4CESA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cesA00
4LSNA 1KTQA 1S5JA 3K5LA 3HJFA 3C95A 1SL0A 3AO5A 2RF2A 3IG1A 1NOYA 1BGXT 1C0UA 5T7BA 1KVAA 3KJVA 3NAEA 4DU1A 3DOLA 3AA4A 4C8MA 4O0IA 1SKWA 4I2PA 3MEEA 4Z0UA 3HK2A 4JRPA 1BI4A 1Z26A 2P1JA 4FM1A 4B8AB 4DTNA 3LALA 4ICLA 4HUEA 1JLGA 1HNIA 4M42A 1DTQA 3OYLA 4JS4A 5J2MA 1VRUA 3T1AA 3M8QA 3SQ4A 4CJUA 2FBYA 3ISNC 3AVIA 3ZSXA 1HYVA 3RMAA 3PY8A 3BDPA 4B9MA 4J2AA 4KHUA 4CK1A 1IG9A 3NDKA 4J2DA 5K14A 1KFSA 4B8CA 3O4NA 2OPQA 2Z1IA 4RG8A 4Z4IA 1QQCA 4NCGA 4DFMA 4EZ6A 3PUFA 3M8SA 2YNFA 4FXDA 1C1AA 3BGRA 4GVMA 4CEEA 3KLFA 3V6DA 5HROA 4FZXC 1QSSA 1RDCA 3KLIA 4AILC 3ZSVA 1HNVA 4FZZA 1NKBA 4JLHA 4M3XA 1NOZA 5HBMA 5SZTA 4RW4A 1U04A 1TAQA 4DS4A 1HYZA 3MXIA 4C8OA 4O4GA 1DTTA 1DLOA 1QSLA 1XC9A 3M8PA 3NE6A 3ZSZA 4O55A 3AO3A 1EP4A 3VQ4A 1NK6A 4CGIA 4CJFA 3CQ8A 1NK8A 2XY6A 1WAJA 4O0JA 4H4OA 1RCHA 3AVAA 2Z1GA 4CGHA 1KVCA 4PA1A 1RILA 3NGIA 4KI6A 2HHVA 3NH1A 4CIEA 3V9ZA 1SL1A 3CM5A 5D3GA 1Q9XA 3AVMA 3ZSQA 4CJEA 1YT3A 5C24A 3ZSRA 3HP9A 3AO4A 4DTMA 4N47A 3DRSA 3AVKA 3OYIA 1ZBLA 3KD5E 1UAXA 1L3VA 4QCLA 3QETA 4IG0A 3L8BA 1NK7A 3RRGA 5HRRA 3OVNA 1J53A 3QEPA 2P51A 4CJVA 2X78A 2G8WA 2HVIA 3LZIA 1GOCA 1HJRA 1X9WA 4ELUA 1IKXA 4LD0A 1BHLA 1UA0A 3DLRA 3ZCMA 4LH4A 1B92A 1LAWA 4CGFA 4FJ9A 3SI6A 4BWMA 3TAPA 3V1QA 1JXEA 1WSGA 2HW3A 1S1UA 4ID1A 1RTJA 2OPRA 2YHAA 3TAEA 2D5RA 2BANA 3DRPA 5CYQA 4M45A 1N6QA 4CEZA 3KD1E 3TAFA 2G8VA 2DY4A 1NKCA 3OYFA 3F73A 3QINA 4AHCA 1I3AA 4DSKA 3K58A 1C6VA 3JYTA 3NGZA 1SKRA 5HRSA 4K8ZA 4BWJA 3L2VA 5J1EA 4IFYA 4FJJA 2Q3SA 4M3YA 1BISA 2RN2A 1NK0A 1QS4A 4Z4FA 3SUPA 2HHQA 5J2QA 4I7FA 1RDDA 2HB5A 3AO1A 2YNHA 4CFCA 4CF0A 3OYAA 3QEWA 3L3VA 2D0BA 1RBSA 2X74A 4DTSA 1NJYA 2EHGA 4OGCA 2KW4A 1T03A 2X6SA 4ZHRA 4H8KA 2OZSA 3S3NA 2G8HA 1KSPA 3OYJA 4B9TA 1VK0A 3QERA 3SCXA 4HCCA 4RW8A 4DG1A 3HL8A 1JKHA 4CJRA 1U4BA 1RBTA 3SQ1A 4KKOA 1VRTA 4KHQA 1NK5A 1L3SA 4KV8A 3SUQA 1C1BA 3MXMA 2OYQA 5CYMA 2XHBA 3CFOA 1IH7A 1CLQA 3NBPA 3KLHA 3NHGA 4O44A 1NK9A 4FK2A 1VSFA 3S3MA 1X9MA 1GOBA 3AVHA 4FK4A 1RT2A 4CEBA 3TAGA 3RR8A 4TSXA 4CF2A 1IKVA 1LWCA 2B4JA 3DMJA 4KHNA 1R0AA 1KVBA 4M41A 4FCYA 1U45A 1EX4A 1KFDA 1QHTA 3LANA 1HYSA 1RT3A 3LAMA 1S1WA 4CERA 3OYKA 3HXMA 2FBXA 3MEDA 4CHNA 4CIFA 5I3UA 4EZ9A 3QESA 4KHYA 2O4IA 2KTQA 3VQ6A 1TK5A 1D8YA 4E7KA 1LV5A 3VQAA 4BE1A 4BDPA 4FJNA 1S1TA 1WAFA 4F8RA 3I8DA 4I9QA 3QEIA 3T19A 1J9AA 1VSEA 3TR8A 3K5NA 3V81A 4DF8A 1D9DA 4CHYA 2ATQA 3VQQA 3CFRA 2G8IA 4CHPA 4Z4CA 3KKSA 4OPKA 2F96A 1UOCA 4FJXA 1JL2A 4DU3A 2RPIA 1N5YA 1J5OA 4L8RB 4B9LA 1RBRA 3OYHA 3VN5A 4FJ7A 3CM6A 2Z1HA 2W42A 3DLHA 3KTQA 1ZBUA 2YKMA 2E4LA 3WNEA 1VSIA 4KHSA 4YNQA 1YVUA 5CZ1A 2VWKA 3RMBA 1ZBFA 4J2EA 3L2RA 4LY7A 2IGIA 3RMDA 4E7IA 2G8UA 3AA2A 4KB1A 1CZ9A 4CJWA 1WNSA 1ZBHA 4CEAA 1ZYQA 2KZMA 3LPTA 4FJ8A 3B6PA 3OS2A 3P83D 3PX0A 2YNIA 3HO1A 1TKZA 4WE1A 3TAMA 5KGXA 4F3OA 3V9WA 1Y97A 4DSJA 4FK0A 4B3OA 4DTRA 3LP1A 3LP2A 1Q8IA 1XI1A 4W5QA 3SPZA 3MAQA 3WNGA 2JLEA 3QIOA 3NH0A 3OS0A 4CEDA 4HTUA 1NK4A 4HHTA 1NKEA 2ZE2A 2DFEA 3DM2A 4KO0A 4KREA 3U3YA 4OPJA 3HT3A 2HHUA 4FZYA 4IFVA 4OVLA 1BI4B 5CY4A 3NF6A 3HVRA 3CFPA 2Y1IA 1WSEA 2XRIA 5EU7A 3WNFA 4E7LA 4KTZA 4F2SA 1UWBA 2YV0X 3NF8A 1TGOA 2HHWA 1LW0A 3SUNA 3EZ5A 2XO7A 4C8KA 4DFPA 4DQRA 3AV9A 3SJJA 3NF9A 4BE2A 1GOAA 3NH2A 3RR7A 4CJ5A 1ZBIA 2D0AA 4FJIA 3A2FA 4FLTA 2PY5A 1S1VA 1JLQA 2OPSA 2JGUA 1BL3A 3HPGA 3SYZA 1YTAA 2QXFA 4IDKA 4DFKA 1SKSA 4FJGA 2HMIA 3PO4A 2HVHA 5CZ2A 5HRNA 4Z4EA 1A5VA 2QKBA 2HNDA 1O1WA 1ASVA 2BE2A 4AHUA 4CCHA 4CJSA 3KIOA 4LH5A 2QK9A 3K5OA 1LW2A 2FBVA 5FRNA 3OJUA 1S1XA 2FBTA 1G15A 3KK2A 2WOMA 4AHRA 1YTUA 3HVTA 4NYNA 4F4KA 5SWMA 4IKFA 1FKOA 3K2PA 1A5XA 1IKYA 1WSIA 3VQDA 2VG5A 1S6PA 3ASMA 3VQ9A 3OYBA 3HP6A 3V9XA 1S9EA 4DQSA 2OA8A 2E6LA 4CEOA 1X1PA 4GMJB 3IAYA 1RT4A 4DU4A 1T8EA 3VA3A 2IAJA 3ZT0A 4M3WA 2KFNA 1BIUA 4DSIA 1VSLA 3C94A 3ZT1A 4J2BA 4CE9A 4W5NA 1U49A 1EKEA 2IC3A 2NUBA 4IBNA 4KFBA 4M3RA 2DTUA 1WSHA 4XIUA 1C0TA 1VSKA 3DLEA 4PUOA 3MEGA 3VQ7A 5DMRA 1XHXA 4FVMA 1RTHA 4FW1A 4IG3A 4CHOA 4E89A 1VSMA 3I0RA 3OYDA 3V1RA 5J2NA 3QO9A 5KRSA 4BACA 3TI0A 1Z25A 4B9UA 4PY5A 4PWDA 3VA0A 3RRHA 4FW2A 1KCFA 3O3HA 3L2UA 4N5SA 4BDZA 4DWIA 1LAVA 4M3ZA 3PV8A 2LSNA 4CGJA 5FROA 2XY5A 3MECA 4DQPA 4E7HA 5KI6A 1BQNA 4HUFA 2HHTA 1IKWA 3AVBA 1BQMA 3HPOA 2P5OA 4NCBA 4DLEA 3LP3A 3DYAA 1RT5A 4LSLA 3AVFA 2XY7A 4ELTA 3ITHA 1JLAA 1L3UA 1ITGA 3AVGA 3O3GA 3OJSA 4EP4A 4DTPA 1U48A 3IRXA 3O4QA 2B5JA 3QEVA 5KRTA 3SQ2A 1W0HA 2KQ2A 3LPUA 4CF1A 1TKTA 3AA3A 4AH9A 4W5RA 3SPYA 2A1SA 1U47A 3K5MA 4ZTFA 3D45A 2E6MA 1X9SA 1TL3A 1REVA 1RBUA 3K57A 2VG7A 1XWLA 1TKDA 3WNHA 3TARA 1MU2A 3OYEA 1C1CA 2EX3A 1CXQA 3VQCA 1CXUA 2IOCA 3OY9A 4DSLA 5E41A 4I9LA 4OJRA 4KTWA 2ITGA 4KTQA 4ELVA 4CK2A 4RW7A 2Y1JA 1JXBA 2VG6A 4CJ3A 1C0MA 4E1MA 3TAQA 1JLFA 2DFFA 3G0ZA 4DF4A 2P5GA 3OYGA 1TAUA 3ZSWA 3U6FA 3HM9A 3RTVA 4CK3A 3PX6A 3DLBA 4FLUA 2HHSA 1NJXA 4MQ3A 2QKKA 3S9HA 3TANA 3LZJA 1B9DA 1W9HA 1WLJA 4OLAA 3NGYA 3O3FA 4OGEA 5FRMA 3SUOA 3M8RA 4CEFA 1TVRA 4DSFA 4AHVA 1RT7A 4DMNA 4Z4HA 4FJKA 3K59A 3HSTB 3SNNA 4DSEA 4E3SA 4PQUA 4DQQA 1WSFA 2ZQBA 1TL1A 1WSJA 3F9KA 4QAGA 3P1GA 3ZT3A 3ZT2A 3B6OA 4EP5A 3PX4A 4DQIA 2KFZA 3ZSOA 1QTMA 4CJKA 4DLGA 3E01A 4FJ5A 2F8SA 4UQGA 3CYMA 2YHBA 2HNYA 1XHZA 5DK5A 3VQBA 3AVNA 4JS5A 2D0CA 4BDYA 1EXQA 2IS3A 4E0DA 4F3TA 2YKNA 2FC0A 1CZBA 4AHSA 2ZD1A 2G8FA 4NYFA 4FJHA 3AVJA 1J54A 4OKKA 1HQUA 2R7YA 4C8LA 3CG7A 3LAKA 3L3UA 2HNZA 1FKPA 4W5TA 1UA1A 2AJQA 5KTQA 1T05A 1HQEA 2YNGA 1RNHA 4N41A 1D9FA 4CEQA 3VQ8A 4ZTJA 4B08A 1T7PA 3ALYA 1JL1A 4E1NA 3RMCA 2G8KA 4F2RA 4FJMA 5FDLA 4HUGA 3DLKA 4R5PA 4W5OA 3IS9A 4C8NA 2Z1JA 4I2QA 3KLGA 4Q0BA 1JLBA 3D0PA 4AHTA 4B9NA 3QNOA 1HRHA 3VQEA 2GV9A 2OPPA 2WONA 3OYNA 2VWJA 4E19A 1NJWA 4KHWA 3FFIA 3ZSYA 5HRPA 3L2WA 3G10A 4B9VA 1KLMA 4FM2A 4FLVA 2BGGA 1LWEA 1RTIA 4Z4GA 1L3TA 5KGWA 4FJLA 3NFAA 4MFBA 3SZ2A 2HHXA 4DTUA 2GUIA 3ZT4A 1SUQA 4BE0A 4G1QA 1K6YA 4CJ4A 3TABA 1WN7A 3DLGA 4FLWA 5HLFA 1TKXA 4CF8A 4CFDA 1BIZA 4HCBA 3KK3A 1I39A 5I42A 4OLBA 1RDAA 2X6NA 1D5AA 2B6AA 1L5UA 3THVA 2RKIA 1KRPA 3T3FA 4M3UA 1IO2A 3AO2A 1KLNA 2DFHA 1LWFA 3OYCA 4CFAA 3NF7A 3H08A 3SV3A 1EETA 1ASWA 1B9FA 4CFBA 1TK8A 2PYJA 4YFUA 4FLYA 4DS5A 3L2QA 3UIQA 1VSJA 1JLCA 2O4GA 3RWUA 5JS2A 1A5WA 3EYZA 4NCAA 1QE1A 4Q5VA 1RTDA 3SV4A 4KB0A 3TWHA 4CJPA 4JRQA 4B9SA 1ASUA 3LDSA 3LWLA 3QIPA 3LWMA 1BCMA 5J2PA 5C42A 3KLEA 4CGDA 1RT6A 4KRFA 4M3TA 4CJTA 3AVCA 3LP0A 3VQPA 4CESA 4DTOA 2KZZA 1FK9A 3I0SA 3C6UA 4N76A 4N56A 4CHQA 3NCIA 1VSDA 3JSMA 1RDBA 1QSYA 5HP1A 1VSHA 4Y1CA 4Y1DA 3MXJA 3AA5X 3VQ5A 1TV6A 1HMVA 3AVLA 1Q9YA 3U3GA 3DRRA 4OKEA 3OYMA 1BCOA 1SV5A 1S6QA 2XY8A 4FM0A 5C25A 4RW6A 4K8XA 4KAZA 3V1OA 2BDPA 2I5JA 3HPHA 4FLXA 1RT1A 4DFJA 4CHZA 2PZSA 4GW6A 4O5BA 4FYDA 4DTJA 3V9SA 1RBVA 2PYLA 4ID5A 1TK0A 4QOZB 2F8TA 3S3OA 1F21A 4CF9A 4DTXA 3DI6A 3C6TA 1JLEA 4CJLA 4KPYA 3QNNA 1S9GA 3PO5A 5JS1A 4CECA 3SQ0A 3QLHA 2OZMA 4CGGA 4E7JA 1SL2A 4FLZA 1HPZA 3KKRA 3V9UA 3HYFA 3OS1A 3QEXA 4CJQA 4OKJA 3P5JA 4H4MA 3KK1A 1NJZA 1FXXA 4CIGA 4HVJA 4KI4A 2ETJA 3V4IA 3ULDA 2A1RA 3EY1A 2IDOA 4RW9A 2GBZA 3DOKA
chains in the Genus database with same CATH superfamily
3I55N 4LSNA 1YJNN 3BUZB 3HJFA 4FO0A 3JAMO 1NOYA 1BGXT 3KJVA 1KVAA 2QWOA 3DOLA 4C8MA 3HZ6A 1X9JA 4O0IA 4I2PA 3MEEA 1DT9A 4DR6K 2HBKA 5LJVA 3LALA 4ICLA 2QTDA 3LDQA 5BRDA 3M8QA 2FBYA 3AVIA 4JN4A 3ZSXA 2UXBK 1NU0A 4A2AA 1W2BM 2OCEA 1KFSA 3O4NA 2Z1IA 4PKHA 1QQCA 3PUFA 1NGGA 3M8SA 3KLFA 4FZXC 4BC4A 3KLIA 3OBWA 3E1YA 1NKBA 4M3XA 1TAQA 1W7AA 3ZSZA 3VQ4A 3WEEA 1NK6A 4CGIA 3OW2M 4O0JA 5GAGP 1RCHA 2ZF5O 5EXWA 2Z1GA 3F2KA 4CGHA 1KC8O 1SL1A 1N34K 3AVMA 2Q0UA 1Q82O 4DTMA 3AO4A 3SBGA 3OYIA 1WOQA 4K25A 1J53A 1H1VA 3QEPA 3DLRA 3ZCMA 1LAWA 4JHDB 2P9SA 1JXEA 4BC5A 1RTJA 2YHAA 1JJ2M 1N6QA 5GINA 3LM9A 3KD1E 3TAFA 2NRHA 4CI6A 5BPMA 4DSKA 3NGZA 5HRSA 3WT0A 1Q18A 3MK6A 3VF4A 3VTIA 1NGEA 3AO1A 5EY4A 5KQ8A 3QDKA 2YI1A 3L3VA 1RBSA 4DTSA 4OGCA 1T03A 2KW4A 4BRNA 4H8KA 2P9KA 3BF1A 4GKKK 3SCXA 3O9SA 5FPEA 4RW8A 5AFUH 3VF2A 4DV5K 4X65K 1JKHA 2HBMA 1U4BA 4M7XA 3GDQA 5AZIB 3MXMA 2OYQA 5CYMA 2XHBA 3NBPA 2VQFK 1VQLN 3O9UA 3AVHA 4FK4A 1RT2A 3E9LA 3RR8A 2B4JA 3DMJA 4KHNA 4M41A 4HWIA 4FCYA 1QHTA 3LANA 1HYSA 3LAMA 3OYKA 3MEDA 4CHNA 3THWA 2KTQA 1S72N 2O4IA 2QWPA 4E7KA 3VEVA 3VQAA 4FJNA 3ATVA 4H5NA 4B3RK 1S1TA 1E4FT 4FWRA 1VQPN 4I9QA 3QEIA 1BU6O 1J9AA 2G8IA 3ZX2A 4CHPA 4Z4CA 5IT9O 5AQLA 4FWQA 4DU3A 2RPIA 1N5YA 1HNXK 2QEXN 4B9LA 4FJ7A 3E9PA 2VCPA 1ZBUA 2E4LA 3WNEA 3MX5A 3L2RA 3J7AP 2IGIA 3T1YK 4KB1A 4B1YB 4CJWA 1WNSA 1ZYQA 3LPTA 4FJ8A 3DWLA 1YF5L 3P83D 2YNIA 1Q81O 4F3OA 1Y97A 4IEEA 4B3OA 3FFKB 4PKIA 3LP2A 2GELA 3H46O 3UKRA 3RVCA 5AFUA 2ZE2A 3DM2A 3PIPL 3U3YA 1NM1A 3HVRA 3CFPA 2Y1IA 4E7LA 3WNFA 4KTZA 4F2SA 3NF8A 2UXCK 1ATNA 4DR7K 2FF6A 3SJJA 3NF9A 4H5RA 4DCHA 2D0AA 5JLHA 4FLTA 2PY5A 3SYZA 1JCFA 1YTAA 2QXFA 3MWTA 1SKSA 3AY9A 3PO4A 