4CEYC

Crystal structure of human enterovirus 71 in complex with the uncoating inhibitor nld
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
242
Chain Sequence
b'GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTGTIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title More-Powerful Virus Inhibitors from Structure-Based Analysis of Hev71 Capsid-Binding Molecules
pubmed doi rcsb
source organism Enterovirus a71
molecule tags Virus
total genus 44
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ceyC00
1DDLA 4WM8C 1MQTB 4EJRA 1IHMA 1B35A 3JD72 2PLV1 4Q4Y1 1VBE3 1RUF3 1QQP1 3VBRC 1RUG3 1RVF3 3JD71 5C9AB 2RS13 1NCRC 1FOD1 4LLFA 1HRI3 5CFDB 1ASJ3 1PO12 1NCQB 4RR3A 2TBVA 3VBSB 5A33A 4JGYC 4QPGC 3VDDB 1AL23 1BBT2 1PO11 2XBO2 3M8LA 3VBUC 4CDQB 1PIV2 2RMU2 4RS5B 1RUD2 1RMU3 2FZ1A 2WFF3 4GMP1 1AR93 3JB8A 2BFUL 4SBVA 1BBT1 1FMD1 2XBO1 4GH4C 4RQPA 1PIV1 4CDWB 5L7OB 2RMU1 1EAH2 1RUD1 2HWD2 2PLV3 1COV2 4Q4Y3 5J96B 2WLPA 4WM8B 2HWB1 1QQP3 5FOJB 5AC92 3JD73 3VBOA 1VRH2 5ABJA 5A32A 2HWD1 1COV1 1AR82 1NG0A 1OOPB 1FOD3 4AEDB 5AC91 4Q4W2 4Q4V2 4QPIB 4WM7A 4NWWA 1ZBA2 4NWVA 5BNNA 1QJY2 1A6CA 5BNOC 1NCRB 1RB8G 3J8F2 5C8CA 1HRV2 4Q4V1 1F2NA 3JB4C 2R071 5CFDA 1ZBA1 1H8TA 1QJY1 3ZFFC 1PO13 2MEV2 3J8F1 1Z7S2 4QPGB 1HRV1 4GMP3 3VDDA 3VBHA 4WM7C 1RUE2 5BNNC 5CFCA 3JBG1 1BBT3 2BUKA 1W39A 2MEV1 2XBO3 3HAGA 3ZFEC 1ZBE2 1PIV3 2RMU3 1RUD3 3DPRA 1Z7S1 5C8CC 5ACA2 1RUE1 1X33A 1H8TC 2HWB3 1TMF2 4RR3B 1ZBE1 3IDEA 4CDWA 5A33B 4FTSA 1VB2A 2RS32 2HWD3 1ND3C 1RUH2 4FTEA 1COV3 5ACA1 2RR12 4WM8A 1AL22 5CFCC 2ZAHA 1TMF1 5AC93 1BEV1 1NY72 1VRH3 2RS31 1RMU2 4GB32 3DPRC 1RUH1 1VBC2 4CEWA 2RR11 3VBRA 4RQPB 4Q4V3 1PGW2 1VBA2 1ZBA3 1QJY3 1MEC2 1E57A 1R082 4GB31 1C8NA 4Q4X2 3ZFGC 5BNOB 1VBC1 2FZ2A 2WZR2 3J8F3 2Y26A 1HRV3 1QQP2 1PGW1 1RHI1 1VBA1 3VBOB 3ZFFB 5ABJB 5A32B 3JBG3 1R081 1MEC1 4Q4X1 2MEV3 4YVSA 2WZR1 4JGYA 1RUJ2 1V9U2 4CEWC 1Z7S3 4QPGA 3LOBA 1FOD2 4WM7B 5BNNB 1RUE3 3VBUA 1ZBE3 1RUJ1 2BBVA 1V9U1 5C8CB 1M06G 5BNPA 5FMOS 5ACA3 1H8TB 1VBB1 4GH4A 1TMF3 4FSJA 4YVSC 1SMVA 1F8VA 1BEV3 2RS33 2ZTNA 1RUH3 3VBHB 2X5IC 2RR13 4PDWC 5CFCB 1FMD2 1AUYA 3DPRB 4GB33 1VBC3 5BNPC 4Y4YA 3CJIC 2HWB2 4JGZC 1RHI3 1VBA3 1CJDA 3ZFGB 1R083 1MEC3 4Q4X3 5BNOA 4CDUA 2WZR3 1POV1 1RUI2 1NA1C 3ZFFA 2HWF2 4CEWB 4CDXC 1D4M2 1RUJ3 1V9U3 2XPJA 2RM22 3VBRB 1RUI1 1BMV2 2R072 4Z92B 2HWF1 3ZFEA 4CDUC 1AL0G 1D4M1 2RM21 1BMV1 5D8AA 1R1A2 4Y5Z0 3JBG2 1QJU1 4IV3C 4YVSB 3ZXAC 3FBMA 4JGYB 1FPN2 1ND3A 1AYM2 1EV11 1R1A1 1HX6A 3VBUB 3NAPC 1FMD3 1PO22 2QQPA 1FPN1 1AYM1 5BNPB 2WS91 5D8AC 4GH4B 2WWSA 1PO21 1RUC2 1AR62 5C4WA 3TN91 1VBD2 2BPA2 1BEV2 3ZFGA 4FTBA 1POV0 2R042 1RUC1 5C9AC 1AR61 1RUI3 1VBD1 5J98B 2HWF3 1AR71 1PVC2 5JZGC 1D4M3 2RM23 2R041 1RHI2 4CEYA 2R073 5C4WC 1NCQC 4CDUB 1HXS2 1PVC1 1C8M1 2IZWA 2DF7A 5DDJ1 1R092 1R1A3 4IV1A 4CDQC 1HXS1 4RS5C 1FPN3 1PGL2 1AYM3 2X5IA 2WS93 3S6PA 1R091 4PDWA 1VBB2 4CEYC 4N53C 3ZFEB 1PO23 1NOVA 5L7OC 3TN93 1CD3G 2BFUS 1ND2C 1PGL1 1QJZA 5D8AB 1K5MC 3CJIA 4JGZA 4IV1C 2RS52 1RUC3 4N43A 1AR63 2GH8A 1VBD3 3VBFC 1VAKA 1ND3B 1AR73 2HWE2 1OOPC 4AEDC 4QPIC 2RS51 2R043 1NA1A 2GSYA 2HWE1 5JZGB 1PVC3 4YVWC 4CDXA 1C8M3 1TME2 5DDJ3 1B35C 5C4WB 4N43C 1X36A 1HXS3 2HWC2 1TME1 5K0UA 1QJX2 1R093 4IV3A 2HWC1 1WCDJ 1AYN2 1QJX1 4RHV2 4CEYB 4RR3C 1VBB3 5FMOL 4N53B 1QJU2 3NAPA 1AYN1 1ND2B 5K0UC 2R062 1K5MB 4RHV1 1EV12 1MQTA 4IV1B 1EAH1 2RS53 3VBFB 2HWE3 2R061 2X5IB 4RFT0 2WS92 4PDWB 4RQPC 5C9AA 1VRH1 5LK7B 3TN92 1GFF2 1AR81 4YVWB 5JZGA 1TME3 1POV3 4Q4W1 3CJIB 1MQTC 1B35B 4JGZB 4BCUA 4N43B 3VBOC 5ABJC 1NCQA 1VBE2 3VBSA 1AR72 1RUF2 2HWC3 1RUG2 1RVF2 1QJX3 1NA1B 2VQ0A 2RS12 4CDQA 1VBE1 4GMP0 1RUF1 4RS5A 4CDXB 1C8M2 1RUG1 1AYN3 1HRI2 5CFDC 1RVF1 5DDJ2 1ASJ2 1OPOA 4RHV3 2RS11 1QJU3 4N53A 5L7OA 1EAH3 3VBSC 5K0UB 1HRI1 3VBHC 3VDDC 1ND2A 1ASJ1 2R063 1K5MA 1VB4A 1EV13 4IV3B 1OHFA 2WFF2 3VBFA 1AR92 2ZZQA 1AR83 1AL21 1OOPA 4AEDA 4Q4W3 4QPIA 3NAPB 5GKAC 1NY71 4CDWC 1RMU1 2WFF1 2PLV2 1NCRA 1AR91 4Q4Y2 1HQNA 4YVWA
chains in the Genus database with same CATH superfamily
