4CEYC

Crystal structure of human enterovirus 71 in complex with the uncoating inhibitor nld
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
242
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTGTIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title More-Powerful Virus Inhibitors from Structure-Based Analysis of Hev71 Capsid-Binding Molecules
pubmed doi rcsb
source organism Enterovirus a71
molecule tags Virus
molecule keywords VP1
total genus 44
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ceyC00
1EV12 2WZR1 3ZFEA 2IZWA 2HWE1 2WS91 1RUI3 1Z7S2 2ZZQA 1K5MB 1RUJ3 4N53A 1FOD2 1ZBA2 3DPRC 3FBMA 1D4M3 1QJX1 5LK7B 4Q4X1 3JD72 1VBC3 4CDWA 3ZFFA 1BEV2 3VDDA 4YVWC 5D8AC 4CEYA 2WFF3 5BNPB 5C9AA 1DDLA 1PO12 1HXS2 3J8F2 1QJY2 1H8TB 3DPRB 1C8M1 4RQPA 3ZXAC 1HRI1 5K0UA 1H8TC 4GMP0 4WM8B 3ZFGB 4CDXC 5K0UB 4RQPC 2TBVA 5C4WC 1H8TA 2R073 2R063 4RQPB 1RUC3 1VBB1 3VBUC 3VDDB 4NWVA 5J98B 1RVF2 3VDDC 1ASJ3 2RS33 1AR93 4CDWB 1FMD3 1QQP1 1F8VA 1B35C 5DDJ1 1RUD3 1PO11 3J8F1 1RUC1 1MEC2 4RR3C 1PO22 1QJU1 4WM7B 3VBOB 1HXS3 2GSYA 2HWC2 2R041 5DDJ3 1AR82 1C8NA 4YVWB 4CDXA 2R071 1AR73 4Q4W1 1PGW1 4Q4V2 4RR3B 2RMU3 2HWF3 2MEV1 3VBUA 1FPN3 1W39A 2XBO2 1QJX3 1RHI2 2RS11 1C8M2 4RR3A 1ASJ2 2RS32 4QPIB 5K0UC 1NG0A 4N43C 1NOVA 1ZBA3 4QPIA 4Q4W3 4PDWC 1V9U3 1VRH3 3NAPA 4FTEA 1ZBE1 1AL22 1HX6A 2WLPA 1RHI1 5BNNB 2RR13 4CDQC 2XPJA 1A6CA 5BNNA 2RS13 2HWB3 1NCRC 3VBFB 1VBA2 3ZFEC 1AYN1 1B35B 1NCRA 1RUG3 4RS5C 5A33A 4AEDA 4YVWA 1TME3 4GB31 4CDUB 1NA1B 1AR63 3TN93 1COV3 1RUH1 5L7OA 2PLV3 1R1A2 2GH8A 1AR91 5ACA2 1PO21 5BNPA 5CFCC 4SBVA 3VBRC 1VBC2 2FZ1A 1VBE3 1RUI1 5A32A 1R1A1 3VBRA 4YVSC 2ZTNA 4Y5Z0 1ZBE3 1IHMA 5BNOC 4PDWA 1MQTB 1HQNA 1V9U2 1VRH2 1BBT1 3DPRA 1AL23 1VBB2 1K5MA 2VQ0A 1BEV3 1R093 1PIV3 4WM8C 1VBE1 1NCQC 1RUD1 2HWE3 2WS93 1EV13 1MQTA 1ND2B 1AR81 1HRI2 5BNPC 2HWF1 1RUG2 1RUJ1 1FPN1 3TN92 2PLV1 1PGL1 5ABJA 1BEV1 1D4M2 4CEYB 3JBG1 1FPN2 1CJDA 1MEC3 1NCQA 1OHFA 1RUF3 1ND3B 5C8CC 4CDUA 5J96B 1QJY3 2HWB1 1AYM3 5AC91 2HWC3 4GMP3 1TMF2 3JBG3 5C9AC 3JD73 2RM22 1Z7S1 1EV11 2WZR2 5L7OB 4FTBA 1POV3 3ZFFB 2HWE2 2WS92 1NY71 4QPGC 1M06G 1D4M1 4IV1C 1AUYA 5BNNC 1QJZA 1VAKA 2R043 1NCQB 1NY72 1VBD3 3JD71 1AR92 1RB8G 2BUKA 4Y4YA 1RUG1 3CJIA 2HWF2 4QPIC 3LOBA 1RMU3 5C8CB 4IV3C 5CFDC 1COV1 2RR12 1C8M3 1BBT2 1R083 3ZFGC 1QJU3 2HWB2 3VBHC 1PVC2 1R091 1OOPB 1RUE1 1HRV1 4RS5B 1F2NA 2HWD3 4FTSA 4JGZC 1AR71 4JGZB 2RM23 5ABJB 5JZGA 2Y26A 2MEV3 1ND3C 2WFF2 1ASJ1 2RS31 1EAH2 1VBA3 3VBHB 3VBSA 2WWSA 4QPGA 1HRI3 1ND3A 5D8AA 4WM8A 4CEYC 3ZFGA 1AYN3 5A32B 1PIV1 4CEWC 1ZBA1 2RS53 4CEWB 5BNOB 1RMU1 4JGYC 1RUH3 4Q4W2 5BNOA 1RUD2 2XBO3 4N53C 4IV1B 2DF7A 1RUF2 5JZGC 1PIV2 1X36A 1QJU2 4IV1A 1WCDJ 4EJRA 1PVC3 1POV1 1PO13 3J8F3 1VB4A 1ZBE2 5C4WB 4GB33 1NA1C 2X5IB 4CEWA 2XBO1 1HRV2 1RUE2 2RS12 3M8LA 1PO23 3NAPB 4Q4V3 3ZFEB 2ZAHA 3VBSC 1EAH3 3VBRB 5FMOL 1OPOA 3VBSB 3VBHA 5C8CA 1VBD2 2X5IC 1COV2 1X33A 4JGZA 1E57A 1FMD2 2R062 4RS5A 5ACA3 1AL21 4GH4C 1TMF3 4Z92B 1EAH1 3JBG2 4GH4B 4CDQA 1ND2C 3TN91 3HAGA 4IV3A 5CFDA 1QQP2 1AYM2 5DDJ2 5GKAC 1R081 5FOJB 1VB2A 4RHV1 5AC93 1TMF1 5CFCB 1POV0 1AR62 4Q4V1 2WZR3 4Q4Y2 1R092 1HRV3 2MEV2 2R072 2BPA2 1R1A3 4YVSB 1AL0G 3JB4C 4GH4A 1B35A 4RHV2 1AR61 5ABJC 1TME2 1BBT3 1R082 2R042 2X5IA 1QJY1 1HXS1 4RFT0 2PLV2 1RUC2 1VBC1 4CDUC 1Z7S3 1VBB3 4Q4X2 2RMU1 4BCUA 4WM7A 1K5MC 3VBOA 5CFCA 1GFF2 1BMV2 1FMD1 1QQP3 3NAPC 1RVF1 1AYN2 5L7OC 4Q4Y1 3ZFFC 1FOD1 5AC92 2RMU2 4AEDC 3S6PA 1RUI2 3IDEA 1ND2A 1RHI3 3JB8A 1AYM1 5JZGB 1MQTC 1RVF3 2BBVA 5C9AB 1OOPC 1FOD3 2HWD1 4PDWB 1PGL2 5FMOS 4N43B 1TME1 2FZ2A 2QQPA 1RUF1 2RM21 1QJX2 4N43A 1VBE2 1NCRB 3VBFC 1PGW2 1CD3G 1VBA1 1VBD1 3CJIB 5C4WA 1AR83 1V9U1 1VRH1 1SMVA 4FSJA 1OOPA 2WFF1 1NA1A 2BFUL 4RHV3 4WM7C 3VBOC 3CJIC 4JGYA 3VBFA 1RUJ2 4JGYB 1PVC1 2R061 2RS52 1RUH2 5D8AB 2BFUS 4GB32 1RMU2 4QPGB 4LLFA 4YVSA 4AEDB 4CDXB 5A33B 2RR11 2HWC1 4GMP1 4Q4X3 4N53B 4NWWA 4Q4Y3 1RUE3 1BMV1 3VBUB 2RS51 2HWD2 4IV3B 5CFDB 1MEC1 4CDQB 4CDWC 1AR72 5ACA1
chains in the Genus database with same CATH superfamily
1FXZA 4V1PA 5FYTA 3RMYA 3VKOA 3LEIA 3ZFEA 1JU4A 1V6KA 1QIQA 2HWE1 2WS91 1C4RA 1CJPA 3ZPOA 2QTWB 2EIBA 1GUIA 4K3UA 3IT8A 4UFHA 3FHQA 3GHMA 1DHKB 3HMYA 2P3JA 3DUIA 5ANNA 5AVPA 3TWIA 4XAAA 5DUWA 3KWVA 4AHYA 1NT0A 4YZ5A 2D5FA 1G9FA 1ZBA2 3B7MA 4XFHA 3MFAA 5LA0A 1ZRDA 1D4M3 1QJX1 3KLSA 1Y7BA 2PHTA 1O4YA 3FFZA 2PHFA 3KV9A 1QY4A 4XOGA 3JD72 2WWJA 5LK7B 1POQA 2I74A 1RITA 3TB0A 4QX3A 2VQTA 3VDDA 4YVWC 4YGCA 2AENA 1OUXA 1QF3A 3IM0A 5DZEA 1XNDA 4MVTA 4GKYA 3ZXLA 4BQ5A 5CG9A 4CXYA 2QQMA 3FC0A 2GH2A 1BVP1 4YM1A 4B1LA 4EN9B 2JDAA 1UMHA 4L97A 4QWNA 3EXUA 1S0JA 1HRI1 1PHMA 1H8TC 4GMP0 4MV2A 2LRPA 5I0UA 3O1SA 1DQ1A 4MHRA 4E8CA 5K0UB 4BLJA 1QJFA 3WG2A 3VKFC 1EY2A 2W47A 2ORXA 1H9PA 2TBVA 1MS8A 1MS3A 1W3XA 2R063 4BM8A 1H2LA 3DXUA 3LEGA 3NWKA 1RUC3 4NHMA 1GYKA 2VVEA 4KGGA 2GP5A 1WCQA 1OF3A 4YW6A 4LK7A 4NRMA 1W0OA 4NWVA 4UI9L 5J98B 4Z07A 2ZGKA 4X6RB 2WUHA 2DCZA 3I3BA 3WP3A 1ASJ3 1H2MA 3WF0A 1K45A 5K8SA 1BK0A 4EN7B 1F8VA 1XNKA 1DQ4A 1W03A 3AKRA 1H2KA 1D0GA 2VBBA 