4Z4EA 1A5VA 4BC3A 4CZFA 5I9EB 1XMOK 1LW2A 2IIRA 3OJUA 4CZJA 4WF9L 1S1XA 4DV6K 4G9ZA 4AHRA 4F4KA 5AQXA 2V52B 3K2PA 1QVFM 3HP6A 3WXLA 1T44A 3ASMA 3CCUN 3SAGA 3OYBA 4RCHA 1X1PA 4GMJB 1RT4A 4DU4A 3WXJA 3VA3A 3ZT0A 3AGKA 1BIUA 4CE9A 3QBXA 3MEGA 5F0XA 2VWBA 2P9SB 2FXUA 3BEXA 4CHOA 3VMFB 3I0RA 4B9UA 1Z25A 3VA0A 5M1QA 3L2UA 5LMNK 3CERA 3TSQA 3MECA 5F2RA 4JI5K 4XH1A 1IKWA 1YVNA 3AVBA 3CCJN 1HX1A 3HPOA 1HUXA 4NCBA 3B8AX 3LP3A 2XY7A 4ELTA 3I8BA 3ITHA 3UKUA 4DUZK 4NXNK 1ITGA 3AVGA 3DXKB 3OJSA 3LPUA 4RTFD 1TKTA 3AA3A 2P9KB 4JKAA 4YOWA 4GV3A 3D45A 2E6MA 3H3OB 1X9SA 1REVA 3K57A 1MU2A 4AM6A 2CH6A 1CXUA 5H1SQ 3MX2A 4KTWA 2ITGA 2A5XA 4CJ3A 2O8BA 2P5GA 2QWNA 3ZETA 3HM9A 3U6FA 3IFRA 1KAZA 4MQ3A 2P9PA 4KH4A 2QKKA 4C1NI 2VYPA 3G71N 1W9HA 4YOUA 4C23A 1WLJA 4OLAA 2CGKA 3O3FA 1TYQA 1QQNA 1ZXOA 4Z4HA 4FJKA 1K8AO 3HOTA 4DQQA 1K8KA 1WSFA 4QAGA 1TL1A 1WSJA 3RSEB 5E84A 4MO4A 2NRRA 3LDPA 4UQGA 2F8SA 1XHZA 4JS5A 3D2EB 2VGMA 1HPMA 5GIOA 2ZD1A 2BH1A 3U4LA 3IMXA 1BA0A 2F7TA 1FKPA 3WXMB 2A3ZA 1TUYA 5BREA 1D9FA 2Q31A 3VQ8A 4B08A 1JL1A 4DV7K 4C8NA 3OHRA 2NNWA 2VWJA 3FFIA 1KLMA 4FM2A 4JI4K 1RTIA 4PL8A 3H45C 5AQZA 4MFBA 5FLXO 3C7NA 1SUQA 1K6YA 1WN7A 3DLGA 3O08A 2V7ZA 4CF8A 4HCBA 5EVZA 5I42A 3MN5A 3THVA 1KLNA 1LWFA 1SZ2A 3NF7A 1BO5O 1ASWA 4JI3K 5GIPA 1SAZA 1QE1A 4Q5VA 3SV4A 3TWHA 1RFQA 4CJPA 2CGLA 2E2PA 4JKFA 3A5OC 3QIPA 3LWMA 4OX9K 4KRFA 3EE9A 3HBTA 4DTOA 3THYB 3VERA 3C6UA 4BQZA 4AM7A 2QWMA 4LF6K 3T1HK 1RDBA 2QWRA 1QSYA 3H3NO 4BROA 1C0FA 5AQKA 4Y1CA 4M3WA 3VQ5A 3U3GA 2XY8A 5C25A 4FWOA 4LFBK 4RW6A 3FZFA 3HPHA 4FLXA 4DFJA 4LFAK 4CHZA 4O5BA 4DTJA 3TSUA 2E20A 3GE1A 3S3OA 3DI6A 3C6TA 5AQQA 4CJLA 3BY5A 3H1QA 3QNNA 1GLCG 2OZMA 3SQ0A 3QLHA 4E7JA 4JKDA 1SL2A 5AQPA 3KKRA 3OS1A 4RWTA 4FWNA 3WUHA 4CJQA 4OKJA 4JI7K 4BR4A 3A5LC 3CJ7A 3KK1A 1FXXA 4HVJA 2A1RA 4JAXA 3C0BA 4CW7B 2V51B 3EY1A 3SQ2A 3C95A 3GG4A 3IG1A 4ISGA 3ULEA 5T7BA 1DEJA 3KK7A 3K9KA 3T69A 3SAFA 3HK2A 4CZLA 4CBXA 2P1JA 4B8AB 4DTNA 5AZJA 1HKCA 1VRUA 4CJUA 3RMAA 3PY8A 4KHUA 4X64K 3LDLA 5DM6L 1IG9A 3R6MA 1K9MO 5K14A 4AQYK 5C2FA 5M1FA 1VQ4N 4JHDA 2OPQA 4DFMA 1WB9A 3UKUB 4FXDA 2YNFA 4GVMA 3BGRA 4CEEA 3V6DA 1RDCA 1QVGM 3ZSVA 1HNVA 3R8EA 4GY2B 4JLHA 1NOZA 5SZTA 4RW4A 4IFEA 1U04A 4UY8O 5BPNA 3MXIA 4C8OA 1DTTA 1XC9A 3NVKA 4CVNE 3CQ8A 2XY6A 2FF3B 3L4IA 2O8BB 3AVAA 2PFUA 4BRCA 1YHQN 1KVCA 4PA1A 1RILA 5KPZA 3NH1A 5KPTA 1NGJA 1Q9XA 2FSJA 2O8CB 1GLBG 4CJEA 1YT3A 5C24A 1FJGK 3HP9A 2P9PB 1ZBLA 1IG8A 1L3VA 4IG0A 3L8BA 1X3NA 4B1ZA 1GOCA 1M90O 4ELUA 1IKXA 4LD0A 3DAWA 1RDWX 2NRVA 4WYBA 4O8KA 2WC9A 1P8ZA 3SI6A 3TAPA 4B3SK 3V1QA 3CF5L 1WSGA 1S1UA 1K8KB 2OPRA 5CYQA 2BANA 3O9QA 2DY4A 2RE2A 1NKCA 5E26A 3DJCA 1IBMK 4BREA 4K8ZA 1E3MA 4X66K 4DB3A 1WBDA 4FJJA 4M3YA 5AQHA 2HHQA 4I7FA 3LM2A 2WBNA 4AF1A 2ZGYA 1M1KO 3QEWA 2X74A 3SK3A 1NMDA 3CC4N 2F9TA 2YJFA 3S3NA 2G8HA 4YOTA 5BR8K 1RBTA 1VRTA 1NK5A 3VGLA 1YUWA 1BOTO 1NK9A 3VGMA 4FK2A 3OA9A 1GOBA 3EN9A 3TAGA 1W97L 1LWCA 1R0AA 1KVBA 1U45A 1BDGA 4CERA 3TTCA 1HNWK 4CIFA 3K0SA 4EZ9A 3QESA 1D8YA 4BE1A 1ESVA 4BDPA 2P9LA 1WAFA 4F8RA 4U67L 2HF4A 5DM7L 2BUPA 4JKEA 3TR8A 1D9DA 4CHYA 3T7ZA 3VQQA 4NLCA 3CPEA 2FSNA 2O8DB 3KKSA 4FOIA 3IUCA 1JL2A 2J4RA 4YDUA 3VN5A 3FZKA 1ZC6A 3RMBA 1ZBFA 4J2EA 2G8UA 2CGJA 5FPNA 2GX9A 3G6EN 1ZBSA 5AQGA 3B6PA 1TKZA 1JCGA 4QS9A 4WFBL 3CCVN 3UE5A 5AQVA 5KGXA 1BWFO 3EE8A 4FK0A 3J80O 3CQXA 3D7EO 3QIOA 3ULEB 3NH0A 2P9NA 3OS0A 4HTUA 1NK4A 2DFEA 4XH5A 3HT3A 4IFVA 1N33K 4WQ5A 1WSEA 2XRIA 5AZJB 3CJBA 2F4VK 1TGOA 3HRGA 3HTVA 2HHWA 3VTHA 1LW0A 3SUNA 4C8KA 3FGUA 5BR9A 1GOAA 3NH2A 1ZBIA 1EWQA 3CC7N 1ATSA 1S1VA 2OPSA 5M1PA 4EIAA 3CD6N 5HRNA 2HBJA 2HNDA 5JICA 2BE2A 4YHHK 4CCHA 5FPMA 3KIOA 4BRMA 4FWPA 1G15A 5JVGL 4CZEA 4DV0K 4OO1J 3HVTA 4JKHA 3BZCA 3DXKA 1FKOA 3VEYA 4DQSA 2OA8A 4FVUA 1NLVA 4BRHA 1T8EA 2KFNA 4KBOA 1VSLA 3ZT1A 4W5NA 4BRQA 3NMUA 4KFBA 2DTUA 4XIUA 2OANA 3O9TA 3TTDA 3QO9A 4YORA 1MWKA 4FW2A 1KCFA 4DV3K 4BDZA 4DR1K 2F9WA 3PV8A 3CC2N 5FROA 3QBWA 3VEOA 4E7HA 2ASMA 3VGKA 2HHTA 1BQMA 3HI0A 1QQMA 4L3QA 2YHXA 3DYAA 4LSLA 3QFUA 1IBLK 4CD3A 3RSEA 4DTPA 1KAXA 4EP4A 3MCPA 3IRXA 3O4QA 3QEVA 4AH9A 2A1SA 3K5MA 5KPRA 4PKGA 5LL6Z 1TL3A 4IEIA 3D2EA 1RBUA 1XWLA 4BVPA 3TARA 1C1CA 3OY9A 1CXQA 2IOCA 1NGFA 4DSLA 4I9LA 4OJRA 4KTQA 1IBKK 4ELVA 4CK2A 4K43A 4A62A 4E1MA 5GAEP 1Q86O 5LY3A 4B3TK 3OYGA 5LMUK 3E9OA 4CK3A 3CJCA 3R9PA 2HHSA 1Z05A 1B9DA 5IWAK 4JYAK 3NGYA 4OGEA 5FRMA 5AQOA 2UYTA 4CBUA 3SUOA 3M8RA 1D4XA 3E66A 1GLEG 2QWLA 4DSEA 3H1VX 2P9LB 1XMQK 4IWVA 4J2AA 3ZT2A 4DQIA 4EP5A 2E5LK 4CJKA 3QMLA 2IS3A 4LFCK 3M3ZA 3VEWA 1VQNN 1CZBA 2G8FA 5AQNA 5JVHL 1VHXA 1YAGA 3L3UA 1V4SA 4W5TA 1UA1A 3FZLA 1T6CA 1NWKA 2ASOA 3S41A 2GEMA 2Q0RA 4CEQA 3ALYA 4E1NA 3RMCA 3THYA 4F2RA 3DLKA 2I7PA 4DV1K 4B9NA 3F9MA 3QNOA 3FZMA 3VQEA 1U6ZA 5BRFA 2GV9A 3VETA 3OYNA 4EFHA 3VEXA 4K41A 3JXUA 4BRKA 3M6GA 1L3TA 3TTFA 3TABA 4G1QA 1VAZA 4FLWA 2IVOA 2E1ZA 4CFDA 4C1NK 4X62K 2P9NB 1SQKA 1I39A 4OLBA 3U9ZA 2WUSA 2B6AA 2RKIA 3T3FA 1IO2A 3AO2A 2OTJN 2DFHA 3ENOA 4EHUA 1EETA 1TK8A 1B9FA 4Z4FA 4YFUA 3L2QA 3ZLJA 1VSJA 4A2BA 4ILHA 5CE3A 3ZX0A 4JRQA 4FWSA 4FWMA 1BCMA 4NXMK 5J2PA 3TPQA 4CJTA 3AVCA 4CESA 3VQPA 1FK9A 3I0SA 3M1FA 3NCIA 2WFBA 5HP1A 2P9UB 3C6HA 3MXJA 4JKBA 1Q9YA 3WXIA 1XUPO 1SV5A 1EQYA 3V1OA 3ZEUA 5AQRA 3ZYYX 2YX6A 2QA4N 3V9SA 2PYLA 4ID5A 3ENBA 1F21A 1JLEA 3ATUA 3CXCM 4KPYA 1S9GA 3PO5A 5ADXH 3QEXA 3P5JA 3EO3A 4KI4A 2ETJA 3V4IA 4HTLA 2IDOA 4RW9A 2D0PA 1S5JA 5AQTA 4B1UB 3K5LA 3CCQN 1SL0A 3AO5A 2RF2A 1MWMA 3NAEA 3PLAA 2O8CA 3AA4A 1SKWA 4Z0UA 4JRPA 1NNEA 1Z26A 1XNRK 3TU5A 3FZHA 4HUEA 1JLGA 4M42A 1DTQA 4IJAA 4BRPA 1HR0K 3ISNC 1HYVA 3QICA 4H5WA 4CK1A 3NDKA 4B8CA 1GLAG 4RG8A 4EZ6A 5TKWA 3UB5A 1OH5A 5GADP 2NRTA 4CZGA 4WQ4A 4FZZA 5KQDA 1RDUA 3THXB 4O4GA 1QSLA 3CCLN 3G25A 1NK8A 3JS6A 3J81O 4H4OA 4KI6A 2H3GX 3NGIA 3V9ZA 3CM5A 5D3GA 3HSCA 1QHAA 4N47A 3DRSA 3AVKA 4QCLA 3RRGA 4BR0A 1T3VA 2HVIA 3LZIA 2I7NA 1HJRA 5HOOA 1X9WA 4BR7A 4LH4A 2ZJRL 2HW3A 1KAYA 4CJ7A 3TAEA 3DRPA 2D4WA 4CEZA 1NGBA 4IO8A 2G8VA 4EHTA 3OYFA 3QINA 1C6VA 4YOXA 4BWJA 3L2VA 5J1EA 4IFYA 3C6AA 1GLJO 3VOVA 1NK0A 1QS4A 1NGCA 2P9IB 4BGBA 1X3MA 1RDDA 2HB5A 2YNHA 3OYAA 4CF0A 1NJYA 4ZHRA 4MO5A 1YI2N 3OYJA 4B9TA 1MDUB 3QERA 4HCCA 4DG1A 2O8DA 4CJRA 3SQ1A 5AQIA 3HM8A 1C1BA 4H0XB 4YY3K 3CFOA 1KXPA 2W6LA 1IH7A 4F9OA 3H6EA 4IJNA 4O44A 1VSFA 3S3MA 1X9MA 4JK7A 3IKMA 4IDHA 4TSXA 4H0VB 4CF2A 3I33A 3W3DA 2HHHK 1NG9A 1EX4A 1KFDA 5EX5A 3HXMA 1CZAN 2FBXA 4KHYA 3VQ6A 1R59O 1TK5A 1LV5A 4CZIA 1HJOA 1Q7YO 5AQYA 5M1OA 2DPNA 3G4SN 3GOIA 3BF3A 4JK8A 3T19A 1VSEA 2ATQA 2KHOA 3CFRA 2GWJA 4FPAA 4OPKA 2F96A 1T6DA 4DR4K 4L8RB 1J5OA 1RBRA 2UU9K 3OYHA 2W42A 3KTQA 3ZEUB 2YKMA 4QS8A 4H0OA 1VSIA 1BUPA 5CZ1A 4YNQA 3RMDA 3L0QA 4YOYA 4E7IA 3AA2A 5F1XA 2E1YA 1ZBHA 4CEAA 3LL3A 3PX0A 3TAMA 5FPDA 3V9WA 4DSJA 1LCUA 5BRHA 3GL1A 1XI1A 4W5QA 3MAQA 2JLEA 4CEDA 4HHTA 4OPJA 3HOSA 2HHUA 4OVLA 5BN9A 5EU7A 2NLXA 1J6ZA 2YV0X 4WQ4C 1I94K 2QW9A 4DFPA 1OH7A 3CJAA 5AR0A 3L4QA 4IXCA 3CPWM 1HKBA 3A2FA 3GBTA 1JLQA 5AQFA 4KH5A 4IDKA 2HMIA 3TSPA 2QKBA 1O1WA 1S22A 4CJSA 5B8HA 4LH5A 2QK9A 2YCHA 1VQON 2FBTA 3KK2A 3L6QA 2WOMA 4NYNA 5SWMA 4IKFA 4LC9B 4OPHA 1IKYA 4H0YB 3DLLL 3VQDA 2VG5A 3VQ9A 1S9EA 4H5VA 2E6LA 1VQ7N 3IAYA 1OH8A 3O4WA 2IAJA 4A57A 3QFPA 2WTUA 4DSIA 3D6RA 1U49A 1EKEA 2NUBA 4IBNA 5LJWA 4K0KK 1WSHA 4PUOA 3DLEA 1NMNA 1XHXA 3OYDA 1RTHA 4IG3A 4E89A 5J2NA 3NVMA 4BACA 3TI0A 4FOEA 4PWDA 3O3HA 4N5SA 4DWIA 4M3ZA 1NGIA 2BTFA 2LSNA 2XY5A 4DQPA 5KI6A 4FSVA 2P5OA 3CIPA 1XQSC 2Q36A 3KHYA 3MN7A 3ID8A 4CF1A 4O5FA 4W5RA 3SPYA 4JI0K 4B3MK 5AQMA 4WFNL 2VG7A 4XH4A 5BPLA 2EX3A 2O8FB 4JI1K 2GUPA 4RW7A 3P38A 1JXBA 2VG6A 3TAQA 4JKGB 1JLFA 4JD2A 1P90A 1GLDG 3O1WA 1TAUA 4DR5K 3RTVA 1YIJN 3DLBA 4FLUA 4O8UA 1NJXA 4QS7A 3J8AA 3S9HA 3SLCA 3AAPA 2EWSA 3ENHA 3J7ZO 3EEQA 4JI8K 2PAVA 1TVRA 4DSFA 1VQ5N 1RT7A 4DMNA 4DV4K 3K59A 3KZBA 4E3SA 4DUYK 4PQUA 3A5NC 2ZQBA 4KHWA 3ZT3A 3P1GA 3PX4A 4DR3K 2KFZA 2HF3A 3ZSOA 1QTMA 3E01A 1BA1A 2ZM6K 2YHBA 1BG3A 3O80A 3AVNA 5DK5A 3VQBA 1EXQA 1O13A 1N32K 4B1XB 4E0DA 2YKNA 3M5RA 4FJHA 1J54A 4OKKA 2R7YA 4BG8A 2W6KA 3LAKA 4CZMA 2Q2RA 4A59A 5CHIA 5KTQA 4N41A 2YNGA 4JI2K 4ZTJA 1T7PA 2G8KA 2A42A 4FJMA 5FDLA 4HUGA 4R5PA 4W5OA 2Z1JA 3KLGA 3D0PA 1HRHA 3VEZA 1C0GA 2P9UA 2WONA 4Z94A 4E19A 1NJWA 2AA4A 3L2WA 4B9VA 3G10A 4Z4GA 2D0OA 3SZ2A 4DTUA 2GUIA 1WUAA 3ZT4A 3CHWA 4BE0A 1XNQK 5HLFA 3SJHA 1BIZA 4NLBA 3KK3A 4DKWA 4DQ8A 1RDAA 1D5AA 1L5UA 3CCSN 5AQUA 4M3UA 2NRXA 3OYCA 4CFAA 3SV3A 3H08A 2PYJA 3EZWA 3RWUA 1JLCA 3SAHA 1A5WA 3EYZA 4NCAA 3OTOK 4V19S 3CCRN 4B9SA 2UUCK 4H5TA 3LDSA 3J7YP 3LWLA 1EO1A 4CGDA 1HKGA 4M3TA 2KZZA 3LP0A 2CH5A 4B1VA 5AQWA 1OVQA 4N76A 4OPAA 1VSHA 2JWKA 1J5EK 5M1NA 1TV6A 2UUAK 1V4TA 3DRRA 3OYMA 1BCOA 2QM1A 4FM0A 4KHPK 4KAZA 4DV2K 2BDPA 1RT1A 2E8AA 4GW6A 4FYDA 1RBVA 4QOZB 2NRZA 3N4QA 3W0LA 2ZJQL 1XC3A 2O8EB 4DTXA 5AQJA 5JS1A 4CECA 