2Q1FA 2BNNA 1W0NA 5GZDA 4Q0UA 3NQHA 2D98A 1SACA 3BOPA 3FHQA 3O0XA 5CBLA 3JQWA 2PLV1 2WO2A 5FBJA 1Z0HA 1VBE3 1XE0A 1ZRFA 2NN8A 4MOAA 3K77A 4XAEA 2E51A 2ZX1A 4BQYA 3F2ZA 1AF9A 2VZTA 4UWDA 1H6YA 1RVF3 3RZMA 5CG8A 1GQHA 4ZY9A 3PJYA 3I3BA 4D8MA 2BBAA 5A1LA 1KFXL 3THCA 1TNFA 3ZR5A 4RGGA 2B7YA 2QQLA 4JX0A 4KWUA 1QXPA 2Q5TA 4JQTA 3GGLA 1MZFA 4HFSA 1FOD1 4LE4A 1KDKA 1LU1A 2WR9A 4XTPA 4RR3A 3ZXLA 3ILRA 1U5ZA 1DG6A 5A1FA 3NSTA 3RI8A 1HJGA 2RDRA 4HPKB 4QGNA 2CNAA 3RJRA 2ZCWA 3VDDB 4AI2A 1VLNA 1O4ZA 1XXNA 2JIGA 3WX5A 1BBT2 1F4HA 4BWOA 2VXJA 4M4RA 3VBUC 4XW3A 4CDQB 1V6JA 4RS5B 3AZWA 2FZ1A 2CYFA 3PVOA 3IT8A 3OGRA 1XNCA 4LR4A 5C70A 2BFUL 4SBVA 2QUOA 1BBT1 5C5TA 1FMD1 4R9BA 3C7OA 4MGSA 1FXZA 4LTAA 2HKXA 3G7DA 1JXNA 4HK8A 4QM8A 4YW3A 3O1OA 3MLJA 1QHDA 1VAVA 1GZCA 5C3RA 1MS1A 2HWB1 2E33A 4W6YA 1I6XA 5AC92 4AZZA 1V6MA 2DTYA 1EUUA 2MHFA 2Y6HA 3OPZA 5L73A 1VRH2 3VD7A 2ARBA 1XB9A 1YFYA 3AVSA 5KWRA 3S57A 1X7NA 1JYTA 1WD4A 2L9LA 1S0FA 5IVFA 1W6QB 4ZKTB 1OQEA 1REEA 2PHUA 3NKGA 3PUHA 5AC91 2DWRA 3AP9A 4NWVA 3ZPOA 1ENQA 1F9KA 4L0PA 4DINB 5BNOC 4DS0A 5AFBA 3E5XA 4Q8LA 4Q5OA 4META 5C8CA 5FZBA 3WDUA 4QQOA 1DZRA 2YBSA 2O14A 2D97A 2R071 3ZYRA 5A7NA 1NXMA 3OEAA 3D3AA 4BU2A 3O14A 3GZUC 4AI0A 1WMDA 1UOGA 4UFIA 4E4SA 4NRPA 3S7IA 1GZWB 2AGSA 3PUIA 5LBEA 2Y6KA 1UPSA 1WBLA 1L7QA 4INDA 4KG0A 3JBG1 4TXWA 5LBCA 5CAZA 2BUKA 1GWMA 2XBO3 5CFCA 3HAGA 3RNSA 1ZBE2 1MZEA 2VMIA 1GNZA 2GU9A 3ACIA 5LCWL 2JKXA 4LK7A 5IAXA 4QKFA 4I3PA 1WD3A 1X33A 5LW9A 1XRUA 4DUVA 2DDUA 2JG9C 4AG4A 1ZBE1 2DVBA 4AWDA 5FKCA 4CDWA 5A33B 2FD8A 1VB2A 5IVEA 1ND3C 4Q0VA 5FY0A 3IAPA 1COV3 4QM9A 1S0GA 2RR12 5FZDA 4MUVA 2P4EA 2QQKA 4COVA 4P9IA 2XJRA 5CNAA 2QCSB 1O4YA 2XKPA 1W6PB 2VH9A 5FDBA 3DPRC 3AKPA 1JTZX 1MVEA 3FC0A 5CZKA 1C5HA 2RR11 3B9CA 4QX7A 5FYHA 1EYBA 5T55A 1V6IA 1Q3EA 3VBRA 4BQ5A 2UU8A 5T50A 5EWSA 4I0WB 3RVHA 3TBDA 1QJY3 4TN7A 5BNOB 1HQLA 4LQRA 2WIIB 4JAAA 1KEXA 1VMFA 1WKYA 2FZ2A 4BQ2A 3J8F3 4DY3A 2WN2A 4OUSA 4QXHA 2I45A 3BIEA 1HRV3 5I0RA 2P5BA 5FUPA 3SEPA 3H3LA 4HONA 3VBOB 5ABJB 4XZUG 3MPPG 4FCAA 2MEV3 4YVSA 3CU7A 4E8DA 5J09A 4UW6A 4JGYA 5SV5A 2UWCA 1Z7S3 1ZZ9A 4OYUA 2CDPA 3RG0A 1Y9MA 3KQ4B 4O9GA 1RUE3 4UW3A 3KF3A 4FPJA 5C33A 3UKNA 1REFA 4MGIE 1DF0A 1NKGA 4ES9A 2ET7A 1L7LA 1DGWX 2FHRA 3S7EA 3VUOA 3ZX7A 2D93A 1JU4A 1JZ2A 3SC7X 2W2IA 2VVEA 4XETA 5I8SA 3WQ0A 4LHLA 4CUBA 1BVVA 4CP9B 4GH4A 3ZYIB 2BTVC 2YB7A 1N47A 4E4HA 4LULA 5IJRA 5A6XA 1F8VA 2BYVE 3PU8A 1N1SA 4Y26A 1PVXA 2DTWA 1MZ6A 2B5HA 2X10A 5LBBA 2EIGA 3B7MA 4JRAA 4UFJA 1Q5OA 3N9NA 3T2TA 3O1SA 3VKOA 5HBAA 1DQ2A 1IPJA 2ZEXA 2A3XA 3AMMA 2JWPA 3P5BA 1SG3A 5APAA 5CB7A 5FPUA 4QGLA 1RGSA 1AUYA 1JS9A 1W9TA 1C57A 3DPRB 3AJZA 4GB33 1W2OA 2VZQA 3BIWE 3K4DA 4YG0A 3MIGA 5FZ3A 3PDQA 3VZJA 3WW1A 5FCCA 1KJLA 3OBAA 5FYTA 1W0OA 1BJQA 4AI9A 4ARXA 4UOJA 1CJDA 1ULFA 4P5HA 1ULCA 4CDUA 2VU9A 4YW7A 5IK5A 2GN3A 1POV1 5JMCA 3N36A 4D6RA 1RINA 3HWJA 5HPOA 5CEHA 4HMZA 4RA0A 4NIDA 3MBWA 4HVRA 5DAXA 1NA1C 1O91A 5A7PA 1W8WA 1QGLA 4QD2A 4A4AA 2GMEA 1W9SA 2VVDA 3BPSA 4IESA 5FKBA 4CDXC 3MICA 3VL9A 4D6SA 1RC6A 4XACA 1VE0A 3O0VA 3PUAA 3T30A 3WCSA 4AR2A 4G3YC 1ST8A 4AQSA 1BMV2 1E5SA 2VUJA 5GLUA 3Q8FA 1YYNA 1O8PA 1AL0G 2OZJA 5FUNA 3IWZA 3VDCA 1EPWA 5FZOB 3WHTA 1LHUA 3JU9A 3A23A 1BMV1 1VPHA 2QQUA 4Y5Z0 3CLPA 4A7KA 1CAVA 4MV2A 1CPMA 3TRSB 4E4DX 2ZAAA 1ZZ6A 3WUDA 3WUCA 1Z78A 3ILNA 3LA2A 5A3OA 4NMIA 3K51A 4W6WA 4ZZ5A 2F4PA 1HX6A 5FXWA 2QZ2A 4BMEA 5A7WA 1XYPA 2H6CA 1S2BA 4PI2A 3ZYFA 5EV7A 2E7TA 3I2KA 2WNVC 3RI9A 1W8UA 4CCDA 4D7TA 2XLFA 3ZR6A 2IXLA 4DFSA 2W91A 2WS91 2XB6C 3OYWB 1APNA 3DXUA 4N9HA 4P02B 4XQDA 4Y5TA 5HCFA 2WWSA 3HJRA 1AR62 5C4WA 1OUXA 4XF3A 4A6OA 4PJYA 1I5ZA 5DZGA 1OBNA 4CZSA 2R0HA 4BYYA 5JPNB 1CESA 1GQPA 3K4ZA 4GAZA 4A3XA 3UNPA 1WLWA 3EYPA 1YCIA 2W1SA 2VR4A 3AXEA 4NIHA 4C0BA 3CZJA 4Z2WA 3FHAA 1AR61 5GLTA 3ME2A 2FDHA 2BDRA 2R6QA 1QOSA 2D6PA 2LTNA 3AZYA 2VMGA 1LGCA 1DZTA 2Q4SA 2HWF3 4KG8A 3U14A 1FX5A 1GWLA 1PVC2 3AX4A 5EHDA 1RYYA 3PU3A 3SMHA 2RM23 5IHRA 5GZCA 4Y24A 4XDPA 1D2QA 4CEYA 1NCQC 1DQ4A 1JZ8A 1PVC1 1C8M1 1QWRA 2GP3A 5FZHA 5FZ0A 4OLLA 4IE5A 4XJWA 4ASMB 3FZ3A 2ZX2A 5F5CA 1QU0A 4R9CA 3LEKA 2PHFA 1JZ5A 1ALYA 4QXCA 1ENXA 2R7EB 