4CESA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cesA00
3AVBA 3DLEA 4CEEA 2HHXA 1VSKA 3T19A 1TK0A 4Z4CA 3TABA 2XHBA 3L3VA 4F2SA 4KHNA 2KZZA 3NF6A 4M3TA 4JRQA 1EP4A 2VWJA 1RBVA 4W5QA 3DLRA 3QNNA 1IG9A 3NF9A 3MECA 2FBTA 4J2BA 3ULDA 2OPSA 4KHUA 2XY7A 5D3GA 3O4NA 4Z4GA 1U49A 3ZSXA 3TI0A 4IDKA 3MXMA 4FJ9A 3PX0A 3NF8A 4AHVA 1WLJA 1QTMA 3C95A 3T1AA 1BQMA 1VK0A 2VG5A 2KW4A 3HT3A 4CIGA 3SQ1A 1S1TA 4O55A 4F8RA 5HRRA 4FK4A 1IKVA 4DU3A 4KTQA 3HM9A 1TAUA 1GOAA 3IS9A 1HYZA 1NK5A 4M41A 1A5WA 3OYHA 4DFKA 3K2PA 4CFCA 2QK9A 4KPYA 4LH5A 4KB1A 3FFIA 4NCBA 3QEPA 1J53A 4OJRA 4W5OA 2ZQBA 3SJJA 2KFNA 3ZSZA 1WAFA 3AVHA 4CFBA 4CGHA 4CGFA 3NGIA 4FJLA 5HP1A 1YTUA 3V1OA 4DQRA 4C8OA 1N5YA 4BDYA 4EZ9A 2D0CA 2G8IA 4IG3A 4DSEA 5HBMA 3RMDA 1XC9A 1RTDA 3LAMA 4CK1A 4W5RA 4DMNA 1TV6A 4Y1CA 4DQPA 5CY4A 4EZ6A 3UIQA 1NOZA 3ASMA 3U3YA 4MQ3A 3BDPA 3P83D 4CE9A 2YV0X 2P1JA 3ZT1A 3HVTA 4CJ3A 1IKXA 4CGGA 4E7KA 3RR7A 3ITHA 3KJVA 1SKSA 5C42A 3CG7A 1EXQA 1D5AA 1ZBLA 3LZIA 4DS5A 1LW2A 2B5JA 1ZYQA 3OJUA 4FJIA 4IKFA 2P51A 1RBTA 3TWHA 1JKHA 3LANA 1HPZA 4ICLA 1QSYA 3HJFA 3QERA 1J9AA 4JS4A 3TARA 1NJXA 1J5OA 4DSKA 3NCIA 1JLBA 3S3MA 2X74A 3ZSQA 4RG8A 1J54A 4H8KA 4KKOA 4YFUA 1Z26A 3AA5X 4YNQA 4HUEA 4FZZA 4CK3A 4K8ZA 5JS1A 2YKMA 3LALA 1S1UA 4FW1A 3KLEA 3QLHA 4IFYA 3SNNA 2R7YA 2HNDA 4HTUA 3M8SA 1WSJA 3L2QA 2PY5A 1U04A 3K5LA 3SV4A 3OJSA 4F4KA 1JLAA 1S6PA 4E1NA 3QNOA 4QCLA 2QKBA 3AVCA 3K59A 4DU4A 5KGXA 3CM5A 3LWLA 4CJEA 1NJZA 1YT3A 4CJWA 4CCHA 4AH9A 4MFBA 3AO4A 4CFDA 4FZXC 1IO2A 1KFDA 1D9FA 5KTQA 3VQ6A 4E3SA 3S3OA 3PY8A 4KTWA 4M42A 1HNIA 2DFEA 1ITGA 1S6QA 4FW2A 4OKEA 4M3YA 3A2FA 2HMIA 1BI4A 1RTHA 2XY6A 2AJQA 3QINA 3SQ0A 4E1MA 4QOZB 3C94A 3MEGA 4B8CA 1RNHA 3WNHA 2ZE2A 1DLOA 3V9SA 4FJ5A 3KKSA 2DFHA 3NAEA 4B3OA 3TAPA 3IAYA 1L5UA 4NYNA 4DG1A 4C8NA 3K5MA 2OYQA 4DF4A 4CJFA 3OYFA 3L2UA 4Z4HA 3HXMA 3K5NA 4KV8A 4FM1A 1XHZA 4OKKA 2BE2A 3DLKA 4FK2A 3VQEA 3K57A 3S3NA 2IOCA 1B92A 1IH7A 4M3XA 3C6UA 3NBPA 1CXQA 1WSFA 4IBNA 1WSEA 2GV9A 4M3RA 1BISA 4E7IA 1NJYA 1NKBA 3G0ZA 4GW6A 4BWJA 2Y1JA 3RRGA 3KK1A 2F8TA 2IS3A 3LPUA 1S1WA 3K58A 1S9EA 1T8EA 4JLHA 3VQ8A 2VWKA 3JSMA 1JLGA 3OYKA 3OYIA 2YNIA 3HVRA 3AVNA 3NGYA 1WSHA 3D45A 3IRXA 3NFAA 1VSEA 1W9HA 3HK2A 4I2QA 3HYFA 4CF8A 1G15A 4B9VA 3EZ5A 2FBXA 1HYSA 4AHTA 1VSDA 4GMJB 4CHZA 3NH1A 3LWMA 5HLFA 1I39A 4I2PA 4DSIA 2D0BA 1UA1A 3NHGA 4PQUA 4B9UA 1SL0A 3ZT2A 3L8BA 2IDOA 4N47A 1CLQA 1C1CA 2X6SA 3V1RA 3JYTA 4FJGA 4CJUA 1Q9YA 5I42A 4F3TA 1JXEA 4F2RA 3KTQA 2A1SA 1K6YA 4KAZA 1KSPA 2X78A 3TAGA 2IGIA 4M45A 3CYMA 1Q8IA 4BDZA 2Z1GA 3AVIA 4FM2A 4DSJA 2OPRA 1NK6A 2DY4A 3ZT4A 3SZ2A 4CJKA 3THVA 2O4GA 1FXXA 3MAQA 2ETJA 1RT2A 1TL3A 1BCMA 4JRPA 4UQGA 3PV8A 1RT7A 1LV5A 1TK8A 1KTQA 4CF9A 3OYBA 4F3OA 1HYVA 1N6QA 4Z4EA 2YKNA 4LSLA 2P5OA 5T7BA 1TKTA 4FLYA 3VQAA 4M3ZA 3RMCA 3SCXA 1VSHA 3LZJA 2ITGA 4E7LA 2QKKA 1L3SA 4CJLA 2DTUA 4DLEA 1JL2A 2EX3A 3MXIA 3DOLA 3M8RA 1X9MA 3EY1A 4CF1A 1R0AA 1XI1A 1IKYA 1ASWA 1UA0A 3LP3A 4HUGA 4FVMA 3AVJA 4G1QA 3VA3A 1RBRA 2RKIA 2HVHA 1VSIA 2DFFA 5DK5A 1HQEA 1EKEA 3SYZA 3AVGA 1B9DA 3DYAA 4BE0A 4M3UA 4CIFA 1U4BA 4RW8A 2D0AA 4EP5A 4HCCA 4K8XA 4J2DA 3OYLA 3LAKA 3DRSA 5FROA 4B9NA 3VQ7A 1T05A 4B8AB 3IG1A 3OYGA 4CECA 1LWEA 4N41A 1JLEA 1O1WA 1BIUA 1BIZA 2E6MA 4CJRA 4C8MA 3QEIA 3PX6A 1WAJA 1T7PA 2HNYA 1HRHA 1DTTA 3SUOA 2XO7A 3V81A 1XHXA 1WSIA 4L8RB 3AO2A 2KTQA 4FJ7A 4DFPA 1S1VA 2BANA 3V9XA 4ZTJA 3KLIA 1VSMA 4E7JA 1RCHA 1RDBA 4FM0A 4DTJA 4FLXA 4CGJA 1F21A 5C25A 4N76A 3AVAA 1RDDA 1RT5A 5CYMA 5J2PA 4CJQA 3SQ4A 4CHOA 4N5SA 4DFJA 5KGWA 3LPTA 5SWMA 4FJNA 1C6VA 1WN7A 4OGEA 3M8PA 5EU7A 4DSLA 1BCOA 3SUQA 3HPHA 4O0IA 5K14A 4FCYA 3OY9A 1BL3A 4RW9A 2E6LA 4CFAA 4HCBA 2D5RA 4DTSA 4FJMA 4KRFA 3VN5A 1VRUA 1C0UA 1FKOA 3V9WA 5KRSA 3RR8A 3AA2A 4IFVA 3V9UA 1CZBA 1RDAA 5FDLA 4BACA 3KD5E 2JLEA 3RMBA 3HO1A 2PYJA 4DTNA 1UOCA 2XY8A 4J2AA 2YNFA 3KLGA 4FYDA 3AVFA 3OYMA 1TL1A 4CGDA 3NH2A 4I9LA 4DQQA 4FJXA 3MEEA 1TK5A 3QESA 1UWBA 4HUFA 4BE2A 3M8QA 4FLWA 4KREA 1YVUA 3AVLA 4WE1A 1X9SA 3F9KA 4NCAA 1RTIA 3HPGA 4ELTA 4KHQA 1ASVA 3SV3A 4HHTA 3DMJA 3RRHA 4CHYA 1NK7A 1RT4A 1QQCA 3LDSA 3SPYA 3ALYA 5CZ2A 4IG0A 2LSNA 1QSSA 4I9QA 4LSNA 3OYNA 3QEWA 4DTPA 2EHGA 3V1QA 5J1EA 1RILA 2B6AA 2OA8A 2GBZA 4ID1A 3OS2A 1SL2A 3NGZA 3AA4A 3PUFA 3ZSVA 1NK8A 3ZSRA 1A5XA 4GVMA 3SPZA 1JXBA 4O0JA 4B08A 2OPPA 2PZSA 2GUIA 2Z1IA 1WSGA 3CFPA 4FJJA 1SKWA 4KI4A 2A1RA 2IAJA 4AILC 4DWIA 2YNGA 3WNFA 4CIEA 1KVAA 4DU1A 3U3GA 2E4LA 3OYEA 2G8VA 4RW4A 3TAMA 3O3FA 5J2MA 4CEOA 4QAGA 1RT6A 3OS1A 3CFRA 3TAFA 2PYLA 1BHLA 3ZSYA 1CXUA 1S9GA 3F73A 1W0HA 1L3VA 1SUQA 3D0PA 3HSTB 3VQ4A 4Z4IA 3CQ8A 2O4IA 3L2RA 1TKXA 4KTZA 1Q9XA 1ASUA 4RW6A 1SKRA 2P5GA 3KK3A 4FJKA 1QE1A 3NDKA 2HHQA 3MXJA 3B6PA 3AO3A 3L3UA 3OYDA 1KVBA 3TR8A 2QXFA 2VG7A 4O4GA 3VA0A 4AHSA 5HRSA 4Z0UA 4OPJA 3VQQA 1KRPA 4CJ4A 4NCGA 2HW3A 1HJRA 2KQ2A 4LD0A 4ZHRA 4CHPA 1ZBHA 3SUNA 5HROA 1NKCA 3HP6A 4CESA 4CEBA 5SZTA 5E41A 4KO0A 3QIPA 4FLTA 1MU2A 3WNGA 1U45A 4FJHA 3RMAA 2F8SA 3QIOA 2G8KA 2Z1JA 4CF2A 1QS4A 4DTXA 4O44A 3L2WA 1TVRA 4XIUA 2I5JA 2ZD1A 1RTJA 1L3UA 4PWDA 4DQIA 1VSJA 1X9WA 5FRNA 3AVMA 5HRPA 4ELUA 4FZYA 4E0DA 1ZBIA 4OLAA 3CM6A 3ZSWA 1KFSA 2Q3SA 1TKZA 3NE6A 3TAEA 1C1AA 3VQPA 4J2EA 3KK2A 1TKDA 2B4JA 2G8UA 2F96A 3NH0A 3C6TA 3O3HA 2WOMA 4KHYA 3EYZA 2VG6A 3SUPA 3SI6A 3BGRA 3HL8A 2W42A 2HHUA 1DTQA 2HNZA 4CHNA 2XY5A 4ID5A 4CEZA 2BDPA 4B9TA 1JLCA 4FK0A 4FLZA 3OYAA 4AHRA 4CJTA 1NK9A 3KIOA 3OYJA 1SL1A 1A5VA 1JLFA 3PO5A 4R5PA 1FKPA 3T3FA 2XRIA 3ZCMA 4DS4A 2G8FA 3P5JA 1S5JA 2YHBA 4CJPA 4CHQA 2HHWA 3RTVA 1Y97A 3WNEA 4DTRA 2YHAA 3V9ZA 4CEAA 3HPOA 3V6DA 5HRNA 3DOKA 1SV5A 3S9HA 5KRTA 4JS5A 2OPQA 1REVA 1ZBFA 3OVNA 4BE1A 1NOYA 3VQ5A 4Z4FA 3DRRA 1LAVA 3VQCA 1TGOA 4FJ8A 3PX4A 5CYQA 1NK0A 2WONA 3AV9A 4W5NA 1HMVA 4OLBA 4Q0BA 1BQNA 4DTUA 4DSFA 3DLGA 3AO5A 4CJSA 1KCFA 3G10A 4PA1A 1NJWA 3I8DA 4CJVA 4DTOA 4OPKA 2KFZA 2HB5A 4ELVA 4CGIA 1VRTA 1S1XA 3AVKA 4NYFA 2IC3A 1T03A 1X1PA 1LW0A 1ZBUA 2HVIA 3I0SA 3ISNC 1XWLA 4CEQA 3VQDA 3AA3A 1C0MA 3I0RA 4AHUA 3KLHA 1U48A 4KHSA 4HVJA 4DLGA 1GOBA 3LP1A 4ZTFA 5J2QA 4C8LA 4N56A 3TAQA 4B9LA 4BWMA 4EP4A 3KD1E 1I3AA 3TANA 2HHVA 3U6FA 3O4QA 1GOCA 4H4OA 4DFMA 2FC0A 1BI4B 1JLQA 2ATQA 1NK4A 4KI6A 1L3TA 3E01A 4KHWA 3KKRA 4OVLA 3DRPA 1TAQA 3LP0A 1C1BA 1KLMA 5KI6A 4OKJA 4CF0A 3OS0A 4DQSA 3V4IA 3QETA 2OZSA 1U47A 3DM2A 3DI6A 3VQBA 4CK2A 4FLUA 2JGUA 1HNVA 1HQUA 1CZ9A 4DTMA 3DLBA 4BDPA 3P1GA 1NKEA 2OZMA 5I3UA 5CZ1A 4DF8A 4PUOA 4B9MA 3B6OA 2X6NA 4AHCA 3QEXA 3HP9A 5C24A 1IKWA 4O5BA 5JS2A 3ZT0A 3MEDA 1QHTA 1UAXA 4E89A 1EETA 1RT1A 1VSLA 2FBYA 4W5TA 2NUBA 3QO9A 3VQ9A 1KVCA 4H4MA 4FLVA 3DLHA 4KB0A 4Q5VA 4PY5A 3KLFA 2G8WA 3ZSOA 5FRMA 4KFBA 3O3GA 1C0TA 1RDCA 1QSLA 2BGGA 2HHTA 1RBUA 1FK9A 4E19A 1JL1A 1EX4A 4CEFA 1WNSA 1BGXT 1RT3A 3AO1A 3LP2A 2HHSA 2Z1HA 4Y1DA 3L2VA 4I7FA 4TSXA 1Z25A 2FBVA 1LWCA 5J2NA 3SQ2A 1VSFA 4B9SA 2KZMA 4CERA 4C8KA 2Y1IA 3ZT3A 1RBSA 1B9FA 1KLNA 2RF2A 3CFOA 1YTAA 3H08A 3NF7A 2YNHA 1D8YA 5DMRA 2RN2A 3K5OA 4LY7A 3QEVA 3RWUA 4CEDA 1D9DA 2RPIA 4FXDA 1LAWA 4E7HA 1LWFA 3OYCA 3PO4A 4M3WA 2G8HA 4OGCA 4LH4A 4CJ5A 4RW7A
chains in the Genus database with same CATH superfamily
3AVBA 3DLEA 2ZJQL 4CEEA 2HHXA 4H0TB 4Z4CA 3TABA 1YAGA 2W40A 2NRXA 5DM6L 3O9TA 3HI0A 1DKGD 4W5QA 1IG9A 3NF9A 2OPSA 4KHUA 3O4NA 1U49A 3EE8A 4BROA 3TI0A 4IDKA 4AHVA 1WLJA 3QB0A 2O8FA 4PKIA 4AM6A 3SQ1A 4CIGA 4DCHA 4JKBA 1IKVA 2I7PA 3FE1A 1NK5A 1A5WA 2VCPA 3O5BA 3OYHA 3O9UA 2NLXA 3R6MA 1VQMN 1E3MA 4H0VB 4JI5K 1J53A 4OJRA 5AZIB 3OBWA 3AVHA 2VWBA 4CGFA 3J7AP 3P39A 1V4SA 5HP1A 5FPEA 4DQRA 3K9KA 1XMOK 4DSEA 3G25A 3GE1A 3TPQA 3RMDA 4O8UA 3P83D 2YV0X 3A5LC 2P1JA 4E7KA 1IKXA 3ITHA 1YITN 1SKSA 5C42A 5F1XA 3CG7A 2Q0UA 3BZKA 5AQLA 5TKWA 3WQTA 3K0SA 3LZIA 1VQ6N 1P8ZA 3HJFA 2PBDA 1LOTB 3CJBA 3TARA 4GV9A 2WUSA 4H8KA 4BR9A 1VQ9N 1H1VA 4BQLA 4CK3A 3LALA 4FW1A 4FPAA 3DXKB 4IFYA 2R7YA 3A0IX 3VPZA 3L2QA 2VYPA 3OJSA 1JLAA 5TKYA 4E1NA 4QCLA 1V4TA 3K59A 4DU4A 3CPEA 1YT3A 4CJWA 4BGBA 4AH9A 4MFBA 5C2FA 3EE9A 1IO2A 4OO1J 4OKEA 4M3YA 4IOCL 4CZKA 3ZX2A 3QINA 3R9PA 3SQ0A 1T6CA 3MEGA 1U6ZA 1DLOA 4FJ5A 4JKFA 2DFHA 3QMLA 3NAEA 4B3OA 1VQNN 4DV1K 4NYNA 3K5MA 4C8NA 3J7ZO 1JCFA 3L2UA 3HXMA 3K5NA 2YJEA 2BE2A 4A5AA 4FK2A 3VQEA 3S3NA 2IOCA 2NRRA 3C6UA 4E7IA 1CXQA 3CI5A 4CW7B 2IVNA 1NMNA 3H46O 4JLHA 4J8FA 2VWKA 4JI4K 4LF5K 2UXDK 3OYKA 2YNIA 4IFEA 4JI2K 3NVMA 3D45A 1W9HA 1YHQN 4CF8A 4XEIA 3EZ5A 1VSDA 3LWMA 3L0QA 4I2PA 4YDUA 1UA1A 4NLBA 3NHGA 4X62K 1C1CA 4L3QA 1T6DA 4F3TA 4F2RA 2P9PB 4BRAA 4FWOA 2QA4N 1VQ4N 1K6YA 1KAZA 1KSPA 4FM2A 3Q7CA 2WBNA 5HOOA 1NK6A 3TTDA 3SZ2A 4AQYK 2O4GA 1FXXA 2E2PA 3PSIA 1YJNN 1T44A 1N6QA 2P5OA 4IXCA 3VOVA 3VQAA 3HBTA 5GAEP 2UUBK 3LZJA 2YHXA 4DLEA 5AQNA 1JL2A 3MX5A 3CD6N 4JK9A 1N33K 5JVHL 4LF7K 4FVMA 5AQQA 3VEXA 1M90O 1RBRA 3VF2A 2HVHA 2DFFA 5LMNK 3SYZA 4CIFA 1U4BA 2Q0RA 1MWKA 3LAKA 4M7XA 2PFUA 5FROA 3C0BA 