3VF6A 3P4IA 1OH6A 3V9UA 3WQTA 3THXA 5EOYA 2HBLA 3ULDA 4GV6A 3SUPA 4BQLA 3NFAA 1KTQA 2E2QA 3F5TA 3DXMB 4J8FA 5C0YA 4DU1A 1C0UA 4LF8K 4BC2A 4IOXA 1BI4A 4FM1A 3O9RA 4JKCA 1DGKN 1HNIA 4BRIA 3OYLA 4JS4A 5J2MA 3T1AA 3PSIA 3SQ4A 2PBDA 4B9MA 2OTLN 5ELZA 3BDPA 3CI5A 5A2QO 4J2DA 1ILYA 1YJ9N 4Z4IA 4KH6A 5AJ3K 4NCGA 4YDUC 1C1AA 5HROA 1QSSA 4AILC 5C2DA 5HBMA 4DS4A 3O5BA 1HYZA 4A61A 1DLOA 3IDHA 5JMVA 3M8PA 3NE6A 4O55A 3AO3A 1EP4A 4U7BA 4CJFA 4A5BA 1WAJA 3AAQA 3D2FB 2A6AA 3VENA 2P9IA 2KLAA 3CETA 2QI2A 4JD2B 4B9QA 3ID6A 1LOTB 2HHVA 2Q97A 4CIEA 3WXKA 3ZSQA 3ZSRA 3CMAN 3KD5E 1UAXA 3QETA 3P39A 1NK7A 5HRRA 2FLOA 3OVNA 2KKZA 1N36K 4MLEA 2P51A 4WQ5C 4CJVA 4PL7A 2X78A 1YJWN 4M63C 2G8WA 1BHLA 1UA0A 4FJ9A 4FL9A 1B92A 4CGFA 1OVYA 3SMPA 1Z6RA 4BWMA 2HSTA 1NGHA 1QZ5A 4ID1A 5JLFA 4BY9C 2D5RA 4M45A 2YHYA 3F73A 4AHCA 4IZ9A 1I3AA 3CCMN 3K58A 3KVGA 3JYTA 1SKRA 4GKJK 3C65A 3WEEB 2Q3SA 1BISA 2RN2A 1N8RO 3Q7BA 3I56N 5J2QA 1VQ9N 4CFCA 4I6MA 2D0BA 4EAHD 2EHGA 2X6SA 3O8MA 3VPZA 2OZSA 1KSPA 1VK0A 4H0TB 3HL8A 4H0PA 4KKOA 4KHQA 4CZKA 3EKSA 1L3SA 4KV8A 3SUQA 1CLQA 1VQKN 3KLHA 3NHGA 4FWLA 4CEBA 4CZHA 3CMEN 3PSFA 1QQOA 1IKVA 3MWPA 2E2OA 2W40A 3EKUA 1RT3A 1S1WA 2A41A 2GTDA 5I3UA 2W41A 3AARA 2IVNA 3A8YA 4LF9K 4IOCL 3ZX3A 3I8DA 3VESA 4FPBA 3V81A 3K5NA 5MLCQ 4DF8A 4M7YA 3CQYA 3P31A 1E4GT 1UOCA 4FJXA 1NJIO 4BRAA 1U2VA 1TUUA 2ASPA 2Z1HA 3CM6A 3DLHA 3LDNA 4NB4A 4JK9A 4KHSA 1YVUA 2VWKA 4LY7A 3CCEN 1CZ9A 3KWGA 4BVOA 4JNEA 2KZMA 3OS2A 1Y64A 1VQ6N 3HO1A 5C15A 3THWB 4WE1A 1G99A 1JCEA 4DTRA 3LP1A 1Q8IA 3CJ9A 3SPZA 3WNGA 4K42A 1NKEA 4KO0A 3BZKA 4BR9A 4KREA 3PIOL 4FZYA 5CY4A 1BI4B 3NF6A 1UWBA 1MA9B 3EZ5A 2XO7A 3R3LA 4DQRA 3AV9A 4BE2A 4DR2K 3RR7A 4CJ5A 4DHYA 2Q1NA 4FJIA 5ADXA 2V7YA 2JGUA 1BL3A 3HPGA 2HMPA 4DFKA 4FJGA 2HVHA 5CZ2A 5BN8A 3MMVA 1ASVA 4GVEA 4H03B 5CR4A 4AHUA 3AGRA 3K5OA 4PHTX 1HLUA 2FBVA 5FRNA 4GV9A 1OKJA 2UUBK 4BG9A 1VQMN 4BRGA 1YTUA 5TKYA 4YOVA 3UKRB 1A5XA 3A5MC 1WSIA 3V9XA 1S6PA 2NRWA 1HNZK 5C12A 4CEOA 3A0IX 3C94A 2O8FA 4J2BA 4WFAL 5HL7L 2IC3A 4M3RA 1C0TA 1VSKA 3VQ7A 4E1JA 1GLFO 4JKGA 5DMRA 3WQUA 4FVMA 4FW1A 1VSMA 3V1RA 5KRSA 4PY5A 2E2NA 4XEIA 3RRHA 3D2FA 1LAVA 3SMSA 4MDAA 2VGNA 4CGJA 2D1KA 1BQNA 4HUFA 4DLEA 1RT5A 3AVFA 4BGAA 1JLAA 1L3UA 2ITMA 4I6MB 3O3GA 1EWRA 1U48A 2B5JA 5KRTA 4LF5K 1W0HA 2KQ2A 1U47A 4ZTFA 5M1KA 1RGIA 4ILJA 3FR0A 1TKDA 4ILGB 3WNHA 3OYEA 3VQCA 4BRLA 5E41A 4BRFA 1YXQA 2Y1JA 1C0MA 2DFFA 3G0ZA 2QWQA 4DF4A 3ZSWA 3PX6A 4IO9L 3SBTA 4CBWA 2RHKA 3MCAB 4B1WB 3TANA 3LZJA 2HOEA 3FE1A 5GAHP 2E88A 1KQSM 3O1BA 3KWIA 4CEFA 4AHVA 1IV0A 3HSTB 3SNNA 3F9KA 3U8XA 3B6OA 4DLGA 4FJ5A 2IVPA 1WBBA 3CYMA 2HNYA 4BDYA 2D0CA 1NBWA 4F3TA 2ZJPL 2FC0A 1DKGD 4AHSA 3O6WA 4NYFA 3AVJA 1IJJA 1HQUA 3EL2A 3CG7A 4C8LA 2AJQA 2HNZA 1U2VB 1T05A 1HQEA 3LDOA 1RNHA 1NGAA 3ZETB 3IS9A 4I2QA 4Y0WA 4Q0BA 1JLBA 2NZTA 4AHTA 2OPPA 1FW6A 5C10A 2VQEK 3ZSYA 5HRPA 1SS6A 2BGGA 5AZIA 4JEPA 4FLVA 3Q7CA 1LWEA 1NGDA 5KGWA 4FJLA 1TYQB 4ISFA 4LF7K 2HHXA 3R1XA 1KD1O 3N4PA 2GWKA 4CJ4A 4BRDA 1TKXA 2AP1A 3BP8A 4GNIA 2O8EA 2A40A 3FLCO 3K9JA 2X6NA 2FSKA 1KRPA 2YHWA 2ZWHA 4A5AA 2YJEA 4CD1A 4CFBA 4FLYA 4DS5A 1GLLO 3UIQA 4MDBA 2O4GA 4JI6K 5JS2A 1YITN 1RTDA 3QB0A 4KB0A 4LF4K 1ASUA 3DXMA 2QXLA 5C42A 3KLEA 2JWLA 1RT6A 3U9DA 2UXDK 4FWKA 3MN9A 4IOAL 4N56A 4CHQA 1ATRA 1VSDA 3JSMA 2ZGZA 4R79A 4Y1DA 3MN6A 3AA5X 1QZ6A 1HMVA 3AVLA 4OKEA 1S6QA 4JV5K 1VQ8N 4K8XA 1K73O 2I5JA 3C7NB 2PZSA 1TK0A 3OBYA 2F8TA 4ISEA 4BR2A 4CF9A 4BR5A 4NO7A 4CGGA 4FLZA 1HPZA 1S3XA 3HYFA 4H4MA 3MDQA 5AQSA 3CJ1A 1NJZA 4CIGA 4WCEL 4MLHA 2GBZA 3DOKA
chains in the Genus database with same CATH topology
4LSNA 1KTQA 1S5JA 3K5LA 3HJFA 3C95A 1SL0A 3AO5A 2RF2A 3IG1A 1NOYA 1BGXT 1C0UA 5T7BA 1KVAA 3KJVA 3NAEA 4DU1A 3DOLA 3AA4A 4C8MA 4O0IA 1SKWA 4I2PA 3MEEA 4Z0UA 3HK2A 4JRPA 1BI4A 1Z26A 2P1JA 4FM1A 4B8AB 4DTNA 3LALA 4ICLA 4HUEA 1JLGA 1HNIA 4M42A 1DTQA 3OYLA 4JS4A 5J2MA 1VRUA 3T1AA 3M8QA 3SQ4A 4CJUA 2FBYA 3ISNC 3AVIA 3ZSXA 1HYVA 3RMAA 3PY8A 3BDPA 4B9MA 4J2AA 4KHUA 4CK1A 1IG9A 3NDKA 4J2DA 5K14A 1KFSA 4B8CA 3O4NA 2OPQA 2Z1IA 4RG8A 4Z4IA 1QQCA 4NCGA 4DFMA 4EZ6A 3PUFA 3M8SA 2YNFA 4FXDA 1C1AA 3BGRA 4GVMA 4CEEA 3KLFA 3V6DA 5HROA 4FZXC 1QSSA 1RDCA 3KLIA 4AILC 3ZSVA 1HNVA 4FZZA 1NKBA 4JLHA 4M3XA 1NOZA 5HBMA 5SZTA 4RW4A 1U04A 1TAQA 4DS4A 1HYZA 3MXIA 4C8OA 4O4GA 1DTTA 1DLOA 1QSLA 1XC9A 3M8PA 3NE6A 3ZSZA 4O55A 3AO3A 1EP4A 3VQ4A 1NK6A 4CGIA 4CJFA 3CQ8A 1NK8A 2XY6A 1WAJA 4O0JA 4H4OA 1RCHA 3AVAA 2Z1GA 4CGHA 1KVCA 4PA1A 1RILA 3NGIA 4KI6A 2HHVA 3NH1A 4CIEA 3V9ZA 1SL1A 3CM5A 5D3GA 1Q9XA 3AVMA 3ZSQA 4CJEA 1YT3A 5C24A 3ZSRA 3HP9A 3AO4A 4DTMA 4N47A 3DRSA 3AVKA 3OYIA 1ZBLA 3KD5E 1UAXA 1L3VA 4QCLA 3QETA 4IG0A 3L8BA 1NK7A 3RRGA 5HRRA 3OVNA 1J53A 3QEPA 2P51A 4CJVA 2X78A 2G8WA 2HVIA 3LZIA 1GOCA 1HJRA 1X9WA 4ELUA 1IKXA 4LD0A 1BHLA 1UA0A 3DLRA 3ZCMA 4LH4A 1B92A 1LAWA 4CGFA 4FJ9A 3SI6A 4BWMA 3TAPA 3V1QA 1JXEA 1WSGA 2HW3A 1S1UA 4ID1A 1RTJA 2OPRA 2YHAA 3TAEA 2D5RA 2BANA 3DRPA 5CYQA 4M45A 1N6QA 4CEZA 3KD1E 3TAFA 2G8VA 2DY4A 1NKCA 3OYFA 3F73A 3QINA 4AHCA 1I3AA 4DSKA 3K58A 1C6VA 3JYTA 3NGZA 1SKRA 5HRSA 4K8ZA 4BWJA 3L2VA 5J1EA 4IFYA 4FJJA 2Q3SA 4M3YA 1BISA 2RN2A 1NK0A 1QS4A 4Z4FA 3SUPA 2HHQA 5J2QA 4I7FA 1RDDA 2HB5A 3AO1A 2YNHA 4CFCA 4CF0A 3OYAA 3QEWA 3L3VA 2D0BA 1RBSA 2X74A 4DTSA 1NJYA 2EHGA 4OGCA 2KW4A 1T03A 2X6SA 4ZHRA 4H8KA 2OZSA 3S3NA 2G8HA 1KSPA 3OYJA 4B9TA 1VK0A 3QERA 3SCXA 4HCCA 4RW8A 4DG1A 3HL8A 1JKHA 4CJRA 1U4BA 1RBTA 3SQ1A 4KKOA 1VRTA 4KHQA 1NK5A 1L3SA 4KV8A 3SUQA 1C1BA 3MXMA 2OYQA 5CYMA 2XHBA 3CFOA 1IH7A 1CLQA 3NBPA 3KLHA 3NHGA 4O44A 1NK9A 4FK2A 1VSFA 3S3MA 1X9MA 1GOBA 3AVHA 4FK4A 1RT2A 4CEBA 3TAGA 3RR8A 4TSXA 4CF2A 1IKVA 1LWCA 2B4JA 3DMJA 4KHNA 1R0AA 1KVBA 4M41A 4FCYA 1U45A 1EX4A 1KFDA 1QHTA 3LANA 1HYSA 1RT3A 3LAMA 1S1WA 4CERA 3OYKA 3HXMA 2FBXA 3MEDA 4CHNA 4CIFA 5I3UA 4EZ9A 3QESA 4KHYA 2O4IA 2KTQA 3VQ6A 1TK5A 1D8YA 4E7KA 1LV5A 3VQAA 4BE1A 4BDPA 4FJNA 1S1TA 1WAFA 4F8RA 3I8DA 4I9QA 3QEIA 3T19A 1J9AA 1VSEA 3TR8A 3K5NA 3V81A 4DF8A 1D9DA 4CHYA 2ATQA 3VQQA 3CFRA 2G8IA 4CHPA 4Z4CA 3KKSA 4OPKA 2F96A 1UOCA 4FJXA 1JL2A 4DU3A 2RPIA 1N5YA 1J5OA 4L8RB 4B9LA 1RBRA 3OYHA 3VN5A 4FJ7A 3CM6A 2Z1HA 2W42A 3DLHA 3KTQA 1ZBUA 2YKMA 2E4LA 3WNEA 1VSIA 4KHSA 4YNQA 1YVUA 5CZ1A 2VWKA 3RMBA 1ZBFA 4J2EA 3L2RA 4LY7A 2IGIA 3RMDA 4E7IA 2G8UA 3AA2A 4KB1A 1CZ9A 4CJWA 1WNSA 1ZBHA 4CEAA 1ZYQA 2KZMA 3LPTA 4FJ8A 3B6PA 3OS2A 3P83D 3PX0A 2YNIA 3HO1A 1TKZA 4WE1A 3TAMA 5KGXA 4F3OA 3V9WA 1Y97A 4DSJA 4FK0A 4B3OA 4DTRA 3LP1A 3LP2A 1Q8IA 1XI1A 4W5QA 3SPZA 3MAQA 3WNGA 2JLEA 3QIOA 3NH0A 3OS0A 4CEDA 4HTUA 1NK4A 4HHTA 1NKEA 2ZE2A 2DFEA 3DM2A 4KO0A 4KREA 3U3YA 4OPJA 3HT3A 2HHUA 4FZYA 4IFVA 4OVLA 1BI4B 5CY4A 3NF6A 3HVRA 3CFPA 2Y1IA 1WSEA 2XRIA 5EU7A 3WNFA 4E7LA 4KTZA 4F2SA 1UWBA 2YV0X 3NF8A 1TGOA 2HHWA 1LW0A 3SUNA 3EZ5A 2XO7A 4C8KA 4DFPA 4DQRA 3AV9A 3SJJA 3NF9A 4BE2A 1GOAA 3NH2A 3RR7A 4CJ5A 1ZBIA 2D0AA 4FJIA 3A2FA 4FLTA 2PY5A 1S1VA 1JLQA 2OPSA 2JGUA 1BL3A 3HPGA 3SYZA 1YTAA 2QXFA 4IDKA 4DFKA 1SKSA 4FJGA 2HMIA 3PO4A 2HVHA 5CZ2A 5HRNA 4Z4EA 1A5VA 2QKBA 2HNDA 1O1WA 1ASVA 2BE2A 4AHUA 4CCHA 4CJSA 3KIOA 4LH5A 2QK9A 3K5OA 1LW2A 2FBVA 5FRNA 3OJUA 1S1XA 2FBTA 1G15A 3KK2A 2WOMA 4AHRA 1YTUA 3HVTA 4NYNA 4F4KA 5SWMA 4IKFA 1FKOA 3K2PA 1A5XA 1IKYA 1WSIA 3VQDA 2VG5A 1S6PA 3ASMA 3VQ9A 3OYBA 3HP6A 3V9XA 1S9EA 4DQSA 2OA8A 2E6LA 4CEOA 1X1PA 4GMJB 3IAYA 1RT4A 4DU4A 1T8EA 3VA3A 2IAJA 3ZT0A 4M3WA 2KFNA 1BIUA 4DSIA 1VSLA 3C94A 3ZT1A 4J2BA 4CE9A 4W5NA 1U49A 1EKEA 2IC3A 2NUBA 4IBNA 4KFBA 4M3RA 2DTUA 1WSHA 4XIUA 1C0TA 1VSKA 3DLEA 4PUOA 3MEGA 3VQ7A 5DMRA 1XHXA 4FVMA 1RTHA 4FW1A 4IG3A 4CHOA 4E89A 1VSMA 3I0RA 3OYDA 3V1RA 5J2NA 3QO9A 5KRSA 4BACA 3TI0A 1Z25A 4B9UA 4PY5A 4PWDA 3VA0A 3RRHA 4FW2A 1KCFA 3O3HA 3L2UA 4N5SA 4BDZA 4DWIA 1LAVA 4M3ZA 3PV8A 2LSNA 4CGJA 5FROA 2XY5A 3MECA 4DQPA 4E7HA 5KI6A 1BQNA 4HUFA 2HHTA 1IKWA 3AVBA 1BQMA 3HPOA 2P5OA 4NCBA 4DLEA 3LP3A 3DYAA 1RT5A 4LSLA 3AVFA 2XY7A 4ELTA 3ITHA 1JLAA 1L3UA 1ITGA 3AVGA 3O3GA 3OJSA 4EP4A 4DTPA 1U48A 3IRXA 3O4QA 2B5JA 3QEVA 5KRTA 3SQ2A 1W0HA 2KQ2A 3LPUA 4CF1A 1TKTA 3AA3A 4AH9A 4W5RA 3SPYA 2A1SA 1U47A 3K5MA 4ZTFA 3D45A 2E6MA 1X9SA 1TL3A 1REVA 1RBUA 3K57A 2VG7A 1XWLA 1TKDA 3WNHA 3TARA 1MU2A 3OYEA 1C1CA 2EX3A 1CXQA 3VQCA 1CXUA 2IOCA 3OY9A 4DSLA 5E41A 4I9LA 4OJRA 4KTWA 2ITGA 4KTQA 4ELVA 4CK2A 4RW7A 2Y1JA 1JXBA 2VG6A 4CJ3A 1C0MA 4E1MA 3TAQA 1JLFA 2DFFA 3G0ZA 4DF4A 2P5GA 3OYGA 1TAUA 3ZSWA 3U6FA 3HM9A 3RTVA 4CK3A 3PX6A 3DLBA 4FLUA 2HHSA 1NJXA 4MQ3A 2QKKA 3S9HA 3TANA 3LZJA 1B9DA 1W9HA 1WLJA 4OLAA 3NGYA 3O3FA 4OGEA 5FRMA 3SUOA 3M8RA 4CEFA 1TVRA 4DSFA 4AHVA 1RT7A 4DMNA 4Z4HA 4FJKA 3K59A 3HSTB 3SNNA 4DSEA 4E3SA 4PQUA 4DQQA 1WSFA 2ZQBA 1TL1A 1WSJA 3F9KA 4QAGA 3P1GA 3ZT3A 3ZT2A 3B6OA 4EP5A 3PX4A 4DQIA 2KFZA 3ZSOA 1QTMA 4CJKA 4DLGA 3E01A 4FJ5A 2F8SA 4UQGA 3CYMA 2YHBA 2HNYA 1XHZA 5DK5A 3VQBA 3AVNA 4JS5A 2D0CA 4BDYA 