5L19A 1CZVA 3ZIWA 1NUKA 4S2FA 3VN4A 4IXLA 4AI8A 4MH0E 4DQAA 4TZDA 2DU0A 3K4AA 4QQPA 2X5IA 5FREA 5FXVA 4FP2A 2ADDA 3O1UA 1LHOA 1HV0A 3N4MA 2JECA 4YZ3A 3OOXA 4CXWA 5L7OC 3VD9A 4UW4A 2WNVB 1OI6A 1PZ8A 4NHLA 3TN93 1KFUL 1U5YA 1OF4A 1UY0A 3I7DA 5FP3A 1ND2C 3LEIA 4MX3A 5FAXA 4QX2A 1K5MC 3BUCA 2D6MA 2RS52 4HT1T 4AI1A 3POFA 5C5UA 1KGYA 4ONUA 4XFFA 1D0HA 3V56A 4LKFA 1VP6A 2QFEA 1H0BA 1GP5A 5L9BA 5F6KA 1UF2C 2AH2A 4NPMA 4AEDC 2WUHA 2RS51 3ZN6A 4ARYA 5JUVA 3CHXA 2AENA 1FNYA 1DQ6A 1JH5A 1W8OA 3T1MA 4Y22B 4LE3A 3APBA 1S4CA 2NLRA 4I02A 5FP4A 3AMHA 2ZEWA 3H8OA 1XPWA 2GMMA 2YV8A 4MYEA 2BGCA 1AJOA 1A3KA 4A2UA 2A5ZA 2ZGMA 2ZMLA 4R9AA 5LA1A 5K4LA 3RYPA 4N8MA 3S0MA 2OW4A 2Y6LA 4LUMA 3WDVA 2RDSA 2D6LX 4PLMA 2JE9A 4BK4A 1R093 1LCLA 2F6BA 1NLRA 5IATA 3AP7A 3ON7A 2TNFA 1F35A 3Q8CA 1WCDJ 4R4ZA 4IQPA 4D94A 2P34A 3BU0A 1MR5A 1C5IA 3C7EA 2J1SA 4HOOA 5FK8A 5JAXA 1IKPA 4YM3A 1BCXA 4RR3C 2OYZA 3ZXKA 2OQ6A 4B8EA 3H3ZA 5FZ7A 2VXRA 4XBQA 5FPAA 3ZMOA 4IDZA 3RZGA 2FDKA 2V4AA 2FBEA 3UGGA 3AL6A 5C3QA 4LPLA 3GDBA 1ND2B 5FZ8A 1YNAA 1ZA7A 3AZVA 1WMXA 1K5MB 3EJKA 5H9PA 2J7MA 1EV12 1MQTA 3ILFA 4A7YA 2VNOA 1O3QA 1PNFA 1EAH1 1ULEA 2B9UA 2J1RA 3FFQA 2QKDA 3KCCA 2WA4A 4QHZA 3ECQA 1HLCA 1OQ1A 1IS4A 2V4VA 2ATFA 4UAPA 3ZXFA 1LHWA 2AUYA 2ZGPA 4RFT0 4KMQA 1J83A 3I2JA 5FPLA 5C9AA 5LK7B 2E7AA 3IPVB 3IBMA 3TN92 5FZGA 5CKNA 2BGOA 2DFBA 3M7AA 4OZOA 3UT0A 5JZGA 3N7KA 4Q4W1 2PELA 1CQ9A 2JDHA 4GZ9A 4JGZB 1G9BA 1RL3A 2ZMNA 5EP9A 3V64A 4FI9A 3C2UA 2EAKA 3T0BA 1RUF2 4M0NA 2HWC3 5A3TA 2Q8CA 3USUA 3C7HA 1K42A 1H30A 1QJX3 3WSOA 1LOGA 4LORA 4YGEA 1DGLA 1WZXA 2RS12 4OHXA 5GLZA 2WABA 3WZ1A 4WV8A 2HEYF 1GBGA 1RUF1 4LBNA 4RYDA 4EN6B 1PHMA 3J9SA 3VHNA 3KCXA 3T3YA 3GHNA 2G19A 3M3IA 1C28A 3IIAA 1OPOA 4FO9A 3JQXA 2ZXQA 1UOFA 1UZVA 3CL1A 4Y1UA 3RZKA 2RS11 2BGPA 1QJU3 2EAAA 5C8WA 3LD8A 3VBSC 3WP4A 3FFZA 3RYRA 5FLIA 5E6HA 1CX1A 4CCMA 5EJ1B 4EN8B 4QKNA 3U37A 3VB9A 5KXDA 1QH6A 2RVAA 2JDYA 1P8JA 4OI2A 1LOCA 1UIKA 2IVIB 4FPLA 2OA2A 2W08A 1SLCA 3IDCB 1QKQA 1WLCA 2ZZQA 3EQEA 3NJZA 1AR83 5KC5A 2C9AA 4K9SA 4DNYA 1WW4A 3NRUA 4AFCA 4I0BA 4QPIA 4LJHA 2WQ8A 3DCQA 4CDWC 3GBFA 4BXSV 3H8RA 1MZ5A 3E6BA 2XDVA 4AAPA 2ZZJA 5IFTA 2ZHKA 4Y20A 1IPSA 5FY7A 4CXXA 2BERA 1KQRA 2XVKA 4GULA 1D2SA 4A3ZA 4E8CA 1DZQA 2R49A 4Y5SA 5LRSA 2BOIA 4I30A 4Y1YA 1QIQA 3MUY1 3WG3A 4M3CE 5CIRA 1QQP1 4KWKA 1RUG3 4JVAA 4Y33A 3VBRC 1G9DA 2VPVA 2AZ5A 3RJ2X 4PBPA 5FZ6A 4P5YA 1O59A 4AEJA 5HI0A 1A8DA 1GV9A 4FAGA 2BP6A 2RDNA 1OUSA 2ZGLA 1IS5A 2ARXA 2UY9A 1PX4A 3P1IA 1GQGA 1HRI3 2VQUA 1LOAA 1W6MA 4HSJA 1YQ2A 4OVEA 4XYXA 5FTTC 3UGFA 1ASJ3 1OH4A 1PO12 1LOFA 1TNRA 1V6OA 2Y64A 3D4KA 4XBLA 2YZ4A 1FYUA 4M01A 4OI4A 3VBSB 2OT7A 1K12A 4JGYC 4LOTA 1YHFA 3WF3A 5JSPA 3CO2A 3KT4A 2XONA 1XC6A 5FYCA 3WW3A 3ZXEA 2G9FA 4U2AA 4OQ9A 4DO0A 3CZUA 4HBNA 1AL23 1MS3A 1PO11 4I2OA 4NR1A 1Y3TA 4A41A 3VL8A 3DGTA 2BEOA 3C3VA 4IEQA 1KS4A 4LITA 2RMU2 4Z07A 5F37A 3PVEA 4GIQA 1RMU3 3MHZA 2WFF3 1WA6X 4NIAA 3OF1A 4TWTA 3WW2A 1UNBA 3FMGA 3ZDSA 1UKGA 1V6NA 4GH4C 3OGGA 4RQPA 4TSVA 4CDWB 3JXSA 2RMU1 4GALA 2VULA 1HV1A 3FUQA 4OMDA 2HWD2 4MHRA 1AXKA 2A73B 2PLV3 4NOTA 4FPEA 3OGJA 4CA9A 4EROA 3BYWA 1HB2A 2EXJA 1N1YA 2QTWB 3HQRA 4LIUA 4TTGA 4XUNA 5DUWA 1GMMA 2WN3A 2XR4A 2Z42A 5FOJB 2P2KA 4AHXA 1FATA 1NZCA 1Y4WA 2DCYA 3MDPA 2YXSA 1JHNA 2HWD1 4XUQA 4QWNA 2XQRA 3HT1A 4LHKA 4UF0B 5JR7B 4XFHA 1CIYA 1AR82 3U78A 1AX0A 3ZYPA 1OOPB 3F95A 4AL9A 2J22A 1U5IA 2Z4FA 1FOD3 1JZ3A 1UY2A 3VZMA 4WM7A 4Q4V2 5FFOC 4OHZA 5BNNA 1ZBA2 4LLOA 4CCJA 5JPMB 3VV1A 1H2LA 3ZYHA 1FAYA 2CY6A 4HKLA 5JVVA 3AFKA 1FNZA 4EN0A 3HNMA 2E31A 5FZCA 1UL9A 2IVJA 1F2NA 3HT2A 3I3DA 1UYYA 1ZBA1 4Q4V1 1H8TA 5EYYA 4AXOA 4O65A 4QAWA 1PNGA 4XDOA 4YM1A 4Q0QA 1ZYBA 2C26A 1CJPA 2HYKA 1H4HA 1N1TA 2W1UA 4UI9L 4YG3A 1H2MA 3NKTA 2CV6A 4LK6A 3VBHA 1AX2A 1DLLA 1T6BX 1UD1A 3NL1A 1NAEA 1BBT3 1G9CA 1W39A 4YARA 2OUHA 3M2MA 4JDMA 4CP2A 5FWJA 4V2WA 4JDNA 3WNXA 1OC1A 4W6XA 1UU6A 3N7LA 5ACA2 1SBEA 3VKFC 3WHUA 3E1F1 5H9QA 4PLNA 2HWB3 1XU2A 2A6VA 2AC1A 4XXPA 3VKLA 5FOBB 5FQ0B 2W94A 4HETA 5F6LB 3AMPA 3BGAA 2RS32 1PM7A 2JD9A 2VQAA 4DZGA 3H8XA 5ACA1 2K2SA 1JYVA 5FWEA 1AL22 3IN9A 4JTNA 