTLA 4H0YB 3EE8A 1X9SA 3IG1A 4M3WA 3ZSRA 1JLBA 4W5OA 3HO1A 1Z25A 4DV3K 3G25A 3V81A 4B1WB 4JHDA 5BR8K 3NFAA 1A5XA 3K57A 4K42A 1E3MA 1IKVA 2XY8A 3T7ZA 4CJPA 4IG0A 1I3AA 4CJQA 3V9XA 4DV7K 4BRIA 1XUPO 2V7YA 5HBMA 4FPBA 1V4SA 3CFPA 3SQ1A 2CGLA 3L2QA 1ASVA 3KVGA 4FZXC 1Q9XA 1ATRA 1LAWA 3AO2A 2OZMA 1RDWX 5AQNA 2X74A 4JN4A 1SAZA 5MLCQ 3HJFA 3KK7A 4CEFA 2D0PA 1CZBA 4CERA 4X62K 3H3OB 2PYLA 1TAUA 2GWKA 1TK0A 1U4BA 3QEPA 3CFOA 3CJ1A 2ZJPL 2GWJA 2HB5A 4DG1A 3L3UA 4CEQA 2NZTA 3S3OA 4BQZA 1IBMK 1QZ6A 3VF6A 4LF6K 4DCHA 3C0BA 4WCEL 1LAVA 4JI5K 1RCHA 3QO9A 5AQYA 3HI0A 4DSLA 3VENA 1LOTB 1H1VA 4DFMA 4M3YA 3AO4A 1V4TA 2UUAK 4X66K 4AM6A 4H0XB 1OVQA 3NF6A 1VQ9N 4DSKA 1NK9A 1NGCA 5AQFA 3L4QA 3A2FA 3HYFA 3NGYA 1N36K 1YF5L 3O4NA 4F8RA 4WFBL 2Z1HA 1WAFA 1BHLA 4IJAA 1KQSM 3OBWA 4B9QA 3SI6A 1RDDA 1UA1A 2E2NA 1MWMA 2NUBA 4B9MA 3L2RA 5BN8A 4M3RA 1VSMA 3H3NO 2E2PA 3TAFA 4NYNA 1YUWA 3VETA 3K9KA 1ZC6A 1T6CA 2HBMA 4A57A 4N76A 3SBTA 4BE1A 2BTFA 2Y1IA 3LWMA 3ENHA 4EFHA 3M1FA 4NXNK 4OLBA 4FSVA 2IVOA 2EX3A 3ITHA 4MLHA 4BWMA 1EXQA 3M8SA 4RW8A 4ID5A 1XMOK 2FC0A 3KD5E 4M7XA 3SYZA 3C6HA 3RWUA 4JI8K 1RDBA 1QVFM 3LP0A 4JKBA 3OA9A 5LJVA 4KTWA 2PFUA 5FPNA 4DFJA 3C6TA 3CJCA 4LF9K 3RR7A 5CY4A 3M8RA 1UWBA 4L8RB 2KFNA 3DJCA 1WBDA 4Y1CA 3L8BA 1VAZA 4Z0UA 4CHPA 4DU1A 5GIPA 2G8KA 3CMAN 5J2NA 1U04A 4Z4IA 4LF5K 4RWTA 3VA0A 3GBTA 3EKSA 4LH5A 5I3UA 4X65K 4ELUA 2DFHA 3AA5X 4JEPA 5IT9O 2O8BB 5LL6Z 3DLBA 3DWLA 3K58A 3PIOL 4K43A 1OH7A 2E88A 2VYPA 1SKWA 1KAYA 2B4JA 5FPDA 2CGJA 3PV8A 3QFPA 2ITMA 2O8EA 1T44A 4I6MB 4BR5A 4PHTX 2E2QA 2YV0X 1JXEA 3EYZA 2HSTA 4MLEA 1J6ZA 2P51A 1RTJA 2JWLA 3FLCO 1SZ2A 4ELTA 2KW4A 1RT4A 4BRMA 3HP6A 2ZGYA 1W97L 2D0CA 3DYAA 3CCMN 1HRHA 3PO4A 2I5JA 1TK8A 3FZHA 2W6KA 4C8NA 1JLCA 2X6NA 5I42A 3QEXA 3T1YK 1D8YA 2RKIA 1FK9A 1UAXA 2OTJN 5B8HA 5AQMA 1TV6A 4B1VA 3EL2A 3ZT4A 4CVNE 1EKEA 4W5RA 5EY4A 3OS0A 2D5RA 4E19A 1VSDA 1EO1A 3IDHA 1WSFA 2FLOA 3I56N 1F21A 3IFRA 3NF9A 2NRVA 1NU0A 4FWMA 1IO2A 2DFFA 3MMVA 4EP4A 4YOUA 3ZSVA 2ZF5O 1HJOA 3LP1A 3U4LA 2A5XA 2KHOA 4AQYK 2GX9A 4FLZA 5HRRA 4CESA 4HUFA 3QIPA 4M45A 4E7HA 3HPHA 4FOEA 1VQ7N 1K73O 3SUNA 4NCGA 3DXKA 5JS1A 1QHTA 1XI1A 3BZKA 3AY9A 2OPRA 5KPRA 2ZQBA 4F4KA 4BRLA 3NCIA 5GAHP 1XQSC 3CJ9A 1NK5A 3EE9A 4MO4A 2DY4A 3H1QA 4M42A 2IC3A 5AFUA 3MN5A 3NH0A 4A5AA 1CZ9A 3THYB 1HX1A 4CJTA 4ID1A 4F2SA 4JLHA 3WT0A 3TAQA 1X9MA 4CJKA 4C8LA 3OVNA 4HCBA 1FKPA 1JXBA 4AHTA 4PQUA 2WUSA 3D2FB 4FWQA 2PBDA 1BCOA 2Q31A 3AVMA 4HVJA 3CJAA 4DSEA 3OW2M 2YHBA 4WFNL 4PL7A 2Q3SA 4CW7B 3OYDA 2E8AA 3CCSN 1ILYA 1M1KO 3M8QA 2UU9K 1XNRK 5AQSA 1W0HA 3MEGA 4A2BA 1RDUA 2WC9A 3O3GA 2P5OA 4GY2B 2IVPA 1VSFA 2HHWA 1RTHA 5BRDA 4E7KA 1X9WA 4DQQA 3DMJA 3SV4A 4H03B 1BWFO 2JGUA 4DTSA 3OY9A 1LWFA 3KTQA 4Q0BA 4K25A 5BREA 3QIOA 3EY1A 3S3MA 4FVUA 2FSJA 5AQJA 4KAZA 1NGAA 1RBSA 1NM1A 1ESVA 2O8DA 1HR0K 1G99A 5M1PA 4Y0WA 3BUZB 4FWNA 1Z05A 1NKCA 3ULEB 4F3TA 4J2BA 1NOYA 3C6UA 1NGGA 3O9SA 2VG7A 5DM6L 3PO5A 3THWA 4ZTFA 2QKBA 5AQQA 2HOEA 5JVGL 4KPYA 3BF1A 4CHQA 1NK0A 3R3LA 4RW9A 3UIQA 1HNZK 1GLFO 5CE3A 3SAGA 4OPHA 4N5SA 3CXCM 4CFDA 4DR4K 4JKHA 1YT3A 1XC9A 3AVIA 1RBUA 2ETJA 2VWJA 1HYVA 4DQRA 4IEEA 4HWIA 2Z1JA 3ULDA 1EWRA 2ATQA 2VCPA 3KLIA 3VF2A 4EAHD 5KGXA 2ASMA 1HKBA 3HVRA 4O8UA 3THVA 4PKHA 3MN9A 3HM9A 4R5PA 3MDQA 2OYQA 3IRXA 1P90A 4CIEA 3IUCA 3MN6A 4YORA 3JS6A 4BRDA 4OVLA 1A5VA 3TABA 1VQON 2IGIA 3J8AA 4NLCA 3DLRA 1JLQA 3V1RA 2Q0UA 1KSPA 2G8UA 1JLAA 4FLWA 3ZETA 1EX4A 3MX5A 4M3TA 3F5TA 4KFBA 1WB9A 1HNVA 4JK9A 1KLNA 4B9VA 3TSPA 2Q0RA 2P9IB 1UOCA 2AP1A 4ISEA 3LPUA 3WEEA 1W2BM 3PLAA 1VSKA 4E0DA 4B3SK 3MEEA 3NE6A 4B1YB 2E5LK 4E7IA 3EZWA 4W5NA 4CBXA 3LDNA 1S1XA 2P9SA 3NVMA 4M41A 4E1JA 5GIOA 1XHXA 4H0PA 3NH2A 2QEXN 4BQLA 5M1NA 3G10A 4PWDA 3LPTA 4BE2A 5J2MA 3SQ0A 5CR4A 1T05A 1S9EA 4EHUA 2A42A 1YJWN 1NGEA 4FK0A 3QEIA 3P31A 3QBWA 4YFUA 3C7NA 5C24A 4I7FA 3CC4N 4CHZA 3C94A 4B8CA 3THXA 3J80O 4LFAK 1RT3A 3VEZA 3SAHA 4IDHA 4IG3A 2DTUA 3HBTA 2KTQA 3H45C 3AGRA 1JCGA 3V4IA 1U49A 3AA3A 3WNFA 4E7LA 1TAQA 2QWNA 4DV5K 3Q7BA 4DUYK 4GKKK 3CQ8A 5FPMA 4KHYA 1NGDA 2CH6A 1HYZA 4AHRA 3CC7N 1FKOA 1ZXOA 1BIUA 1KXPA 1TUYA 4L3QA 3VPZA 4LF7K 4FO0A 2JLEA 5JLHA 5DM7L 2XHBA 4FJLA 5BRFA 1E4GT 2JWKA 3SPYA 4FLUA 5C15A 5JLFA 3ZT3A 4O4GA 1L3TA 1Y97A 2YHYA 4CIFA 3KLHA 1TK5A 1SKRA 5CYQA 3LAKA 4KH6A 3J81O 1L5UA 4DQPA 2IOCA 2OA8A 4IXCA 3C95A 3L3VA 3KIOA 3RR8A 1K6YA 3VQ8A 4GV6A 3ENOA 3WQUA 4BREA 3RSEB 2CGKA 4B3OA 2HVHA 4CGHA 2G8IA 1YIJN 1Z6RA 1NGBA 3ATUA 4JD2B 3HXMA 4O0IA 1RT2A 3L0QA 5BN9A 5C12A 5BRHA 3OYKA 1HLUA 3A5MC 3U6FA 2YNIA 4FXDA 2G8HA 3K9JA 3WUHA 3E66A 4BRAA 3VQBA 3MECA 3KHYA 4Z4CA 3DLEA 1LW0A 4PY5A 1T7PA 1JCFA 4PKGA 2A1RA 1U45A 1U2VA 3OYMA 3TTFA 3CERA 4FW2A 4MDBA 3O6WA 4JI4K 3KJVA 1K8AO 4FLVA 2G8WA 1NG9A 3MK6A 4CGGA 2F8SA 1JLFA 1C0GA 1RBTA 1I39A 3SBGA 2WBNA 5AZJB 2Z1IA 2QTDA 3KD1E 1ZBHA 3VA3A 4FWKA 2NRHA 3AVLA 2Z1GA 3S9HA 2HMIA 5ADXA 1MDUB 4B3TK 4JI0K 2O8FB 4BRKA 1NMNA 3AO5A 3FFKB 1GLEG 4FJ9A 2QWQA 1TKTA 3OYEA 2AA4A 4X64K 3VTHA 3IMXA 1VSLA 2O8EB 5AQHA 4B9SA 4CZLA 3K0SA 3VEYA 2QK9A 3AVCA 3ZSZA 4IFEA 4JK7A 1IG8A 4CJVA 4YOVA 4DV0K 3WXKA 3QEWA 4DR1K 4QS9A 4IEIA 3ZT1A 3LWLA 3PX0A 3AAPA 4CJWA 4BRQA 1ZBFA 1Q18A 4GMJB 2I7NA 1K8KA 4C23A 1QSYA 2P9NA 3OYCA 2B5JA 2VGNA 4CJFA 4OPJA 4FK2A 3HTVA 1BISA 2YJEA 3FZMA 1NKBA 2HMPA 3B6PA 4H8KA 3IS9A 1NWKA 4PKIA 4CEDA 5FPEA 3H08A 4M3XA 4DLGA 5IWAK 3D0PA 2Q2RA 3G6EN 1BI4A 3ISNC 2QM1A 5H1SQ 4K41A 2EWSA 4N47A 4CFBA 3D7EO 1SV5A 2G8FA 3HL8A 4JKAA 1TUUA 3R8EA 1S1WA 4IBNA 2GTDA 4DSIA 4EHTA 3BY5A 3AVGA 4OJRA 3DLLL 2VGMA 3OYGA 4FK4A 1NOZA 3KKSA 4BGBA 2UYTA 1VHXA 3AAQA 3O3HA 2GELA 4DQIA 3SUPA 2H3GX 2RPIA 2ASOA 4IOCL 3VEWA 3MCAB 3HP9A 4JKCA 1ASUA 4JKGB 5CYMA 4CJRA 4DV2K 4OGCA 2GEMA 2F9WA 4CF2A 4CZMA 2QXFA 2P9KB 3TSUA 3DXMA 4AHVA 1IG9A 4K8ZA 1VSHA 4M63C 2FF3B 4CD3A 4RW6A 5AQKA 5AQOA 3SQ4A 2FBYA 3DOKA 5C2FA 1WSEA 1VK0A 3CG7A 1HQEA 4FL9A 4CE9A 3UKUA 4CZJA 5AQGA 2PYJA 3RMDA 2YKMA 1TVRA 1TYQA 4DR2K 4BWJA 1R59O 4LFCK 2YNGA 3L6QA 1S1TA 4BRCA 4DFPA 3T69A 4AM7A 1D9FA 5AR0A 4XEIA 4H5VA 2ZJRL 3AA4A 5BPLA 4AHCA 4GV3A 4KH4A 3QNOA 2OTLN 4QOZB 3MWPA 5SWMA 1ZYQA 3DAWA 5AQXA 5AJ3K 1Z26A 1EETA 4LSLA 5E41A 3P39A 4U7BA 2D0AA 1YVUA 3FZKA 2O8DB 1LV5A 3VQ9A 3V9SA 3GE1A 3KKRA 1KFDA 3TPQA 2WFBA 4JYAK 3ZLJA 2XY6A 1TKXA 4QS7A 4CGJA 3LM9A 3NDKA 2HHVA 4RW7A 1BG3A 1C0MA 3VEVA 2Q1NA 3U3YA 4JKFA 4N56A 3CCLN 3W0LA 1S1UA 5EVZA 1Q81O 4DTUA 2G8VA 3D45A 4DFKA 2QKKA 2IIRA 3AA2A 3ZCMA 1N8RO 3G71N 3WQTA 3VQQA 3TTCA 4DQ8A 2QA4N 1VQKN 3NF8A 3DM2A 5EX5A 4KHWA 3NBPA 3DLGA 2GUIA 3JAMO 3MXMA 3ZSQA 3UKRA 2R7YA 3LDOA 4JNEA 2NNWA 1ZBLA 3NHGA 1S9GA 1Q86O 3A5OC 4IJNA 2DFEA 3JXUA 3RRHA 1X9JA 3SLCA 4A61A 3CCRN 4FJJA 1T6DA 4C8OA 3CCVN 4ILHA 1WNSA 4A59A 4DR5K 1HKGA 4FJIA 4LH4A 2X6SA 2OANA 4BG9A 3ASMA 4H5RA 3RTVA 2OPSA 1BQMA 1YJNN 3PIPL 4CZKA 2EHGA 4YHHK 4IFYA 3KLEA 3CIPA 2A1SA 1GLLO 1NBWA 3GL1A 4Z4EA 3KZBA 3C6AA 2IAJA 4I9LA 1X1PA 3MXJA 4ISGA 1QSSA 2A41A 1RNHA 5JICA 4ILGB 3PSIA 4OPAA 2P9SB 2VQFK 3LDQA 3HZ6A 4KB0A 3O9RA 3SNNA 5GAGP 3R1XA 2Q97A 1HKCA 4JI6K 4FJ5A 3HOTA 2OPQA 1HUXA 5AQRA 2B6AA 4LY7A 4CJ5A 1D5AA 2RHKA 3CQYA 2RF2A 3D2EA 5AQWA 3AVBA 5FRMA 2FBXA 2WONA 1SL0A 2PZSA 2RN2A 2P9LB 3ALYA 5BPNA 1EP4A 1NJIO 1N5YA 1RGIA 3QETA 2PY5A 3O3FA 4XH1A 3FFIA 4DS5A 5HROA 4FJNA 1U48A 3H1VX 3V1QA 4FZZA 4KI4A 2O8CB 1BUPA 4W5QA 3SV3A 2YX6A 1B9DA 5J1EA 4F3OA 1ZBSA 2AJQA 4I2QA 5E84A 4FW1A 2E4LA 3VOVA 5AZIB 5JS2A 4I6MA 3QNNA 1DT9A 1NNEA 2BDPA 4JI2K 3LDSA 3O8MA 1JKHA 3PUFA 3CCJN 1VQ8N 4MQ3A 1GLAG 1DKGD 1BOTO 1HQUA 1X3NA 2P9UA 4H4OA 3SK3A 4CJEA 1T03A 1C1BA 3QMLA 3SJJA 4NCBA 1HNWK 4BC4A 1OVYA 3CM6A 1WAJA 1LW2A 3B8AX 1BO5O 3OYLA 4WQ4A 3UB5A 3T3FA 4M3ZA 3RVCA 4Z94A 3CC2N 3M8PA 4BRNA 2HHSA 3N4PA 2Y1JA 2BH1A 4TSXA 2ZM6K 