2FDHA 4P08A 1RUC1 1JZ7A 3H9AA 3N7JA 4PLOA 4HZFA 5FAXA 3NO8A 4UT5A 5DAXA 3MO4A 1SBDA 4Q26A 1LOBA 5FZHA 1W9SA 1U5YA 3ZSLA 4UBHA 2CY6A 2GSYA 2DVBA 5IAXA 2E32A 4LBQD 5DDJ3 4AVBA 3AP4A 1AR82 1C8NA 2P2KA 1XSQA 2R16A 2YU1A 4YVWB 3WSOA 1F5FA 4UFLA 2R071 3K46A 1YNAA 3IIIA 3UETA 2WA3A 4LO6B 1UY1A 2R32A 1N47A 2Z42A 4LITA 2FDKA 5LRSA 3IDBB 2ZGMA 2X29A 4ASKA 3R4SA 2XBO2 4Z82A 1QJX3 1RHI2 3AYAA 1C8M2 2CWSA 2DCKA 4Z1VA 1SPPB 4RR3A 1JODA 3NRUA 2RS32 1XU2A 3HN1A 3KV4A 3WDUA 3C7OA 3A0NA 3USUA 3V0AB 1VRH3 2IC1A 2WSVA 1ZBE1 5J09A 4FTEA 3UL2A 1AL22 1HX6A 5F39A 5FZGA 4KI5M 1RHI1 4RA0A 4LKFA 1S0IA 5F3IA 4BDVB 2RS13 4EWEA 5BNNA 2HKXA 2ZACA 3ILRA 4TWTA 3MV11 2QQIA 5JUVA 1AYN1 1B35B 1DP0A 2DWRA 4HN1A 1NCRA 4JKKA 5A33A 5CBLA 2BW8A 4E2QA 1LESA 1NQDA 2WZEA 4OZXA 1VALA 2VH9A 4AFCA 3HPNA 4MZUA 4CDUB 5EIYB 3AYEA 5FY0A 2BVVA 4RGGA 3SEEA 5I0RA 3ZMOA 1H30A 4FAHA 2P6CA 2R30A 1BK1A 2PLV3 1GZ9A 2GH8A 1AR91 4Y26A 5B4NA 5FQ0A 1D2QA 4LO8A 4WVMA 1R64A 1VBC2 2YU2A 3POGA 2FZ1A 4CUAA 4BB3A 4CUGA 4IQPA 4JX0A 2JB4A 1R1A1 4UBGA 5A7OA 5CADA 4K21A 5KXCA 4E4ZA 1P8JA 3WG3A 4Y5Z0 3FN9A 3ZN5A 3J7MA 2VXJA 4C8DA 1MQTB 1HQNA 1VRH2 5FXVA 1LGCA 2VZSA 5BY5A 5LA9A 1W8FA 1JYCA 5GLZA 5JOWA 1BHGA 5FTTC 1EV13 3ZN6B 4N90A 4DY5A 3UNPA 3GZTB 1ULDA 3A23A 3FUQA 3T2PA 5BNPC 5A80A 3JCIA 1TZOA 2DURA 3WUCA 5A3NA 1RUG2 4LIUA 1RUJ1 2FDFA 1CX1A 5LB6A 1PMHX 2X09A 3PMEA 2TNFA 2WRAA 1W6NA 5BV6A 4LBJA 5FPZA 3LEMA 4QDQA 4JC1A 4UWDA 4XVHA 4H3WA 3SITA 4CEYB 4KQ7A 5B2GB 3SH3A 3JBG1 5I8TA 4XILA 1S1AA 4N7IA 3ZN4A 5LW9A 3P5BA 4AOCA 1ENRA 4P9LA 3VHNA 4B4QA 1RUF3 3FBYA 5KXBA 2Z2SB 1OFSA 3FJSA 3AJZA 2W08A 1V0AA 2O14A 3B00A 2DBNA 1F4AA 1S2BA 4HFSA 5J96B 2JENA 1WKYA 4FXKB 5AC91 4LBOA 1TMF2 3PTYA 1SFPA 3QACA 4LHNA 5DG1A 1HB3A 5FYBA 3JBG3 3Q9OA 4D6RA 5C9AC 5J1XA 2UWBA 1W04A 1Z7S1 4IE6A 1UZVA 5FQ0B 2JE8A 4XJ8A 4RL7A 1MS9A 3ZFFB 2XJPA 3HNBM 5LWBA 2HWE2 2WS92 1OD3A 2JG8A 2VW0A 1A8DA 3T4VA 4YM2A 5JI9A 2F17A 5FZFA 4V2WA 3HQRA 3WDVA 1D4M1 1AUYA 3USUB 1HQWA 1QJZA 4YM0A 5F8PA 3L2YA 4OCTA 3B9IA 1S0CA 1RB8G 3N7KA 4D0QA 3U4SA 4DS0A 2O1QA 3OGVA 4NE9A 4CU6A 3LDKA 1Q8SA 3D3AA 4CRQA 3IZOA 4TYSA 4IESA 5C8CB 4IE5A 3B5LB 1BYHA 1C8M3 2YYOA 4XBQA 5IVYA 1JMUB 1WLCA 3KMHA 3IPVB 2HWB2 3UGHA 3K4AA 4B8EA 1W9YA 4P9JA 3APBA 1RUE1 3PLQA 1HDKA 3BUCA 1F2NA 2FDJA 2GNDA 2XWJB 2JDKA 5FPUA 4FTSA 2VMEA 4JGZC 4D94A 4W65A 1AR71 2B9VA 4JGZB 2NMNA 1UCXA 2RM23 4R8HA 3RRDA 1N3PA 4I2OA 4JKLA 3IIAA 3MF6A 2Y26A 2MEV3 2ZGLA 2ZGNA 1ND3C 3DKWA 2ZBJA 3CZJA 4N9IA 3RYPA 5A6ZA 3AXDA 5L9RA 3WZ1A 1EAH2 3TEWA 3W5NA 2DU1A 4JV4A 4ZKTB 1DG6A 1YIFA 3VDAA 2I45A 4QDRA 4WM8A 5A3TA 1AYN3 3AKPA 2XLFA 4CP0A 3WQ7A 5FZ4A 4F8AA 1HN0A 5FUPA 3OYWB 4E4DX 3LFMA 3WF3A 5FZ8A 5A1AA 3OD0A 1UYYA 5BNOB 1RMU1 2V4VA 5KR7A 1V6OA 2G9ZA 2W52A 1U5IA 2QBXA 5IK4A 1MZEA 2EXHA 1LAJA 1UY2A 2KM2A 2FCTA 4LBQA 4MGSA 2LS6A 4N53C 2YB7A 4Q8LA 3SNMA 1KFXL 3W58A 1MS5A 4Y1ZA 4FVVA 1RUF2 3GJBA 1H1MA 1CR7A 1L3JA 2QQOA 1UKGA 4BOWA 3ME2A 4MXWB 4IV1A 3ZIXA 5JOZA 1JYVA 5T50A 1PVC3 3LEKA 3O1OA 2XLAA 1SBFA 2VMFA 4Q1PA 1G9AA 3ORJA 4KU7A 4QX8A 5FY4A 1H1AA 1S0GA 2X5IB 3RZKA 2WQ4A 3H42B 5HCHA 1ZA4A 1OF4A 1DZQA 1HRV2 1LENA 1RUE2 3LPFA 5HV4A 3M8LA 1PO23 4Q4V3 2ZAHA 1EAH3 1X8MA 3BTAA 1Z0HA 5AFBA 3G7DA 2P3KA 3ILFA 5E16A 1TVGA 3KT4A 4G4FA 4CCOA 5A6YA 5JOYA 4LBQB 4YFZA 3BCWA 2XKPA 2O8QA 2WAAA 3SISA 4J1XA 1C1LA 2MHFA 4GJZA 5CKQA 4D7TA 2ES3A 2W68A 2WN3A 3NNFA 4QQHA 3O0XA 4RS5A 4GAZA 1AL21 1DGRN 2JJ6A 4LO7A 1ZRRA 3D0JA 2GN7A 1HN1A 3MW4A 4ATFA 2RHPA 4CP2A 3O5SA 5JSOA 2YGMA 2OA2A 4RN5A 3CJXA 1U12A 1D7PM 2VZOA 3HAGA 2UY9A 4FCAA 5CFDA 3WHTA 3WXPA 4AAXA 2AEYA 1GZTA 1QMJA 4O65A 4OVEA 3RG0A 1SDDB 1VB2A 1UX7A 3OY8B 4XDPA 4BYYA 1WGPA 4BQ3A 1QOOA 4AFMA 1AHSA 1KD7A 2DVGA 4QX5A 4S2HA 4FP3A 1LULA 1NZCA 2JDUA 2VNOA 5A70A 1R1A3 3B9CA 1CAXA 2WNOA 1HLCA 1AL0G 4GH4A 1B35A 4LBKA 1GICA 1ZREA 3GNEA 1PVXA 1OQDA 5EHDA 2HBUA 5ABJC 1A78A 1H6YA 4N7UA 3RWKX 1WA6X 1X9TA 3AVRA 2AZ5A 3M3EA 4Q2FA 1LGNA 2P17A 4LE4A 4RFT0 2FCUA 3WUDA 2D6MA 3UESA 1O8PA 4URAA 5KXDA 4CDUC 2BTVC 1VBB3 2N7GA 3VKNA 2VUAA 4OUEA 1IPJA 3LPGA 4QU1A 4R52A 5A3LA 1IKQA 2ORZA 2RMU1 1M4WA 1W99A 3HNMA 4PJYA 1GFF2 3ZN6A 1BMV2 2C6SA 2EVXA 2A7AA 4AR2A 4R9DA 5LCWL 2WFPA 4Q4Y1 2YROA 1IQAA 1FOD1 2WAOA 5AC92 2NP0A 4YW1A 2V5DA 1QNYA 4CP1A 4ZHNA 4O61A 2ZEXA 1QHDA 2P3IA 5EFUA 4QX0A 4EN8B 2RMU2 1RUNA 3FL7A 1G9CA 1OLQA 3NVCA 1HKDA 3S6PA 2W1QA 3IDEA 1SZBA 5FP4A 1AYM1 4FPCA 2WL1A 2WQ8A 4UOJA 4LK6A 1J3PA 4YZ2A 5KBFA 1FOD3 2MNGA 4XQDA 4DNYA 1EPWA 4KGQA 4I3GA 5D21A 4YG0A 3SXWA 3N9LA 4IEPA 1YFUA 2NQYA 2QQPA 3KVAA 2GC2A 3MIEA 3MPPG 4LTAA 5L73A 3WW2A 2VBDA 5L36A 1GQHA 1STMA 1VAVA 1WMXA 1NCRB 2IXLA 4G3YC 2A70A 4IGOA 4MGYE 4ET7A 1W0NA 4CCKA 1YRZA 2ZOEB 1JUHA 3EHKA 4HXCA 3V0BB 4EN0A 1OA2A 1WCSA 1MVQA 2EXKA 3CJIB 3PDQA 3WNXA 1LB2A 1LOFA 1OPMA 1K5JA 1YFYA 3LSEA 2VUDA 2XJRA 3I2KA 4F7ZA 3CIHA 4LO4B 4Q0VA 2YC4A 4FSJA 5FZLA 1GP4A 1OOPA 3A22A 1WMDA 3MIDA 4AVVA 2FMYA 1UIJA 3A0KA 1Y9GA 3NV3A 4UXAA 5EJZB 3T08A 3UK9A 4M0HA 5KXEA 1WCKA 4RHV3 5H9PA 2WA4A 1N3QA 4D6QA 3VKMA 1O3TA 3NNGA 2E9QA 3KVBA 4Y33A 4FT8A 2JDPA 4JGYB 4BIOA 2R061 5CA6A 2PFWA 