4CUGA 5DAQA 1AXYA 1W90A 3OBRA 1VJ2A 3UETA 4CPBA 3ZKYA 5AC93 1VRH3 1DQ1A 1RMU2 2RS31 3LDKA 4YW5A 2OQ7A 3GNEA 1HKDA 5JCTA 3QH7A 2BNMA 5AVPA 5JXIA 3AYDA 2WQZC 3GBWA 2C9KA 3ZM8A 4LO6B 3LE0A 3CEWA 1R082 4ZU4A 2HYXA 3R0RA 3OB8A 4Q4X2 4FFFA 2VOVA 4UFMA 5L9RA 3HNBM 5IUQA 2WZR2 3W20A 1ZRRA 2A75A 3I59A 3AC0A 2VNGA 2Y26A 3LDBA 5F1RA 3VD4A 1LENA 1RHI1 2XGXA 4D7SA 3OSDA 5TSWA 5A32B 3JBG3 1R081 2OPWA 3LA7A 4Q4X1 2VMEA 5FLJA 4LNVA 1RITA 3N9OA 2W92A 1N3OA 1NZIA 2PXJA 2WZR1 1V70A 1V9U2 3I2IA 1PX3A 4CEWC 3KQRA 4QPGA 3ASIA 1FOD2 3Q8EA 2WLQA 1UZYA 5C7GA 2VM9A 4P9JA 2X53S 1O5LA 2DUQA 2N7GA 3PTRB 3S30A 5BUVA 1VMHA 3SH4A 1ZBE3 3Q8AA 4LEJA 1V9U1 4YSFA 4WVVA 2FQPA 1WW7A 5BNPA 1XYOA 4CPBD 5I8YA 1VBB1 4HK9A 5DQ0A 5DUXA 5F8PA 1CAVB 2FDIA 4RD7A 4UW5A 3UESA 1ZX5A 1SMVA 2ORZA 4NPRA 2J1AA 1O3TA 3H9AA 1EPZA 4ATFA 2Y33A 2BWAA 2XWJB 2FCTA 2VNVA 2X5IC 4XFIA 2R30A 2QBXA 2RR13 1MACA 4OI0A 2LRPA 4XMIA 4PIYA 5BV6A 4JCKA 1FMD2 5JLVA 3AKRA 3WQBA 3K75B 3NMBA 4F7ZA 5JOZA 4W4ZA 4NIIA 4F83A 1W2NA 1DYKA 3C7GA 3GJBA 1LRHA 4Y4YA 2ENRA 5A70A 1QXJA 1W04A 4QQ2A 1UY1A 2HWB2 2GNDA 4KBZA 3G6JB 2D3SA 1UCXA 4FFGA 2EIDA 1SDDB 1BK1A 2A6YA 1SLAA 4MXWA 3VHOA 4JKLA 1X8EA 1YLLA 2YG0A 5CKQA 3A21A 4IEUA 3SKJE 4Q8KA 4DOUA 2WQ4A 3A22A 1VRBA 1QDOA 3SCFA 5A3NA 3V0AA 4CXYA 1W2UA 1V0AA 4EWDA 4XURA 4BK5A 1UWWA 1S0EA 1RIRA 1QJEA 4I01A 4CEWB 1HN1A 3M3EA 2XPJA 4DXRA 2W52A 2VBBA 5DN2A 3TNPB 3ZVXA 3WNPA 2KA3A 4FOWA 2ERFA 2GNMA 2R072 2YDEA 3ITQA 3LSEA 3WNOA 5A3LA 5J48A 2IXKA 3R4UA 2A71A 3ZFEA 1QOTA 1OLQA 2JB8A 2DCTA 2VCMA 3OUHA 4O7XA 3ETPA 2OKXA 2W3JA 5D8AA 4IUGA 4O61A 1R1A2 2DCKA 4QDQA 1XE8A 3JBG2 5IK4A 2DUPA 3N3HA 1W0PA 4ZXKA 4IGOA 3PUSA 3VHPA 2D43A 4BXFA 1WBFA 3I2OA 4XFAA 1BKZA 1VMJA 2R1DA 1AYM2 2BQPA 5T3NA 4M00A 5A6QA 1A8MA 3MV11 1R1A1 1WCQA 4AFBA 5KHGA 1QDCA 4WVWA 3VBUB 2QQPA 1VR3A 5A6ZA 3T08A 3VGIA 1RXFA 2JDAA 2JDKA 3POYA 5C3SA 5FYZA 1CAWA 2LROA 5JOXA 4XTMA 1LU2A 2NMOA 4ES8A 1AYM1 1TE1B 4LA2A 1YQ5A 4BIFA 2JEMA 2YFUA 2B42B 2B39A 3H0OA 4JDOA 5EIYB 1Y7BA 2JB4A 3I2HA 4MXVA 2EA7A 4K40A 1OLRA 1W6OA 4FTBA 1Y9QA 3D8CA 3DV8A 3SISA 4LBKA 1XNAA 5IVVA 1ULOA 2R042 2Y6GA 5C9AC 3POIA 5JSOA 4CTEA 1REDA 1CWPA 4B7KA 3SHRA 1LKNA 4FPKA 5E1RA 1AR71 3LFIA 1KS5A 3HVDA 5H9RA 5JZGC 3KGLA 4GKYA 2CHHA 1BYHA 5EZWA 2A1XA 1YFWA 2I74A 2R041 4KNCA 4LKEA 4PCRA 3O1VA 1GANA 3NNJA 4CU9A 2GC3A 5IT6A 2JENA 1GP6A 4QQHA 3SQOA 3RMYA 3NNGA 5KR7A 1LHVA 1TEIA 1C1LA 2DF7A 5DDJ1 4ZZ8A 4JKKA 2WZPP 2QQWA 1CAXA 4AVCA 3U4SA 4CP1A 1O3SA 2E7QA 3FL7A 2UURA 1CAUB 1PGL2 3I54A 2WS93 3E5QA 4PDWA 4YZ4A 1POQA 3K3OA 4K21A 5FO7B 5EFUA 1UU5A 4K20A 2VW0A 1U0AA 2PTMA 2UYBA 4J1WA 5I8TA 2GDFA 1CD3G 4FPOB 2VL4A 1D4VB 3KGZA 3TEXA 4QXKA 1PGL1 5DAWA 1RUNA 3CJIA 3PJQA 4IV1C 2JG9B 4AGVA 3I3MA 4N43A 2ARCA 1AR63 4YGDA 3SH5A 1MS8A 1VAKA 1UU4A 2PHWA 2ZGQA 3GYDA 1ND3B 1MS9A 4XEZA 2QQMA 4Q27A 1S55A 2HWE2 1HB1A 5HCAA 3OEBA 1YIFA 5IWFA 1UZWA 2DVAA 1LB2A 4QPIC 2ZGOA 2NQYA 3KV5A 2VOWA 4BJ0A 2LW8A 2W47A 1LTEA 4IEOA 2HWE1 3C8XA 5JZGB 1PVC3 1C8M3 1TME2 2ZOEB 4ZS3A 3HD8B 1LOBA 1NT0A 2FDFA 2VBPA 1HIXA 4DUWA 3ATGA 3ES1A 4F8AA 1ULPA 4Y1ZA 1X36A 2K0GA 3BALA 4WVMB 3SKVA 3VZOA 5FJKA 1EY2A 1TME1 2PAEA 3I3EA 2VOKA 4JC1A 3LEMA 2NPIA 4IEXA 5JIAA 3I2FA 3ST7A 1OFSA 3OD0A 3LPGA 5DAVA 4OI1A 5C3PA 1N3PA 1UAIA 3BN6A 3MW2A 4IV3A 3INAA 3AL5A 3QH6A 3SNMA 3MIEA 3N7MA 1AYN2 1W6NB 4GQ7A 3POWA 4Z82A 4ET7A 4RHV2 1LOFC 2B46X 2GP5A 3NAPA 4P14A 4CCEA 1D0GA 2QDNA 5JI9A 2VZSA 1AYN1 1DHKB 2MNGA 1X8MA 2VZ1A 5K0UC 1AXZA 2WNUC 2XQXA 3SCGA 1PK6A 2R062 4RHV1 5FZKA 2KR2A 3CQOA 5A1AA 4IV1B 4MO3M 2VOTA 2RS53 4LBJA 1X9TA 3H8UA 5E89A 4LUKA 2WSVA 5FYYA 2A3YA 1OQDA 2W46A 1UMIA 2YC0A 3HMYA 2R061 2DURA 4FP3A 2KD7A 2WS92 3RFRA 2XXZA 3WW4A 3LEGA 4RQPC 4XCAA 4C91A 3EO6A 3B02A 4ORFA 5GLWA 2EVXA 1FV3A 2VUCA 3E97A 3BI3A 1GFF2 3QOPA 4FFHA 5IK7A 3WNKA 3A7QA 1AVBA 3ELNA 2Z2SB 3OBZA 3AJYA 4JHZA 4YM2A 4BCUA 3HQXA 1F4AA 3AP5A 4LIVA 1H8VA 3ZMNA 1DU3D 2WO3A 1WGPA 5FZIA 1ODMA 2SLIA 4FOVA 4GWJA 4HPKA 1TVGA 4UFHA 1G9AA 5FPZA 2XG3A 5LEJA 4X8PA 1YXWA 1UX6A 4EWEA 1NA1B 2ZABA 4EV0A 4KWLA 1SLTA 4CDQA 3T1LA 4LBQB 4RS5A 4E9KA 4P08A 4CDXB 1C8M2 2B4KA 1W9YA 2ZKNA 