4CESA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cesA00
2BE2A 3TI0A 2AJQA 3ULDA 3SUPA 4E7LA 1SL2A 4B9NA 4DSKA 2DY4A 1MU2A 5SWMA 4DFPA 1BISA 4KHWA 2LSNA 3QERA 4CEDA 3RMAA 4IG0A 3ZSQA 3DOKA 3DMJA 3VA0A 2PY5A 2BGGA 4E7IA 1HPZA 3VA3A 3KKSA 3V9ZA 3C94A 4DQQA 3WNGA 4FJ9A 4H4OA 4KTQA 3QEPA 4Z4EA 1XI1A 3AVFA 2B4JA 3MECA 3RMBA 1JXBA 4KI6A 3ZSOA 3MEEA 1CXQA 4F2RA 4J2BA 4CF8A 3ZSVA 3VQQA 3HM9A 1L3TA 2F96A 3VQPA 3MXMA 4IDKA 1U4BA 4Z4GA 5FRNA 1YTUA 4FJJA 3HP6A 4CF9A 2GBZA 3CYMA 2KFNA 1A5VA 4KO0A 4CHYA 1RNHA 4CJRA 3RTVA 4FLWA 3OYKA 3SZ2A 1R0AA 1ZBIA 4MQ3A 4Z0UA 1NK8A 1T8EA 3DM2A 4CECA 3VQ9A 3TAEA 4FLUA 1N5YA 3KD1E 2QKKA 4DU4A 4M3TA 3QIOA 1XHXA 2E6MA 3VQ8A 1RT5A 3OYJA 1C1CA 4CHNA 1X9SA 4KI4A 3AO5A 1B92A 4M3WA 1VSKA 4Y1DA 1HNVA 4QAGA 1N6QA 3AVHA 1T05A 2O4IA 5C24A 3B6OA 4CHQA 4CJUA 4FK4A 1QS4A 2RPIA 2VG5A 3RMCA 1LAVA 4FJGA 1VSDA 1KFDA 3LAMA 4DTNA 3TAGA 3QINA 4N47A 1QTMA 5KGWA 3CFRA 4KPYA 3F73A 3C6TA 3NF9A 5FDLA 3K57A 3LZIA 3DLRA 4FLVA 5KTQA 1BIUA 3QEIA 3HYFA 4FZYA 3MXJA 1IKVA 4FM2A 1RDCA 4DTXA 3HJFA 4Q0BA 1HMVA 3WNEA 2IAJA 4FXDA 3NAEA 4F2SA 2HW3A 5KGXA 4CGFA 4QOZB 4CF0A 3K2PA 4W5OA 3SUNA 3P83D 3V1OA 4CFBA 1A5WA 4DFKA 3IAYA 3A2FA 3VQAA 1U45A 2GV9A 1LWEA 3VQBA 4E19A 1X9WA 4Z4HA 1QQCA 4W5RA 5KRSA 3L2RA 3AVAA 4CCHA 1X1PA 3LANA 4Y1CA 3LP1A 4FJNA 3M8QA 2XHBA 3DOLA 1SL1A 3HPGA 3CM5A 5FRMA 3LALA 3AO4A 3FFIA 4CJKA 2VWJA 3QEWA 4Z4IA 1RDDA 5J2QA 3IS9A 4DF8A 4HVJA 4E0DA 1KLMA 1RBSA 2D0CA 1RT6A 2VWKA 4DSEA 1QSLA 3BDPA 5HROA 1UOCA 2D0BA 1T7PA 1HYVA 4E7KA 4FK0A 2ZE2A 4K8ZA 4AHCA 3AO3A 2HNZA 1TKDA 2QXFA 4WE1A 1SV5A 3HVRA 4CJPA 1XHZA 1X9MA 3O4NA 1IKWA 3ZT4A 1S1XA 4FJKA 4IG3A 1VSIA 4HUFA 4CEEA 3WNHA 2HHSA 2PYJA 1YVUA 2KFZA 3NDKA 4KREA 2X6NA 3VQEA 4B9UA 2KW4A 4DQIA 2QK9A 4W5TA 1VSFA 3DRRA 3NF7A 5JS2A 4OPJA 3LWMA 4E7HA 4CGHA 1S5JA 4IFVA 3OYAA 1LAWA 2G8WA 3AVBA 1U04A 3V81A 3UIQA 4FJIA 1KCFA 1SKSA 3OS1A 4C8LA 1JL2A 3DLHA 3VN5A 1RT3A 4CJEA 4CHOA 4Z4CA 1TV6A 3LZJA 4N76A 3DLKA 4AHUA 3E01A 3AVJA 4CK1A 3SJJA 1IO2A 3M8RA 2G8VA 3ZCMA 2Z1JA 3TARA 4CJWA 2R7YA 4ELVA 3OYDA 3D45A 4FJ5A 1S6PA 4OVLA 4C8KA 4FLYA 1RTHA 3ALYA 1UAXA 2X6SA 3D0PA 3IG1A 1WLJA 2RF2A 4H8KA 3SQ4A 1HYZA 3NH1A 1L3UA 1SKRA 3L2QA 3B6PA 1JXEA 1D5AA 1RBUA 1RDAA 3U3GA 2P5OA 2IC3A 4IKFA 2DFEA 4DTMA 2OPRA 4CJVA 4DFJA 1EX4A 1S6QA 4HTUA 1D9DA 3TAPA 4CFCA 3L8BA 4DTUA 4RG8A 4Q5VA 3L2UA 3SCXA 3PV8A 3NGYA 1BCMA 1NK4A 3QO9A 3OYMA 4RW4A 2IS3A 4E1NA 2XY8A 5HBMA 1U48A 4ELTA 4C8OA 4KHYA 4K8XA 1ZYQA 2O4GA 2HVHA 3ZT2A 1KRPA 2Z1IA 2ETJA 1IH7A 4B08A 4DMNA 3LPUA 4OPKA 2YV0X 2A1RA 4CHPA 1NKEA 3CQ8A 5J2NA 4GVMA 4CK2A 1C0MA 3K5OA 3SPZA 2A1SA 4LD0A 3CFPA 4DTOA 5JS1A 4B9VA 1FKOA 1TKXA 5J1EA 3MXIA 1ZBFA 4FJXA 1CZ9A 1SL0A 5HRPA 4FW2A 2P51A 3PX6A 3KJVA 3LPTA 4KKOA 3TAFA 4AH9A 1G15A 3G10A 1S1UA 4IFYA 3K5MA 1WSJA 4CJ5A 4ZHRA 3T3FA 1TK5A 4F3TA 2KTQA 3QNNA 1HQUA 3HSTB 3RRHA 4DWIA 5EU7A 3DLEA 1TAQA 1LV5A 4BE0A 1J9AA 4CFAA 4JRPA 3HPHA 4FLXA 3VQDA 1KLNA 5CYMA 1QE1A 4CESA 4DSLA 4KHQA 3ZSZA 1BGXT 3NHGA 3OYBA 3VQ4A 5KRTA 5HP1A 3THVA 1RT2A 3AA4A 4HCBA 3KLHA 4E7JA 4JLHA 1O1WA 4LSNA 2FBTA 4DSFA 1IG9A 2PZSA 3VQ6A 3DYAA 3AO1A 3K5LA 1KVAA 2FBYA 1KSPA 1RILA 2QKBA 4NYFA 3JSMA 3ASMA 3IRXA 4E1MA 1JLQA 3OVNA 4CEOA 3KK2A 4AILC 3VQ5A 4CE9A 3AVGA 4M42A 4OLAA 4ID1A 3AA2A 4OJRA 3DI6A 1NKBA 3L2VA 1Z26A 4BDPA 4OKEA 4DU3A 3DLBA 4CGIA 2ITGA 3KTQA 4DSIA 4M3UA 4CEQA 4HUGA 3OYLA 3BGRA 3QESA 4DTJA 3S9HA 3PX4A 4C8NA 1QSYA 1KVBA 2NUBA 3TANA 4DTSA 3NCIA 4I9LA 1ASWA 4CERA 1EXQA 3K59A 4I9QA 4OLBA 2HHUA 3PO5A 3OYEA 3TAQA 1YT3A 3SNNA 1T03A 4NYNA 3HP9A 3OYFA 1NJXA 3RWUA 1RCHA 4F4KA 3HT3A 1ASVA 3JYTA 2YNGA 1TGOA 3AVCA 1B9DA 3ZT1A 4FJ7A 1LW2A 2W42A 3KLFA 3RRGA 3OJUA 3AV9A 1RBTA 2F8SA 3ITHA 1RT4A 2RN2A 1EKEA 3K58A 1A5XA 5DMRA 4M45A 1RTDA 3QNOA 4L8RB 3AVKA 2YHBA 1VRTA 3SQ1A 3HO1A 3LP0A 1C1AA 4DQSA 1EETA 4LSLA 3NH2A 4PY5A 4ZTJA 2G8KA 5FROA 4B3OA 2X78A 1SKWA 2BDPA 5D3GA 4OGEA 3OY9A 3SI6A 1CZBA 1TAUA 1JLBA 3AVNA 4FLTA 1RBRA 1TL1A 1L3SA 4PWDA 5I42A 1RTIA 1GOBA 1S1TA 3T19A 1QSSA 4C8MA 4KFBA 4CF1A 4EP5A 2YHAA 3V1RA 3V9SA 3C95A 4YNQA 3ZSXA 3MAQA 4DF4A 3DLGA 4KTWA 1NJWA 3NF8A 4PA1A 4BDZA 4CJ4A 3AA3A 1Y97A 1EP4A 3AO2A 3O3FA 3AVIA 5C42A 4FYDA 3G0ZA 2P5GA 2HHQA 5T7BA 4AHRA 3PUFA 1KFSA 5I3UA 2G8UA 3MEGA 4ELUA 1VRUA 1WSHA 3NFAA 3OYGA 3U6FA 2IOCA 1U49A 4FJMA 3V4IA 1VSJA 1HQEA 4HCCA 4EZ9A 2YKNA 1IKXA 3CM6A 2G8IA 1BQNA 2G8HA 2GUIA 2Q3SA 4FCYA 3SV4A 4KRFA 3M8SA 3AA5X 4BWMA 4DS5A 4RW8A 1ZBHA 1S9EA 1RTJA 1TVRA 2XRIA 3DRPA 3KLGA 2OPQA 4DSJA 2I5JA 4TSXA 2KZZA 3CFOA 5DK5A 3I0RA 1DLOA 4MFBA 5CY4A 2DTUA 5CZ1A 1D8YA 4BE1A 1FKPA 3HL8A 4R5PA 4I7FA 5J2PA 4DTRA 2WOMA 4M3ZA 1BI4B 4FZZA 4CGJA 4B8CA 1WSEA 2Z1HA 3O3GA 1WAFA 2Z1GA 1C0UA 2ZD1A 5HLFA 2HB5A 4O0IA 2F8TA 3NE6A 3HK2A 2EHGA 3ZT3A 1HRHA 1Q9YA 4J2DA 4E3SA 2Y1JA 3QEXA 1ZBLA 4EZ6A 4B9MA 4KAZA 1NJYA 3OYIA 2HVIA 4N56A 3O3HA 4M41A 4AHTA 1WN7A 3LWLA 4N41A 3LP2A 2FBXA 3OYCA 2HHXA 3S3OA 3KIOA 4CHZA 4UQGA 4G1QA 4NCBA 3T1AA 3ZSWA 1L5UA 5KI6A 2XY6A 1FXXA 1DTQA 1REVA 3RR8A 3WNFA 4CJTA 3KK3A 1J5OA 4O0JA 3OS2A 1VSLA 2FC0A 1JLEA 3S3MA 4M3YA 3SQ2A 1SUQA 1B9FA 1WSIA 3LAKA 3OS0A 2PYLA 1QHTA 1TKZA 2KQ2A 3OYNA 3U3YA 3V6DA 2D5RA 5SZTA 1UA0A 1RBVA 1ZBUA 2JLEA 4B8AB 1XC9A 4LY7A 3ZT0A 3I8DA 5J2MA 2YNHA 4CJFA 4PUOA 2OA8A 4JRQA 4YFUA 4NCAA 2E6LA 2HHVA 4CIGA 2OYQA 2RKIA 1KVCA 2HNYA 3NH0A 1TK8A 4AHVA 4CJLA 1ASUA 4EP4A 4KB0A 1BHLA 1W9HA 4DQPA 4PQUA 1L3VA 3PO4A 3ISNC 1BCOA 3AVMA 5E41A 3SPYA 3HXMA 3PX0A 4B9LA 1LWCA 4DLEA 4LH4A 4F8RA 3SUQA 4FJLA 1CXUA 1YTAA 4B9SA 4KHUA 3V9UA 4J2EA 4JS4A 4FLZA 3L2WA 4CGDA 1C6VA 4Z4FA 1VSEA 2XY7A 4B9TA 3F9KA 1GOCA 1FK9A 1S1VA 1GOAA 1I39A 3KLIA 3TABA 3OJSA 4J2AA 3P1GA 1BQMA 1J53A 1Q9XA 2OZMA 1D9FA 3TAMA 1UWBA 1IKYA 1Q8IA 1XWLA 4KV8A 3V1QA 4DS4A 4BWJA 1Z25A 4XIUA 2HHTA 1JLAA 1WSFA 4OKJA 4RW6A 4CEBA 4CIEA 2Y1IA 4KTZA 2IDOA 3C6UA 3CG7A 3L3UA 4F3OA 1NKCA 3HVTA 3OYHA 1F21A 3RR7A 4KB1A 2OPSA 1VSMA 5CZ2A 3ZSRA 1HYSA 2G8FA 1C1BA 3QIPA 1JLCA 3QLHA 4NCGA 2OPPA 4O4GA 4DTPA 1LWFA 4CGGA 1NK6A 2P1JA 1JLGA 5C25A 3DRSA 3SYZA 1RDBA 3NF6A 1TKTA 2B5JA 3QETA 1DTTA 2KZMA 4DLGA 4KHNA 1BL3A 1NK7A 3KK1A 1WSGA 3NGZA 1JL1A 1TL3A 4FJHA 3EZ5A 2XO7A 4BDYA 1KTQA 4CEFA 4CFDA 3VQ7A 4CEAA 1NOZA 2YKMA 4FW1A 4H4MA 5HRRA 4HUEA 1ITGA 4O55A 4HHTA 4FZXC 3VQCA 1NK5A 4CJQA 3QEVA 1NK9A 2IGIA 4FM1A 2XY5A 4LH5A 2VG6A 1S9GA 2OZSA 4W5QA 4DG1A 1WNSA 2D0AA 3L3VA 4JS5A 3M8PA 3SUOA 1JLFA 5HRSA 1LW0A 4BACA 3KKRA 2DFHA 4O44A 1RT7A 2HMIA 1RT1A 3H08A 1BIZA 4GW6A 4RW9A 2WONA 4I2QA 4CF2A 4FM0A 3S3NA 4AHSA 5HRNA 1BI4A 3MEDA 3LDSA 4ZTFA 1UA1A 4FJ8A 2ATQA 4I2PA 2VG7A 1S1WA 4CIFA 2E4LA 4OKKA 1CLQA 3HPOA 3V9WA 4QCLA 1WAJA 3P5JA 4ID5A 3SV3A 1NOYA 3KLEA 3KD5E 1TK0A 4RW7A 3EYZA 1HJRA 4CEZA 3O4QA 1HNIA 3K5NA 1C0TA 4W5NA 4CK3A 4DQRA 2B6AA 4M3RA 4E89A 4FK2A 3EY1A 1NJZA 1VSHA 4OGCA 4CJSA 4IBNA 3V9XA 3SQ0A 2FBVA 3LP3A 2HNDA 3TWHA 3ZSYA 1K6YA 3NGIA 4BE2A 2X74A 1NK0A 2ZQBA 1I3AA 1VK0A 4M3XA 4DU1A 2HHWA 4CJ3A 4DFMA 1U47A 2YNIA 2JGUA 4O5BA 1JKHA 1J54A 2YNFA 3RMDA 4ICLA 3I0SA 2EX3A 4KHSA 2DFFA 1W0HA 4GMJB 2BANA 5CYQA 3NBPA 4FVMA 3AVLA 5K14A 3TR8A 4N5SA 3PY8A
chains in the Genus database with same CATH superfamily
3TI0A 1QQOA 2HOEA 3A5MC 4K41A 3EN9A 1SL2A 3SMSA 1BISA 4IG0A 3P38A 3SK3A 1HPZA 3KKSA 2UYTA 4DQQA 2V7ZA 3QEPA 4BC3A 3AVFA 3WXMB 1CXQA 1VQNN 4CF8A 3ZSVA 3HM9A 3DXKB 1U4BA 4FJJA 2KFNA 4FLWA 3Q7BA 4Z0UA 3DM2A 4O8UA 3TAEA 1N5YA 3KD1E 3QIOA 1XHXA 4FWKA 1RT5A 4K42A 3FLCO 3AO5A 5FPNA 4XH1A 4QAGA 3AVHA 5EX5A 4CHQA 4CZEA 3UE5A 1VSDA 1KFDA 3TAGA 4N47A 5AZJB 3C6TA 3TPQA 1XQSC 5KTQA 1BIUA 3MXJA 4FM2A 5AQXA 1HMVA 3WNEA 3FZHA 3VESA 2HW3A 5M1FA 4CZFA 3K0SA 1X9WA 4OO1J 3LANA 4Y1CA 3LP1A 2P9LA 3M8QA 5FPMA 3CM5A 4H0VB 1YI2N 3LALA 2VWJA 1GLFO 4WQ4A 1Q82O 1TUUA 1RFQA 4DSEA 1RT6A 1X9JA 3VPZA 1XC3A 2A6AA 4E7KA 4FK0A 3ZX3A 2E1ZA 3AO3A 1TKDA 1SV5A 4CJPA 3BUZB 2ZJQL 1I94K 3VQEA 4DQIA 4BRGA 5IWAK 4E7HA 1S5JA 3OYAA 1LAWA 1VQLN 3J8AA 3V81A 1KCFA 1SKSA 1WBDA 1JL2A 1HNWK 4CJEA 3LZJA 4CK1A 4ELVA 2G8VA 5HOOA 3C7NB 4A2AA 4OVLA 3CXCM 1RTHA 2X6SA 3D0PA 1WLJA 5AQHA 2AP1A 1MWMA 4A57A 1BDGA 3VF4A 1L3UA 1YUWA 4B1ZA 3B6PA 3L2QA 1RBUA 1RDAA 3TSPA 2P5OA 2IC3A 3D2EA 4GV3A 1MA9B 5LJWA 4HTUA 1D9DA 4FL9A 5ADXA 4KH4A 2ZGYA 3NGYA 1RDUA 2XY8A 1ZYQA 2Q36A 4QS7A 4R79A 4B08A 4DMNA 2ZGZA 2YV0X 2QA4N 4CK2A 1C0MA 3K5OA 4B9VA 1FKOA 4FJXA 5HRPA 2P51A 3PX6A 2YJFA 4KKOA 1NJIO 4AH9A 1CZAN 3K5MA 3THYA 5AJ3K 4ZHRA 3T3FA 2OANA 2IIRA 3SAHA 3VTIA 2KTQA 1TUYA 3RRHA 1LV5A 3BY5A 1Y64A 5IT9O 1QE1A 5AQWA 3CCQN 1G99A 1ATRA 3U4LA 3PIPL 4QS9A 3UKRB 4JKHA 5M1QA 4PKHA 2FBYA 1KSPA 1RILA 3FGUA 3QFUA 4NYFA 1JLQA 3SJHA 5BRFA 3VQ5A 2BUPA 3S41A 4DB3A 4OJRA 2ZJPL 3DI6A 1NKBA 3C65A 3DLBA 4HUGA 3OYLA 4DTJA 3DWLA 3VEZA 3NCIA 3K59A 4LF8K 4I6MB 1YT3A 1T03A 2NLXA 3HT3A 3JYTA 4X62K 3KLFA 2CH5A 2CGKA 3E66A 1RDWX 4CD3A 3K58A 4M45A 2A5XA 3NVMA 3SQ1A 4DR4K 1Q18A 4LSLA 1HKGA 4ZTJA 