4BR0A 3OYGA 1JLEA 2ZJPL 5AZIA 1DEJA 1BIUA 3VGMA 2A42A 2FF6A 3ENOA 5AQJA 4C8MA 1DTTA 2XO7A 3V81A 4L8RB 2KTQA 4B1ZA 1S1VA 2BANA 1ZC6A 4DTJA 4BGAA 1F21A 3CCEN 1RDDA 1RT5A 3SAHA 4DFJA 1BA1A 5KGWA 3WEEB 1C6VA 2KHOA 1O13A 4O0IA 3OY9A 4RW9A 4BVPA 1YIJN 1OH7A 1VRUA 5JVGL 3V9WA 1WOQA 3AA2A 4IFVA 4BACA 1OH5A 3FLCO 3HO1A 3WXKA 3DXKA 4IO9L 4J2AA 3VF4A 4CGDA 3NH2A 3THWB 5GAHP 4FVUA 3CCVN 4JKDA 4FLWA 4NCAA 1RTIA 4NO7A 4CD3A 3SV3A 3DMJA 2PAVA 4CHYA 3IKMA 3ALYA 4WFNL 2LSNA 4FWQA 5AFUA 4LSNA 4DTPA 2EHGA 2OA8A 2UUCK 1SL2A 4GV6A 5FPNA 3NGZA 3AA4A 1A5XA 1JXBA 4B08A 2OPPA 3CETA 3P31A 1WSGA 2OCEA 4CZIA 4OX9K 1ATSA 1KVAA 4DU1A 1HJOA 4LF4K 1RT6A 2J4RA 3CFRA 1OH6A 3ZSYA 1S9GA 4BREA 1W0HA 1J5EK 3D0PA 1MWMA 3HSTB 3VQ4A 2O4IA 2CGLA 5GADP 2P5GA 4RW6A 3CIPA 3KK3A 1QE1A 4CZHA 3BUZB 3EO3A 2VG7A 2NRHA 1D4XA 3VQQA 1N36K 4K41A 1HJRA 4CHPA 3H1QA 3SUNA 3ZYYX 1NJIO 5E41A 2P9PA 4FLTA 3WNGA 5AQWA 2F8SA 1NGCA 1QS4A 2FXUA 1TVRA 3CQXA 4GKKK 4H0PA 1L3UA 2HOEA 2IVOA 2P9SB 1WBBA 3ZSWA 4BG8A 1SAZA 1TKZA 3LL3A 1C1AA 2B4JA 1BDGA 2G8UA 1OVQA 3C6TA 3O3HA 2WOMA 5AQPA 3EYZA 2W42A 1DTQA 4CEZA 3LDLA 3CCMN 1JLCA 2VGMA 4CZEA 4FLZA 4AHRA 4CJTA 2JWLA 3OYJA 4OPHA 1JLFA 5IT9O 2XRIA 1S5JA 2F9TA 3V9ZA 1HKGA 3HPOA 5HRNA 1SV5A 4CBWA 3OHRA 5AQSA 4BE1A 5BPNA 4FO0A 4X65K 5BRFA 1NK0A 3AV9A 2D0PA 4JHDB 3MX2A 4DTUA 2V51B 3AO5A 3PIPL 4DV2K 4K25A 1KCFA 4PA1A 4ILHA 3BEXA 5AFUH 3H6EA 1LW0A 3I0SA 4CEQA 2Q31A 3WEEA 1YF5L 1GLCG 4KHSA 1GOBA 4ZTFA 3TANA 2HHVA 3I8BA 2P9UA 1XMQK 4KI6A 1L3TA 1BO5O 4BR2A 3KKRA 3LP0A 4JN4A 4XH5A 3GOIA 4JKCA 3DM2A 3LM9A 4CK2A 1HNVA 3OTOK 1IJJA 1NKEA 2OZMA 5CZ1A 3THWA 2QWQA 4WFAL 3QEXA 4O5BA 4R79A 4DR2K 4DUYK 1ZXOA 4H5TA 4F9OA 1VSLA 1KQSM 2NUBA 3VEZA 1KVCA 4KB0A 1HPMA 2OTJN 5F0XA 4KFBA 1RDCA 1RBUA 1FK9A 4E19A 2ZGZA 4CEFA 1HKBA 1LWCA 1OKJA 5ADXA 1QQOA 3AGKA 4CERA 4C8KA 3ZT3A 4A2BA 2GX9A 3SMSA 1D8YA 3MK6A 1JCEA 2RN2A 4LY7A 4CZLA 4LH4A 3L4IA 2ITMA 4ISGA 2HBLA 2P9IB 4JRQA 1VQ7N 5FLXO 3G71N 1G99A 2UYTA 3IUCA 2ZJRL 2E88A 1HR0K 2XY7A 4JV5K 3QDKA 3ZSXA 4BRDA 3PX0A 2W6KA 1W2BM 1BQMA 1Z6RA 3HT3A 1S1TA 5HRRA 4FK4A 2KKZA 5JICA 4NXNK 3IFRA 1YJ9N 4DFKA 3K2PA 4CFCA 2QM1A 2P9SA 4LH5A 4NCBA 3M3ZA 3FZMA 5M1OA 4W5OA 3NGIA 4CGHA 1TUYA 3CCQN 4FJLA 1YTUA 4IG3A 5HBMA 1XC9A 4W5RA 3FZFA 3BDPA 4YY3K 1BU6O 4B1YB 3CC4N 3KJVA 3Q7BA 1GLFO 5C15A 1EXQA 1ZBLA 4DS5A 1LW2A 2B5JA 1RBTA 3C7NB 1JKHA 4ICLA 3T7ZA 3QERA 1J9AA 4AM7A 4JS4A 1NJXA 4BRPA 4DSKA 3UE5A 3NCIA 3S3MA 4RG8A 5B8HA 2GEMA 1Z26A 3AA5X 4YNQA 4JHDA 5M1NA 1NGJA 1S1UA 2HNDA 4DV5K 2PY5A 4MO5A 1U04A 4PL8A 3SV4A 3G4SN 3QNOA 3AVCA 3ZX0A 1VQKN 3RVCA 4H0XB 5ADXH 2A40A 3VQ6A 4E3SA 3S3OA 4M42A 2QXLA 1RTHA 1K73O 3DXMB 3KVGA 2V52B 3C94A 2E5LK 1RNHA 2ZE2A 1KAYA 3KKSA 4PL7A 3TAPA 1GLAG 1L5UA 4DG1A 2OYQA 4CJFA 3OYFA 4Z4HA 1BOTO 4C1NK 3DLKA 5GIOA 1B92A 4M3RA 1WSEA 3P38A 1BISA 1NJYA 3G0ZA 2GWKA 3M5RA 4GW6A 4BWJA 3RRGA 3VEVA 1E4FT 3K58A 1T8EA 3OA9A 3U8XA 3AVNA 4NB4A 3VGLA 4I2QA 4A5BA 4B9VA 3CJ1A 4DR6K 1HYSA 3OW2M 1Q7YO 4FWNA 4PQUA 4H5NA 2H3GX 5AQKA 1KXPA 3ZT2A 1SL0A 4DV6K 3JYTA 4FJGA 5I42A 5AQHA 1Q86O 3KTQA 5LMUK 3VTHA 2IGIA 1Q8IA 1W97L 2Z1GA 4BDZA 4IWVA 2JWKA 4DSJA 4FOEA 3ZT4A 4CJKA 2A41A 5E26A 1RT2A 4JRPA 4UQGA 3PV8A 1RT7A 4F3OA 2P9IA 1HYVA 4Z4EA 2YKNA 5T7BA 3THXB 3M6GA 3RMCA 1C0FA 3SAGA 2AP1A 2YI1A 1X9MA 3EY1A 1R0AA 1XI1A 3U4LA 4Y0WA 3LP3A 4EIAA 1UA0A 3AVJA 4G1QA 3VA3A 4CZGA 2RKIA 1VSIA 3CJCA 3R8EA 1EKEA 4GV3A 4BE0A 5BRDA 5AQIA 3WUHA 5EY4A 4X64K 4J2DA 4B9NA 3VQ7A 1T05A 3IG1A 4BVOA 1XNQK 2VQFK 2E6MA 2FSKA 3QEIA 1WAJA 1HRHA 1XHXA 1NU0A 4FJ7A 4DFPA 3V9XA 1VSMA 4FLXA 5C25A 5CYMA 5J2PA 4CHOA 5SWMA 4OGEA 5AQMA 3M8PA 5EU7A 3HPHA 3J8AA 5JLHA 3C7NA 5AQZA 3GBTA 4CZMA 4DTSA 4KRFA 3SMPA 2QWNA 5FDLA 4JI0K 2PYJA 3CJ7A 3NMUA 3MN9A 1QQMA 3AVFA 3OYMA 4I9LA 3MEEA 1UWBA 4HUFA 1SS6A 1U2VB 1YVUA 3AVLA 2QWPA 3HPGA 5M1FA 1ASVA 3KWGA 1QQCA 2YCHA 3SPYA 5CZ2A 4IG0A 3OYNA 3V1QA 3H3OB 2GBZA 3OS2A 3DXMA 3PUFA 1NK8A 4DV0K 3ZSRA 4EHUA 2QTDA 2GUIA 2Z1IA 1SKWA 3A8YA 2A1RA 4AILC 4HWIA 4JKHA 3U3GA 4LF8K 4RW4A 5JMVA 3TAMA 4U7BA 3O3FA 4DV7K 1I94K 3OS1A 3PSFA 3A5OC 1BHLA 2E2NA 5AQRA 3ATUA 3ID8A 1L3VA 1NGBA 3L2RA 1RDWX 4FJKA 3MXJA 3OYDA 1KVBA 3LDPA 3TR8A 4O4GA 4AHSA 4H5RA 3CC7N 4OPJA 4CJ4A 5AQOA 2KQ2A 1GLDG 3CPWM 1MU2A 4FJHA 3AAPA 2G8KA 2Z1JA 4FYDA 2ZD1A 4PWDA 2P9LB 1WUAA 3AVMA 4JEPA 4ELUA 1ZBIA 4E0DA 1KFSA 2Q3SA 1X3NA 3TAEA 4RWTA 1MDUB 1NLVA 1VQLN 1TKDA 3CCUN 5EXWA 3THXA 1OVYA 3HL8A 2HHUA 2HNZA 4CHNA 4U67L 3QBWA 2BDPA 3OYAA 4IEEA 1NK9A 2WTUA 1SL1A 4DHYA 3TSQA 3VEYA 3PO5A 3T3FA 3CCLN 3P5JA 2HHWA 3RTVA 2YHAA 1NNEA 2E20A 3A5NC 4JK8A 4JS5A 2OPQA 4LFAK 3DRRA 1LAVA 1TGOA 2QEXN 4DSFA 3DLGA 4CJSA 3IMXA 3G10A 3ENBA 3IDHA 5AZJB 2P9UB 3WQUA 5I9EB 3P4IA 1S1XA 3SBTA 1NGEA 2HVIA 3VQDA 3AA3A 4AHUA 5C0YA 3MN6A 4DLGA 5GAGP 2FC0A 1GLLO 1NK4A 3E01A 3CCJN 1TAQA 3C6HA 1C1BA 4PKGA 5KI6A 4OKJA 4CF0A 3V4IA 1HNXK 4FWRA 3GDQA 4O8KA 4BC4A 1IBMK 3FZKA 5I3UA 4PUOA 4LFCK 3B6OA 3R3LA 1IKWA 5JS2A 4M7YA 1U2VA 1QHTA 1UAXA 5E84A 1RT1A 4JD2A 3VENA 3VETA 4W5TA 4PY5A 4Q5VA 3KLFA 3ZSOA 2BGGA 1JL1A 3K9JA 2W41A 1EX4A 1WNSA 4WF9L 1RT3A 2HHSA 2Z1HA 4Y1DA 3E1YA 3ZLJA 4TSXA 1VAZA 2KZMA 1BUPA 5EVZA 1B9FA 2GTDA 2RF2A 2YNHA 2P9KB 5GINA 1OH8A 2RPIA 4FXDA 1LAWA 4DR4K 3OYCA 4M3WA 3VGKA 2G8HA 3BF1A 5HRSA 3MWTA 2RE2A 4B1WB 1HUXA 1VSKA 3N4PA 2XHBA 1HNWK 2NRWA 1TYQA 4JI7K 1WBDA 4A61A 4DB3A 3MECA 2FBTA 4J2BA 3ULDA 3U9ZA 5AQFA 2QWOA 4Z4GA 1QTMA 3C95A 3T1AA 2ASOA 4O55A 4XH4A 4DU3A 1ATNA 3BP8A 2HF4A 1GOAA 3IS9A 2P9LA 4M41A 2HHHK 3LM2A 2QK9A 4KPYA 4KB1A 4KH6A 3FFIA 3QEPA 1GLEG 2ZQBA 3SJJA 3EKSA 3ZSZA 1N5YA 3GL1A 4BDYA 4EZ9A 2D0CA 3MCAB 2G8IA 1RTDA 3LAMA 4CK1A 4DMNA 4DQPA 3BZCA 3ASMA 3U3YA 4LF6K 3ZT1A 4CJ3A 3O8MA 4FJIA 4MLEA 1ZYQA 1VQ5N 1XUPO 4B3MK 3TWHA 3LANA 4I6MB 4A57A 1QHAA 4CD1A 1J5OA 5LY3A 4JYAK 2GWJA 3MN5A 5EX5A 4FZZA 4K8ZA 5JS1A 3D6RA 5AZJA 3QLHA 3SNNA 4LF9K 4HTUA 2EWSA 4FWPA 1NGHA 1NJZA 3CM5A 1NWKA 1S22A 2ZF5O 4CFDA 4FZXC 1LCUA 5KTQA 3MMVA 5M1PA 5BR8K 3PY8A 4KTWA 2DFEA 1S6QA 1QZ6A 5AR0A 1NG9A 4QOZB 4E1MA 3AARA 4B8CA 3WNHA 4FL9A 1JCGA 3J80O 1BG3A 3O9RA 4DUZK 5KPZA 3H45C 3VF6A 4A59A 4K0KK 4OKKA 1C0GA 3K57A 5HL7L 4ISFA 4M3XA 1BWFO 4IBNA 1WSFA 3O6WA 1NKBA 2GV9A 3W0LA 2F8TA 2IS3A 1IV0A 1S9EA 3D2FB 3VQ8A 3JSMA 1DGKN 2IIRA 3IRXA 3VMFB 3NFAA 1VSEA 4YOVA 3LDOA 3HK2A 2E2OA 3HYFA 4OPAA 2FBXA 4AHTA 4GMJB 4IOXA 5HLFA 2QWMA 2D0BA 1HX1A 4B9UA 2DPNA 2IDOA 4N47A 3M1FA 1CLQA 4BC2A 2HBKA 3LDNA 4H0YB 2A1SA 2P9KA 4KAZA 3TAGA 4JNEA 1Y64A 4M45A 3CYMA 2OPRA 2DY4A 3HOTA 4WQ4C 3MAQA 4Z94A 1TL3A 1BCMA 5BN9A 1TK8A 1KTQA 1TKTA 3SCXA 1VSHA 3DAWA 3QBXA 2RHKA 4E7LA 1L3SA 4CJLA 4DR7K 2DTUA 3JXUA 3MXIA 1R59O 3M8RA 3CJ9A 1IKYA 1ASWA 4LC9B 3W3DA 1HQEA 3KHYA 3AVGA 1B9DA 4M3UA 4QS9A 4RW8A 2D0AA 4GKJK 4GVEA 4ILGB 3RSEA 3DRSA 4B8AB 3C65A 3I56N 4CECA 1LWEA 1RGIA 3MDQA 4N41A 4LFBK 1BIZA 2E8AA 2CH5A 3I55N 4JI8K 3PX6A 4CZFA 5MLCQ 1DT9A 1WSIA 1ILYA 3SK3A 3HM8A 4BRKA 4ZTJA 3KLIA 4E7JA 1RCHA 1RDBA 1QVGM 1EWQA 4CGJA 4N76A 4CJQA 4FJNA 1WN7A 3FFKB 1X9JA 4WCEL 3DWLA 3CHWA 3F9MA 1NGIA 3SUQA 2HMPA 5K14A 4FCYA 4I6MA 1BL3A 2E6LA 4H0OA 4HCBA 2D5RA 5DM7L 3UB5A 3VN5A 1C0UA 4BRFA 1QVFM 1FKOA 1X3MA 4G9ZA 4BR4A 3KD5E 1Q81O 1CZBA 4NXMK 3J7YP 3RMBA 3H3NO 1UOCA 3QFUA 3ZX3A 4KH4A 1TK5A 2QW9A 3QESA 2KLAA 4BE2A 3M8QA 1T3VA 3DJCA 2VQEK 1X9SA 3F9KA 4GY2B 4KHQA 4B3TK 3O1BA 5C10A 3UKUB 1NK7A 3O9QA 4MDAA 4I9QA 4H5VA 1RILA 4BG9A 3J81O 4ID1A 3SPZA 4O0JA 4BRIA 3ZETA 2PZSA 4IZ9A 4FJJA 4KI4A 4DWIA 2YNGA 3WNFA 2E4LA 2G8VA 2HBMA 5J2MA 3HSCA 4CEOA 4WQ5C 3NVKA 3KK7A 2CGKA 1CXUA 3D2FA 3F73A 4JKGB 1SUQA 3CQ8A 2CGJA 1Q9XA 2KFNA 1ASUA 2HHQA 3NDKA 3FZHA 3AO3A 3L3UA 2NRZA 4B3SK 3VA0A 3EL2A 2O8EA 4Z0UA 2F7TA 4NCGA 4ZHRA 3ENHA 1ZBHA 3THYB 5HROA 1NKCA 4CJ7A 3HP6A 5SZTA 3FR0A 4KO0A 1NGGA 3RMAA 3QIOA 4O44A 3L2WA 2I5JA 3MN7A 4DQIA 1VSJA 1X9WA 1HKCA 4EAHD 4OLAA 4FZYA 3NE6A 1IG8A 4EHTA 4J2EA 3KK2A 2F96A 1K8KB 3NH0A 3SI6A 5EOYA 3BGRA 1NGDA 4ID5A 2FSJA 4B9TA 4FK0A 5FPDA 1M1KO 3KIOA 3E66A 2FSNA 2UXBK 3AY9A 3ZCMA 4BC3A 2WC9A 1Y97A 3R1XA 3WT0A 3SBGA 4CEAA 3DOKA 4JI3K 2NRVA 5KRTA 1REVA 1ZBFA 3OVNA 4BRLA 1NOYA 3VQ5A 3VTIA 4Z4FA 3VQCA 3AAQA 4FJ8A 3PX4A 2W6LA 5CYQA 2WONA 3EKUA 4W5NA 4Q0BA 1BQNA 4H5WA 3I8DA 4CJVA 4PKHA 2OANA 1EO1A 4DTOA 3CCSN 2HB5A 4ELVA 4B1XB 4BRMA 4NYFA 1X1PA 1ZBUA 5H1SQ 1XWLA 2Q97A 1ATRA 3KLHA 3I0RA 3ATVA 3LP1A 5J2QA 4IOAL 4WFBL 4B9LA 1P90A 5AQXA 5KPTA 3KD1E 1I3AA 3VERA 2A5XA 1MA9B 1GOCA 1BI4B 3ID6A 5CHIA 4IO8A 3DRPA 1KLMA 1VQ8N 3SAFA 1RDUA 4JD2B 4CBXA 5BPMA 3O08A 2OZSA 3A5MC 3DI6A 4FLUA 1CZ9A 4DTMA 2P9NA 3EZWA 4CI6A 4DF8A 3CC2N 2X6NA 4AHCA 3ZT0A 3D7EO 3MEDA 3E9OA 4E89A 4DV4K 4H4MA 3UKUA 2D1KA 1Q82O 2YHWA 5FRMA 2VGNA 3O3GA 1C0TA 3GG4A 5AQVA 1QSLA 4GNIA 2UU9K 3AO1A 3LP2A 2NZTA 3AGRA 4DV3K 2F9WA 4I7FA 1Z25A 2FBVA 5J2NA 2A6AA 3SQ2A 2HBJA 1YTAA 3H08A 4PHTX 1TYQB 3C6AA 5IWAK 5DMRA 4BRGA 3K5OA 3QEVA 5M1QA 3RWUA 1D9DA 