1EXQA 2IS3A 4E0DA 4F3TA 2YKNA 2FC0A 1CZBA 4AHSA 2ZD1A 2G8FA 4NYFA 4FJHA 3AVJA 1J54A 4OKKA 1HQUA 2R7YA 4C8LA 3CG7A 3LAKA 3L3UA 2HNZA 1FKPA 4W5TA 1UA1A 2AJQA 5KTQA 1T05A 1HQEA 2YNGA 1RNHA 4N41A 1D9FA 4CEQA 3VQ8A 4ZTJA 4B08A 1T7PA 3ALYA 1JL1A 4E1NA 3RMCA 2G8KA 4F2RA 4FJMA 5FDLA 4HUGA 3DLKA 4R5PA 4W5OA 3IS9A 4C8NA 2Z1JA 4I2QA 3KLGA 4Q0BA 1JLBA 3D0PA 4AHTA 4B9NA 3QNOA 1HRHA 3VQEA 2GV9A 2OPPA 2WONA 3OYNA 2VWJA 4E19A 1NJWA 4KHWA 3FFIA 3ZSYA 5HRPA 3L2WA 3G10A 4B9VA 1KLMA 4FM2A 4FLVA 2BGGA 1LWEA 1RTIA 4Z4GA 1L3TA 5KGWA 4FJLA 3NFAA 4MFBA 3SZ2A 2HHXA 4DTUA 2GUIA 3ZT4A 1SUQA 4BE0A 4G1QA 1K6YA 4CJ4A 3TABA 1WN7A 3DLGA 4FLWA 5HLFA 1TKXA 4CF8A 4CFDA 1BIZA 4HCBA 3KK3A 1I39A 5I42A 4OLBA 1RDAA 2X6NA 1D5AA 2B6AA 1L5UA 3THVA 2RKIA 1KRPA 3T3FA 4M3UA 1IO2A 3AO2A 1KLNA 2DFHA 1LWFA 3OYCA 4CFAA 3NF7A 3H08A 3SV3A 1EETA 1ASWA 1B9FA 4CFBA 1TK8A 2PYJA 4YFUA 4FLYA 4DS5A 3L2QA 3UIQA 1VSJA 1JLCA 2O4GA 3RWUA 5JS2A 1A5WA 3EYZA 4NCAA 1QE1A 4Q5VA 1RTDA 3SV4A 4KB0A 3TWHA 4CJPA 4JRQA 4B9SA 1ASUA 3LDSA 3LWLA 3QIPA 3LWMA 1BCMA 5J2PA 5C42A 3KLEA 4CGDA 1RT6A 4KRFA 4M3TA 4CJTA 3AVCA 3LP0A 3VQPA 4CESA 4DTOA 2KZZA 1FK9A 3I0SA 3C6UA 4N76A 4N56A 4CHQA 3NCIA 1VSDA 3JSMA 1RDBA 1QSYA 5HP1A 1VSHA 4Y1CA 4Y1DA 3MXJA 3AA5X 3VQ5A 1TV6A 1HMVA 3AVLA 1Q9YA 3U3GA 3DRRA 4OKEA 3OYMA 1BCOA 1SV5A 1S6QA 2XY8A 4FM0A 5C25A 4RW6A 4K8XA 4KAZA 3V1OA 2BDPA 2I5JA 3HPHA 4FLXA 1RT1A 4DFJA 4CHZA 2PZSA 4GW6A 4O5BA 4FYDA 4DTJA 3V9SA 1RBVA 2PYLA 4ID5A 1TK0A 4QOZB 2F8TA 3S3OA 1F21A 4CF9A 4DTXA 3DI6A 3C6TA 1JLEA 4CJLA 4KPYA 3QNNA 1S9GA 3PO5A 5JS1A 4CECA 3SQ0A 3QLHA 2OZMA 4CGGA 4E7JA 1SL2A 4FLZA 1HPZA 3KKRA 3V9UA 3HYFA 3OS1A 3QEXA 4CJQA 4OKJA 3P5JA 4H4MA 3KK1A 1NJZA 1FXXA 4CIGA 4HVJA 4KI4A 2ETJA 3V4IA 3ULDA 2A1RA 3EY1A 2IDOA 4RW9A 2GBZA 3DOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSN A;  1KTQ A;  1S5J A;  3K5L A;  3HJF A;  3C95 A;  1SL0 A;  3AO5 A;  2RF2 A;  3IG1 A;  1NOY A;  1BGX T;  1C0U A;  5T7B A;  1KVA A;  3KJV A;  3NAE A;  4DU1 A;  3DOL A;  3AA4 A;  4C8M A;  4O0I A;  1SKW A;  4I2P A;  3MEE A;  4Z0U A;  3HK2 A;  4JRP A;  1BI4 A;  1Z26 A;  2P1J A;  4FM1 A;  4B8A B;  4DTN A;  3LAL A;  4ICL A;  4HUE A;  1JLG A;  1HNI A;  4M42 A;  1DTQ A;  3OYL A;  4JS4 A;  5J2M A;  1VRU A;  3T1A A;  3M8Q A;  3SQ4 A;  4CJU A;  2FBY A;  3ISN C;  3AVI A;  3ZSX A;  1HYV A;  3RMA A;  3PY8 A;  3BDP A;  4B9M A;  4J2A A;  4KHU A;  4CK1 A;  1IG9 A;  3NDK A;  4J2D A;  5K14 A;  1KFS A;  4B8C A;  3O4N A;  2OPQ A;  2Z1I A;  4RG8 A;  4Z4I A;  1QQC A;  4NCG A;  4DFM A;  4EZ6 A;  3PUF A;  3M8S A;  2YNF A;  4FXD A;  1C1A A;  3BGR A;  4GVM A;  4CEE A;  3KLF A;  3V6D A;  5HRO A;  4FZX C;  1QSS A;  1RDC A;  3KLI A;  4AIL C;  3ZSV A;  1HNV A;  4FZZ A;  1NKB A;  4JLH A;  4M3X A;  1NOZ A;  5HBM A;  5SZT A;  4RW4 A;  1U04 A;  1TAQ A;  4DS4 A;  1HYZ A;  3MXI A;  4C8O A;  4O4G A;  1DTT A;  1DLO A;  1QSL A;  1XC9 A;  3M8P A;  3NE6 A;  3ZSZ A;  4O55 A;  3AO3 A;  1EP4 A;  3VQ4 A;  1NK6 A;  4CGI A;  4CJF A;  3CQ8 A;  1NK8 A;  2XY6 A;  1WAJ A;  4O0J A;  4H4O A;  1RCH A;  3AVA A;  2Z1G A;  4CGH A;  1KVC A;  4PA1 A;  1RIL A;  3NGI A;  4KI6 A;  2HHV A;  3NH1 A;  4CIE A;  3V9Z A;  1SL1 A;  3CM5 A;  5D3G A;  1Q9X A;  3AVM A;  3ZSQ A;  4CJE A;  1YT3 A;  5C24 A;  3ZSR A;  3HP9 A;  3AO4 A;  4DTM A;  4N47 A;  3DRS A;  3AVK A;  3OYI A;  1ZBL A;  3KD5 E;  1UAX A;  1L3V A;  4QCL A;  3QET A;  4IG0 A;  3L8B A;  1NK7 A;  3RRG A;  5HRR A;  3OVN A;  1J53 A;  3QEP A;  2P51 A;  4CJV A;  2X78 A;  2G8W A;  2HVI A;  3LZI A;  1GOC A;  1HJR A;  1X9W A;  4ELU A;  1IKX A;  4LD0 A;  1BHL A;  1UA0 A;  3DLR A;  3ZCM A;  4LH4 A;  1B92 A;  1LAW A;  4CGF A;  4FJ9 A;  3SI6 A;  4BWM A;  3TAP A;  3V1Q A;  1JXE A;  1WSG A;  2HW3 A;  1S1U A;  4ID1 A;  1RTJ A;  2OPR A;  2YHA A;  3TAE A;  2D5R A;  2BAN A;  3DRP A;  5CYQ A;  4M45 A;  1N6Q A;  4CEZ A;  3KD1 E;  3TAF A;  2G8V A;  2DY4 A;  1NKC A;  3OYF A;  3F73 A;  3QIN A;  4AHC A;  1I3A A;  4DSK A;  3K58 A;  1C6V A;  3JYT A;  3NGZ A;  1SKR A;  5HRS A;  4K8Z A;  4BWJ A;  3L2V A;  5J1E A;  4IFY A;  4FJJ A;  2Q3S A;  4M3Y A;  1BIS A;  2RN2 A;  1NK0 A;  1QS4 A;  4Z4F A;  3SUP A;  2HHQ A;  5J2Q A;  4I7F A;  1RDD A;  2HB5 A;  3AO1 A;  2YNH A;  4CFC A;  4CF0 A;  3OYA A;  3QEW A;  3L3V A;  2D0B A;  1RBS A;  2X74 A;  4DTS A;  1NJY A;  2EHG A;  4OGC A;  2KW4 A;  1T03 A;  2X6S A;  4ZHR A;  4H8K A;  2OZS A;  3S3N A;  2G8H A;  1KSP A;  3OYJ A;  4B9T A;  1VK0 A;  3QER A;  3SCX A;  4HCC A;  4RW8 A;  4DG1 A;  3HL8 A;  1JKH A;  4CJR A;  1U4B A;  1RBT A;  3SQ1 A;  4KKO A;  1VRT A;  4KHQ A;  1NK5 A;  1L3S A;  4KV8 A;  3SUQ A;  1C1B A;  3MXM A;  2OYQ A;  5CYM A;  2XHB A;  3CFO A;  1IH7 A;  1CLQ A;  3NBP A;  3KLH A;  3NHG A;  4O44 A;  1NK9 A;  4FK2 A;  1VSF A;  3S3M A;  1X9M A;  1GOB A;  3AVH A;  4FK4 A;  1RT2 A;  4CEB A;  3TAG A;  3RR8 A;  4TSX A;  4CF2 A;  1IKV A;  1LWC A;  2B4J A;  3DMJ A;  4KHN A;  1R0A A;  1KVB A;  4M41 A;  4FCY A;  1U45 A;  1EX4 A;  1KFD A;  1QHT A;  3LAN A;  1HYS A;  1RT3 A;  3LAM A;  1S1W A;  4CER A;  3OYK A;  3HXM A;  2FBX A;  3MED A;  4CHN A;  4CIF A;  5I3U A;  4EZ9 A;  3QES A;  4KHY A;  2O4I A;  2KTQ A;  3VQ6 A;  1TK5 A;  1D8Y A;  4E7K A;  1LV5 A;  3VQA A;  4BE1 A;  4BDP A;  4FJN A;  1S1T A;  1WAF A;  4F8R A;  3I8D A;  4I9Q A;  3QEI A;  3T19 A;  1J9A A;  1VSE A;  3TR8 A;  3K5N A;  3V81 A;  4DF8 A;  1D9D A;  4CHY A;  2ATQ A;  3VQQ A;  3CFR A;  2G8I A;  4CHP A;  4Z4C A;  3KKS A;  4OPK A;  2F96 A;  1UOC A;  4FJX A;  1JL2 A;  4DU3 A;  2RPI A;  1N5Y A;  1J5O A;  4L8R B;  4B9L A;  1RBR A;  3OYH A;  3VN5 A;  4FJ7 A;  3CM6 A;  2Z1H A;  2W42 A;  3DLH A;  3KTQ A;  1ZBU A;  2YKM A;  2E4L A;  3WNE A;  1VSI A;  4KHS A;  4YNQ A;  1YVU A;  5CZ1 A;  2VWK A;  3RMB A;  1ZBF A;  4J2E A;  3L2R A;  4LY7 A;  2IGI A;  3RMD A;  4E7I A;  2G8U A;  3AA2 A;  4KB1 A;  1CZ9 A;  4CJW A;  1WNS A;  1ZBH A;  4CEA A;  1ZYQ A;  2KZM A;  3LPT A;  4FJ8 A;  3B6P A;  3OS2 A;  3P83 D;  3PX0 A;  2YNI A;  3HO1 A;  1TKZ A;  4WE1 A;  3TAM A;  5KGX A;  4F3O A;  3V9W A;  1Y97 A;  4DSJ A;  4FK0 A;  4B3O A;  4DTR A;  3LP1 A;  3LP2 A;  1Q8I A;  1XI1 A;  4W5Q A;  3SPZ A;  3MAQ A;  3WNG A;  2JLE A;  3QIO A;  3NH0 A;  3OS0 A;  4CED A;  4HTU A;  1NK4 A;  4HHT A;  1NKE A;  2ZE2 A;  2DFE A;  3DM2 A;  4KO0 A;  4KRE A;  3U3Y A;  4OPJ A;  3HT3 A;  2HHU A;  4FZY A;  4IFV A;  4OVL A;  1BI4 B;  5CY4 A;  3NF6 A;  3HVR A;  3CFP A;  2Y1I A;  1WSE A;  2XRI A;  5EU7 A;  3WNF A;  4E7L A;  4KTZ A;  4F2S A;  1UWB A;  2YV0 X;  3NF8 A;  1TGO A;  2HHW A;  1LW0 A;  3SUN A;  3EZ5 A;  2XO7 A;  4C8K A;  4DFP A;  4DQR A;  3AV9 A;  3SJJ A;  3NF9 A;  4BE2 A;  1GOA A;  3NH2 A;  3RR7 A;  4CJ5 A;  1ZBI A;  2D0A A;  4FJI A;  3A2F A;  4FLT A;  2PY5 A;  1S1V A;  1JLQ A;  2OPS A;  2JGU A;  1BL3 A;  3HPG A;  3SYZ A;  1YTA A;  2QXF A;  4IDK A;  4DFK A;  1SKS A;  4FJG A;  2HMI A;  3PO4 A;  2HVH A;  5CZ2 A;  5HRN A;  4Z4E A;  1A5V A;  2QKB A;  2HND A;  1O1W A;  1ASV A;  2BE2 A;  4AHU A;  4CCH A;  4CJS A;  3KIO A;  4LH5 A;  2QK9 A;  3K5O A;  1LW2 A;  2FBV A;  5FRN A;  3OJU A;  1S1X A;  2FBT A;  1G15 A;  3KK2 A;  2WOM A;  4AHR A;  1YTU A;  3HVT A;  4NYN A;  4F4K A;  5SWM A;  4IKF A;  1FKO A;  3K2P A;  1A5X A;  1IKY A;  1WSI A;  3VQD A;  2VG5 A;  1S6P A;  3ASM A;  3VQ9 A;  3OYB A;  3HP6 A;  3V9X A;  1S9E A;  4DQS A;  2OA8 A;  2E6L A;  4CEO A;  1X1P A;  4GMJ B;  3IAY A;  1RT4 A;  4DU4 A;  1T8E A;  3VA3 A;  2IAJ A;  3ZT0 A;  4M3W A;  2KFN A;  1BIU A;  4DSI A;  1VSL A;  3C94 A;  3ZT1 A;  4J2B A;  4CE9 A;  4W5N A;  1U49 A;  1EKE A;  2IC3 A;  2NUB A;  4IBN A;  4KFB A;  4M3R A;  2DTU A;  1WSH A;  4XIU A;  1C0T A;  1VSK A;  3DLE A;  4PUO A;  3MEG A;  3VQ7 A;  5DMR A;  1XHX A;  4FVM A;  1RTH A;  4FW1 A;  4IG3 A;  4CHO A;  4E89 A;  1VSM A;  3I0R A;  3OYD A;  3V1R A;  5J2N A;  3QO9 A;  5KRS A;  4BAC A;  3TI0 A;  1Z25 A;  4B9U A;  4PY5 A;  4PWD A;  3VA0 A;  3RRH A;  4FW2 A;  1KCF A;  3O3H A;  3L2U A;  4N5S A;  4BDZ A;  4DWI A;  1LAV A;  4M3Z A;  3PV8 A;  2LSN A;  4CGJ A;  5FRO A;  2XY5 A;  3MEC A;  4DQP A;  4E7H A;  5KI6 A;  1BQN A;  4HUF A;  2HHT A;  1IKW A;  3AVB A;  1BQM A;  3HPO A;  2P5O A;  4NCB A;  4DLE A;  3LP3 A;  3DYA A;  1RT5 A;  4LSL A;  3AVF A;  2XY7 A;  4ELT A;  3ITH A;  1JLA A;  1L3U A;  1ITG A;  3AVG A;  3O3G A;  3OJS A;  4EP4 A;  4DTP A;  1U48 A;  3IRX A;  3O4Q A;  2B5J A;  3QEV A;  5KRT A;  3SQ2 A;  1W0H A;  2KQ2 A;  3LPU A;  4CF1 A;  1TKT A;  3AA3 A;  4AH9 A;  4W5R A;  3SPY A;  2A1S A;  1U47 A;  3K5M A;  4ZTF A;  3D45 A;  2E6M A;  1X9S A;  1TL3 A;  1REV A;  1RBU A;  3K57 A;  2VG7 A;  1XWL A;  1TKD A;  3WNH A;  3TAR A;  1MU2 A;  3OYE A;  1C1C A;  2EX3 A;  1CXQ A;  3VQC A;  1CXU A;  2IOC A;  3OY9 A;  4DSL A;  5E41 A;  4I9L A;  4OJR A;  4KTW A;  2ITG A;  4KTQ A;  4ELV A;  4CK2 A;  