2UXDK 1O13A 1QQOA 3LZIA 4R79A 4BE0A 4E89A 3ZSWA 2J4RA 3VERA 4FM1A 1L3VA 4IOXA 4KB1A 4JKDA 1MWKA 3L2VA 4DV4K 2KZZA 4ELVA 4JI3K 5GADP 1GOBA 3WXMB 2P1JA 5J2PA 4CHOA 1VSJA 2NRZA 4BDZA 4JS4A 2YI1A 3SUOA 1HPMA 1ZBIA 1DTTA 5AQZA 3HPOA 2HBKA 4IO8A 4WE1A 4DSFA 4DU4A 1RBVA 2E1YA 3RRGA 4UQGA 2NLXA 4KV8A 1B9FA 4FLYA 2FBVA 4E7JA 2A40A 4CGIA 3ID8A 3ZSOA 4FWPA 2E2OA 2YHWA 2ITGA 3NVKA 4Z4FA 3EZ5A 5EU7A 4V19S 3CQXA 4BC5A 4JS5A 4K0KK 3DRSA 3VGLA 4JHDB 4BRPA 3OYBA 2HHUA 4YDUA 3ATVA 1IKXA 4O0JA 1P8ZA 1J53A 3K2PA 2YKNA 1N32K 3F73A 3U3GA 4FCYA 3DLHA 3KWIA 3WNGA 3P38A 2KKZA 4JKEA 1YITN 5FROA 3K5NA 5C25A 2XY5A 3MEDA 4PL8A 4ISFA 1KFSA 3HRGA 4E1NA 4E1MA 1ATNA 1SS6A 4B9UA 4DF8A 3CI5A 4DU3A 1N33K 4JI1K 3TI0A 2D0OA 1WSIA 3V9WA 1XMQK 5KPTA 3V1OA 3HSCA 4Z4HA 3H6EA 3WXLA 3F9KA 2WTUA 4CK2A 3ID6A 3QFUA 4B3MK 1ZBUA 4CI6A 3U8XA 4OKEA 1KAXA 4DMNA 1DLOA 4BR4A 3LALA 3TAMA 1RFQA 4A5BA 3TR8A 5I9EB 1S5JA 4DTRA 2HW3A 4HUEA 5KRTA 3QERA 3AO3A 1HJRA 4OGEA 2BUPA 3WNEA 1DTQA 3GOIA 4W5TA 1JLGA 2P5GA 2FF6A 4MO5A 4CHYA 4JV5K 4H0VB 5HRPA 3UE5A 3BEXA 1YTUA 4CF1A 2XO7A 1BI4B 2HHQA 3ULEA 5EXWA 1FW6A 4CFAA 3KLGA 3MCPA 3OHRA 2ZWHA 3Q7CA 4FJKA 4H0TB 3E9PA 3E9LA 5JVHL 4WF9L 2Q36A 1WSJA 4CZEA 2YNHA 4KKOA 1WLJA 4EZ9A 1NJYA 4C8KA 2HVIA 1BQNA 2YNFA 1VQPN 3QDKA 4MDAA 4BROA 1VRUA 4B08A 1KVAA 3VQ6A 3R6MA 5AQTA 2DPNA 1YHQN 1YXQA 2E20A 5TKWA 4YOXA 4FPAA 4XH5A 4NCAA 1S6PA 5HOOA 1E4FT 4FVMA 3P83D 3A5NC 3AO1A 3CCEN 4JRPA 1S3XA 3I0RA 2BANA 1MA9B 3CD6N 3CPWM 3LP3A 1SKSA 5HRNA 4CGDA 5KPZA 4NLBA 4FWOA 3RMBA 3CETA 4CZGA 3ZEUA 4XH4A 5HP1A 3BDPA 3QINA 1WUAA 2F4VK 3SCXA 3LP2A 4J8FA 3DXMB 3LDLA 3CMEN 4O55A 3L2WA 1NK4A 3CCUN 4DLEA 3DOLA 3VEXA 2LSNA 4DV6K 3CYMA 3P5JA 3G0ZA 3OS2A 1WOQA 2W42A 3VESA 1U6ZA 2ZJQL 2P9PA 4GNIA 4FJ8A 1GOCA 4B9TA 4CJSA 1FJGK 3SZ2A 2BGGA 3G4SN 1RT6A 2V52B 1S1VA 3P1GA 1N34K 1KCFA 4FLTA 4G9ZA 1CXQA 3S41A 3QB0A 1MU2A 2FSKA 4YNQA 3CF5L 1HPZA 3SPZA 1D9DA 4DSJA 3SUQA 3E01A 4WFAL 3ZSXA 4OLAA 1VRTA 1D4XA 1LWEA 3U9DA 3HSTB 4O8KA 4DR6K 4KO0A 4NB4A 1HMVA 3GDQA 1LCUA 1O1WA 2V51B 4CIGA 3EKUA 3VQ5A 1BCMA 3QBXA 4EP5A 2VWKA 3I8DA 4CEAA 2A6AA 3O08A 3OYNA 4I2PA 3MAQA 3VQPA 4EZ6A 4DTXA 2QXLA 3E9OA 4H5TA 1NJZA 3EN9A 3K5MA 1WBBA 3RMAA 1UA0A 1TL1A 5KGWA 3OYIA 4CCHA 3PY8A 3QLHA 5TKYA 4OO1J 2QWOA 4WQ4C 4ZTJA 1WSHA 3HM8A 4C8MA 3VEOA 4K8XA 3TAEA 1VQ6N 1VQ4N 4KHSA 4IKFA 4E3SA 4AILC 3OBYA 4AHSA 3V9UA 1BGXT 3N4QA 1QQCA 3UKRB 2IVNA 1BL3A 2KLAA 4WYBA 2D0BA 1NGFA 1TKZA 1KD1O 4CJLA 5F1XA 4B1ZA 4BDYA 4BC3A 1QVGM 3DXKB 3MX2A 3O9UA 4BR2A 3FZLA 3AVNA 4I9QA 3I8BA 3WNHA 3LANA 2F7TA 3OYJA 3RSEA 3BF3A 1NJXA 4G1QA 3E1YA 1I94K 3FR0A 3TANA 5AQLA 3FGUA 4JD2A 3AVAA 4A62A 1J5EK 1LWCA 3AV9A 4MFBA 1EWQA 4IWVA 3DRRA 1DEJA 4B8AB 1VQ5N 3EO3A 4CD1A 1RT7A 4XIUA 2VWBA 2W40A 3AGKA 4KHNA 4YDUC 3U9ZA 2E1ZA 4DF4A 3ENBA 3KK2A 1NGHA 4CBWA 4JK8A 2HHXA 2NRTA 4YOTA 3HK2A 4DQSA 4LSNA 2FBTA 4BRHA 4OKKA 4DKWA 3CCQN 5KQDA 1GLDG 4KHPK 4RCHA 3SAFA 1NK6A 1JJ2M 3S3NA 1NGIA 4DB3A 2UXCK 4N41A 4GW6A 5T7BA 4B1UB 2HNDA 1IKYA 3R9PA 3D2EB 4AF1A 1M90O 3PSFA 3O9TA 1YJ9N 5AZJA 3OYAA 3KWGA 1NK7A 3ZYYX 1TL3A 3FE1A 4BR7A 4CJ7A 4EIAA 1IBKK 4H4MA 1NGJA 2XRIA 5AFUH 1CXUA 3CJ7A 2O8FA 3LAMA 4BVOA 3LM2A 4PUOA 4FJMA 1QE1A 3J7AP 1VSEA 5M1FA 1QQMA 3ZSYA 3K5LA 2BE2A 1C0FA 1NJWA 1N6QA 4DR7K 3THWB 4KI6A 1CLQA 1Q9YA 3OJSA 1ITGA 4B3RK 1NK8A 2P9UB 3VGKA 4M3UA 4CEEA 3C65A 5LMNK 4B1XB 3J7ZO 3A5LC 4BC2A 1RTIA 4CF8A 2QI2A 2ZGZA 5AQIA 2QWRA 4KHUA 3T1HK 5FLXO 2GBZA 1ATSA 4F2RA 1Q7YO 4CF9A 4J2AA 2FXUA 2OPPA 3VQAA 4CZFA 3ZT2A 1VQMN 5HRSA 1T8EA 4DTOA 4J2EA 3NF7A 5LY3A 4WQ5A 2ASPA 4BDPA 4FWLA 3SQ2A 1JCEA 3VGMA 4KBOA 4CFCA 3ZX0A 4DTJA 1TGOA 1GOAA 1RDCA 5LMUK 1W9HA 1GLJO 1YI2N 3TSQA 5HL7L 3L2UA 1IV0A 3CFRA 3BP8A 3VQEA 3NH1A 3O5BA 4M7YA 3F9MA 4FJXA 4KTZA 2UUBK 2HF3A 3HVTA 4B9NA 3CHWA 3ZETB 1KVBA 2E6MA 2X78A 3VQ7A 4KTQA 3TAPA 4H5WA 5C42A 5KQ8A 2W41A 4CF0A 1HNXK 4Y1DA 4DTMA 4QCLA 2HBLA 1B92A 3WEEB 4KREA 4FJHA 1QTMA 3TTDA 1Q82O 4CECA 1BU6O 4JKGA 4RW4A 4ZHRA 4BRFA 3FZFA 4DWIA 5M1OA 4Z4GA 4FM0A 3O1BA 3KLFA 2P9KA 4IOAL 1YTAA 2YCHA 3M3ZA 5FDLA 1S6QA 2RE2A 3LZJA 1XNQK 4LF8K 5F0XA 2YHAA 1K9MO 1WN7A 1X3MA 5CZ1A 4DV1K 2QWPA 2VQEK 2F9TA 4BACA 1J5OA 3C7NB 4BG8A 4YOWA 1L3SA 4FJ7A 1GLCG 4ICLA 3W3DA 4BVPA 2NRWA 3THXB 3O4QA 3WXIA 3QESA 1KAZA 3AVKA 1KTQA 5LJWA 3ZX3A 4CZHA 4OX9K 1RT1A 2O8BA 1KLMA 1FXXA 3TWHA 2IDOA 2O4IA 1DGKN 4LC9B 2NRRA 2ZD1A 1BA1A 3OYHA 1RDAA 2I7PA 4FLXA 1S72N 1YVNA 5A2QO 4BR0A 1HYSA 2ZE2A 3TARA 4JAXA 1ASWA 4H0OA 4IFVA 4OKJA 4HUGA 3BZCA 4RTFD 2HF4A 2A3ZA 2GUPA 3IAYA
chains in the Genus database with same CATH topology
1UAXA 3OYFA 1NKBA 1RTDA 3B6PA 1TV6A 4H8KA 5HRPA 1QS4A 3IS9A 3ZT4A 1YTUA 4CF1A 4CEDA 3H08A 1TKDA 2XO7A 4M3XA 1EKEA 1BI4B 4DLGA 4W5RA 2HHQA 3VQDA 3OS1A 3D0PA 3KK1A 1C0UA 4CFAA 2D5RA 3OS0A 5J2QA 1BI4A 3KLGA 3BGRA 2KZMA 4E19A 4FJKA 1VSDA 3ISNC 2F8TA 1WSFA 4AH9A 1WSJA 2YNHA 4KKOA 1WLJA 4NYFA 4N47A 4CFBA 4EZ9A 1NJYA 4C8KA 4O44A 2HVIA 1BQNA 2YNFA 1SV5A 1F21A 2G8FA 4CGFA 1VRUA 3T1AA 4B08A 1KVAA 3NF9A 5HLFA 3HL8A 4CJ4A 4HHTA 1S1WA 1IO2A 1A5WA 2DFFA 4IBNA 3VQ6A 2O4GA 4EP4A 3ZSVA 4DSIA 3LP1A 1R0AA 4DTPA 2VG6A 4CJUA 4NCAA 1S6PA 1RT5A 4FLZA 4FVMA 3P83D 3AVGA 5HRRA 4OJRA 3AO1A 4CESA 3NGZA 3OYGA 4HUFA 1SL2A 4FK4A 3QIPA 4M45A 1NOZA 3KKSA 3KK3A 3I0RA 4JRPA 4E7HA 3HPHA 2E6LA 2BANA 4QAGA 3O3HA 4DQIA 3LP3A 4CEOA 5HRNA 3SUPA 1SKSA 1XHZA 2RPIA 4CGDA 3SUNA 4NCGA 5JS1A 1QHTA 1XI1A 3RMBA 4O5BA 2OPRA 4FJGA 4J2DA 4KRFA 3VQ4A 3HP9A 2ZQBA 2F96A 4F4KA 3NCIA 1ASUA 5HP1A 5CYMA 3BDPA 3QINA 3SCXA 5KRSA 1NK5A 3LP2A 4CJRA 2DY4A 4OGCA 4O55A 1C6VA 4CF2A 5DK5A 4M42A 2QXFA 5KI6A 2IC3A 4AHVA 3NH0A 1IG9A 1KVCA 1CZ9A 3L2WA 1REVA 1VSHA 1BIZA 4Q5VA 1NK4A 4K8ZA 4DLEA 3DOLA 4CJTA 4RG8A 4ID1A 4F2SA 1U47A 2LSNA 1XWLA 4JLHA 4RW6A 3CYMA 3P5JA 3G0ZA 3OS2A 4CJKA 3TAQA 1X9MA 4C8LA 1KRPA 3SQ4A 2IS3A 3OVNA 4OPKA 4HCBA 1FKPA 1JXBA 4AHTA 4PQUA 2W42A 2FBYA 3DOKA 4CHNA 1WSEA 1BCOA 3AVMA 4HVJA 1VK0A 3CG7A 4FZYA 1HQEA 4CK3A 4DSEA 4CE9A 4FJ8A 1GOCA 4B9TA 2YHBA 4CJSA 2PYJA 3RMDA 3QEVA 2Q3SA 2YKMA 3JYTA 1TVRA 3SZ2A 4DTNA 1JLEA 3DI6A 3OYDA 2BGGA 4BWJA 1RT6A 3JSMA 2YNGA 3M8QA 2WOMA 1S1VA 3P1GA 1S1TA 1KCFA 1W0HA 4FLTA 1C1CA 4DFPA 1CXQA 4IDKA 3T19A 3VN5A 4JRQA 3MEGA 3NAEA 1MU2A 3O3GA 2P5OA 4YNQA 1D9FA 1VSFA 1HPZA 3SPZA 1D9DA 4B9LA 4DSJA 3SUQA 1SUQA 3AA4A 3E01A 4CEBA 4AHCA 3ZSXA 4OLAA 1RTHA 2HHWA 4E7KA 3QNOA 4QOZB 1X9WA 1VRTA 4DQQA 2KFZA 5SWMA 1LWEA 3CM5A 3DMJA 3HSTB 3SV4A 1J9AA 1ZYQA 2JGUA 4KO0A 4DTSA 3OY9A 1HMVA 1LWFA 3KTQA 4Q0BA 1Z26A 1EETA 1O1WA 3K5OA 4LSLA 1JL1A 5E41A 4CIGA 1C1AA 4AHUA 3QIOA 3EY1A 3S3MA 2D0AA 1YVUA 3VQ5A 1G15A 1BCMA 1VSIA 4KAZA 1LV5A 3VQ9A 4EP5A 3V9SA 3MXIA 3KKRA 1KFDA 1RBSA 1Q8IA 2VWKA 4LD0A 3I8DA 4CEAA 3OYNA 4I2PA 3MAQA 2XY6A 1TKXA 3VQPA 4EZ6A 4DTXA 1IKWA 4CGJA 1NJZA 1NKCA 4F3TA 4J2BA 1NOYA 4KHQA 3K5MA 3C6UA 3PO5A 2VG7A 3NDKA 3RMAA 1UA0A 1TL1A 4RW7A 5KGWA 4ZTFA 2HHVA 1C0MA 3OYIA 4CCHA 2QKBA 4CEZA 3K59A 3PY8A 4KPYA 3QLHA 1RILA 3PX6A 4GVMA 4CHQA 4ZTJA 5FRNA 3U3YA 1WSHA 5CZ2A 4N56A 1NK0A 4C8MA 4RW9A 3UIQA 1JL2A 4K8XA 3TAEA 1S1UA 4N5SA 3AVFA 4CK1A 4DTUA 1IH7A 3DRPA 4CFDA 4E3SA 3D45A 4DFKA 2G8VA 2QKKA 4IKFA 4KHSA 4AILC 1SL1A 2OZSA 2XY7A 3AA2A 3ZCMA 4AHSA 3V9UA 1YT3A 1BGXT 1J54A 3VQQA 1XC9A 3AVIA 1RBUA 3HPGA 2ETJA 3AVHA 2VWJA 1QQCA 3NF8A 5D3GA 3DM2A 4KHWA 3NBPA 1HYVA 3DLGA 1BL3A 3I0SA 4DQRA 1HNIA 2Z1JA 2GUIA 3MXMA 3ZSQA 2D0BA 3ULDA 2HNZA 2R7YA 4HTUA 1TKZA 2ATQA 3KLIA 5KGXA 4CJLA 3HVRA 4BDYA 1ZBLA 1QSLA 3NHGA 3V6DA 3THVA 1S9GA 3V9ZA 3HM9A 4R5PA 2OYQA 3AVNA 2GV9A 2DFEA 3IRXA 4CIEA 3HT3A 4I9QA 3WNHA 3LANA 3ZT0A 3RRHA 3TAGA 4FJJA 4C8OA 3RMCA 3PX4A 3OYJA 1WSGA 4OVLA 1A5VA 3TABA 1NJXA 1WNSA 4G1QA 2HNYA 4DS4A 2IGIA 4FJIA 5KTQA 3TANA 3VQCA 4LH4A 4CJ3A 2X6SA 3AVAA 1LWCA 