2XJQA 2XVKA 3WV6A 1RUH2 4DUXA 4MHUA 4XFAA 4BWOA 1UU5A 1RMU2 3KZ4C 1ZRCA 1W0PA 3H7YA 5DUUA 4YVSA 4CDXB 2RR11 1QNWA 4FPKA 3S57A 3D0SA 3E5QA 4M01A 4BA6A 2E7QA 1T2XA 4Q4Y3 5F1RA 2DUQA 1RUE3 1A34A 2JWPA 4DO0A 3VBUB 3BU0A 5JI7A 1MEC1 1V6LA 1UYZA 4MSVA 3THDA 3J7LA 2WT0A 3R4UA 4X8PA 2WO3A 3OJBA 1ONAA 4QX1A 4PIYA 4AFAA 1MZ6A 4AXOA 1AR72 4BJ0A 4CDWC 4C90A 5F6KA 5C5TA 2WO1A 3AMMA 4PCRA 1TNFA 1QXPA 4FPJA 3Q8BA 4AG4A 2YPJA 1R1ZA 1PMJX 2ZHKA 3OY8A 1W2OA 4P00B 2JX9A 1Z78A 2PAMA 1HB2A 1NX9A 2VM9A 4FP2A 4DUVA 1YQ2A 4CVUA 4ASMB 1YQ8A 1K5MB 2ZZQA 1HV1A 1FOD2 3PU3A 4UFIA 5HPOA 3DV8A 1NXMA 2W3JA 3SMHA 1RTVA 3HD8B 3BIEA 4XBLA 3RZJA 1LOCA 5A7PA 3S7IA 4META 3PUQA 2HJIA 3ZSEA 2PHRA 4M4RA 4CEYA 4YFWA 1W8OA 2V4AA 4YWAA 5C9AA 2SLIA 1PO12 1HXS2 3J8F2 5FY9A 2B4KA 2LW8A 4MGQA 3WNLA 3DPRB 2RVAA 1C8M1 2CAVA 1DZTA 2ETEA 3J7NA 3ZXAC 2FBEA 3MBWA 5A3OA 1GOGA 4CXXA 1AJOA 5EZWA 1Q5OA 3ZYJB 4RQPC 5JXGA 4AL9A 1Q56A 2R073 4OHXA 4E4HA 1I1EA 4RQPB 1QH7A 4DINB 4ZU5A 1Q8PA 5IFTA 3U0ZA 4NIHA 4XHXA 5LA1A 5IAVA 3ACFA 2CHHA 2D97A 2ARCA 3SHRA 3VDDB 1W6MA 4C0BA 1RVF2 2IXHA 1QEXA 2CV6A 3VHRA 1W2TA 4YGEA 2D98A 3GGLA 4OI2A 3MYXA 3Q8FA 5EV7A 4XUNA 1LR5A 4DQAA 4BU2A 2W46A 1JUIA 1XYPA 2NLRA 4IE4A 1PZ7A 4LNVA 3HR9A 4Q0PA 1OT5A 3KSCA 1MEC2 3WF4A 2PXJA 1FNZA 3RI9A 4CE8A 1PO22 2XLGA 1F35A 4XCBA 2A6VA 2R6QA 3KGLA 4FPHA 3VBOB 5FO9B 3ZO0B 1GP5A 4FPYA 3ZYHA 4FQZA 3O0VA 2R041 2GP3A 4XUQA 2VZVA 1GLHA 4HPKB 2QQKA 1G6NA 2ZGTA 3B01A 5A3UA 2D44A 1PGW1 4XIOA 2JEMA 3WNMA 4RR3B 2DCTA 1ULOA 5CU1A 4NO4A 1LHVA 2CYFA 4FPEA 3VD5A 3ZLIA 4PF5A 2JIJA 1JOBA 2VULA 1DYOA 1RYYA 5I8SA 5FKBA 2KA3A 4GIQA 4NPMA 4R9BA 3BU7A 2D5HA 5GJ6A 3AZWA 4XMAA 3MI8A 3JZVA 1ZBA3 2VNGA 2IXJA 4Q4W3 3C7GA 2YMZA 4QPIA 1O3QA 2JG9C 1V9U3 3LQCA 4QQ2A 1ZZBA 2Y6HA 4GWIA 3ZDVA 3SCGA 2WLPA 1UXZA 3POJA 1SHWB 2VQAA 4CDQC 1WBLA 1A6CA 2OS2A 1J3QA 5DZFA 3LF7A 4WVVA 1NCRC 4XQWA 4Q0QA 1ZRFA 1NKGA 1VBA2 3UYJA 3O1UA 3POBA 1QXJA 3X29B 1VPHA 3LB9A 2AEZA 3NV4A 4B7KA 4YVWA 3SLIA 1TME3 5K7PA 2BP6A 4IEUA 5FP9A 5CZKA 3GBGA 2OVUA 4PT6A 1UIKA 5EQUA 5BXXA 3ZYFA 1NLRA 3K51A 5JIUA 4ZPIA 4EWAA 4ES8A 5ACA2 3TEYA 5IK5A 2GN3A 1UPIA 1ZA7A 3AP5A 4QXCA 2ZS6B 4SBVA 5T5LA 3VBRC 4JQRA 5I8YA 3H1YA 2EA7A 3ZR5A 4H55A 1WMEA 3C7FA 4JDMA 1FT9A 3GCWA 2B5HA 3ZYGA 1G8WA 2BEOA 3PUSA 4WVZA 4KWLA 1RC6A 4HN0A 1V6NA 3LCPA 3LSDA 4NHXA 4JKMA 5BNOC 5F6LB 3DYPA 3CMGA 2Z69A 4K1ZA 4XFCA 5HCFA 1BBT1 2QVSB 2F6BA 1SCRA 2AR6A 4NOTA 1BVVA 2QZ2A 3S0MA 2PMWB 1K5MA 2VQ0A 4QXBA 2DBIA 2GNBA 5LATA 2RE9A 1JZ2A 4QB6A 3WLUA 1C5HA 4H2AA 1NCQC 2HWE3 2WS93 4HANA 4Y22A 1NE6A 1C57A 1ND2B 5FPLA 4NHKA 1HRI2 5JPMB 5I0TA 4AVSA 5IJRA 4XQ4A 4E4SA 2NPIA 1UY0A 3MICA 5FZAA 4D7YA 4LBLA 1CPNA 4GQ7A 4KH9A 3I8TA 1XSRA 4U2AA 4XFIA 5FV3A 4ONUA 3TN92 3JQWA 3MLLA 3VZJA 4B3NA 1ENXA 3AM2A 4P9GA 5FXWA 1DCSA 3B3QE 2Q8DA 4A6SA 3TOJA 5FFOC 4RD7A 4U36A 5LY2A 5BUVA 1U5XA 5FZIA 5FY1A 2ZEYA 3VL8A 1TEIA 1O4TA 1OKOA 2ZX3A 1PX3A 1XPWA 1MEC3 1NCQA 3FHIB 5E8AA 5C8CC 3BALA 2WO2A 2OT7A 1PM4A 2H0BA 1ODNA 3BIWE 3ACGA 4PBPA 3U10A 2Q8CA 3WP5A 4DZGA 3ILNA 2HWB1 1MZ5A 2XMLA 1FNYA 2Y6JA 1RGSA 4I0AA 2WC2A 1JYWA 1UQXA 1JH5A 2D6LX 1UN1A 5E6HA 1D4VB 4FTBA 4GJYA 1UD1A 1IGOA 1QU0A 2UU8A 4BQ4A 2W92A 3I7DA 4QPGC 1H9WA 4GA9A 3E6DA 2GMPA 3V0AA 4IV1C 4PLMA 5BNNC 1SLAA 2NYYA 5A1LA 4ISRA 4XF3A 4LEJA 4Y1VA 3MIHA 1NCQB 5FZCA 1NY72 4CSWA 2Y6KA 2B7YA 2PAEA 1H2NA 1SPPA 2BUKA 2VZ1A 3RPQA 5FMDA 4Y4YA 1RUG1 3I2OA 5JSRA 3BB6A 2GC1A 3V0BA 3CHXA 1J1LA 1FATA 3C7HA 4J6GA 2ZX2A 4JVAA 2D3SA 1MR5A 1Y4WA 2XVLA 3KQRA 5JR7B 3RS6A 4AI3A 1BBT2 1ZVFA 1OA3A 1LTEA 1QJU3 4WVWA 4B4RA 4PQ9A 1YQ5A 2VY0A 1OOPB 3CO2A 4PHZA 1NZIA 1NAEA 2YBKA 3MHZA 4RS5B 1QGLA 2VW1A 1SBEA 3AFGA 3FUOA 3KT1A 4LA2A 2GNTA 1OLME 4IEZA 3AKSA 4CCNA 2HYKA 1CAVB 4YSFA 3POYA 4UF0A 5LBFA 3MGUA 4ZXEA 4LKDA 4UFJA 3VN4A 4JTOA 1HB1A 5ABJB 5L9VA 1IS3A 1CAWB 1D2SA 2JE9A 2WKKA 2WNVC 3RSJA 4M4PA 1JZ4A 1L7RA 2RS31 3MIGA 2X53S 4AQTA 2YDEA 3VBHB 3VBSA 5C3RA 5CAZA 1O7FA 1FV3A 2W87A 2VZQA 4FPFA 4QQOA 4QPGA 4CEYC 2EAAA 5A32B 4FFIA 1G9BA 4CEWC 2WNUA 3T0DA 2RS53 2IUWA 5C8WA 2E33A 1G86A 4JGYC 2VMCA 1W05A 1RUD2 1RL3A 2TEPA 4AFBA 4LKEA 3VDCA 3BPZA 3K3OA 2I2SA 1S2EA 2XBO3 3ZPYA 4XXPA 3D5OA 4OMCA 5A7WB 2AGSA 1GBGA 4L11A 2OYZA 3LZZA 3W5MA 3N9MA 5JZGC 4QX2A 1UWWA 1E5RA 5JLVA 3SC7X 2QQUA 3H3UA 4FAGA 3D4KA 1PO13 3J8F3 1DBNA 3I4IA 2XHNA 4HSJA 1N1VA 4W6XA 4GB33 3NV2A 5I93A 3H3ZA 1KEXA 5FZKA 2HBTA 3RVHA 2XL9A 2EIEA 3ITQA 2ZHNA 4P14A 5JMCA 1NLSA 4CZSA 2RS12 2BWCA 3ZFEB 3NAPB 4LOTA 2VMGA 1WCUA 2YY1A 3VBSC 4NPLA 4SLIA 4Y1XA 1AVBA 2J7MA 1UKRA 4XTMA 1EUUA 4I0BA 3VBSB 1GU3A 3VBHA 5FYUA 5CISA 3RZMA 3IDAA 2BQPA 5DQ0A 2QQWA 1SFYA 1VBD2 3I3DA 3R05A 5IFPA 3OPWA 1DU3D 1W6OB 3VZOA 3U07A 1UYXA 2VTXA 3ON7A 2UURA 1K42A 3ALQA 5ACA3 3EB7A 3H1MA 3NJVA 2L9LA 4Z92B 4HOOA 4E9KA 1EAH1 3N9QA 1YUDA 3L2HA 2Q30A 4QB1A 5FMCA 3PUIA 2PHDA 4NIAA 3V65A 3FFQA 1OC1A 3PL0A 4QGMA 4CP9A 4DXTA 4MLOA 3MEPA 4CDQA 2Q8OA 1PK6C 3UT0A 1YHFA 1QOSA 3Q8EA 1AYM2 5FZ9A 1MZFA 4KL1A 4M00A 3GZAA 4KU8A 5DDJ2 5GKAC 3ACIA 4Y5SA 1R081 4YPJA 4A41A 5FOJB 4RHV1 1UZYA 2XHKA 4QQLA 5CFCB 5T54A 3RZZA 3VHOA 5IW0A 1UO9A 