1LWFA 3PO4A 3T1HK 5JLFA 4JKGA 4V19S 3JAMO 3T19A 1K9MO 1TK0A 4F2SA 4KHNA 2NNWA 3L3VA 3UKRA 3CMEN 2KZZA 3NF6A 4M3TA 1EP4A 2VWJA 1RBVA 3DLRA 3QNNA 5D3GA 3D2EB 5M1KA 3MXMA 3THYA 4FJ9A 3E9PA 3NF8A 4CBUA 4FWMA 1VK0A 4EFHA 2VG5A 2KW4A 4F8RA 1VQON 5LL6Z 1SQKA 4KTQA 3HM9A 1TAUA 1KAXA 2HF3A 1HYZA 4H03B 4B1VA 2FF3B 1QQNA 3N4QA 1K8KA 1WAFA 4WQ4A 4CFBA 3I33A 3V1OA 4C8OA 4EZ6A 1TV6A 4Y1CA 3UIQA 5CY4A 1NOZA 4MQ3A 4CE9A 3HVTA 4XH1A 4CGGA 3JS6A 3RR7A 1D5AA 3EEQA 3F5TA 4IKFA 3OJUA 2O8DB 2P51A 1QSYA 1HPZA 3TTCA 5GIPA 4UY8O 1JLBA 2X74A 3ZSQA 1J54A 4B3RK 4KKOA 3PIOL 4YFUA 4HUEA 1XQSC 4WYBA 4JKAA 2YKMA 2Q2RA 3KLEA 3M8SA 1WSJA 4YHHK 4A62A 1RFQA 3K5LA 4RCHA 3EN9A 5C12A 4F4KA 2YX6A 1S6PA 2QKBA 1YI2N 5KGXA 3LWLA 4CJEA 4CCHA 3VEWA 3AO4A 1KFDA 1D9FA 5CE3A 1HNIA 1ITGA 4FW2A 3A2FA 2HMIA 1BI4A 2XY6A 2AJQA 3FGUA 3V9SA 5AQTA 3IAYA 5ELZA 1BA0A 2A3ZA 4DF4A 3CMAN 1YXQA 4FM1A 1XHZA 4BRHA 4KV8A 4FPBA 1IH7A 3NBPA 3SLCA 2FLOA 2Y1JA 3KK1A 3LPUA 1S1WA 4CZJA 4BC5A 1JLGA 4K43A 3QFPA 3OYIA 3HVRA 3NGYA 1WSHA 1VQPN 1G15A 1WB9A 5A2QO 3CCRN 4CHZA 3NH1A 2QWLA 1I39A 4BR5A 1NMDA 4DSIA 3ZEUB 1W7AA 1YUWA 4FSVA 3L8BA 2X6SA 3V1RA 4CJUA 1Q9YA 1NBWA 3MCPA 4X66K 5AQYA 1JXEA 4IDHA 2X78A 2E2QA 5F2RA 3AVIA 4WQ5A 3THVA 5C2DA 2ETJA 3B8AX 4MDBA 4IEIA 2V7YA 1LV5A 4CF9A 3OYBA 4FWKA 1K8AO 2O8CB 3QICA 4LSLA 4E1JA 4FLYA 4M3ZA 3RSEB 3O4WA 1KC8O 2ITGA 2BH1A 2ZM6K 2QKKA 1ESVA 3D2EA 2EX3A 3CJAA 4AF1A 3DOLA 4CF1A 4HUGA 5LJWA 5DK5A 3DYAA 4EP5A 4HCCA 4K8XA 2GELA 3OYLA 4YOTA 4YOWA 1O1WA 4RTFD 4JK7A 4K42A 4CJRA 4YOXA 1T7PA 1YVNA 2HNYA 3SUOA 3AO2A 5KQDA 3HZ6A 2HSTA 2V7ZA 5KPRA 4FM0A 3AVAA 3SQ4A 4N5SA 1GLJO 3LPTA 3HRGA 5BR9A 1NGAA 4DR5K 4DSLA 1BCOA 4C1NI 3WXIA 1EQYA 3CQYA 3LDQA 5BRHA 2O8DA 1E4GT 2O8BB 1TUUA 4IJAA 4CFAA 2BTFA 4FJMA 4JAXA 3TSPA 3O80A 5KRSA 3ULEB 3RR8A 3V9UA 1RDAA 2JLEA 4JKEA 3WXLA 3S41A 1N34K 3MWPA 4DTNA 4NLCA 2XY8A 5AJ3K 2YNFA 3KLGA 5BN8A 5FPMA 1TL1A 4BRCA 4DQQA 4FJXA 3ZETB 4JI6K 3FZLA 4KREA 4WE1A 4ELTA 3BF3A 3VEOA 4HHTA 3RRHA 1RT4A 3LDSA 1QSSA 4YDUC 3QEWA 2F4VK 5J1EA 2B6AA 2Q36A 4HTLA 3TTFA 3WXJA 2UUAK 3ZSVA 2GUPA 4GVMA 3CFPA 2IAJA 1EWRA 4CIEA 3OYEA 2OTLN 4QS7A 4QAGA 3TAFA 2O8EB 2PYLA 3DLLL 5BREA 2ASMA 4C23A 4FWSA 4ISEA 4M63C 4Z4IA 2E1YA 2YHYA 1TKXA 4KTZA 1SZ2A 1SKRA 3B6PA 3KWIA 2QXFA 2UXCK 3ZEUA 1KRPA 3TSUA 2HW3A 4LD0A 4JI1K 2O8FB 1Q18A 3E9LA 4BR7A 4CEBA 4CESA 3QIPA 1XC3A 1U45A 4DQ8A 4CF2A 4DTXA 4XIUA 1GLBG 1RTJA 3OBYA 5FRNA 5HRPA 1Z05A 3CM6A 3WXMB 1IBLK 2QWRA 2Q1NA 3VQPA 2O8CA 3O9SA 1HNZK 4KHYA 2VG6A 3SUPA 2WFBA 1NGFA 3CERA 3L6QA 1NM1A 2XY5A 4DR1K 4BQZA 2IVPA 1A5VA 4KBOA 4B1UB 4R5PA 1FKPA 4FWLA 4DS4A 2G8FA 1ZBSA 2YHBA 2D4WA 4CJPA 4CHQA 3WNEA 4DTRA 3V6DA 3BY5A 3S9HA 2ASPA 5KQ8A 5AQGA 3VESA 1HMVA 4OLBA 3SJHA 1NJWA 3F2KA 1N8RO 4MLHA 4OPKA 4MO4A 2KFZA 4YOUA 4CGIA 1VRTA 3AVKA 4YOYA 2NRTA 1HLUA 2IC3A 2ZWHA 1T03A 1IBKK 3ISNC 1CZAN 3TU5A 1C0MA 1U48A 1JJ2M 4HVJA 4C8LA 1FW6A 3T69A 5LJVA 4N56A 3TAQA 1KD1O 4BWMA 4EP4A 5BPLA 2O8BA 3HOSA 3U6FA 3O4QA 4DFMA 4H4OA 3CF5L 2D0OA 1JLQA 2P9NB 2ATQA 4ILJA 5CR4A 4KHWA 4OVLA 3G6EN 3OS0A 4DQSA 4KH5A 3QETA 3ULEA 4BY9C 4QS8A 1U47A 3H1VX 3VQBA 1QZ5A 2JGUA 4KHPK 1HQUA 1XNRK 2QI2A 1VHXA 4DKWA 3DLBA 4BDPA 5AQUA 3P1GA 4O5FA 4B9MA 3L4QA 3HTVA 3HP9A 5C24A 1EETA 1S3XA 2FBYA 3QO9A 4IJNA 2I7NA 3VQ9A 4FLVA 3DLHA 2E1ZA 4YORA 1N32K 2G8WA 2HHTA 3PLAA 1J6ZA 4A2AA 3U9DA 4BRQA 1BGXT 3KZBA 3O1WA 2CH6A 1YJWN 3L2VA 1FJGK 3CXCM 1VSFA 4B9SA 2Y1IA 1RBSA 3UKRB 1KLNA 3CFOA 2ZGYA 3NF7A 2BUPA 4DR3K 3T1YK 4CEDA 4BRNA 4FOIA 4CVNE 4B9QA 4E7HA 2AA4A 4OGCA 4CJ5A 1S72N 4RW7A 2YJFA
chains in the Genus database with same CATH topology
3AVBA 3DLEA 4CEEA 2HHXA 1VSKA 3T19A 1TK0A 4Z4CA 3TABA 2XHBA 3L3VA 4F2SA 4KHNA 2KZZA 3NF6A 4M3TA 4JRQA 1EP4A 2VWJA 1RBVA 4W5QA 3DLRA 3QNNA 1IG9A 3NF9A 3MECA 2FBTA 4J2BA 3ULDA 2OPSA 4KHUA 2XY7A 5D3GA 3O4NA 4Z4GA 1U49A 3ZSXA 3TI0A 4IDKA 3MXMA 4FJ9A 3PX0A 3NF8A 4AHVA 1WLJA 1QTMA 3C95A 3T1AA 1BQMA 1VK0A 2VG5A 2KW4A 3HT3A 4CIGA 3SQ1A 1S1TA 4O55A 4F8RA 5HRRA 4FK4A 1IKVA 4DU3A 4KTQA 3HM9A 1TAUA 1GOAA 3IS9A 1HYZA 1NK5A 4M41A 1A5WA 3OYHA 4DFKA 3K2PA 4CFCA 2QK9A 4KPYA 4LH5A 4KB1A 3FFIA 4NCBA 3QEPA 1J53A 4OJRA 4W5OA 2ZQBA 3SJJA 2KFNA 3ZSZA 1WAFA 3AVHA 4CFBA 4CGHA 4CGFA 3NGIA 4FJLA 5HP1A 1YTUA 3V1OA 4DQRA 4C8OA 1N5YA 4BDYA 4EZ9A 2D0CA 2G8IA 4IG3A 4DSEA 5HBMA 3RMDA 1XC9A 1RTDA 3LAMA 4CK1A 4W5RA 4DMNA 1TV6A 4Y1CA 4DQPA 5CY4A 4EZ6A 3UIQA 1NOZA 3ASMA 3U3YA 4MQ3A 3BDPA 3P83D 4CE9A 2YV0X 2P1JA 3ZT1A 3HVTA 4CJ3A 1IKXA 4CGGA 4E7KA 3RR7A 3ITHA 3KJVA 1SKSA 5C42A 3CG7A 1EXQA 1D5AA 1ZBLA 3LZIA 4DS5A 1LW2A 2B5JA 1ZYQA 3OJUA 4FJIA 4IKFA 2P51A 1RBTA 3TWHA 1JKHA 3LANA 1HPZA 4ICLA 1QSYA 3HJFA 3QERA 1J9AA 4JS4A 3TARA 1NJXA 1J5OA 4DSKA 3NCIA 1JLBA 3S3MA 2X74A 3ZSQA 4RG8A 1J54A 4H8KA 4KKOA 4YFUA 1Z26A 3AA5X 4YNQA 4HUEA 4FZZA 4CK3A 4K8ZA 5JS1A 2YKMA 3LALA 1S1UA 4FW1A 3KLEA 3QLHA 4IFYA 3SNNA 2R7YA 2HNDA 4HTUA 3M8SA 1WSJA 3L2QA 2PY5A 1U04A 3K5LA 3SV4A 3OJSA 4F4KA 1JLAA 1S6PA 4E1NA 3QNOA 4QCLA 2QKBA 3AVCA 3K59A 4DU4A 5KGXA 3CM5A 3LWLA 4CJEA 1NJZA 1YT3A 4CJWA 4CCHA 4AH9A 4MFBA 3AO4A 4CFDA 4FZXC 1IO2A 1KFDA 1D9FA 5KTQA 3VQ6A 4E3SA 3S3OA 3PY8A 4KTWA 4M42A 1HNIA 2DFEA 1ITGA 1S6QA 4FW2A 4OKEA 4M3YA 3A2FA 2HMIA 1BI4A 1RTHA 2XY6A 2AJQA 3QINA 3SQ0A 4E1MA 4QOZB 3C94A 3MEGA 4B8CA 1RNHA 3WNHA 2ZE2A 1DLOA 3V9SA 4FJ5A 3KKSA 2DFHA 3NAEA 4B3OA 3TAPA 3IAYA 1L5UA 4NYNA 4DG1A 4C8NA 3K5MA 2OYQA 4DF4A 4CJFA 3OYFA 3L2UA 4Z4HA 3HXMA 3K5NA 4KV8A 4FM1A 1XHZA 4OKKA 2BE2A 3DLKA 4FK2A 3VQEA 3K57A 3S3NA 2IOCA 1B92A 1IH7A 4M3XA 3C6UA 3NBPA 1CXQA 1WSFA 4IBNA 1WSEA 2GV9A 4M3RA 1BISA 4E7IA 1NJYA 1NKBA 3G0ZA 4GW6A 4BWJA 2Y1JA 3RRGA 3KK1A 2F8TA 2IS3A 3LPUA 1S1WA 3K58A 1S9EA 1T8EA 4JLHA 3VQ8A 2VWKA 3JSMA 1JLGA 3OYKA 3OYIA 2YNIA 3HVRA 3AVNA 3NGYA 1WSHA 3D45A 3IRXA 3NFAA 1VSEA 1W9HA 3HK2A 4I2QA 3HYFA 4CF8A 1G15A 4B9VA 3EZ5A 2FBXA 1HYSA 4AHTA 1VSDA 4GMJB 4CHZA 3NH1A 3LWMA 5HLFA 1I39A 4I2PA 4DSIA 2D0BA 1UA1A 3NHGA 4PQUA 4B9UA 1SL0A 3ZT2A 3L8BA 2IDOA 4N47A 1CLQA 1C1CA 2X6SA 3V1RA 3JYTA 4FJGA 4CJUA 1Q9YA 5I42A 4F3TA 1JXEA 4F2RA 3KTQA 2A1SA 1K6YA 4KAZA 1KSPA 2X78A 3TAGA 2IGIA 4M45A 3CYMA 1Q8IA 4BDZA 2Z1GA 3AVIA 4FM2A 4DSJA 2OPRA 1NK6A 2DY4A 3ZT4A 3SZ2A 4CJKA 3THVA 2O4GA 1FXXA 3MAQA 2ETJA 1RT2A 1TL3A 1BCMA 4JRPA 4UQGA 3PV8A 1RT7A 1LV5A 1TK8A 1KTQA 4CF9A 3OYBA 4F3OA 1HYVA 1N6QA 4Z4EA 2YKNA 4LSLA 2P5OA 5T7BA 1TKTA 4FLYA 3VQAA 4M3ZA 3RMCA 3SCXA 1VSHA 3LZJA 2ITGA 4E7LA 2QKKA 1L3SA 4CJLA 2DTUA 4DLEA 1JL2A 2EX3A 3MXIA 3DOLA 3M8RA 1X9MA 3EY1A 4CF1A 1R0AA 1XI1A 1IKYA 1ASWA 1UA0A 3LP3A 4HUGA 4FVMA 3AVJA 4G1QA 3VA3A 1RBRA 2RKIA 2HVHA 1VSIA 2DFFA 5DK5A 1HQEA 1EKEA 3SYZA 3AVGA 1B9DA 3DYAA 4BE0A 4M3UA 4CIFA 1U4BA 4RW8A 2D0AA 4EP5A 4HCCA 4K8XA 4J2DA 3OYLA 3LAKA 3DRSA 5FROA 4B9NA 3VQ7A 1T05A 4B8AB 3IG1A 3OYGA 4CECA 1LWEA 4N41A 1JLEA 1O1WA 1BIUA 1BIZA 2E6MA 4CJRA 4C8MA 3QEIA 3PX6A 1WAJA 1T7PA 2HNYA 1HRHA 1DTTA 3SUOA 2XO7A 3V81A 1XHXA 1WSIA 4L8RB 3AO2A 2KTQA 4FJ7A 4DFPA 1S1VA 2BANA 3V9XA 4ZTJA 3KLIA 1VSMA 4E7JA 1RCHA 1RDBA 4FM0A 4DTJA 4FLXA 4CGJA 1F21A 5C25A 4N76A 3AVAA 1RDDA 1RT5A 5CYMA 5J2PA 4CJQA 3SQ4A 4CHOA 4N5SA 4DFJA 5KGWA 3LPTA 5SWMA 4FJNA 1C6VA 1WN7A 4OGEA 3M8PA 5EU7A 4DSLA 1BCOA 3SUQA 3HPHA 4O0IA 5K14A 4FCYA 3OY9A 1BL3A 4RW9A 2E6LA 4CFAA 4HCBA 2D5RA 4DTSA 4FJMA 4KRFA 3VN5A 1VRUA 1C0UA 1FKOA 3V9WA 5KRSA 3RR8A 3AA2A 4IFVA 3V9UA 1CZBA 1RDAA 5FDLA 4BACA 3KD5E 2JLEA 3RMBA 3HO1A 2PYJA 4DTNA 1UOCA 2XY8A 4J2AA 2YNFA 3KLGA 4FYDA 3AVFA 3OYMA 1TL1A 4CGDA 3NH2A 4I9LA 4DQQA 4FJXA 3MEEA 1TK5A 3QESA 1UWBA 4HUFA 4BE2A 3M8QA 4FLWA 4KREA 1YVUA 3AVLA 4WE1A 1X9SA 3F9KA 4NCAA 1RTIA 3HPGA 4ELTA 4KHQA 1ASVA 3SV3A 4HHTA 3DMJA 3RRHA 4CHYA 1NK7A 1RT4A 1QQCA 3LDSA 3SPYA 3ALYA 5CZ2A 4IG0A 2LSNA 1QSSA 4I9QA 4LSNA 3OYNA 3QEWA 4DTPA 2EHGA 3V1QA 5J1EA 1RILA 2B6AA 2OA8A 2GBZA 4ID1A 3OS2A 1SL2A 3NGZA 3AA4A 3PUFA 3ZSVA 1NK8A 3ZSRA 1A5XA 4GVMA 3SPZA 1JXBA 4O0JA 4B08A 2OPPA 2PZSA 2GUIA 2Z1IA 1WSGA 3CFPA 4FJJA 1SKWA 4KI4A 2A1RA 2IAJA 4AILC 4DWIA 2YNGA 3WNFA 4CIEA 1KVAA 4DU1A 3U3GA 2E4LA 3OYEA 2G8VA 4RW4A 3TAMA 3O3FA 5J2MA 4CEOA 4QAGA 1RT6A 3OS1A 3CFRA 3TAFA 2PYLA 1BHLA 3ZSYA 1CXUA 1S9GA 3F73A 1W0HA 1L3VA 1SUQA 3D0PA 3HSTB 3VQ4A 4Z4IA 3CQ8A 2O4IA 3L2RA 1TKXA 4KTZA 1Q9XA 1ASUA 4RW6A 1SKRA 2P5GA 3KK3A 4FJKA 1QE1A 3NDKA 2HHQA 3MXJA 3B6PA 3AO3A 3L3UA 3OYDA 1KVBA 3TR8A 2QXFA 2VG7A 4O4GA 3VA0A 4AHSA 5HRSA 4Z0UA 4OPJA 3VQQA 1KRPA 4CJ4A 4NCGA 2HW3A 1HJRA 2KQ2A 4LD0A 4ZHRA 4CHPA 1ZBHA 3SUNA 5HROA 1NKCA 3HP6A 4CESA 4CEBA 5SZTA 5E41A 4KO0A 3QIPA 4FLTA 1MU2A 3WNGA 1U45A 4FJHA 3RMAA 2F8SA 3QIOA 2G8KA 2Z1JA 4CF2A 1QS4A 4DTXA 4O44A 3L2WA 1TVRA 4XIUA 2I5JA 2ZD1A 1RTJA 1L3UA 4PWDA 4DQIA 1VSJA 1X9WA 5FRNA 3AVMA 5HRPA 4ELUA 4FZYA 4E0DA 1ZBIA 4OLAA 3CM6A 3ZSWA 1KFSA 2Q3SA 1TKZA 3NE6A 3TAEA 1C1AA 3VQPA 4J2EA 3KK2A 1TKDA 2B4JA 2G8UA 2F96A 3NH0A 3C6TA 3O3HA 2WOMA 4KHYA 3EYZA 2VG6A 3SUPA 