3DLRA 1JLQA 3V1RA 3ASMA 3RTVA 3AV9A 4MFBA 2OPSA 1BQMA 1KSPA 2G8UA 2EHGA 1JLAA 4IFYA 3NGIA 4FLWA 1NKEA 3KLEA 1EX4A 3DRRA 4M3TA 2HHTA 2VG5A 3DLKA 4KFBA 4B8AB 2A1SA 1HNVA 3OJUA 1RT7A 5DMRA 4PA1A 4XIUA 1KLNA 4FYDA 1C0TA 4KHNA 4B9VA 4Z4EA 3B6OA 1L3UA 2KQ2A 4DF4A 1UOCA 1RBRA 2IAJA 4I9LA 3KK2A 5K14A 1X1PA 3LPUA 3MXJA 1QSSA 2HHXA 4HCCA 1VSKA 4FM2A 5SZTA 3AVJA 3MEEA 4E0DA 1RNHA 3HK2A 3NE6A 4DQSA 4LSNA 2FBTA 4E7IA 4OKKA 3IG1A 1X9SA 4M3WA 3ZSRA 4W5NA 1JLBA 4W5OA 3HO1A 1Z25A 3V81A 1NK6A 4KB0A 1S1XA 3SNNA 3S3NA 4M41A 4N41A 4GW6A 5T7BA 4FJ5A 3NFAA 1A5XA 2HNDA 1IKYA 2OPQA 3K57A 1XHXA 2B6AA 4LY7A 4CJ5A 3NH2A 1IKVA 1D5AA 5FRMA 2RF2A 2XY8A 3AVBA 4CJPA 3OYAA 2FBXA 4IG0A 3G10A 1NK7A 2WONA 1I3AA 1SL0A 2RN2A 2PZSA 4PWDA 3LPTA 4BE2A 4CJQA 3ALYA 1TL3A 3V9XA 1EP4A 5J2MA 1N5YA 3SQ0A 4H4MA 3QETA 5HBMA 1T05A 2PY5A 1S9EA 2XRIA 1CXUA 3O3FA 4FK0A 4DS5A 3FFIA 3QEIA 5HROA 4YFUA 3CFPA 4FJNA 1U48A 3LAMA 3SQ1A 5C24A 4I7FA 3L2QA 1ASVA 3V1QA 4CHZA 4FZZA 3C94A 4B8CA 4PUOA 4FJMA 4FZXC 1Q9XA 3AO2A 1LAWA 4KI4A 2OZMA 1RT3A 1QE1A 2X74A 4W5QA 4IG3A 3SV3A 2DTUA 1VSEA 3HJFA 1B9DA 2KTQA 5J1EA 4F3OA 2AJQA 4CEFA 3V4IA 3ZSYA 3K5LA 1U49A 1CZBA 3AA3A 2BE2A 4I2QA 3WNFA 4FW1A 4CERA 4E7LA 1TAQA 1NJWA 1N6QA 2PYLA 1TAUA 2E4LA 5JS2A 1TK0A 3QNNA 1U4BA 4KI6A 1CLQA 3CQ8A 3QEPA 3OJSA 1Q9YA 3CFOA 4KHYA 2BDPA 3LDSA 1ITGA 1JKHA 1HYZA 4AHRA 3PUFA 2HB5A 4DG1A 3L3UA 4MQ3A 4CEQA 1NK8A 3S3OA 1FKOA 1HQUA 1BIUA 4M3UA 4CEEA 2JLEA 4H4OA 1LAVA 1RCHA 4CJEA 3QO9A 1C1BA 1RTIA 4CF8A 2XHBA 3SJJA 1T03A 4DSLA 4FJLA 4NCBA 3SPYA 4FLUA 3CM6A 4DFMA 4M3YA 1WAJA 3AO4A 1LW2A 3ZT3A 4O4GA 4KHUA 1L3TA 1Y97A 4CIFA 3OYLA 3T3FA 2GBZA 4F2RA 3KLHA 4M3ZA 1TK5A 3NF6A 1SKRA 4CF9A 5CYQA 1NK9A 4DSKA 4J2AA 3LAKA 2OPPA 3M8PA 3VQAA 2HHSA 2Y1JA 3ZT2A 3A2FA 1L5UA 4DQPA 2IOCA 3HYFA 3NGYA 5HRSA 4DTOA 1T8EA 4J2EA 3NF7A 4TSXA 2OA8A 3C95A 3L3VA 3LZIA 4BDPA 3KIOA 3O4NA 3RR8A 3SQ2A 4F8RA 2Z1HA 1WAFA 1BHLA 4CFCA 4E89A 4BE0A 3ZSWA 1TGOA 4DTJA 1GOAA 1K6YA 3VQ8A 3SI6A 1RDDA 1UA1A 4FM1A 1L3VA 2NUBA 2HVHA 1RDCA 4KB1A 4B9MA 4B3OA 3L2RA 4CGHA 1W9HA 3L2VA 4M3RA 2G8IA 2KZZA 4ELVA 3HXMA 3L2UA 4O0IA 3CFRA 1RT2A 1GOBA 1VSMA 3VQEA 2P1JA 3NH1A 5J2PA 3TAFA 3OYKA 4CHOA 4FJXA 4KTZA 1VSJA 4NYNA 4BDZA 3HVTA 3U6FA 4B9NA 2YNIA 4JS4A 3SUOA 4FXDA 1ZBIA 1DTTA 3HPOA 1KVBA 2E6MA 2X78A 3VQ7A 4KTQA 4WE1A 4DSFA 4N76A 4DU4A 1RBVA 3TAPA 3RRGA 4BE1A 4UQGA 5C42A 2G8HA 2Y1IA 3LWMA 4KV8A 4CF0A 1B9FA 4FLYA 3VQBA 4Y1DA 2FBVA 3MECA 4Z4CA 4E7JA 4CGIA 3DLEA 4DTMA 1B92A 4QCLA 3ZSOA 4OLBA 1LW0A 4KREA 4FJHA 1QTMA 2ITGA 4PY5A 2EX3A 3ITHA 4RW4A 4BWMA 4CECA 4ZHRA 1T7PA 1EXQA 3M8SA 3EZ5A 4Z4FA 4RW8A 5EU7A 2A1RA 4ID5A 1U45A 4DWIA 2FC0A 3OYMA 4Z4GA 3KD5E 4FW2A 4FM0A 3SYZA 4JS5A 3RWUA 3KJVA 1RDBA 3KLFA 4FLVA 3DRSA 2G8WA 2HHUA 3LP0A 3OYBA 4KTWA 4CGGA 1IKXA 1YTAA 3C6TA 1JLFA 4O0JA 4DFJA 2F8SA 3RR7A 1J53A 1RBTA 3K2PA 5FDLA 1S6QA 2YKNA 1I39A 1UWBA 5CY4A 3M8RA 3F73A 3LZJA 3U3GA 4FCYA 2YHAA 2Z1IA 3DLHA 4L8RB 2KFNA 3KD1E 4Y1CA 3WNGA 1ZBHA 3L8BA 3VA3A 1WN7A 4Z0UA 5CZ1A 3AVLA 4CHPA 4DU1A 2Z1GA 2G8KA 3S9HA 5FROA 2HMIA 5J2NA 3K5NA 5C25A 4BACA 1U04A 1J5OA 2XY5A 3MEDA 4Z4IA 1L3SA 4FJ7A 3AO5A 3VA0A 4ICLA 4LH5A 5I3UA 1KFSA 4FJ9A 4E1NA 1TKTA 4E1MA 3OYEA 3O4QA 3QESA 2DFHA 4ELUA 3AA5X 1KTQA 3AVKA 4B9UA 4DF8A 4DU3A 3TI0A 3DLBA 3V9WA 1WSIA 1RT1A 3K58A 1VSLA 1KLMA 3V1OA 4Z4HA 1FXXA 4B9SA 1SKWA 2B4JA 2IDOA 3TWHA 2O4IA 3F9KA 3PV8A 4CK2A 2ZD1A 1ZBUA 4OKEA 2YV0X 1JXEA 2QK9A 3OYHA 3AVCA 3EYZA 4DMNA 1DLOA 3ZSZA 1RDAA 2P51A 3LALA 4FLXA 1RTJA 3TAMA 4CJVA 3QEWA 1HYSA 4ELTA 2ZE2A 3ZT1A 3LWLA 3TR8A 2KW4A 3PX0A 3TARA 1RT4A 1S5JA 4DTRA 3HP6A 4HUEA 5KRTA 4CJWA 3QERA 3AO3A 1ASWA 2HW3A 1ZBFA 4GMJB 4IFVA 2D0CA 3DYAA 1HJRA 4OKJA 1QSYA 4HUGA 1HRHA 4OGEA 2I5JA 3WNEA 1TK8A 1DTQA 3PO4A 4W5TA 1JLGA 4C8NA 3OYCA 2B5JA 2P5GA 1JLCA 2X6NA 4CJFA 4OPJA 5I42A 4FK2A 3QEXA 4CHYA 1D8YA 1BISA 2RKIA 3IAYA 1FK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UAX A;  3OYF A;  1NKB A;  1RTD A;  3B6P A;  1TV6 A;  4H8K A;  5HRP A;  1QS4 A;  3IS9 A;  3ZT4 A;  1YTU A;  4CF1 A;  4CED A;  3H08 A;  1TKD A;  2XO7 A;  4M3X A;  1EKE A;  1BI4 B;  4DLG A;  4W5R A;  2HHQ A;  3VQD A;  3OS1 A;  3D0P A;  3KK1 A;  1C0U A;  4CFA A;  2D5R A;  3OS0 A;  5J2Q A;  1BI4 A;  3KLG A;  3BGR A;  2KZM A;  4E19 A;  4FJK A;  1VSD A;  3ISN C;  2F8T A;  1WSF A;  4AH9 A;  1WSJ A;  2YNH A;  4KKO A;  1WLJ A;  4NYF A;  4N47 A;  4CFB A;  4EZ9 A;  1NJY A;  4C8K A;  4O44 A;  2HVI A;  1BQN A;  2YNF A;  1SV5 A;  1F21 A;  2G8F A;  4CGF A;  1VRU A;  3T1A A;  4B08 A;  1KVA A;  3NF9 A;  5HLF A;  3HL8 A;  4CJ4 A;  4HHT A;  1S1W A;  1IO2 A;  1A5W A;  2DFF A;  4IBN A;  3VQ6 A;  2O4G A;  4EP4 A;  3ZSV A;  4DSI A;  3LP1 A;  1R0A A;  4DTP A;  2VG6 A;  4CJU A;  4NCA A;  1S6P A;  1RT5 A;  4FLZ A;  4FVM A;  3P83 D;  3AVG A;  5HRR A;  4OJR A;  3AO1 A;  4CES A;  3NGZ A;  3OYG A;  4HUF A;  1SL2 A;  4FK4 A;  3QIP A;  4M45 A;  1NOZ A;  3KKS A;  3KK3 A;  3I0R A;  4JRP A;  4E7H A;  3HPH A;  2E6L A;  2BAN A;  4QAG A;  3O3H A;  4DQI A;  3LP3 A;  4CEO A;  5HRN A;  3SUP A;  1SKS A;  1XHZ A;  2RPI A;  4CGD A;  3SUN A;  4NCG A;  5JS1 A;  1QHT A;  1XI1 A;  3RMB A;  4O5B A;  2OPR A;  4FJG A;  4J2D A;  4KRF A;  3VQ4 A;  3HP9 A;  2ZQB A;  2F96 A;  4F4K A;  3NCI A;  1ASU A;  5HP1 A;  5CYM A;  3BDP A;  3QIN A;  3SCX A;  5KRS A;  1NK5 A;  3LP2 A;  4CJR A;  2DY4 A;  4OGC A;  4O55 A;  1C6V A;  4CF2 A;  5DK5 A;  4M42 A;  2QXF A;  5KI6 A;  2IC3 A;  4AHV A;  3NH0 A;  1IG9 A;  1KVC A;  1CZ9 A;  3L2W A;  1REV A;  1VSH A;  1BIZ A;  4Q5V A;  1NK4 A;  4K8Z A;  4DLE A;  3DOL A;  4CJT A;  4RG8 A;  4ID1 A;  4F2S A;  1U47 A;  2LSN A;  1XWL A;  4JLH A;  4RW6 A;  3CYM A;  3P5J A;  3G0Z A;  3OS2 A;  4CJK A;  3TAQ A;  1X9M A;  4C8L A;  1KRP A;  3SQ4 A;  2IS3 A;  3OVN A;  4OPK A;  4HCB A;  1FKP A;  1JXB A;  4AHT A;  4PQU A;  2W42 A;  2FBY A;  3DOK A;  4CHN A;  1WSE A;  1BCO A;  3AVM A;  4HVJ A;  1VK0 A;  3CG7 A;  4FZY A;  1HQE A;  4CK3 A;  4DSE A;  4CE9 A;  4FJ8 A;  1GOC A;  4B9T A;  2YHB A;  4CJS A;  2PYJ A;  3RMD A;  3QEV A;  2Q3S A;  2YKM A;  3JYT A;  1TVR A;  3SZ2 A;  4DTN A;  1JLE A;  3DI6 A;  3OYD A;  2BGG A;  4BWJ A;  1RT6 A;  3JSM A;  2YNG A;  3M8Q A;  2WOM A;  1S1V A;  3P1G A;  1S1T A;  1KCF A;  1W0H A;  4FLT A;  1C1C A;  4DFP A;  1CXQ A;  4IDK A;  3T19 A;  3VN5 A;  4JRQ A;  3MEG A;  3NAE A;  1MU2 A;  3O3G A;  2P5O A;  4YNQ A;  1D9F A;  1VSF A;  1HPZ A;  3SPZ A;  1D9D A;  4B9L A;  4DSJ A;  3SUQ A;  1SUQ A;  3AA4 A;  3E01 A;  4CEB A;  4AHC A;  3ZSX A;  4OLA A;  1RTH A;  2HHW A;  4E7K A;  3QNO A;  4QOZ B;  1X9W A;  1VRT A;  4DQQ A;  2KFZ A;  5SWM A;  1LWE A;  3CM5 A;  3DMJ A;  3HST B;  3SV4 A;  1J9A A;  1ZYQ A;  2JGU A;  4KO0 A;  4DTS A;  3OY9 A;  1HMV A;  1LWF A;  3KTQ A;  4Q0B A;  1Z26 A;  1EET A;  1O1W A;  3K5O A;  4LSL A;  1JL1 A;  5E41 A;  4CIG A;  1C1A A;  4AHU A;  3QIO A;  3EY1 A;  3S3M A;  2D0A A;  1YVU A;  3VQ5 A;  1G15 A;  1BCM A;  1VSI A;  4KAZ A;  1LV5 A;  3VQ9 A;  4EP5 A;  3V9S A;  3MXI A;  3KKR A;  1KFD A;  1RBS A;  1Q8I A;  2VWK A;  4LD0 A;  3I8D A;  4CEA A;  3OYN A;  4I2P A;  3MAQ A;  2XY6 A;  1TKX A;  3VQP A;  4EZ6 A;  4DTX A;  1IKW A;  4CGJ A;  1NJZ A;  1NKC A;  4F3T A;  4J2B A;  1NOY A;  4KHQ A;  3K5M A;  3C6U A;  3PO5 A;  2VG7 A;  3NDK A;  3RMA A;  1UA0 A;  1TL1 A;  4RW7 A;  5KGW A;  4ZTF A;  2HHV A;  1C0M A;  3OYI A;  4CCH A;  2QKB A;  4CEZ A;  3K59 A;  3PY8 A;  4KPY A;  3QLH A;  1RIL A;  3PX6 A;  4GVM A;  4CHQ A;  4ZTJ A;  5FRN A;  3U3Y A;  1WSH A;  5CZ2 A;  4N56 A;  1NK0 A;  4C8M A;  4RW9 A;  3UIQ A;  1JL2 A;  4K8X A;  3TAE A;  1S1U A;  4N5S A;  3AVF A;  4CK1 A;  4DTU A;  1IH7 A;  3DRP A;  4CFD A;  4E3S A;  3D45 A;  4DFK A;  2G8V A;  