1O3SA 1G9DA 2K0GA 2CTVA 2VNRA 4Q4Y2 1HRV3 3HT2A 4S2GA 3SEPA 2MEV2 2R072 3P3NA 4FO9A 5CVRA 4ATEA 3TEZA 1ULPA 2BPA2 1O59A 3J4UH 3IN9A 2EXIA 3JB4C 3H8OA 4XUTA 1W8ZA 2DTYA 3GYDA 4I09A 4COUA 5F37A 4QM8A 2ARBA 2YHJA 5FR3A 1TME2 1R082 2P37A 3CQOA 3LDRA 4CCDA 3N35A 5G04L 3U1XA 4MGZE 3ST7A 1KFUL 1BJQA 3PJYA 2RV9A 2IXCA 3DYMA 4TN7A 2BV4A 2VD7A 3U4XA 4Q8KA 3RI8A 2IVIB 1KS4A 2RG4A 1SQ4A 3BN6A 1UOFA 5I0SA 4LE3A 4ASLA 5C33A 2E7TA 2ET7A 4M0NA 4Q4X2 2FMDA 3B02A 1IOAA 1K5MC 4WM7A 5CFCA 5I91A 4CPBA 4N8MA 1GR3A 1UOBA 3KV5A 2WDBA 2XQRA 3NAPC 1F5JA 3GXUA 4HKOA 3ACLA 1RVF1 4B7EA 1AYN2 2HLEA 1UU6A 1JU3A 3POEA 4A3ZA 5J36A 2XJUA 2VECA 4FFFA 2BGCA 3HN3A 4KBBA 4AEDC 4NHLA 2J1TA 1KJRA 2R0HA 1XC6A 4LBMA 2OUHA 3SKVA 5HI0A 1ND2A 2BOJA 3FWEA 1J59A 4PF1A 1ODMA 5FYMA 1RVF3 3ZIWA 1S55A 3CL1A 2YUEA 3FX3A 4AGRA 2J1UA 3KF3A 4ZU4A 3CKHA 3H8RA 2HWD1 1ALYA 4DRVA 3N7LA 4OHZA 3S7EA 1GKBA 2VZPA 2VCCA 1ZZ9A 4DOUA 4N43B 5LA2A 5KC5A 1US2A 3WF1A 1RUF1 1XOYA 2NZ9A 1QJX2 4NRQA 1O4ZA 3WCSA 2W39A 1VBE2 3VBFC 4A45A 5FZBA 2E53A 3AMQA 1GOFA 3M3IA 4MO3M 1LKNA 4K8RB 2RDNA 2P3YA 5C4WA 2GDFA 3HEIA 1H0BA 5JXJA 1AR83 1CGPA 2EXJA 3CZUA 4QM9A 1V6IA 3VZNA 2WT2A 2ZPXA 4HK8A 1C5IA 4QQPA 3C2UA 1FX5A 2O0OA 2IFWA 1C1FA 2ID4A 4K20A 4K1YA 2VZUA 1Q43A 3VBOC 1OBNA 2BRTA 1AXKA 3ZYPA 2J1SA 4XETA 5DABA 3ASIA 4D7SA 2Q4SA 3EYPA 2MPFA 2A73B 5D8AB 2DVDA 1VRBA 1LHWA 1W2UA 5FZDA 2E7AA 2UWCA 1O6UA 2EF6A 2G4IA 3CDZB 3SH4A 4AEKA 5L9BA 4L92A 4N53B 3UGGA 2PHLA 4UAPA 3IKWA 2RDSA 1WZXA 3U14A 4AHZA 1BMV1 2RJ2A 4D8MA 4EQVA 1IG0A 4XBNA 4OI4A 3WDXA 4LUKA 2WBKA 5KWRA 1OA4A 3AX4A 1W6PB 3WHUA 5JR2A 3WVJA 4CDQB 4JRLA 2RDRA 2TUNA 3RJRA 1E5HA 3K75B 5JXIA 4AF9A 4XYXA 4CU8A 1EV12 1AJKA 1N1YA 2WZR1 4IXLA 4NRPA 2Q8EA 2IZWA 4YYOA 1WBFA 4BISA 2WIIB 1XBFA 1ENSA 4TLFA 1RUI3 1HV0A 5FPXA 1Z7S2 2PHWA 1CPMA 2NMOA 4MYEA 5FJHA 5GZCA 1WW7A 5HCAA 4R9AA 4QT6A 1QDOA 3NQHA 4N53A 5E88A 4CCJA 4JHTA 2OKXA 5F32A 3DPRC 3FBMA 4XJUA 5A6XA 3C7EA 3AXEA 5GZEA 1YIPA 3B93A 4YW5A 3MDPA 2O8OA 4UW5A 3VKLA 2PHXA 3I59A 5EXOA 4Q4X1 2HEWF 2HEVF 5A1FA 1VBC3 4BQXA 3HWJA 2VCBA 1SLIA 2VO5A 1T6GC 4YRDA 3ZFFA 2SBAA 1OXCA 5D8AC 2ADDA 3WY6A 4B29A 3MIBA 5I0DA 4COZA 2UYBA 3KHBA 4H7LA 1QOTA 4EE2A 3VGIA 5DXDA 5F7UA 4YW2A 2VMHA 1DYPA 2WR9A 2YPDA 3DXTA 1W9FA 1MS0A 2E63A 3Q8AA 4RQPA 2YBSA 3IAPA 4LO5B 3UGFA 4BZ4A 5K9YA 1LGBA 4DEVA 4YARA 4CDXC 5C6CA 2OW4A 1YXWA 2Y6LA 2ET1A 4CA9A 2Y6FA 3T4HB 1H8TA 2J1VA 5D2AA 1AXYA 2EICA 4LLOA 1VBB1 2B39A 4L8QA 5J3UA 3E5XA 2LM3A 3K77A 3O1PA 5IATA 1CZTA 1UL9A 2YGLA 4QKDA 4LT5A 2WNVB 3VDDC 1JOPA 3BVCA 4FOWA 2RS33 4ZU7A 1KQRA 4OHWA 5SV5A 4I02A 5FIXA 3F2ZA 1JYNA 5GZDA 5DDJ1 1NYWA 2EALA 4ARYA 4DPNA 4XABA 4IGQA 5F5IA 4XJWA 5F5AA 4CP9B 2ADEA 2WWUA 1MVEA 4L9BA 2CDOA 1VIWB 2DV9A 3PVOA 4EYUA 4RR3C 1UF2C 1OURA 4Y4RA 4M3CE 1QJU1 4EZ4A 4L0PA 2DTWA 4GKXA 1QXRA 1WLDA 3FMGA 1JTZX 2HWC2 3FE5A 2VJXA 2OPKA 1PK6A 4LXLA 1DQ0A 4XAEA 1JHJA 1W9TA 3GALA 4HK9A 2VMDA 1GQGA 4CDXA 3AKTA 2G9FA 3KCCA 1IZ3A 4FPOB 4HPKA 3LA3A 4QU2A 1X9PA 2DFBA 1SACA 3G6JB 4Q4W1 4R4ZA 3THTA 4A7KA 1JZ6A 4Q4V2 4XDOA 1S2KA 2RMU3 2MEV1 5LBEA 1LU1A 3VBUA 1FPN3 1UX6A 1W39A 2BERA 2P6HA 2P34A 3N3HA 3ES1A 1L7LA 4AI2A 4OULA 3K48A 2JKXA 1DGRA 1DYKA 1W8TA 1ASJ2 3AKQA 1LJ7A 4UW3A 5DAVA 4BH9A 3O1VA 2OUJA 5JVVA 3RDIA 1NG0A 4N43C 5TSWA 3U75A 5K0UC 4LA3A 1QJEA 5C3QA 2PQSA 5CKNA 2QQNA 1GNZA 2XOMA 4AI0A 3NAPA 4AVCA 1IS6A 5F5CA 4AVAA 3A21A 1YWKA 2Q1ZB 4PLNA 1YFXA 2W95A 4AQ2A 5BNNB 3IB3A 3AP7A 4O9GA 3VBFB 4MXVA 5CIRA 1UOJA 5LRRA 1TQ5A 5LASA 3N9OA 3VUOA 2P5BA 4QKNA 3ZFEC 1N1TA 4UFMA 1EYBA 4PI2A 4RS5C 1OKQA 1LHNA 3TNPB 3ZOIA 1K12A 5GALA 2P1BA 4GB31 1ULFA 3N9PA 1NA1B 1AR63 4OUMA 1COV3 3RQ0A 4QHOA 4XZPA 1RINA 4IDZA 2PQQA 1JBCA 1IPKA 3POWA 2AREA 4FFHA 2LALA 4XF0A 5L7OA 1R1A2 3M70A 3PNAA 1IS5A 1PO21 2XGXA 4NIGA 2VNVA 5B4XA 4F3JA 4UW6A 3VLBB 1QDCA 2X05A 5CFCC 5LZ6A 5F3GA 2BYVE 1RUI1 3OUHA 2E31A 2XG3A 4AVTA 2DVAA 4CCEA 2GC3A 3C8XA 2ZJCA 2A75A 1PK6B 1ZBE3 4NIDA 4QHZA 4OHYA 1W90A 1EUTA 1AZDA 2QQVA 1F31A 4Y22B 3W20A 2ZEZA 4FBFA 1FYUA 3DPRA 3KS7A 1UU4A 1VBB2 3I2HA 4M3CB 3HBZA 2XDVA 4P9IA 1U5ZA 5FYSA 4XIKA 1UZZA 3MFCA 4QX7A 3SCHA 3WEZA 4B1MA 3N36A 1VBE1 4AHWA 3GZUC 3KCXA 2IFRA 1CZSA 1WW4A 2VL4A 1AR81 3B69A 1REDA 3H3LA 4WV8A 5JCTA 2A3YA 5FZ1A 3I59B 3S5AA 3I2DA 1DQ5A 5FBZA 1FPN1 4CPBD 2VCAA 1GWMA 3T30A 4XHBA 3ECQA 1CAWA 4H14A 5IVEA 5ABJA 1BEV1 4AW7A 2BZDA 4XFGA 1GP6A 1A8MA 5H9QA 5KHGA 4WZFA 5IWFA 2JD4A 1CVNA 1ULEA 3THCA 3WCRA 4BQ2A 3KM5A 3L9JT 4XC9A 3QH7A 1HJGA 5GLWA 3KHCA 5FDBA 1YJLA 5FZMA 1WW6A 1KXGA 1S0BA 1REEA 3HOBA 5FUIA 2IXKA 4CDUA 1AX1A 3POSA 2W1SA 4QAWA 3RJ2X 3NJZA 5GZGA 1W8HA 1I6XA 2YC2A 4FFGA 3UJOA 1JHNA 4GMP3 3NV1A 1XE7A 3KT7A 1IKPA 3U11A 2RM22 3UKNA 4E27A 3S5QA 5FY8A 5L7OB 1POV3 1QH6A 5LBBA 3WQ0A 1GNYA 3NNJA 4HKLA 4JCKA 3D82A 2NN8A 2E6VA 3EO6A 4EN6B 5DAPA 3GBFA 2BNMA 3BI3A 3A7QA 2VOWA 4KNCA 1J58A 5FZEA 3WQ1A 1ULGA 1VAKA 5CB7A 1L7QA 2Y60A 3AZXA 2R043 4JDNA 2G19A 3JD71 1AR92 3ZXKA 1Y9QA 1XNCA 2C5DA 2Z5WA 3WNNA 2DCYA 1HB4A 1UY3A 2JDMA 3CJIA 3GCXA 3ABZA 4QPIC 1RMU3 1LRHA 4PI0A 2WSUA 1XRUA 3ZM8A 4A6OA 2GNMA 1X8EA 1YI9A 4AEMA 4IV3C 