3SI6A 3BGRA 3HL8A 2W42A 2HHUA 1DTQA 2HNZA 4CHNA 2XY5A 4ID5A 4CEZA 2BDPA 4B9TA 1JLCA 4FK0A 4FLZA 3OYAA 4AHRA 4CJTA 1NK9A 3KIOA 3OYJA 1SL1A 1A5VA 1JLFA 3PO5A 4R5PA 1FKPA 3T3FA 2XRIA 3ZCMA 4DS4A 2G8FA 3P5JA 1S5JA 2YHBA 4CJPA 4CHQA 2HHWA 3RTVA 1Y97A 3WNEA 4DTRA 2YHAA 3V9ZA 4CEAA 3HPOA 3V6DA 5HRNA 3DOKA 1SV5A 3S9HA 5KRTA 4JS5A 2OPQA 1REVA 1ZBFA 3OVNA 4BE1A 1NOYA 3VQ5A 4Z4FA 3DRRA 1LAVA 3VQCA 1TGOA 4FJ8A 3PX4A 5CYQA 1NK0A 2WONA 3AV9A 4W5NA 1HMVA 4OLBA 4Q0BA 1BQNA 4DTUA 4DSFA 3DLGA 3AO5A 4CJSA 1KCFA 3G10A 4PA1A 1NJWA 3I8DA 4CJVA 4DTOA 4OPKA 2KFZA 2HB5A 4ELVA 4CGIA 1VRTA 1S1XA 3AVKA 4NYFA 2IC3A 1T03A 1X1PA 1LW0A 1ZBUA 2HVIA 3I0SA 3ISNC 1XWLA 4CEQA 3VQDA 3AA3A 1C0MA 3I0RA 4AHUA 3KLHA 1U48A 4KHSA 4HVJA 4DLGA 1GOBA 3LP1A 4ZTFA 5J2QA 4C8LA 4N56A 3TAQA 4B9LA 4BWMA 4EP4A 3KD1E 1I3AA 3TANA 2HHVA 3U6FA 3O4QA 1GOCA 4H4OA 4DFMA 2FC0A 1BI4B 1JLQA 2ATQA 1NK4A 4KI6A 1L3TA 3E01A 4KHWA 3KKRA 4OVLA 3DRPA 1TAQA 3LP0A 1C1BA 1KLMA 5KI6A 4OKJA 4CF0A 3OS0A 4DQSA 3V4IA 3QETA 2OZSA 1U47A 3DM2A 3DI6A 3VQBA 4CK2A 4FLUA 2JGUA 1HNVA 1HQUA 1CZ9A 4DTMA 3DLBA 4BDPA 3P1GA 1NKEA 2OZMA 5I3UA 5CZ1A 4DF8A 4PUOA 4B9MA 3B6OA 2X6NA 4AHCA 3QEXA 3HP9A 5C24A 1IKWA 4O5BA 5JS2A 3ZT0A 3MEDA 1QHTA 1UAXA 4E89A 1EETA 1RT1A 1VSLA 2FBYA 4W5TA 2NUBA 3QO9A 3VQ9A 1KVCA 4H4MA 4FLVA 3DLHA 4KB0A 4Q5VA 4PY5A 3KLFA 2G8WA 3ZSOA 5FRMA 4KFBA 3O3GA 1C0TA 1RDCA 1QSLA 2BGGA 2HHTA 1RBUA 1FK9A 4E19A 1JL1A 1EX4A 4CEFA 1WNSA 1BGXT 1RT3A 3AO1A 3LP2A 2HHSA 2Z1HA 4Y1DA 3L2VA 4I7FA 4TSXA 1Z25A 2FBVA 1LWCA 5J2NA 3SQ2A 1VSFA 4B9SA 2KZMA 4CERA 4C8KA 2Y1IA 3ZT3A 1RBSA 1B9FA 1KLNA 2RF2A 3CFOA 1YTAA 3H08A 3NF7A 2YNHA 1D8YA 5DMRA 2RN2A 3K5OA 4LY7A 3QEVA 3RWUA 4CEDA 1D9DA 2RPIA 4FXDA 1LAWA 4E7HA 1LWFA 3OYCA 3PO4A 4M3WA 2G8HA 4OGCA 4LH4A 4CJ5A 4RW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AVB A;  3DLE A;  4CEE A;  2HHX A;  1VSK A;  3T19 A;  1TK0 A;  4Z4C A;  3TAB A;  2XHB A;  3L3V A;  4F2S A;  4KHN A;  2KZZ A;  3NF6 A;  4M3T A;  4JRQ A;  1EP4 A;  2VWJ A;  1RBV A;  4W5Q A;  3DLR A;  3QNN A;  1IG9 A;  3NF9 A;  3MEC A;  2FBT A;  4J2B A;  3ULD A;  2OPS A;  4KHU A;  2XY7 A;  5D3G A;  3O4N A;  4Z4G A;  1U49 A;  3ZSX A;  3TI0 A;  4IDK A;  3MXM A;  4FJ9 A;  3PX0 A;  3NF8 A;  4AHV A;  1WLJ A;  1QTM A;  3C95 A;  3T1A A;  1BQM A;  1VK0 A;  2VG5 A;  2KW4 A;  3HT3 A;  4CIG A;  3SQ1 A;  1S1T A;  4O55 A;  4F8R A;  5HRR A;  4FK4 A;  1IKV A;  4DU3 A;  4KTQ A;  3HM9 A;  1TAU A;  1GOA A;  3IS9 A;  1HYZ A;  1NK5 A;  4M41 A;  1A5W A;  3OYH A;  4DFK A;  3K2P A;  4CFC A;  2QK9 A;  4KPY A;  4LH5 A;  4KB1 A;  3FFI A;  4NCB A;  3QEP A;  1J53 A;  4OJR A;  4W5O A;  2ZQB A;  3SJJ A;  2KFN A;  3ZSZ A;  1WAF A;  3AVH A;  4CFB A;  4CGH A;  4CGF A;  3NGI A;  4FJL A;  5HP1 A;  1YTU A;  3V1O A;  4DQR A;  4C8O A;  1N5Y A;  4BDY A;  4EZ9 A;  2D0C A;  2G8I A;  4IG3 A;  4DSE A;  5HBM A;  3RMD A;  1XC9 A;  1RTD A;  3LAM A;  4CK1 A;  4W5R A;  4DMN A;  1TV6 A;  4Y1C A;  4DQP A;  5CY4 A;  4EZ6 A;  3UIQ A;  1NOZ A;  3ASM A;  3U3Y A;  4MQ3 A;  3BDP A;  3P83 D;  4CE9 A;  2YV0 X;  2P1J A;  3ZT1 A;  3HVT A;  4CJ3 A;  1IKX A;  4CGG A;  4E7K A;  3RR7 A;  3ITH A;  3KJV A;  1SKS A;  5C42 A;  3CG7 A;  1EXQ A;  1D5A A;  1ZBL A;  3LZI A;  4DS5 A;  1LW2 A;  2B5J A;  1ZYQ A;  3OJU A;  4FJI A;  4IKF A;  2P51 A;  1RBT A;  3TWH A;  1JKH A;  3LAN A;  1HPZ A;  4ICL A;  1QSY A;  3HJF A;  3QER A;  1J9A A;  4JS4 A;  3TAR A;  1NJX A;  1J5O A;  4DSK A;  3NCI A;  1JLB A;  3S3M A;  2X74 A;  3ZSQ A;  4RG8 A;  1J54 A;  4H8K A;  4KKO A;  4YFU A;  1Z26 A;  3AA5 X;  4YNQ A;  4HUE A;  4FZZ A;  4CK3 A;  4K8Z A;  5JS1 A;  2YKM A;  3LAL A;  1S1U A;  4FW1 A;  3KLE A;  3QLH A;  4IFY A;  3SNN A;  2R7Y A;  2HND A;  4HTU A;  3M8S A;  1WSJ A;  3L2Q A;  2PY5 A;  1U04 A;  3K5L A;  3SV4 A;  3OJS A;  4F4K A;  1JLA A;  1S6P A;  4E1N A;  3QNO A;  4QCL A;  2QKB A;  3AVC A;  3K59 A;  4DU4 A;  5KGX A;  3CM5 A;  3LWL A;  4CJE A;  1NJZ A;  1YT3 A;  4CJW A;  4CCH A;  4AH9 A;  4MFB A;  3AO4 A;  4CFD A;  4FZX C;  1IO2 A;  1KFD A;  1D9F A;  5KTQ A;  3VQ6 A;  4E3S A;  3S3O A;  3PY8 A;  4KTW A;  4M42 A;  1HNI A;  2DFE A;  1ITG A;  1S6Q A;  4FW2 A;  4OKE A;  4M3Y A;  3A2F A;  2HMI A;  1BI4 A;  1RTH A;  2XY6 A;  2AJQ A;  3QIN A;  3SQ0 A;  4E1M A;  4QOZ B;  3C94 A;  3MEG A;  4B8C A;  1RNH A;  3WNH A;  2ZE2 A;  1DLO A;  3V9S A;  4FJ5 A;  3KKS A;  2DFH A;  3NAE A;  4B3O A;  3TAP A;  3IAY A;  1L5U A;  4NYN A;  4DG1 A;  4C8N A;  3K5M A;  2OYQ A;  4DF4 A;  4CJF A;  3OYF A;  3L2U A;  4Z4H A;  3HXM A;  3K5N A;  4KV8 A;  4FM1 A;  1XHZ A;  4OKK A;  2BE2 A;  3DLK A;  4FK2 A;  3VQE A;  3K57 A;  3S3N A;  2IOC A;  1B92 A;  1IH7 A;  4M3X A;  3C6U A;  3NBP A;  1CXQ A;  1WSF A;  4IBN A;  1WSE A;  2GV9 A;  4M3R A;  1BIS A;  4E7I A;  1NJY A;  1NKB A;  3G0Z A;  4GW6 A;  4BWJ A;  2Y1J A;  3RRG A;  3KK1 A;  2F8T A;  2IS3 A;  3LPU A;  1S1W A;  3K58 A;  1S9E A;  1T8E A;  4JLH A;  3VQ8 A;  2VWK A;  3JSM A;  1JLG A;  3OYK A;  3OYI A;  2YNI A;  3HVR A;  3AVN A;  3NGY A;  1WSH A;  3D45 A;  3IRX A;  3NFA A;  1VSE A;  1W9H A;  3HK2 A;  4I2Q A;  3HYF A;  4CF8 A;  1G15 A;  4B9V A;  3EZ5 A;  2FBX A;  1HYS A;  4AHT A;  1VSD A;  4GMJ B;  4CHZ A;  3NH1 A;  3LWM A;  5HLF A;  1I39 A;  4I2P A;  4DSI A;  2D0B A;  1UA1 A;  3NHG A;  4PQU A;  4B9U A;  1SL0 A;  3ZT2 A;  3L8B A;  2IDO A;  4N47 A;  1CLQ A;  1C1C A;  2X6S A;  3V1R A;  3JYT A;  4FJG A;  4CJU A;  1Q9Y A;  5I42 A;  4F3T A;  1JXE A;  4F2R A;  3KTQ A;  2A1S A;  1K6Y A;  4KAZ A;  1KSP A;  2X78 A;  3TAG A;  2IGI A;  4M45 A;  3CYM A;  1Q8I A;  4BDZ A;  2Z1G A;  3AVI A;  4FM2 A;  4DSJ A;  2OPR A;  1NK6 A;  2DY4 A;  3ZT4 A;  3SZ2 A;  4CJK A;  3THV A;  2O4G A;  1FXX A;  3MAQ A;  2ETJ A;  1RT2 A;  1TL3 A;  1BCM A;  4JRP A;  4UQG A;  3PV8 A;  1RT7 A;  1LV5 A;  1TK8 A;  1KTQ A;  4CF9 A;  3OYB A;  4F3O A;  1HYV A;  1N6Q A;  4Z4E A;  2YKN A;  4LSL A;  2P5O A;  5T7B A;  1TKT A;  4FLY A;  3VQA A;  4M3Z A;  3RMC A;  3SCX A;  1VSH A;  3LZJ A;  2ITG A;  4E7L A;  2QKK A;  1L3S A;  4CJL A;  2DTU A;  4DLE A;  1JL2 A;  2EX3 A;  3MXI A;  3DOL A;  3M8R A;  1X9M A;  3EY1 A;  4CF1 A;  1R0A A;  1XI1 A;  1IKY A;  1ASW A;  1UA0 A;  3LP3 A;  4HUG A;  4FVM A;  3AVJ A;  4G1Q A;  3VA3 A;  1RBR A;  2RKI A;  2HVH A;  1VSI A;  2DFF A;  5DK5 A;  1HQE A;  1EKE A;  3SYZ A;  3AVG A;  1B9D A;  3DYA A;  4BE0 A;  4M3U A;  4CIF A;  1U4B A;  4RW8 A;  2D0A A;  4EP5 A;  4HCC A;  4K8X A;  4J2D A;  3OYL A;  3LAK A;  3DRS A;  5FRO A;  4B9N A;  3VQ7 A;  1T05 A;  4B8A B;  3IG1 A;  3OYG A;  4CEC A;  1LWE A;  4N41 A;  1JLE A;  1O1W A;  1BIU A;  1BIZ A;  2E6M A;  4CJR A;  4C8M A;  3QEI A;  3PX6 A;  1WAJ A;  1T7P A;  2HNY A;  1HRH A;  1DTT A;  3SUO A;  2XO7 A;  3V81 A;  1XHX A;  1WSI A;  4L8R B;  3AO2 A;  2KTQ A;  4FJ7 A;  4DFP A;  1S1V A;  2BAN A;  3V9X A;  4ZTJ A;  3KLI A;  1VSM A;  4E7J A;  1RCH A;  1RDB A;  4FM0 A;  4DTJ A;  4FLX A;  4CGJ A;  1F21 A;  5C25 A;  4N76 A;  3AVA A;  1RDD A;  1RT5 A;  5CYM A;  5J2P A;  4CJQ A;  3SQ4 A;  4CHO A;  4N5S A;  4DFJ A;  5KGW A;  3LPT A;  5SWM A;  4FJN A;  1C6V A;  1WN7 A;  4OGE A;  3M8P A;  5EU7 A;  4DSL A;  1BCO A;  3SUQ A;  3HPH A;  4O0I A;  5K14 A;  4FCY A;  3OY9 A;  1BL3 A;  4RW9 A;  2E6L A;  4CFA A;  4HCB A;  2D5R A;  4DTS A;  4FJM A;  4KRF A;  3VN5 A;  1VRU A;  1C0U A;  1FKO A;  3V9W A;  5KRS A;  3RR8 A;  3AA2 A;  4IFV A;  3V9U A;  1CZB A;  1RDA A;  5FDL A;  4BAC A;  3KD5 E;  2JLE A;  3RMB A;  3HO1 A;  2PYJ A;  4DTN A;  1UOC A;  2XY8 A;  4J2A A;  2YNF A;  3KLG A;  4FYD A;  3AVF A;  3OYM A;  1TL1 A;  4CGD A;  3NH2 A;  4I9L A;  4DQQ A;  4FJX A;  3MEE A;  1TK5 A;  3QES A;  1UWB A;  4HUF A;  4BE2 A;  3M8Q A;  4FLW A;  4KRE A;  1YVU A;  3AVL A;  4WE1 A;  1X9S A;  3F9K A;  4NCA A;  1RTI A;  3HPG A;  4ELT A;  4KHQ A;  1ASV A;  3SV3 A;  4HHT A;  3DMJ A;  3RRH A;  4CHY A;  1NK7 A;  1RT4 A;  1QQC A;  3LDS A;  3SPY A;  3ALY A;  5CZ2 A;  4IG0 A;  2LSN A;  1QSS A;  4I9Q A;  4LSN A;  3OYN A;  3QEW A;  4DTP A;  2EHG A;  3V1Q A;  5J1E A;  1RIL A;  2B6A A;  2OA8 A;  2GBZ A;  4ID1 A;  3OS2 A;  1SL2 A;  3NGZ A;  3AA4 A;  3PUF A;  3ZSV A;  1NK8 A;  3ZSR A;  1A5X A;  4GVM A;  3SPZ A;  1JXB A;  4O0J A;  4B08 A;  2OPP A;  2PZS A;  2GUI A;  2Z1I A;  1WSG A;  3CFP A;  4FJJ A;  1SKW A;  4KI4 A;  2A1R A;  2IAJ A;  4AIL C;  4DWI A;  2YNG A;  3WNF A;  4CIE A;  1KVA A;  4DU1 A;  3U3G A;  2E4L A;  3OYE A;  2G8V A;  4RW4 A;  3TAM A;  3O3F A;  5J2M A;  4CEO A;  4QAG A;  1RT6 A;  3OS1 A;  3CFR A;  3TAF A;  2PYL A;  1BHL A;  3ZSY A;  1CXU A;  1S9G A;  3F73 A;  1W0H A;  1L3V A;  1SUQ A;  3D0P A;  3HST B;  3VQ4 A;  4Z4I A;  3CQ8 A;  2O4I A;  3L2R A;  1TKX A;  4KTZ A;  1Q9X A;  1ASU A;  4RW6 A;  1SKR A;  2P5G A;  3KK3 A;  4FJK A;  1QE1 A;  3NDK A;  2HHQ A;  3MXJ A;  3B6P A;  3AO3 A;  3L3U A;  3OYD A;  