4RW7 A;  2Y1J A;  1JXB A;  2VG6 A;  4CJ3 A;  1C0M A;  4E1M A;  3TAQ A;  1JLF A;  2DFF A;  3G0Z A;  4DF4 A;  2P5G A;  3OYG A;  1TAU A;  3ZSW A;  3U6F A;  3HM9 A;  3RTV A;  4CK3 A;  3PX6 A;  3DLB A;  4FLU A;  2HHS A;  1NJX A;  4MQ3 A;  2QKK A;  3S9H A;  3TAN A;  3LZJ A;  1B9D A;  1W9H A;  1WLJ A;  4OLA A;  3NGY A;  3O3F A;  4OGE A;  5FRM A;  3SUO A;  3M8R A;  4CEF A;  1TVR A;  4DSF A;  4AHV A;  1RT7 A;  4DMN A;  4Z4H A;  4FJK A;  3K59 A;  3HST B;  3SNN A;  4DSE A;  4E3S A;  4PQU A;  4DQQ A;  1WSF A;  2ZQB A;  1TL1 A;  1WSJ A;  3F9K A;  4QAG A;  3P1G A;  3ZT3 A;  3ZT2 A;  3B6O A;  4EP5 A;  3PX4 A;  4DQI A;  2KFZ A;  3ZSO A;  1QTM A;  4CJK A;  4DLG A;  3E01 A;  4FJ5 A;  2F8S A;  4UQG A;  3CYM A;  2YHB A;  2HNY A;  1XHZ A;  5DK5 A;  3VQB A;  3AVN A;  4JS5 A;  2D0C A;  4BDY A;  1EXQ A;  2IS3 A;  4E0D A;  4F3T A;  2YKN A;  2FC0 A;  1CZB A;  4AHS A;  2ZD1 A;  2G8F A;  4NYF A;  4FJH A;  3AVJ A;  1J54 A;  4OKK A;  1HQU A;  2R7Y A;  4C8L A;  3CG7 A;  3LAK A;  3L3U A;  2HNZ A;  1FKP A;  4W5T A;  1UA1 A;  2AJQ A;  5KTQ A;  1T05 A;  1HQE A;  2YNG A;  1RNH A;  4N41 A;  1D9F A;  4CEQ A;  3VQ8 A;  4ZTJ A;  4B08 A;  1T7P A;  3ALY A;  1JL1 A;  4E1N A;  3RMC A;  2G8K A;  4F2R A;  4FJM A;  5FDL A;  4HUG A;  3DLK A;  4R5P A;  4W5O A;  3IS9 A;  4C8N A;  2Z1J A;  4I2Q A;  3KLG A;  4Q0B A;  1JLB A;  3D0P A;  4AHT A;  4B9N A;  3QNO A;  1HRH A;  3VQE A;  2GV9 A;  2OPP A;  2WON A;  3OYN A;  2VWJ A;  4E19 A;  1NJW A;  4KHW A;  3FFI A;  3ZSY A;  5HRP A;  3L2W A;  3G10 A;  4B9V A;  1KLM A;  4FM2 A;  4FLV A;  2BGG A;  1LWE A;  1RTI A;  4Z4G A;  1L3T A;  5KGW A;  4FJL A;  3NFA A;  4MFB A;  3SZ2 A;  2HHX A;  4DTU A;  2GUI A;  3ZT4 A;  1SUQ A;  4BE0 A;  4G1Q A;  1K6Y A;  4CJ4 A;  3TAB A;  1WN7 A;  3DLG A;  4FLW A;  5HLF A;  1TKX A;  4CF8 A;  4CFD A;  1BIZ A;  4HCB A;  3KK3 A;  1I39 A;  5I42 A;  4OLB A;  1RDA A;  2X6N A;  1D5A A;  2B6A A;  1L5U A;  3THV A;  2RKI A;  1KRP A;  3T3F A;  4M3U A;  1IO2 A;  3AO2 A;  1KLN A;  2DFH A;  1LWF A;  3OYC A;  4CFA A;  3NF7 A;  3H08 A;  3SV3 A;  1EET A;  1ASW A;  1B9F A;  4CFB A;  1TK8 A;  2PYJ A;  4YFU A;  4FLY A;  4DS5 A;  3L2Q A;  3UIQ A;  1VSJ A;  1JLC A;  2O4G A;  3RWU A;  5JS2 A;  1A5W A;  3EYZ A;  4NCA A;  1QE1 A;  4Q5V A;  1RTD A;  3SV4 A;  4KB0 A;  3TWH A;  4CJP A;  4JRQ A;  4B9S A;  1ASU A;  3LDS A;  3LWL A;  3QIP A;  3LWM A;  1BCM A;  5J2P A;  5C42 A;  3KLE A;  4CGD A;  1RT6 A;  4KRF A;  4M3T A;  4CJT A;  3AVC A;  3LP0 A;  3VQP A;  4CES A;  4DTO A;  2KZZ A;  1FK9 A;  3I0S A;  3C6U A;  4N76 A;  4N56 A;  4CHQ A;  3NCI A;  1VSD A;  3JSM A;  1RDB A;  1QSY A;  5HP1 A;  1VSH A;  4Y1C A;  4Y1D A;  3MXJ A;  3AA5 X;  3VQ5 A;  1TV6 A;  1HMV A;  3AVL A;  1Q9Y A;  3U3G A;  3DRR A;  4OKE A;  3OYM A;  1BCO A;  1SV5 A;  1S6Q A;  2XY8 A;  4FM0 A;  5C25 A;  4RW6 A;  4K8X A;  4KAZ A;  3V1O A;  2BDP A;  2I5J A;  3HPH A;  4FLX A;  1RT1 A;  4DFJ A;  4CHZ A;  2PZS A;  4GW6 A;  4O5B A;  4FYD A;  4DTJ A;  3V9S A;  1RBV A;  2PYL A;  4ID5 A;  1TK0 A;  4QOZ B;  2F8T A;  3S3O A;  1F21 A;  4CF9 A;  4DTX A;  3DI6 A;  3C6T A;  1JLE A;  4CJL A;  4KPY A;  3QNN A;  1S9G A;  3PO5 A;  5JS1 A;  4CEC A;  3SQ0 A;  3QLH A;  2OZM A;  4CGG A;  4E7J A;  1SL2 A;  4FLZ A;  1HPZ A;  3KKR A;  3V9U A;  3HYF A;  3OS1 A;  3QEX A;  4CJQ A;  4OKJ A;  3P5J A;  4H4M A;  3KK1 A;  1NJZ A;  1FXX A;  4CIG A;  4HVJ A;  4KI4 A;  2ETJ A;  3V4I A;  3ULD A;  2A1R A;  3EY1 A;  2IDO A;  4RW9 A;  2GBZ A;  3DOK A; 
#chains in the Genus database with same CATH topology
 3I55 N;  4LSN A;  1YJN N;  3BUZ B;  3HJF A;  4FO0 A;  3JAM O;  1NOY A;  1BGX T;  3KJV A;  1KVA A;  2QWO A;  3DOL A;  4C8M A;  3HZ6 A;  1X9J A;  4O0I A;  4I2P A;  3MEE A;  1DT9 A;  4DR6 K;  2HBK A;  5LJV A;  3LAL A;  4ICL A;  2QTD A;  3LDQ A;  5BRD A;  3M8Q A;  2FBY A;  3AVI A;  4JN4 A;  3ZSX A;  2UXB K;  1NU0 A;  4A2A A;  1W2B M;  2OCE A;  1KFS A;  3O4N A;  2Z1I A;  4PKH A;  1QQC A;  3PUF A;  1NGG A;  3M8S A;  3KLF A;  4FZX C;  4BC4 A;  3KLI A;  3OBW A;  3E1Y A;  1NKB A;  4M3X A;  1TAQ A;  1W7A A;  3ZSZ A;  3VQ4 A;  3WEE A;  1NK6 A;  4CGI A;  3OW2 M;  4O0J A;  5GAG P;  1RCH A;  2ZF5 O;  5EXW A;  2Z1G A;  3F2K A;  4CGH A;  1KC8 O;  1SL1 A;  1N34 K;  3AVM A;  2Q0U A;  1Q82 O;  4DTM A;  3AO4 A;  3SBG A;  3OYI A;  1WOQ A;  4K25 A;  1J53 A;  1H1V A;  3QEP A;  3DLR A;  3ZCM A;  1LAW A;  4JHD B;  2P9S A;  1JXE A;  4BC5 A;  1RTJ A;  2YHA A;  1JJ2 M;  1N6Q A;  5GIN A;  3LM9 A;  3KD1 E;  3TAF A;  2NRH A;  4CI6 A;  5BPM A;  4DSK A;  3NGZ A;  5HRS A;  3WT0 A;  1Q18 A;  3MK6 A;  3VF4 A;  3VTI A;  1NGE A;  3AO1 A;  5EY4 A;  5KQ8 A;  3QDK A;  2YI1 A;  3L3V A;  1RBS A;  4DTS A;  4OGC A;  1T03 A;  2KW4 A;  4BRN A;  4H8K A;  2P9K A;  3BF1 A;  4GKK K;  3SCX A;  3O9S A;  5FPE A;  4RW8 A;  5AFU H;  3VF2 A;  4DV5 K;  4X65 K;  1JKH A;  2HBM A;  1U4B A;  4M7X A;  3GDQ A;  5AZI B;  3MXM A;  2OYQ A;  5CYM A;  2XHB A;  3NBP A;  2VQF K;  1VQL N;  3O9U A;  3AVH A;  4FK4 A;  1RT2 A;  3E9L A;  3RR8 A;  2B4J A;  3DMJ A;  4KHN A;  4M41 A;  4HWI A;  4FCY A;  1QHT A;  3LAN A;  1HYS A;  3LAM A;  3OYK A;  3MED A;  4CHN A;  3THW A;  2KTQ A;  1S72 N;  2O4I A;  2QWP A;  4E7K A;  3VEV A;  3VQA A;  4FJN A;  3ATV A;  4H5N A;  4B3R K;  1S1T A;  1E4F T;  4FWR A;  1VQP N;  4I9Q A;  3QEI A;  1BU6 O;  1J9A A;  2G8I A;  3ZX2 A;  4CHP A;  4Z4C A;  5IT9 O;  5AQL A;  4FWQ A;  4DU3 A;  2RPI A;  1N5Y A;  1HNX K;  2QEX N;  4B9L A;  4FJ7 A;  3E9P A;  2VCP A;  1ZBU A;  2E4L A;  3WNE A;  3MX5 A;  3L2R A;  3J7A P;  2IGI A;  3T1Y K;  4KB1 A;  4B1Y B;  4CJW A;  1WNS A;  1ZYQ A;  3LPT A;  4FJ8 A;  3DWL A;  1YF5 L;  3P83 D;  2YNI A;  1Q81 O;  4F3O A;  1Y97 A;  4IEE A;  4B3O A;  3FFK B;  4PKI A;  3LP2 A;  2GEL A;  3H46 O;  3UKR A;  3RVC A;  5AFU A;  2ZE2 A;  3DM2 A;  3PIP L;  3U3Y A;  1NM1 A;  3HVR A;  3CFP A;  2Y1I A;  4E7L A;  3WNF A;  4KTZ A;  4F2S A;  3NF8 A;  2UXC K;  1ATN A;  4DR7 K;  2FF6 A;  3SJJ A;  3NF9 A;  4H5R A;  4DCH A;  2D0A A;  5JLH A;  4FLT A;  2PY5 A;  3SYZ A;  1JCF A;  1YTA A;  2QXF A;  3MWT A;  1SKS A;  3AY9 A;  3PO4 A;  4Z4E A;  1A5V A;  4BC3 A;  4CZF A;  5I9E B;  1XMO K;  1LW2 A;  2IIR A;  3OJU A;  4CZJ A;  4WF9 L;  1S1X A;  4DV6 K;  4G9Z A;  4AHR A;  4F4K A;  5AQX A;  2V52 B;  3K2P A;  1QVF M;  3HP6 A;  3WXL A;  1T44 A;  3ASM A;  3CCU N;  3SAG A;  3OYB A;  4RCH A;  1X1P A;  4GMJ B;  1RT4 A;  4DU4 A;  3WXJ A;  3VA3 A;  3ZT0 A;  3AGK A;  1BIU A;  4CE9 A;  3QBX A;  3MEG A;  5F0X A;  2VWB A;  2P9S B;  2FXU A;  3BEX A;  4CHO A;  3VMF B;  3I0R A;  4B9U A;  1Z25 A;  3VA0 A;  5M1Q A;  3L2U A;  5LMN K;  3CER A;  3TSQ A;  3MEC A;  5F2R A;  4JI5 K;  4XH1 A;  1IKW A;  1YVN A;  3AVB A;  3CCJ N;  1HX1 A;  3HPO A;  1HUX A;  4NCB A;  3B8A X;  3LP3 A;  2XY7 A;  4ELT A;  3I8B A;  3ITH A;  3UKU A;  4DUZ K;  4NXN K;  1ITG A;  3AVG A;  3DXK B;  3OJS A;  3LPU A;  4RTF D;  1TKT A;  3AA3 A;  2P9K B;  4JKA A;  4YOW A;  4GV3 A;  3D45 A;  2E6M A;  3H3O B;  1X9S A;  1REV A;  3K57 A;  1MU2 A;  4AM6 A;  2CH6 A;  1CXU A;  5H1S Q;  3MX2 A;  4KTW A;  2ITG A;  2A5X A;  4CJ3 A;  2O8B A;  2P5G A;  2QWN A;  3ZET A;  3HM9 A;  3U6F A;  3IFR A;  1KAZ A;  4MQ3 A;  2P9P A;  4KH4 A;  2QKK A;  4C1N I;  2VYP A;  3G71 N;  1W9H A;  4YOU A;  4C23 A;  1WLJ A;  4OLA A;  2CGK A;  3O3F A;  1TYQ A;  1QQN A;  1ZXO A;  4Z4H A;  4FJK A;  1K8A O;  3HOT A;  4DQQ A;  1K8K A;  1WSF A;  4QAG A;  1TL1 A;  1WSJ A;  3RSE B;  5E84 A;  4MO4 A;  2NRR A;  3LDP A;  4UQG A;  2F8S A;  1XHZ A;  4JS5 A;  3D2E B;  2VGM A;  1HPM A;  5GIO A;  2ZD1 A;  2BH1 A;  3U4L A;  3IMX A;  1BA0 A;  2F7T A;  1FKP A;  3WXM B;  2A3Z A;  1TUY A;  5BRE A;  1D9F A;  2Q31 A;  3VQ8 A;  4B08 A;  1JL1 A;  4DV7 K;  4C8N A;  3OHR A;  2NNW A;  2VWJ A;  3FFI A;  1KLM A;  4FM2 A;  4JI4 K;  1RTI A;  4PL8 A;  3H45 C;  5AQZ A;  4MFB A;  5FLX O;  3C7N A;  1SUQ A;  1K6Y A;  1WN7 A;  3DLG A;  3O08 A;  2V7Z A;  4CF8 A;  4HCB A;  5EVZ A;  5I42 A;  3MN5 A;  3THV A;  1KLN A;  1LWF A;  1SZ2 A;  3NF7 A;  1BO5 O;  1ASW A;  4JI3 K;  5GIP A;  1SAZ A;  1QE1 A;  4Q5V A;  3SV4 A;  3TWH A;  1RFQ A;  4CJP A;  2CGL A;  2E2P A;  4JKF A;  3A5O C;  3QIP A;  3LWM A;  4OX9 K;  4KRF A;  3EE9 A;  3HBT A;  4DTO A;  3THY B;  3VER A;  3C6U A;  4BQZ A;  4AM7 A;  2QWM A;  4LF6 K;  3T1H K;  1RDB A;  2QWR A;  1QSY A;  3H3N O;  4BRO A;  1C0F A;  5AQK A;  4Y1C A;  4M3W A;  3VQ5 A;  3U3G A;  2XY8 A;  5C25 A;  4FWO A;  4LFB K;  4RW6 A;  3FZF A;  3HPH A;  4FLX A;  4DFJ A;  4LFA K;  4CHZ A;  4O5B A;  4DTJ A;  3TSU A;  2E20 A;  3GE1 A;  3S3O A;  3DI6 A;  3C6T A;  5AQQ A;  4CJL A;  3BY5 A;  3H1Q A;  3QNN A;  1GLC G;  2OZM A;  3SQ0 A;  3QLH A;  4E7J A;  4JKD A;  1SL2 A;  5AQP A;  3KKR A;  3OS1 A;  4RWT A;  4FWN A;  3WUH A;  4CJQ A;  4OKJ A;  4JI7 K;  4BR4 A;  3A5L C;  3CJ7 