4E8DA 4I0WB 4BMBA 2R49A 2RR12 2WT1A 5BNQA 1R083 5GLUA 4Z2WA 4LBNA 3ZFGC 3ZXFA 1UZ0A 2W2IA 2Y64A 1MS1A 1GZWA 1PVC2 5H9RA 1UAIA 2WZ8A 3AYDA 3K2OA 4QGLA 2DVFA 1S0FA 2YV8A 5ISLA 1VMHA 4AHXA 5FBJA 2BOIA 1HIXA 2D6PA 4P02B 1QKQA 2ERFA 1W06A 2W1UA 4PIZA 4LMFA 1XYOA 1YEWA 4GWJA 1YJKA 4K6BA 1APNA 4CCLA 2OXBA 4Q27A 4KWKA 2WFF2 3LFIA 4D69A 3K4DA 2XUMA 2WWSA 1NLQA 1HRI3 1CQ9A 4QKBA 5EYXA 4MOAA 4Q0UA 4DY3A 5D8AA 1FAYA 1SFNA 1F9KA 5AVAA 3U78A 1JOJA 1PIV1 3BOPA 4JQTA 4A7ZA 5C3SA 4G9SB 3I3QA 1JZ5A 3HQXA 4M3CF 4XFFA 1OVPA 3V56A 5FY5A 2OQ7A 3OGRA 3RZGA 5A7QA 4AK3A 1OQ1A 2XXZA 4CEWB 3VD9A 3UKTA 5BNOA 1GZCA 4XURA 2OX0A 4AI9A 2JICA 4IETA 5FYZA 4MUVA 2AYHA 3V64A 3LIHA 3KV6A 1PMIA 3PUHA 3VZLA 4ES9A 2DF7A 4MXWA 2IVJA 1PIV2 1IPSA 5A7WA 5FLJA 1QJU2 1WMFA 2VU9A 2B46X 4P5HA 2VVFA 4ZY9A 4A3XA 4EJRA 4KG8A 1POV1 4R4XA 1VB4A 5C4WB 4KWJA 2XR4A 2J22A 1AX2A 5FYVA 3RZHA 1S0DA 5DPNA 4AZZA 5H9SA 1XB9A 4DIQA 1H1IA 1NUKA 2XBO1 4QGNA 5BPXA 3WD5A 5HV0A 1GANA 3E97A 5IHRA 2WO7A 1O5LA 1Q3EA 2JG9A 3M3QA 3K4ZA 3IDCB 5GZFA 1OPOA 1I5ZA 3VBRB 3WP4A 1SLLA 3LDBA 5KHHA 5G05L 1FI2A 3OF1A 4OYUA 1SDWA 4YW3A 4JRAA 1LOAA 1OVSA 3MW3A 2QUOA 3P3PA 3PMSA 5C8CA 1KJLA 2JKBA 2C4XA 4YG3A 5FP8A 1X33A 2CGOA 3BPSA 3M7AA 1E57A 1FMD2 2ZHLA 4JGZA 4TXWA 5CYYA 4ARXA 1OH4A 2CWMA 5GLVA 5CKMA 3VHPA 5EJ1B 3RMXA 3KD4A 4AQSA 5FKCA 5JOXA 4YZ3A 2XJVA 1PNFA 3JBG2 3THPA 4ZZ5A 3SQOA 3M4FA 3WOGA 2UWAA 4R9CA 2WABA 1ZNPA 3IBMA 1UZWA 2ZGPA 1O8SA 3ZKYA 5FO7B 5JSPA 3TN91 1BLZA 4IEWA 3B94A 4BE3A 2XQXA 4OMDA 1QQP2 2PA7A 3OTFA 3RFRA 1O5UA 3J26N 4QB2A 4QDSA 4QKFA 2PAKA 3DEMA 2XVGA 3T09A 5FZOB 1TMF1 3WW1A 1DIWA 1POV0 1AR62 2HEYF 3CEWA 4Q4V1 2XL7A 5J37A 4Y5TA 1R092 2BGPA 3IMMA 2XUEA 4WBBA 3AVSA 4JDOA 2YC0A 2OIIA 3W59A 4YGDA 5T3NA 3WG1A 2FDGA 4L99A 1DLCA 3ACHA 5KHKA 1OLMA 2A1XA 1BBT3 4GALA 3ZYBA 2UY8A 4BHPA 1UPSA 1CZVA 1UW8A 2X5IA 4IE7A 4IW3A 2GMEA 3OGSA 3C3VA 1TE1B 4GZ9A 2D3RA 4KMQA 2VVDA 1RUC2 1VBC1 4NROA 2BBAA 2CSGA 1JI6A 1YI7A 4JAAA 2E51A 2VZRA 5FYYA 2D40A 4A4AA 1RIRA 4Y1YA 3AZYA 3OUJA 1VJ2A 4DXRA 3WR0A 4Y3OA 2YZ4A 2JE7A 5L7OC 4XPVA 3I2GA 1Y9MA 2HYXA 4XDQA 4ZONA 4AYUA 4XTPA 3LA7A 4BIFA 3H8XA 1LOGA 3WDYA 3ZSJA 4D6SA 4IERA 1CESA 3POFA 2VTXJ 1RUI2 2WQZC 2D7FA 3JB8A 3ZXEA 2LROA 2J1AA 1MQTC 1J3RA 3I97A 3OPZA 3R4DB 3AP6A 1ULCA 4UYBA 1UXXX 2ZKNA 3NNMA 3PJQA 4CCMA 1GSLA 2BVBA 3I3EA 1KITA 1DZRA 2B8MA 1VLNA 2XWBB 4PDWB 2CDPA 4YGBA 1JYIA 1PZ8A 3PIJA 3I3MA 1XYNA 1DLLA 4NN0A 1TME1 4BK5A 1V6JA 5BYNA 3WNKA 2RM21 4N43A 5DN2A 1ZZ6A 4X8NA 2H0VA 1GWKA 1CD3G 4OZOA 3BTYA 1A3KA 3AYCA 4QPWA 1SLTA 5FYHA 1LHOA 4IEOA 1NXD1 4J25A 4O7XA 3NL1A 5J48A 1FV2A 2JDHA 1URXA 4PBOA 4AE2A 3UJQA 3WT3A 2Z4FA 3BTXA 3ETQA 2ZGUA 2ILMA 4JHZA 5FPVA 5JIAA 1V9U1 2D3PA 1JZ3A 5A7NA 2WFF1 2D93A 3I54A 3OEAA 5JDBA 3IPVA 5JMOA 3JUUA 3VD4A 3PVNA 2BFUL 2GC0A 2WINB 3W21A 3QD6A 4AI1A 2W9XA 4IEVA 2GAUA 3VBFA 2ZGQA 1WW5A 2ZMKA 5LY1A 1RXGA 1PVC1 4TTGA 3O1MA 2ZHMA 3OGGA 2RS52 2ZMNA 1OSGA 1V6MA 5FWEA 1GNHA 2GMMA 4LHKA 4P9XA 4GB32 3ETPA 4FI9A 3VB9A 4AFDA 3I2IA 4XFBA 2HWC1 2VOTA 1SG3A 5FYCA 2PHUA 4NWWA 4QXHA 2XB6C 2C9AA 5SV8A 5JPNB 3P1IA 1UMZA 1K3IA 4Y20B 1CN1A 3PIGA 5LK5A 2RS51 1W8UA 4OQ9A 2HWD2 4IV3B 5FCCA 5FO8B 2A6WA 3HIFA 3ZVXA 1S0EA 3GDBA 4PQQA 2ENRA 3PUAA 4TZDA 2W1WA 2Y33A 4K40A 5ACA1 3LOIA 2D6OX 4OHVA 4KWUA 1XNAA 2QDRA 4LORA 5A3MA 3MW2A 4Q29A 5FZOA 1CONA 1YLLA 1UNBA 4LOSA 1GWLA 1KDMA 1VR3A 5C7GA 2A6ZA 1RUJ3 4N9HA 2VTFA 4GXLA 4S2FA 3T0BA 3TRSB 4DRRA 3LGRA 4NPRA 2ZX0A 4LR4A 5HCBA 2ZGOA 3R0RA 4CTEA 5IK7A 3QLQA 4PIXA 1Y43B 3AC0A 3O0WA 4MGKE 4UW4A 4LHLA 1PNGA 3M3OA 5EYYA 3LE0A 3VD7A 3OBAA 3ZKUA 1VAMA 3WX5A 4LQRA 3AMPA 4BQWA 3O1TA 4CDWA 2BNOA 4QHBA 3I2JA 1BEV2 1T6BX 2VQUA 2C1FA 4XZUG 2J1EA 2WFF3 3WNOA 2DU0A 4WVMB 3HT1A 5BNPB 1DDLA 3OOXA 4P9YA 1ENQA 1QJY2 1H8TB 2NM1A 3DYOA 3DCQA 3AL5A 1YQ6A 1YQCA 3E1F1 5K0UA 4WM8B 3ZFGB 2XH6A 3BTZA 4CUCA 3ZMNA 1UOGA 2V73A 3AP9A 1AXZA 1LEMA 5C4WC 1U0AA 3SKJE 2EIGA 3HVDA 3LWCA 3I49A 2QFEA 4HMZA 3VBUC 4BLIA 1I9RA 2FQPA 3QBQA 4ZS3A 4LPLA 5IVVA 1V70A 1W6NB 2ZEWA 2ZX4A 1AR93 4OLLA 3NJYA 5FWJA 4CDWB 1FMD3 1QQP1 3MLJA 1B35C 5KC6A 2K9ZA 5HXMA 1RUD3 2P4EA 4W8JA 2VG9A 3T2TA 1PO11 2ATFA 3J8F1 1LODA 3PTRB 4ITCA 4C1WA 1DF0A 1W8NA 1SLBA 2VUCA 3H8UA 4UFKA 1C28A 5FXZA 3E6BA 2K2SA 1RJ7A 2OQ6A 4XF1A 1W3VA 4XACA 4WM7B 4WZCA 5EPAA 4NR1A 1HXS3 4YG6A 1WWYA 3VZKA 5J7MA 3URFA 3WW4A 2ZZJA 5FP7A 2HH9A 3AB0A 4TSVA 4Z8BA 2CAUA 2QJVA 3KF5A 2YXSA 1EP0A 2IXIA 5EP9A 5FY7A 4A2UA 1AR73 4Y24A 5FYIA 1SCSA 4RGAA 4YW7A 3RWNA 2JDNA 4RGKA 5F2WA 2VBPA 4AAPA 3WDWA 4HVRA 2HWF3 3FLPA 1GV9A 1VMJA 1I5PA 2Y6GA 4DEQA 1W6PA 2A3XA 4MGIE 2GALA 1DQ2A 1ZRIA 2J42A 2VPVA 2YFZA 5L19A 3NJXA 2RS11 1UMIA 2XJTA 2DUPA 4CXWA 3OGJA 3M2MA 2VCMA 1GZWB 1W9WA 3PVEA 5C5UA 4BXSV 4QPIB 4FOVA 3PVBB 1NOVA 3EMRA 2BDRA 2WLQA 3ZYRA 4PDWC 5AFEA 4BPZA 4Q1RA 4OQ8A 1W2NA 1TNRA 5F3EA 1LNSA 3HBKA 4DXZA 1W28A 3ES4A 5LBCA 2RR13 2EIDA 2ZXQA 1W6MB 5FXXA 1OUSA 2XPJA 2D43A 2B42B 2WN2A 4A7YA 3UKVA 2HWB3 1DGWA 1WLTA 4Q0SA 2B45X 5APAA 1ZZCA 3OBZA 5FRAA 1H8VA 2DFCA 4IGPA 1H4HA 5FUNA 1RUG3 1ZZ8A 3GF6A 4AEDA 2ZA9A 5DAWA 2JIGA 4LJHA 1F15A 3AL6A 3TN93 