2IVOA 3SI6A 5BPMA 1TAUA 1BU6O 1L3SA 4PWDA 5AZIA 3ZETA 3RSEA 3T19A 2P9SB 1LOTB 1N34K 3V1RA 5M1OA 4YORA 1EO1A 3WXJA 3DLGA 2P9KB 3NF8A 4PA1A 4CJ4A 1EP4A 3AVIA 3G0ZA 3H45C 4JD2B 2HHQA 1IG8A 3CPWM 4FWLA 5T7BA 4AHRA 3PUFA 1VRUA 4U7BA 1VSJA 5C15A 4HCCA 1IKXA 4YOTA 3CM6A 2V52B 2P9PA 4LC9B 3ID6A 3M8SA 1M1KO 2XRIA 3PSFA 4JKBA 1N8RO 4OPAA 2FSNA 4MFBA 5CY4A 1EQYA 4H03B 4YOXA 4BE1A 4O5FA 1HJOA 2Z1GA 3CJ7A 2ZD1A 3P39A 5HLFA 1E4GT 2F8TA 3NE6A 4J2DA 4E3SA 3VERA 2E20A 4B9MA 1OH8A 3OYIA 5M1NA 3O3HA 4N41A 3LP2A 2FBXA 3S3OA 5KI6A 1BOTO 1DTQA 3WNFA 1J5OA 4O0JA 3OS2A 2FC0A 4BRCA 2PYLA 1TKZA 4IO8A 4CBUA 4BG8A 1K8KB 1UA0A 2QKBA 2A3ZA 4FSVA 1T3VA 4YFUA 4NCAA 2HHVA 3MWPA 2OYQA 2HNYA 3FZFA 1Q81O 3U9ZA 1U2VB 3NH0A 1N36K 4KB0A 4CZMA 1BHLA 1W9HA 2WUSA 3AVMA 5E41A 4NLCA 1LWCA 1HX1A 4K43A 4B9SA 4KHUA 4IZ9A 4JI2K 3L2WA 1VSEA 1I39A 3EKUA 3J7ZO 3OJSA 1WOQA 2KHOA 4BRLA 5BREA 1J53A 1UWBA 3V1QA 4KV8A 4BWJA 1JLAA 4OX9K 3DXMA 4KTZA 4WFBL 2OTLN 2G8FA 1JLCA 1P90A 1ATNA 4NCGA 4DTPA 3QBWA 2VGMA 3OW2M 3CCJN 4H5NA 3T1HK 3SAFA 1NMNA 4HWIA 4KHNA 1BL3A 1NK7A 1WSGA 2V7YA 3EZ5A 4FJHA 4BC5A 4CEFA 3CPEA 2YKMA 4HHTA 1NK5A 4CZGA 2D4WA 3DJCA 5EVZA 1NK9A 1QQMA 3O08A 1S9GA 2BTFA 2E8AA 1YHQN 4DG1A 4DV2K 2D0AA 3L3VA 3SUOA 1JLFA 4A2BA 3KKRA 1RT7A 1U6ZA 2WONA 4I2QA 3HOSA 4FM0A 4AHSA 3MN9A 5HRNA 4CIFA 1NBWA 3KK7A 1NOYA 3KLEA 1VQMN 5AR0A 5B8HA 2GWJA 2YHWA 3O4QA 4EIAA 2B6AA 4E89A 5JMVA 5FPDA 2E2OA 4CJSA 2F7TA 2O8FB 3IUCA 2HNDA 1NK0A 4BE2A 1VK0A 4M3XA 3EZWA 4JHDB 4DFMA 2YNIA 3I8BA 5BR8K 2E88A 4ICLA 4FVMA 2UUBK 3O3GA 4BR0A 2A42A 3ULDA 4H0PA 3ZEUB 3ZX0A 3SUPA 4E7LA 2DY4A 1MU2A 4DFPA 2LSNA 4CEDA 3DXKA 3AGKA 3DOKA 3DMJA 2GEMA 3D7EO 3GG4A 4ILHA 4E7IA 3V9ZA 2Q1NA 3C94A 3PIOL 4NXMK 4KTQA 2UXBK 3R8EA 4XH5A 3DLLL 4Z4EA 3LDLA 2HBLA 3RMBA 1XI1A 2YJEA 5A2QO 4J2BA 2F96A 2KLAA 3VQPA 5MLCQ 4HTLA 1SZ2A 4KO0A 4CJRA 3SZ2A 3OYKA 1ZBIA 4WF9L 4M3TA 5AZJA 2E6MA 4BREA 1B92A 2I7PA 3KZBA 3BF1A 1HNVA 1T05A 2O4IA 3B6OA 4BR5A 5BN8A 4CJUA 2RPIA 2VG5A 1LAVA 1QTMA 4KPYA 3AAPA 3F73A 3MX5A 3LZIA 4YOYA 1IBKK 4M7YA 3O9RA 3HJFA 3HSCA 4CGFA 3K2PA 4DFKA 3IAYA 3A0IX 3A2FA 2GV9A 1LWEA 3VQBA 2WTUA 4Z4HA 1QQCA 4CCHA 5KRSA 2Q0UA 3AVAA 2XHBA 3A5NC 3DOLA 3QMLA 3CJCA 3AO4A 3FFIA 5J2QA 4PL7A 3IS9A 5AQKA 4E0DA 4JK8A 2D0CA 2Q31A 4MO5A 5HROA 3PSIA 3W3DA 1UOCA 2D0BA 4IDHA 1T7PA 2QTDA 1VQPN 4GKKK 1KAYA 3EO3A 1NM1A 2QXFA 1XHZA 1X9MA 3O4NA 4CD1A 3VF2A 3A5LC 1VSIA 1YVUA 4KREA 2X6NA 4DQ8A 5JVGL 5AQVA 3C7NA 4BRNA 5JS2A 3T69A 4NB4A 3VEVA 1U04A 2F9TA 2E1YA 3UIQA 3DLHA 5AQOA 5JLHA 3VN5A 1XMQK 3JS6A 3E01A 2E2NA 3UKUA 3TARA 5F2RA 2GWKA 3OYDA 5LMNK 3D45A 4X65K 4BVPA 4LF6K 3ALYA 3WEEB 3IG1A 4H8KA 2RF2A 1VQ7N 4BY9C 4B1XB 2D0OA 4DV7K 3I55N 4KH6A 4F9OA 2QW9A 1SKRA 1JXEA 1D5AA 4DR1K 2DFEA 2HHHK 1EX4A 1K8AO 3TAPA 3L8BA 2O8BA 3CCEN 4BGBA 1OH7A 2IS3A 4E1NA 3HTVA 5HBMA 3KWGA 3VF6A 4CI6A 4JKGB 2HVHA 3CJAA 3ZT2A 3ENHA 1QZ6A 4AF1A 2ETJA 1IH7A 4OPKA 3LPUA 1NKEA 5J2NA 4BR4A 3VETA 4FWMA 3SPZA 4DTOA 4LFCK 5J1EA 3TU5A 1P8ZA 3CCLN 1S1UA 1VQ9N 1WSJA 3BZCA 3CCMN 4F3TA 3UKRA 3QNNA 3G6EN 1WB9A 2F4VK 5EU7A 3DLEA 1TAQA 4BE0A 1J9AA 2QWLA 3VQDA 4DSLA 3EEQA 3OYBA 3THVA 5HP1A 1OH5A 3C6AA 3KLHA 1OKJA 4CZHA 1O1WA 3WQUA 2FBTA 1IG9A 4WFAL 2PZSA 3K5LA 3ASMA 5M1PA 3IRXA 4AILC 4CEOA 4OLAA 4CZKA 4ID1A 3AA2A 2ASOA 4GVEA 4I6MA 3FZKA 4A62A 1Z26A 4A5AA 5BRHA 4BDPA 4OKEA 4B3SK 4M3UA 4DSIA 4CEQA 3QESA 2Q0RA 3PX4A 4C8NA 4Z94A 1KXPA 3IDHA 4H5WA 3OYEA 4NYNA 3OYFA 1YF5L 3E9LA 3RWUA 3THWB 1TGOA 3EKSA 3ZT1A 3OJUA 3AV9A 2YCHA 3VEYA 3P4IA 1RBTA 3VGKA 1S22A 2P9IB 3VMFB 2P9SA 4DQSA 4H0XB 1SKWA 2BDPA 2P9KA 5D3GA 3BP8A 4OGEA 2E2QA 2IVNA 1JLBA 2PBDA 3LDQA 2FLOA 3QDKA 1RTIA 4BROA 4C8MA 4KFBA 4CF1A 4ISGA 4EP5A 4JV5K 3V9SA 4BR2A 4YNQA 3ZSXA 4DF4A 4ILJA 4H5RA 4BDZA 3O3FA 1Y97A 5CHIA 1NMDA 2E5LK 5FPEA 5I3UA 3MEGA 2E2PA 4ELUA 5DM7L 3NFAA 3OYGA 1FW6A 4JI7K 3MN7A 1HQEA 1NLVA 1Q86O 4DR5K 2G8HA 5LJVA 2GUIA 4FCYA 2ZF5O 4KRFA 1ZBHA 1RTJA 1NGJA 2OPQA 4H5TA 3KLGA 2I5JA 4TSXA 2KZZA 1C0FA 5E26A 2DTUA 1D8YA 3CMAN 5J2PA 4DTRA 4M3ZA 3SLCA 1BI4B 3HI0A 4CGJA 4XH4A 2FXUA 1BWFO 4JEPA 1WAFA 1C0UA 4C1NK 3CD6N 4IEIA 4O0IA 4FO0A 1D4XA 3ZT3A 3HK2A 1HRHA 3SBTA 2Y1JA 2YI1A 3MCPA 4BGAA 3QEXA 4EZ6A 3CC7N 2CH6A 3HOTA 4N56A 4BRKA 1YIJN 4B3RK 2CGLA 3M6GA 2HHXA 4CHZA 4NCBA 5LMUK 3T1AA 3ZSWA 1K8KA 3RR8A 1DKGD 4M3YA 3J7YP 1U2VA 1BO5O 4LF4K 4DR6K 3LAKA 1V4TA 4DKWA 4PKGA 3OYNA 5SZTA 2NNWA 1U49A 4GV9A 3U8XA 4LY7A 5J2MA 2YNHA 4JRQA 2RKIA 1TK8A 4CJLA 3MX2A 3F2KA 1L3VA 1BCOA 3ID8A 4BQZA 4B9LA 4DLEA 4JKDA 4F8RA 1YTAA 2UU9K 4J2EA 5AQZA 4JS4A 4Z4FA 4B9TA 3TTDA 1S1VA 3SMPA 1WUAA 4BRDA 1NNEA 1GLJO 4J2AA 4IO9L 1QVFM 2O8CB 2ASPA 1Q9XA 2NRVA 1YITN 1XWLA 1ZBSA 2H3GX 4XIUA 4DS4A 3VGLA 2D1KA 2PFUA 2Y1IA 4OKJA 4CIEA 5CR4A 2IDOA 3BEXA 3L3UA 5HL7L 4F3OA 1HYSA 5AFUA 5CZ2A 3ZSRA 1C1BA 3QIPA 4O4GA 1NK6A 2P1JA 5E84A 3DRSA 3MCAB 3CCSN 3BZKA 2W6KA 1ESVA 3NGZA 1KTQA 3LDPA 1NOZA 4H4MA 3HBTA 1ITGA 4O55A 3VOVA 4BRIA 4GV6A 4CJQA 2HBKA 4FM1A 2P9NB 2VG6A 4BG9A 2QEXN 2RE2A 1YAGA 1LW0A 4LFBK 4BACA 3J81O 1RT1A 4DV0K 1BIZA 4RW9A 2FSKA 4CF2A 3S3NA 3F9MA 3LDSA 4FJ8A 4ZTFA 1NGFA 1UA1A 3CC2N 3CCUN 2ATQA 4G9ZA 2BH1A 2VG7A 2E4LA 1CLQA 2O8FA 1WAJA 5C12A 4ID5A 2PAVA 4JHDA 4WYBA 1TK0A 5KQDA 1HKCA 1C0TA 4AM6A 4DQRA 4M3RA 3EY1A 1NJZA 4OGCA 3SQ0A 2FBVA 3ZEUA 3UB5A 3TWHA 5GAEP 4M63C 2X74A 4BRHA 3O8MA 4IOCL 4CZLA 3FZMA 3M5RA 1U47A 1MWKA 4BRPA 3L0QA 3I0SA 2EWSA 4GMJB 5CYQA 3G4SN 3NBPA 1HUXA 4BRFA 4A61A 2BE2A 3A5OC 3O4WA 4DSKA 1NGEA 1XNQK 2J4RA 3VA0A 3CI5A 2BGGA 3JXUA 4H5VA 3WNGA 3CMEN 3ENBA 4C1NI 2B4JA 1JXBA 4KI6A 2ASMA 3MEEA 1V4SA 3T1YK 1Z05A 4IJAA 5TKYA 2G8KA 4Z4GA 4IOAL 4IDKA 5F0XA 4BC4A 4CHYA 3RTVA 4MQ3A 1NK8A 4CECA 1K9MO 3DAWA 3CJ1A 4DU4A 1S72N 3VQ8A 3OYJA 1C1CA 4CHNA 4H0TB 4YY3K 1SQKA 4M3WA 1VSKA 4Y1DA 1N6QA 1XMOK 5C24A 3TTCA 1IBLK 4FK4A 3RMCA 4FJGA 3QINA 5KGWA 3NF9A 3M3ZA 3QEIA 3HYFA 1RDCA 4Q0BA 2ZWHA 3OA9A 4FXDA 3NAEA 2UXDK 5KGXA 3P83D 4CFBA 4DR2K 3VQAA 1U45A 4E19A 4MLHA 1YJWN 4DUYK 5GAHP 4FJNA 1SL1A 5FRMA 4Z4IA 4CJKA 1T6CA 5ADXH 4DV4K 1GLEG 1RBSA 2VWKA 1QSLA 3WQTA 1EWQA 1HYVA 3WUHA 3CETA 2GELA 2ZE2A 4K8ZA 4AHCA 2HNZA 3MN6A 4LF9K 5BPLA 3EE9A 3EL2A 3ZT4A 1S1XA 3ULEB 4NLBA 3VEOA 4CEEA 3WNHA 2HHSA 1J5EK 5C2DA 3GDQA 2QK9A 4CGHA 4IFVA 1VQ4N 2G8WA 3WEEA 3KWIA 4DV1K 5GIPA 1NGGA 3OS1A 1OVYA 1RT3A 3MN5A 4CHOA 4Z4CA 1TV6A 4N76A 1QVGM 3DLKA 3HRGA 4AHUA 3AVJA 4DV5K 3CHWA 1IO2A 3ZCMA 2JWLA 4WQ4C 4FPBA 4FJ5A 1S6PA 4B1WB 4C8KA 1UAXA 3GOIA 1IBMK 3ZETB 3RSEB 3FFKB 1HYZA 2ITMA 4JI0K 4B9QA 3O9UA 1JCFA 3D6RA 4IKFA 2OPRA 3LDNA 4CJVA 2NRZA 4DFJA 1X3MA 4CFCA 2YHYA 1HR0K 2I7NA 3L2UA 3C0BA 4ISFA 3QO9A 3CQYA 2NRTA 4KH5A 2P9PB 1U48A 4C8OA 3O80A 3HZ6A 4KHYA 2CGJA 2IVPA 4K8XA 1GLLO 2A1RA 4RTFD 3CQ8A 1KC8O 4C23A 2A1SA 4LD0A 3CFPA 3MXIA 1CZ9A 4PL8A 4FW2A 3KJVA 2RHKA 1G15A 4IFYA 1TK5A 2QWMA 3GBTA 1HQUA 4DCHA 5TKWA 4DWIA 5AQNA 1VQ6N 4JKFA 1WBBA 5CYMA 4CESA 4KHQA 5KPZA 3AARA 3VQ4A 5KRTA 2W6LA 1RT2A 3AA4A 4E7JA 4MDBA 4LSNA 4DSFA 3DYAA 4RWTA 3AO1A 2DPNA 2NRRA 2UUAK 3R3LA 3O9TA 4X64K 3JSMA 4CE9A 3AVGA 5JVHL 2JWKA 4ISEA 3L2VA 5LY3A 4XEIA 3KTQA 4CGIA 4JK9A 3BGRA 5C0YA 4DR7K 2NUBA 4DTSA 1ASWA 1EXQA 4FWNA 4I9QA 3ZYYX 3THXB 1LCUA 3TAQA 2P9IA 3QFPA 4LF7K 1NJXA 4F4KA 1RCHA 3A8YA 2YNGA 1B9DA 3AVCA 2W42A 2GTDA 3NVKA 3ITHA 2RN2A 1A5XA 1S3XA 3QNOA 1NGBA 3AVKA 1C1AA 5M1KA 1EETA 4PY5A 4KBOA 3OBWA 4BRAA 2X78A 5GADP 1CZBA 4FLTA 4WQ5A 1RBRA 5I42A 1GOBA 1S1TA 4CBWA 3WXLA 3C95A 2HBMA 3MAQA 4BR9A 4KTWA 4FYDA 3AO2A 5C42A 2P5GA 3F5TA 5AQTA 2G8UA 1WSHA 1HLUA 1YXQA 4CW7B 4EZ9A 2Q3SA 4DS5A 3L4QA 3DRPA 4JI8K 3CFOA 4K0KK 3Q7CA 1DLOA 3HL8A 1MDUB 2P9UB 1WSEA 2Z1HA 3CF5L 2HB5A 4JNEA 3OTOK 4NO7A 3ATUA 3N4QA 4FWQA 4AHTA 3LWLA 3TSQA 4IXCA 1NG9A 3RVCA 2AA4A 4CZJA 4AQYK 4G1QA 2QWQA 1L5UA 2XY6A 4CJTA 1T44A 3QICA 2QI2A 4MLEA 4JI4K 1VSLA 3SAGA 3S3MA 5EXWA 1SUQA 1ZXOA 1VHXA 1HNZK 1W2BM 1E3MA 2O8DB 2KQ2A 2NRXA 3FZLA 3V6DA 2D5RA 1NGIA 1RBVA 2JLEA 2WBNA 4B8AB 4PUOA 3ZT0A 3I8DA 1GLAG 5EOYA 2OA8A 4KHPK 5ELZA 2E6LA 2WC9A 2QWPA 1R59O 3IKMA 5JLFA 4MDAA 2VQFK 4V19S 3PO4A 1TYQB 3SPYA 2A40A 3T7ZA 4CVNE 3CJ9A 2O8CA 4FLZA 4CGDA 1C6VA 3K9JA 3ENOA 3F9KA 2W40A 1FK9A 3KLIA 3O6WA 1BG3A 4BVOA 3IFRA 4NXNK 3TAMA 1Z25A 5LL6Z 4RW6A 1BUPA 3HVTA 3OYHA 1F21A 5KPRA 1M90O 1VSMA 3G25A 1J6ZA 3J7AP 2OPPA 3VTHA 1LWFA 4CGGA 5C25A 1RDBA 1O13A 1TKTA 2B5JA 3QETA 5BRDA 4JD2A 3KK1A 2P9NA 4GNIA 2XO7A 3LL3A 3VQ7A 4CFDA 4HUEA 2O8EB 3QEVA 1W7AA 5KQ8A 4FWPA 1K73O 1VAZA 4LH5A 2W41A 2OZSA 4JI1K 3MDQA 1WNSA 3B8AX 3M8PA 5HRSA 1VQ5N 2DFHA 4O44A 3VEXA 2HMIA 4YHHK 4YDUA 3MEDA 2YHXA 3QBXA 4B3TK 1S1WA 4IOXA 3HPOA 3V9WA 4QCLA 3P5JA 1GLBG 1KAZA 4GY2B 3KD5E 4CEZA 3WT0A 3K5NA 1HNIA 2A41A 3D2FB 4W5NA 4K25A 3MK6A 4CK3A 4FK2A 2VQEK 3UKUB 3LP3A 4UY8O 3ZSYA 1N32K 2KKZA 3KVGA 4DU1A 2HHWA 4CJ3A 3I56N 2JGUA 4O5BA 2YNFA 3RMDA 4CBXA 2EX3A 2DFFA 1W97L 5K14A 1W0HA 2BANA 3PY8A 1JCEA 1VQON 2AJQA 4B9NA 