A;  3KK1 A;  1FXX A;  4HVJ A;  2A1R A;  4JAX A;  3C0B A;  4CW7 B;  2V51 B;  3EY1 A;  3SQ2 A;  3C95 A;  3GG4 A;  3IG1 A;  4ISG A;  3ULE A;  5T7B A;  1DEJ A;  3KK7 A;  3K9K A;  3T69 A;  3SAF A;  3HK2 A;  4CZL A;  4CBX A;  2P1J A;  4B8A B;  4DTN A;  5AZJ A;  1HKC A;  1VRU A;  4CJU A;  3RMA A;  3PY8 A;  4KHU A;  4X64 K;  3LDL A;  5DM6 L;  1IG9 A;  3R6M A;  1K9M O;  5K14 A;  4AQY K;  5C2F A;  5M1F A;  1VQ4 N;  4JHD A;  2OPQ A;  4DFM A;  1WB9 A;  3UKU B;  4FXD A;  2YNF A;  4GVM A;  3BGR A;  4CEE A;  3V6D A;  1RDC A;  1QVG M;  3ZSV A;  1HNV A;  3R8E A;  4GY2 B;  4JLH A;  1NOZ A;  5SZT A;  4RW4 A;  4IFE A;  1U04 A;  4UY8 O;  5BPN A;  3MXI A;  4C8O A;  1DTT A;  1XC9 A;  3NVK A;  4CVN E;  3CQ8 A;  2XY6 A;  2FF3 B;  3L4I A;  2O8B B;  3AVA A;  2PFU A;  4BRC A;  1YHQ N;  1KVC A;  4PA1 A;  1RIL A;  5KPZ A;  3NH1 A;  5KPT A;  1NGJ A;  1Q9X A;  2FSJ A;  2O8C B;  1GLB G;  4CJE A;  1YT3 A;  5C24 A;  1FJG K;  3HP9 A;  2P9P B;  1ZBL A;  1IG8 A;  1L3V A;  4IG0 A;  3L8B A;  1X3N A;  4B1Z A;  1GOC A;  1M90 O;  4ELU A;  1IKX A;  4LD0 A;  3DAW A;  1RDW X;  2NRV A;  4WYB A;  4O8K A;  2WC9 A;  1P8Z A;  3SI6 A;  3TAP A;  4B3S K;  3V1Q A;  3CF5 L;  1WSG A;  1S1U A;  1K8K B;  2OPR A;  5CYQ A;  2BAN A;  3O9Q A;  2DY4 A;  2RE2 A;  1NKC A;  5E26 A;  3DJC A;  1IBM K;  4BRE A;  4K8Z A;  1E3M A;  4X66 K;  4DB3 A;  1WBD A;  4FJJ A;  4M3Y A;  5AQH A;  2HHQ A;  4I7F A;  3LM2 A;  2WBN A;  4AF1 A;  2ZGY A;  1M1K O;  3QEW A;  2X74 A;  3SK3 A;  1NMD A;  3CC4 N;  2F9T A;  2YJF A;  3S3N A;  2G8H A;  4YOT A;  5BR8 K;  1RBT A;  1VRT A;  1NK5 A;  3VGL A;  1YUW A;  1BOT O;  1NK9 A;  3VGM A;  4FK2 A;  3OA9 A;  1GOB A;  3EN9 A;  3TAG A;  1W97 L;  1LWC A;  1R0A A;  1KVB A;  1U45 A;  1BDG A;  4CER A;  3TTC A;  1HNW K;  4CIF A;  3K0S A;  4EZ9 A;  3QES A;  1D8Y A;  4BE1 A;  1ESV A;  4BDP A;  2P9L A;  1WAF A;  4F8R A;  4U67 L;  2HF4 A;  5DM7 L;  2BUP A;  4JKE A;  3TR8 A;  1D9D A;  4CHY A;  3T7Z A;  3VQQ A;  4NLC A;  3CPE A;  2FSN A;  2O8D B;  3KKS A;  4FOI A;  3IUC A;  1JL2 A;  2J4R A;  4YDU A;  3VN5 A;  3FZK A;  1ZC6 A;  3RMB A;  1ZBF A;  4J2E A;  2G8U A;  2CGJ A;  5FPN A;  2GX9 A;  3G6E N;  1ZBS A;  5AQG A;  3B6P A;  1TKZ A;  1JCG A;  4QS9 A;  4WFB L;  3CCV N;  3UE5 A;  5AQV A;  5KGX A;  1BWF O;  3EE8 A;  4FK0 A;  3J80 O;  3CQX A;  3D7E O;  3QIO A;  3ULE B;  3NH0 A;  2P9N A;  3OS0 A;  4HTU A;  1NK4 A;  2DFE A;  4XH5 A;  3HT3 A;  4IFV A;  1N33 K;  4WQ5 A;  1WSE A;  2XRI A;  5AZJ B;  3CJB A;  2F4V K;  1TGO A;  3HRG A;  3HTV A;  2HHW A;  3VTH A;  1LW0 A;  3SUN A;  4C8K A;  3FGU A;  5BR9 A;  1GOA A;  3NH2 A;  1ZBI A;  1EWQ A;  3CC7 N;  1ATS A;  1S1V A;  2OPS A;  5M1P A;  4EIA A;  3CD6 N;  5HRN A;  2HBJ A;  2HND A;  5JIC A;  2BE2 A;  4YHH K;  4CCH A;  5FPM A;  3KIO A;  4BRM A;  4FWP A;  1G15 A;  5JVG L;  4CZE A;  4DV0 K;  4OO1 J;  3HVT A;  4JKH A;  3BZC A;  3DXK A;  1FKO A;  3VEY A;  4DQS A;  2OA8 A;  4FVU A;  1NLV A;  4BRH A;  1T8E A;  2KFN A;  4KBO A;  1VSL A;  3ZT1 A;  4W5N A;  4BRQ A;  3NMU A;  4KFB A;  2DTU A;  4XIU A;  2OAN A;  3O9T A;  3TTD A;  3QO9 A;  4YOR A;  1MWK A;  4FW2 A;  1KCF A;  4DV3 K;  4BDZ A;  4DR1 K;  2F9W A;  3PV8 A;  3CC2 N;  5FRO A;  3QBW A;  3VEO A;  4E7H A;  2ASM A;  3VGK A;  2HHT A;  1BQM A;  3HI0 A;  1QQM A;  4L3Q A;  2YHX A;  3DYA A;  4LSL A;  3QFU A;  1IBL K;  4CD3 A;  3RSE A;  4DTP A;  1KAX A;  4EP4 A;  3MCP A;  3IRX A;  3O4Q A;  3QEV A;  4AH9 A;  2A1S A;  3K5M A;  5KPR A;  4PKG A;  5LL6 Z;  1TL3 A;  4IEI A;  3D2E A;  1RBU A;  1XWL A;  4BVP A;  3TAR A;  1C1C A;  3OY9 A;  1CXQ A;  2IOC A;  1NGF A;  4DSL A;  4I9L A;  4OJR A;  4KTQ A;  1IBK K;  4ELV A;  4CK2 A;  4K43 A;  4A62 A;  4E1M A;  5GAE P;  1Q86 O;  5LY3 A;  4B3T K;  3OYG A;  5LMU K;  3E9O A;  4CK3 A;  3CJC A;  3R9P A;  2HHS A;  1Z05 A;  1B9D A;  5IWA K;  4JYA K;  3NGY A;  4OGE A;  5FRM A;  5AQO A;  2UYT A;  4CBU A;  3SUO A;  3M8R A;  1D4X A;  3E66 A;  1GLE G;  2QWL A;  4DSE A;  3H1V X;  2P9L B;  1XMQ K;  4IWV A;  4J2A A;  3ZT2 A;  4DQI A;  4EP5 A;  2E5L K;  4CJK A;  3QML A;  2IS3 A;  4LFC K;  3M3Z A;  3VEW A;  1VQN N;  1CZB A;  2G8F A;  5AQN A;  5JVH L;  1VHX A;  1YAG A;  3L3U A;  1V4S A;  4W5T A;  1UA1 A;  3FZL A;  1T6C A;  1NWK A;  2ASO A;  3S41 A;  2GEM A;  2Q0R A;  4CEQ A;  3ALY A;  4E1N A;  3RMC A;  3THY A;  4F2R A;  3DLK A;  2I7P A;  4DV1 K;  4B9N A;  3F9M A;  3QNO A;  3FZM A;  3VQE A;  1U6Z A;  5BRF A;  2GV9 A;  3VET A;  3OYN A;  4EFH A;  3VEX A;  4K41 A;  3JXU A;  4BRK A;  3M6G A;  1L3T A;  3TTF A;  3TAB A;  4G1Q A;  1VAZ A;  4FLW A;  2IVO A;  2E1Z A;  4CFD A;  4C1N K;  4X62 K;  2P9N B;  1SQK A;  1I39 A;  4OLB A;  3U9Z A;  2WUS A;  2B6A A;  2RKI A;  3T3F A;  1IO2 A;  3AO2 A;  2OTJ N;  2DFH A;  3ENO A;  4EHU A;  1EET A;  1TK8 A;  1B9F A;  4Z4F A;  4YFU A;  3L2Q A;  3ZLJ A;  1VSJ A;  4A2B A;  4ILH A;  5CE3 A;  3ZX0 A;  4JRQ A;  4FWS A;  4FWM A;  1BCM A;  4NXM K;  5J2P A;  3TPQ A;  4CJT A;  3AVC A;  4CES A;  3VQP A;  1FK9 A;  3I0S A;  3M1F A;  3NCI A;  2WFB A;  5HP1 A;  2P9U B;  3C6H A;  3MXJ A;  4JKB A;  1Q9Y A;  3WXI A;  1XUP O;  1SV5 A;  1EQY A;  3V1O A;  3ZEU A;  5AQR A;  3ZYY X;  2YX6 A;  2QA4 N;  3V9S A;  2PYL A;  4ID5 A;  3ENB A;  1F21 A;  1JLE A;  3ATU A;  3CXC M;  4KPY A;  1S9G A;  3PO5 A;  5ADX H;  3QEX A;  3P5J A;  3EO3 A;  4KI4 A;  2ETJ A;  3V4I A;  4HTL A;  2IDO A;  4RW9 A;  2D0P A;  1S5J A;  5AQT A;  4B1U B;  3K5L A;  3CCQ N;  1SL0 A;  3AO5 A;  2RF2 A;  1MWM A;  3NAE A;  3PLA A;  2O8C A;  3AA4 A;  1SKW A;  4Z0U A;  4JRP A;  1NNE A;  1Z26 A;  1XNR K;  3TU5 A;  3FZH A;  4HUE A;  1JLG A;  4M42 A;  1DTQ A;  4IJA A;  4BRP A;  1HR0 K;  3ISN C;  1HYV A;  3QIC A;  4H5W A;  4CK1 A;  3NDK A;  4B8C A;  1GLA G;  4RG8 A;  4EZ6 A;  5TKW A;  3UB5 A;  1OH5 A;  5GAD P;  2NRT A;  4CZG A;  4WQ4 A;  4FZZ A;  5KQD A;  1RDU A;  3THX B;  4O4G A;  1QSL A;  3CCL N;  3G25 A;  1NK8 A;  3JS6 A;  3J81 O;  4H4O A;  4KI6 A;  2H3G X;  3NGI A;  3V9Z A;  3CM5 A;  5D3G A;  3HSC A;  1QHA A;  4N47 A;  3DRS A;  3AVK A;  4QCL A;  3RRG A;  4BR0 A;  1T3V A;  2HVI A;  3LZI A;  2I7N A;  1HJR A;  5HOO A;  1X9W A;  4BR7 A;  4LH4 A;  2ZJR L;  2HW3 A;  1KAY A;  4CJ7 A;  3TAE A;  3DRP A;  2D4W A;  4CEZ A;  1NGB A;  4IO8 A;  2G8V A;  4EHT A;  3OYF A;  3QIN A;  1C6V A;  4YOX A;  4BWJ A;  3L2V A;  5J1E A;  4IFY A;  3C6A A;  1GLJ O;  3VOV A;  1NK0 A;  1QS4 A;  1NGC A;  2P9I B;  4BGB A;  1X3M A;  1RDD A;  2HB5 A;  2YNH A;  3OYA A;  4CF0 A;  1NJY A;  4ZHR A;  4MO5 A;  1YI2 N;  3OYJ A;  4B9T A;  1MDU B;  3QER A;  4HCC A;  4DG1 A;  2O8D A;  4CJR A;  3SQ1 A;  5AQI A;  3HM8 A;  1C1B A;  4H0X B;  4YY3 K;  3CFO A;  1KXP A;  2W6L A;  1IH7 A;  4F9O A;  3H6E A;  4IJN A;  4O44 A;  1VSF A;  3S3M A;  1X9M A;  4JK7 A;  3IKM A;  4IDH A;  4TSX A;  4H0V B;  4CF2 A;  3I33 A;  3W3D A;  2HHH K;  1NG9 A;  1EX4 A;  1KFD A;  5EX5 A;  3HXM A;  1CZA N;  2FBX A;  4KHY A;  3VQ6 A;  1R59 O;  1TK5 A;  1LV5 A;  4CZI A;  1HJO A;  1Q7Y O;  5AQY A;  5M1O A;  2DPN A;  3G4S N;  3GOI A;  3BF3 A;  4JK8 A;  3T19 A;  1VSE A;  2ATQ A;  2KHO A;  3CFR A;  2GWJ A;  4FPA A;  4OPK A;  2F96 A;  1T6D A;  4DR4 K;  4L8R B;  1J5O A;  1RBR A;  2UU9 K;  3OYH A;  2W42 A;  3KTQ A;  3ZEU B;  2YKM A;  4QS8 A;  4H0O A;  1VSI A;  1BUP A;  5CZ1 A;  4YNQ A;  3RMD A;  3L0Q A;  4YOY A;  4E7I A;  3AA2 A;  5F1X A;  2E1Y A;  1ZBH A;  4CEA A;  3LL3 A;  3PX0 A;  3TAM A;  5FPD A;  3V9W A;  4DSJ A;  1LCU A;  5BRH A;  3GL1 A;  1XI1 A;  4W5Q A;  3MAQ A;  2JLE A;  4CED A;  4HHT A;  4OPJ A;  3HOS A;  2HHU A;  4OVL A;  5BN9 A;  5EU7 A;  2NLX A;  1J6Z A;  2YV0 X;  4WQ4 C;  1I94 K;  2QW9 A;  4DFP A;  1OH7 A;  3CJA A;  5AR0 A;  3L4Q A;  4IXC A;  3CPW M;  1HKB A;  3A2F A;  3GBT A;  1JLQ A;  5AQF A;  4KH5 A;  4IDK A;  2HMI A;  3TSP A;  2QKB A;  1O1W A;  1S22 A;  4CJS A;  5B8H A;  4LH5 A;  2QK9 A;  2YCH A;  1VQO N;  2FBT A;  3KK2 A;  3L6Q A;  2WOM A;  4NYN A;  5SWM A;  4IKF A;  4LC9 B;  4OPH A;  1IKY A;  4H0Y B;  3DLL L;  3VQD A;  2VG5 A;  3VQ9 A;  1S9E A;  4H5V A;  2E6L A;  1VQ7 N;  3IAY A;  1OH8 A;  3O4W A;  2IAJ A;  4A57 A;  3QFP A;  2WTU A;  4DSI A;  3D6R A;  1U49 A;  1EKE A;  2NUB A;  4IBN A;  5LJW A;  4K0K K;  1WSH A;  4PUO A;  3DLE A;  1NMN A;  1XHX A;  3OYD A;  1RTH A;  4IG3 A;  4E89 A;  5J2N A;  3NVM A;  4BAC A;  3TI0 A;  4FOE A;  4PWD A;  3O3H A;  4N5S A;  4DWI A;  4M3Z A;  1NGI A;  2BTF A;  2LSN A;  2XY5 A;  4DQP A;  5KI6 A;  4FSV A;  2P5O A;  3CIP A;  1XQS C;  2Q36 A;  3KHY A;  3MN7 A;  3ID8 A;  4CF1 A;  4O5F A;  4W5R A;  3SPY A;  4JI0 K;  4B3M K;  5AQM A;  4WFN L;  2VG7 A;  4XH4 A;  5BPL A;  2EX3 A;  2O8F B;  4JI1 K;  2GUP A;  4RW7 A;  3P38 A;  1JXB A;  2VG6 A;  3TAQ A;  4JKG B;  1JLF A;  4JD2 A;  1P90 A;  1GLD G;  3O1W A;  1TAU A;  4DR5 K;  3RTV A;  1YIJ N;  3DLB A;  4FLU