2QKK A;  4IKF A;  4KHS A;  4AIL C;  1SL1 A;  2OZS A;  2XY7 A;  3AA2 A;  3ZCM A;  4AHS A;  3V9U A;  1YT3 A;  1BGX T;  1J54 A;  3VQQ A;  1XC9 A;  3AVI A;  1RBU A;  3HPG A;  2ETJ A;  3AVH A;  2VWJ A;  1QQC A;  3NF8 A;  5D3G A;  3DM2 A;  4KHW A;  3NBP A;  1HYV A;  3DLG A;  1BL3 A;  3I0S A;  4DQR A;  1HNI A;  2Z1J A;  2GUI A;  3MXM A;  3ZSQ A;  2D0B A;  3ULD A;  2HNZ A;  2R7Y A;  4HTU A;  1TKZ A;  2ATQ A;  3KLI A;  5KGX A;  4CJL A;  3HVR A;  4BDY A;  1ZBL A;  1QSL A;  3NHG A;  3V6D A;  3THV A;  1S9G A;  3V9Z A;  3HM9 A;  4R5P A;  2OYQ A;  3AVN A;  2GV9 A;  2DFE A;  3IRX A;  4CIE A;  3HT3 A;  4I9Q A;  3WNH A;  3LAN A;  3ZT0 A;  3RRH A;  3TAG A;  4FJJ A;  4C8O A;  3RMC A;  3PX4 A;  3OYJ A;  1WSG A;  4OVL A;  1A5V A;  3TAB A;  1NJX A;  1WNS A;  4G1Q A;  2HNY A;  4DS4 A;  2IGI A;  4FJI A;  5KTQ A;  3TAN A;  3VQC A;  4LH4 A;  4CJ3 A;  2X6S A;  3AVA A;  1LWC A;  3DLR A;  1JLQ A;  3V1R A;  3ASM A;  3RTV A;  3AV9 A;  4MFB A;  2OPS A;  1BQM A;  1KSP A;  2G8U A;  2EHG A;  1JLA A;  4IFY A;  3NGI A;  4FLW A;  1NKE A;  3KLE A;  1EX4 A;  3DRR A;  4M3T A;  2HHT A;  2VG5 A;  3DLK A;  4KFB A;  4B8A B;  2A1S A;  1HNV A;  3OJU A;  1RT7 A;  5DMR A;  4PA1 A;  4XIU A;  1KLN A;  4FYD A;  1C0T A;  4KHN A;  4B9V A;  4Z4E A;  3B6O A;  1L3U A;  2KQ2 A;  4DF4 A;  1UOC A;  1RBR A;  2IAJ A;  4I9L A;  3KK2 A;  5K14 A;  1X1P A;  3LPU A;  3MXJ A;  1QSS A;  2HHX A;  4HCC A;  1VSK A;  4FM2 A;  5SZT A;  3AVJ A;  3MEE A;  4E0D A;  1RNH A;  3HK2 A;  3NE6 A;  4DQS A;  4LSN A;  2FBT A;  4E7I A;  4OKK A;  3IG1 A;  1X9S A;  4M3W A;  3ZSR A;  4W5N A;  1JLB A;  4W5O A;  3HO1 A;  1Z25 A;  3V81 A;  1NK6 A;  4KB0 A;  1S1X A;  3SNN A;  3S3N A;  4M41 A;  4N41 A;  4GW6 A;  5T7B A;  4FJ5 A;  3NFA A;  1A5X A;  2HND A;  1IKY A;  2OPQ A;  3K57 A;  1XHX A;  2B6A A;  4LY7 A;  4CJ5 A;  3NH2 A;  1IKV A;  1D5A A;  5FRM A;  2RF2 A;  2XY8 A;  3AVB A;  4CJP A;  3OYA A;  2FBX A;  4IG0 A;  3G10 A;  1NK7 A;  2WON A;  1I3A A;  1SL0 A;  2RN2 A;  2PZS A;  4PWD A;  3LPT A;  4BE2 A;  4CJQ A;  3ALY A;  1TL3 A;  3V9X A;  1EP4 A;  5J2M A;  1N5Y A;  3SQ0 A;  4H4M A;  3QET A;  5HBM A;  1T05 A;  2PY5 A;  1S9E A;  2XRI A;  1CXU A;  3O3F A;  4FK0 A;  4DS5 A;  3FFI A;  3QEI A;  5HRO A;  4YFU A;  3CFP A;  4FJN A;  1U48 A;  3LAM A;  3SQ1 A;  5C24 A;  4I7F A;  3L2Q A;  1ASV A;  3V1Q A;  4CHZ A;  4FZZ A;  3C94 A;  4B8C A;  4PUO A;  4FJM A;  4FZX C;  1Q9X A;  3AO2 A;  1LAW A;  4KI4 A;  2OZM A;  1RT3 A;  1QE1 A;  2X74 A;  4W5Q A;  4IG3 A;  3SV3 A;  2DTU A;  1VSE A;  3HJF A;  1B9D A;  2KTQ A;  5J1E A;  4F3O A;  2AJQ A;  4CEF A;  3V4I A;  3ZSY A;  3K5L A;  1U49 A;  1CZB A;  3AA3 A;  2BE2 A;  4I2Q A;  3WNF A;  4FW1 A;  4CER A;  4E7L A;  1TAQ A;  1NJW A;  1N6Q A;  2PYL A;  1TAU A;  2E4L A;  5JS2 A;  1TK0 A;  3QNN A;  1U4B A;  4KI6 A;  1CLQ A;  3CQ8 A;  3QEP A;  3OJS A;  1Q9Y A;  3CFO A;  4KHY A;  2BDP A;  3LDS A;  1ITG A;  1JKH A;  1HYZ A;  4AHR A;  3PUF A;  2HB5 A;  4DG1 A;  3L3U A;  4MQ3 A;  4CEQ A;  1NK8 A;  3S3O A;  1FKO A;  1HQU A;  1BIU A;  4M3U A;  4CEE A;  2JLE A;  4H4O A;  1LAV A;  1RCH A;  4CJE A;  3QO9 A;  1C1B A;  1RTI A;  4CF8 A;  2XHB A;  3SJJ A;  1T03 A;  4DSL A;  4FJL A;  4NCB A;  3SPY A;  4FLU A;  3CM6 A;  4DFM A;  4M3Y A;  1WAJ A;  3AO4 A;  1LW2 A;  3ZT3 A;  4O4G A;  4KHU A;  1L3T A;  1Y97 A;  4CIF A;  3OYL A;  3T3F A;  2GBZ A;  4F2R A;  3KLH A;  4M3Z A;  1TK5 A;  3NF6 A;  1SKR A;  4CF9 A;  5CYQ A;  1NK9 A;  4DSK A;  4J2A A;  3LAK A;  2OPP A;  3M8P A;  3VQA A;  2HHS A;  2Y1J A;  3ZT2 A;  3A2F A;  1L5U A;  4DQP A;  2IOC A;  3HYF A;  3NGY A;  5HRS A;  4DTO A;  1T8E A;  4J2E A;  3NF7 A;  4TSX A;  2OA8 A;  3C95 A;  3L3V A;  3LZI A;  4BDP A;  3KIO A;  3O4N A;  3RR8 A;  3SQ2 A;  4F8R A;  2Z1H A;  1WAF A;  1BHL A;  4CFC A;  4E89 A;  4BE0 A;  3ZSW A;  1TGO A;  4DTJ A;  1GOA A;  1K6Y A;  3VQ8 A;  3SI6 A;  1RDD A;  1UA1 A;  4FM1 A;  1L3V A;  2NUB A;  2HVH A;  1RDC A;  4KB1 A;  4B9M A;  4B3O A;  3L2R A;  4CGH A;  1W9H A;  3L2V A;  4M3R A;  2G8I A;  2KZZ A;  4ELV A;  3HXM A;  3L2U A;  4O0I A;  3CFR A;  1RT2 A;  1GOB A;  1VSM A;  3VQE A;  2P1J A;  3NH1 A;  5J2P A;  3TAF A;  3OYK A;  4CHO A;  4FJX A;  4KTZ A;  1VSJ A;  4NYN A;  4BDZ A;  3HVT A;  3U6F A;  4B9N A;  2YNI A;  4JS4 A;  3SUO A;  4FXD A;  1ZBI A;  1DTT A;  3HPO A;  1KVB A;  2E6M A;  2X78 A;  3VQ7 A;  4KTQ A;  4WE1 A;  4DSF A;  4N76 A;  4DU4 A;  1RBV A;  3TAP A;  3RRG A;  4BE1 A;  4UQG A;  5C42 A;  2G8H A;  2Y1I A;  3LWM A;  4KV8 A;  4CF0 A;  1B9F A;  4FLY A;  3VQB A;  4Y1D A;  2FBV A;  3MEC A;  4Z4C A;  4E7J A;  4CGI A;  3DLE A;  4DTM A;  1B92 A;  4QCL A;  3ZSO A;  4OLB A;  1LW0 A;  4KRE A;  4FJH A;  1QTM A;  2ITG A;  4PY5 A;  2EX3 A;  3ITH A;  4RW4 A;  4BWM A;  4CEC A;  4ZHR A;  1T7P A;  1EXQ A;  3M8S A;  3EZ5 A;  4Z4F A;  4RW8 A;  5EU7 A;  2A1R A;  4ID5 A;  1U45 A;  4DWI A;  2FC0 A;  3OYM A;  4Z4G A;  3KD5 E;  4FW2 A;  4FM0 A;  3SYZ A;  4JS5 A;  3RWU A;  3KJV A;  1RDB A;  3KLF A;  4FLV A;  3DRS A;  2G8W A;  2HHU A;  3LP0 A;  3OYB A;  4KTW A;  4CGG A;  1IKX A;  1YTA A;  3C6T A;  1JLF A;  4O0J A;  4DFJ A;  2F8S A;  3RR7 A;  1J53 A;  1RBT A;  3K2P A;  5FDL A;  1S6Q A;  2YKN A;  1I39 A;  1UWB A;  5CY4 A;  3M8R A;  3F73 A;  3LZJ A;  3U3G A;  4FCY A;  2YHA A;  2Z1I A;  3DLH A;  4L8R B;  2KFN A;  3KD1 E;  4Y1C A;  3WNG A;  1ZBH A;  3L8B A;  3VA3 A;  1WN7 A;  4Z0U A;  5CZ1 A;  3AVL A;  4CHP A;  4DU1 A;  2Z1G A;  2G8K A;  3S9H A;  5FRO A;  2HMI A;  5J2N A;  3K5N A;  5C25 A;  4BAC A;  1U04 A;  1J5O A;  2XY5 A;  3MED A;  4Z4I A;  1L3S A;  4FJ7 A;  3AO5 A;  3VA0 A;  4ICL A;  4LH5 A;  5I3U A;  1KFS A;  4FJ9 A;  4E1N A;  1TKT A;  4E1M A;  3OYE A;  3O4Q A;  3QES A;  2DFH A;  4ELU A;  3AA5 X;  1KTQ A;  3AVK A;  4B9U A;  4DF8 A;  4DU3 A;  3TI0 A;  3DLB A;  3V9W A;  1WSI A;  1RT1 A;  3K58 A;  1VSL A;  1KLM A;  3V1O A;  4Z4H A;  1FXX A;  4B9S A;  1SKW A;  2B4J A;  2IDO A;  3TWH A;  2O4I A;  3F9K A;  3PV8 A;  4CK2 A;  2ZD1 A;  1ZBU A;  4OKE A;  2YV0 X;  1JXE A;  2QK9 A;  3OYH A;  3AVC A;  3EYZ A;  4DMN A;  1DLO A;  3ZSZ A;  1RDA A;  2P51 A;  3LAL A;  4FLX A;  1RTJ A;  3TAM A;  4CJV A;  3QEW A;  1HYS A;  4ELT A;  2ZE2 A;  3ZT1 A;  3LWL A;  3TR8 A;  2KW4 A;  3PX0 A;  3TAR A;  1RT4 A;  1S5J A;  4DTR A;  3HP6 A;  4HUE A;  5KRT A;  4CJW A;  3QER A;  3AO3 A;  1ASW A;  2HW3 A;  1ZBF A;  4GMJ B;  4IFV A;  2D0C A;  3DYA A;  1HJR A;  4OKJ A;  1QSY A;  4HUG A;  1HRH A;  4OGE A;  2I5J A;  3WNE A;  1TK8 A;  1DTQ A;  3PO4 A;  4W5T A;  1JLG A;  4C8N A;  3OYC A;  2B5J A;  2P5G A;  1JLC A;  2X6N A;  4CJF A;  4OPJ A;  5I42 A;  4FK2 A;  3QEX A;  4CHY A;  1D8Y A;  1BIS A;  2RKI A;  3IAY A;  1FK9 A; 
#chains in the Genus database with same CATH topology