5SWMA 4KHWA 2WFBA 3MWTA 3QERA 3RMAA 3ZSQA 2HF3A 1ZC6A 2PY5A 2O8BB 3VA3A 4FJ9A 4H4OA 3TSUA 3MMVA 5AQFA 3MECA 3ZSOA 4IJNA 5JICA 4F2RA 2VYPA 4L3QA 1L3TA 3VQQA 3MXMA 1YTUA 5FRNA 3HP6A 4B1UB 4CF9A 2GBZA 3CYMA 1A5VA 1RNHA 1R0AA 4EAHD 1T8EA 3NMUA 4FVUA 3VQ9A 4FLUA 2QKKA 4CZIA 4B3MK 2YX6A 1X9SA 3P31A 4KI4A 4YOWA 3H46O 1KQSM 3ZLJA 3E1YA 2QWOA 1QS4A 4MO4A 3O9QA 4M7XA 4EHTA 4JAXA 4FPAA 4DTNA 3LAMA 5C10A 3CFRA 5FDLA 3K57A 4FLVA 3DLRA 1YJNN 5H1SQ 4FZYA 1IKVA 4DTXA 4Y0WA 2IAJA 4F2SA 4QOZB 4CF0A 3SUNA 4W5OA 3V1OA 1A5WA 3EE8A 2F9WA 1T6DA 5AQMA 3H1QA 3L2RA 4W5RA 1X1PA 5AQJA 4WFNL 3HPGA 4JI5K 5AQSA 3QEWA 4U67L 1RDDA 4DF8A 4FWOA 4HVJA 5BN9A 4A59A 1KLMA 3BDPA 3ULEA 2P9LB 4YOUA 4JKAA 4J8FA 3OBYA 4WE1A 3HVRA 3CJBA 1IKWA 3VENA 3CQXA 4FJKA 4IG3A 4HUFA 2KFZA 2PYJA 3NDKA 1IV0A 2QXLA 3CIPA 4B9UA 4JYAK 2KW4A 1QQNA 4W5TA 1VSFA 3DRRA 3NF7A 3LWMA 4OPJA 1NGAA 1OVQA 3AVBA 1X3NA 1NWKA 5AQYA 5EY4A 4FJIA 4C8LA 2QWRA 4H0YB 3SJJA 3M8RA 1NGCA 4O8KA 2Z1JA 4CJWA 2R7YA 4FLYA 3CERA 1ATSA 3FR0A 5AQUA 3SQ4A 3NH1A 2Q2RA 1DEJA 1BA0A 3H1VX 3U3GA 2ZM6K 4DR3K 4DTMA 3E9OA 1SS6A 1S6QA 4DTUA 2V51B 4RG8A 4Q5VA 4JI6K 1VQKN 3SCXA 3PV8A 1BCMA 1NK4A 3OYMA 4RW4A 4WQ5C 4ELTA 3D2EB 3L6QA 3QB0A 5AQQA 2QWNA 2O4GA 1KRPA 2Z1IA 3VEWA 3CC4N 4CHPA 3O5BA 4GVMA 5JS1A 1TKXA 1ZBFA 3O1WA 1SL0A 3LPTA 3LDOA 4BQLA 3N4PA 1JCGA 3TAFA 3G10A 4CJ5A 1C0GA 3HSTB 4DV6K 4FOEA 4FLXA 4CFAA 3BF3A 3HPHA 4JRPA 1KLNA 4JKEA 3ZSZA 4BC2A 1BGXT 3NHGA 3THYB 2VCPA 4GKJK 1YJ9N 4HCBA 4IWVA 4JLHA 3R6MA 5AQLA 3VQ6A 1KVAA 2NRWA 3H3NO 4E1MA 3KK2A 3OVNA 3VGMA 4JKCA 4M42A 1NGHA 3C6HA 3L4IA 3THXA 5AQRA 4DU3A 2ITGA 3S9HA 1QSYA 1KVBA 3TANA 2FSJA 4I9LA 2UUCK 1HNXK 4CERA 1ILYA 3R9PA 4OLBA 2HHUA 3PO5A 3SNNA 5FLXO 3HP9A 1DT9A 1ASVA 4PHTX 3AAQA 4FJ7A 1LW2A 1E4FT 3RRGA 5I9EB 4FOIA 2F8SA 1RT4A 1EKEA 2VWBA 5DMRA 1RTDA 4L8RB 4EHUA 4JI3K 2YHBA 1VRTA 3HO1A 3LP0A 3NH2A 5FROA 4B3OA 4AM7A 3W0LA 3CCRN 3OY9A 1QHAA 3AVNA 4JK7A 1TL1A 2HMPA 3HM8A 1QSSA 4FWSA 2YHAA 3SBGA 3G71N 2FF6A 1NJWA 3AA3A 1KFSA 1OH6A 5AZIB 3CCVN 3U6FA 2IOCA 4FJMA 3V4IA 1EWRA 1GLDG 2YKNA 2G8IA 1BQNA 1BA1A 3AY9A 4BR7A 4DHYA 3SV4A 4JKGA 3AA5X 4BWMA 4RW8A 2P9UA 1S9EA 1TVRA 4EFHA 4DSJA 5DK5A 5DM6L 3I0RA 3ATVA 5AQGA 5CZ1A 1KAXA 1FKPA 4R5PA 4I7FA 2OTJN 2WOMA 2OCEA 4FZZA 4B8CA 3E9PA 2NZTA 3KHYA 2EHGA 1Q9YA 4KAZA 1ZBLA 3H6EA 5C2FA 2HVIA 1NJYA 3K9KA 4M41A 2HBJA 1WN7A 3OYCA 5AFUH 3KIOA 2O8DA 4UQGA 1H1VA 1FXXA 4YDUC 1REVA 4RCHA 3KK3A 3OHRA 1JLEA 3SQ2A 4E1JA 1B9FA 1WSIA 3OS0A 1N33K 1QHTA 3U3YA 1TYQA 1GLCG 1XC9A 1ZBUA 4CJFA 4CIGA 1KVCA 4BRQA 4AHVA 1ASUA 4EP4A 1Z6RA 4DQPA 4PQUA 3IMXA 3ISNC 4DV3K 1HPMA 4X66K 3HXMA 3PX0A 4B1YB 3O1BA 5CE3A 4LH4A 4FJLA 3SUQA 1CXUA 1QZ5A 1SAZA 3V9UA 1RGIA 3THWA 3PLAA 3R1XA 1IJJA 3I33A 2XY7A 1GOCA 1GOAA 5KPTA 3TABA 2HF4A 1FJGK 1Q7YO 3P1GA 4OPHA 1BQMA 1KD1O 4IFEA 1NGDA 2OZMA 1D9FA 1IKYA 1Q8IA 3U9DA 1WSFA 2HHTA 4CEBA 3GL1A 2ZJRL 3C6UA 3CG7A 1DGKN 3GE1A 4JN4A 1NKCA 4KB1A 3RR7A 3ZX2A 2OPSA 4A5BA 5GINA 3AGRA 3QLHA 2UXCK 1JLGA 3LM2A 4LFAK 1NU0A 3SYZA 2O8EA 3NF6A 3DXMB 1DTTA 2KZMA 4LF5K 2FF3B 4DLGA 2GX9A 2GUPA 4FWRA 3LM9A 3WXIA 1VQ8N 1JL1A 1TL3A 4DUZK 4BDYA 5BPNA 2NRHA 4CEAA 1HKBA 4FW1A 5HRRA 4FZXC 3VQCA 4WCEL 2IGIA 2XY5A 2QM1A 3H3OB 4W5QA 4JS5A 3H08A 4GW6A 1YVNA 4ILGB 3WXKA 1JJ2M 3D2FA 4QS8A 1BI4A 4I2PA 4IEEA 4OKKA 3M1FA 2HSTA 5GIOA 3SV3A 1XNRK 5BR9A 2D0PA 4RW7A 3EYZA 1HJRA 2Q97A 3O9SA 4BRMA 3FE1A 1VSHA 4IBNA 3V9XA 5AQIA 5F1XA 4B1VA 4YOVA 2VGNA 3NGIA 1K6YA 3TTFA 4CJ7A 2ZQBA 1I3AA 5AQPA 4H0OA 3JAMO 5GAGP 1JKHA 1J54A 4KHSA 3TR8A 3J80O 3AVLA 4PKIA 1XUPO 4N5SA
chains in the Genus database with same CATH topology
2BE2A 3TI0A 2AJQA 3ULDA 3SUPA 4E7LA 1SL2A 4B9NA 4DSKA 2DY4A 1MU2A 5SWMA 4DFPA 1BISA 4KHWA 2LSNA 3QERA 4CEDA 3RMAA 4IG0A 3ZSQA 3DOKA 3DMJA 3VA0A 2PY5A 2BGGA 4E7IA 1HPZA 3VA3A 3KKSA 3V9ZA 3C94A 4DQQA 3WNGA 4FJ9A 4H4OA 4KTQA 3QEPA 4Z4EA 1XI1A 3AVFA 2B4JA 3MECA 3RMBA 1JXBA 4KI6A 3ZSOA 3MEEA 1CXQA 4F2RA 4J2BA 4CF8A 3ZSVA 3VQQA 3HM9A 1L3TA 2F96A 3VQPA 3MXMA 4IDKA 1U4BA 4Z4GA 5FRNA 1YTUA 4FJJA 3HP6A 4CF9A 2GBZA 3CYMA 2KFNA 1A5VA 4KO0A 4CHYA 1RNHA 4CJRA 3RTVA 4FLWA 3OYKA 3SZ2A 1R0AA 1ZBIA 4MQ3A 4Z0UA 1NK8A 1T8EA 3DM2A 4CECA 3VQ9A 3TAEA 4FLUA 1N5YA 3KD1E 2QKKA 4DU4A 4M3TA 3QIOA 1XHXA 2E6MA 3VQ8A 1RT5A 3OYJA 1C1CA 4CHNA 1X9SA 4KI4A 3AO5A 1B92A 4M3WA 1VSKA 4Y1DA 1HNVA 4QAGA 1N6QA 3AVHA 1T05A 2O4IA 5C24A 3B6OA 4CHQA 4CJUA 4FK4A 1QS4A 2RPIA 2VG5A 3RMCA 1LAVA 4FJGA 1VSDA 1KFDA 3LAMA 4DTNA 3TAGA 3QINA 4N47A 1QTMA 5KGWA 3CFRA 4KPYA 3F73A 3C6TA 3NF9A 5FDLA 3K57A 3LZIA 3DLRA 4FLVA 5KTQA 1BIUA 3QEIA 3HYFA 4FZYA 3MXJA 1IKVA 4FM2A 1RDCA 4DTXA 3HJFA 4Q0BA 1HMVA 3WNEA 2IAJA 4FXDA 3NAEA 4F2SA 2HW3A 5KGXA 4CGFA 4QOZB 4CF0A 3K2PA 4W5OA 3SUNA 3P83D 3V1OA 4CFBA 1A5WA 4DFKA 3IAYA 3A2FA 3VQAA 1U45A 2GV9A 1LWEA 3VQBA 4E19A 1X9WA 4Z4HA 1QQCA 4W5RA 5KRSA 3L2RA 3AVAA 4CCHA 1X1PA 3LANA 4Y1CA 3LP1A 4FJNA 3M8QA 2XHBA 3DOLA 1SL1A 3HPGA 3CM5A 5FRMA 3LALA 3AO4A 3FFIA 4CJKA 2VWJA 3QEWA 4Z4IA 1RDDA 5J2QA 3IS9A 4DF8A 4HVJA 4E0DA 1KLMA 1RBSA 2D0CA 1RT6A 2VWKA 4DSEA 1QSLA 3BDPA 5HROA 1UOCA 2D0BA 1T7PA 1HYVA 4E7KA 4FK0A 2ZE2A 4K8ZA 4AHCA 3AO3A 2HNZA 1TKDA 2QXFA 4WE1A 1SV5A 3HVRA 4CJPA 1XHZA 1X9MA 3O4NA 1IKWA 3ZT4A 1S1XA 4FJKA 4IG3A 1VSIA 4HUFA 4CEEA 3WNHA 2HHSA 2PYJA 1YVUA 2KFZA 3NDKA 4KREA 2X6NA 3VQEA 4B9UA 2KW4A 4DQIA 2QK9A 4W5TA 1VSFA 3DRRA 3NF7A 5JS2A 4OPJA 3LWMA 4E7HA 4CGHA 1S5JA 4IFVA 3OYAA 1LAWA 2G8WA 3AVBA 1U04A 3V81A 3UIQA 4FJIA 1KCFA 1SKSA 3OS1A 4C8LA 1JL2A 3DLHA 3VN5A 1RT3A 4CJEA 4CHOA 4Z4CA 1TV6A 3LZJA 4N76A 3DLKA 4AHUA 3E01A 3AVJA 4CK1A 3SJJA 1IO2A 3M8RA 2G8VA 3ZCMA 2Z1JA 3TARA 4CJWA 2R7YA 4ELVA 3OYDA 3D45A 4FJ5A 1S6PA 4OVLA 4C8KA 4FLYA 1RTHA 3ALYA 1UAXA 2X6SA 3D0PA 3IG1A 1WLJA 2RF2A 4H8KA 3SQ4A 1HYZA 3NH1A 1L3UA 1SKRA 3L2QA 3B6PA 1JXEA 1D5AA 1RBUA 1RDAA 3U3GA 2P5OA 2IC3A 4IKFA 2DFEA 4DTMA 2OPRA 4CJVA 4DFJA 1EX4A 1S6QA 4HTUA 1D9DA 3TAPA 4CFCA 3L8BA 4DTUA 4RG8A 4Q5VA 3L2UA 3SCXA 3PV8A 3NGYA 1BCMA 1NK4A 3QO9A 3OYMA 4RW4A 2IS3A 4E1NA 2XY8A 5HBMA 1U48A 4ELTA 4C8OA 4KHYA 4K8XA 1ZYQA 2O4GA 2HVHA 3ZT2A 1KRPA 2Z1IA 2ETJA 1IH7A 4B08A 4DMNA 3LPUA 4OPKA 2YV0X 2A1RA 4CHPA 1NKEA 3CQ8A 5J2NA 4GVMA 4CK2A 1C0MA 3K5OA 3SPZA 2A1SA 4LD0A 3CFPA 4DTOA 5JS1A 4B9VA 1FKOA 1TKXA 5J1EA 3MXIA 1ZBFA 4FJXA 1CZ9A 1SL0A 5HRPA 4FW2A 2P51A 3PX6A 3KJVA 3LPTA 4KKOA 3TAFA 4AH9A 1G15A 3G10A 1S1UA 4IFYA 3K5MA 1WSJA 4CJ5A 4ZHRA 3T3FA 1TK5A 4F3TA 2KTQA 3QNNA 1HQUA 3HSTB 3RRHA 4DWIA 5EU7A 3DLEA 1TAQA 1LV5A 4BE0A 1J9AA 4CFAA 4JRPA 3HPHA 4FLXA 3VQDA 1KLNA 5CYMA 1QE1A 4CESA 4DSLA 4KHQA 3ZSZA 1BGXT 3NHGA 3OYBA 3VQ4A 5KRTA 5HP1A 3THVA 1RT2A 3AA4A 4HCBA 3KLHA 4E7JA 4JLHA 1O1WA 4LSNA 2FBTA 4DSFA 1IG9A 2PZSA 3VQ6A 3DYAA 3AO1A 3K5LA 1KVAA 2FBYA 1KSPA 1RILA 2QKBA 4NYFA 3JSMA 3ASMA 3IRXA 4E1MA 1JLQA 3OVNA 4CEOA 3KK2A 4AILC 3VQ5A 4CE9A 3AVGA 4M42A 4OLAA 4ID1A 3AA2A 4OJRA 3DI6A 1NKBA 3L2VA 1Z26A 4BDPA 4OKEA 4DU3A 3DLBA 4CGIA 2ITGA 3KTQA 4DSIA 4M3UA 4CEQA 4HUGA 3OYLA 3BGRA 3QESA 4DTJA 3S9HA 3PX4A 4C8NA 1QSYA 1KVBA 2NUBA 3TANA 4DTSA 3NCIA 4I9LA 1ASWA 4CERA 1EXQA 3K59A 4I9QA 4OLBA 2HHUA 3PO5A 3OYEA 3TAQA 1YT3A 3SNNA 1T03A 4NYNA 3HP9A 3OYFA 1NJXA 3RWUA 1RCHA 4F4KA 3HT3A 1ASVA 3JYTA 2YNGA 1TGOA 3AVCA 1B9DA 3ZT1A 4FJ7A 1LW2A 2W42A 3KLFA 3RRGA 3OJUA 3AV9A 1RBTA 2F8SA 3ITHA 1RT4A 2RN2A 1EKEA 3K58A 1A5XA 5DMRA 4M45A 1RTDA 3QNOA 4L8RB 3AVKA 2YHBA 1VRTA 3SQ1A 3HO1A 3LP0A 1C1AA 4DQSA 1EETA 4LSLA 3NH2A 4PY5A 4ZTJA 2G8KA 5FROA 4B3OA 2X78A 1SKWA 2BDPA 5D3GA 4OGEA 3OY9A 3SI6A 1CZBA 1TAUA 1JLBA 3AVNA 4FLTA 1RBRA 1TL1A 1L3SA 4PWDA 5I42A 1RTIA 1GOBA 1S1TA 3T19A 1QSSA 4C8MA 4KFBA 4CF1A 4EP5A 2YHAA 3V1RA 3V9SA 3C95A 4YNQA 3ZSXA 3MAQA 4DF4A 3DLGA 4KTWA 1NJWA 3NF8A 4PA1A 4BDZA 4CJ4A 3AA3A 1Y97A 1EP4A 3AO2A 3O3FA 3AVIA 5C42A 4FYDA 3G0ZA 2P5GA 2HHQA 5T7BA 4AHRA 3PUFA 1KFSA 5I3UA 2G8UA 3MEGA 4ELUA 1VRUA 1WSHA 3NFAA 3OYGA 3U6FA 2IOCA 1U49A 4FJMA 3V4IA 1VSJA 1HQEA 4HCCA 4EZ9A 2YKNA 1IKXA 3CM6A 2G8IA 1BQNA 2G8HA 2GUIA 2Q3SA 4FCYA 3SV4A 4KRFA 3M8SA 3AA5X 4BWMA 4DS5A 4RW8A 1ZBHA 1S9EA 1RTJA 1TVRA 2XRIA 3DRPA 3KLGA 2OPQA 4DSJA 2I5JA 4TSXA 2KZZA 3CFOA 5DK5A 3I0RA 1DLOA 4MFBA 5CY4A 2DTUA 5CZ1A 1D8YA 4BE1A 1FKPA 3HL8A 4R5PA 4I7FA 5J2PA 4DTRA 2WOMA 4M3ZA 1BI4B 4FZZA 4CGJA 4B8CA 1WSEA 2Z1HA 3O3GA 1WAFA 2Z1GA 1C0UA 2ZD1A 5HLFA 2HB5A 4O0IA 2F8TA 3NE6A 3HK2A 2EHGA 3ZT3A 1HRHA 1Q9YA 4J2DA 4E3SA 2Y1JA 3QEXA 1ZBLA 4EZ6A 4B9MA 4KAZA 1NJYA 3OYIA 2HVIA 4N56A 3O3HA 4M41A 4AHTA 1WN7A 3LWLA 4N41A 3LP2A 2FBXA 3OYCA 2HHXA 3S3OA 3KIOA 4CHZA 4UQGA 4G1QA 4NCBA 3T1AA 3ZSWA 1L5UA 5KI6A 2XY6A 1FXXA 1DTQA 1REVA 3RR8A 3WNFA 4CJTA 3KK3A 1J5OA 4O0JA 3OS2A 1VSLA 2FC0A 1JLEA 3S3MA 4M3YA 3SQ2A 1SUQA 1B9FA 1WSIA 3LAKA 3OS0A 2PYLA 1QHTA 1TKZA 2KQ2A 3OYNA 3U3YA 3V6DA 2D5RA 5SZTA 1UA0A 1RBVA 1ZBUA 2JLEA 4B8AB 1XC9A 4LY7A 3ZT0A 3I8DA 5J2MA 2YNHA 4CJFA 4PUOA 2OA8A 4JRQA 4YFUA 4NCAA 2E6LA 2HHVA 