5FZ9A 3UKTA 3WQ1A 3FBYA 1NQJA 3K2OA 2YGMA 4XF9A 1JN2P 1PMHX 2YPDA 1ODNA 4P9WA 2GC0A 4NAOA 5A80A 1HB3A 1EAH3 3TAYA 1LAJA 1OLMA 2VY0A 5K0UB 5DXDA 3LDRA 2WNUB 4OHVA 3VBHC 3DYMA 2XOMA 4Q0SA 3ZIXA 1J3PA 1UO9A 2ES3A 3ZOIA 2C5DA 2RHPA 5HXMA 4FPYA 3NV3A 4B3NA 1EV13 2BJSA 3POGA 1E5RA 1SBDA 4AVVA 3WQ7A 3AMNA 3VBFA 2WFPA 4D7YA 4IL7A 3KZ4C 4RL7A 1AR92 4AHWA 4X6RB 2VG9A 1W6QA 2JJ6A 1MVQA 1PMJX 4M3CB 3OTFA 4XJ8A 1YJLA 3V0BA 4Q4W3 3LSDA 1BHGA 2PAKA 4HXCA 4PQQA 1NY71 1W8TA 2ORXA 4IW3A 3WF2A 4YFZA 1AR91 2OIIA 3H50A 3OD4A 3KLSA 4H7LA 4Q4Y2 1KITA 2ZEYA 3H7JA 5EXOA 2JE8A 2YC4A 4DXZA 1S2EA 5T5JA 3JD72 4AHYA 1SPPB 5K7PA 2XJUA 4Q4Y1 5A3UA 4L8QA 1ZRDA 1VIWB 1UYZA 1RUF3 3ZKUA 1YFUA 1GZWA 4JV4A 3LZZA 3ORJA 2WKKA 3JD71 4ZONA 3TEZA 2OZ6A 3BODA 1W2AX 2JXAA 5FYMA 3LGRA 5FRAA 2RS13 1V6LA 1QXRA 3WDYA 1NCRC 4QX1A 5B4XA 2D44A 1UZ0A 3NNFA 4YZ5A 2E63A 2IUWA 2WZ8A 3MIDA 4KWJA 1QF3A 5FYSA 1H9WA 2GAUA 3TYJA 4COUA 1JYXA 1NCQB 3W58A 4BB3A 2FDJA 1ZNPA 3BVCA 5A33A 3D82A 3Q9OA 4FQ4A 4YRDA 3AKQA 1W3XA 3MUZ1 1YUDA 4QPGC 5M0TA 1ZM1A 4I09A 1JU3A 3U10A 3ETQA 1S2KA 1WCSA 3M8LA 4K8FA 2VJXA 3QACA 1XSQA 4EE2A 5LASA 1PIV2 3VD5A 1RUD2 2XLGA 1W6PA 4GMP1 4YW1A 3U07A 1XNDA 4URTA 2YBPA 5FZEA 3THDA 2NMNA 5GALA 1UY3A 4MGZE 5FUIA 4XCBA 4NRQA 5FPBA 2RJKA 5GZFA 1PIV1 2JDMA 5L7OB 1EAH2 4HLTA 1RUD1 1H6XA 2JDNA 4FQZA 1YI7A 2PHRA 3CKHA 5J96B 2WLPA 3H1MA 4V2VA 5G04L 5LBFA 5FR3A 3T2QA 1NE4A 1Y9GA 1QQP3 3RGBA 4CUCA 2TUNA 1GU3A 2AACA 3VBOA 4N7UA 5EQUA 5ABJA 3X29B 3T4VA 1DBNA 4XDQA 1OKOA 5E88A 1QOOA 4XHXA 5KHHA 3WF0A 2XHKA 2XWBB 1WLDA 4Q4W2 4AEDB 2VTFA 3DF0A 4NWWA 1YQ8A 2X05A 1A6CA 1X50A 1NCRB 3LIGA 1RB8G 2Z79A 3B5LB 5SV8A 2JDPA 1KXGA 2CTVA 4ZS2A 5CFDA 4B29A 2PHDA 2VECA 4GJZA 2ZEZA 3S5AA 1J1LA 1PO13 1U12A 4CP9A 1NX9A 5JXJA 1LULA 4AQ2A 5A7QA 2JG8A 4ZHNA 4PBOA 3WP5A 3D0JA 5LA0A 4QPGB 3NWKA 1RTVA 4B4RA 4XHBA 3PVBB 1DGWA 1IOAA 3KV9A 4AK3A 4DB5A 5KBFA 2VW1A 2WINB 4QB2A 2WT1A 3ZFEC 4CYDA 4LKDA 4BQ1A 1CONA 2RMU3 4Q1PA 4QMAA 3DPRA 2JIJA 3AP6A 3B9IA 1BXHA 5C8CC 1YEWA 1QNWA 5FYUA 3TEYA 2LUWA 1US2A 5I0DA 5FZMA 3WP3A 4RR3B 1TMF2 4IE6A 5CKMA 1GZTA 3IDEA 2PYTA 3AK0A 2ADEA 2HWD3 4FTEA 1RUH2 4NHMA 1ONAA 1I3HA 3POEA 5T5PA 3HN1A 4B4QA 1QNYA 3NV4A 5GZGA 1DQ5A 4WM8A 3ZN4A 4AQTA 4O9EA 4QGMA 5CFCC 1TMF1 3HIFA 4NIGA 4QT6A 1GUIA 3LKJA 5JXHA 1ULGA 4NRMA 1LHNA 2AEZA 1BEV1 2JICA 2CGOA 4FOYA 3VLBB 1RUH1 1VBC2 2W9XA 3CJXA 2EXKA 4XUPA 3MW4A 2BOJA 4R52A 4Y4RA 2EXIA 3ZXGA 3PMEA 4L2NA 4Q4V3 1PGW2 1VBA2 2IFWA 3ES4A 1ZBA3 3OG2A 4J6GA 4LO4B 3U1XA 1MEC2 1ZZ7A 4BIOA 1C8NA 1VBC1 4IGQA 1CPNA 4NVPA 3RWKX 5J3UA 2ZGUA 3BB6A 1PGSA 1W28A 2A6WA 3I8TA 1QQP2 5FMCA 3KVBA 1PGW1 1VBA1 1MEC1 2RJ2A 5FYVA 1AHSA 5KHIA 3E6DA 1RUJ2 3J7NA 2Y0IA 4UBHA 4KGQA 3PTYA 2A3WA 4MVTA 4YGCA 5IFPA 1YFXA 3LOBA 2R32A 2VCAA 1G7YA 1ENRA 2O0OA 2WO1A 3PIGA 1OH3A 2BU9A 1H1IA 2WNEA 1YRZA 4ZPIA 5LATA 4AVBA 2QQOA 5CU1A 1RUJ1 1DIWA 2BBVA 4ISQA 5F32A 5C8CB 3T0DA 3R05A 4JTOA 3IMMA 1M06G 3A0KA 2DV9A 5FMOS 2W5FA 5ACA3 5D21A 3TB0A 1Q56A 5IAVA 2VUDA 1GNYA 4C8DA 1MS5A 2ZJCA 4FSJA 4YVSC 1J3RA 5L36A 5I91A 5E16A 3KF5A 2RS33 4WVZA 3N9PA 5BXXA 5D1IA 3TNQA 3WINE 1F5JA 1V00A 2GALA 5FXZA 3WDWA 5CFCB 4PDWC 1GOFA 1XYNA 2C24A 2UY8A 3THPA 1VALA 1KRIA 1WCKA 4XJAA 1UX7A 3W9AA 5KXCA 4R4XA 2CAUA 5B2GB 4AFAA 4CCKA 4PI0A 2CWSA 3CJIC 4PIXA 4YFWA 1WA4A 4CU7A 3BTZA 4AYUA 1YQ6A 1RHI3 1R1ZA 2VMCA 4QB1A 2EALA 1R083 2G9GA 4Q4X3 4AVSA 2J42A 1GWKA 2PHLA 2WZR3 4MZUA 4CCLA 1IQAA 3NJXA 1X82A 5LA9A 5HCHA 3T2PA 1RUI2 2E6VA 1H1MA 4QDRA 3ZFFA 2FDGA 2VVFA 3U75A 3W5MA 2ZX3A 3D0SA 3ACLA 5JDBA 1D4M2 1QMJA 1GNHA 1V9U3 1IQDC 1SFNA 3VBRB 4MLOA 3U4XA 5EPAA 1RUI1 2Q8OA 4XUTA 5FJHA 3LPFA 4Q26A 2VO5A 1SHWB 2GZWA 2CGPA 1H2KA 3MLKA 2W68A 2JE7A 4CDUC 3ZSJA 2WNVA 1DYPA 2OUJA 1D4M1 4RGAA 5FY8A 4DEQA 5F9TA 1LEMA 3GM8A 3T0AA 2PAMA 2XJPA 4D69A 2G4IA 3UKVA 4FAHA 5CG9A 2FMYA 3WT3A 5F5AA 3PLQA 1QJU1 4JZRA 4IV3C 4CUAA 3ENRA 1YIPA 4YVSB 4JGYB 3GALA 3HOBA 1FPN2 1WCUA 3IMNA 5CYYA 5FBZA 4Y1VA 3RDIA 2PHTA 4YPJA 4BLIA 2G9ZA 2KM2A 1HQWA 3NAPC 1FMD3 1PO22 2D5HA 4MGYE 4XJZA 3LF7A 1CN1A 5JOWA 3NW4A 4CCNA 1UMHA 1FPN1 2WJSA 5F2WA 4CCOA 4K3UA 4KQ7A 3MPBA 4XIOA 2Y34A 