A;  4O8U A;  1NJX A;  4QS7 A;  3J8A A;  3S9H A;  3SLC A;  3AAP A;  2EWS A;  3ENH A;  3J7Z O;  3EEQ A;  4JI8 K;  2PAV A;  1TVR A;  4DSF A;  1VQ5 N;  1RT7 A;  4DMN A;  4DV4 K;  3K59 A;  3KZB A;  4E3S A;  4DUY K;  4PQU A;  3A5N C;  2ZQB A;  4KHW A;  3ZT3 A;  3P1G A;  3PX4 A;  4DR3 K;  2KFZ A;  2HF3 A;  3ZSO A;  1QTM A;  3E01 A;  1BA1 A;  2ZM6 K;  2YHB A;  1BG3 A;  3O80 A;  3AVN A;  5DK5 A;  3VQB A;  1EXQ A;  1O13 A;  1N32 K;  4B1X B;  4E0D A;  2YKN A;  3M5R A;  4FJH A;  1J54 A;  4OKK A;  2R7Y A;  4BG8 A;  2W6K A;  3LAK A;  4CZM A;  2Q2R A;  4A59 A;  5CHI A;  5KTQ A;  4N41 A;  2YNG A;  4JI2 K;  4ZTJ A;  1T7P A;  2G8K A;  2A42 A;  4FJM A;  5FDL A;  4HUG A;  4R5P A;  4W5O A;  2Z1J A;  3KLG A;  3D0P A;  1HRH A;  3VEZ A;  1C0G A;  2P9U A;  2WON A;  4Z94 A;  4E19 A;  1NJW A;  2AA4 A;  3L2W A;  4B9V A;  3G10 A;  4Z4G A;  2D0O A;  3SZ2 A;  4DTU A;  2GUI A;  1WUA A;  3ZT4 A;  3CHW A;  4BE0 A;  1XNQ K;  5HLF A;  3SJH A;  1BIZ A;  4NLB A;  3KK3 A;  4DKW A;  4DQ8 A;  1RDA A;  1D5A A;  1L5U A;  3CCS N;  5AQU A;  4M3U A;  2NRX A;  3OYC A;  4CFA A;  3SV3 A;  3H08 A;  2PYJ A;  3EZW A;  3RWU A;  1JLC A;  3SAH A;  1A5W A;  3EYZ A;  4NCA A;  3OTO K;  4V19 S;  3CCR N;  4B9S A;  2UUC K;  4H5T A;  3LDS A;  3J7Y P;  3LWL A;  1EO1 A;  4CGD A;  1HKG A;  4M3T A;  2KZZ A;  3LP0 A;  2CH5 A;  4B1V A;  5AQW A;  1OVQ A;  4N76 A;  4OPA A;  1VSH A;  2JWK A;  1J5E K;  5M1N A;  1TV6 A;  2UUA K;  1V4T A;  3DRR A;  3OYM A;  1BCO A;  2QM1 A;  4FM0 A;  4KHP K;  4KAZ A;  4DV2 K;  2BDP A;  1RT1 A;  2E8A A;  4GW6 A;  4FYD A;  1RBV A;  4QOZ B;  2NRZ A;  3N4Q A;  3W0L A;  2ZJQ L;  1XC3 A;  2O8E B;  4DTX A;  5AQJ A;  5JS1 A;  4CEC A;  3VF6 A;  3P4I A;  1OH6 A;  3V9U A;  3WQT A;  3THX A;  5EOY A;  2HBL A;  3ULD A;  4GV6 A;  3SUP A;  4BQL A;  3NFA A;  1KTQ A;  2E2Q A;  3F5T A;  3DXM B;  4J8F A;  5C0Y A;  4DU1 A;  1C0U A;  4LF8 K;  4BC2 A;  4IOX A;  1BI4 A;  4FM1 A;  3O9R A;  4JKC A;  1DGK N;  1HNI A;  4BRI A;  3OYL A;  4JS4 A;  5J2M A;  3T1A A;  3PSI A;  3SQ4 A;  2PBD A;  4B9M A;  2OTL N;  5ELZ A;  3BDP A;  3CI5 A;  5A2Q O;  4J2D A;  1ILY A;  1YJ9 N;  4Z4I A;  4KH6 A;  5AJ3 K;  4NCG A;  4YDU C;  1C1A A;  5HRO A;  1QSS A;  4AIL C;  5C2D A;  5HBM A;  4DS4 A;  3O5B A;  1HYZ A;  4A61 A;  1DLO A;  3IDH A;  5JMV A;  3M8P A;  3NE6 A;  4O55 A;  3AO3 A;  1EP4 A;  4U7B A;  4CJF A;  4A5B A;  1WAJ A;  3AAQ A;  3D2F B;  2A6A A;  3VEN A;  2P9I A;  2KLA A;  3CET A;  2QI2 A;  4JD2 B;  4B9Q A;  3ID6 A;  1LOT B;  2HHV A;  2Q97 A;  4CIE A;  3WXK A;  3ZSQ A;  3ZSR A;  3CMA N;  3KD5 E;  1UAX A;  3QET A;  3P39 A;  1NK7 A;  5HRR A;  2FLO A;  3OVN A;  2KKZ A;  1N36 K;  4MLE A;  2P51 A;  4WQ5 C;  4CJV A;  4PL7 A;  2X78 A;  1YJW N;  4M63 C;  2G8W A;  1BHL A;  1UA0 A;  4FJ9 A;  4FL9 A;  1B92 A;  4CGF A;  1OVY A;  3SMP A;  1Z6R A;  4BWM A;  2HST A;  1NGH A;  1QZ5 A;  4ID1 A;  5JLF A;  4BY9 C;  2D5R A;  4M45 A;  2YHY A;  3F73 A;  4AHC A;  4IZ9 A;  1I3A A;  3CCM N;  3K58 A;  3KVG A;  3JYT A;  1SKR A;  4GKJ K;  3C65 A;  3WEE B;  2Q3S A;  1BIS A;  2RN2 A;  1N8R O;  3Q7B A;  3I56 N;  5J2Q A;  1VQ9 N;  4CFC A;  4I6M A;  2D0B A;  4EAH D;  2EHG A;  2X6S A;  3O8M A;  3VPZ A;  2OZS A;  1KSP A;  1VK0 A;  4H0T B;  3HL8 A;  4H0P A;  4KKO A;  4KHQ A;  4CZK A;  3EKS A;  1L3S A;  4KV8 A;  3SUQ A;  1CLQ A;  1VQK N;  3KLH A;  3NHG A;  4FWL A;  4CEB A;  4CZH A;  3CME N;  3PSF A;  1QQO A;  1IKV A;  3MWP A;  2E2O A;  2W40 A;  3EKU A;  1RT3 A;  1S1W A;  2A41 A;  2GTD A;  5I3U A;  2W41 A;  3AAR A;  2IVN A;  3A8Y A;  4LF9 K;  4IOC L;  3ZX3 A;  3I8D A;  3VES A;  4FPB A;  3V81 A;  3K5N A;  5MLC Q;  4DF8 A;  4M7Y A;  3CQY A;  3P31 A;  1E4G T;  1UOC A;  4FJX A;  1NJI O;  4BRA A;  1U2V A;  1TUU A;  2ASP A;  2Z1H A;  3CM6 A;  3DLH A;  3LDN A;  4NB4 A;  4JK9 A;  4KHS A;  1YVU A;  2VWK A;  4LY7 A;  3CCE N;  1CZ9 A;  3KWG A;  4BVO A;  4JNE A;  2KZM A;  3OS2 A;  1Y64 A;  1VQ6 N;  3HO1 A;  5C15 A;  3THW B;  4WE1 A;  1G99 A;  1JCE A;  4DTR A;  3LP1 A;  1Q8I A;  3CJ9 A;  3SPZ A;  3WNG A;  4K42 A;  1NKE A;  4KO0 A;  3BZK A;  4BR9 A;  4KRE A;  3PIO L;  4FZY A;  5CY4 A;  1BI4 B;  3NF6 A;  1UWB A;  1MA9 B;  3EZ5 A;  2XO7 A;  3R3L A;  4DQR A;  3AV9 A;  4BE2 A;  4DR2 K;  3RR7 A;  4CJ5 A;  4DHY A;  2Q1N A;  4FJI A;  5ADX A;  2V7Y A;  2JGU A;  1BL3 A;  3HPG A;  2HMP A;  4DFK A;  4FJG A;  2HVH A;  5CZ2 A;  5BN8 A;  3MMV A;  1ASV A;  4GVE A;  4H03 B;  5CR4 A;  4AHU A;  3AGR A;  3K5O A;  4PHT X;  1HLU A;  2FBV A;  5FRN A;  4GV9 A;  1OKJ A;  2UUB K;  4BG9 A;  1VQM N;  4BRG A;  1YTU A;  5TKY A;  4YOV A;  3UKR B;  1A5X A;  3A5M C;  1WSI A;  3V9X A;  1S6P A;  2NRW A;  1HNZ K;  5C12 A;  4CEO A;  3A0I X;  3C94 A;  2O8F A;  4J2B A;  4WFA L;  5HL7 L;  2IC3 A;  4M3R A;  1C0T A;  1VSK A;  3VQ7 A;  4E1J A;  1GLF O;  4JKG A;  5DMR A;  3WQU A;  4FVM A;  4FW1 A;  1VSM A;  3V1R A;  5KRS A;  4PY5 A;  2E2N A;  4XEI A;  3RRH A;  3D2F A;  1LAV A;  3SMS A;  4MDA A;  2VGN A;  4CGJ A;  2D1K A;  1BQN A;  4HUF A;  4DLE A;  1RT5 A;  3AVF A;  4BGA A;  1JLA A;  1L3U A;  2ITM A;  4I6M B;  3O3G A;  1EWR A;  1U48 A;  2B5J A;  5KRT A;  4LF5 K;  1W0H A;  2KQ2 A;  1U47 A;  4ZTF A;  5M1K A;  1RGI A;  4ILJ A;  3FR0 A;  1TKD A;  4ILG B;  3WNH A;  3OYE A;  3VQC A;  4BRL A;  5E41 A;  4BRF A;  1YXQ A;  2Y1J A;  1C0M A;  2DFF A;  3G0Z A;  2QWQ A;  4DF4 A;  3ZSW A;  3PX6 A;  4IO9 L;  3SBT A;  4CBW A;  2RHK A;  3MCA B;  4B1W B;  3TAN A;  3LZJ A;  2HOE A;  3FE1 A;  5GAH P;  2E88 A;  1KQS M;  3O1B A;  3KWI A;  4CEF A;  4AHV A;  1IV0 A;  3HST B;  3SNN A;  3F9K A;  3U8X A;  3B6O A;  4DLG A;  4FJ5 A;  2IVP A;  1WBB A;  3CYM A;  2HNY A;  4BDY A;  2D0C A;  1NBW A;  4F3T A;  2ZJP L;  2FC0 A;  1DKG D;  4AHS A;  3O6W A;  4NYF A;  3AVJ A;  1IJJ A;  1HQU A;  3EL2 A;  3CG7 A;  4C8L A;  2AJQ A;  2HNZ A;  1U2V B;  1T05 A;  1HQE A;  3LDO A;  1RNH A;  1NGA A;  3ZET B;  3IS9 A;  4I2Q A;  4Y0W A;  4Q0B A;  1JLB A;  2NZT A;  4AHT A;  2OPP A;  1FW6 A;  5C10 A;  2VQE K;  3ZSY A;  5HRP A;  1SS6 A;  2BGG A;  5AZI A;  4JEP A;  4FLV A;  3Q7C A;  1LWE A;  1NGD A;  5KGW A;  4FJL A;  1TYQ B;  4ISF A;  4LF7 K;  2HHX A;  3R1X A;  1KD1 O;  3N4P A;  2GWK A;  4CJ4 A;  4BRD A;  1TKX A;  2AP1 A;  3BP8 A;  4GNI A;  2O8E A;  2A40 A;  3FLC O;  3K9J A;  2X6N A;  2FSK A;  1KRP A;  2YHW A;  2ZWH A;  4A5A A;  2YJE A;  4CD1 A;  4CFB A;  4FLY A;  4DS5 A;  1GLL O;  3UIQ A;  4MDB A;  2O4G A;  4JI6 K;  5JS2 A;  1YIT N;  1RTD A;  3QB0 A;  4KB0 A;  4LF4 K;  1ASU A;  3DXM A;  2QXL A;  5C42 A;  3KLE A;  2JWL A;  1RT6 A;  3U9D A;  2UXD K;  4FWK A;  3MN9 A;  4IOA L;  4N56 A;  4CHQ A;  1ATR A;  1VSD A;  3JSM A;  2ZGZ A;  4R79 A;  4Y1D A;  3MN6 A;  3AA5 X;  1QZ6 A;  1HMV A;  3AVL A;  4OKE A;  1S6Q A;  4JV5 K;  1VQ8 N;  4K8X A;  1K73 O;  2I5J A;  3C7N B;  2PZS A;  1TK0 A;  3OBY A;  2F8T A;  4ISE A;  4BR2 A;  4CF9 A;  4BR5 A;  4NO7 A;  4CGG A;  4FLZ A;  1HPZ A;  1S3X A;  3HYF A;  4H4M A;  3MDQ A;  5AQS A;  3CJ1 A;  1NJZ A;  4CIG A;  4WCE L;  4MLH A;  2GBZ A;  3DOK A; 
#chains in the Genus database with same CATH homology
 4LSN A;  1KTQ A;  1S5J A;  3K5L A;  3HJF A;  3C95 A;  1SL0 A;  3AO5 A;  2RF2 A;  3IG1 A;  1NOY A;  1BGX T;  1C0U A;  5T7B A;  1KVA A;  3KJV A;  3NAE A;  4DU1 A;  3DOL A;  3AA4 A;  4C8M A;  4O0I A;  1SKW A;  4I2P A;  3MEE A;  4Z0U A;  3HK2 A;  4JRP A;  1BI4 A;  1Z26 A;  2P1J A;  4FM1 A;  4B8A B;  4DTN A;  3LAL A;  4ICL A;  4HUE A;  1JLG A;  1HNI A;  4M42 A;  1DTQ A;  3OYL A;  4JS4 A;  5J2M A;  1VRU A;  3T1A A;  3M8Q A;  3SQ4 A;  4CJU A;  2FBY A;  3ISN C;  3AVI A;  3ZSX A;  1HYV A;  3RMA A;  3PY8 A;  3BDP A;  4B9M A;  4J2A A;  4KHU A;  4CK1 A;  1IG9 A;  3NDK A;  4J2D A;  5K14 A;  1KFS A;  4B8C A;  3O4N A;  2OPQ A;  2Z1I A;  4RG8 A;  4Z4I A;  1QQC A;  4NCG A;  4DFM A;  4EZ6 A;  3PUF A;  3M8S A;  2YNF A;  4FXD A;  1C1A A;  3BGR A;  4GVM A;  4CEE A;  3KLF A;  3V6D A;  5HRO A;  4FZX C;  1QSS A;  1RDC A;  3KLI A;  4AIL C;  3ZSV A;  1HNV A;  4FZZ A;  1NKB A;  4JLH A;  4M3X A;  1NOZ A;  5HBM A;  5SZT A;  4RW4 A;  1U04 A;  1TAQ A;  4DS4 A;  1HYZ A;  3MXI A;  4C8O A;  4O4G A;  1DTT A;  1DLO A;  1QSL A;  1XC9 A;  3M8P A;  3NE6 A;  3ZSZ A;  4O55 A;  3AO3 A;  1EP4 A;  3VQ4 A;  1NK6 A;  4CGI A;  4CJF A;  3CQ8 A;  1NK8 A;  2XY6 A;  1WAJ A;  4O0J A;  4H4O A;  1RCH A;  3AVA A;  2Z1G A;  4CGH A;  1KVC A;  4PA1 A;  1RIL A;  3NGI A;  4KI6 A;  2HHV A;  3NH1 A;  4CIE A;  3V9Z A;  1SL1 A;  3CM5 A;  5D3G A;  1Q9X A;  3AVM A;  3ZSQ A;  4CJE A;  1YT3 A;  5C24 A;  3ZSR A;  3HP9 A;  3AO4 A;  4DTM A;  4N47 A;  3DRS A;  3AVK A;  3OYI A;  1ZBL A;  3KD5 E;  1UAX A;  1L3V A;  4QCL A;  3QET A;  4IG0 A;  3L8B A;  1NK7 A;  3RRG A;  5HRR A;  3OVN A;  1J53 A;  3QEP A;  2P51 A;  4CJV A;  2X78 A;  2G8W A;  2HVI A;  3LZI A;  1GOC A;  1HJR A;  