4CIGA 2OYQA 2RKIA 1KVCA 2HNYA 3NH0A 1TK8A 4AHVA 4CJLA 1ASUA 4EP4A 4KB0A 1BHLA 1W9HA 4DQPA 4PQUA 1L3VA 3PO4A 3ISNC 1BCOA 3AVMA 5E41A 3SPYA 3HXMA 3PX0A 4B9LA 1LWCA 4DLEA 4LH4A 4F8RA 3SUQA 4FJLA 1CXUA 1YTAA 4B9SA 4KHUA 3V9UA 4J2EA 4JS4A 4FLZA 3L2WA 4CGDA 1C6VA 4Z4FA 1VSEA 2XY7A 4B9TA 3F9KA 1GOCA 1FK9A 1S1VA 1GOAA 1I39A 3KLIA 3TABA 3OJSA 4J2AA 3P1GA 1BQMA 1J53A 1Q9XA 2OZMA 1D9FA 3TAMA 1UWBA 1IKYA 1Q8IA 1XWLA 4KV8A 3V1QA 4DS4A 4BWJA 1Z25A 4XIUA 2HHTA 1JLAA 1WSFA 4OKJA 4RW6A 4CEBA 4CIEA 2Y1IA 4KTZA 2IDOA 3C6UA 3CG7A 3L3UA 4F3OA 1NKCA 3HVTA 3OYHA 1F21A 3RR7A 4KB1A 2OPSA 1VSMA 5CZ2A 3ZSRA 1HYSA 2G8FA 1C1BA 3QIPA 1JLCA 3QLHA 4NCGA 2OPPA 4O4GA 4DTPA 1LWFA 4CGGA 1NK6A 2P1JA 1JLGA 5C25A 3DRSA 3SYZA 1RDBA 3NF6A 1TKTA 2B5JA 3QETA 1DTTA 2KZMA 4DLGA 4KHNA 1BL3A 1NK7A 3KK1A 1WSGA 3NGZA 1JL1A 1TL3A 4FJHA 3EZ5A 2XO7A 4BDYA 1KTQA 4CEFA 4CFDA 3VQ7A 4CEAA 1NOZA 2YKMA 4FW1A 4H4MA 5HRRA 4HUEA 1ITGA 4O55A 4HHTA 4FZXC 3VQCA 1NK5A 4CJQA 3QEVA 1NK9A 2IGIA 4FM1A 2XY5A 4LH5A 2VG6A 1S9GA 2OZSA 4W5QA 4DG1A 1WNSA 2D0AA 3L3VA 4JS5A 3M8PA 3SUOA 1JLFA 5HRSA 1LW0A 4BACA 3KKRA 2DFHA 4O44A 1RT7A 2HMIA 1RT1A 3H08A 1BIZA 4GW6A 4RW9A 2WONA 4I2QA 4CF2A 4FM0A 3S3NA 4AHSA 5HRNA 1BI4A 3MEDA 3LDSA 4ZTFA 1UA1A 4FJ8A 2ATQA 4I2PA 2VG7A 1S1WA 4CIFA 2E4LA 4OKKA 1CLQA 3HPOA 3V9WA 4QCLA 1WAJA 3P5JA 4ID5A 3SV3A 1NOYA 3KLEA 3KD5E 1TK0A 4RW7A 3EYZA 1HJRA 4CEZA 3O4QA 1HNIA 3K5NA 1C0TA 4W5NA 4CK3A 4DQRA 2B6AA 4M3RA 4E89A 4FK2A 3EY1A 1NJZA 1VSHA 4OGCA 4CJSA 4IBNA 3V9XA 3SQ0A 2FBVA 3LP3A 2HNDA 3TWHA 3ZSYA 1K6YA 3NGIA 4BE2A 2X74A 1NK0A 2ZQBA 1I3AA 1VK0A 4M3XA 4DU1A 2HHWA 4CJ3A 4DFMA 1U47A 2YNIA 2JGUA 4O5BA 1JKHA 1J54A 2YNFA 3RMDA 4ICLA 3I0SA 2EX3A 4KHSA 2DFFA 1W0HA 4GMJB 2BANA 5CYQA 3NBPA 4FVMA 3AVLA 5K14A 3TR8A 4N5SA 3PY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE2 A;  3TI0 A;  2AJQ A;  3ULD A;  3SUP A;  4E7L A;  1SL2 A;  4B9N A;  4DSK A;  2DY4 A;  1MU2 A;  5SWM A;  4DFP A;  1BIS A;  4KHW A;  2LSN A;  3QER A;  4CED A;  3RMA A;  4IG0 A;  3ZSQ A;  3DOK A;  3DMJ A;  3VA0 A;  2PY5 A;  2BGG A;  4E7I A;  1HPZ A;  3VA3 A;  3KKS A;  3V9Z A;  3C94 A;  4DQQ A;  3WNG A;  4FJ9 A;  4H4O A;  4KTQ A;  3QEP A;  4Z4E A;  1XI1 A;  3AVF A;  2B4J A;  3MEC A;  3RMB A;  1JXB A;  4KI6 A;  3ZSO A;  3MEE A;  1CXQ A;  4F2R A;  4J2B A;  4CF8 A;  3ZSV A;  3VQQ A;  3HM9 A;  1L3T A;  2F96 A;  3VQP A;  3MXM A;  4IDK A;  1U4B A;  4Z4G A;  5FRN A;  1YTU A;  4FJJ A;  3HP6 A;  4CF9 A;  2GBZ A;  3CYM A;  2KFN A;  1A5V A;  4KO0 A;  4CHY A;  1RNH A;  4CJR A;  3RTV A;  4FLW A;  3OYK A;  3SZ2 A;  1R0A A;  1ZBI A;  4MQ3 A;  4Z0U A;  1NK8 A;  1T8E A;  3DM2 A;  4CEC A;  3VQ9 A;  3TAE A;  4FLU A;  1N5Y A;  3KD1 E;  2QKK A;  4DU4 A;  4M3T A;  3QIO A;  1XHX A;  2E6M A;  3VQ8 A;  1RT5 A;  3OYJ A;  1C1C A;  4CHN A;  1X9S A;  4KI4 A;  3AO5 A;  1B92 A;  4M3W A;  1VSK A;  4Y1D A;  1HNV A;  4QAG A;  1N6Q A;  3AVH A;  1T05 A;  2O4I A;  5C24 A;  3B6O A;  4CHQ A;  4CJU A;  4FK4 A;  1QS4 A;  2RPI A;  2VG5 A;  3RMC A;  1LAV A;  4FJG A;  1VSD A;  1KFD A;  3LAM A;  4DTN A;  3TAG A;  3QIN A;  4N47 A;  1QTM A;  5KGW A;  3CFR A;  4KPY A;  3F73 A;  3C6T A;  3NF9 A;  5FDL A;  3K57 A;  3LZI A;  3DLR A;  4FLV A;  5KTQ A;  1BIU A;  3QEI A;  3HYF A;  4FZY A;  3MXJ A;  1IKV A;  4FM2 A;  1RDC A;  4DTX A;  3HJF A;  4Q0B A;  1HMV A;  3WNE A;  2IAJ A;  4FXD A;  3NAE A;  4F2S A;  2HW3 A;  5KGX A;  4CGF A;  4QOZ B;  4CF0 A;  3K2P A;  4W5O A;  3SUN A;  3P83 D;  3V1O A;  4CFB A;  1A5W A;  4DFK A;  3IAY A;  3A2F A;  3VQA A;  1U45 A;  2GV9 A;  1LWE A;  3VQB A;  4E19 A;  1X9W A;  4Z4H A;  1QQC A;  4W5R A;  5KRS A;  3L2R A;  3AVA A;  4CCH A;  1X1P A;  3LAN A;  4Y1C A;  3LP1 A;  4FJN A;  3M8Q A;  2XHB A;  3DOL A;  1SL1 A;  3HPG A;  3CM5 A;  5FRM A;  3LAL A;  3AO4 A;  3FFI A;  4CJK A;  2VWJ A;  3QEW A;  4Z4I A;  1RDD A;  5J2Q A;  3IS9 A;  4DF8 A;  4HVJ A;  4E0D A;  1KLM A;  1RBS A;  2D0C A;  1RT6 A;  2VWK A;  4DSE A;  1QSL A;  3BDP A;  5HRO A;  1UOC A;  2D0B A;  1T7P A;  1HYV A;  4E7K A;  4FK0 A;  2ZE2 A;  4K8Z A;  4AHC A;  3AO3 A;  2HNZ A;  1TKD A;  2QXF A;  4WE1 A;  1SV5 A;  3HVR A;  4CJP A;  1XHZ A;  1X9M A;  3O4N A;  1IKW A;  3ZT4 A;  1S1X A;  4FJK A;  4IG3 A;  1VSI A;  4HUF A;  4CEE A;  3WNH A;  2HHS A;  2PYJ A;  1YVU A;  2KFZ A;  3NDK A;  4KRE A;  2X6N A;  3VQE A;  4B9U A;  2KW4 A;  4DQI A;  2QK9 A;  4W5T A;  1VSF A;  3DRR A;  3NF7 A;  5JS2 A;  4OPJ A;  3LWM A;  4E7H A;  4CGH A;  1S5J A;  4IFV A;  3OYA A;  1LAW A;  2G8W A;  3AVB A;  1U04 A;  3V81 A;  3UIQ A;  4FJI A;  1KCF A;  1SKS A;  3OS1 A;  4C8L A;  1JL2 A;  3DLH A;  3VN5 A;  1RT3 A;  4CJE A;  4CHO A;  4Z4C A;  1TV6 A;  3LZJ A;  4N76 A;  3DLK A;  4AHU A;  3E01 A;  3AVJ A;  4CK1 A;  3SJJ A;  1IO2 A;  3M8R A;  2G8V A;  3ZCM A;  2Z1J A;  3TAR A;  4CJW A;  2R7Y A;  4ELV A;  3OYD A;  3D45 A;  4FJ5 A;  1S6P A;  4OVL A;  4C8K A;  4FLY A;  1RTH A;  3ALY A;  1UAX A;  2X6S A;  3D0P A;  3IG1 A;  1WLJ A;  2RF2 A;  4H8K A;  3SQ4 A;  1HYZ A;  3NH1 A;  1L3U A;  1SKR A;  3L2Q A;  3B6P A;  1JXE A;  1D5A A;  1RBU A;  1RDA A;  3U3G A;  2P5O A;  2IC3 A;  4IKF A;  2DFE A;  4DTM A;  2OPR A;  4CJV A;  4DFJ A;  1EX4 A;  1S6Q A;  4HTU A;  1D9D A;  3TAP A;  4CFC A;  3L8B A;  4DTU A;  4RG8 A;  4Q5V A;  3L2U A;  3SCX A;  3PV8 A;  3NGY A;  1BCM A;  1NK4 A;  3QO9 A;  3OYM A;  4RW4 A;  2IS3 A;  4E1N A;  2XY8 A;  5HBM A;  1U48 A;  4ELT A;  4C8O A;  4KHY A;  4K8X A;  1ZYQ A;  2O4G A;  2HVH A;  3ZT2 A;  1KRP A;  2Z1I A;  2ETJ A;  1IH7 A;  4B08 A;  4DMN A;  3LPU A;  4OPK A;  2YV0 X;  2A1R A;  4CHP A;  1NKE A;  3CQ8 A;  5J2N A;  4GVM A;  4CK2 A;  1C0M A;  3K5O A;  3SPZ A;  2A1S A;  4LD0 A;  3CFP A;  4DTO A;  5JS1 A;  4B9V A;  1FKO A;  1TKX A;  5J1E A;  3MXI A;  1ZBF A;  4FJX A;  1CZ9 A;  1SL0 A;  5HRP A;  4FW2 A;  2P51 A;  3PX6 A;  3KJV A;  3LPT A;  4KKO A;  3TAF A;  4AH9 A;  1G15 A;  3G10 A;  1S1U A;  4IFY A;  3K5M A;  1WSJ A;  4CJ5 A;  4ZHR A;  3T3F A;  1TK5 A;  4F3T A;  2KTQ A;  3QNN A;  1HQU A;  3HST B;  3RRH A;  4DWI A;  5EU7 A;  3DLE A;  1TAQ A;  1LV5 A;  4BE0 A;  1J9A A;  4CFA A;  4JRP A;  3HPH A;  4FLX A;  3VQD A;  1KLN A;  5CYM A;  1QE1 A;  4CES A;  4DSL A;  4KHQ A;  3ZSZ A;  1BGX T;  3NHG A;  3OYB A;  3VQ4 A;  5KRT A;  5HP1 A;  3THV A;  1RT2 A;  3AA4 A;  4HCB A;  3KLH A;  4E7J A;  4JLH A;  1O1W A;  4LSN A;  2FBT A;  4DSF A;  1IG9 A;  2PZS A;  3VQ6 A;  3DYA A;  3AO1 A;  3K5L A;  1KVA A;  2FBY A;  1KSP A;  1RIL A;  2QKB A;  4NYF A;  3JSM A;  3ASM A;  3IRX A;  4E1M A;  1JLQ A;  3OVN A;  4CEO A;  3KK2 A;  4AIL C;  3VQ5 A;  4CE9 A;  3AVG A;  4M42 A;  4OLA A;  4ID1 A;  3AA2 A;  4OJR A;  3DI6 A;  1NKB A;  3L2V A;  1Z26 A;  4BDP A;  4OKE A;  4DU3 A;  3DLB A;  4CGI A;  2ITG A;  3KTQ A;  4DSI A;  4M3U A;  4CEQ A;  4HUG A;  3OYL A;  3BGR A;  3QES A;  4DTJ A;  3S9H A;  3PX4 A;  4C8N A;  1QSY A;  1KVB A;  2NUB A;  3TAN A;  4DTS A;  3NCI A;  4I9L A;  1ASW A;  4CER A;  1EXQ A;  3K59 A;  4I9Q A;  4OLB A;  2HHU A;  3PO5 A;  3OYE A;  3TAQ A;  1YT3 A;  3SNN A;  1T03 A;  4NYN A;  3HP9 A;  3OYF A;  1NJX A;  3RWU A;  1RCH A;  4F4K A;  3HT3 A;  1ASV A;  3JYT A;  2YNG A;  1TGO A;  3AVC A;  1B9D A;  3ZT1 A;  4FJ7 A;  1LW2 A;  2W42 A;  3KLF A;  3RRG A;  3OJU A;  3AV9 A;  1RBT A;  2F8S A;  3ITH A;  1RT4 A;  2RN2 A;  1EKE A;  3K58 A;  1A5X A;  5DMR A;  4M45 A;  1RTD A;  3QNO A;  4L8R B;  3AVK A;  2YHB A;  1VRT A;  3SQ1 A;  3HO1 A;  3LP0 A;  1C1A A;  4DQS A;  1EET A;  4LSL A;  3NH2 A;  4PY5 A;  4ZTJ A;  2G8K A;  5FRO A;  4B3O A;  2X78 A;  1SKW A;  2BDP A;  5D3G A;  4OGE A;  3OY9 A;  3SI6 A;  1CZB A;  1TAU A;  1JLB A;  3AVN A;  4FLT A;  1RBR A;  1TL1 A;  1L3S A;  4PWD A;  5I42 A;  1RTI A;  1GOB A;  1S1T A;  3T19 A;  1QSS A;  4C8M A;  4KFB A;  4CF1 A;  4EP5 A;  2YHA A;  3V1R A;  3V9S A;  3C95 A;  4YNQ A;  3ZSX A;  3MAQ A;  4DF4 A;  3DLG A;  4KTW A;  1NJW A;  3NF8 A;  4PA1 A;  4BDZ A;  4CJ4 A;  3AA3 A;  1Y97 A;  1EP4 A;  3AO2 A;  3O3F A;  3AVI A;  5C42 A;  4FYD A;  3G0Z A;  2P5G A;  2HHQ A;  5T7B A;  4AHR A;  3PUF A;  1KFS A;  5I3U A;  2G8U A;  3MEG A;  4ELU A;  1VRU A;  1WSH A;  3NFA A;  3OYG A;  3U6F A;  2IOC A;  1U49 A;  4FJM A;  3V4I A;  1VSJ A;  1HQE A;  4HCC A;  4EZ9 A;  2YKN A;  1IKX A;  3CM6 A;  2G8I A;  1BQN A;  2G8H A;  2GUI A;  2Q3S A;  4FCY A;  3SV4 A;  4KRF A;  3M8S A;  3AA5 X;  4BWM A;  4DS5 A;  4RW8 A;  1ZBH A;  1S9E A;  1RTJ A;  1TVR A;  2XRI A;  3DRP A;  3KLG A;  2OPQ A;  4DSJ A;  2I5J A;  4TSX A;  2KZZ A;  3CFO A;  5DK5 A;  3I0R A;  1DLO A;  4MFB A;  5CY4 A;  2DTU A;  5CZ1 A;  1D8Y A;  4BE1 A;  1FKP A;  3HL8 A;  4R5P A;  4I7F A;  5J2P A;  4DTR A;  2WOM A;  4M3Z A;  1BI4 B;  4FZZ A;  4CGJ A;  4B8C A;  1WSE A;  2Z1H A;  3O3G A;  1WAF A;  2Z1G A;  1C0U A;  2ZD1 A;  5HLF A;  2HB5 A;  4O0I A;  2F8T A;  3NE6 A;  