 3J7Y P;  3OYF A;  1RTD A;  3M6G A;  1QS4 A;  1TKD A;  3TU5 A;  4ILJ A;  3VQD A;  3OS1 A;  5EOY A;  4BRG A;  3KK1 A;  1C0U A;  5J2Q A;  5C2D A;  3BGR A;  2KZM A;  3LDP A;  2F8T A;  4CBU A;  4AH9 A;  4DHY A;  2HHH K;  4NYF A;  3D6R A;  2V7Z A;  4O44 A;  5GAE P;  5AQU A;  3SMS A;  2FSN A;  4FWS A;  4GV9 A;  4CGF A;  3T1A A;  4FWR A;  5HLF A;  4CJ4 A;  4HHT A;  1A5W A;  2O4G A;  2QWM A;  2W6L A;  1GLB G;  1YAG A;  1R0A A;  4DTP A;  2VG6 A;  4GVE A;  4CJU A;  3LL3 A;  5ELZ A;  1RT5 A;  3O4W A;  3I55 N;  3MWT A;  3NGZ A;  1SL2 A;  5M1Q A;  3KK3 A;  2E6L A;  4QAG A;  1IBL K;  3QIC A;  4CEO A;  1XHZ A;  5M1K A;  3ZEU B;  4IO9 L;  4O5B A;  4FJG A;  4J2D A;  4KRF A;  3VQ4 A;  5E26 A;  2F96 A;  3NMU A;  5KRS A;  4O5F A;  3A8Y A;  4LFB K;  1U2V B;  1C6V A;  5DK5 A;  3M5R A;  3O1W A;  5KI6 A;  3L4I A;  1W7A A;  1KVC A;  1REV A;  4Q5V A;  1BIZ A;  4A2A A;  4RG8 A;  4YOY A;  1U47 A;  5F2R A;  1XWL A;  3THY A;  5JMV A;  2OCE A;  1KRP A;  4F9O A;  2IS3 A;  4OPK A;  4U67 L;  2P9P B;  3O9Q A;  4CHN A;  1BDG A;  5AQV A;  3D2F A;  1XC3 A;  2D1K A;  4FZY A;  4CK3 A;  3EEQ A;  3QEV A;  3SMP A;  3JYT A;  4DTN A;  1JLE A;  3DI6 A;  5AQP A;  4YY3 K;  3MN7 A;  3JSM A;  1OH8 A;  2WOM A;  2QWL A;  2UXB K;  1C1C A;  3HOS A;  3VN5 A;  4IDK A;  3T19 A;  4C1N K;  2UUC K;  4JRQ A;  3NAE A;  3ZX2 A;  5C10 A;  4GKJ K;  3F2K A;  4B9L A;  1SUQ A;  4CEB A;  1NLV A;  2P9L A;  5BPM A;  2KFZ A;  3CM5 A;  2YHX A;  1J9A A;  1SQK A;  1EQY A;  4JI7 K;  1OKJ A;  3GG4 A;  3K5O A;  1JL1 A;  1K8K B;  1C1A A;  4AHU A;  2P9N B;  3VMF B;  2QW9 A;  1G15 A;  1VSI A;  3MXI A;  1Q8I A;  2O8C A;  4LD0 A;  2CH5 A;  1OH6 A;  4BY9 C;  1VQL N;  3A0I X;  4NXM K;  3O80 A;  1KC8 O;  3CPE A;  1CZA N;  5ADX H;  2HBJ A;  1IKW A;  4KHQ A;  5AZI A;  4CEZ A;  3K59 A;  1RIL A;  3PX6 A;  4GVM A;  5FRN A;  5CZ2 A;  1JL2 A;  3AVF A;  4CK1 A;  1QQN A;  1IH7 A;  3DRP A;  4KH5 A;  3IKM A;  1SL1 A;  2OZS A;  4DR3 K;  2XY7 A;  4LF4 K;  5CHI A;  4IZ9 A;  4WQ5 C;  2NRX A;  1J54 A;  3VTI A;  4NO7 A;  3HPG A;  4C1N I;  3AVH A;  4CZI A;  5D3G A;  1QZ5 A;  1BA0 A;  3I0S A;  1HNI A;  1QHA A;  5BR9 A;  2HNZ A;  4HTU A;  3CJB A;  2D4W A;  1NMD A;  1QSL A;  4H5N A;  3V6D A;  3V9Z A;  3SJH A;  3HT3 A;  2GV9 A;  3VF4 A;  5GIN A;  2YJF A;  3ZT0 A;  3TAG A;  1VQN N;  3RMC A;  3PX4 A;  1WSG A;  3AAR A;  4DUZ K;  3WXJ A;  2HNY A;  4DS4 A;  4QS8 A;  2PAV A;  5KTQ A;  3VQC A;  4CJ3 A;  1T3V A;  5C0Y A;  3NGI A;  1NKE A;  2HHT A;  2VG5 A;  4FOI A;  3DLK A;  1Y64 A;  3OJU A;  4UY8 O;  5DMR A;  4PA1 A;  4BGA A;  3OTO K;  4FYD A;  1C0T A;  3I33 A;  3B6O A;  1L3U A;  2KQ2 A;  1RBR A;  3P4I A;  3UKU B;  5K14 A;  3H46 O;  1OH5 A;  2P9I A;  1IJJ A;  4BR9 A;  1TYQ B;  1S22 A;  4HCC A;  4FM2 A;  5SZT A;  3AVJ A;  4HTL A;  4H0Y B;  3EE8 A;  1X9S A;  3IG1 A;  4M3W A;  3ZSR A;  1JLB A;  4W5O A;  3HO1 A;  1Z25 A;  4DV3 K;  3G25 A;  3V81 A;  4B1W B;  4JHD A;  5BR8 K;  3NFA A;  1A5X A;  3K57 A;  4K42 A;  1E3M A;  1IKV A;  2XY8 A;  3T7Z A;  4CJP A;  4IG0 A;  1I3A A;  4CJQ A;  3V9X A;  4DV7 K;  4BRI A;  1XUP O;  2V7Y A;  5HBM A;  4FPB A;  1V4S A;  3CFP A;  3SQ1 A;  2CGL A;  3L2Q A;  1ASV A;  3KVG A;  4FZX C;  1Q9X A;  1ATR A;  1LAW A;  3AO2 A;  2OZM A;  1RDW X;  5AQN A;  2X74 A;  4JN4 A;  1SAZ A;  5MLC Q;  3HJF A;  3KK7 A;  4CEF A;  2D0P A;  1CZB A;  4CER A;  4X62 K;  3H3O B;  2PYL A;  1TAU A;  2GWK A;  1TK0 A;  1U4B A;  3QEP A;  3CFO A;  3CJ1 A;  2ZJP L;  2GWJ A;  2HB5 A;  4DG1 A;  3L3U A;  4CEQ A;  2NZT A;  3S3O A;  4BQZ A;  1IBM K;  1QZ6 A;  3VF6 A;  4LF6 K;  4DCH A;  3C0B A;  4WCE L;  1LAV A;  4JI5 K;  1RCH A;  3QO9 A;  5AQY A;  3HI0 A;  4DSL A;  3VEN A;  1LOT B;  1H1V A;  4DFM A;  4M3Y A;  3AO4 A;  1V4T A;  2UUA K;  4X66 K;  4AM6 A;  4H0X B;  1OVQ A;  3NF6 A;  1VQ9 N;  4DSK A;  1NK9 A;  1NGC A;  5AQF A;  3L4Q A;  3A2F A;  3HYF A;  3NGY A;  1N36 K;  1YF5 L;  3O4N A;  4F8R A;  4WFB L;  2Z1H A;  1WAF A;  1BHL A;  4IJA A;  1KQS M;  3OBW A;  4B9Q A;  3SI6 A;  1RDD A;  1UA1 A;  2E2N A;  1MWM A;  2NUB A;  4B9M A;  3L2R A;  5BN8 A;  4M3R A;  1VSM A;  3H3N O;  2E2P A;  3TAF A;  4NYN A;  1YUW A;  3VET A;  3K9K A;  1ZC6 A;  1T6C A;  2HBM A;  4A57 A;  4N76 A;  3SBT A;  4BE1 A;  2BTF A;  2Y1I A;  3LWM A;  3ENH A;  4EFH A;  3M1F A;  4NXN K;  4OLB A;  4FSV A;  2IVO A;  2EX3 A;  3ITH A;  4MLH A;  4BWM A;  1EXQ A;  3M8S A;  4RW8 A;  4ID5 A;  1XMO K;  2FC0 A;  3KD5 E;  4M7X A;  3SYZ A;  3C6H A;  3RWU A;  4JI8 K;  1RDB A;  1QVF M;  3LP0 A;  4JKB A;  3OA9 A;  5LJV A;  4KTW A;  2PFU A;  5FPN A;  4DFJ A;  3C6T A;  3CJC A;  4LF9 K;  3RR7 A;  5CY4 A;  3M8R A;  1UWB A;  4L8R B;  2KFN A;  3DJC A;  1WBD A;  4Y1C A;  3L8B A;  1VAZ A;  4Z0U A;  4CHP A;  4DU1 A;  5GIP A;  2G8K A;  3CMA N;  5J2N A;  1U04 A;  4Z4I A;  4LF5 K;  4RWT A;  3VA0 A;  3GBT A;  3EKS A;  4LH5 A;  5I3U A;  4X65 K;  4ELU A;  2DFH A;  3AA5 X;  4JEP A;  5IT9 O;  2O8B B;  5LL6 Z;  3DLB A;  3DWL A;  3K58 A;  3PIO L;  4K43 A;  1OH7 A;  2E88 A;  2VYP A;  1SKW A;  1KAY A;  2B4J A;  5FPD A;  2CGJ A;  3PV8 A;  3QFP A;  2ITM A;  2O8E A;  1T44 A;  4I6M B;  4BR5 A;  4PHT X;  2E2Q A;  2YV0 X;  1JXE A;  3EYZ A;  2HST A;  4MLE A;  1J6Z A;  2P51 A;  1RTJ A;  2JWL A;  3FLC O;  1SZ2 A;  4ELT A;  2KW4 A;  1RT4 A;  4BRM A;  3HP6 A;  2ZGY A;  1W97 L;  2D0C A;  3DYA A;  3CCM N;  1HRH A;  3PO4 A;  2I5J A;  1TK8 A;  3FZH A;  2W6K A;  4C8N A;  1JLC A;  2X6N A;  5I42 A;  3QEX A;  3T1Y K;  1D8Y A;  2RKI A;  1FK9 A;  1UAX A;  2OTJ N;  5B8H A;  5AQM A;  1TV6 A;  4B1V A;  3EL2 A;  3ZT4 A;  4CVN E;  1EKE A;  4W5R A;  5EY4 A;  3OS0 A;  2D5R A;  4E19 A;  1VSD A;  1EO1 A;  3IDH A;  1WSF A;  2FLO A;  3I56 N;  1F21 A;  3IFR A;  3NF9 A;  2NRV A;  1NU0 A;  4FWM A;  1IO2 A;  2DFF A;  3MMV A;  4EP4 A;  4YOU A;  3ZSV A;  2ZF5 O;  1HJO A;  3LP1 A;  3U4L A;  2A5X A;  2KHO A;  4AQY K;  2GX9 A;  4FLZ A;  5HRR A;  4CES A;  4HUF A;  3QIP A;  4M45 A;  4E7H A;  3HPH A;  4FOE A;  1VQ7 N;  1K73 O;  3SUN A;  4NCG A;  3DXK A;  5JS1 A;  1QHT A;  1XI1 A;  3BZK A;  3AY9 A;  2OPR A;  5KPR A;  2ZQB A;  4F4K A;  4BRL A;  3NCI A;  5GAH P;  1XQS C;  3CJ9 A;  1NK5 A;  3EE9 A;  4MO4 A;  2DY4 A;  3H1Q A;  4M42 A;  2IC3 A;  5AFU A;  3MN5 A;  3NH0 A;  4A5A A;  1CZ9 A;  3THY B;  1HX1 A;  4CJT A;  4ID1 A;  4F2S A;  4JLH A;  3WT0 A;  3TAQ A;  1X9M A;  4CJK A;  4C8L A;  3OVN A;  4HCB A;  1FKP A;  1JXB A;  4AHT A;  4PQU A;  2WUS A;  3D2F B;  4FWQ A;  2PBD A;  1BCO A;  2Q31 A;  3AVM A;  4HVJ A;  3CJA A;  4DSE A;  3OW2 M;  2YHB A;  4WFN L;  4PL7 A;  2Q3S A;  4CW7 B;  3OYD A;  2E8A A;  3CCS N;  1ILY A;  1M1K O;  3M8Q A;  2UU9 K;  1XNR K;  5AQS A;  1W0H A;  3MEG A;  4A2B A;  1RDU A;  2WC9 A;  3O3G A;  2P5O A;  4GY2 B;  2IVP A;  1VSF A;  2HHW A;  1RTH A;  5BRD A;  4E7K A;  1X9W A;  4DQQ A;  3DMJ A;  3SV4 A;  4H03 B;  1BWF O;  2JGU A;  4DTS A;  3OY9 A;  1LWF A;  3KTQ A;  4Q0B A;  4K25 A;  5BRE A;  3QIO A;  3EY1 A;  3S3M A;  4FVU A;  2FSJ A;  5AQJ A;  4KAZ A;  1NGA A;  1RBS A;  1NM1 A;  1ESV A;  2O8D A;  1HR0 K;  1G99 A;  5M1P A;  4Y0W A;  3BUZ B;  4FWN A;  1Z05 A;  1NKC A;  3ULE B;  4F3T A;  4J2B A;  1NOY A;  3C6U A;  1NGG A;  3O9S A;  2VG7 A;  5DM6 L;  3PO5 A;  3THW A;  4ZTF A;  2QKB A;  5AQQ A;  2HOE A;  5JVG L;  4KPY A;  3BF1 A;  4CHQ A;  1NK0 A;  3R3L A;  4RW9 A;  3UIQ A;  1HNZ K;  1GLF O;  5CE3 A;  3SAG A;  4OPH A;  4N5S A;  3CXC M;  4CFD A;  4DR4 K;  4JKH A;  1YT3 A;  1XC9 A;  3AVI A;  1RBU A;  2ETJ A;  2VWJ A;  1HYV A;  4DQR A;  4IEE A;  4HWI A;  2Z1J A;  3ULD A;  1EWR A;  2ATQ A;  2VCP A;  3KLI A;  3VF2 A;  4EAH D;  5KGX A;  2ASM A;  1HKB A;  3HVR A;  4O8U A;  3THV A;  4PKH A;  3MN9 A;  3HM9 A;  4R5P A;  3MDQ A;  2OYQ A;  3IRX A;  1P90 A;  4CIE A;  3IUC A;  3MN6 A;  4YOR A;  3JS6 A;  4BRD A;  4OVL A;  1A5V A;  3TAB A;  1VQO N;  2IGI A;  3J8A A;  4NLC A;  3DLR A;  1JLQ A;  3V1R A;  2Q0U A;  1KSP A;  2G8U A;  1JLA A;  4FLW A;  3ZET A;  1EX4 A;  3MX5 A;  4M3T A;  3F5T A;  4KFB A;  1WB9 A;  1HNV A;  4JK9 A;  1KLN A;  4B9V A;  3TSP A;  2Q0R A;  2P9I B;  1UOC A;  2AP1 A;  4ISE A;  3LPU A;  3WEE A;  1W2B M;  3PLA A;  1VSK A;  4E0D A;  4B3S K;  3MEE A;  3NE6 A;  4B1Y B;  2E5L K;  4E7I A;  3EZW A;  4W5N A;  4CBX A;  3LDN A;  1S1X A;  2P9S A;  3NVM A;  4M41 A;  4E1J A;  5GIO A;  1XHX A;  4H0P A;  3NH2 A;  2QEX N;  4BQL A;  5M1N A;  3G10 A;  4PWD A;  3LPT A;  4BE2 A;  5J2M A;  3SQ0 A;  5CR4 A;  1T05 A;  1S9E A;  4EHU A;  2A42 A;  1YJW N;  1NGE A;  4FK0 A;  3QEI A;  3P31 A;  3QBW A;  4YFU A;  3C7N A;  5C24 A;  4I7F A;  3CC4 N;  4CHZ A;  3C94 A;  4B8C A;  3THX A;  3J80 