4GWNA 1RUH1 5A6QA 1Q8QA 4J1WA 3WNPA 2Q1FA 1W6OA 2GU9A 2ZKLA 2OZJA 3AJYA 4YNIA 4P9WA 4E2GA 1LOFC 5BNPA 1NE4A 4HKWA 4O9EA 1E5IA 3AZVA 5FREA 3OD4A 4HLTA 1VBE3 5JAXA 3RYRA 5A32A 1DFQA 4XCAA 1US3A 5EJ3A 4IE0A 3VBRA 3VL9A 4C1XA 3CNAA 1OMIA 2ZTNA 3ELNA 2AACA 2JB8A 2H6CA 2JG9B 1JN2P 4YVSC 5EWSA 4AGVA 4IEXA 5IVFA 1IHMA 3H0OA 4XUOA 1YYNA 1QWRA 4PDWA 3T2OA 1V9U2 5CG8A 1V00A 1WD4A 1LHUA 4DXSA 1AL23 2QKDA 4YZ4A 1DQ6A 1RUOA 2JDYA 3I2FA 1BEV3 2JD9A 1PIV3 1R093 1CX4A 1XQNA 2C9KA 2ZGRA 4WM8C 3OYWA 1RUD1 3WINE 4DUWA 1MQTA 4EV0A 3JU9A 3LD8A 3LA2A 4HSLA 2HWF1 4LUMA 3ZXDA 2UYAA 3GJAA 1Y3TA 4ZS2A 4COYA 3H7JA 5F5QA 1WLWA 2PLV1 1PGL1 2WYFA 5CNAA 4CU9A 2JECA 2PELA 3OG2A 5FPBA 1D4M2 1JXNA 1W6QA 2A6XA 2QE3A 2ZAAA 3T1LA 4M3CA 5A3WA 4BK4A 2FD8A 3W9AA 4E2SA 1FPN2 5IK8A 3O7OA 1CJDA 4Q5OA 1KS5A 1CWPA 1OHFA 1ND3B 4RSUA 4W6WA 1H6XA 4I01A 3VV1A 3E5UA 2ZGSA 1JYTA 2RDQA 4FQ4A 1QJY3 1AYM3 3S30A 4ZZ8A 3CBNA 2D6KA 2HWC3 3DGTA 3DECA 4XF4A 1H4GA 4CYDA 3N7MA 1BQPA 4EWDA 3M3CA 1GMMA 2IWGB 3JD73 3DL3A 2Z79A 5FZ7A 3N9NA 1EV11 2WZR2 3CLPA 1ZM1A 5D1IA 4XJAA 5T5PA 1HJFA 1NY71 4HBNA 2A71A 4DFSA 3MUY1 2GZWA 1MPXA 4HONA 2VXRA 3F95A 1M06G 3T2QA 1ST8A 3QCWA 1VBD3 2VW2A 5FK8A 2VZTA 2KD7A 3GBWA 3ZSKA 4EROA 4MADA 2YG0A 2HWF2 3NMBA 1PX4A 2VE1A 3LOBA 5DZGA 3ZDSA 1XU1A 2JDZA 1CIWA 2VC9A 4LHSA 4XF9A 3O1RA 4NAOA 1IS4A 1G7YA 1WUVA 4FPGA 1COV1 1LU2A 4KBZA 4YLZA 5DUXA 3M1HA 5CFDC 2W94A 1IG3A 5T52A 2PYTA 3WDTA 2W91A 2FDIA 2R1BA 5HXVA 3LAGA 3A4UA 4IEQA 3VBHC 5FLIA 5FMBA 4MG2A 1OQEA 3RGBA 1R091 2KR2A 1HRV1 2XONA 1LEDA 2HWD3 4JZRA 3JQXA 3R6SA 3N4MA 2Q1MA 3EQEA 1XJAA 2WZPP 2BWAA 2QDNA 4JTNA 3OPTA 4NAMA 4BQ1A 4MGTA 2R1DA 1O3RA 5T5JA 1REFA 4NVPA 2QCSB 3PURA 5JZGA 2WYSA 5IVJA 4YW4A 2DYCA 1ASJ1 5F2SA 1VBA3 4K9SA 4S2DA 2Q5TA 3FHAA 3ZX7A 1ND3A 1BKZA 2C24A 1VE0A 3ZFGA 1CAUA 3DN7A 4MH0E 2QQLA 3AFKA 1J83A 3H1WA 4GD4A 4QPYA 4XW3A 3SH5A 3ZXJA 3RZLA 1ZBA1 4B4PA 4QMAA 1D0HA 3ROUA 1MS4A 1RUH3 1SEFA 4Q4W2 4NJ4A 1LCLA 2CGNA 4QD2A 5LEJA 2V5YA 2KXLA 3OUIA 4K7JA 3MUZ1 5IVBA 4RFRB 4IV1B 2FCVA 1X36A 2JXAA 3IMNA 2G1MA 4INDA 4W50A 2ZMLA 4IUGA 5CEHA 3RNSA 1I3HA 1WCDJ 2OPWA 2ARAA 3AMNA 2R7EB 3CU7A 5C71A 1W8WA 1ZBE2 5C3PA 4AI8A 1HQLA 2VZ3A 1W6QB 1NA1C 2AC1A 3OCPA 3OEBA 4OI0A 1KDKA 4CEWA 2CNAA 4LIVA 1CAUB 2V72A 3WG4A 3BKZA 2Q0AA 1OH3A 4A42A 3IAQA 2E26A 1YCIA 3WW3A 5F3CA 3WF2A 4CUBA 1VP6A 2VOVA 3BYWA 1X82A 3MLKA 5FMOL 2CL2A 5K4LA 1OFNA 3KGZA 4FXGB 1GQPA 3TNQA 3ZYIB 3K3NA 3NKTA 4XE9A 5FLHA 5C3OA 4UF0B 2X5IC 4HVQA 1COV2 3AK0A 3USSA 4AQ6A 4F83A 1KRIA 4A44A 2R062 1X7NA 4GH4C 1TMF3 4XJ9A 3E6CC 2A3WA 1JS9A 1XE8A 2LUWA 4HVOA 4GH4B 1ACCA 5DUVA 1JYXA 2OZ6A 5FZ0A 4FOYA 1ND2C 4Y1UA 1Q8OA 4K8FA 3JXSA 4CCCA 1UYPA 4IV3A 3UV9A 3PU8A 4HL0A 1BZWA 5FP3A 4BQYA 1CIYA 3Q8CA 1S4CA 1PZ9A 4OI1A 2LTNA 5IYYA 5AC93 4TLGA 1YFWA 2CGPA 2WJSA 2WZR3 1Q8VA 4ORFA 3ZR6A 2DCJA 1CAXB 4OUSA 2D6NA 2Y8KA 5DMYA 2A5ZA 4ISQA 2VMIA 4YVSB 5GLTA 2JG8B 4RHV2 2K46A 5FK7A 3KB5A 2H6BA 3D6EA 3HQUA 4W4ZA 4AWDA 1AR61 2JG8C 2C26A 3HNYM 4Z2AA 1XNBA 2WNVA 4NMIA 4YZ1A 2C0ZA 1J84A 1F4HA 2R042 3BOWA 4NHYA 4HG6B 1JZ8A 3BODA 3SCFA 4COWA 1J1TA 1WA4A 1QJY1 1HXS1 4XEZA 2PLV2 4I30A 1BCXA 4HETA 2ZABA 1N3OA 2R0FA 3HJRA 2VAUA 2WNUC 1Z7S3 1YC61 3QOPA 4BMEA 4OFGA 2VOXA 2DUOA 3KQ4B 1LOEA 3J9SA 3GZEA 4BCUA 3AMHA 3VBOA 4H7MA 4URTA 3OBRA 2AH2A 2F4LA 4FOQA 1FMD1 1AX0A 1QQP3 5FPAA 3TAYA 5FOBB 5A3PA 1B09A 2CU5A 3QH6A 3IWZA 2Y0IA 1GOHA 2PTMA 3ZFFC 3KCYA 3ENRA 1DGLA 3MPBA 3MV01 3TYJA 2YBPA 3GM8A 4IEYA 2QNKA 3MIFA 4XJZA 4GWMA 5C70A 4ZXKA 5JWPA 4NIIA 1RJ8A 1BXHA 3OBTA 3RYKA 5FZ3A 4KG0A 2J1RA 3NW4A 4AEJA 4CU7A 1RHI3 3D8CA 2G9GA 4QXKA 5JZGB 1JW6A 2BBVA 3P6BA 2A6YA 5E1RA 2XJSA 5C9AB 1X50A 1OOPC 3WQBA 4D3WA 2AUYA 5KHIA 4LULA 2DDUA 1ZYBA 2W5FA 2V09A 5LEKA 1PGL2 3NKGA 5FMOS 1ZX5A 2FZ2A 3MF9A 3VZMA 4DMIA 4EZHA 2BGOA 4IL7A 4X6QB 5IUQA 2X10A 2VR4A 3INAA 4NUBA 3T1MA 1ZZ7A 5T55A 3TEXA 1PGW2 1SLCA 3J7HA 3BGAA 3OB8A 2FHRA 1VBA1 4V2VA 4XMIA 5IT6A 1KGYA 1VBD1 3DKQA 3LKJA 4GULA 4I3PA 3LIGA 1PGSA 1WD3A 1CAVA 4FPLA 2BNNA 3CF6E 2QQJA 1IQDC 1VRH1 4BXFA 1E5SA 1SMVA 5IVCA 1DGWX 2Y34A 2VGDA 2W0XA 1NA1A 2BU9A 3U37A 3EBRA 1OD5A 1XNTA 5FJKA 1O91A 2PN5A 1VMFA 2ARXA 4LKSA 1AF9A 2RJKA 5M0TA 2QZ3A 4WM7C 4XUPA 3CJIC 3TBDA 1HW5A 1NQJA 2Y38A 3AZZA 3DF0A 4JGYA 5FZ6A 5A7SA 4C91A 5HBAA 1RUJ2 5DAQA 2WNUB 3ZSMA 2I07B 2EAKA 1UY4A 4RYDA 3PHMA 2ZX1A 2YFUA 2WNEA 2VUJA 3ZXGA 3EJKA 3ATGA 3MZHA 2B9UA 3FLTA 1EPZA 4XXAA 2BFUS 4C0HA 3NNLA 4QPGB 5T5OA 3O14A 4MX3A 3T3YA 4LLFA 3O12A 4AEDB 5A33B 1PM7A 2BJSA 3T0AA 4GMP1 1LECA 1OI6A 3FLRA 1TG7A 2ZCWA 4Q4X3 1OLRA 5ANQA 4YM3A 3GHNA 2XKOA 4COVA 3H50A 1XXNA 5JXHA 4P5YA 3NSTA 4Y20A 1YO8A 3FZ3A 4DB5A 1MACA 1RXFA 2VOKA 2X8KA 3WP6A 5CFDB 5ERLA 5GM0A 3VDBA 2RJLA 4W6YA 1XE0A 3VD3A 3POIA 4HT1T 5F9TA 1N1SA 5DG2A 5KHJA 1W2AX 2Y0OA 4AGGA 1C3HA 2F4PA 3OSDA 4L2NA 5E89A
chains in the Genus database with same CATH topology