3HK2 A;  2EHG A;  3ZT3 A;  1HRH A;  1Q9Y A;  4J2D A;  4E3S A;  2Y1J A;  3QEX A;  1ZBL A;  4EZ6 A;  4B9M A;  4KAZ A;  1NJY A;  3OYI A;  2HVI A;  4N56 A;  3O3H A;  4M41 A;  4AHT A;  1WN7 A;  3LWL A;  4N41 A;  3LP2 A;  2FBX A;  3OYC A;  2HHX A;  3S3O A;  3KIO A;  4CHZ A;  4UQG A;  4G1Q A;  4NCB A;  3T1A A;  3ZSW A;  1L5U A;  5KI6 A;  2XY6 A;  1FXX A;  1DTQ A;  1REV A;  3RR8 A;  3WNF A;  4CJT A;  3KK3 A;  1J5O A;  4O0J A;  3OS2 A;  1VSL A;  2FC0 A;  1JLE A;  3S3M A;  4M3Y A;  3SQ2 A;  1SUQ A;  1B9F A;  1WSI A;  3LAK A;  3OS0 A;  2PYL A;  1QHT A;  1TKZ A;  2KQ2 A;  3OYN A;  3U3Y A;  3V6D A;  2D5R A;  5SZT A;  1UA0 A;  1RBV A;  1ZBU A;  2JLE A;  4B8A B;  1XC9 A;  4LY7 A;  3ZT0 A;  3I8D A;  5J2M A;  2YNH A;  4CJF A;  4PUO A;  2OA8 A;  4JRQ A;  4YFU A;  4NCA A;  2E6L A;  2HHV A;  4CIG A;  2OYQ A;  2RKI A;  1KVC A;  2HNY A;  3NH0 A;  1TK8 A;  4AHV A;  4CJL A;  1ASU A;  4EP4 A;  4KB0 A;  1BHL A;  1W9H A;  4DQP A;  4PQU A;  1L3V A;  3PO4 A;  3ISN C;  1BCO A;  3AVM A;  5E41 A;  3SPY A;  3HXM A;  3PX0 A;  4B9L A;  1LWC A;  4DLE A;  4LH4 A;  4F8R A;  3SUQ A;  4FJL A;  1CXU A;  1YTA A;  4B9S A;  4KHU A;  3V9U A;  4J2E A;  4JS4 A;  4FLZ A;  3L2W A;  4CGD A;  1C6V A;  4Z4F A;  1VSE A;  2XY7 A;  4B9T A;  3F9K A;  1GOC A;  1FK9 A;  1S1V A;  1GOA A;  1I39 A;  3KLI A;  3TAB A;  3OJS A;  4J2A A;  3P1G A;  1BQM A;  1J53 A;  1Q9X A;  2OZM A;  1D9F A;  3TAM A;  1UWB A;  1IKY A;  1Q8I A;  1XWL A;  4KV8 A;  3V1Q A;  4DS4 A;  4BWJ A;  1Z25 A;  4XIU A;  2HHT A;  1JLA A;  1WSF A;  4OKJ A;  4RW6 A;  4CEB A;  4CIE A;  2Y1I A;  4KTZ A;  2IDO A;  3C6U A;  3CG7 A;  3L3U A;  4F3O A;  1NKC A;  3HVT A;  3OYH A;  1F21 A;  3RR7 A;  4KB1 A;  2OPS A;  1VSM A;  5CZ2 A;  3ZSR A;  1HYS A;  2G8F A;  1C1B A;  3QIP A;  1JLC A;  3QLH A;  4NCG A;  2OPP A;  4O4G A;  4DTP A;  1LWF A;  4CGG A;  1NK6 A;  2P1J A;  1JLG A;  5C25 A;  3DRS A;  3SYZ A;  1RDB A;  3NF6 A;  1TKT A;  2B5J A;  3QET A;  1DTT A;  2KZM A;  4DLG A;  4KHN A;  1BL3 A;  1NK7 A;  3KK1 A;  1WSG A;  3NGZ A;  1JL1 A;  1TL3 A;  4FJH A;  3EZ5 A;  2XO7 A;  4BDY A;  1KTQ A;  4CEF A;  4CFD A;  3VQ7 A;  4CEA A;  1NOZ A;  2YKM A;  4FW1 A;  4H4M A;  5HRR A;  4HUE A;  1ITG A;  4O55 A;  4HHT A;  4FZX C;  3VQC A;  1NK5 A;  4CJQ A;  3QEV A;  1NK9 A;  2IGI A;  4FM1 A;  2XY5 A;  4LH5 A;  2VG6 A;  1S9G A;  2OZS A;  4W5Q A;  4DG1 A;  1WNS A;  2D0A A;  3L3V A;  4JS5 A;  3M8P A;  3SUO A;  1JLF A;  5HRS A;  1LW0 A;  4BAC A;  3KKR A;  2DFH A;  4O44 A;  1RT7 A;  2HMI A;  1RT1 A;  3H08 A;  1BIZ A;  4GW6 A;  4RW9 A;  2WON A;  4I2Q A;  4CF2 A;  4FM0 A;  3S3N A;  4AHS A;  5HRN A;  1BI4 A;  3MED A;  3LDS A;  4ZTF A;  1UA1 A;  4FJ8 A;  2ATQ A;  4I2P A;  2VG7 A;  1S1W A;  4CIF A;  2E4L A;  4OKK A;  1CLQ A;  3HPO A;  3V9W A;  4QCL A;  1WAJ A;  3P5J A;  4ID5 A;  3SV3 A;  1NOY A;  3KLE A;  3KD5 E;  1TK0 A;  4RW7 A;  3EYZ A;  1HJR A;  4CEZ A;  3O4Q A;  1HNI A;  3K5N A;  1C0T A;  4W5N A;  4CK3 A;  4DQR A;  2B6A A;  4M3R A;  4E89 A;  4FK2 A;  3EY1 A;  1NJZ A;  1VSH A;  4OGC A;  4CJS A;  4IBN A;  3V9X A;  3SQ0 A;  2FBV A;  3LP3 A;  2HND A;  3TWH A;  3ZSY A;  1K6Y A;  3NGI A;  4BE2 A;  2X74 A;  1NK0 A;  2ZQB A;  1I3A A;  1VK0 A;  4M3X A;  4DU1 A;  2HHW A;  4CJ3 A;  4DFM A;  1U47 A;  2YNI A;  2JGU A;  4O5B A;  1JKH A;  1J54 A;  2YNF A;  3RMD A;  4ICL A;  3I0S A;  2EX3 A;  4KHS A;  2DFF A;  1W0H A;  4GMJ B;  2BAN A;  5CYQ A;  3NBP A;  4FVM A;  3AVL A;  5K14 A;  3TR8 A;  4N5S A;  3PY8 A; 
#chains in the Genus database with same CATH topology
 3TI0 A;  1QQO A;  2HOE A;  3A5M C;  4K41 A;  3EN9 A;  1SL2 A;  3SMS A;  1BIS A;  4IG0 A;  3P38 A;  3SK3 A;  1HPZ A;  3KKS A;  2UYT A;  4DQQ A;  2V7Z A;  3QEP A;  4BC3 A;  3AVF A;  3WXM B;  1CXQ A;  1VQN N;  4CF8 A;  3ZSV A;  3HM9 A;  3DXK B;  1U4B A;  4FJJ A;  2KFN A;  4FLW A;  3Q7B A;  4Z0U A;  3DM2 A;  4O8U A;  3TAE A;  1N5Y A;  3KD1 E;  3QIO A;  1XHX A;  4FWK A;  1RT5 A;  4K42 A;  3FLC O;  3AO5 A;  5FPN A;  4XH1 A;  4QAG A;  3AVH A;  5EX5 A;  4CHQ A;  4CZE A;  3UE5 A;  1VSD A;  1KFD A;  3TAG A;  4N47 A;  5AZJ B;  3C6T A;  3TPQ A;  1XQS C;  5KTQ A;  1BIU A;  3MXJ A;  4FM2 A;  5AQX A;  1HMV A;  3WNE A;  3FZH A;  3VES A;  2HW3 A;  5M1F A;  4CZF A;  3K0S A;  1X9W A;  4OO1 J;  3LAN A;  4Y1C A;  3LP1 A;  2P9L A;  3M8Q A;  5FPM A;  3CM5 A;  4H0V B;  1YI2 N;  3LAL A;  2VWJ A;  1GLF O;  4WQ4 A;  1Q82 O;  1TUU A;  1RFQ A;  4DSE A;  1RT6 A;  1X9J A;  3VPZ A;  1XC3 A;  2A6A A;  4E7K A;  4FK0 A;  3ZX3 A;  2E1Z A;  3AO3 A;  1TKD A;  1SV5 A;  4CJP A;  3BUZ B;  2ZJQ L;  1I94 K;  3VQE A;  4DQI A;  4BRG A;  5IWA K;  4E7H A;  1S5J A;  3OYA A;  1LAW A;  1VQL N;  3J8A A;  3V81 A;  1KCF A;  1SKS A;  1WBD A;  1JL2 A;  1HNW K;  4CJE A;  3LZJ A;  4CK1 A;  4ELV A;  2G8V A;  5HOO A;  3C7N B;  4A2A A;  4OVL A;  3CXC M;  1RTH A;  2X6S A;  3D0P A;  1WLJ A;  5AQH A;  2AP1 A;  1MWM A;  4A57 A;  1BDG A;  3VF4 A;  1L3U A;  1YUW A;  4B1Z A;  3B6P A;  3L2Q A;  1RBU A;  1RDA A;  3TSP A;  2P5O A;  2IC3 A;  3D2E A;  4GV3 A;  1MA9 B;  5LJW A;  4HTU A;  1D9D A;  4FL9 A;  5ADX A;  4KH4 A;  2ZGY A;  3NGY A;  1RDU A;  2XY8 A;  1ZYQ A;  2Q36 A;  4QS7 A;  4R79 A;  4B08 A;  4DMN A;  2ZGZ A;  2YV0 X;  2QA4 N;  4CK2 A;  1C0M A;  3K5O A;  4B9V A;  1FKO A;  4FJX A;  5HRP A;  2P51 A;  3PX6 A;  2YJF A;  4KKO A;  1NJI O;  4AH9 A;  1CZA N;  3K5M A;  3THY A;  5AJ3 K;  4ZHR A;  3T3F A;  2OAN A;  2IIR A;  3SAH A;  3VTI A;  2KTQ A;  1TUY A;  3RRH A;  1LV5 A;  3BY5 A;  1Y64 A;  5IT9 O;  1QE1 A;  5AQW A;  3CCQ N;  1G99 A;  1ATR A;  3U4L A;  3PIP L;  4QS9 A;  3UKR B;  4JKH A;  5M1Q A;  4PKH A;  2FBY A;  1KSP A;  1RIL A;  3FGU A;  3QFU A;  4NYF A;  1JLQ A;  3SJH A;  5BRF A;  3VQ5 A;  2BUP A;  3S41 A;  4DB3 A;  4OJR A;  2ZJP L;  3DI6 A;  1NKB A;  3C65 A;  3DLB A;  4HUG A;  3OYL A;  4DTJ A;  3DWL A;  3VEZ A;  3NCI A;  3K59 A;  4LF8 K;  4I6M B;  1YT3 A;  1T03 A;  2NLX A;  3HT3 A;  3JYT A;  4X62 K;  3KLF A;  2CH5 A;  2CGK A;  3E66 A;  1RDW X;  4CD3 A;  3K58 A;  4M45 A;  2A5X A;  3NVM A;  3SQ1 A;  4DR4 K;  1Q18 A;  4LSL A;  1HKG A;  4ZTJ A;  2IVO A;  3SI6 A;  5BPM A;  1TAU A;  1BU6 O;  1L3S A;  4PWD A;  5AZI A;  3ZET A;  3RSE A;  3T19 A;  2P9S B;  1LOT B;  1N34 K;  3V1R A;  5M1O A;  4YOR A;  1EO1 A;  3WXJ A;  3DLG A;  2P9K B;  3NF8 A;  4PA1 A;  4CJ4 A;  1EP4 A;  3AVI A;  3G0Z A;  3H45 C;  4JD2 B;  2HHQ A;  1IG8 A;  3CPW M;  4FWL A;  5T7B A;  4AHR A;  3PUF A;  1VRU A;  4U7B A;  1VSJ A;  5C15 A;  4HCC A;  1IKX A;  4YOT A;  3CM6 A;  2V52 B;  2P9P A;  4LC9 B;  3ID6 A;  3M8S A;  1M1K O;  2XRI A;  3PSF A;  4JKB A;  1N8R O;  4OPA A;  2FSN A;  4MFB A;  5CY4 A;  1EQY A;  4H03 B;  4YOX A;  4BE1 A;  4O5F A;  1HJO A;  2Z1G A;  3CJ7 A;  2ZD1 A;  3P39 A;  5HLF A;  1E4G T;  2F8T A;  3NE6 A;  4J2D A;  4E3S A;  3VER A;  2E20 A;  4B9M A;  1OH8 A;  3OYI A;  5M1N A;  3O3H A;  4N41 A;  3LP2 A;  2FBX A;  3S3O A;  5KI6 A;  1BOT O;  1DTQ A;  3WNF A;  1J5O A;  4O0J A;  3OS2 A;  2FC0 A;  4BRC A;  2PYL A;  1TKZ A;  4IO8 A;  4CBU A;  4BG8 A;  1K8K B;  1UA0 A;  2QKB A;  2A3Z A;  4FSV A;  1T3V A;  4YFU A;  4NCA A;  2HHV A;  3MWP A;  2OYQ A;  2HNY A;  3FZF A;  1Q81 O;  3U9Z A;  1U2V B;  3NH0 A;  1N36 K;  4KB0 A;  4CZM A;  1BHL A;  1W9H A;  2WUS A;  3AVM A;  5E41 A;  4NLC A;  1LWC A;  1HX1 A;  4K43 A;  4B9S A;  4KHU A;  4IZ9 A;  4JI2 K;  3L2W A;  1VSE A;  1I39 A;  3EKU A;  3J7Z O;  3OJS A;  1WOQ A;  2KHO A;  4BRL A;  5BRE A;  1J53 A;  1UWB A;  3V1Q A;  4KV8 A;  4BWJ A;  1JLA A;  4OX9 K;  3DXM A;  4KTZ A;  4WFB L;  2OTL N;  2G8F A;  1JLC A;  1P90 A;  1ATN A;  4NCG A;  4DTP A;  3QBW A;  2VGM A;  3OW2 M;  3CCJ N;  4H5N A;  3T1H K;  3SAF A;  1NMN A;  4HWI A;  4KHN A;  1BL3 A;  1NK7 A;  1WSG A;  2V7Y A;  3EZ5 A;  4FJH A;  4BC5 A;  4CEF A;  3CPE A;  2YKM A;  4HHT A;  1NK5 A;  4CZG A;  2D4W A;  3DJC A;  5EVZ A;  1NK9 A;  1QQM A;  3O08 A;  1S9G A;  2BTF A;  2E8A A;  1YHQ N;  4DG1 A;  4DV2 K;  2D0A A;  3L3V A;  3SUO A;  1JLF A;  4A2B A;  3KKR A;  1RT7 A;  1U6Z A;  2WON A;  4I2Q A;  3HOS A;  4FM0 A;  4AHS A;  3MN9 A;  5HRN A;  4CIF A;  1NBW A;  3KK7 A;  1NOY A;  3KLE A;  1VQM N;  5AR0 A;  5B8H A;  2GWJ A;  2YHW A;  3O4Q A;  4EIA A;  2B6A A;  4E89 A;  5JMV A;  5FPD A;  2E2O A;  4CJS A;  2F7T A;  2O8F B;  3IUC A;  2HND A;  1NK0 A;  4BE2 A;  1VK0 A;  4M3X A;  3EZW A;  4JHD B;  4DFM A;  2YNI A;  3I8B A;  5BR8 K;  2E88 A;  4ICL A;  4FVM A;  2UUB K;  3O3G A;  4BR0 A;  2A42 A;  3ULD A;  4H0P A;  3ZEU B;  3ZX0 A;  3SUP A;  4E7L A;  2DY4 A;  1MU2 A;  4DFP A;  2LSN A;  4CED A;  3DXK A;  3AGK A;  3DOK A;  3DMJ A;  2GEM A;  3D7E O;  3GG4 A;  4ILH A;  4E7I A;  3V9Z A;  2Q1N A;  3C94 A;  3PIO L;  4NXM K;  4KTQ A;  2UXB K;  3R8E A;  4XH5 A;  3DLL L;  4Z4E A;  3LDL A;  2HBL A;  3RMB A;  1XI1 A;  2YJE A;  5A2Q