1X9W A;  4ELU A;  1IKX A;  4LD0 A;  1BHL A;  1UA0 A;  3DLR A;  3ZCM A;  4LH4 A;  1B92 A;  1LAW A;  4CGF A;  4FJ9 A;  3SI6 A;  4BWM A;  3TAP A;  3V1Q A;  1JXE A;  1WSG A;  2HW3 A;  1S1U A;  4ID1 A;  1RTJ A;  2OPR A;  2YHA A;  3TAE A;  2D5R A;  2BAN A;  3DRP A;  5CYQ A;  4M45 A;  1N6Q A;  4CEZ A;  3KD1 E;  3TAF A;  2G8V A;  2DY4 A;  1NKC A;  3OYF A;  3F73 A;  3QIN A;  4AHC A;  1I3A A;  4DSK A;  3K58 A;  1C6V A;  3JYT A;  3NGZ A;  1SKR A;  5HRS A;  4K8Z A;  4BWJ A;  3L2V A;  5J1E A;  4IFY A;  4FJJ A;  2Q3S A;  4M3Y A;  1BIS A;  2RN2 A;  1NK0 A;  1QS4 A;  4Z4F A;  3SUP A;  2HHQ A;  5J2Q A;  4I7F A;  1RDD A;  2HB5 A;  3AO1 A;  2YNH A;  4CFC A;  4CF0 A;  3OYA A;  3QEW A;  3L3V A;  2D0B A;  1RBS A;  2X74 A;  4DTS A;  1NJY A;  2EHG A;  4OGC A;  2KW4 A;  1T03 A;  2X6S A;  4ZHR A;  4H8K A;  2OZS A;  3S3N A;  2G8H A;  1KSP A;  3OYJ A;  4B9T A;  1VK0 A;  3QER A;  3SCX A;  4HCC A;  4RW8 A;  4DG1 A;  3HL8 A;  1JKH A;  4CJR A;  1U4B A;  1RBT A;  3SQ1 A;  4KKO A;  1VRT A;  4KHQ A;  1NK5 A;  1L3S A;  4KV8 A;  3SUQ A;  1C1B A;  3MXM A;  2OYQ A;  5CYM A;  2XHB A;  3CFO A;  1IH7 A;  1CLQ A;  3NBP A;  3KLH A;  3NHG A;  4O44 A;  1NK9 A;  4FK2 A;  1VSF A;  3S3M A;  1X9M A;  1GOB A;  3AVH A;  4FK4 A;  1RT2 A;  4CEB A;  3TAG A;  3RR8 A;  4TSX A;  4CF2 A;  1IKV A;  1LWC A;  2B4J A;  3DMJ A;  4KHN A;  1R0A A;  1KVB A;  4M41 A;  4FCY A;  1U45 A;  1EX4 A;  1KFD A;  1QHT A;  3LAN A;  1HYS A;  1RT3 A;  3LAM A;  1S1W A;  4CER A;  3OYK A;  3HXM A;  2FBX A;  3MED A;  4CHN A;  4CIF A;  5I3U A;  4EZ9 A;  3QES A;  4KHY A;  2O4I A;  2KTQ A;  3VQ6 A;  1TK5 A;  1D8Y A;  4E7K A;  1LV5 A;  3VQA A;  4BE1 A;  4BDP A;  4FJN A;  1S1T A;  1WAF A;  4F8R A;  3I8D A;  4I9Q A;  3QEI A;  3T19 A;  1J9A A;  1VSE A;  3TR8 A;  3K5N A;  3V81 A;  4DF8 A;  1D9D A;  4CHY A;  2ATQ A;  3VQQ A;  3CFR A;  2G8I A;  4CHP A;  4Z4C A;  3KKS A;  4OPK A;  2F96 A;  1UOC A;  4FJX A;  1JL2 A;  4DU3 A;  2RPI A;  1N5Y A;  1J5O A;  4L8R B;  4B9L A;  1RBR A;  3OYH A;  3VN5 A;  4FJ7 A;  3CM6 A;  2Z1H A;  2W42 A;  3DLH A;  3KTQ A;  1ZBU A;  2YKM A;  2E4L A;  3WNE A;  1VSI A;  4KHS A;  4YNQ A;  1YVU A;  5CZ1 A;  2VWK A;  3RMB A;  1ZBF A;  4J2E A;  3L2R A;  4LY7 A;  2IGI A;  3RMD A;  4E7I A;  2G8U A;  3AA2 A;  4KB1 A;  1CZ9 A;  4CJW A;  1WNS A;  1ZBH A;  4CEA A;  1ZYQ A;  2KZM A;  3LPT A;  4FJ8 A;  3B6P A;  3OS2 A;  3P83 D;  3PX0 A;  2YNI A;  3HO1 A;  1TKZ A;  4WE1 A;  3TAM A;  5KGX A;  4F3O A;  3V9W A;  1Y97 A;  4DSJ A;  4FK0 A;  4B3O A;  4DTR A;  3LP1 A;  3LP2 A;  1Q8I A;  1XI1 A;  4W5Q A;  3SPZ A;  3MAQ A;  3WNG A;  2JLE A;  3QIO A;  3NH0 A;  3OS0 A;  4CED A;  4HTU A;  1NK4 A;  4HHT A;  1NKE A;  2ZE2 A;  2DFE A;  3DM2 A;  4KO0 A;  4KRE A;  3U3Y A;  4OPJ A;  3HT3 A;  2HHU A;  4FZY A;  4IFV A;  4OVL A;  1BI4 B;  5CY4 A;  3NF6 A;  3HVR A;  3CFP A;  2Y1I A;  1WSE A;  2XRI A;  5EU7 A;  3WNF A;  4E7L A;  4KTZ A;  4F2S A;  1UWB A;  2YV0 X;  3NF8 A;  1TGO A;  2HHW A;  1LW0 A;  3SUN A;  3EZ5 A;  2XO7 A;  4C8K A;  4DFP A;  4DQR A;  3AV9 A;  3SJJ A;  3NF9 A;  4BE2 A;  1GOA A;  3NH2 A;  3RR7 A;  4CJ5 A;  1ZBI A;  2D0A A;  4FJI A;  3A2F A;  4FLT A;  2PY5 A;  1S1V A;  1JLQ A;  2OPS A;  2JGU A;  1BL3 A;  3HPG A;  3SYZ A;  1YTA A;  2QXF A;  4IDK A;  4DFK A;  1SKS A;  4FJG A;  2HMI A;  3PO4 A;  2HVH A;  5CZ2 A;  5HRN A;  4Z4E A;  1A5V A;  2QKB A;  2HND A;  1O1W A;  1ASV A;  2BE2 A;  4AHU A;  4CCH A;  4CJS A;  3KIO A;  4LH5 A;  2QK9 A;  3K5O A;  1LW2 A;  2FBV A;  5FRN A;  3OJU A;  1S1X A;  2FBT A;  1G15 A;  3KK2 A;  2WOM A;  4AHR A;  1YTU A;  3HVT A;  4NYN A;  4F4K A;  5SWM A;  4IKF A;  1FKO A;  3K2P A;  1A5X A;  1IKY A;  1WSI A;  3VQD A;  2VG5 A;  1S6P A;  3ASM A;  3VQ9 A;  3OYB A;  3HP6 A;  3V9X A;  1S9E A;  4DQS A;  2OA8 A;  2E6L A;  4CEO A;  1X1P A;  4GMJ B;  3IAY A;  1RT4 A;  4DU4 A;  1T8E A;  3VA3 A;  2IAJ A;  3ZT0 A;  4M3W A;  2KFN A;  1BIU A;  4DSI A;  1VSL A;  3C94 A;  3ZT1 A;  4J2B A;  4CE9 A;  4W5N A;  1U49 A;  1EKE A;  2IC3 A;  2NUB A;  4IBN A;  4KFB A;  4M3R A;  2DTU A;  1WSH A;  4XIU A;  1C0T A;  1VSK A;  3DLE A;  4PUO A;  3MEG A;  3VQ7 A;  5DMR A;  1XHX A;  4FVM A;  1RTH A;  4FW1 A;  4IG3 A;  4CHO A;  4E89 A;  1VSM A;  3I0R A;  3OYD A;  3V1R A;  5J2N A;  3QO9 A;  5KRS A;  4BAC A;  3TI0 A;  1Z25 A;  4B9U A;  4PY5 A;  4PWD A;  3VA0 A;  3RRH A;  4FW2 A;  1KCF A;  3O3H A;  3L2U A;  4N5S A;  4BDZ A;  4DWI A;  1LAV A;  4M3Z A;  3PV8 A;  2LSN A;  4CGJ A;  5FRO A;  2XY5 A;  3MEC A;  4DQP A;  4E7H A;  5KI6 A;  1BQN A;  4HUF A;  2HHT A;  1IKW A;  3AVB A;  1BQM A;  3HPO A;  2P5O A;  4NCB A;  4DLE A;  3LP3 A;  3DYA A;  1RT5 A;  4LSL A;  3AVF A;  2XY7 A;  4ELT A;  3ITH A;  1JLA A;  1L3U A;  1ITG A;  3AVG A;  3O3G A;  3OJS A;  4EP4 A;  4DTP A;  1U48 A;  3IRX A;  3O4Q A;  2B5J A;  3QEV A;  5KRT A;  3SQ2 A;  1W0H A;  2KQ2 A;  3LPU A;  4CF1 A;  1TKT A;  3AA3 A;  4AH9 A;  4W5R A;  3SPY A;  2A1S A;  1U47 A;  3K5M A;  4ZTF A;  3D45 A;  2E6M A;  1X9S A;  1TL3 A;  1REV A;  1RBU A;  3K57 A;  2VG7 A;  1XWL A;  1TKD A;  3WNH A;  3TAR A;  1MU2 A;  3OYE A;  1C1C A;  2EX3 A;  1CXQ A;  3VQC A;  1CXU A;  2IOC A;  3OY9 A;  4DSL A;  5E41 A;  4I9L A;  4OJR A;  4KTW A;  2ITG A;  4KTQ A;  4ELV A;  4CK2 A;  4RW7 A;  2Y1J A;  1JXB A;  2VG6 A;  4CJ3 A;  1C0M A;  4E1M A;  3TAQ A;  1JLF A;  2DFF A;  3G0Z A;  4DF4 A;  2P5G A;  3OYG A;  1TAU A;  3ZSW A;  3U6F A;  3HM9 A;  3RTV A;  4CK3 A;  3PX6 A;  3DLB A;  4FLU A;  2HHS A;  1NJX A;  4MQ3 A;  2QKK A;  3S9H A;  3TAN A;  3LZJ A;  1B9D A;  1W9H A;  1WLJ A;  4OLA A;  3NGY A;  3O3F A;  4OGE A;  5FRM A;  3SUO A;  3M8R A;  4CEF A;  1TVR A;  4DSF A;  4AHV A;  1RT7 A;  4DMN A;  4Z4H A;  4FJK A;  3K59 A;  3HST B;  3SNN A;  4DSE A;  4E3S A;  4PQU A;  4DQQ A;  1WSF A;  2ZQB A;  1TL1 A;  1WSJ A;  3F9K A;  4QAG A;  3P1G A;  3ZT3 A;  3ZT2 A;  3B6O A;  4EP5 A;  3PX4 A;  4DQI A;  2KFZ A;  3ZSO A;  1QTM A;  4CJK A;  4DLG A;  3E01 A;  4FJ5 A;  2F8S A;  4UQG A;  3CYM A;  2YHB A;  2HNY A;  1XHZ A;  5DK5 A;  3VQB A;  3AVN A;  4JS5 A;  2D0C A;  4BDY A;  1EXQ A;  2IS3 A;  4E0D A;  4F3T A;  2YKN A;  2FC0 A;  1CZB A;  4AHS A;  2ZD1 A;  2G8F A;  4NYF A;  4FJH A;  3AVJ A;  1J54 A;  4OKK A;  1HQU A;  2R7Y A;  4C8L A;  3CG7 A;  3LAK A;  3L3U A;  2HNZ A;  1FKP A;  4W5T A;  1UA1 A;  2AJQ A;  5KTQ A;  1T05 A;  1HQE A;  2YNG A;  1RNH A;  4N41 A;  1D9F A;  4CEQ A;  3VQ8 A;  4ZTJ A;  4B08 A;  1T7P A;  3ALY A;  1JL1 A;  4E1N A;  3RMC A;  2G8K A;  4F2R A;  4FJM A;  5FDL A;  4HUG A;  3DLK A;  4R5P A;  4W5O A;  3IS9 A;  4C8N A;  2Z1J A;  4I2Q A;  3KLG A;  4Q0B A;  1JLB A;  3D0P A;  4AHT A;  4B9N A;  3QNO A;  1HRH A;  3VQE A;  2GV9 A;  2OPP A;  2WON A;  3OYN A;  2VWJ A;  4E19 A;  1NJW A;  4KHW A;  3FFI A;  3ZSY A;  5HRP A;  3L2W A;  3G10 A;  4B9V A;  1KLM A;  4FM2 A;  4FLV A;  2BGG A;  1LWE A;  1RTI A;  4Z4G A;  1L3T A;  5KGW A;  4FJL A;  3NFA A;  4MFB A;  3SZ2 A;  2HHX A;  4DTU A;  2GUI A;  3ZT4 A;  1SUQ A;  4BE0 A;  4G1Q A;  1K6Y A;  4CJ4 A;  3TAB A;  1WN7 A;  3DLG A;  4FLW A;  5HLF A;  1TKX A;  4CF8 A;  4CFD A;  1BIZ A;  4HCB A;  3KK3 A;  1I39 A;  5I42 A;  4OLB A;  1RDA A;  2X6N A;  1D5A A;  2B6A A;  1L5U A;  3THV A;  2RKI A;  1KRP A;  3T3F A;  4M3U A;  1IO2 A;  3AO2 A;  1KLN A;  2DFH A;  1LWF A;  3OYC A;  4CFA A;  3NF7 A;  3H08 A;  3SV3 A;  1EET A;  1ASW A;  1B9F A;  4CFB A;  1TK8 A;  2PYJ A;  4YFU A;  4FLY A;  4DS5 A;  3L2Q A;  3UIQ A;  1VSJ A;  1JLC A;  2O4G A;  3RWU A;  5JS2 A;  1A5W A;  3EYZ A;  4NCA A;  1QE1 A;  4Q5V A;  1RTD A;  3SV4 A;  4KB0 A;  3TWH A;  4CJP A;  4JRQ A;  4B9S A;  1ASU A;  3LDS A;  3LWL A;  3QIP A;  3LWM A;  1BCM A;  5J2P A;  5C42 A;  3KLE A;  4CGD A;  1RT6 A;  4KRF A;  4M3T A;  4CJT A;  3AVC A;  3LP0 A;  3VQP A;  4CES A;  4DTO A;  2KZZ A;  1FK9 A;  3I0S A;  3C6U A;  4N76 A;  4N56 A;  4CHQ A;  3NCI A;  1VSD A;  3JSM A;  1RDB A;  1QSY A;  5HP1 A;  1VSH A;  4Y1C A;  4Y1D A;  3MXJ A;  3AA5 X;  3VQ5 A;  1TV6 A;  1HMV A;  3AVL A;  1Q9Y A;  3U3G A;  3DRR A;  4OKE A;  3OYM A;  1BCO A;  1SV5 A;  1S6Q A;  2XY8 A;  4FM0 A;  5C25 A;  4RW6 A;  4K8X A;  4KAZ A;  3V1O A;  2BDP A;  2I5J A;  3HPH A;  4FLX A;  1RT1 A;  4DFJ A;  4CHZ A;  2PZS A;  4GW6 A;  4O5B A;  4FYD A;  4DTJ A;  3V9S A;  1RBV A;  2PYL A;  4ID5 A;  1TK0 A;  4QOZ B;  2F8T A;  3S3O A;  1F21 A;  4CF9 A;  4DTX A;  3DI6 A;  3C6T A;  1JLE A;  4CJL A;  4KPY A;  3QNN A;  1S9G A;  3PO5 A;  5JS1 A;  4CEC A;  3SQ0 A;  3QLH A;  2OZM A;  4CGG A;  4E7J A;  1SL2 A;  4FLZ A;  1HPZ A;  3KKR A;  3V9U A;  3HYF A;  3OS1 A;  3QEX A;  4CJQ A;  4OKJ A;  3P5J A;  4H4M A;  3KK1 A;  1NJZ A;  1FXX A;  4CIG A;  4HVJ A;  4KI4 A;  2ETJ A;  3V4I A;  3ULD A;  2A1R A;  3EY1 A;  2IDO A;  4RW9 A;  2GBZ A;  3DOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...