1FXZA 4V1PA 3RMYA 3VKOA 3ZFEA 1V6KA 2HWE1 2WS91 1C4RA 1CJPA 4K3UA 3IT8A 3GHMA 3HMYA 1DHKB 5AVPA 2P3JA 3DUIA 3TWIA 5DUWA 4AHYA 4YZ5A 2D5FA 1G9FA 1ZBA2 3B7MA 4XFHA 3MFAA 1ZRDA 1D4M3 1QJX1 3KLSA 1Y7BA 2PHTA 1O4YA 3FFZA 2PHFA 5LK7B 1QY4A 4XOGA 3JD72 2I74A 1RITA 3TB0A 3VDDA 4YVWC 4YGCA 2AENA 1QF3A 3IM0A 5DZEA 3ZXLA 1XNDA 4MVTA 4GKYA 5CG9A 3FC0A 2GH2A 1BVP1 4YM1A 4EN9B 4L97A 3EXUA 1S0JA 1HRI1 1PHMA 1H8TC 4GMP0 4MV2A 5I0UA 1DQ1A 5K0UB 4BLJA 3WG2A 3VKFC 1EY2A 1H9PA 2TBVA 1MS8A 1MS3A 2R063 4BM8A 1H2LA 3NWKA 1RUC3 4NHMA 1GYKA 2VVEA 4KGGA 1W0OA 4NWVA 5J98B 4Z07A 2ZGKA 4X6RB 2DCZA 3WP3A 1ASJ3 1H2MA 5K8SA 1F8VA 4EN7B 1XNKA 1DQ4A 3AKRA 1H2KA 1D0GA 1RUC1 3H9AA 3N7JA 4PLOA 4HZFA 5FAXA 3NO8A 1SBDA 4Q26A 1LOBA 1U5YA 3ZSLA 4UBHA 2CY6A 2GSYA 2DVBA 4LBQD 5DDJ3 4AVBA 3AP4A 1AR82 1C8NA 2P2KA 4YVWB 2R16A 1F5FA 2R071 1YNAA 2WA3A 4LO6B 2R32A 1N47A 2Z42A 5LRSA 3IDBB 2ZGMA 2X29A 3R4SA 2XBO2 4Z82A 1QJX3 1RHI2 3AYAA 1C8M2 2CWSA 2DCKA 4Z1VA 4RR3A 2RS32 1XU2A 3HN1A 3WDUA 3A0NA 3USUA 3V0AB 1VRH3 2IC1A 2WSVA 1ZBE1 5J09A 4FTEA 3UL2A 1AL22 1HX6A 1RHI1 4RA0A 1S0IA 4EWEA 5BNNA 2RS13 2HKXA 2ZACA 3ILRA 4TWTA 1AYN1 1B35B 2DWRA 4HN1A 5CBLA 1NCRA 5A33A 2BW8A 4E2QA 1LESA 1NQDA 4OZXA 1VALA 2VH9A 4AFCA 4MZUA 4CDUB 3AYEA 2BVVA 4RGGA 5I0RA 3ZMOA 1H30A 4FAHA 2R30A 1BK1A 2PLV3 1GZ9A 2GH8A 1AR91 4Y26A 5FQ0A 1D2QA 4LO8A 4WVMA 1VBC2 2FZ1A 4IQPA 5KXCA 1R1A1 4UBGA 5CADA 4K21A 4E4ZA 3WG3A 4Y5Z0 3ZN5A 1MQTB 1HQNA 1VRH2 1LGCA 5BY5A 1JYCA 5GLZA 5JOWA 5FTTC 1EV13 3ZN6B 4N90A 4DY5A 3GZTB 1ULDA 3FUQA 5BNPC 3JCIA 2DURA 3WUCA 1RUG2 1RUJ1 3PMEA 2TNFA 1W6NA 5BV6A 4LBJA 5FPZA 4JC1A 4H3WA 3SITA 4CEYB 4KQ7A 5B2GB 3SH3A 3JBG1 5I8TA 4XILA 1S1AA 4N7IA 3ZN4A 1ENRA 4P9LA 3VHNA 4B4QA 1RUF3 3FBYA 5KXBA 2Z2SB 1OFSA 3FJSA 3AJZA 2W08A 3B00A 1S2BA 4HFSA 5J96B 2JENA 4FXKB 5AC91 4LBOA 1TMF2 3PTYA 3QACA 4LHNA 5DG1A 3JBG3 3Q9OA 5C9AC 2UWBA 1Z7S1 5FQ0B 4XJ8A 4RL7A 1MS9A 3ZFFB 2XJPA 2HWE2 2WS92 2JG8A 2VW0A 1A8DA 4YM2A 5JI9A 3WDVA 1D4M1 1AUYA 3USUB 1HQWA 1QJZA 4YM0A 3L2YA 3B9IA 1S0CA 1RB8G 3N7KA 4DS0A 2O1QA 1Q8SA 4CRQA 4TYSA 4IESA 5C8CB 3B5LB 1BYHA 1C8M3 2YYOA 4XBQA 1WLCA 3KMHA 3IPVB 2HWB2 4B8EA 4P9JA 3APBA 1RUE1 3PLQA 1HDKA 1F2NA 2GNDA 2XWJB 4FTSA 4JGZC 4D94A 4W65A 1AR71 4JGZB 2NMNA 1UCXA 2RM23 4R8HA 3RRDA 1N3PA 4I2OA 3IIAA 3MF6A 2Y26A 2MEV3 3DKWA 2ZGNA 1ND3C 2ZGLA 2ZBJA 3RYPA 4N9IA 3AXDA 3WZ1A 1EAH2 2DU1A 4JV4A 4ZKTB 1DG6A 1YIFA 2I45A 4WM8A 1AYN3 3AKPA 2XLFA 4CP0A 3WQ7A 4F8AA 3OYWB 4E4DX 5BNOB 3OD0A 1RMU1 1V6OA 2W52A 1U5IA 5IK4A 1MZEA 2EXHA 2KM2A 4LBQA 4N53C 4Q8LA 3SNMA 1KFXL 3W58A 1MS5A 4Y1ZA 4FVVA 1RUF2 1CR7A 1H1MA 1L3JA 4BOWA 1UKGA 3ME2A 4MXWB 4IV1A 3ZIXA 5JOZA 5T50A 1PVC3 2XLAA 1SBFA 4Q1PA 1G9AA 4KU7A 1H1AA 1S0GA 2X5IB 2WQ4A 1ZA4A 1DZQA 1HRV2 1LENA 1RUE2 3M8LA 1PO23 4Q4V3 2ZAHA 1EAH3 1X8MA 3BTAA 1Z0HA 5AFBA 3G7DA 2P3KA 3ILFA 5E16A 3KT4A 4G4FA 5JOYA 4LBQB 4YFZA 3BCWA 2XKPA 2O8QA 3SISA 4J1XA 1C1LA 2MHFA 4D7TA 2ES3A 2W68A 4QQHA 3O0XA 4RS5A 1AL21 1DGRN 2JJ6A 4LO7A 1ZRRA 3D0JA 2GN7A 3MW4A 4ATFA 2RHPA 4CP2A 3O5SA 5JSOA 2YGMA 2OA2A 3CJXA 1U12A 3HAGA 4FCAA 5CFDA 2UY9A 3WHTA 3WXPA 1QMJA 4OVEA 3RG0A 1VB2A 4BYYA 3OY8B 1WGPA 1QOOA 4AFMA 1AHSA 1KD7A 2DVGA 4QX5A 4S2HA 4FP3A 1LULA 1NZCA 2VNOA 1R1A3 3B9CA 1CAXA 1HLCA 1AL0G 4GH4A 1B35A 4LBKA 1GICA 1ZREA 3GNEA 1PVXA 1OQDA 5ABJC 1A78A 4N7UA 2AZ5A 3M3EA 4Q2FA 1LGNA 2P17A 4LE4A 4RFT0 3WUDA 2D6MA 5KXDA 4CDUC 2BTVC 1VBB3 2N7GA 3VKNA 2VUAA 1IPJA 4R52A 5A3LA 1IKQA 2RMU1 1M4WA 4PJYA 1GFF2 3ZN6A 1BMV2 2EVXA 2A7AA 4R9DA 2WFPA 4Q4Y1 2YROA 1IQAA 1FOD1 5AC92 2NP0A 4YW1A 1QNYA 4CP1A 1QHDA 2P3IA 5EFUA 4EN8B 2RMU2 1RUNA 1G9CA 1OLQA 3NVCA 1HKDA 3S6PA 3IDEA 1AYM1 4FPCA 2WL1A 1J3PA 4YZ2A 5KBFA 1FOD3 2MNGA 4XQDA 4DNYA 1EPWA 4KGQA 4I3GA 4YG0A 3SXWA 4IEPA 1YFUA 2NQYA 2QQPA 3MIEA 2GC2A 3MPPG 4LTAA 5L73A 3WW2A 5L36A 1GQHA 1VAVA 4G3YC 1NCRB 2IXLA 4MGYE 2A70A 1YRZA 2ZOEB 1JUHA 3EHKA 3V0BB 4EN0A 1OA2A 1WCSA 1MVQA 2EXKA 3CJIB 3WNXA 1LB2A 1LOFA 1OPMA 3LSEA 1YFYA 4F7ZA 2XJRA 4LO4B 4Q0VA 4FSJA 1OOPA 1WMDA 3MIDA 4AVVA 2FMYA 1UIJA 3A0KA 3NV3A 4UXAA 3UK9A 4M0HA 5KXEA 1WCKA 4RHV3 5H9PA 2WA4A 1N3QA 3VKMA 1O3TA 2E9QA 4FT8A 5CA6A 4JGYB 4BIOA 2R061 2PFWA 2XJQA 2XVKA 3WV6A 1RUH2 4XFAA 4BWOA 1UU5A 1RMU2 3KZ4C 1ZRCA 1W0PA 3H7YA 5DUUA 4YVSA 4CDXB 2RR11 1QNWA 4FPKA 3D0SA 3E5QA 4M01A 4BA6A 2E7QA 4Q4Y3 5F1RA 2DUQA 1RUE3 3VBUB 5JI7A 1MEC1 1V6LA 4MSVA 2WT0A 3R4UA 4X8PA 3OJBA 4AFAA 1ONAA 4CDWC 4PIYA 4AXOA 1MZ6A 4C90A 1AR72 5F6KA 3AMMA 4PCRA 1TNFA 1QXPA 4FPJA 4AG4A 2YPJA 1R1ZA 3OY8A 2ZHKA 2JX9A 1Z78A 2PAMA 4FP2A 2ZZQA 1K5MB 1HV1A 1FOD2 3DV8A 1NXMA 3SMHA 1RTVA 3HD8B 4XBLA 1LOCA 3S7IA 4META 2HJIA 3ZSEA 2PHRA 4CEYA 4YFWA 5C9AA 2SLIA 1PO12 1HXS2 3J8F2 3DPRB 1C8M1 2CAVA 1DZTA 2ETEA 3ZXAC 2FBEA 1AJOA 5EZWA 1Q5OA 3ZYJB 4RQPC 1Q56A 2R073 4OHXA 1I1EA 4RQPB 1QH7A 4DINB 4ZU5A 1Q8PA 3U0ZA 4XHXA 2D97A 3SHRA 3VDDB 1W6MA 4C0BA 1RVF2 2IXHA 2CV6A 3VHRA 4YGEA 2D98A 4OI2A 3MYXA 5EV7A 4DQAA 1LR5A 1JUIA 1XYPA 2NLRA 1PZ7A 4LNVA 3HR9A 4Q0PA 3KSCA 1MEC2 3RI9A 1FNZA 1PO22 2XLGA 2A6VA 2R6QA 3KGLA 4FPHA 3VBOB 5FO9B 3ZO0B 4FPYA 4FQZA 3O0VA 2R041 1GLHA 4HPKB 1G6NA 2ZGTA 3B01A 2D44A 1PGW1 4XIOA 2JEMA 4RR3B 2DCTA 5CU1A 4NO4A 1LHVA 2CYFA 4FPEA 4PF5A 2VULA 5I8SA 2KA3A 4GIQA 4R9BA 3BU7A 2D5HA 5GJ6A 3AZWA 4XMAA 3MI8A 3JZVA 1ZBA3 2VNGA 2IXJA 4Q4W3 4QPIA 2YMZA 1O3QA 2JG9C 