O;  4J2B A;  2F96 A;  2KLA A;  3VQP A;  5MLC Q;  4HTL A;  1SZ2 A;  4KO0 A;  4CJR A;  3SZ2 A;  3OYK A;  1ZBI A;  4WF9 L;  4M3T A;  5AZJ A;  2E6M A;  4BRE A;  1B92 A;  2I7P A;  3KZB A;  3BF1 A;  1HNV A;  1T05 A;  2O4I A;  3B6O A;  4BR5 A;  5BN8 A;  4CJU A;  2RPI A;  2VG5 A;  1LAV A;  1QTM A;  4KPY A;  3AAP A;  3F73 A;  3MX5 A;  3LZI A;  4YOY A;  1IBK K;  4M7Y A;  3O9R A;  3HJF A;  3HSC A;  4CGF A;  3K2P A;  4DFK A;  3IAY A;  3A0I X;  3A2F A;  2GV9 A;  1LWE A;  3VQB A;  2WTU A;  4Z4H A;  1QQC A;  4CCH A;  5KRS A;  2Q0U A;  3AVA A;  2XHB A;  3A5N C;  3DOL A;  3QML A;  3CJC A;  3AO4 A;  3FFI A;  5J2Q A;  4PL7 A;  3IS9 A;  5AQK A;  4E0D A;  4JK8 A;  2D0C A;  2Q31 A;  4MO5 A;  5HRO A;  3PSI A;  3W3D A;  1UOC A;  2D0B A;  4IDH A;  1T7P A;  2QTD A;  1VQP N;  4GKK K;  1KAY A;  3EO3 A;  1NM1 A;  2QXF A;  1XHZ A;  1X9M A;  3O4N A;  4CD1 A;  3VF2 A;  3A5L C;  1VSI A;  1YVU A;  4KRE A;  2X6N A;  4DQ8 A;  5JVG L;  5AQV A;  3C7N A;  4BRN A;  5JS2 A;  3T69 A;  4NB4 A;  3VEV A;  1U04 A;  2F9T A;  2E1Y A;  3UIQ A;  3DLH A;  5AQO A;  5JLH A;  3VN5 A;  1XMQ K;  3JS6 A;  3E01 A;  2E2N A;  3UKU A;  3TAR A;  5F2R A;  2GWK A;  3OYD A;  5LMN K;  3D45 A;  4X65 K;  4BVP A;  4LF6 K;  3ALY A;  3WEE B;  3IG1 A;  4H8K A;  2RF2 A;  1VQ7 N;  4BY9 C;  4B1X B;  2D0O A;  4DV7 K;  3I55 N;  4KH6 A;  4F9O A;  2QW9 A;  1SKR A;  1JXE A;  1D5A A;  4DR1 K;  2DFE A;  2HHH K;  1EX4 A;  1K8A O;  3TAP A;  3L8B A;  2O8B A;  3CCE N;  4BGB A;  1OH7 A;  2IS3 A;  4E1N A;  3HTV A;  5HBM A;  3KWG A;  3VF6 A;  4CI6 A;  4JKG B;  2HVH A;  3CJA A;  3ZT2 A;  3ENH A;  1QZ6 A;  4AF1 A;  2ETJ A;  1IH7 A;  4OPK A;  3LPU A;  1NKE A;  5J2N A;  4BR4 A;  3VET A;  4FWM A;  3SPZ A;  4DTO A;  4LFC K;  5J1E A;  3TU5 A;  1P8Z A;  3CCL N;  1S1U A;  1VQ9 N;  1WSJ A;  3BZC A;  3CCM N;  4F3T A;  3UKR A;  3QNN A;  3G6E N;  1WB9 A;  2F4V K;  5EU7 A;  3DLE A;  1TAQ A;  4BE0 A;  1J9A A;  2QWL A;  3VQD A;  4DSL A;  3EEQ A;  3OYB A;  3THV A;  5HP1 A;  1OH5 A;  3C6A A;  3KLH A;  1OKJ A;  4CZH A;  1O1W A;  3WQU A;  2FBT A;  1IG9 A;  4WFA L;  2PZS A;  3K5L A;  3ASM A;  5M1P A;  3IRX A;  4AIL C;  4CEO A;  4OLA A;  4CZK A;  4ID1 A;  3AA2 A;  2ASO A;  4GVE A;  4I6M A;  3FZK A;  4A62 A;  1Z26 A;  4A5A A;  5BRH A;  4BDP A;  4OKE A;  4B3S K;  4M3U A;  4DSI A;  4CEQ A;  3QES A;  2Q0R A;  3PX4 A;  4C8N A;  4Z94 A;  1KXP A;  3IDH A;  4H5W A;  3OYE A;  4NYN A;  3OYF A;  1YF5 L;  3E9L A;  3RWU A;  3THW B;  1TGO A;  3EKS A;  3ZT1 A;  3OJU A;  3AV9 A;  2YCH A;  3VEY A;  3P4I A;  1RBT A;  3VGK A;  1S22 A;  2P9I B;  3VMF B;  2P9S A;  4DQS A;  4H0X B;  1SKW A;  2BDP A;  2P9K A;  5D3G A;  3BP8 A;  4OGE A;  2E2Q A;  2IVN A;  1JLB A;  2PBD A;  3LDQ A;  2FLO A;  3QDK A;  1RTI A;  4BRO A;  4C8M A;  4KFB A;  4CF1 A;  4ISG A;  4EP5 A;  4JV5 K;  3V9S A;  4BR2 A;  4YNQ A;  3ZSX A;  4DF4 A;  4ILJ A;  4H5R A;  4BDZ A;  3O3F A;  1Y97 A;  5CHI A;  1NMD A;  2E5L K;  5FPE A;  5I3U A;  3MEG A;  2E2P A;  4ELU A;  5DM7 L;  3NFA A;  3OYG A;  1FW6 A;  4JI7 K;  3MN7 A;  1HQE A;  1NLV A;  1Q86 O;  4DR5 K;  2G8H A;  5LJV A;  2GUI A;  4FCY A;  2ZF5 O;  4KRF A;  1ZBH A;  1RTJ A;  1NGJ A;  2OPQ A;  4H5T A;  3KLG A;  2I5J A;  4TSX A;  2KZZ A;  1C0F A;  5E26 A;  2DTU A;  1D8Y A;  3CMA N;  5J2P A;  4DTR A;  4M3Z A;  3SLC A;  1BI4 B;  3HI0 A;  4CGJ A;  4XH4 A;  2FXU A;  1BWF O;  4JEP A;  1WAF A;  1C0U A;  4C1N K;  3CD6 N;  4IEI A;  4O0I A;  4FO0 A;  1D4X A;  3ZT3 A;  3HK2 A;  1HRH A;  3SBT A;  2Y1J A;  2YI1 A;  3MCP A;  4BGA A;  3QEX A;  4EZ6 A;  3CC7 N;  2CH6 A;  3HOT A;  4N56 A;  4BRK A;  1YIJ N;  4B3R K;  2CGL A;  3M6G A;  2HHX A;  4CHZ A;  4NCB A;  5LMU K;  3T1A A;  3ZSW A;  1K8K A;  3RR8 A;  1DKG D;  4M3Y A;  3J7Y P;  1U2V A;  1BO5 O;  4LF4 K;  4DR6 K;  3LAK A;  1V4T A;  4DKW A;  4PKG A;  3OYN A;  5SZT A;  2NNW A;  1U49 A;  4GV9 A;  3U8X A;  4LY7 A;  5J2M A;  2YNH A;  4JRQ A;  2RKI A;  1TK8 A;  4CJL A;  3MX2 A;  3F2K A;  1L3V A;  1BCO A;  3ID8 A;  4BQZ A;  4B9L A;  4DLE A;  4JKD A;  4F8R A;  1YTA A;  2UU9 K;  4J2E A;  5AQZ A;  4JS4 A;  4Z4F A;  4B9T A;  3TTD A;  1S1V A;  3SMP A;  1WUA A;  4BRD A;  1NNE A;  1GLJ O;  4J2A A;  4IO9 L;  1QVF M;  2O8C B;  2ASP A;  1Q9X A;  2NRV A;  1YIT N;  1XWL A;  1ZBS A;  2H3G X;  4XIU A;  4DS4 A;  3VGL A;  2D1K A;  2PFU A;  2Y1I A;  4OKJ A;  4CIE A;  5CR4 A;  2IDO A;  3BEX A;  3L3U A;  5HL7 L;  4F3O A;  1HYS A;  5AFU A;  5CZ2 A;  3ZSR A;  1C1B A;  3QIP A;  4O4G A;  1NK6 A;  2P1J A;  5E84 A;  3DRS A;  3MCA B;  3CCS N;  3BZK A;  2W6K A;  1ESV A;  3NGZ A;  1KTQ A;  3LDP A;  1NOZ A;  4H4M A;  3HBT A;  1ITG A;  4O55 A;  3VOV A;  4BRI A;  4GV6 A;  4CJQ A;  2HBK A;  4FM1 A;  2P9N B;  2VG6 A;  4BG9 A;  2QEX N;  2RE2 A;  1YAG A;  1LW0 A;  4LFB K;  4BAC A;  3J81 O;  1RT1 A;  4DV0 K;  1BIZ A;  4RW9 A;  2FSK A;  4CF2 A;  3S3N A;  3F9M A;  3LDS A;  4FJ8 A;  4ZTF A;  1NGF A;  1UA1 A;  3CC2 N;  3CCU N;  2ATQ A;  4G9Z A;  2BH1 A;  2VG7 A;  2E4L A;  1CLQ A;  2O8F A;  1WAJ A;  5C12 A;  4ID5 A;  2PAV A;  4JHD A;  4WYB A;  1TK0 A;  5KQD A;  1HKC A;  1C0T A;  4AM6 A;  4DQR A;  4M3R A;  3EY1 A;  1NJZ A;  4OGC A;  3SQ0 A;  2FBV A;  3ZEU A;  3UB5 A;  3TWH A;  5GAE P;  4M63 C;  2X74 A;  4BRH A;  3O8M A;  4IOC L;  4CZL A;  3FZM A;  3M5R A;  1U47 A;  1MWK A;  4BRP A;  3L0Q A;  3I0S A;  2EWS A;  4GMJ B;  5CYQ A;  3G4S N;  3NBP A;  1HUX A;  4BRF A;  4A61 A;  2BE2 A;  3A5O C;  3O4W A;  4DSK A;  1NGE A;  1XNQ K;  2J4R A;  3VA0 A;  3CI5 A;  2BGG A;  3JXU A;  4H5V A;  3WNG A;  3CME N;  3ENB A;  4C1N I;  2B4J A;  1JXB A;  4KI6 A;  2ASM A;  3MEE A;  1V4S A;  3T1Y K;  1Z05 A;  4IJA A;  5TKY A;  2G8K A;  4Z4G A;  4IOA L;  4IDK A;  5F0X A;  4BC4 A;  4CHY A;  3RTV A;  4MQ3 A;  1NK8 A;  4CEC A;  1K9M O;  3DAW A;  3CJ1 A;  4DU4 A;  1S72 N;  3VQ8 A;  3OYJ A;  1C1C A;  4CHN A;  4H0T B;  4YY3 K;  1SQK A;  4M3W A;  1VSK A;  4Y1D A;  1N6Q A;  1XMO K;  5C24 A;  3TTC A;  1IBL K;  4FK4 A;  3RMC A;  4FJG A;  3QIN A;  5KGW A;  3NF9 A;  3M3Z A;  3QEI A;  3HYF A;  1RDC A;  4Q0B A;  2ZWH A;  3OA9 A;  4FXD A;  3NAE A;  2UXD K;  5KGX A;  3P83 D;  4CFB A;  4DR2 K;  3VQA A;  1U45 A;  4E19 A;  4MLH A;  1YJW N;  4DUY K;  5GAH P;  4FJN A;  1SL1 A;  5FRM A;  4Z4I A;  4CJK A;  1T6C A;  5ADX H;  4DV4 K;  1GLE G;  1RBS A;  2VWK A;  1QSL A;  3WQT A;  1EWQ A;  1HYV A;  3WUH A;  3CET A;  2GEL A;  2ZE2 A;  4K8Z A;  4AHC A;  2HNZ A;  3MN6 A;  4LF9 K;  5BPL A;  3EE9 A;  3EL2 A;  3ZT4 A;  1S1X A;  3ULE B;  4NLB A;  3VEO A;  4CEE A;  3WNH A;  2HHS A;  1J5E K;  5C2D A;  3GDQ A;  2QK9 A;  4CGH A;  4IFV A;  1VQ4 N;  2G8W A;  3WEE A;  3KWI A;  4DV1 K;  5GIP A;  1NGG A;  3OS1 A;  1OVY A;  1RT3 A;  3MN5 A;  4CHO A;  4Z4C A;  1TV6 A;  4N76 A;  1QVG M;  3DLK A;  3HRG A;  4AHU A;  3AVJ A;  4DV5 K;  3CHW A;  1IO2 A;  3ZCM A;  2JWL A;  4WQ4 C;  4FPB A;  4FJ5 A;  1S6P A;  4B1W B;  4C8K A;  1UAX A;  3GOI A;  1IBM K;  3ZET B;  3RSE B;  3FFK B;  1HYZ A;  2ITM A;  4JI0 K;  4B9Q A;  3O9U A;  1JCF A;  3D6R A;  4IKF A;  2OPR A;  3LDN A;  4CJV A;  2NRZ A;  4DFJ A;  1X3M A;  4CFC A;  2YHY A;  1HR0 K;  2I7N A;  3L2U A;  3C0B A;  4ISF A;  3QO9 A;  3CQY A;  2NRT A;  4KH5 A;  2P9P B;  1U48 A;  4C8O A;  3O80 A;  3HZ6 A;  4KHY A;  2CGJ A;  2IVP A;  4K8X A;  1GLL O;  2A1R A;  4RTF D;  3CQ8 A;  1KC8 O;  4C23 A;  2A1S A;  4LD0 A;  3CFP A;  3MXI A;  1CZ9 A;  4PL8 A;  4FW2 A;  3KJV A;  2RHK A;  1G15 A;  4IFY A;  1TK5 A;  2QWM A;  3GBT A;  1HQU A;  4DCH A;  5TKW A;  4DWI A;  5AQN A;  1VQ6 N;  4JKF A;  1WBB A;  5CYM A;  4CES A;  4KHQ A;  5KPZ A;  3AAR A;  3VQ4 A;  5KRT A;  2W6L A;  1RT2 A;  3AA4 A;  4E7J A;  4MDB A;  4LSN A;  4DSF A;  3DYA A;  4RWT A;  3AO1 A;  2DPN A;  2NRR A;  2UUA K;  3R3L A;  3O9T A;  4X64 K;  3JSM A;  4CE9 A;  3AVG A;  5JVH L;  2JWK A;  4ISE A;  3L2V A;  5LY3 A;  4XEI A;  3KTQ A;  4CGI A;  4JK9 A;  3BGR A;  5C0Y A;  4DR7 K;  2NUB A;  4DTS A;  1ASW A;  1EXQ A;  4FWN A;  4I9Q A;  3ZYY X;  3THX B;  1LCU A;  3TAQ A;  2P9I A;  3QFP A;  4LF7 K;  1NJX A;  4F4K A;  1RCH A;  3A8Y A;  2YNG A;  1B9D A;  3AVC A;  2W42 A;  2GTD A;  3NVK A;  3ITH A;  2RN2 A;  1A5X A;  1S3X A;  3QNO A;  1NGB A;  3AVK A;  1C1A A;  5M1K A;  1EET A;  4PY5 A;  4KBO A;  3OBW A;  4BRA A;  2X78 A;  5GAD P;  1CZB A;  4FLT A;  4WQ5 A;  1RBR A;  5I42 A;  1GOB A;  1S1T A;  4CBW A;  3WXL A;  3C95 A;  2HBM A;  3MAQ A;  4BR9 A;  4KTW A;  4FYD A;  3AO2 A;  5C42 A;  2P5G A;  3F5T A;  5AQT A;  2G8U A;  1WSH A;  1HLU A;  1YXQ A;  4CW7 B;  4EZ9 A;  2Q3S A;  4DS5 A;  3L4Q A;  3DRP A;  4JI8 K;  3CFO A;  4K0K K;  3Q7C A;  1DLO A;  3HL8 A;  1MDU B;  2P9U B;  1WSE A;  2Z1H A;  3CF5 L;  2HB5 A;  4JNE A;  3OTO K;  4NO7 A;  3ATU A;  3N4Q A;  4FWQ A;  4AHT A;  3LWL A;  3TSQ A;  4IXC A;  1NG9 A;  3RVC A;  2AA4 A;  4CZJ A;  4AQY K;  4G1Q