1KVB A;  3TR8 A;  2QXF A;  2VG7 A;  4O4G A;  3VA0 A;  4AHS A;  5HRS A;  4Z0U A;  4OPJ A;  3VQQ A;  1KRP A;  4CJ4 A;  4NCG A;  2HW3 A;  1HJR A;  2KQ2 A;  4LD0 A;  4ZHR A;  4CHP A;  1ZBH A;  3SUN A;  5HRO A;  1NKC A;  3HP6 A;  4CES A;  4CEB A;  5SZT A;  5E41 A;  4KO0 A;  3QIP A;  4FLT A;  1MU2 A;  3WNG A;  1U45 A;  4FJH A;  3RMA A;  2F8S A;  3QIO A;  2G8K A;  2Z1J A;  4CF2 A;  1QS4 A;  4DTX A;  4O44 A;  3L2W A;  1TVR A;  4XIU A;  2I5J A;  2ZD1 A;  1RTJ A;  1L3U A;  4PWD A;  4DQI A;  1VSJ A;  1X9W A;  5FRN A;  3AVM A;  5HRP A;  4ELU A;  4FZY A;  4E0D A;  1ZBI A;  4OLA A;  3CM6 A;  3ZSW A;  1KFS A;  2Q3S A;  1TKZ A;  3NE6 A;  3TAE A;  1C1A A;  3VQP A;  4J2E A;  3KK2 A;  1TKD A;  2B4J A;  2G8U A;  2F96 A;  3NH0 A;  3C6T A;  3O3H A;  2WOM A;  4KHY A;  3EYZ A;  2VG6 A;  3SUP A;  3SI6 A;  3BGR A;  3HL8 A;  2W42 A;  2HHU A;  1DTQ A;  2HNZ A;  4CHN A;  2XY5 A;  4ID5 A;  4CEZ A;  2BDP A;  4B9T A;  1JLC A;  4FK0 A;  4FLZ A;  3OYA A;  4AHR A;  4CJT A;  1NK9 A;  3KIO A;  3OYJ A;  1SL1 A;  1A5V A;  1JLF A;  3PO5 A;  4R5P A;  1FKP A;  3T3F A;  2XRI A;  3ZCM A;  4DS4 A;  2G8F A;  3P5J A;  1S5J A;  2YHB A;  4CJP A;  4CHQ A;  2HHW A;  3RTV A;  1Y97 A;  3WNE A;  4DTR A;  2YHA A;  3V9Z A;  4CEA A;  3HPO A;  3V6D A;  5HRN A;  3DOK A;  1SV5 A;  3S9H A;  5KRT A;  4JS5 A;  2OPQ A;  1REV A;  1ZBF A;  3OVN A;  4BE1 A;  1NOY A;  3VQ5 A;  4Z4F A;  3DRR A;  1LAV A;  3VQC A;  1TGO A;  4FJ8 A;  3PX4 A;  5CYQ A;  1NK0 A;  2WON A;  3AV9 A;  4W5N A;  1HMV A;  4OLB A;  4Q0B A;  1BQN A;  4DTU A;  4DSF A;  3DLG A;  3AO5 A;  4CJS A;  1KCF A;  3G10 A;  4PA1 A;  1NJW A;  3I8D A;  4CJV A;  4DTO A;  4OPK A;  2KFZ A;  2HB5 A;  4ELV A;  4CGI A;  1VRT A;  1S1X A;  3AVK A;  4NYF A;  2IC3 A;  1T03 A;  1X1P A;  1LW0 A;  1ZBU A;  2HVI A;  3I0S A;  3ISN C;  1XWL A;  4CEQ A;  3VQD A;  3AA3 A;  1C0M A;  3I0R A;  4AHU A;  3KLH A;  1U48 A;  4KHS A;  4HVJ A;  4DLG A;  1GOB A;  3LP1 A;  4ZTF A;  5J2Q A;  4C8L A;  4N56 A;  3TAQ A;  4B9L A;  4BWM A;  4EP4 A;  3KD1 E;  1I3A A;  3TAN A;  2HHV A;  3U6F A;  3O4Q A;  1GOC A;  4H4O A;  4DFM A;  2FC0 A;  1BI4 B;  1JLQ A;  2ATQ A;  1NK4 A;  4KI6 A;  1L3T A;  3E01 A;  4KHW A;  3KKR A;  4OVL A;  3DRP A;  1TAQ A;  3LP0 A;  1C1B A;  1KLM A;  5KI6 A;  4OKJ A;  4CF0 A;  3OS0 A;  4DQS A;  3V4I A;  3QET A;  2OZS A;  1U47 A;  3DM2 A;  3DI6 A;  3VQB A;  4CK2 A;  4FLU A;  2JGU A;  1HNV A;  1HQU A;  1CZ9 A;  4DTM A;  3DLB A;  4BDP A;  3P1G A;  1NKE A;  2OZM A;  5I3U A;  5CZ1 A;  4DF8 A;  4PUO A;  4B9M A;  3B6O A;  2X6N A;  4AHC A;  3QEX A;  3HP9 A;  5C24 A;  1IKW A;  4O5B A;  5JS2 A;  3ZT0 A;  3MED A;  1QHT A;  1UAX A;  4E89 A;  1EET A;  1RT1 A;  1VSL A;  2FBY A;  4W5T A;  2NUB A;  3QO9 A;  3VQ9 A;  1KVC A;  4H4M A;  4FLV A;  3DLH A;  4KB0 A;  4Q5V A;  4PY5 A;  3KLF A;  2G8W A;  3ZSO A;  5FRM A;  4KFB A;  3O3G A;  1C0T A;  1RDC A;  1QSL A;  2BGG A;  2HHT A;  1RBU A;  1FK9 A;  4E19 A;  1JL1 A;  1EX4 A;  4CEF A;  1WNS A;  1BGX T;  1RT3 A;  3AO1 A;  3LP2 A;  2HHS A;  2Z1H A;  4Y1D A;  3L2V A;  4I7F A;  4TSX A;  1Z25 A;  2FBV A;  1LWC A;  5J2N A;  3SQ2 A;  1VSF A;  4B9S A;  2KZM A;  4CER A;  4C8K A;  2Y1I A;  3ZT3 A;  1RBS A;  1B9F A;  1KLN A;  2RF2 A;  3CFO A;  1YTA A;  3H08 A;  3NF7 A;  2YNH A;  1D8Y A;  5DMR A;  2RN2 A;  3K5O A;  4LY7 A;  3QEV A;  3RWU A;  4CED A;  1D9D A;  2RPI A;  4FXD A;  1LAW A;  4E7H A;  1LWF A;  3OYC A;  3PO4 A;  4M3W A;  2G8H A;  4OGC A;  4LH4 A;  4CJ5 A;  4RW7 A; 
#chains in the Genus database with same CATH topology
 3AVB A;  3DLE A;  2ZJQ L;  4CEE A;  2HHX A;  4H0T B;  4Z4C A;  3TAB A;  1YAG A;  2W40 A;  2NRX A;  5DM6 L;  3O9T A;  3HI0 A;  1DKG D;  4W5Q A;  1IG9 A;  3NF9 A;  2OPS A;  4KHU A;  3O4N A;  1U49 A;  3EE8 A;  4BRO A;  3TI0 A;  4IDK A;  4AHV A;  1WLJ A;  3QB0 A;  2O8F A;  4PKI A;  4AM6 A;  3SQ1 A;  4CIG A;  4DCH A;  4JKB A;  1IKV A;  2I7P A;  3FE1 A;  1NK5 A;  1A5W A;  2VCP A;  3O5B A;  3OYH A;  3O9U A;  2NLX A;  3R6M A;  1VQM N;  1E3M A;  4H0V B;  4JI5 K;  1J53 A;  4OJR A;  5AZI B;  3OBW A;  3AVH A;  2VWB A;  4CGF A;  3J7A P;  3P39 A;  1V4S A;  5HP1 A;  5FPE A;  4DQR A;  3K9K A;  1XMO K;  4DSE A;  3G25 A;  3GE1 A;  3TPQ A;  3RMD A;  4O8U A;  3P83 D;  2YV0 X;  3A5L C;  2P1J A;  4E7K A;  1IKX A;  3ITH A;  1YIT N;  1SKS A;  5C42 A;  5F1X A;  3CG7 A;  2Q0U A;  3BZK A;  5AQL A;  5TKW A;  3WQT A;  3K0S A;  3LZI A;  1VQ6 N;  1P8Z A;  3HJF A;  2PBD A;  1LOT B;  3CJB A;  3TAR A;  4GV9 A;  2WUS A;  4H8K A;  4BR9 A;  1VQ9 N;  1H1V A;  4BQL A;  4CK3 A;  3LAL A;  4FW1 A;  4FPA A;  3DXK B;  4IFY A;  2R7Y A;  3A0I X;  3VPZ A;  3L2Q A;  2VYP A;  3OJS A;  1JLA A;  5TKY A;  4E1N A;  4QCL A;  1V4T A;  3K59 A;  4DU4 A;  3CPE A;  1YT3 A;  4CJW A;  4BGB A;  4AH9 A;  4MFB A;  5C2F A;  3EE9 A;  1IO2 A;  4OO1 J;  4OKE A;  4M3Y A;  4IOC L;  4CZK A;  3ZX2 A;  3QIN A;  3R9P A;  3SQ0 A;  1T6C A;  3MEG A;  1U6Z A;  1DLO A;  4FJ5 A;  4JKF A;  2DFH A;  3QML A;  3NAE A;  4B3O A;  1VQN N;  4DV1 K;  4NYN A;  3K5M A;  4C8N A;  3J7Z O;  1JCF A;  3L2U A;  3HXM A;  3K5N A;  2YJE A;  2BE2 A;  4A5A A;  4FK2 A;  3VQE A;  3S3N A;  2IOC A;  2NRR A;  3C6U A;  4E7I A;  1CXQ A;  3CI5 A;  4CW7 B;  2IVN A;  1NMN A;  3H46 O;  4JLH A;  4J8F A;  2VWK A;  4JI4 K;  4LF5 K;  2UXD K;  3OYK A;  2YNI A;  4IFE A;  4JI2 K;  3NVM A;  3D45 A;  1W9H A;  1YHQ N;  4CF8 A;  4XEI A;  3EZ5 A;  1VSD A;  3LWM A;  3L0Q A;  4I2P A;  4YDU A;  1UA1 A;  4NLB A;  3NHG A;  4X62 K;  1C1C A;  4L3Q A;  1T6D A;  4F3T A;  4F2R A;  2P9P B;  4BRA A;  4FWO A;  2QA4 N;  1VQ4 N;  1K6Y A;  1KAZ A;  1KSP A;  4FM2 A;  3Q7C A;  2WBN A;  5HOO A;  1NK6 A;  3TTD A;  3SZ2 A;  4AQY K;  2O4G A;  1FXX A;  2E2P A;  3PSI A;  1YJN N;  1T44 A;  1N6Q A;  2P5O A;  4IXC A;  3VOV A;  3VQA A;  3HBT A;  5GAE P;  2UUB K;  3LZJ A;  2YHX A;  4DLE A;  5AQN A;  1JL2 A;  3MX5 A;  3CD6 N;  4JK9 A;  1N33 K;  5JVH L;  4LF7 K;  4FVM A;  5AQQ A;  3VEX A;  1M90 O;  1RBR A;  3VF2 A;  2HVH A;  2DFF A;  5LMN K;  3SYZ A;  4CIF A;  1U4B A;  2Q0R A;  1MWK A;  3LAK A;  4M7X A;  2PFU A;  5FRO A;  3C0B A;  4BR0 A;  3OYG A;  1JLE A;  2ZJP L;  5AZI A;  1DEJ A;  1BIU A;  3VGM A;  2A42 A;  2FF6 A;  3ENO A;  5AQJ A;  4C8M A;  1DTT A;  2XO7 A;  3V81 A;  4L8R B;  2KTQ A;  4B1Z A;  1S1V A;  2BAN A;  1ZC6 A;  4DTJ A;  4BGA A;  1F21 A;  3CCE N;  1RDD A;  1RT5 A;  3SAH A;  4DFJ A;  1BA1 A;  5KGW A;  3WEE B;  1C6V A;  2KHO A;  1O13 A;  4O0I A;  3OY9 A;  4RW9 A;  4BVP A;  1YIJ N;  1OH7 A;  1VRU A;  5JVG L;  3V9W A;  1WOQ A;  3AA2 A;  4IFV A;  4BAC A;  1OH5 A;  3FLC O;  3HO1 A;  3WXK A;  3DXK A;  4IO9 L;  4J2A A;  3VF4 A;  4CGD A;  3NH2 A;  3THW B;  5GAH P;  4FVU A;  3CCV N;  4JKD A;  4FLW A;  4NCA A;  1RTI A;  4NO7 A;  4CD3 A;  3SV3 A;  3DMJ A;  2PAV A;  4CHY A;  3IKM A;  3ALY A;  4WFN L;  2LSN A;  4FWQ A;  5AFU A;  4LSN A;  4DTP A;  2EHG A;  2OA8 A;  2UUC K;  1SL2 A;  4GV6 A;  5FPN A;  3NGZ A;  3AA4 A;  1A5X A;  1JXB A;  4B08 A;  2OPP A;  3CET A;  3P31 A;  1WSG A;  2OCE A;  4CZI A;  4OX9 K;  1ATS A;  1KVA A;  4DU1 A;  1HJO A;  4LF4 K;  1RT6 A;  2J4R A;  3CFR A;  1OH6 A;  3ZSY A;  1S9G A;  4BRE A;  1W0H A;  1J5E K;  3D0P A;  1MWM A;  3HST B;  3VQ4 A;  2O4I A;  2CGL A;  5GAD P;  2P5G A;  4RW6 A;  3CIP A;  3KK3 A;  1QE1 A;  4CZH A;  3BUZ B;  3EO3 A;  2VG7 A;  2NRH A;  1D4X A;  3VQQ A;  1N36 K;  4K41 A;  1HJR A;  4CHP A;  3H1Q A;  3SUN A;  3ZYY X;  1NJI O;  5E41 A;  2P9P A;  4FLT A;  3WNG A;  5AQW A;  2F8S A;  1NGC A;  1QS4 A;  2FXU A;  1TVR A;  3CQX A;  4GKK K;  4H0P A;  1L3U A;  2HOE A;  2IVO A;  2P9S B;  1WBB A;  3ZSW A;  4BG8 A;  1SAZ A;  1TKZ A;  3LL3 A;  1C1A A;  2B4J A;  1BDG A;  2G8U A;  1OVQ A;  3C6T A;  3O3H A;  2WOM A;  5AQP A;  3EYZ A;  2W42 A;  1DTQ A;  4CEZ A;  3LDL A;  3CCM N;  1JLC A;  2VGM A;  4CZE A;  4FLZ A;  4AHR A;  4CJT A;  2JWL A;  3OYJ A;  4OPH A;  1JLF A;  5IT9 O;  2XRI A;  1S5J A;  2F9T A;  3V9Z A;  1HKG A;  3HPO A;  5HRN A;  1SV5 A;  4CBW A;  3OHR A;  5AQS A;  4BE1 A;  5BPN A;  4FO0 A;  4X65 K;  5BRF A;  1NK0 A;  3AV9 A;  2D0P A;  4JHD B;  3MX2 A;  4DTU A;  2V51 B;  3AO5 A;  3PIP L;  4DV2 K;  4K25 A;  1KCF A;  4PA1 A;  4ILH A;  3BEX A;  5AFU H;  3H6E A;  1LW0 A;  3I0S A;  4CEQ A;  2Q31 A;  3WEE A;  1YF5 L;  1GLC G;  4KHS A;  1GOB A;  4ZTF A;  3TAN A;  2HHV A;  3I8B A;  2P9U A;  1XMQ K;  4KI6 A;  1L3T A;  1BO5 O;  4BR2 A;  3KKR A;  3LP0 A;  4JN4 A;  4XH5 A;  3GOI A;  4JKC A;  3DM2 A;  3LM9 A;  4CK2 A;  1HNV A;  3OTO K;  1IJJ A;  1NKE A;  2OZM A;  5CZ1 A;  3THW A;  2QWQ A;  4WFA L;  3QEX A;  4O5B A;  4R79 A;  4DR2 K;  4DUY K;  1ZXO A;  4H5T A;  4F9O A;  1VSL A;  1KQS M;  2NUB A;  3VEZ A;  1KVC A;  4KB0 A;  1HPM A;  2OTJ N;  5F0X A;  4KFB A;  1RDC A;  1RBU A;  1FK9 A;  4E19 A;  2ZGZ A;  4CEF A;  1HKB A;  1LWC