5LB6A 3QLQA 4HVOA 4HZFA 3RZJA 4Y22A 4GH4B 4J1XA 5FYBA 5EYXA 5FY1A 1CR7A 5GJ6A 1PO21 1RUC2 1OXCA 3VDAA 4NO4A 1VBD2 2D6OX 4IEVA 1JUIA 1UOJA 3ZFGA 4L92A 4JQRA 3WG4A 1CVNA 5DMYA 3SITA 4COYA 4OHYA 1ZRIA 2VTXJ 3W5NA 4X8NA 3ALQA 3KCYA 2Y0OA 4OCTA 1RUC1 2NM1A 2WC2A 4YYOA 1NXD1 1VBD1 2A6ZA 2XHNA 5J98B 1GP4A 1AX1A 3NO8A 3ZSKA 2PMWB 3KS7A 4UXAA 4EQVA 1LESA 3Q8BA 1HW5A 3R4SA 2B9VA 4PF5A 5DAPA 4CU8A 5A6YA 5IYYA 2WT0A 4BA6A 1RHI2 5C4WC 2R073 3MYXA 2PN5A 3E5UA 3KM5A 4CDUB 1HXS2 2LM3A 3EHKA 2FCUA 1F31A 3FLTA 2IZWA 1A34A 1LNSA 1O3RA 1NE6A 1S0BA 3WEZA 5FP7A 4OULA 1R1A3 4XJ9A 3WF4A 4CDQC 3WR0A 2VZRA 4LBOA 1HXS1 5LZ6A 4AVTA 4RS5C 3H1WA 2ZGNA 1ZZBA 1J84A 3MIHA 4DRVA 3D5OA 1AYM3 4XC9A 3U11A 3GCWA 1VBB2 4CEYC 3JUUA 2XUMA 2WAOA 1UZZA 2YPJA 3IPVA 5FYIA 3WD5A 4EZHA 3BOWA 2BFUS 3CDZB 4CCCA 4CSWA 3KB5A 1G9FA 2RDQA 4OQ8A 2XJTA 2ZHMA 4JRLA 1QJZA 4XOGA 4D6QA 1W8HA 2E53A 2QJVA 3H3UA 4JGZA 3T4HB 3HBKA 4E4ZA 3MIFA 1OA3A 2ID4A 2GH8A 3HEIA 3VBFC 5GZEA 2HBTA 2A7AA 1AR73 2WL1A 2ZKLA 3MLLA 2EIBA 5GM0A 1DCSA 2R043 1OD5A 5A7WB 3KVAA 2K46A 1MS4A 1DYOA 4N7IA 5HV0A 1OVSA 1F5FA 2JDZA 1UIJA 3GJAA 4NJ4A 4XIKA 2WRAA 1UW8A 4DIQA 1UQXA 2ZA9A 2P3IA 4P9XA 2HEWF 5DUVA 2D7FA 5DDJ3 2PFWA 4BH9A 5C4WB 1JYCA 3AM2A 4XMAA 1DGRN 4XPVA 4DEVA 3B00A 3FJSA 5T52A 4PQ9A 2J1UA 2RV9A 3M3CA 3NV1A 3DN7A 3VKNA 4QQLA 4FPFA 5LWBA 3LAGA 1BK0A 1PZ9A 4IEYA 2WO7A 2FCVA 4C1XA 4WZCA 4LOSA 1UYPA 2DVGA 3W21A 1XU1A 4NUBA 1WMEA 2R1BA 4HN1A 3L9JT 2EIEA 1U5XA 5LK5A 2VC9A 3SXWA 3OUIA 4A45A 3VKMA 4CEYB 3FX3A 4OFGA 2XKOA 3UJQA 2D3PA 4ASLA 1XNKA 4AGRA 3J4UH 2PHXA 2ZACA 1IS6A 2VD7A 3KSCA 3O1TA 4Q1RA 4XQ4A 5F3CA 1GKBA 4IEPA 1DGRA 1BQPA 1US3A 1ZRCA 2Y38A 1AJKA 2C1FA 2XJVA 3HPNA 5CA6A 3J26N 4AE2A 3VBFB 4SLIA 3NJYA 4QU2A 2HWE3 5IVCA 2X5IB 1DP0A 3V0BB 2NYYA 3CF6E 2YFZA 2W1WA 4BQWA 1VRH1 4XFBA 1RUOA 3MW3A 1VAMA 2V72A 4B1MA 5DZEA 1OURA 2ZGTA 5FZAA 1SEFA 3VZKA 4H3WA 5J1XA 1TME3 1POV3 4KU7A 1MS0A 1MQTC 1IS3A 5F3IA 3DL3A 3C7FA 1PM4A 2AYHA 3VBOC 2IC1A 3FN9A 3NNLA 5IW0A 3RMXA 4AEKA 1OSGA 5ABJC 3J7MA 4XF4A 2HEVF 1VBE2 3VBSA 4GA9A 1AR72 4AOCA 4C90A 4IE7A 2B45X 2XJQA 4YLZA 3M3OA 5F3EA 3WG1A 4QXBA 4YW4A 1RVF2 3ZN6B 4UFKA 4XF0A 1EUTA 4PT6A 1TQ5A 3OPWA 3FHIB 1VBE1 2XJSA 4L9BA 1DQ0A 1O7FA 1ULDA 2OPKA 2Q1ZB 2V5YA 2WSUA 3B01A 4NHYA 1L3JA 3LWCA 1AYN3 3MI8A 3NVCA 5FY5A 5CFDC 1RVF1 2VZVA 5DDJ2 2BRTA 3DYPA 4XFGA 3M70A 4RHV3 4E27A 4LKSA 2V09A 4AI3A 4BQ3A 1UXXX 2J1TA 2JG8C 2YMZA 4GWIA 4N53A 4AFMA 4AW7A 1JZ7A 3P6BA 2OS2A 3THTA 1IG3A 5BY5A 1HDKA 4A7ZA 1C4RA 4BE3A 4BQ4A 3V65A 1IKQA 4LMFA 2R063 2W95A 5FY9A 2P17A 4XQWA 3VZNA 4EN7B 3L2HA 1YQCA 4OZXA 4LO7A 1LGNA 4EN9B 1OHFA 2A6XA 2YUEA 4LXLA 5LA2A 2Y60A 3CMGA 3I97A 1XOYA 3DKWA 3I4IA 4QU1A 4UF0A 1CZTA 2IXCA 4ASKA 1F15A 3VDBA 3VD3A 1OOPA 4HANA 1I9RA 1XBFA 3MO4A 4K1ZA 1OFNA 4BLJA 1XSRA 5JWPA 1LODA 1W3VA 4S2HA 1S0DA 1IG0A 1WW5A 4AVAA 4OUEA 3GXUA 3N7JA 3OY8A 3QCWA 2MPFA 3FLPA 3RPQA 1E5HA 4YVWA 3R6SA 1DDLA 4WM8C 2VGDA 3AYAA 4BPZA 3FLRA 1MQTB 4EJRA 5JXGA 1IHMA 2JDUA 1B35A 1SLIA 2P37A 4CU6A 2ETEA 3J7LA 1STMA 2VMDA 4FVVA 1W8ZA 4HG6B 4GD4A 1JI6A 2JD4A 4W50A 3ZN5A 2O1QA 4S2GA 5FK7A 5FPXA 1OMIA 3AMQA 3SEEA 1CIWA 5C9AB 1NLSA 4NHKA 2WBKA 2GNBA 4YW6A 2E32A 3BPZA 5GLVA 1BLZA 1GZ9A 3K46A 5FZ1A 2YC2A 3N9LA 3GF6A 4U36A 4Y3OA 4LLFA 5CFDB 5FP8A 2Z69A 3IDBB 4ZU7A 3BTAA 3UL2A 4XABA 1JYWA 4QPYA 3A4UA 3EMRA 2TBVA 2JG8B 2UYAA 4KU8A 5C3OA 2Y6FA 5FQ0A 2QZ3A 4JKMA 2VZPA 5ERLA 2ZS6B 5FLHA 3PURA 3USUB 2D40A 1GLHA 4EYUA 2Y8KA 4PHZA 2XBO2 1OT5A 2P6CA 5A3PA 2IFRA 2VW2A 5KC6A 5JSRA 4R8HA 1W8FA 3MFCA 2NP0A 1AR93 3JB8A 5ANQA 3IAQA 2WT2A 3PMSA 1I1EA 4YWAA 5A7SA 1YO8A 4QHBA 2XBO1 2YU2A 1FV2A 1H1AA 4G4FA 4E2QA 5ISLA 2W39A 3LCPA 3IZOA 2ZPXA 4KBBA 3UGHA 2BZDA 5I0UA 1COV2 3EBRA 3IKWA 4Q4Y3 4QB6A 4WM8B 1O4TA 5ANNA 5LY2A 2J1EA 4D0QA 1Q43A 2H6BA 3JD73 5A3MA 4ITCA 3T2OA 5A32A 1OKQA 3O0WA 4XZPA 4C1WA 4MGKE 5J7MA 3H42B 3WNMA 1COV1 3HR9A 5FXXA 1O6UA 4C0HA 4NE9A 4Z2AA 3MV01 1NG0A 2ZHNA 1XJAA 2YGLA 3OPTA 2VBDA 5FO8B 4NPLA 1ZREA 4QPIB 2VZUA 4RSUA 5HCBA 3K48A 3WDTA 3ZYGA 4XF1A 1QJY2 1OLME 4UBGA 2WDBA 3JCIA 1OVPA 1IGOA 2CL2A 3J8F2 4Y20B 4BM8A 4E2SA 4URAA 4Z1VA 