O;  4LFA K;  1RT3 A;  3VEZ A;  3SAH A;  4IDH A;  4IG3 A;  2DTU A;  3HBT A;  2KTQ A;  3H45 C;  3AGR A;  1JCG A;  3V4I A;  1U49 A;  3AA3 A;  3WNF A;  4E7L A;  1TAQ A;  2QWN A;  4DV5 K;  3Q7B A;  4DUY K;  4GKK K;  3CQ8 A;  5FPM A;  4KHY A;  1NGD A;  2CH6 A;  1HYZ A;  4AHR A;  3CC7 N;  1FKO A;  1ZXO A;  1BIU A;  1KXP A;  1TUY A;  4L3Q A;  3VPZ A;  4LF7 K;  4FO0 A;  2JLE A;  5JLH A;  5DM7 L;  2XHB A;  4FJL A;  5BRF A;  1E4G T;  2JWK A;  3SPY A;  4FLU A;  5C15 A;  5JLF A;  3ZT3 A;  4O4G A;  1L3T A;  1Y97 A;  2YHY A;  4CIF A;  3KLH A;  1TK5 A;  1SKR A;  5CYQ A;  3LAK A;  4KH6 A;  3J81 O;  1L5U A;  4DQP A;  2IOC A;  2OA8 A;  4IXC A;  3C95 A;  3L3V A;  3KIO A;  3RR8 A;  1K6Y A;  3VQ8 A;  4GV6 A;  3ENO A;  3WQU A;  4BRE A;  3RSE B;  2CGK A;  4B3O A;  2HVH A;  4CGH A;  2G8I A;  1YIJ N;  1Z6R A;  1NGB A;  3ATU A;  4JD2 B;  3HXM A;  4O0I A;  1RT2 A;  3L0Q A;  5BN9 A;  5C12 A;  5BRH A;  3OYK A;  1HLU A;  3A5M C;  3U6F A;  2YNI A;  4FXD A;  2G8H A;  3K9J A;  3WUH A;  3E66 A;  4BRA A;  3VQB A;  3MEC A;  3KHY A;  4Z4C A;  3DLE A;  1LW0 A;  4PY5 A;  1T7P A;  1JCF A;  4PKG A;  2A1R A;  1U45 A;  1U2V A;  3OYM A;  3TTF A;  3CER A;  4FW2 A;  4MDB A;  3O6W A;  4JI4 K;  3KJV A;  1K8A O;  4FLV A;  2G8W A;  1NG9 A;  3MK6 A;  4CGG A;  2F8S A;  1JLF A;  1C0G A;  1RBT A;  1I39 A;  3SBG A;  2WBN A;  5AZJ B;  2Z1I A;  2QTD A;  3KD1 E;  1ZBH A;  3VA3 A;  4FWK A;  2NRH A;  3AVL A;  2Z1G A;  3S9H A;  2HMI A;  5ADX A;  1MDU B;  4B3T K;  4JI0 K;  2O8F B;  4BRK A;  1NMN A;  3AO5 A;  3FFK B;  1GLE G;  4FJ9 A;  2QWQ A;  1TKT A;  3OYE A;  2AA4 A;  4X64 K;  3VTH A;  3IMX A;  1VSL A;  2O8E B;  5AQH A;  4B9S A;  4CZL A;  3K0S A;  3VEY A;  2QK9 A;  3AVC A;  3ZSZ A;  4IFE A;  4JK7 A;  1IG8 A;  4CJV A;  4YOV A;  4DV0 K;  3WXK A;  3QEW A;  4DR1 K;  4QS9 A;  4IEI A;  3ZT1 A;  3LWL A;  3PX0 A;  3AAP A;  4CJW A;  4BRQ A;  1ZBF A;  1Q18 A;  4GMJ B;  2I7N A;  1K8K A;  4C23 A;  1QSY A;  2P9N A;  3OYC A;  2B5J A;  2VGN A;  4CJF A;  4OPJ A;  4FK2 A;  3HTV A;  1BIS A;  2YJE A;  3FZM A;  1NKB A;  2HMP A;  3B6P A;  4H8K A;  3IS9 A;  1NWK A;  4PKI A;  4CED A;  5FPE A;  3H08 A;  4M3X A;  4DLG A;  5IWA K;  3D0P A;  2Q2R A;  3G6E N;  1BI4 A;  3ISN C;  2QM1 A;  5H1S Q;  4K41 A;  2EWS A;  4N47 A;  4CFB A;  3D7E O;  1SV5 A;  2G8F A;  3HL8 A;  4JKA A;  1TUU A;  3R8E A;  1S1W A;  4IBN A;  2GTD A;  4DSI A;  4EHT A;  3BY5 A;  3AVG A;  4OJR A;  3DLL L;  2VGM A;  3OYG A;  4FK4 A;  1NOZ A;  3KKS A;  4BGB A;  2UYT A;  1VHX A;  3AAQ A;  3O3H A;  2GEL A;  4DQI A;  3SUP A;  2H3G X;  2RPI A;  2ASO A;  4IOC L;  3VEW A;  3MCA B;  3HP9 A;  4JKC A;  1ASU A;  4JKG B;  5CYM A;  4CJR A;  4DV2 K;  4OGC A;  2GEM A;  2F9W A;  4CF2 A;  4CZM A;  2QXF A;  2P9K B;  3TSU A;  3DXM A;  4AHV A;  1IG9 A;  4K8Z A;  1VSH A;  4M63 C;  2FF3 B;  4CD3 A;  4RW6 A;  5AQK A;  5AQO A;  3SQ4 A;  2FBY A;  3DOK A;  5C2F A;  1WSE A;  1VK0 A;  3CG7 A;  1HQE A;  4FL9 A;  4CE9 A;  3UKU A;  4CZJ A;  5AQG A;  2PYJ A;  3RMD A;  2YKM A;  1TVR A;  1TYQ A;  4DR2 K;  4BWJ A;  1R59 O;  4LFC K;  2YNG A;  3L6Q A;  1S1T A;  4BRC A;  4DFP A;  3T69 A;  4AM7 A;  1D9F A;  5AR0 A;  4XEI A;  4H5V A;  2ZJR L;  3AA4 A;  5BPL A;  4AHC A;  4GV3 A;  4KH4 A;  3QNO A;  2OTL N;  4QOZ B;  3MWP A;  5SWM A;  1ZYQ A;  3DAW A;  5AQX A;  5AJ3 K;  1Z26 A;  1EET A;  4LSL A;  5E41 A;  3P39 A;  4U7B A;  2D0A A;  1YVU A;  3FZK A;  2O8D B;  1LV5 A;  3VQ9 A;  3V9S A;  3GE1 A;  3KKR A;  1KFD A;  3TPQ A;  2WFB A;  4JYA K;  3ZLJ A;  2XY6 A;  1TKX A;  4QS7 A;  4CGJ A;  3LM9 A;  3NDK A;  2HHV A;  4RW7 A;  1BG3 A;  1C0M A;  3VEV A;  2Q1N A;  3U3Y A;  4JKF A;  4N56 A;  3CCL N;  3W0L A;  1S1U A;  5EVZ A;  1Q81 O;  4DTU A;  2G8V A;  3D45 A;  4DFK A;  2QKK A;  2IIR A;  3AA2 A;  3ZCM A;  1N8R O;  3G71 N;  3WQT A;  3VQQ A;  3TTC A;  4DQ8 A;  2QA4 N;  1VQK N;  3NF8 A;  3DM2 A;  5EX5 A;  4KHW A;  3NBP A;  3DLG A;  2GUI A;  3JAM O;  3MXM A;  3ZSQ A;  3UKR A;  2R7Y A;  3LDO A;  4JNE A;  2NNW A;  1ZBL A;  3NHG A;  1S9G A;  1Q86 O;  3A5O C;  4IJN A;  2DFE A;  3JXU A;  3RRH A;  1X9J A;  3SLC A;  4A61 A;  3CCR N;  4FJJ A;  1T6D A;  4C8O A;  3CCV N;  4ILH A;  1WNS A;  4A59 A;  4DR5 K;  1HKG A;  4FJI A;  4LH4 A;  2X6S A;  2OAN A;  4BG9 A;  3ASM A;  4H5R A;  3RTV A;  2OPS A;  1BQM A;  1YJN N;  3PIP L;  4CZK A;  2EHG A;  4YHH K;  4IFY A;  3KLE A;  3CIP A;  2A1S A;  1GLL O;  1NBW A;  3GL1 A;  4Z4E A;  3KZB A;  3C6A A;  2IAJ A;  4I9L A;  1X1P A;  3MXJ A;  4ISG A;  1QSS A;  2A41 A;  1RNH A;  5JIC A;  4ILG B;  3PSI A;  4OPA A;  2P9S B;  2VQF K;  3LDQ A;  3HZ6 A;  4KB0 A;  3O9R A;  3SNN A;  5GAG P;  3R1X A;  2Q97 A;  1HKC A;  4JI6 K;  4FJ5 A;  3HOT A;  2OPQ A;  1HUX A;  5AQR A;  2B6A A;  4LY7 A;  4CJ5 A;  1D5A A;  2RHK A;  3CQY A;  2RF2 A;  3D2E A;  5AQW A;  3AVB A;  5FRM A;  2FBX A;  2WON A;  1SL0 A;  2PZS A;  2RN2 A;  2P9L B;  3ALY A;  5BPN A;  1EP4 A;  1NJI O;  1N5Y A;  1RGI A;  3QET A;  2PY5 A;  3O3F A;  4XH1 A;  3FFI A;  4DS5 A;  5HRO A;  4FJN A;  1U48 A;  3H1V X;  3V1Q A;  4FZZ A;  4KI4 A;  2O8C B;  1BUP A;  4W5Q A;  3SV3 A;  2YX6 A;  1B9D A;  5J1E A;  4F3O A;  1ZBS A;  2AJQ A;  4I2Q A;  5E84 A;  4FW1 A;  2E4L A;  3VOV A;  5AZI B;  5JS2 A;  4I6M A;  3QNN A;  1DT9 A;  1NNE A;  2BDP A;  4JI2 K;  3LDS A;  3O8M A;  1JKH A;  3PUF A;  3CCJ N;  1VQ8 N;  4MQ3 A;  1GLA G;  1DKG D;  1BOT O;  1HQU A;  1X3N A;  2P9U A;  4H4O A;  3SK3 A;  4CJE A;  1T03 A;  1C1B A;  3QML A;  3SJJ A;  4NCB A;  1HNW K;  4BC4 A;  1OVY A;  3CM6 A;  1WAJ A;  1LW2 A;  3B8A X;  1BO5 O;  3OYL A;  4WQ4 A;  3UB5 A;  3T3F A;  4M3Z A;  3RVC A;  4Z94 A;  3CC2 N;  3M8P A;  4BRN A;  2HHS A;  3N4P A;  2Y1J A;  2BH1 A;  4TSX A;  2ZM6 K;  2UXD K;  1O13 A;  1QQO A;  3LZI A;  4R79 A;  4BE0 A;  4E89 A;  3ZSW A;  2J4R A;  3VER A;  4FM1 A;  1L3V A;  4IOX A;  4KB1 A;  4JKD A;  1MWK A;  3L2V A;  4DV4 K;  2KZZ A;  4ELV A;  4JI3 K;  5GAD P;  1GOB A;  3WXM B;  2P1J A;  5J2P A;  4CHO A;  1VSJ A;  2NRZ A;  4BDZ A;  4JS4 A;  2YI1 A;  3SUO A;  1HPM A;  1ZBI A;  1DTT A;  5AQZ A;  3HPO A;  2HBK A;  4IO8 A;  4WE1 A;  4DSF A;  4DU4 A;  1RBV A;  2E1Y A;  3RRG A;  4UQG A;  2NLX A;  4KV8 A;  1B9F A;  4FLY A;  2FBV A;  4E7J A;  2A40 A;  4CGI A;  3ID8 A;  3ZSO A;  4FWP A;  2E2O A;  2YHW A;  2ITG A;  3NVK A;  4Z4F A;  3EZ5 A;  5EU7 A;  4V19 S;  3CQX A;  4BC5 A;  4JS5 A;  4K0K K;  3DRS A;  3VGL A;  4JHD B;  4BRP A;  3OYB A;  2HHU A;  4YDU A;  3ATV A;  1IKX A;  4O0J A;  1P8Z A;  1J53 A;  3K2P A;  2YKN A;  1N32 K;  3F73 A;  3U3G A;  4FCY A;  3DLH A;  3KWI A;  3WNG A;  3P38 A;  2KKZ A;  4JKE A;  1YIT N;  5FRO A;  3K5N A;  5C25 A;  2XY5 A;  3MED A;  4PL8 A;  4ISF A;  1KFS A;  3HRG A;  4E1N A;  4E1M A;  1ATN A;  1SS6 A;  4B9U A;  4DF8 A;  3CI5 A;  4DU3 A;  1N33 K;  4JI1 K;  3TI0 A;  2D0O A;  1WSI A;  3V9W A;  1XMQ K;  5KPT A;  3V1O A;  3HSC A;  4Z4H A;  3H6E A;  3WXL A;  3F9K A;  2WTU A;  4CK2 A;  3ID6 A;  3QFU A;  4B3M K;  1ZBU A;  4CI6 A;  3U8X A;  4OKE A;  1KAX A;  4DMN A;  1DLO A;  4BR4 A;  3LAL A;  3TAM A;  1RFQ A;  4A5B A;  3TR8 A;  5I9E B;  1S5J A;  4DTR A;  2HW3 A;  4HUE A;  5KRT A;  3QER A;  3AO3 A;  1HJR A;  4OGE A;  2BUP A;  3WNE A;  1DTQ A;  3GOI A;  4W5T A;  1JLG A;  2P5G A;  2FF6 A;  4MO5 A;  4CHY A;  4JV5 K;  4H0V B;  5HRP A;  3UE5 A;  3BEX A;  1YTU A;  4CF1 A;  2XO7 A;  1BI4 B;  2HHQ A;  3ULE A;  5EXW A;  1FW6 A;  4CFA A;  3KLG A;  3MCP A;  3OHR A;  2ZWH A;  3Q7C A;  4FJK A;  4H0T B;  3E9P A;  3E9L A;  5JVH L;  4WF9 L;  2Q36 A;  1WSJ A;  4CZE A;  2YNH A;  4KKO A;  1WLJ A;  4EZ9 A;  1NJY A;  4C8K A;  2HVI A;  1BQN A;  2YNF A;  1VQP N;  3QDK A;  4MDA A;  4BRO A;  1VRU A;  4B08 A;  1KVA A;  