A;  1OKJ A;  5ADX A;  1QQO A;  3AGK A;  4CER A;  4C8K A;  3ZT3 A;  4A2B A;  2GX9 A;  3SMS A;  1D8Y A;  3MK6 A;  1JCE A;  2RN2 A;  4LY7 A;  4CZL A;  4LH4 A;  3L4I A;  2ITM A;  4ISG A;  2HBL A;  2P9I B;  4JRQ A;  1VQ7 N;  5FLX O;  3G71 N;  1G99 A;  2UYT A;  3IUC A;  2ZJR L;  2E88 A;  1HR0 K;  2XY7 A;  4JV5 K;  3QDK A;  3ZSX A;  4BRD A;  3PX0 A;  2W6K A;  1W2B M;  1BQM A;  1Z6R A;  3HT3 A;  1S1T A;  5HRR A;  4FK4 A;  2KKZ A;  5JIC A;  4NXN K;  3IFR A;  1YJ9 N;  4DFK A;  3K2P A;  4CFC A;  2QM1 A;  2P9S A;  4LH5 A;  4NCB A;  3M3Z A;  3FZM A;  5M1O A;  4W5O A;  3NGI A;  4CGH A;  1TUY A;  3CCQ N;  4FJL A;  1YTU A;  4IG3 A;  5HBM A;  1XC9 A;  4W5R A;  3FZF A;  3BDP A;  4YY3 K;  1BU6 O;  4B1Y B;  3CC4 N;  3KJV A;  3Q7B A;  1GLF O;  5C15 A;  1EXQ A;  1ZBL A;  4DS5 A;  1LW2 A;  2B5J A;  1RBT A;  3C7N B;  1JKH A;  4ICL A;  3T7Z A;  3QER A;  1J9A A;  4AM7 A;  4JS4 A;  1NJX A;  4BRP A;  4DSK A;  3UE5 A;  3NCI A;  3S3M A;  4RG8 A;  5B8H A;  2GEM A;  1Z26 A;  3AA5 X;  4YNQ A;  4JHD A;  5M1N A;  1NGJ A;  1S1U A;  2HND A;  4DV5 K;  2PY5 A;  4MO5 A;  1U04 A;  4PL8 A;  3SV4 A;  3G4S N;  3QNO A;  3AVC A;  3ZX0 A;  1VQK N;  3RVC A;  4H0X B;  5ADX H;  2A40 A;  3VQ6 A;  4E3S A;  3S3O A;  4M42 A;  2QXL A;  1RTH A;  1K73 O;  3DXM B;  3KVG A;  2V52 B;  3C94 A;  2E5L K;  1RNH A;  2ZE2 A;  1KAY A;  3KKS A;  4PL7 A;  3TAP A;  1GLA G;  1L5U A;  4DG1 A;  2OYQ A;  4CJF A;  3OYF A;  4Z4H A;  1BOT O;  4C1N K;  3DLK A;  5GIO A;  1B92 A;  4M3R A;  1WSE A;  3P38 A;  1BIS A;  1NJY A;  3G0Z A;  2GWK A;  3M5R A;  4GW6 A;  4BWJ A;  3RRG A;  3VEV A;  1E4F T;  3K58 A;  1T8E A;  3OA9 A;  3U8X A;  3AVN A;  4NB4 A;  3VGL A;  4I2Q A;  4A5B A;  4B9V A;  3CJ1 A;  4DR6 K;  1HYS A;  3OW2 M;  1Q7Y O;  4FWN A;  4PQU A;  4H5N A;  2H3G X;  5AQK A;  1KXP A;  3ZT2 A;  1SL0 A;  4DV6 K;  3JYT A;  4FJG A;  5I42 A;  5AQH A;  1Q86 O;  3KTQ A;  5LMU K;  3VTH A;  2IGI A;  1Q8I A;  1W97 L;  2Z1G A;  4BDZ A;  4IWV A;  2JWK A;  4DSJ A;  4FOE A;  3ZT4 A;  4CJK A;  2A41 A;  5E26 A;  1RT2 A;  4JRP A;  4UQG A;  3PV8 A;  1RT7 A;  4F3O A;  2P9I A;  1HYV A;  4Z4E A;  2YKN A;  5T7B A;  3THX B;  3M6G A;  3RMC A;  1C0F A;  3SAG A;  2AP1 A;  2YI1 A;  1X9M A;  3EY1 A;  1R0A A;  1XI1 A;  3U4L A;  4Y0W A;  3LP3 A;  4EIA A;  1UA0 A;  3AVJ A;  4G1Q A;  3VA3 A;  4CZG A;  2RKI A;  1VSI A;  3CJC A;  3R8E A;  1EKE A;  4GV3 A;  4BE0 A;  5BRD A;  5AQI A;  3WUH A;  5EY4 A;  4X64 K;  4J2D A;  4B9N A;  3VQ7 A;  1T05 A;  3IG1 A;  4BVO A;  1XNQ K;  2VQF K;  2E6M A;  2FSK A;  3QEI A;  1WAJ A;  1HRH A;  1XHX A;  1NU0 A;  4FJ7 A;  4DFP A;  3V9X A;  1VSM A;  4FLX A;  5C25 A;  5CYM A;  5J2P A;  4CHO A;  5SWM A;  4OGE A;  5AQM A;  3M8P A;  5EU7 A;  3HPH A;  3J8A A;  5JLH A;  3C7N A;  5AQZ A;  3GBT A;  4CZM A;  4DTS A;  4KRF A;  3SMP A;  2QWN A;  5FDL A;  4JI0 K;  2PYJ A;  3CJ7 A;  3NMU A;  3MN9 A;  1QQM A;  3AVF A;  3OYM A;  4I9L A;  3MEE A;  1UWB A;  4HUF A;  1SS6 A;  1U2V B;  1YVU A;  3AVL A;  2QWP A;  3HPG A;  5M1F A;  1ASV A;  3KWG A;  1QQC A;  2YCH A;  3SPY A;  5CZ2 A;  4IG0 A;  3OYN A;  3V1Q A;  3H3O B;  2GBZ A;  3OS2 A;  3DXM A;  3PUF A;  1NK8 A;  4DV0 K;  3ZSR A;  4EHU A;  2QTD A;  2GUI A;  2Z1I A;  1SKW A;  3A8Y A;  2A1R A;  4AIL C;  4HWI A;  4JKH A;  3U3G A;  4LF8 K;  4RW4 A;  5JMV A;  3TAM A;  4U7B A;  3O3F A;  4DV7 K;  1I94 K;  3OS1 A;  3PSF A;  3A5O C;  1BHL A;  2E2N A;  5AQR A;  3ATU A;  3ID8 A;  1L3V A;  1NGB A;  3L2R A;  1RDW X;  4FJK A;  3MXJ A;  3OYD A;  1KVB A;  3LDP A;  3TR8 A;  4O4G A;  4AHS A;  4H5R A;  3CC7 N;  4OPJ A;  4CJ4 A;  5AQO A;  2KQ2 A;  1GLD G;  3CPW M;  1MU2 A;  4FJH A;  3AAP A;  2G8K A;  2Z1J A;  4FYD A;  2ZD1 A;  4PWD A;  2P9L B;  1WUA A;  3AVM A;  4JEP A;  4ELU A;  1ZBI A;  4E0D A;  1KFS A;  2Q3S A;  1X3N A;  3TAE A;  4RWT A;  1MDU B;  1NLV A;  1VQL N;  1TKD A;  3CCU N;  5EXW A;  3THX A;  1OVY A;  3HL8 A;  2HHU A;  2HNZ A;  4CHN A;  4U67 L;  3QBW A;  2BDP A;  3OYA A;  4IEE A;  1NK9 A;  2WTU A;  1SL1 A;  4DHY A;  3TSQ A;  3VEY A;  3PO5 A;  3T3F A;  3CCL N;  3P5J A;  2HHW A;  3RTV A;  2YHA A;  1NNE A;  2E20 A;  3A5N C;  4JK8 A;  4JS5 A;  2OPQ A;  4LFA K;  3DRR A;  1LAV A;  1TGO A;  2QEX N;  4DSF A;  3DLG A;  4CJS A;  3IMX A;  3G10 A;  3ENB A;  3IDH A;  5AZJ B;  2P9U B;  3WQU A;  5I9E B;  3P4I A;  1S1X A;  3SBT A;  1NGE A;  2HVI A;  3VQD A;  3AA3 A;  4AHU A;  5C0Y A;  3MN6 A;  4DLG A;  5GAG P;  2FC0 A;  1GLL O;  1NK4 A;  3E01 A;  3CCJ N;  1TAQ A;  3C6H A;  1C1B A;  4PKG A;  5KI6 A;  4OKJ A;  4CF0 A;  3V4I A;  1HNX K;  4FWR A;  3GDQ A;  4O8K A;  4BC4 A;  1IBM K;  3FZK A;  5I3U A;  4PUO A;  4LFC K;  3B6O A;  3R3L A;  1IKW A;  5JS2 A;  4M7Y A;  1U2V A;  1QHT A;  1UAX A;  5E84 A;  1RT1 A;  4JD2 A;  3VEN A;  3VET A;  4W5T A;  4PY5 A;  4Q5V A;  3KLF A;  3ZSO A;  2BGG A;  1JL1 A;  3K9J A;  2W41 A;  1EX4 A;  1WNS A;  4WF9 L;  1RT3 A;  2HHS A;  2Z1H A;  4Y1D A;  3E1Y A;  3ZLJ A;  4TSX A;  1VAZ A;  2KZM A;  1BUP A;  5EVZ A;  1B9F A;  2GTD A;  2RF2 A;  2YNH A;  2P9K B;  5GIN A;  1OH8 A;  2RPI A;  4FXD A;  1LAW A;  4DR4 K;  3OYC A;  4M3W A;  3VGK A;  2G8H A;  3BF1 A;  5HRS A;  3MWT A;  2RE2 A;  4B1W B;  1HUX A;  1VSK A;  3N4P A;  2XHB A;  1HNW K;  2NRW A;  1TYQ A;  4JI7 K;  1WBD A;  4A61 A;  4DB3 A;  3MEC A;  2FBT A;  4J2B A;  3ULD A;  3U9Z A;  5AQF A;  2QWO A;  4Z4G A;  1QTM A;  3C95 A;  3T1A A;  2ASO A;  4O55 A;  4XH4 A;  4DU3 A;  1ATN A;  3BP8 A;  2HF4 A;  1GOA A;  3IS9 A;  2P9L A;  4M41 A;  2HHH K;  3LM2 A;  2QK9 A;  4KPY A;  4KB1 A;  4KH6 A;  3FFI A;  3QEP A;  1GLE G;  2ZQB A;  3SJJ A;  3EKS A;  3ZSZ A;  1N5Y A;  3GL1 A;  4BDY A;  4EZ9 A;  2D0C A;  3MCA B;  2G8I A;  1RTD A;  3LAM A;  4CK1 A;  4DMN A;  4DQP A;  3BZC A;  3ASM A;  3U3Y A;  4LF6 K;  3ZT1 A;  4CJ3 A;  3O8M A;  4FJI A;  4MLE A;  1ZYQ A;  1VQ5 N;  1XUP O;  4B3M K;  3TWH A;  3LAN A;  4I6M B;  4A57 A;  1QHA A;  4CD1 A;  1J5O A;  5LY3 A;  4JYA K;  2GWJ A;  3MN5 A;  5EX5 A;  4FZZ A;  4K8Z A;  5JS1 A;  3D6R A;  5AZJ A;  3QLH A;  3SNN A;  4LF9 K;  4HTU A;  2EWS A;  4FWP A;  1NGH A;  1NJZ A;  3CM5 A;  1NWK A;  1S22 A;  2ZF5 O;  4CFD A;  4FZX C;  1LCU A;  5KTQ A;  3MMV A;  5M1P A;  5BR8 K;  3PY8 A;  4KTW A;  2DFE A;  1S6Q A;  1QZ6 A;  5AR0 A;  1NG9 A;  4QOZ B;  4E1M A;  3AAR A;  4B8C A;  3WNH A;  4FL9 A;  1JCG A;  3J80 O;  1BG3 A;  3O9R A;  4DUZ K;  5KPZ A;  3H45 C;  3VF6 A;  4A59 A;  4K0K K;  4OKK A;  1C0G A;  3K57 A;  5HL7 L;  4ISF A;  4M3X A;  1BWF O;  4IBN A;  1WSF A;  3O6W A;  1NKB A;  2GV9 A;  3W0L A;  2F8T A;  2IS3 A;  1IV0 A;  1S9E A;  3D2F B;  3VQ8 A;  3JSM A;  1DGK N;  2IIR A;  3IRX A;  3VMF B;  3NFA A;  1VSE A;  4YOV A;  3LDO A;  3HK2 A;  2E2O A;  3HYF A;  4OPA A;  2FBX A;  4AHT A;  4GMJ B;  4IOX A;  5HLF A;  2QWM A;  2D0B A;  1HX1 A;  4B9U A;  2DPN A;  2IDO A;  4N47 A;  3M1F A;  1CLQ A;  4BC2 A;  2HBK A;  3LDN A;  4H0Y B;  2A1S A;  2P9K A;  4KAZ A;  3TAG A;  4JNE A;  1Y64 A;  4M45 A;  3CYM A;  2OPR A;  2DY4 A;  3HOT A;  4WQ4 C;  3MAQ A;  4Z94 A;  1TL3 A;  1BCM A;  5BN9 A;  1TK8 A;  1KTQ A;  1TKT A;  3SCX A;  1VSH A;  3DAW A;  3QBX A;  2RHK A;  4E7L A;  1L3S A;  4CJL A;  4DR7 K;  2DTU A;  3JXU A;  3MXI A;  1R59 O;  3M8R A;  3CJ9 A;  1IKY A;  1ASW A;  4LC9 B;  3W3D A;  1HQE A;  3KHY A;  3AVG A;  1B9D A;  4M3U A;  4QS9 A;  4RW8 A;  2D0A A;  4GKJ K;  4GVE A;  4ILG B;  3RSE A;  3DRS A;  4B8A B;  3C65 A;  3I56 N;  4CEC A;  1LWE A;  1RGI A;  3MDQ A;  4N41 A;  4LFB K;  1BIZ A;  2E8A A;  2CH5 A;  3I55 N;  4JI8 K;  3PX6 A;  4CZF A;  5MLC Q;  1DT9 A;  1WSI A;  1ILY A;  3SK3 A;  3HM8 A;  4BRK A;  4ZTJ A;  3KLI A;  4E7J A;  1RCH A;  1RDB A;  1QVG M;  1EWQ A;  4CGJ A;  4N76 A;  4CJQ A;  4FJN A;  1WN7 A;  3FFK B;  1X9J A;  4WCE L;  3DWL A;  3CHW A;  3F9M A;  1NGI A;  3SUQ A;  2HMP A;  5K14 A;  4FCY A;  4I6M A;  1BL3 A;  2E6L A;  4H0O A;  4HCB A;  2D5R A;  5DM7 L;  3UB5 A;  3VN5 A;  1C0U A;  4BRF A;  1QVF M;  1FKO A;  1X3M A;  4G9Z A;  4BR4 A;  3KD5 E;  1Q81 O;  1CZB A;  4NXM K;  3J7Y P;  3RMB A;  3H3N O;  1UOC A;  3QFU A;  3ZX3 A;  4KH4 A;  1TK5 A;  2QW9 A;  3QES A;  2KLA A;  4BE2 A;  3M8Q A;  1T3V A;  3DJC A;  2VQE K;  1X9S A;  3F9K A;  4GY2 B;  4KHQ A;  4B3T K;  3O1B A;  5C10 A;  3UKU B;  1NK7 A;  3O9Q A;  4MDA A;  4I9Q A;  4H5V A;  1RIL A;  4BG9 A;  3J81 O;  4ID1 A;  3SPZ A;  4O0J A;  4BRI A;  3ZET A;  2PZS A;  4IZ9 A;  4FJJ A;  4KI4 A;  4DWI A;  2YNG A;  3WNF A;  2E4L A;  2G8V A;  2HBM A;  5J2M A;  3HSC A;  4CEO A;  4WQ5 C;  3NVK A;  3KK7 A;  2CGK A;  1CXU A;  3D2F A;  3F73 A;  4JKG B;  1SUQ A;  3CQ8 A;  2CGJ A;  1Q9X A;  2KFN A;  1ASU A;  2HHQ A;  3NDK A;  3FZH A;  3AO3 A;  3L3U A;  2NRZ A;  4B3S K;  3VA0 A;  3EL2 A;  2O8E A;  4Z0U A;  2F7T A;  4NCG A;  4ZHR A;  3ENH A;  1ZBH A;  3THY B;  5HRO A;  1NKC A;  4CJ7 A;  3HP6 