2WZEA 4JHTA 1SQ4A 1HRV2 4OUMA 1OA4A 5FZFA 1ZZCA 3JB4C 4MHUA 4K7JA 2QQNA 1QJY1 2LALA 3ZFFC 2MEV2 4A44A 2DVFA 4Y1XA 1JBCA 1S0IA 3EXUA 1NQDA 3J8F1 1Z7S2 1HRV1 3DECA 2F17A 3OJBA 3WP6A 3DEMA 4GMP3 2O8OA 3VDDA 2I2SA 2YY1A 4WM7C 5FPVA 1RUE2 4AF9A 2DCJA 5BNNC 2UWAA 4MSVA 3HBZA 4I3GA 5F3GA 1Q8QA 2MEV1 2OVUA 3KMHA 3ZPYA 3IB3A 3PL0A 2ZX0A 1PIV3 3H7YA 4H14A 1I5PA 4YW2A 1JOPA 1RUD3 1A78A 2VE1A 1Z7S1 2J1VA 2XL7A 4MG2A 2AEYA 1W6MB 3WV6A 2Q0AA 5DG1A 1RUE1 2WWJA 1IZ3A 5H9SA 2WNOA 1H8TC 2K9ZA 2KXLA 2V5DA 3PNAA 4FT8A 4RFRB 4B1LA 2DBNA 2GNTA 4L97A 3OGSA 4G9SB 1JMUB 4FTSA 2OXBA 1SLBA 1JW6A 3ZYJB 1ACCA 5FY4A 1WMFA 3MZHA 2VOXA 1W03A 3PIJA 3I49A 2ZAHA 4GWNA 1JODA 3WLUA 1K3IA 1SBFA 2H0VA 1NY72 3LFMA 3RYKA 4DXSA 4GB32 3N9QA 1XNTA 4H55A 4IETA 4CEWA 3W59A 3I2DA 4P00B 2ILMA 4QDSA 4H7MA 1ENSA 5T5LA 4TLGA 2PQQA 4RQPB 2B8MA 4I0AA 1E57A 4GB31 3ZFGC 3KV6A 4XUOA 1JZ4A 4PLOA 5A7OA 4HVQA 4XXAA 3SLIA 4LHSA 3RSJA 3UYJA 2VNRA 3AB0A 4GJYA 1PZ7A 5IVYA 4ISRA 1RJ8A 3ZFFB 2VMHA 3ABZA 1LJ7A 1OF3A 2GC1A 3FWEA 1KJRA 4DPNA 1Q8PA 2X8KA 4AEMA 2PQSA 3O1PA 1SZBA 5I0TA 1X9PA 3KHCA 1O8SA 1WUVA 2QQVA 4WM7B 1S0JA 1ZA4A 3N35A 4KI5M 5BNNB 1QY4A 2GH2A 4N9IA 4S2DA 4YZ2A 3VHRA 4P9LA 3POJA 3VBUA 5JIUA 2E9QA 2P3JA 4BDVB 3IDAA 5G05L 2Q8EA 4MGQA 4PIZA 4V1PA 3KD4A 2BVBA 1HQNA 2RJLA 3JZVA 4WZFA 1H8TB 2RG4A 1UPIA 2XMLA 3UV9A 4KGGA 2VMFA 1TMF3 1N1VA 4IE4A 3N9MA 4QKDA 1FT9A 3ACFA 1BEV3 1RJ7A 4LT5A 3J7HA 2ZTNA 3E6CC 2AREA 1D7PM 1RUH3 3VBHB 2WWUA 4BZ4A 5A3WA 3ZSEA 1LR5A 2ARAA 4Z8BA 1L7RA 1SDWA 1TG7A 1LEDA 1W05A 2GN7A 3LA3A 4IE0A 4XILA 4AQ6A 2CAVA 2XLAA 3S5QA 5EJ3A 4M4PA 1BVP1 3GZTB 2VCCA 5F39A 5F5IA 1VBC3 3KWVA 5FP9A 1YC61 2AR6A 5BNPC 5JOYA 3I2GA 1G6NA 1T2XA 4LA3A 1HJFA 5FO9B 1RXGA 4JGZC 1GR3A 4YG6A 1O5UA 3SH3A 1VBA3 1UOBA 1GOGA 3GZEA 2O8QA 1V6KA 2P1BA 3PVNA 4FPHA 1MEC3 3SCHA 3ZFGB 4B4PA 5BNOA 1QJFA 4HSLA 3RZHA 4CP0A 1W9FA 2XUEA 4P9YA 4IEWA 3AFGA 5J37A 1CGPA 4TLFA 2CSGA 3WNNA 2Z5WA 3GZAA 3O1RA 1SFPA 1JYIA 4KH9A 2HWF2 2ZGRA 3AYEA 4NN0A 1C3HA 2QVSB 2ZGKA 1XE7A 3WOGA 1RUJ3 3U0ZA 1Q8SA 4QX5A 3DKQA 3T09A 2RM22 3EB7A 5FIXA 3LB9A 3ZXJA 1AZDA 1CAUA 3K3NA 4CE8A 2YROA 1LECA 5T54A 4Z92B 5IVBA 5FMDA 3WDXA 3WXPA 2HWF1 3AP4A 2DFCA 2X29A 3I59B 2RM21 5K8SA 3KHBA 2CGNA 5DABA 2ZHLA 3IIIA 1XQNA 2YHJA 2QQIA 4QHOA 5DZFA 4QPWA 2Q30A 5L9VA 2I07B 3DUIA 4RN5A 2JG9A 5EJZB 4DRRA 5I0SA 4BQXA 3ZXAC 3FBMA 3AZXA 4R9DA 1J3QA 4FOQA 4GXLA 1ND3A 4K1YA 3AXDA 4DUXA 4LHNA 2BNOA 4YZ1A 5C6CA 2D3RA 1EV11 1OA2A 3P3NA 1NLQA 3PUQA 3ZLIA 4GWMA 1J1TA 2W87A 2ZX4A 3R4DB 2DVDA 2DU1A 4TYSA 1SLLA 5B4NA 2Q1MA 4K6BA 1SCSA 4DXTA 2SBAA 2WAAA 2R0FA 5BNPB 1URXA 3AZZA 1KDMA 5D8AC 2A70A 1H9PA 1Q8OA 1W9WA 3D6EA 1G8WA 4PF1A 3URFA 5F5QA 3TN91 2BPA2 3O7OA 1BEV2 4WVMA 4NHXA 5JR2A 1POV0 1DLCA 4K8RB 4XBNA 1SCRA 4D3WA 4Q2FA 4H2AA 1E5IA 3ACHA 5DUUA 4BMBA 4FPGA 1RUI3 4DMIA 3UK9A 4HKOA 2QNKA 3ACGA 4XE9A 4FBFA 3NJVA 3RS6A 3L2YA 1D4M3 2IWGB 3RWNA 1W6NA 5JMOA 2BW8A 1W06A 1M4WA 2WYSA 4LO8A 5E8AA 2ZMKA 4LBMA 5LY1A 1J59A 1JZ6A 2DYCA 4MXWB 4M0HA 1UY4A 4A6SA 1NYWA 3QBQA 5CADA 5FZOA 3V0AB 3B94A 2PA7A 1R092 1GICA 1GYKA 1FI2A 1B09A 1WWYA 4IV1A 1LOEA 1UYXA 4A42A 3MIBA 2BVVA 1T6GC 4L99A 2FMDA 3TOJA 3CNAA 1FPN3 3A0NA 2VAUA 2IXHA 3I3QA 3S6PA 2GC2A 3RQ0A 1R091 1G86A 3LQCA 4N53C 3ZFEB 1PO23 1DFQA 1NOVA 1UMZA 4EWAA 5AFEA 4CVUA 3CBNA 2BV4A 4N90A 3ZYBA 4L11A 2YYOA 3HQUA 5FZ4A 2CU5A 5FZLA 4HKWA 3KV4A 5D8AB 1WW6A 3OYWA 1WLTA 3ZSLA 1RUC3 4FPCA 1R64A 1VBD3 1JHJA 2W1QA 3MF9A 2EF6A 4F3JA 1OOPC 4AHZA 3GBGA 1EP0A 1W99A 4P9GA 3VZLA 2P3YA 1NA1A 2W0XA 5F7UA 1CAWB 3WY6A 2DUOA 2GSYA 3AYCA 4LBQA 4MGTA 4YVWC 4CDXA 3BTXA 3O12A 1ZZ8A 4Q0PA 4COWA 5KHKA 4YNIA 4EZ4A 3DYOA 3GCXA 4LO5B 1B35C 1SFYA 1BZWA 1J58A 3MFAA 5C71A 2Y6JA 4N43C 2IXJA 4GKXA 3O1MA 4XJUA 3OGVA 3KT1A 1W6OB 3P3PA 3M4FA 1N3QA 5D2AA 1HXS3 2HWC2 4OHWA 3H1YA 1OD3A 5K0UA 1CZSA 2WNUA 3HN3A 3ROUA 4UT5A 2Q8DA 3AKTA 1QJX2 1YWKA 2F4LA 2EICA 3AKSA 3WG2A 1W2TA 2G1MA 4AGGA 1H4GA 3NV2A 5K9YA 2HWC1 2V73A 3WVJA 3BKZA 2HLEA 1UXZA 3RZZA 2D6KA 1QJX1 2ZBJA 4M3CA 3FUOA 5JI7A 3KT7A 3ZO0B 1W8NA 1VBB3 5FMOL 4FXGB 4N53B 1QJU2 1YI9A 2EXHA 5IK8A 1JYNA 1HN0A 2CDOA 3TEWA 5LEKA 3B3QE 