A;  2QWQ A;  1L5U A;  2XY6 A;  4CJT A;  1T44 A;  3QIC A;  2QI2 A;  4MLE A;  4JI4 K;  1VSL A;  3SAG A;  3S3M A;  5EXW A;  1SUQ A;  1ZXO A;  1VHX A;  1HNZ K;  1W2B M;  1E3M A;  2O8D B;  2KQ2 A;  2NRX A;  3FZL A;  3V6D A;  2D5R A;  1NGI A;  1RBV A;  2JLE A;  2WBN A;  4B8A B;  4PUO A;  3ZT0 A;  3I8D A;  1GLA G;  5EOY A;  2OA8 A;  4KHP K;  5ELZ A;  2E6L A;  2WC9 A;  2QWP A;  1R59 O;  3IKM A;  5JLF A;  4MDA A;  2VQF K;  4V19 S;  3PO4 A;  1TYQ B;  3SPY A;  2A40 A;  3T7Z A;  4CVN E;  3CJ9 A;  2O8C A;  4FLZ A;  4CGD A;  1C6V A;  3K9J A;  3ENO A;  3F9K A;  2W40 A;  1FK9 A;  3KLI A;  3O6W A;  1BG3 A;  4BVO A;  3IFR A;  4NXN K;  3TAM A;  1Z25 A;  5LL6 Z;  4RW6 A;  1BUP A;  3HVT A;  3OYH A;  1F21 A;  5KPR A;  1M90 O;  1VSM A;  3G25 A;  1J6Z A;  3J7A P;  2OPP A;  3VTH A;  1LWF A;  4CGG A;  5C25 A;  1RDB A;  1O13 A;  1TKT A;  2B5J A;  3QET A;  5BRD A;  4JD2 A;  3KK1 A;  2P9N A;  4GNI A;  2XO7 A;  3LL3 A;  3VQ7 A;  4CFD A;  4HUE A;  2O8E B;  3QEV A;  1W7A A;  5KQ8 A;  4FWP A;  1K73 O;  1VAZ A;  4LH5 A;  2W41 A;  2OZS A;  4JI1 K;  3MDQ A;  1WNS A;  3B8A X;  3M8P A;  5HRS A;  1VQ5 N;  2DFH A;  4O44 A;  3VEX A;  2HMI A;  4YHH K;  4YDU A;  3MED A;  2YHX A;  3QBX A;  4B3T K;  1S1W A;  4IOX A;  3HPO A;  3V9W A;  4QCL A;  3P5J A;  1GLB G;  1KAZ A;  4GY2 B;  3KD5 E;  4CEZ A;  3WT0 A;  3K5N A;  1HNI A;  2A41 A;  3D2F B;  4W5N A;  4K25 A;  3MK6 A;  4CK3 A;  4FK2 A;  2VQE K;  3UKU B;  3LP3 A;  4UY8 O;  3ZSY A;  1N32 K;  2KKZ A;  3KVG A;  4DU1 A;  2HHW A;  4CJ3 A;  3I56 N;  2JGU A;  4O5B A;  2YNF A;  3RMD A;  4CBX A;  2EX3 A;  2DFF A;  1W97 L;  5K14 A;  1W0H A;  2BAN A;  3PY8 A;  1JCE A;  1VQO N;  2AJQ A;  4B9N A;  5SWM A;  4KHW A;  2WFB A;  3MWT A;  3QER A;  3RMA A;  3ZSQ A;  2HF3 A;  1ZC6 A;  2PY5 A;  2O8B B;  3VA3 A;  4FJ9 A;  4H4O A;  3TSU A;  3MMV A;  5AQF A;  3MEC A;  3ZSO A;  4IJN A;  5JIC A;  4F2R A;  2VYP A;  4L3Q A;  1L3T A;  3VQQ A;  3MXM A;  1YTU A;  5FRN A;  3HP6 A;  4B1U B;  4CF9 A;  2GBZ A;  3CYM A;  1A5V A;  1RNH A;  1R0A A;  4EAH D;  1T8E A;  3NMU A;  4FVU A;  3VQ9 A;  4FLU A;  2QKK A;  4CZI A;  4B3M K;  2YX6 A;  1X9S A;  3P31 A;  4KI4 A;  4YOW A;  3H46 O;  1KQS M;  3ZLJ A;  3E1Y A;  2QWO A;  1QS4 A;  4MO4 A;  3O9Q A;  4M7X A;  4EHT A;  4JAX A;  4FPA A;  4DTN A;  3LAM A;  5C10 A;  3CFR A;  5FDL A;  3K57 A;  4FLV A;  3DLR A;  1YJN N;  5H1S Q;  4FZY A;  1IKV A;  4DTX A;  4Y0W A;  2IAJ A;  4F2S A;  4QOZ B;  4CF0 A;  3SUN A;  4W5O A;  3V1O A;  1A5W A;  3EE8 A;  2F9W A;  1T6D A;  5AQM A;  3H1Q A;  3L2R A;  4W5R A;  1X1P A;  5AQJ A;  4WFN L;  3HPG A;  4JI5 K;  5AQS A;  3QEW A;  4U67 L;  1RDD A;  4DF8 A;  4FWO A;  4HVJ A;  5BN9 A;  4A59 A;  1KLM A;  3BDP A;  3ULE A;  2P9L B;  4YOU A;  4JKA A;  4J8F A;  3OBY A;  4WE1 A;  3HVR A;  3CJB A;  1IKW A;  3VEN A;  3CQX A;  4FJK A;  4IG3 A;  4HUF A;  2KFZ A;  2PYJ A;  3NDK A;  1IV0 A;  2QXL A;  3CIP A;  4B9U A;  4JYA K;  2KW4 A;  1QQN A;  4W5T A;  1VSF A;  3DRR A;  3NF7 A;  3LWM A;  4OPJ A;  1NGA A;  1OVQ A;  3AVB A;  1X3N A;  1NWK A;  5AQY A;  5EY4 A;  4FJI A;  4C8L A;  2QWR A;  4H0Y B;  3SJJ A;  3M8R A;  1NGC A;  4O8K A;  2Z1J A;  4CJW A;  2R7Y A;  4FLY A;  3CER A;  1ATS A;  3FR0 A;  5AQU A;  3SQ4 A;  3NH1 A;  2Q2R A;  1DEJ A;  1BA0 A;  3H1V X;  3U3G A;  2ZM6 K;  4DR3 K;  4DTM A;  3E9O A;  1SS6 A;  1S6Q A;  4DTU A;  2V51 B;  4RG8 A;  4Q5V A;  4JI6 K;  1VQK N;  3SCX A;  3PV8 A;  1BCM A;  1NK4 A;  3OYM A;  4RW4 A;  4WQ5 C;  4ELT A;  3D2E B;  3L6Q A;  3QB0 A;  5AQQ A;  2QWN A;  2O4G A;  1KRP A;  2Z1I A;  3VEW A;  3CC4 N;  4CHP A;  3O5B A;  4GVM A;  5JS1 A;  1TKX A;  1ZBF A;  3O1W A;  1SL0 A;  3LPT A;  3LDO A;  4BQL A;  3N4P A;  1JCG A;  3TAF A;  3G10 A;  4CJ5 A;  1C0G A;  3HST B;  4DV6 K;  4FOE A;  4FLX A;  4CFA A;  3BF3 A;  3HPH A;  4JRP A;  1KLN A;  4JKE A;  3ZSZ A;  4BC2 A;  1BGX T;  3NHG A;  3THY B;  2VCP A;  4GKJ K;  1YJ9 N;  4HCB A;  4IWV A;  4JLH A;  3R6M A;  5AQL A;  3VQ6 A;  1KVA A;  2NRW A;  3H3N O;  4E1M A;  3KK2 A;  3OVN A;  3VGM A;  4JKC A;  4M42 A;  1NGH A;  3C6H A;  3L4I A;  3THX A;  5AQR A;  4DU3 A;  2ITG A;  3S9H A;  1QSY A;  1KVB A;  3TAN A;  2FSJ A;  4I9L A;  2UUC K;  1HNX K;  4CER A;  1ILY A;  3R9P A;  4OLB A;  2HHU A;  3PO5 A;  3SNN A;  5FLX O;  3HP9 A;  1DT9 A;  1ASV A;  4PHT X;  3AAQ A;  4FJ7 A;  1LW2 A;  1E4F T;  3RRG A;  5I9E B;  4FOI A;  2F8S A;  1RT4 A;  1EKE A;  2VWB A;  5DMR A;  1RTD A;  4L8R B;  4EHU A;  4JI3 K;  2YHB A;  1VRT A;  3HO1 A;  3LP0 A;  3NH2 A;  5FRO A;  4B3O A;  4AM7 A;  3W0L A;  3CCR N;  3OY9 A;  1QHA A;  3AVN A;  4JK7 A;  1TL1 A;  2HMP A;  3HM8 A;  1QSS A;  4FWS A;  2YHA A;  3SBG A;  3G71 N;  2FF6 A;  1NJW A;  3AA3 A;  1KFS A;  1OH6 A;  5AZI B;  3CCV N;  3U6F A;  2IOC A;  4FJM A;  3V4I A;  1EWR A;  1GLD G;  2YKN A;  2G8I A;  1BQN A;  1BA1 A;  3AY9 A;  4BR7 A;  4DHY A;  3SV4 A;  4JKG A;  3AA5 X;  4BWM A;  4RW8 A;  2P9U A;  1S9E A;  1TVR A;  4EFH A;  4DSJ A;  5DK5 A;  5DM6 L;  3I0R A;  3ATV A;  5AQG A;  5CZ1 A;  1KAX A;  1FKP A;  4R5P A;  4I7F A;  2OTJ N;  2WOM A;  2OCE A;  4FZZ A;  4B8C A;  3E9P A;  2NZT A;  3KHY A;  2EHG A;  1Q9Y A;  4KAZ A;  1ZBL A;  3H6E A;  5C2F A;  2HVI A;  1NJY A;  3K9K A;  4M41 A;  2HBJ A;  1WN7 A;  3OYC A;  5AFU H;  3KIO A;  2O8D A;  4UQG A;  1H1V A;  1FXX A;  4YDU C;  1REV A;  4RCH A;  3KK3 A;  3OHR A;  1JLE A;  3SQ2 A;  4E1J A;  1B9F A;  1WSI A;  3OS0 A;  1N33 K;  1QHT A;  3U3Y A;  1TYQ A;  1GLC G;  1XC9 A;  1ZBU A;  4CJF A;  4CIG A;  1KVC A;  4BRQ A;  4AHV A;  1ASU A;  4EP4 A;  1Z6R A;  4DQP A;  4PQU A;  3IMX A;  3ISN C;  4DV3 K;  1HPM A;  4X66 K;  3HXM A;  3PX0 A;  4B1Y B;  3O1B A;  5CE3 A;  4LH4 A;  4FJL A;  3SUQ A;  1CXU A;  1QZ5 A;  1SAZ A;  3V9U A;  1RGI A;  3THW A;  3PLA A;  3R1X A;  1IJJ A;  3I33 A;  2XY7 A;  1GOC A;  1GOA A;  5KPT A;  3TAB A;  2HF4 A;  1FJG K;  1Q7Y O;  3P1G A;  4OPH A;  1BQM A;  1KD1 O;  4IFE A;  1NGD A;  2OZM A;  1D9F A;  1IKY A;  1Q8I A;  3U9D A;  1WSF A;  2HHT A;  4CEB A;  3GL1 A;  2ZJR L;  3C6U A;  3CG7 A;  1DGK N;  3GE1 A;  4JN4 A;  1NKC A;  4KB1 A;  3RR7 A;  3ZX2 A;  2OPS A;  4A5B A;  5GIN A;  3AGR A;  3QLH A;  2UXC K;  1JLG A;  3LM2 A;  4LFA K;  1NU0 A;  3SYZ A;  2O8E A;  3NF6 A;  3DXM B;  1DTT A;  2KZM A;  4LF5 K;  2FF3 B;  4DLG A;  2GX9 A;  2GUP A;  4FWR A;  3LM9 A;  3WXI A;  1VQ8 N;  1JL1 A;  1TL3 A;  4DUZ K;  4BDY A;  5BPN A;  2NRH A;  4CEA A;  1HKB A;  4FW1 A;  5HRR A;  4FZX C;  3VQC A;  4WCE L;  2IGI A;  2XY5 A;  2QM1 A;  3H3O B;  4W5Q A;  4JS5 A;  3H08 A;  4GW6 A;  1YVN A;  4ILG B;  3WXK A;  1JJ2 M;  3D2F A;  4QS8 A;  1BI4 A;  4I2P A;  4IEE A;  4OKK A;  3M1F A;  2HST A;  5GIO A;  3SV3 A;  1XNR K;  5BR9 A;  2D0P A;  4RW7 A;  3EYZ A;  1HJR A;  2Q97 A;  3O9S A;  4BRM A;  3FE1 A;  1VSH A;  4IBN A;  3V9X A;  5AQI A;  5F1X A;  4B1V A;  4YOV A;  2VGN A;  3NGI A;  1K6Y A;  3TTF A;  4CJ7 A;  2ZQB A;  1I3A A;  5AQP A;  4H0O A;  3JAM O;  5GAG P;  1JKH A;  1J54 A;  4KHS A;  3TR8 A;  3J80 O;  3AVL A;  4PKI A;  1XUP O;  4N5S A; 
#chains in the Genus database with same CATH homology
 2BE2 A;  3TI0 A;  2AJQ A;  3ULD A;  3SUP A;  4E7L A;  1SL2 A;  4B9N A;  4DSK A;  2DY4 A;  1MU2 A;  5SWM A;  4DFP A;  1BIS A;  4KHW A;  2LSN A;  3QER A;  4CED A;  3RMA A;  4IG0 A;  3ZSQ A;  3DOK A;  3DMJ A;  3VA0 A;  2PY5 A;  2BGG A;  4E7I A;  1HPZ A;  3VA3 A;  3KKS A;  3V9Z A;  3C94 A;  4DQQ A;  3WNG A;  4FJ9 A;  4H4O A;  4KTQ A;  3QEP A;  4Z4E A;  1XI1 A;  3AVF A;  2B4J A;  3MEC A;  3RMB A;  1JXB A;  4KI6 A;  3ZSO A;  3MEE A;  1CXQ A;  4F2R A;  4J2B A;  4CF8 A;  3ZSV A;  3VQQ A;  3HM9 A;  1L3T A;  2F96 A;  3VQP A;  3MXM A;  4IDK A;  1U4B A;  4Z4G A;  5FRN A;  1YTU A;  4FJJ A;  3HP6 A;  4CF9 A;  2GBZ A;  3CYM A;  2KFN A;  1A5V A;  4KO0 A;  4CHY A;  1RNH A;  4CJR A;  3RTV A;  4FLW A;  3OYK A;  3SZ2 A;  1R0A A;  1ZBI A;  4MQ3 A;  4Z0U A;  1NK8 A;  1T8E A;  3DM2 A;  4CEC A;  3VQ9 A;  3TAE A;  4FLU A;  1N5Y A;  3KD1 E;  2QKK A;  4DU4 A;  4M3T A;  3QIO A;  1XHX A;  2E6M A;  3VQ8 A;  1RT5 A;  3OYJ A;  1C1C A;  4CHN A;  1X9S A;  4KI4 A;  3AO5 A;  1B92 A;  4M3W A;  1VSK A;  4Y1D A;  1HNV A;  4QAG A;  1N6Q A;  3AVH A;  1T05 A;  2O4I A;  5C24 A;  3B6O A;  4CHQ A;  4CJU A;  4FK4 A;  1QS4 A;  2RPI A;  2VG5 A;  3RMC A;  1LAV A;  4FJG A;  1VSD A;  1KFD A;  3LAM A;  4DTN A;  3TAG A;  3QIN A;  4N47 A;  1QTM A;  5KGW A;  3CFR A;  4KPY A;  3F73 A;  3C6T A;  3NF9 A;  5FDL A;  3K57 A;  3LZI A;  3DLR A;  4FLV A;  5KTQ A;  1BIU A;  3QEI A;  3HYF A;  4FZY A;  3MXJ A;  1IKV A;  4FM2 A;  1RDC A;  4DTX A;  3HJF A;  4Q0B A;  1HMV A;  3WNE A;  2IAJ A;  4FXD A;  3NAE A;  4F2S A;  2HW3 A;  5KGX A;  4CGF A;  4QOZ B;  4CF0 A;  3K2P A;  4W5O A;  3SUN A;  3P83 D;  3V1O A;  4CFB A;  1A5W A;  4DFK A;  3IAY A;  3A2F A;  3VQA A;  1U45 A;  