3VQ6 A;  3R6M A;  5AQT A;  2DPN A;  1YHQ N;  1YXQ A;  2E20 A;  5TKW A;  4YOX A;  4FPA A;  4XH5 A;  4NCA A;  1S6P A;  5HOO A;  1E4F T;  4FVM A;  3P83 D;  3A5N C;  3AO1 A;  3CCE N;  4JRP A;  1S3X A;  3I0R A;  2BAN A;  1MA9 B;  3CD6 N;  3CPW M;  3LP3 A;  1SKS A;  5HRN A;  4CGD A;  5KPZ A;  4NLB A;  4FWO A;  3RMB A;  3CET A;  4CZG A;  3ZEU A;  4XH4 A;  5HP1 A;  3BDP A;  3QIN A;  1WUA A;  2F4V K;  3SCX A;  3LP2 A;  4J8F A;  3DXM B;  3LDL A;  3CME N;  4O55 A;  3L2W A;  1NK4 A;  3CCU N;  4DLE A;  3DOL A;  3VEX A;  2LSN A;  4DV6 K;  3CYM A;  3P5J A;  3G0Z A;  3OS2 A;  1WOQ A;  2W42 A;  3VES A;  1U6Z A;  2ZJQ L;  2P9P A;  4GNI A;  4FJ8 A;  1GOC A;  4B9T A;  4CJS A;  1FJG K;  3SZ2 A;  2BGG A;  3G4S N;  1RT6 A;  2V52 B;  1S1V A;  3P1G A;  1N34 K;  1KCF A;  4FLT A;  4G9Z A;  1CXQ A;  3S41 A;  3QB0 A;  1MU2 A;  2FSK A;  4YNQ A;  3CF5 L;  1HPZ A;  3SPZ A;  1D9D A;  4DSJ A;  3SUQ A;  3E01 A;  4WFA L;  3ZSX A;  4OLA A;  1VRT A;  1D4X A;  1LWE A;  3U9D A;  3HST B;  4O8K A;  4DR6 K;  4KO0 A;  4NB4 A;  1HMV A;  3GDQ A;  1LCU A;  1O1W A;  2V51 B;  4CIG A;  3EKU A;  3VQ5 A;  1BCM A;  3QBX A;  4EP5 A;  2VWK A;  3I8D A;  4CEA A;  2A6A A;  3O08 A;  3OYN A;  4I2P A;  3MAQ A;  3VQP A;  4EZ6 A;  4DTX A;  2QXL A;  3E9O A;  4H5T A;  1NJZ A;  3EN9 A;  3K5M A;  1WBB A;  3RMA A;  1UA0 A;  1TL1 A;  5KGW A;  3OYI A;  4CCH A;  3PY8 A;  3QLH A;  5TKY A;  4OO1 J;  2QWO A;  4WQ4 C;  4ZTJ A;  1WSH A;  3HM8 A;  4C8M A;  3VEO A;  4K8X A;  3TAE A;  1VQ6 N;  1VQ4 N;  4KHS A;  4IKF A;  4E3S A;  4AIL C;  3OBY A;  4AHS A;  3V9U A;  1BGX T;  3N4Q A;  1QQC A;  3UKR B;  2IVN A;  1BL3 A;  2KLA A;  4WYB A;  2D0B A;  1NGF A;  1TKZ A;  1KD1 O;  4CJL A;  5F1X A;  4B1Z A;  4BDY A;  4BC3 A;  1QVG M;  3DXK B;  3MX2 A;  3O9U A;  4BR2 A;  3FZL A;  3AVN A;  4I9Q A;  3I8B A;  3WNH A;  3LAN A;  2F7T A;  3OYJ A;  3RSE A;  3BF3 A;  1NJX A;  4G1Q A;  3E1Y A;  1I94 K;  3FR0 A;  3TAN A;  5AQL A;  3FGU A;  4JD2 A;  3AVA A;  4A62 A;  1J5E K;  1LWC A;  3AV9 A;  4MFB A;  1EWQ A;  4IWV A;  3DRR A;  1DEJ A;  4B8A B;  1VQ5 N;  3EO3 A;  4CD1 A;  1RT7 A;  4XIU A;  2VWB A;  2W40 A;  3AGK A;  4KHN A;  4YDU C;  3U9Z A;  2E1Z A;  4DF4 A;  3ENB A;  3KK2 A;  1NGH A;  4CBW A;  4JK8 A;  2HHX A;  2NRT A;  4YOT A;  3HK2 A;  4DQS A;  4LSN A;  2FBT A;  4BRH A;  4OKK A;  4DKW A;  3CCQ N;  5KQD A;  1GLD G;  4KHP K;  4RCH A;  3SAF A;  1NK6 A;  1JJ2 M;  3S3N A;  1NGI A;  4DB3 A;  2UXC K;  4N41 A;  4GW6 A;  5T7B A;  4B1U B;  2HND A;  1IKY A;  3R9P A;  3D2E B;  4AF1 A;  1M90 O;  3PSF A;  3O9T A;  1YJ9 N;  5AZJ A;  3OYA A;  3KWG A;  1NK7 A;  3ZYY X;  1TL3 A;  3FE1 A;  4BR7 A;  4CJ7 A;  4EIA A;  1IBK K;  4H4M A;  1NGJ A;  2XRI A;  5AFU H;  1CXU A;  3CJ7 A;  2O8F A;  3LAM A;  4BVO A;  3LM2 A;  4PUO A;  4FJM A;  1QE1 A;  3J7A P;  1VSE A;  5M1F A;  1QQM A;  3ZSY A;  3K5L A;  2BE2 A;  1C0F A;  1NJW A;  1N6Q A;  4DR7 K;  3THW B;  4KI6 A;  1CLQ A;  1Q9Y A;  3OJS A;  1ITG A;  4B3R K;  1NK8 A;  2P9U B;  3VGK A;  4M3U A;  4CEE A;  3C65 A;  5LMN K;  4B1X B;  3J7Z O;  3A5L C;  4BC2 A;  1RTI A;  4CF8 A;  2QI2 A;  2ZGZ A;  5AQI A;  2QWR A;  4KHU A;  3T1H K;  5FLX O;  2GBZ A;  1ATS A;  4F2R A;  1Q7Y O;  4CF9 A;  4J2A A;  2FXU A;  2OPP A;  3VQA A;  4CZF A;  3ZT2 A;  1VQM N;  5HRS A;  1T8E A;  4DTO A;  4J2E A;  3NF7 A;  5LY3 A;  4WQ5 A;  2ASP A;  4BDP A;  4FWL A;  3SQ2 A;  1JCE A;  3VGM A;  4KBO A;  4CFC A;  3ZX0 A;  4DTJ A;  1TGO A;  1GOA A;  1RDC A;  5LMU K;  1W9H A;  1GLJ O;  1YI2 N;  3TSQ A;  5HL7 L;  3L2U A;  1IV0 A;  3CFR A;  3BP8 A;  3VQE A;  3NH1 A;  3O5B A;  4M7Y A;  3F9M A;  4FJX A;  4KTZ A;  2UUB K;  2HF3 A;  3HVT A;  4B9N A;  3CHW A;  3ZET B;  1KVB A;  2E6M A;  2X78 A;  3VQ7 A;  4KTQ A;  3TAP A;  4H5W A;  5C42 A;  5KQ8 A;  2W41 A;  4CF0 A;  1HNX K;  4Y1D A;  4DTM A;  4QCL A;  2HBL A;  1B92 A;  3WEE B;  4KRE A;  4FJH A;  1QTM A;  3TTD A;  1Q82 O;  4CEC A;  1BU6 O;  4JKG A;  4RW4 A;  4ZHR A;  4BRF A;  3FZF A;  4DWI A;  5M1O A;  4Z4G A;  4FM0 A;  3O1B A;  3KLF A;  2P9K A;  4IOA L;  1YTA A;  2YCH A;  3M3Z A;  5FDL A;  1S6Q A;  2RE2 A;  3LZJ A;  1XNQ K;  4LF8 K;  5F0X A;  2YHA A;  1K9M O;  1WN7 A;  1X3M A;  5CZ1 A;  4DV1 K;  2QWP A;  2VQE K;  2F9T A;  4BAC A;  1J5O A;  3C7N B;  4BG8 A;  4YOW A;  1L3S A;  4FJ7 A;  1GLC G;  4ICL A;  3W3D A;  4BVP A;  2NRW A;  3THX B;  3O4Q A;  3WXI A;  3QES A;  1KAZ A;  3AVK A;  1KTQ A;  5LJW A;  3ZX3 A;  4CZH A;  4OX9 K;  1RT1 A;  2O8B A;  1KLM A;  1FXX A;  3TWH A;  2IDO A;  2O4I A;  1DGK N;  4LC9 B;  2NRR A;  2ZD1 A;  1BA1 A;  3OYH A;  1RDA A;  2I7P A;  4FLX A;  1S72 N;  1YVN A;  5A2Q O;  4BR0 A;  1HYS A;  2ZE2 A;  3TAR A;  4JAX A;  1ASW A;  4H0O A;  4IFV A;  4OKJ A;  4HUG A;  3BZC A;  4RTF D;  2HF4 A;  2A3Z A;  2GUP A;  3IAY A; 
#chains in the Genus database with same CATH homology
 1UAX A;  3OYF A;  1NKB A;  1RTD A;  3B6P A;  1TV6 A;  4H8K A;  5HRP A;  1QS4 A;  3IS9 A;  3ZT4 A;  1YTU A;  4CF1 A;  4CED A;  3H08 A;  1TKD A;  2XO7 A;  4M3X A;  1EKE A;  1BI4 B;  4DLG A;  4W5R A;  2HHQ A;  3VQD A;  3OS1 A;  3D0P A;  3KK1 A;  1C0U A;  4CFA A;  2D5R A;  3OS0 A;  5J2Q A;  1BI4 A;  3KLG A;  3BGR A;  2KZM A;  4E19 A;  4FJK A;  1VSD A;  3ISN C;  2F8T A;  1WSF A;  4AH9 A;  1WSJ A;  2YNH A;  4KKO A;  1WLJ A;  4NYF A;  4N47 A;  4CFB A;  4EZ9 A;  1NJY A;  4C8K A;  4O44 A;  2HVI A;  1BQN A;  2YNF A;  1SV5 A;  1F21 A;  2G8F A;  4CGF A;  1VRU A;  3T1A A;  4B08 A;  1KVA A;  3NF9 A;  5HLF A;  3HL8 A;  4CJ4 A;  4HHT A;  1S1W A;  1IO2 A;  1A5W A;  2DFF A;  4IBN A;  3VQ6 A;  2O4G A;  4EP4 A;  3ZSV A;  4DSI A;  3LP1 A;  1R0A A;  4DTP A;  2VG6 A;  4CJU A;  4NCA A;  1S6P A;  1RT5 A;  4FLZ A;  4FVM A;  3P83 D;  3AVG A;  5HRR A;  4OJR A;  3AO1 A;  4CES A;  3NGZ A;  3OYG A;  4HUF A;  1SL2 A;  4FK4 A;  3QIP A;  4M45 A;  1NOZ A;  3KKS A;  3KK3 A;  3I0R A;  4JRP A;  4E7H A;  3HPH A;  2E6L A;  2BAN A;  4QAG A;  3O3H A;  4DQI A;  3LP3 A;  4CEO A;  5HRN A;  3SUP A;  1SKS A;  1XHZ A;  2RPI A;  4CGD A;  3SUN A;  4NCG A;  5JS1 A;  1QHT A;  1XI1 A;  3RMB A;  4O5B A;  2OPR A;  4FJG A;  4J2D A;  4KRF A;  3VQ4 A;  3HP9 A;  2ZQB A;  2F96 A;  4F4K A;  3NCI A;  1ASU A;  5HP1 A;  5CYM A;  3BDP A;  3QIN A;  3SCX A;  5KRS A;  1NK5 A;  3LP2 A;  4CJR A;  2DY4 A;  4OGC A;  4O55 A;  1C6V A;  4CF2 A;  5DK5 A;  4M42 A;  2QXF A;  5KI6 A;  2IC3 A;  4AHV A;  3NH0 A;  1IG9 A;  1KVC A;  1CZ9 A;  3L2W A;  1REV A;  1VSH A;  1BIZ A;  4Q5V A;  1NK4 A;  4K8Z A;  4DLE A;  3DOL A;  4CJT A;  4RG8 A;  4ID1 A;  4F2S A;  1U47 A;  2LSN A;  1XWL A;  4JLH A;  4RW6 A;  3CYM A;  3P5J A;  3G0Z A;  3OS2 A;  4CJK A;  3TAQ A;  1X9M A;  4C8L A;  1KRP A;  3SQ4 A;  2IS3 A;  3OVN A;  4OPK A;  4HCB A;  1FKP A;  1JXB A;  4AHT A;  4PQU A;  2W42 A;  2FBY A;  3DOK A;  4CHN A;  1WSE A;  1BCO A;  3AVM A;  4HVJ A;  1VK0 A;  3CG7 A;  4FZY A;  1HQE A;  4CK3 A;  4DSE A;  4CE9 A;  4FJ8 A;  1GOC A;  4B9T A;  2YHB A;  4CJS A;  2PYJ A;  3RMD A;  3QEV A;  2Q3S A;  2YKM A;  3JYT A;  1TVR A;  3SZ2 A;  4DTN A;  1JLE A;  3DI6 A;  3OYD A;  2BGG A;  4BWJ A;  1RT6 A;  3JSM A;  2YNG A;  3M8Q A;  2WOM A;  1S1V A;  3P1G A;  1S1T A;  1KCF A;  1W0H A;  4FLT A;  1C1C A;  4DFP A;  1CXQ A;  4IDK A;  3T19 A;  3VN5 A;  4JRQ A;  3MEG A;  3NAE A;  1MU2 A;  3O3G A;  2P5O A;  4YNQ A;  1D9F A;  1VSF A;  1HPZ A;  3SPZ A;  1D9D A;  4B9L A;  4DSJ A;  3SUQ A;  1SUQ A;  3AA4 A;  3E01 A;  4CEB A;  4AHC A;  3ZSX A;  4OLA A;  1RTH A;  2HHW A;  4E7K A;  3QNO A;  4QOZ B;  1X9W A;  1VRT A;  4DQQ A;  2KFZ A;  5SWM A;  1LWE A;  3CM5 A;  3DMJ A;  3HST B;  3SV4 A;  1J9A A;  1ZYQ A;  2JGU A;  4KO0 A;  4DTS A;  3OY9 A;  1HMV A;  1LWF A;  3KTQ A;  4Q0B A;  