1V9U3 4QQ2A 1ZZBA 3SCGA 2WLPA 2VQAA 4CDQC 1WBLA 1A6CA 5DZFA 1J3QA 4WVVA 1NCRC 4XQWA 4Q0QA 1ZRFA 1VBA2 1QXJA 3X29B 3LB9A 3NV4A 4B7KA 4YVWA 3SLIA 1TME3 4IEUA 3GBGA 2OVUA 5JIUA 1UIKA 5BXXA 1NLRA 3K51A 4EWAA 4ES8A 5ACA2 5IK5A 2GN3A 1UPIA 3AP5A 4SBVA 2ZS6B 5T5LA 3VBRC 4JQRA 5I8YA 3H1YA 2EA7A 4H55A 1WMEA 4JDMA 1FT9A 2B5HA 3ZYGA 1G8WA 2BEOA 4WVZA 4KWLA 1RC6A 4HN0A 1V6NA 3LCPA 3LSDA 5BNOC 5F6LB 4K1ZA 5HCFA 2Z69A 4XFCA 1BBT1 2QVSB 2F6BA 1SCRA 2AR6A 4NOTA 1BVVA 2QZ2A 3S0MA 1K5MA 2VQ0A 2GNBA 2RE9A 3WLUA 1C5HA 1NCQC 2HWE3 2WS93 4HANA 4Y22A 1NE6A 1C57A 1ND2B 4NHKA 1HRI2 5JPMB 5I0TA 4AVSA 4XQ4A 4E4SA 2NPIA 3MICA 4D7YA 4LBLA 1CPNA 4GQ7A 4KH9A 3I8TA 4U2AA 4XFIA 4ONUA 3TN92 3JQWA 3MLLA 3VZJA 4B3NA 1ENXA 3AM2A 4P9GA 3B3QE 3TOJA 5FFOC 4RD7A 4U36A 5BUVA 1U5XA 3VL8A 1TEIA 1O4TA 2ZX3A 1MEC3 1NCQA 3FHIB 5E8AA 5C8CC 3BALA 2H0BA 3WP5A 3BIWE 3U10A 4PBPA 4DZGA 3ILNA 2HWB1 1MZ5A 1FNYA 1RGSA 4I0AA 2WC2A 1JH5A 2D6LX 1UN1A 1D4VB 4FTBA 1UD1A 1IGOA 1QU0A 2UU8A 3I7DA 4QPGC 1H9WA 4GA9A 3E6DA 2GMPA 3V0AA 4IV1C 4PLMA 5BNNC 1SLAA 2NYYA 4ISRA 4XF3A 4LEJA 4Y1VA 3MIHA 1NCQB 1NY72 2B7YA 2PAEA 1H2NA 2BUKA 3RPQA 4Y4YA 1RUG1 5JSRA 3BB6A 2GC1A 3V0BA 1J1LA 1FATA 4J6GA 2ZX2A 4JVAA 2D3SA 1MR5A 2XVLA 3KQRA 5JR7B 3RS6A 4AI3A 1BBT2 1ZVFA 1OA3A 1LTEA 1QJU3 4WVWA 4B4RA 4PQ9A 2VY0A 1OOPB 3CO2A 4RS5B 1QGLA 2VW1A 1SBEA 3AFGA 3FUOA 3KT1A 4LA2A 2GNTA 4IEZA 3AKSA 2HYKA 1CAVB 4YSFA 3POYA 3MGUA 3VN4A 4JTOA 5ABJB 1IS3A 1CAWB 1D2SA 2JE9A 2WKKA 2WNVC 3RSJA 2RS31 3MIGA 2X53S 4AQTA 2YDEA 3VBHB 3VBSA 5CAZA 1O7FA 1FV3A 4FPFA 4QPGA 4QQOA 4CEYC 2EAAA 5A32B 1G9BA 4CEWC 2WNUA 2RS53 5C8WA 1G86A 4JGYC 1RUD2 1RL3A 2TEPA 4AFBA 3BPZA 2I2SA 2XBO3 3ZPYA 4XXPA 3D5OA 2OYZA 2AGSA 1GBGA 4L11A 3LZZA 5JZGC 5JLVA 3H3UA 4FAGA 3D4KA 1PO13 3J8F3 1DBNA 3I4IA 4HSJA 4W6XA 1N1VA 4GB33 3NV2A 5I93A 3H3ZA 2XL9A 2ZHNA 4P14A 5JMCA 1NLSA 4CZSA 2RS12 2BWCA 3ZFEB 3NAPB 2VMGA 2YY1A 3VBSC 4SLIA 4Y1XA 1AVBA 3VBSB 1UKRA 4XTMA 3VBHA 4I0BA 2BQPA 1SFYA 1VBD2 3R05A 1DU3D 1W6OB 3VZOA 3U07A 2UURA 3ALQA 5ACA3 3H1MA 4Z92B 4E9KA 1EAH1 1YUDA 3L2HA 2Q30A 3V65A 2PHDA 3FFQA 4QGMA 4MLOA 3MEPA 4CDQA 2Q8OA 1PK6C 1YHFA 1QOSA 1AYM2 1MZFA 4KL1A 4M00A 3GZAA 4KU8A 5DDJ2 5GKAC 1R081 5FOJB 4RHV1 1UZYA 2XHKA 4QQLA 5CFCB 5T54A 3RZZA 3VHOA 1O3SA 1G9DA 2K0GA 2CTVA 2VNRA 4Q4Y2 1HRV3 3HT2A 4S2GA 4ATEA 2MEV2 2R072 3P3NA 4FO9A 5CVRA 2BPA2 3J4UH 3IN9A 2EXIA 3JB4C 2DTYA 3GYDA 4I09A 4COUA 4QM8A 2ARBA 2YHJA 1TME2 1R082 2P37A 3N35A 4MGZE 3ST7A 1KFUL 1BJQA 3PJYA 2IXCA 3U4XA 4Q8KA 3RI8A 1KS4A 1SQ4A 5I0SA 4LE3A 4ASLA 5C33A 2E7TA 2ET7A 4M0NA 4Q4X2 2FMDA 3B02A 1IOAA 1K5MC 4WM7A 5CFCA 5I91A 1GR3A 3NAPC 1F5JA 4HKOA 3ACLA 1RVF1 4B7EA 1AYN2 1UU6A 5J36A 2XJUA 2VECA 2BGCA 4KBBA 4AEDC 4NHLA 1KJRA 2R0HA 4LBMA 2OUHA 5HI0A 1ND2A 3FWEA 1J59A 1RVF3 3ZIWA 1S55A 3CL1A 2YUEA 3FX3A 4AGRA 4ZU4A 2HWD1 1ALYA 4DRVA 3N7LA 4OHZA 3S7EA 1GKBA 1ZZ9A 4DOUA 4N43B 5KC5A 1RUF1 2NZ9A 1QJX2 1O4ZA 3WCSA 2W39A 1VBE2 3VBFC 2E53A 3AMQA 3M3IA 1LKNA 5C4WA 2GDFA 1H0BA 1AR83 1CGPA 2EXJA 4QM9A 1V6IA 3VZNA 2WT2A 2ZPXA 4HK8A 1C5IA 4QQPA 3C2UA 1FX5A 2O0OA 2IFWA 1C1FA 4K20A 4K1YA 1Q43A 3VBOC 1AXKA 3ZYPA 4XETA 3ASIA 4D7SA 2Q4SA 2MPFA 2A73B 5D8AB 2DVDA 1LHWA 1W2UA 2E7AA 2UWCA 3SH4A 2EF6A 2G4IA 5FO8B 4AEKA 4L92A 4N53B 4AHZA 2PHLA 3IKWA 1BMV1 4XBNA 4OI4A 3WDXA 4LUKA 5KWRA 1OA4A 3AX4A 1W6PB 3WHUA 3WVJA 4CDQB 4JRLA 2TUNA 3RJRA 4AF9A 4XYXA 1EV12 1AJKA 1N1YA 2WZR1 4IXLA 2IZWA 4YYOA 1WBFA 2WIIB 1ENSA 4TLFA 1RUI3 1HV0A 5FPXA 1Z7S2 2PHWA 1CPMA 2NMOA 4MYEA 1WW7A 5HCAA 4R9AA 4QT6A 1QDOA 4N53A 5E88A 3DPRC 3FBMA 4XJUA 3AXEA 5GZEA 1YIPA 3B93A 4YW5A 3MDPA 2O8OA 4UW5A 3VKLA 2PHXA 3I59A 5EXOA 4Q4X1 2HEWF 2HEVF 1VBC3 3HWJA 1SLIA 1T6GC 4YRDA 3ZFFA 2SBAA 5D8AC 3WY6A 4B29A 3MIBA 4COZA 2UYBA 4H7LA 1QOTA 3VGIA 5DXDA 4YW2A 2VMHA 1DYPA 1MS0A 2E63A 4RQPA 5K9YA 4LO5B 4BZ4A 1LGBA 4YARA 4CDXC 5C6CA 2OW4A 1YXWA 2ET1A 1H8TA 1AXYA 4LLOA 1VBB1 2B39A 4L8QA 5J3UA 3E5XA 2LM3A 1UL9A 2YGLA 4LT5A 2WNVB 3VDDC 4FOWA 2RS33 4ZU7A 1KQRA 4OHWA 5SV5A 4I02A 5GZDA 5DDJ1 1NYWA 2EALA 4DPNA 4XJWA 1MVEA 4L9BA 2DV9A 1VIWB 3PVOA 4RR3C 1UF2C 4M3CE 1QJU1 2DTWA 4GKXA 1QXRA 1WLDA 3FMGA 1JTZX 2HWC2 3FE5A 2OPKA 1PK6A 1DQ0A 3GALA 4HK9A 1GQGA 4CDXA 3AKTA 2G9FA 3KCCA 1IZ3A 4FPOB 4HPKA 3LA3A 4QU2A 2DFBA 4Q4W1 1SACA 3G6JB 4R4ZA 3THTA 4A7KA 4Q4V2 1S2KA 2RMU3 2MEV1 1LU1A 3VBUA 1FPN3 1UX6A 1W39A 2P34A 3N3HA 3ES1A 4AI2A 4OULA 3K48A 1DGRA 1DYKA 1ASJ2 3AKQA 1LJ7A 4UW3A 4BH9A 2OUJA 5JVVA 3RDIA 1NG0A 4N43C 5TSWA 5K0UC 4LA3A 1GNZA 4AVCA 4AI0A 3NAPA 1IS6A 4AVAA 1YWKA 2Q1ZB 4PLNA 1YFXA 5BNNB 4AQ2A 3AP7A 4O9GA 3VBFB 4MXVA 5CIRA 5LRRA 1TQ5A 3VUOA 3ZFEC 1N1TA 1EYBA 4RS5C 1OKQA 1LHNA 3TNPB 5GALA 4GB31 1ULFA 1NA1B 1AR63 4OUMA 1COV3 3RQ0A 4XZPA 1RINA 2PQQA 1JBCA 1IPKA 3POWA 2AREA 4XF0A 2LALA 5L7OA 1R1A2 3M70A 3PNAA 1IS5A 1PO21 2XGXA 4F3JA 4UW6A 3VLBB 1QDCA 5CFCC 2BYVE 1RUI1 2XG3A 4AVTA 2DVAA 2GC3A 2ZJCA 2A75A 1PK6B 1ZBE3 4OHYA 1AZDA 1F31A 4Y22B 4FBFA 1FYUA 3DPRA 3KS7A 1UU4A 1VBB2 4M3CB 3HBZA 4P9IA 1U5ZA 4XIKA 1UZZA 3MFCA 3SCHA 3N36A 1VBE1 4AHWA 3GZUC 3KCXA 2IFRA 1WW4A 1AR81 3B69A 1REDA 4WV8A 5JCTA 2A3YA