2GV9 A;  1LWE A;  3VQB A;  4E19 A;  1X9W A;  4Z4H A;  1QQC A;  4W5R A;  5KRS A;  3L2R A;  3AVA A;  4CCH A;  1X1P A;  3LAN A;  4Y1C A;  3LP1 A;  4FJN A;  3M8Q A;  2XHB A;  3DOL A;  1SL1 A;  3HPG A;  3CM5 A;  5FRM A;  3LAL A;  3AO4 A;  3FFI A;  4CJK A;  2VWJ A;  3QEW A;  4Z4I A;  1RDD A;  5J2Q A;  3IS9 A;  4DF8 A;  4HVJ A;  4E0D A;  1KLM A;  1RBS A;  2D0C A;  1RT6 A;  2VWK A;  4DSE A;  1QSL A;  3BDP A;  5HRO A;  1UOC A;  2D0B A;  1T7P A;  1HYV A;  4E7K A;  4FK0 A;  2ZE2 A;  4K8Z A;  4AHC A;  3AO3 A;  2HNZ A;  1TKD A;  2QXF A;  4WE1 A;  1SV5 A;  3HVR A;  4CJP A;  1XHZ A;  1X9M A;  3O4N A;  1IKW A;  3ZT4 A;  1S1X A;  4FJK A;  4IG3 A;  1VSI A;  4HUF A;  4CEE A;  3WNH A;  2HHS A;  2PYJ A;  1YVU A;  2KFZ A;  3NDK A;  4KRE A;  2X6N A;  3VQE A;  4B9U A;  2KW4 A;  4DQI A;  2QK9 A;  4W5T A;  1VSF A;  3DRR A;  3NF7 A;  5JS2 A;  4OPJ A;  3LWM A;  4E7H A;  4CGH A;  1S5J A;  4IFV A;  3OYA A;  1LAW A;  2G8W A;  3AVB A;  1U04 A;  3V81 A;  3UIQ A;  4FJI A;  1KCF A;  1SKS A;  3OS1 A;  4C8L A;  1JL2 A;  3DLH A;  3VN5 A;  1RT3 A;  4CJE A;  4CHO A;  4Z4C A;  1TV6 A;  3LZJ A;  4N76 A;  3DLK A;  4AHU A;  3E01 A;  3AVJ A;  4CK1 A;  3SJJ A;  1IO2 A;  3M8R A;  2G8V A;  3ZCM A;  2Z1J A;  3TAR A;  4CJW A;  2R7Y A;  4ELV A;  3OYD A;  3D45 A;  4FJ5 A;  1S6P A;  4OVL A;  4C8K A;  4FLY A;  1RTH A;  3ALY A;  1UAX A;  2X6S A;  3D0P A;  3IG1 A;  1WLJ A;  2RF2 A;  4H8K A;  3SQ4 A;  1HYZ A;  3NH1 A;  1L3U A;  1SKR A;  3L2Q A;  3B6P A;  1JXE A;  1D5A A;  1RBU A;  1RDA A;  3U3G A;  2P5O A;  2IC3 A;  4IKF A;  2DFE A;  4DTM A;  2OPR A;  4CJV A;  4DFJ A;  1EX4 A;  1S6Q A;  4HTU A;  1D9D A;  3TAP A;  4CFC A;  3L8B A;  4DTU A;  4RG8 A;  4Q5V A;  3L2U A;  3SCX A;  3PV8 A;  3NGY A;  1BCM A;  1NK4 A;  3QO9 A;  3OYM A;  4RW4 A;  2IS3 A;  4E1N A;  2XY8 A;  5HBM A;  1U48 A;  4ELT A;  4C8O A;  4KHY A;  4K8X A;  1ZYQ A;  2O4G A;  2HVH A;  3ZT2 A;  1KRP A;  2Z1I A;  2ETJ A;  1IH7 A;  4B08 A;  4DMN A;  3LPU A;  4OPK A;  2YV0 X;  2A1R A;  4CHP A;  1NKE A;  3CQ8 A;  5J2N A;  4GVM A;  4CK2 A;  1C0M A;  3K5O A;  3SPZ A;  2A1S A;  4LD0 A;  3CFP A;  4DTO A;  5JS1 A;  4B9V A;  1FKO A;  1TKX A;  5J1E A;  3MXI A;  1ZBF A;  4FJX A;  1CZ9 A;  1SL0 A;  5HRP A;  4FW2 A;  2P51 A;  3PX6 A;  3KJV A;  3LPT A;  4KKO A;  3TAF A;  4AH9 A;  1G15 A;  3G10 A;  1S1U A;  4IFY A;  3K5M A;  1WSJ A;  4CJ5 A;  4ZHR A;  3T3F A;  1TK5 A;  4F3T A;  2KTQ A;  3QNN A;  1HQU A;  3HST B;  3RRH A;  4DWI A;  5EU7 A;  3DLE A;  1TAQ A;  1LV5 A;  4BE0 A;  1J9A A;  4CFA A;  4JRP A;  3HPH A;  4FLX A;  3VQD A;  1KLN A;  5CYM A;  1QE1 A;  4CES A;  4DSL A;  4KHQ A;  3ZSZ A;  1BGX T;  3NHG A;  3OYB A;  3VQ4 A;  5KRT A;  5HP1 A;  3THV A;  1RT2 A;  3AA4 A;  4HCB A;  3KLH A;  4E7J A;  4JLH A;  1O1W A;  4LSN A;  2FBT A;  4DSF A;  1IG9 A;  2PZS A;  3VQ6 A;  3DYA A;  3AO1 A;  3K5L A;  1KVA A;  2FBY A;  1KSP A;  1RIL A;  2QKB A;  4NYF A;  3JSM A;  3ASM A;  3IRX A;  4E1M A;  1JLQ A;  3OVN A;  4CEO A;  3KK2 A;  4AIL C;  3VQ5 A;  4CE9 A;  3AVG A;  4M42 A;  4OLA A;  4ID1 A;  3AA2 A;  4OJR A;  3DI6 A;  1NKB A;  3L2V A;  1Z26 A;  4BDP A;  4OKE A;  4DU3 A;  3DLB A;  4CGI A;  2ITG A;  3KTQ A;  4DSI A;  4M3U A;  4CEQ A;  4HUG A;  3OYL A;  3BGR A;  3QES A;  4DTJ A;  3S9H A;  3PX4 A;  4C8N A;  1QSY A;  1KVB A;  2NUB A;  3TAN A;  4DTS A;  3NCI A;  4I9L A;  1ASW A;  4CER A;  1EXQ A;  3K59 A;  4I9Q A;  4OLB A;  2HHU A;  3PO5 A;  3OYE A;  3TAQ A;  1YT3 A;  3SNN A;  1T03 A;  4NYN A;  3HP9 A;  3OYF A;  1NJX A;  3RWU A;  1RCH A;  4F4K A;  3HT3 A;  1ASV A;  3JYT A;  2YNG A;  1TGO A;  3AVC A;  1B9D A;  3ZT1 A;  4FJ7 A;  1LW2 A;  2W42 A;  3KLF A;  3RRG A;  3OJU A;  3AV9 A;  1RBT A;  2F8S A;  3ITH A;  1RT4 A;  2RN2 A;  1EKE A;  3K58 A;  1A5X A;  5DMR A;  4M45 A;  1RTD A;  3QNO A;  4L8R B;  3AVK A;  2YHB A;  1VRT A;  3SQ1 A;  3HO1 A;  3LP0 A;  1C1A A;  4DQS A;  1EET A;  4LSL A;  3NH2 A;  4PY5 A;  4ZTJ A;  2G8K A;  5FRO A;  4B3O A;  2X78 A;  1SKW A;  2BDP A;  5D3G A;  4OGE A;  3OY9 A;  3SI6 A;  1CZB A;  1TAU A;  1JLB A;  3AVN A;  4FLT A;  1RBR A;  1TL1 A;  1L3S A;  4PWD A;  5I42 A;  1RTI A;  1GOB A;  1S1T A;  3T19 A;  1QSS A;  4C8M A;  4KFB A;  4CF1 A;  4EP5 A;  2YHA A;  3V1R A;  3V9S A;  3C95 A;  4YNQ A;  3ZSX A;  3MAQ A;  4DF4 A;  3DLG A;  4KTW A;  1NJW A;  3NF8 A;  4PA1 A;  4BDZ A;  4CJ4 A;  3AA3 A;  1Y97 A;  1EP4 A;  3AO2 A;  3O3F A;  3AVI A;  5C42 A;  4FYD A;  3G0Z A;  2P5G A;  2HHQ A;  5T7B A;  4AHR A;  3PUF A;  1KFS A;  5I3U A;  2G8U A;  3MEG A;  4ELU A;  1VRU A;  1WSH A;  3NFA A;  3OYG A;  3U6F A;  2IOC A;  1U49 A;  4FJM A;  3V4I A;  1VSJ A;  1HQE A;  4HCC A;  4EZ9 A;  2YKN A;  1IKX A;  3CM6 A;  2G8I A;  1BQN A;  2G8H A;  2GUI A;  2Q3S A;  4FCY A;  3SV4 A;  4KRF A;  3M8S A;  3AA5 X;  4BWM A;  4DS5 A;  4RW8 A;  1ZBH A;  1S9E A;  1RTJ A;  1TVR A;  2XRI A;  3DRP A;  3KLG A;  2OPQ A;  4DSJ A;  2I5J A;  4TSX A;  2KZZ A;  3CFO A;  5DK5 A;  3I0R A;  1DLO A;  4MFB A;  5CY4 A;  2DTU A;  5CZ1 A;  1D8Y A;  4BE1 A;  1FKP A;  3HL8 A;  4R5P A;  4I7F A;  5J2P A;  4DTR A;  2WOM A;  4M3Z A;  1BI4 B;  4FZZ A;  4CGJ A;  4B8C A;  1WSE A;  2Z1H A;  3O3G A;  1WAF A;  2Z1G A;  1C0U A;  2ZD1 A;  5HLF A;  2HB5 A;  4O0I A;  2F8T A;  3NE6 A;  3HK2 A;  2EHG A;  3ZT3 A;  1HRH A;  1Q9Y A;  4J2D A;  4E3S A;  2Y1J A;  3QEX A;  1ZBL A;  4EZ6 A;  4B9M A;  4KAZ A;  1NJY A;  3OYI A;  2HVI A;  4N56 A;  3O3H A;  4M41 A;  4AHT A;  1WN7 A;  3LWL A;  4N41 A;  3LP2 A;  2FBX A;  3OYC A;  2HHX A;  3S3O A;  3KIO A;  4CHZ A;  4UQG A;  4G1Q A;  4NCB A;  3T1A A;  3ZSW A;  1L5U A;  5KI6 A;  2XY6 A;  1FXX A;  1DTQ A;  1REV A;  3RR8 A;  3WNF A;  4CJT A;  3KK3 A;  1J5O A;  4O0J A;  3OS2 A;  1VSL A;  2FC0 A;  1JLE A;  3S3M A;  4M3Y A;  3SQ2 A;  1SUQ A;  1B9F A;  1WSI A;  3LAK A;  3OS0 A;  2PYL A;  1QHT A;  1TKZ A;  2KQ2 A;  3OYN A;  3U3Y A;  3V6D A;  2D5R A;  5SZT A;  1UA0 A;  1RBV A;  1ZBU A;  2JLE A;  4B8A B;  1XC9 A;  4LY7 A;  3ZT0 A;  3I8D A;  5J2M A;  2YNH A;  4CJF A;  4PUO A;  2OA8 A;  4JRQ A;  4YFU A;  4NCA A;  2E6L A;  2HHV A;  4CIG A;  2OYQ A;  2RKI A;  1KVC A;  2HNY A;  3NH0 A;  1TK8 A;  4AHV A;  4CJL A;  1ASU A;  4EP4 A;  4KB0 A;  1BHL A;  1W9H A;  4DQP A;  4PQU A;  1L3V A;  3PO4 A;  3ISN C;  1BCO A;  3AVM A;  5E41 A;  3SPY A;  3HXM A;  3PX0 A;  4B9L A;  1LWC A;  4DLE A;  4LH4 A;  4F8R A;  3SUQ A;  4FJL A;  1CXU A;  1YTA A;  4B9S A;  4KHU A;  3V9U A;  4J2E A;  4JS4 A;  4FLZ A;  3L2W A;  4CGD A;  1C6V A;  4Z4F A;  1VSE A;  2XY7 A;  4B9T A;  3F9K A;  1GOC A;  1FK9 A;  1S1V A;  1GOA A;  1I39 A;  3KLI A;  3TAB A;  3OJS A;  4J2A A;  3P1G A;  1BQM A;  1J53 A;  1Q9X A;  2OZM A;  1D9F A;  3TAM A;  1UWB A;  1IKY A;  1Q8I A;  1XWL A;  4KV8 A;  3V1Q A;  4DS4 A;  4BWJ A;  1Z25 A;  4XIU A;  2HHT A;  1JLA A;  1WSF A;  4OKJ A;  4RW6 A;  4CEB A;  4CIE A;  2Y1I A;  4KTZ A;  2IDO A;  3C6U A;  3CG7 A;  3L3U A;  4F3O A;  1NKC A;  3HVT A;  3OYH A;  1F21 A;  3RR7 A;  4KB1 A;  2OPS A;  1VSM A;  5CZ2 A;  3ZSR A;  1HYS A;  2G8F A;  1C1B A;  3QIP A;  1JLC A;  3QLH A;  4NCG A;  2OPP A;  4O4G A;  4DTP A;  1LWF A;  4CGG A;  1NK6 A;  2P1J A;  1JLG A;  5C25 A;  3DRS A;  3SYZ A;  1RDB A;  3NF6 A;  1TKT A;  2B5J A;  3QET A;  1DTT A;  2KZM A;  4DLG A;  4KHN A;  1BL3 A;  1NK7 A;  3KK1 A;  1WSG A;  3NGZ A;  1JL1 A;  1TL3 A;  4FJH A;  3EZ5 A;  2XO7 A;  4BDY A;  1KTQ A;  4CEF A;  4CFD A;  3VQ7 A;  4CEA A;  1NOZ A;  2YKM A;  4FW1 A;  4H4M A;  5HRR A;  4HUE A;  1ITG A;  4O55 A;  4HHT A;  4FZX C;  3VQC A;  1NK5 A;  4CJQ A;  3QEV A;  1NK9 A;  2IGI A;  4FM1 A;  2XY5 A;  4LH5 A;  2VG6 A;  1S9G A;  2OZS A;  4W5Q A;  4DG1 A;  1WNS A;  2D0A A;  3L3V A;  4JS5 A;  3M8P A;  3SUO A;  1JLF A;  5HRS A;  1LW0 A;  4BAC A;  3KKR A;  2DFH A;  4O44 A;  1RT7 A;  2HMI A;  1RT1 A;  3H08 A;  1BIZ A;  4GW6 A;  4RW9 A;  2WON A;  4I2Q A;  4CF2 A;  4FM0 A;  3S3N A;  4AHS A;  5HRN A;  1BI4 A;  3MED A;  3LDS A;  4ZTF A;  1UA1 A;  4FJ8 A;  2ATQ A;  4I2P A;  2VG7 A;  1S1W A;  4CIF A;  2E4L A;  4OKK A;  1CLQ A;  3HPO A;  3V9W A;  4QCL A;  1WAJ A;  3P5J A;  4ID5 A;  3SV3 A;  1NOY A;  3KLE A;  3KD5 E;  1TK0 A;  4RW7 A;  3EYZ A;  1HJR A;  4CEZ A;  3O4Q A;  1HNI A;  3K5N A;  1C0T A;  4W5N A;  4CK3 A;  4DQR A;  2B6A A;  4M3R A;  4E89 A;  4FK2 A;  3EY1 A;  1NJZ A;  1VSH A;  4OGC A;  4CJS A;  4IBN A;  3V9X A;  3SQ0 A;  2FBV A;  3LP3 A;  2HND A;  3TWH A;  3ZSY A;  1K6Y A;  3NGI A;  4BE2 A;  2X74 A;  1NK0 A;  2ZQB A;  1I3A A;  1VK0 A;  4M3X A;  4DU1 A;  2HHW A;  4CJ3 A;  4DFM A;  1U47 A;  2YNI A;  2JGU A;  4O5B A;  1JKH A;  1J54 A;  2YNF A;  3RMD A;  4ICL A;  3I0S A;  2EX3 A;  4KHS A;  2DFF A;  1W0H A;  4GMJ B;  2BAN A;  5CYQ A;  3NBP A;  4FVM A;  3AVL A;  5K14 A;  3TR8 A;  4N5S A;  3PY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...