1Z26 A;  1EET A;  1O1W A;  3K5O A;  4LSL A;  1JL1 A;  5E41 A;  4CIG A;  1C1A A;  4AHU A;  3QIO A;  3EY1 A;  3S3M A;  2D0A A;  1YVU A;  3VQ5 A;  1G15 A;  1BCM A;  1VSI A;  4KAZ A;  1LV5 A;  3VQ9 A;  4EP5 A;  3V9S A;  3MXI A;  3KKR A;  1KFD A;  1RBS A;  1Q8I A;  2VWK A;  4LD0 A;  3I8D A;  4CEA A;  3OYN A;  4I2P A;  3MAQ A;  2XY6 A;  1TKX A;  3VQP A;  4EZ6 A;  4DTX A;  1IKW A;  4CGJ A;  1NJZ A;  1NKC A;  4F3T A;  4J2B A;  1NOY A;  4KHQ A;  3K5M A;  3C6U A;  3PO5 A;  2VG7 A;  3NDK A;  3RMA A;  1UA0 A;  1TL1 A;  4RW7 A;  5KGW A;  4ZTF A;  2HHV A;  1C0M A;  3OYI A;  4CCH A;  2QKB A;  4CEZ A;  3K59 A;  3PY8 A;  4KPY A;  3QLH A;  1RIL A;  3PX6 A;  4GVM A;  4CHQ A;  4ZTJ A;  5FRN A;  3U3Y A;  1WSH A;  5CZ2 A;  4N56 A;  1NK0 A;  4C8M A;  4RW9 A;  3UIQ A;  1JL2 A;  4K8X A;  3TAE A;  1S1U A;  4N5S A;  3AVF A;  4CK1 A;  4DTU A;  1IH7 A;  3DRP A;  4CFD A;  4E3S A;  3D45 A;  4DFK A;  2G8V A;  2QKK A;  4IKF A;  4KHS A;  4AIL C;  1SL1 A;  2OZS A;  2XY7 A;  3AA2 A;  3ZCM A;  4AHS A;  3V9U A;  1YT3 A;  1BGX T;  1J54 A;  3VQQ A;  1XC9 A;  3AVI A;  1RBU A;  3HPG A;  2ETJ A;  3AVH A;  2VWJ A;  1QQC A;  3NF8 A;  5D3G A;  3DM2 A;  4KHW A;  3NBP A;  1HYV A;  3DLG A;  1BL3 A;  3I0S A;  4DQR A;  1HNI A;  2Z1J A;  2GUI A;  3MXM A;  3ZSQ A;  2D0B A;  3ULD A;  2HNZ A;  2R7Y A;  4HTU A;  1TKZ A;  2ATQ A;  3KLI A;  5KGX A;  4CJL A;  3HVR A;  4BDY A;  1ZBL A;  1QSL A;  3NHG A;  3V6D A;  3THV A;  1S9G A;  3V9Z A;  3HM9 A;  4R5P A;  2OYQ A;  3AVN A;  2GV9 A;  2DFE A;  3IRX A;  4CIE A;  3HT3 A;  4I9Q A;  3WNH A;  3LAN A;  3ZT0 A;  3RRH A;  3TAG A;  4FJJ A;  4C8O A;  3RMC A;  3PX4 A;  3OYJ A;  1WSG A;  4OVL A;  1A5V A;  3TAB A;  1NJX A;  1WNS A;  4G1Q A;  2HNY A;  4DS4 A;  2IGI A;  4FJI A;  5KTQ A;  3TAN A;  3VQC A;  4LH4 A;  4CJ3 A;  2X6S A;  3AVA A;  1LWC A;  3DLR A;  1JLQ A;  3V1R A;  3ASM A;  3RTV A;  3AV9 A;  4MFB A;  2OPS A;  1BQM A;  1KSP A;  2G8U A;  2EHG A;  1JLA A;  4IFY A;  3NGI A;  4FLW A;  1NKE A;  3KLE A;  1EX4 A;  3DRR A;  4M3T A;  2HHT A;  2VG5 A;  3DLK A;  4KFB A;  4B8A B;  2A1S A;  1HNV A;  3OJU A;  1RT7 A;  5DMR A;  4PA1 A;  4XIU A;  1KLN A;  4FYD A;  1C0T A;  4KHN A;  4B9V A;  4Z4E A;  3B6O A;  1L3U A;  2KQ2 A;  4DF4 A;  1UOC A;  1RBR A;  2IAJ A;  4I9L A;  3KK2 A;  5K14 A;  1X1P A;  3LPU A;  3MXJ A;  1QSS A;  2HHX A;  4HCC A;  1VSK A;  4FM2 A;  5SZT A;  3AVJ A;  3MEE A;  4E0D A;  1RNH A;  3HK2 A;  3NE6 A;  4DQS A;  4LSN A;  2FBT A;  4E7I A;  4OKK A;  3IG1 A;  1X9S A;  4M3W A;  3ZSR A;  4W5N A;  1JLB A;  4W5O A;  3HO1 A;  1Z25 A;  3V81 A;  1NK6 A;  4KB0 A;  1S1X A;  3SNN A;  3S3N A;  4M41 A;  4N41 A;  4GW6 A;  5T7B A;  4FJ5 A;  3NFA A;  1A5X A;  2HND A;  1IKY A;  2OPQ A;  3K57 A;  1XHX A;  2B6A A;  4LY7 A;  4CJ5 A;  3NH2 A;  1IKV A;  1D5A A;  5FRM A;  2RF2 A;  2XY8 A;  3AVB A;  4CJP A;  3OYA A;  2FBX A;  4IG0 A;  3G10 A;  1NK7 A;  2WON A;  1I3A A;  1SL0 A;  2RN2 A;  2PZS A;  4PWD A;  3LPT A;  4BE2 A;  4CJQ A;  3ALY A;  1TL3 A;  3V9X A;  1EP4 A;  5J2M A;  1N5Y A;  3SQ0 A;  4H4M A;  3QET A;  5HBM A;  1T05 A;  2PY5 A;  1S9E A;  2XRI A;  1CXU A;  3O3F A;  4FK0 A;  4DS5 A;  3FFI A;  3QEI A;  5HRO A;  4YFU A;  3CFP A;  4FJN A;  1U48 A;  3LAM A;  3SQ1 A;  5C24 A;  4I7F A;  3L2Q A;  1ASV A;  3V1Q A;  4CHZ A;  4FZZ A;  3C94 A;  4B8C A;  4PUO A;  4FJM A;  4FZX C;  1Q9X A;  3AO2 A;  1LAW A;  4KI4 A;  2OZM A;  1RT3 A;  1QE1 A;  2X74 A;  4W5Q A;  4IG3 A;  3SV3 A;  2DTU A;  1VSE A;  3HJF A;  1B9D A;  2KTQ A;  5J1E A;  4F3O A;  2AJQ A;  4CEF A;  3V4I A;  3ZSY A;  3K5L A;  1U49 A;  1CZB A;  3AA3 A;  2BE2 A;  4I2Q A;  3WNF A;  4FW1 A;  4CER A;  4E7L A;  1TAQ A;  1NJW A;  1N6Q A;  2PYL A;  1TAU A;  2E4L A;  5JS2 A;  1TK0 A;  3QNN A;  1U4B A;  4KI6 A;  1CLQ A;  3CQ8 A;  3QEP A;  3OJS A;  1Q9Y A;  3CFO A;  4KHY A;  2BDP A;  3LDS A;  1ITG A;  1JKH A;  1HYZ A;  4AHR A;  3PUF A;  2HB5 A;  4DG1 A;  3L3U A;  4MQ3 A;  4CEQ A;  1NK8 A;  3S3O A;  1FKO A;  1HQU A;  1BIU A;  4M3U A;  4CEE A;  2JLE A;  4H4O A;  1LAV A;  1RCH A;  4CJE A;  3QO9 A;  1C1B A;  1RTI A;  4CF8 A;  2XHB A;  3SJJ A;  1T03 A;  4DSL A;  4FJL A;  4NCB A;  3SPY A;  4FLU A;  3CM6 A;  4DFM A;  4M3Y A;  1WAJ A;  3AO4 A;  1LW2 A;  3ZT3 A;  4O4G A;  4KHU A;  1L3T A;  1Y97 A;  4CIF A;  3OYL A;  3T3F A;  2GBZ A;  4F2R A;  3KLH A;  4M3Z A;  1TK5 A;  3NF6 A;  1SKR A;  4CF9 A;  5CYQ A;  1NK9 A;  4DSK A;  4J2A A;  3LAK A;  2OPP A;  3M8P A;  3VQA A;  2HHS A;  2Y1J A;  3ZT2 A;  3A2F A;  1L5U A;  4DQP A;  2IOC A;  3HYF A;  3NGY A;  5HRS A;  4DTO A;  1T8E A;  4J2E A;  3NF7 A;  4TSX A;  2OA8 A;  3C95 A;  3L3V A;  3LZI A;  4BDP A;  3KIO A;  3O4N A;  3RR8 A;  3SQ2 A;  4F8R A;  2Z1H A;  1WAF A;  1BHL A;  4CFC A;  4E89 A;  4BE0 A;  3ZSW A;  1TGO A;  4DTJ A;  1GOA A;  1K6Y A;  3VQ8 A;  3SI6 A;  1RDD A;  1UA1 A;  4FM1 A;  1L3V A;  2NUB A;  2HVH A;  1RDC A;  4KB1 A;  4B9M A;  4B3O A;  3L2R A;  4CGH A;  1W9H A;  3L2V A;  4M3R A;  2G8I A;  2KZZ A;  4ELV A;  3HXM A;  3L2U A;  4O0I A;  3CFR A;  1RT2 A;  1GOB A;  1VSM A;  3VQE A;  2P1J A;  3NH1 A;  5J2P A;  3TAF A;  3OYK A;  4CHO A;  4FJX A;  4KTZ A;  1VSJ A;  4NYN A;  4BDZ A;  3HVT A;  3U6F A;  4B9N A;  2YNI A;  4JS4 A;  3SUO A;  4FXD A;  1ZBI A;  1DTT A;  3HPO A;  1KVB A;  2E6M A;  2X78 A;  3VQ7 A;  4KTQ A;  4WE1 A;  4DSF A;  4N76 A;  4DU4 A;  1RBV A;  3TAP A;  3RRG A;  4BE1 A;  4UQG A;  5C42 A;  2G8H A;  2Y1I A;  3LWM A;  4KV8 A;  4CF0 A;  1B9F A;  4FLY A;  3VQB A;  4Y1D A;  2FBV A;  3MEC A;  4Z4C A;  4E7J A;  4CGI A;  3DLE A;  4DTM A;  1B92 A;  4QCL A;  3ZSO A;  4OLB A;  1LW0 A;  4KRE A;  4FJH A;  1QTM A;  2ITG A;  4PY5 A;  2EX3 A;  3ITH A;  4RW4 A;  4BWM A;  4CEC A;  4ZHR A;  1T7P A;  1EXQ A;  3M8S A;  3EZ5 A;  4Z4F A;  4RW8 A;  5EU7 A;  2A1R A;  4ID5 A;  1U45 A;  4DWI A;  2FC0 A;  3OYM A;  4Z4G A;  3KD5 E;  4FW2 A;  4FM0 A;  3SYZ A;  4JS5 A;  3RWU A;  3KJV A;  1RDB A;  3KLF A;  4FLV A;  3DRS A;  2G8W A;  2HHU A;  3LP0 A;  3OYB A;  4KTW A;  4CGG A;  1IKX A;  1YTA A;  3C6T A;  1JLF A;  4O0J A;  4DFJ A;  2F8S A;  3RR7 A;  1J53 A;  1RBT A;  3K2P A;  5FDL A;  1S6Q A;  2YKN A;  1I39 A;  1UWB A;  5CY4 A;  3M8R A;  3F73 A;  3LZJ A;  3U3G A;  4FCY A;  2YHA A;  2Z1I A;  3DLH A;  4L8R B;  2KFN A;  3KD1 E;  4Y1C A;  3WNG A;  1ZBH A;  3L8B A;  3VA3 A;  1WN7 A;  4Z0U A;  5CZ1 A;  3AVL A;  4CHP A;  4DU1 A;  2Z1G A;  2G8K A;  3S9H A;  5FRO A;  2HMI A;  5J2N A;  3K5N A;  5C25 A;  4BAC A;  1U04 A;  1J5O A;  2XY5 A;  3MED A;  4Z4I A;  1L3S A;  4FJ7 A;  3AO5 A;  3VA0 A;  4ICL A;  4LH5 A;  5I3U A;  1KFS A;  4FJ9 A;  4E1N A;  1TKT A;  4E1M A;  3OYE A;  3O4Q A;  3QES A;  2DFH A;  4ELU A;  3AA5 X;  1KTQ A;  3AVK A;  4B9U A;  4DF8 A;  4DU3 A;  3TI0 A;  3DLB A;  3V9W A;  1WSI A;  1RT1 A;  3K58 A;  1VSL A;  1KLM A;  3V1O A;  4Z4H A;  1FXX A;  4B9S A;  1SKW A;  2B4J A;  2IDO A;  3TWH A;  2O4I A;  3F9K A;  3PV8 A;  4CK2 A;  2ZD1 A;  1ZBU A;  4OKE A;  2YV0 X;  1JXE A;  2QK9 A;  3OYH A;  3AVC A;  3EYZ A;  4DMN A;  1DLO A;  3ZSZ A;  1RDA A;  2P51 A;  3LAL A;  4FLX A;  1RTJ A;  3TAM A;  4CJV A;  3QEW A;  1HYS A;  4ELT A;  2ZE2 A;  3ZT1 A;  3LWL A;  3TR8 A;  2KW4 A;  3PX0 A;  3TAR A;  1RT4 A;  1S5J A;  4DTR A;  3HP6 A;  4HUE A;  5KRT A;  4CJW A;  3QER A;  3AO3 A;  1ASW A;  2HW3 A;  1ZBF A;  4GMJ B;  4IFV A;  2D0C A;  3DYA A;  1HJR A;  4OKJ A;  1QSY A;  4HUG A;  1HRH A;  4OGE A;  2I5J A;  3WNE A;  1TK8 A;  1DTQ A;  3PO4 A;  4W5T A;  1JLG A;  4C8N A;  3OYC A;  2B5J A;  2P5G A;  1JLC A;  2X6N A;  4CJF A;  4OPJ A;  5I42 A;  4FK2 A;  3QEX A;  4CHY A;  1D8Y A;  1BIS A;  2RKI A;  3IAY A;  1FK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...