A;  5SZT A;  3FR0 A;  4KO0 A;  1NGG A;  3RMA A;  3QIO A;  4O44 A;  3L2W A;  2I5J A;  3MN7 A;  4DQI A;  1VSJ A;  1X9W A;  1HKC A;  4EAH D;  4OLA A;  4FZY A;  3NE6 A;  1IG8 A;  4EHT A;  4J2E A;  3KK2 A;  2F96 A;  1K8K B;  3NH0 A;  3SI6 A;  5EOY A;  3BGR A;  1NGD A;  4ID5 A;  2FSJ A;  4B9T A;  4FK0 A;  5FPD A;  1M1K O;  3KIO A;  3E66 A;  2FSN A;  2UXB K;  3AY9 A;  3ZCM A;  4BC3 A;  2WC9 A;  1Y97 A;  3R1X A;  3WT0 A;  3SBG A;  4CEA A;  3DOK A;  4JI3 K;  2NRV A;  5KRT A;  1REV A;  1ZBF A;  3OVN A;  4BRL A;  1NOY A;  3VQ5 A;  3VTI A;  4Z4F A;  3VQC A;  3AAQ A;  4FJ8 A;  3PX4 A;  2W6L A;  5CYQ A;  2WON A;  3EKU A;  4W5N A;  4Q0B A;  1BQN A;  4H5W A;  3I8D A;  4CJV A;  4PKH A;  2OAN A;  1EO1 A;  4DTO A;  3CCS N;  2HB5 A;  4ELV A;  4B1X B;  4BRM A;  4NYF A;  1X1P A;  1ZBU A;  5H1S Q;  1XWL A;  2Q97 A;  1ATR A;  3KLH A;  3I0R A;  3ATV A;  3LP1 A;  5J2Q A;  4IOA L;  4WFB L;  4B9L A;  1P90 A;  5AQX A;  5KPT A;  3KD1 E;  1I3A A;  3VER A;  2A5X A;  1MA9 B;  1GOC A;  1BI4 B;  3ID6 A;  5CHI A;  4IO8 A;  3DRP A;  1KLM A;  1VQ8 N;  3SAF A;  1RDU A;  4JD2 B;  4CBX A;  5BPM A;  3O08 A;  2OZS A;  3A5M C;  3DI6 A;  4FLU A;  1CZ9 A;  4DTM A;  2P9N A;  3EZW A;  4CI6 A;  4DF8 A;  3CC2 N;  2X6N A;  4AHC A;  3ZT0 A;  3D7E O;  3MED A;  3E9O A;  4E89 A;  4DV4 K;  4H4M A;  3UKU A;  2D1K A;  1Q82 O;  2YHW A;  5FRM A;  2VGN A;  3O3G A;  1C0T A;  3GG4 A;  5AQV A;  1QSL A;  4GNI A;  2UU9 K;  3AO1 A;  3LP2 A;  2NZT A;  3AGR A;  4DV3 K;  2F9W A;  4I7F A;  1Z25 A;  2FBV A;  5J2N A;  2A6A A;  3SQ2 A;  2HBJ A;  1YTA A;  3H08 A;  4PHT X;  1TYQ B;  3C6A A;  5IWA K;  5DMR A;  4BRG A;  3K5O A;  3QEV A;  5M1Q A;  3RWU A;  1D9D A;  1LWF A;  3PO4 A;  3T1H K;  5JLF A;  4JKG A;  4V19 S;  3JAM O;  3T19 A;  1K9M O;  1TK0 A;  4F2S A;  4KHN A;  2NNW A;  3L3V A;  3UKR A;  3CME N;  2KZZ A;  3NF6 A;  4M3T A;  1EP4 A;  2VWJ A;  1RBV A;  3DLR A;  3QNN A;  5D3G A;  3D2E B;  5M1K A;  3MXM A;  3THY A;  4FJ9 A;  3E9P A;  3NF8 A;  4CBU A;  4FWM A;  1VK0 A;  4EFH A;  2VG5 A;  2KW4 A;  4F8R A;  1VQO N;  5LL6 Z;  1SQK A;  4KTQ A;  3HM9 A;  1TAU A;  1KAX A;  2HF3 A;  1HYZ A;  4H03 B;  4B1V A;  2FF3 B;  1QQN A;  3N4Q A;  1K8K A;  1WAF A;  4WQ4 A;  4CFB A;  3I33 A;  3V1O A;  4C8O A;  4EZ6 A;  1TV6 A;  4Y1C A;  3UIQ A;  5CY4 A;  1NOZ A;  4MQ3 A;  4CE9 A;  3HVT A;  4XH1 A;  4CGG A;  3JS6 A;  3RR7 A;  1D5A A;  3EEQ A;  3F5T A;  4IKF A;  3OJU A;  2O8D B;  2P51 A;  1QSY A;  1HPZ A;  3TTC A;  5GIP A;  4UY8 O;  1JLB A;  2X74 A;  3ZSQ A;  1J54 A;  4B3R K;  4KKO A;  3PIO L;  4YFU A;  4HUE A;  1XQS C;  4WYB A;  4JKA A;  2YKM A;  2Q2R A;  3KLE A;  3M8S A;  1WSJ A;  4YHH K;  4A62 A;  1RFQ A;  3K5L A;  4RCH A;  3EN9 A;  5C12 A;  4F4K A;  2YX6 A;  1S6P A;  2QKB A;  1YI2 N;  5KGX A;  3LWL A;  4CJE A;  4CCH A;  3VEW A;  3AO4 A;  1KFD A;  1D9F A;  5CE3 A;  1HNI A;  1ITG A;  4FW2 A;  3A2F A;  2HMI A;  1BI4 A;  2XY6 A;  2AJQ A;  3FGU A;  3V9S A;  5AQT A;  3IAY A;  5ELZ A;  1BA0 A;  2A3Z A;  4DF4 A;  3CMA N;  1YXQ A;  4FM1 A;  1XHZ A;  4BRH A;  4KV8 A;  4FPB A;  1IH7 A;  3NBP A;  3SLC A;  2FLO A;  2Y1J A;  3KK1 A;  3LPU A;  1S1W A;  4CZJ A;  4BC5 A;  1JLG A;  4K43 A;  3QFP A;  3OYI A;  3HVR A;  3NGY A;  1WSH A;  1VQP N;  1G15 A;  1WB9 A;  5A2Q O;  3CCR N;  4CHZ A;  3NH1 A;  2QWL A;  1I39 A;  4BR5 A;  1NMD A;  4DSI A;  3ZEU B;  1W7A A;  1YUW A;  4FSV A;  3L8B A;  2X6S A;  3V1R A;  4CJU A;  1Q9Y A;  1NBW A;  3MCP A;  4X66 K;  5AQY A;  1JXE A;  4IDH A;  2X78 A;  2E2Q A;  5F2R A;  3AVI A;  4WQ5 A;  3THV A;  5C2D A;  2ETJ A;  3B8A X;  4MDB A;  4IEI A;  2V7Y A;  1LV5 A;  4CF9 A;  3OYB A;  4FWK A;  1K8A O;  2O8C B;  3QIC A;  4LSL A;  4E1J A;  4FLY A;  4M3Z A;  3RSE B;  3O4W A;  1KC8 O;  2ITG A;  2BH1 A;  2ZM6 K;  2QKK A;  1ESV A;  3D2E A;  2EX3 A;  3CJA A;  4AF1 A;  3DOL A;  4CF1 A;  4HUG A;  5LJW A;  5DK5 A;  3DYA A;  4EP5 A;  4HCC A;  4K8X A;  2GEL A;  3OYL A;  4YOT A;  4YOW A;  1O1W A;  4RTF D;  4JK7 A;  4K42 A;  4CJR A;  4YOX A;  1T7P A;  1YVN A;  2HNY A;  3SUO A;  3AO2 A;  5KQD A;  3HZ6 A;  2HST A;  2V7Z A;  5KPR A;  4FM0 A;  3AVA A;  3SQ4 A;  4N5S A;  1GLJ O;  3LPT A;  3HRG A;  5BR9 A;  1NGA A;  4DR5 K;  4DSL A;  1BCO A;  4C1N I;  3WXI A;  1EQY A;  3CQY A;  3LDQ A;  5BRH A;  2O8D A;  1E4G T;  2O8B B;  1TUU A;  4IJA A;  4CFA A;  2BTF A;  4FJM A;  4JAX A;  3TSP A;  3O80 A;  5KRS A;  3ULE B;  3RR8 A;  3V9U A;  1RDA A;  2JLE A;  4JKE A;  3WXL A;  3S41 A;  1N34 K;  3MWP A;  4DTN A;  4NLC A;  2XY8 A;  5AJ3 K;  2YNF A;  3KLG A;  5BN8 A;  5FPM A;  1TL1 A;  4BRC A;  4DQQ A;  4FJX A;  3ZET B;  4JI6 K;  3FZL A;  4KRE A;  4WE1 A;  4ELT A;  3BF3 A;  3VEO A;  4HHT A;  3RRH A;  1RT4 A;  3LDS A;  1QSS A;  4YDU C;  3QEW A;  2F4V K;  5J1E A;  2B6A A;  2Q36 A;  4HTL A;  3TTF A;  3WXJ A;  2UUA K;  3ZSV A;  2GUP A;  4GVM A;  3CFP A;  2IAJ A;  1EWR A;  4CIE A;  3OYE A;  2OTL N;  4QS7 A;  4QAG A;  3TAF A;  2O8E B;  2PYL A;  3DLL L;  5BRE A;  2ASM A;  4C23 A;  4FWS A;  4ISE A;  4M63 C;  4Z4I A;  2E1Y A;  2YHY A;  1TKX A;  4KTZ A;  1SZ2 A;  1SKR A;  3B6P A;  3KWI A;  2QXF A;  2UXC K;  3ZEU A;  1KRP A;  3TSU A;  2HW3 A;  4LD0 A;  4JI1 K;  2O8F B;  1Q18 A;  3E9L A;  4BR7 A;  4CEB A;  4CES A;  3QIP A;  1XC3 A;  1U45 A;  4DQ8 A;  4CF2 A;  4DTX A;  4XIU A;  1GLB G;  1RTJ A;  3OBY A;  5FRN A;  5HRP A;  1Z05 A;  3CM6 A;  3WXM B;  1IBL K;  2QWR A;  2Q1N A;  3VQP A;  2O8C A;  3O9S A;  1HNZ K;  4KHY A;  2VG6 A;  3SUP A;  2WFB A;  1NGF A;  3CER A;  3L6Q A;  1NM1 A;  2XY5 A;  4DR1 K;  4BQZ A;  2IVP A;  1A5V A;  4KBO A;  4B1U B;  4R5P A;  1FKP A;  4FWL A;  4DS4 A;  2G8F A;  1ZBS A;  2YHB A;  2D4W A;  4CJP A;  4CHQ A;  3WNE A;  4DTR A;  3V6D A;  3BY5 A;  3S9H A;  2ASP A;  5KQ8 A;  5AQG A;  3VES A;  1HMV A;  4OLB A;  3SJH A;  1NJW A;  3F2K A;  1N8R O;  4MLH A;  4OPK A;  4MO4 A;  2KFZ A;  4YOU A;  4CGI A;  1VRT A;  3AVK A;  4YOY A;  2NRT A;  1HLU A;  2IC3 A;  2ZWH A;  1T03 A;  1IBK K;  3ISN C;  1CZA N;  3TU5 A;  1C0M A;  1U48 A;  1JJ2 M;  4HVJ A;  4C8L A;  1FW6 A;  3T69 A;  5LJV A;  4N56 A;  3TAQ A;  1KD1 O;  4BWM A;  4EP4 A;  5BPL A;  2O8B A;  3HOS A;  3U6F A;  3O4Q A;  4DFM A;  4H4O A;  3CF5 L;  2D0O A;  1JLQ A;  2P9N B;  2ATQ A;  4ILJ A;  5CR4 A;  4KHW A;  4OVL A;  3G6E N;  3OS0 A;  4DQS A;  4KH5 A;  3QET A;  3ULE A;  4BY9 C;  4QS8 A;  1U47 A;  3H1V X;  3VQB A;  1QZ5 A;  2JGU A;  4KHP K;  1HQU A;  1XNR K;  2QI2 A;  1VHX A;  4DKW A;  3DLB A;  4BDP A;  5AQU A;  3P1G A;  4O5F A;  4B9M A;  3L4Q A;  3HTV A;  3HP9 A;  5C24 A;  1EET A;  1S3X A;  2FBY A;  3QO9 A;  4IJN A;  2I7N A;  3VQ9 A;  4FLV A;  3DLH A;  2E1Z A;  4YOR A;  1N32 K;  2G8W A;  2HHT A;  3PLA A;  1J6Z A;  4A2A A;  3U9D A;  4BRQ A;  1BGX T;  3KZB A;  3O1W A;  2CH6 A;  1YJW N;  3L2V A;  1FJG K;  3CXC M;  1VSF A;  4B9S A;  2Y1I A;  1RBS A;  3UKR B;  1KLN A;  3CFO A;  2ZGY A;  3NF7 A;  2BUP A;  4DR3 K;  3T1Y K;  4CED A;  4BRN A;  4FOI A;  4CVN E;  4B9Q A;  4E7H A;  2AA4 A;  4OGC A;  4CJ5 A;  1S72 N;  4RW7 A;  2YJF A; 
#chains in the Genus database with same CATH homology
 3AVB A;  3DLE A;  4CEE A;  2HHX A;  1VSK A;  3T19 A;  1TK0 A;  4Z4C A;  3TAB A;  2XHB A;  3L3V A;  4F2S A;  4KHN A;  2KZZ A;  3NF6 A;  4M3T A;  4JRQ A;  1EP4 A;  2VWJ A;  1RBV A;  4W5Q A;  3DLR A;  3QNN A;  1IG9 A;  3NF9 A;  3MEC A;  2FBT A;  4J2B A;  3ULD A;  2OPS A;  4KHU A;  2XY7 A;  5D3G A;  3O4N A;  4Z4G A;  1U49 A;  3ZSX A;  3TI0 A;  4IDK A;  3MXM A;  4FJ9 A;  3PX0 A;  3NF8 A;  4AHV A;  1WLJ A;  1QTM A;  3C95 A;  3T1A A;  1BQM A;  1VK0 A;  2VG5 A;  2KW4 A;  3HT3 A;  4CIG A;  3SQ1 A;  1S1T A;  4O55 A;  4F8R A;  5HRR A;  4FK4 A;  1IKV A;  4DU3 A;  4KTQ A;  3HM9 A;  1TAU A;  1GOA A;  3IS9 A;  1HYZ A;  1NK5 A;  4M41 A;  1A5W A;  3OYH A;  4DFK A;  3K2P A;  4CFC A;  2QK9 A;  4KPY A;  4LH5 A;  4KB1 A;  3FFI A;  4NCB A;  3QEP A;  1J53 A;  4OJR A;  4W5O A;  2ZQB A;  3SJJ A;  2KFN A;  3ZSZ A;  1WAF A;  3AVH A;  4CFB A;  4CGH A;  4CGF A;  3NGI A;  4FJL A;  5HP1 A;  1YTU A;  3V1O A;  4DQR A;  4C8O A;  1N5Y A;  4BDY A;  4EZ9 A;  2D0C A;  2G8I A;  4IG3 A;  4DSE A;  5HBM A;  3RMD A;  1XC9 A;  1RTD A;  3LAM A;  4CK1 A;  4W5R A;  4DMN A;  1TV6 A;  4Y1C A;  4DQP A;  5CY4 A;  4EZ6 A;  3UIQ A;  1NOZ A;  3ASM A;  3U3Y A;  4MQ3 A;  3BDP A;  3P83 D;  4CE9 A;  2YV0 X;  2P1J A;  3ZT1 A;  3HVT A;  4CJ3 A;  1IKX A;  4CGG A;  4E7K A;  3RR7 A;  3ITH A;  3KJV A;  1SKS A;  5C42 A;  3CG7 A;  1EXQ A;  1D5A A;  1ZBL A;  3LZI A;  4DS5 A;  1LW2 A;  2B5J A;  1ZYQ A;  3OJU A;  4FJI A;  4IKF A;  2P51 A;  1RBT A;  3TWH A;  1JKH A;  3LAN A;  1HPZ A;  4ICL A;  1QSY A;  3HJF A;  3QER A;  1J9A A;  4JS4 A;  3TAR A;  1NJX A;  1J5O A;  4DSK A;  3NCI A;  1JLB A;  3S3M A;  2X74 A;  3ZSQ A;  4RG8 A;  1J54 A;  4H8K A;  4KKO A;  4YFU A;  1Z26 A;  3AA5 X;  4YNQ A;  4HUE A;  4FZZ A;  4CK3 A;  4K8Z A;  5JS1 A;  2YKM A;  3LAL A;  1S1U A;  4FW1 A;  3KLE A;  3QLH A;  4IFY A;  3SNN A;  2R7Y A;  2HND A;  4HTU A;  3M8S A;  1WSJ A;  3L2Q A;  2PY5 A;  1U04 A;  3K5L A;  3SV4 A;  3OJS A;  4F4K A;  1JLA A;  1S6P A;  4E1N A;  3QNO A;  4QCL A;  2QKB A;  3AVC A;  3K59 A;  4DU4 A;  5KGX A;  3CM5 A;  3LWL A;  4CJE A;  1NJZ A;  1YT3 A;  4CJW A;  4CCH A;  4AH9 A;  4MFB A;  3AO4 A;  4CFD A;  4FZX C;  1IO2 A;  1KFD A;  1D9F A;  5KTQ A;  3VQ6 A;  4E3S A;  3S3O A;  3PY8 A;  4KTW A;  4M42 A;  1HNI A;  2DFE A;  1ITG A;  1S6Q A;  4FW2 A;  4OKE A;  4M3Y A;  3A2F A;  2HMI A;  1BI4 A;  1RTH A;  2XY6 A;  2AJQ A;  3QIN A;  3SQ0 A;  4E1M A;  4QOZ B;  3C94 A;  3MEG A;  4B8C A;  1RNH A;  3WNH A;  2ZE2 A;  1DLO A;  3V9S A;  4FJ5 A;  3KKS A;  2DFH A;  3NAE A;  4B3O A;  3TAP A;  3IAY A;  1L5U A;  4NYN A;  4DG1 A;  4C8N A;  3K5M A;  2OYQ A;  4DF4 A;  4CJF A;  3OYF A;  3L2U A;  4Z4H A;  3HXM A;  3K5N A;  4KV8 A;  4FM1 A;  1XHZ A;  4OKK A;  2BE2 A;  3DLK A;  4FK2 A;  3VQE A;  3K57 A;  3S3N A;  2IOC A;  1B92 A;  1IH7 A;  4M3X A;  3C6U A;  3NBP A;  1CXQ A;  1WSF A;  4IBN A;  1WSE A;  2GV9 A;  4M3R A;  1BIS A;  4E7I A;  1NJY A;  1NKB A;  3G0Z A;  4GW6 A;  4BWJ A;  2Y1J A;  3RRG A;  3KK1 A;  2F8T A;  2IS3 A;  3LPU A;  1S1W A;  3K58 A;  1S9E A;  1T8E A;  4JLH A;  3VQ8 A;  2VWK A;  3JSM A;  1JLG A;  3OYK A;  3OYI A;  2YNI A;  3HVR A;  3AVN A;  3NGY A;  1WSH A;  3D45 A;  3IRX A;  3NFA A;  1VSE A;  1W9H A;  3HK2 A;  4I2Q A;  3HYF A;  4CF8 A;  1G15 A;  4B9V A;  3EZ5 A;  2FBX A;  1HYS A;  4AHT A;  1VSD A;  4GMJ B;  4CHZ A;  3NH1 A;  3LWM A;  5HLF A;  1I39 A;  4I2P A;  4DSI A;  2D0B A;  1UA1 A;  3NHG A;  4PQU A;  4B9U A;  1SL0 A;  3ZT2 A;  3L8B A;  2IDO A;  4N47 A;  1CLQ A;  1C1C A;  2X6S A;  3V1R A;  3JYT A;  4FJG A;  4CJU A;  1Q9Y A;  5I42 A;  4F3T A;  1JXE A;  4F2R A;  3KTQ A;  2A1S A;  1K6Y A;  4KAZ A;  1KSP A;  2X78 A;  3TAG A;  2IGI A;  4M45 A;  3CYM A;  1Q8I A;  4BDZ A;  2Z1G A;  3AVI A;  4FM2 A;  4DSJ A;  2OPR A;  1NK6 A;  2DY4 A;  3ZT4 A;  3SZ2 A;  4CJK A;  3THV A;  2O4G A;  1FXX A;  3MAQ A;  2ETJ A;  1RT2 A;  1TL3 A;  1BCM A;  4JRP A;  4UQG A;  3PV8 A;  1RT7 A;  1LV5 A;  1TK8 A;  1KTQ A;  4CF9 A;  3OYB A;  4F3O A;  1HYV A;  1N6Q A;  4Z4E A;  2YKN A;  4LSL A;  2P5O A;  5T7B A;  1TKT A;  4FLY A;  3VQA A;  4M3Z A;  3RMC A;  3SCX A;  1VSH A;  3LZJ A;  2ITG A;  4E7L A;  2QKK A;  1L3S A;  4CJL A;  2DTU A;  4DLE A;  1JL2 A;  2EX3 A;  3MXI A;  3DOL A;  3M8R A;  1X9M A;  3EY1 A;  4CF1 A;  1R0A A;  1XI1 A;  1IKY A;  1ASW A;  1UA0 A;  3LP3 A;  4HUG A;  4FVM A;  3AVJ A;  4G1Q A;  3VA3 A;  1RBR A;  2RKI A;  2HVH A;  1VSI A;  2DFF A;  5DK5 A;  1HQE A;  1EKE A;  3SYZ A;  3AVG A;  1B9D A;  3DYA A;  4BE0 A;  4M3U A;  4CIF A;  1U4B A;  4RW8 A;  2D0A A;  4EP5 A;  4HCC A;  4K8X A;  4J2D A;  3OYL A;  3LAK A;  3DRS A;  5FRO A;  4B9N A;  3VQ7 A;  1T05 A;  4B8A B;  3IG1 A;  3OYG A;  4CEC A;  1LWE A;  4N41 A;  1JLE A;  1O1W A;  1BIU A;  1BIZ A;  2E6M A;  4CJR A;  4C8M A;  3QEI A;  3PX6 A;  1WAJ A;  1T7P A;  2HNY A;  1HRH A;  1DTT A;  3SUO A;  2XO7 A;  3V81 A;  1XHX A;  1WSI A;  4L8R B;  3AO2 A;  2KTQ A;  4FJ7 A;  4DFP A;  1S1V A;  2BAN A;  3V9X A;  4ZTJ A;  3KLI A;  1VSM A;  4E7J A;  1RCH A;  1RDB A;  4FM0 A;  4DTJ A;  4FLX A;  4CGJ A;  1F21 A;  5C25 A;  4N76 A;  3AVA A;  1RDD A;  1RT5 A;  5CYM A;  5J2P A;  4CJQ A;  3SQ4 A;  4CHO A;  4N5S A;  4DFJ A;  5KGW A;  3LPT A;  5SWM A;  4FJN A;  1C6V A;  1WN7 A;  4OGE A;  3M8P A;  5EU7 A;  4DSL A;  1BCO A;  3SUQ A;  3HPH A;  4O0I A;  5K14 A;  4FCY A;  3OY9 A;  1BL3 A;  4RW9 A;  2E6L A;  4CFA A;  4HCB A;  2D5R A;  4DTS A;  4FJM A;  4KRF A;  3VN5 A;  1VRU A;  1C0U A;  1FKO A;  3V9W A;  5KRS A;  3RR8 A;  3AA2 A;  4IFV A;  3V9U A;  1CZB A;  1RDA A;  5FDL A;  4BAC A;  3KD5 E;  2JLE A;  3RMB A;  3HO1 A;  2PYJ A;  4DTN A;  1UOC A;  2XY8 A;  4J2A A;  2YNF A;  3KLG A;  4FYD A;  3AVF A;  3OYM A;  1TL1 A;  4CGD A;  3NH2 A;  4I9L A;  4DQQ A;  4FJX A;  3MEE A;  1TK5 A;  3QES A;  1UWB A;  4HUF A;  4BE2 A;  3M8Q A;  4FLW A;  4KRE A;  1YVU A;  3AVL A;  4WE1 A;  1X9S A;  3F9K A;  4NCA A;  1RTI A;  3HPG A;  4ELT A;  4KHQ A;  1ASV A;  3SV3 A;  4HHT A;  3DMJ A;  3RRH A;  4CHY A;  1NK7 A;  1RT4 A;  1QQC A;  3LDS A;  3SPY A;  3ALY A;  5CZ2 A;  4IG0 A;  2LSN A;  1QSS A;  4I9Q A;  4LSN A;  3OYN A;  3QEW A;  4DTP A;  2EHG A;  3V1Q A;  5J1E A;  1RIL A;  2B6A A;  2OA8 A;  2GBZ A;  4ID1 A;  3OS2 A;  1SL2 A;  3NGZ A;  3AA4 A;  3PUF A;  3ZSV A;  1NK8 A;  3ZSR A;  1A5X A;  4GVM A;  3SPZ A;  1JXB A;  4O0J A;  4B08 A;  2OPP A;  2PZS A;  2GUI A;  2Z1I A;  1WSG A;  3CFP A;  4FJJ A;  1SKW A;  4KI4 A;  2A1R A;  2IAJ A;  4AIL C;  4DWI A;  2YNG A;  3WNF A;  4CIE A;  1KVA A;  4DU1 A;  3U3G A;  2E4L A;  3OYE A;  2G8V A;  4RW4 A;  3TAM A;  3O3F A;  5J2M A;  4CEO A;  4QAG A;  1RT6 A;  3OS1 A;  3CFR A;  3TAF A;  2PYL A;  1BHL A;  3ZSY A;  1CXU A;  1S9G A;  3F73 A;  1W0H A;  1L3V A;  1SUQ A;  3D0P A;  3HST B;  3VQ4 A;  4Z4I A;  3CQ8 A;  2O4I A;  3L2R A;  1TKX A;  4KTZ A;  1Q9X A;  1ASU A;  4RW6 A;  1SKR A;  2P5G A;  3KK3 A;  4FJK A;  1QE1 A;  3NDK A;  2HHQ A;  3MXJ A;  3B6P A;  3AO3 A;  3L3U A;  3OYD A;  1KVB A;  3TR8 A;  2QXF A;  2VG7 A;  4O4G A;  3VA0 A;  4AHS A;  5HRS A;  4Z0U A;  4OPJ A;  3VQQ A;  1KRP A;  4CJ4 A;  4NCG A;  2HW3 A;  1HJR A;  2KQ2 A;  4LD0 A;  4ZHR A;  4CHP A;  1ZBH A;  3SUN A;  5HRO A;  1NKC A;  3HP6 A;  4CES A;  4CEB A;  5SZT A;  5E41 A;  4KO0 A;  3QIP A;  4FLT A;  1MU2 A;  3WNG A;  1U45 A;  4FJH A;  3RMA A;  2F8S A;  3QIO A;  2G8K A;  2Z1J A;  4CF2 A;  1QS4 A;  4DTX A;  4O44 A;  3L2W A;  1TVR A;  4XIU A;  2I5J A;  2ZD1 A;  1RTJ A;  1L3U A;  4PWD A;  4DQI A;  1VSJ A;  1X9W A;  5FRN A;  3AVM A;  5HRP A;  4ELU A;  4FZY A;  4E0D A;  1ZBI A;  4OLA A;  3CM6 A;  3ZSW A;  1KFS A;  2Q3S A;  1TKZ A;  3NE6 A;  3TAE A;  1C1A A;  3VQP A;  4J2E A;  3KK2 A;  1TKD A;  2B4J A;  2G8U A;  2F96 A;  3NH0 A;  3C6T A;  3O3H A;  2WOM A;  4KHY A;  3EYZ A;  2VG6 A;  3SUP A;  3SI6 A;  3BGR A;  3HL8 A;  2W42 A;  2HHU A;  1DTQ A;  2HNZ A;  4CHN A;  2XY5 A;  4ID5 A;  4CEZ A;  2BDP A;  4B9T A;  1JLC A;  4FK0 A;  4FLZ A;  3OYA A;  4AHR A;  4CJT A;  1NK9 A;  3KIO A;  3OYJ A;  1SL1 A;  1A5V A;  1JLF A;  3PO5 A;  4R5P A;  1FKP A;  3T3F A;  2XRI A;  3ZCM A;  4DS4 A;  2G8F A;  3P5J A;  1S5J A;  2YHB A;  4CJP A;  4CHQ A;  2HHW A;  3RTV A;  1Y97 A;  3WNE A;  4DTR A;  2YHA A;  3V9Z A;  4CEA A;  3HPO A;  3V6D A;  5HRN A;  3DOK A;  1SV5 A;  3S9H A;  5KRT A;  4JS5 A;  2OPQ A;  1REV A;  1ZBF A;  3OVN A;  4BE1 A;  1NOY A;  3VQ5 A;  4Z4F A;  3DRR A;  1LAV A;  3VQC A;  1TGO A;  4FJ8 A;  3PX4 A;  5CYQ A;  1NK0 A;  2WON A;  3AV9 A;  4W5N A;  1HMV A;  4OLB A;  4Q0B A;  1BQN A;  4DTU A;  4DSF A;  3DLG A;  3AO5 A;  4CJS A;  1KCF A;  3G10 A;  4PA1 A;  1NJW A;  3I8D A;  4CJV A;  4DTO A;  4OPK A;  2KFZ A;  2HB5 A;  4ELV A;  4CGI A;  1VRT A;  1S1X A;  3AVK A;  4NYF A;  2IC3 A;  1T03 A;  1X1P A;  1LW0 A;  1ZBU A;  2HVI A;  3I0S A;  3ISN C;  1XWL A;  4CEQ A;  3VQD A;  3AA3 A;  1C0M A;  3I0R A;  4AHU A;  3KLH A;  1U48 A;  4KHS A;  4HVJ A;  4DLG A;  1GOB A;  3LP1 A;  4ZTF A;  5J2Q A;  4C8L A;  4N56 A;  3TAQ A;  4B9L A;  4BWM A;  4EP4 A;  3KD1 E;  1I3A A;  3TAN A;  2HHV A;  3U6F A;  3O4Q A;  1GOC A;  4H4O A;  4DFM A;  2FC0 A;  1BI4 B;  1JLQ A;  2ATQ A;  1NK4 A;  4KI6 A;  1L3T A;  3E01 A;  4KHW A;  3KKR A;  4OVL A;  3DRP A;  1TAQ A;  3LP0 A;  1C1B A;  1KLM A;  5KI6 A;  4OKJ A;  4CF0 A;  3OS0 A;  4DQS A;  3V4I A;  3QET A;  2OZS A;  1U47 A;  3DM2 A;  3DI6 A;  3VQB A;  4CK2 A;  4FLU A;  2JGU A;  1HNV A;  1HQU A;  1CZ9 A;  4DTM A;  3DLB A;  4BDP A;  3P1G A;  1NKE A;  2OZM A;  5I3U A;  5CZ1 A;  4DF8 A;  4PUO A;  4B9M A;  3B6O A;  2X6N A;  4AHC A;  3QEX A;  3HP9 A;  5C24 A;  1IKW A;  4O5B A;  5JS2 A;  3ZT0 A;  3MED A;  1QHT A;  1UAX A;  4E89 A;  1EET A;  1RT1 A;  1VSL A;  2FBY A;  4W5T A;  2NUB A;  3QO9 A;  3VQ9 A;  1KVC A;  4H4M A;  4FLV A;  3DLH A;  4KB0 A;  4Q5V A;  4PY5 A;  3KLF A;  2G8W A;  3ZSO A;  5FRM A;  4KFB A;  3O3G A;  1C0T A;  1RDC A;  1QSL A;  2BGG A;  2HHT A;  1RBU A;  1FK9 A;  4E19 A;  1JL1 A;  1EX4 A;  4CEF A;  1WNS A;  1BGX T;  1RT3 A;  3AO1 A;  3LP2 A;  2HHS A;  2Z1H A;  4Y1D A;  3L2V A;  4I7F A;  4TSX A;  1Z25 A;  2FBV A;  1LWC A;  5J2N A;  3SQ2 A;  1VSF A;  4B9S A;  2KZM A;  4CER A;  4C8K A;  2Y1I A;  3ZT3 A;  1RBS A;  1B9F A;  1KLN A;  2RF2 A;  3CFO A;  1YTA A;  3H08 A;  3NF7 A;  2YNH A;  1D8Y A;  5DMR A;  2RN2 A;  3K5O A;  4LY7 A;  3QEV A;  3RWU A;  4CED A;  1D9D A;  2RPI A;  4FXD A;  1LAW A;  4E7H A;  1LWF A;  3OYC A;  3PO4 A;  4M3W A;  2G8H A;  4OGC A;  4LH4 A;  4CJ5 A;  4RW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...