4YGBA 3M1HA 3POBA 3QD6A 4LBLA 3ZXDA 2DCZA 3DXTA 1XNBA 2BWCA 5CISA 5LRRA 5KHJA 3WNLA 2VCBA 1H2NA 4QKBA 5HXVA 4BISA 4IEZA 4E2GA 4OMCA 3IM0A 1CAXB 2RE9A 4NAMA 4ATEA 2X09A 3NNMA 2ZGSA 4LBQD 4XFCA 4FFIA 1SPPA 4IGPA 4BHPA 5BYNA 5CVRA 4KL1A 2UWBA 2P3KA 5F2SA 1S0CA 3ZSMA 4PDWB 3OUJA 3OY8B 4UYBA 1LGBA 4B7EA 3O5SA 2D6NA 3RRDA 1UKRA 3WCRA 4DY5A 5KXEA 1GOHA 2OX0A 5HV4A 1AR81 4YVWB 3AVRA 4RGKA 2R16A 1JOJA 1PK6C 2WA3A 3CJIB 2YU1A 1B35B 2CWMA 2H0BA 2QE3A 1PMIA 3LIHA 3MF6A 4N43B 3TWIA 5IVJA 2JKBA 2HJIA 1HB4A 1NCQA 2YBKA 5DG2A 3BTYA 3FE5A 5T5OA 1TZOA 2XH6A 2C0ZA 2XVGA 4ZU5A 4FXKB 5I93A 4AFDA 5FMBA 5FV3A 1RUG2 1UN1A 1K5JA 2JX9A 2WYFA 4YM0A 1MPXA 4BOWA 3GHMA 3MGUA 1JOBA 4X6QB 3RZLA 2NZ9A 2HH9A 2VQ0A 4NROA 4GMP0 2XVLA 3PHMA 4QX3A 3BCWA 2HBUA 1RUG1 2C6SA 1HRI2 1JUHA 2VZOA 3OCPA 3B93A 5AVAA 1Q8VA 2QDRA 1ASJ2 1Y43B 5BNQA 4HL0A 1CX4A 1C1FA 4J25A 2XL9A 4XAAA 5DPNA 5L7OA 1S1AA 4CRQA 4ZXEA 3ZDVA 4MADA 2ET1A 2P6HA 4AAXA 1HRI1 1ZVFA 3VDDC 1ND2A 4Q29A 2VQTA 1QH7A 1YJKA 3POSA 4HN0A 1ASJ1 2DBIA 3CIHA 3M3QA 1K5MA 4QX8A 1VB4A 2E26A 4IV3B 1KD7A 2WFF2 3LOIA 3MEPA 4M3CF 1K45A 1OPMA 2LS6A 3UJOA 3OBTA 1IPKA 3BU7A 3HNYM 2VUAA 4WBBA 4UFLA 3USSA 1AL21 2VTXA 4XVHA 5BPXA 2IXIA 2QQJA 3WF1A 4AEDA 5KXBA 3NAPB 4QX0A 4W65A 5GKAC 5J36A 2TEPA 4IERA 1GSLA 1QEXA 4W8JA 1RMU1 2WFF1 2PLV2 4COZA 2VZ3A 1NCRA 2D5FA 2C4XA 2GMPA 1PK6B 3B69A
chains in the Genus database with same CATH topology
2BNNA 5GZDA 4Q0UA 2D98A 1SACA 3BOPA 3O0XA 5CBLA 3JQWA 2PLV1 1Z0HA 1VBE3 1ZRFA 2NN8A 2E51A 2ZX1A 1AF9A 1RVF3 5CG8A 1GQHA 3PJYA 1KFXL 1TNFA 4RGGA 2B7YA 1QXPA 2Q5TA 1MZFA 4HFSA 1FOD1 4LE4A 1KDKA 1LU1A 4XTPA 4RR3A 3ZXLA 3ILRA 1U5ZA 1DG6A 3NSTA 3RI8A 4HPKB 3RJRA 4QGNA 2CNAA 2ZCWA 3VDDB 4AI2A 1VLNA 1O4ZA 1XXNA 3WX5A 1BBT2 4BWOA 3VBUC 4XW3A 4CDQB 1V6JA 4RS5B 3AZWA 2FZ1A 2CYFA 3PVOA 3IT8A 1XNCA 4LR4A 2BFUL 4SBVA 2QUOA 1BBT1 1FMD1 4R9BA 1FXZA 4LTAA 2HKXA 3G7DA 1JXNA 4HK8A 4QM8A 4YW3A 3MLJA 1QHDA 1VAVA 1GZCA 1MS1A 2HWB1 4W6YA 1I6XA 5AC92 1V6MA 2DTYA 2MHFA 3OPZA 5L73A 1VRH2 2ARBA 1YFYA 5KWRA 1X7NA 1WD4A 1S0FA 1W6QB 4ZKTB 1OQEA 1REEA 2PHUA 3NKGA 5AC91 2DWRA 3AP9A 4NWVA 1ENQA 1F9KA 4DINB 5BNOC 4DS0A 5AFBA 3E5XA 4Q8LA 4META 5C8CA 3WDUA 4QQOA 1DZRA 2D97A 2R071 3ZYRA 1NXMA 3O14A 3GZUC 4AI0A 1WMDA 4E4SA 3S7IA 1GZWB 2AGSA 1UPSA 1WBLA 4INDA 4KG0A 5CAZA 3JBG1 5CFCA 2BUKA 2XBO3 3HAGA 3RNSA 1ZBE2 1MZEA 2VMIA 1GNZA 2GU9A 4I3PA 1WD3A 1X33A 1XRUA 2JG9C 4AG4A 1ZBE1 2DVBA 4AWDA 4CDWA 5A33B 1VB2A 1ND3C 4Q0VA 1COV3 4QM9A 1S0GA 2RR12 4MUVA 4COVA 4P9IA 2XJRA 5CNAA 2QCSB 1O4YA 2XKPA 1W6PB 2VH9A 5FDBA 3DPRC 3AKPA 1JTZX 1MVEA 3FC0A 1C5HA 2RR11 3B9CA 5T55A 1EYBA 1V6IA 1Q3EA 3VBRA 2UU8A 5T50A 5EWSA 4I0WB 3TBDA 1QJY3 5BNOB 1HQLA 2WIIB 4JAAA 2FZ2A 3J8F3 4DY3A 4OUSA 2I45A 1HRV3 5I0RA 3VBOB 5ABJB 3MPPG 4FCAA 2MEV3 4YVSA 3CU7A 5J09A 4UW6A 4JGYA 5SV5A 2UWCA 1Z7S3 1ZZ9A 3RG0A 4O9GA 1RUE3 4UW3A 4FPJA 5C33A 3UKNA 1REFA 4MGIE 1DF0A 4ES9A 2ET7A 1DGWX 2FHRA 3S7EA 3VUOA 3ZX7A 2D93A 5I8SA 2VVEA 4XETA 3WQ0A 4LHLA 1BVVA 4GH4A 3ZYIB 2BTVC 1N47A 4LULA 1F8VA 2BYVE 1N1SA 4Y26A 1PVXA 2DTWA 1MZ6A 2B5HA 2EIGA 3B7MA 4JRAA 3T2TA 1Q5OA 3VKOA 5HBAA 1DQ2A 1IPJA 3AMMA 2A3XA 5CB7A 4QGLA 1RGSA 1AUYA 3DPRB 1C57A 4GB33 3AJZA 4YG0A 3BIWE 3VZJA 3MIGA 3WW1A 5FCCA 1KJLA 1W0OA 1BJQA 1CJDA 1ULFA 4P5HA 1ULCA 4CDUA 2VU9A 5IK5A 2GN3A 1POV1 5JMCA 3N36A 1RINA 3HWJA 4HMZA 4RA0A 4HVRA 1NA1C 1O91A 1QGLA 4QD2A 2GMEA 2VVDA 4IESA 4CDXC 3MICA 3VL9A 1RC6A 3WCSA 3O0VA 4G3YC 4AQSA 1BMV2 2VUJA 5GLUA 1YYNA 1AL0G 2OZJA 3IWZA 1EPWA 3WHTA 1LHUA 3JU9A 1BMV1 4Y5Z0 3CLPA 4A7KA 1CAVA 4MV2A 1CPMA 3TRSB 4E4DX 2ZAAA 1ZZ6A 3WUDA 3WUCA 1Z78A 3ILNA 3LA2A 3K51A 4W6WA 2F4PA 1HX6A 2QZ2A 4BMEA 1XYPA 2H6CA 1S2BA 5EV7A 2E7TA 2WNVC 3RI9A 4D7TA 2XLFA 2IXLA 4DFSA 2WS91 2XB6C 3OYWB 1APNA 4N9HA 4XQDA 5HCFA 2WWSA 1AR62 5C4WA 4XF3A 4PJYA 1I5ZA 5DZGA 4CZSA 2R0HA 4BYYA 5JPNB 1CESA 4A3XA 1WLWA 1YCIA 3AXEA 4C0BA 4Z2WA 1AR61 5GLTA 3ME2A 2R6QA 1QOSA 2D6PA 2LTNA 3AZYA 2VMGA 1LGCA 1DZTA 2Q4SA 2HWF3 4KG8A 1FX5A 1PVC2 3AX4A 3SMHA 2RM23 5GZCA 4Y24A 1D2QA 4CEYA 1NCQC 1DQ4A 1PVC1 1C8M1 1QWRA 4OLLA 4XJWA 4ASMB 3FZ3A 2ZX2A 1QU0A 4R9CA 2PHFA 1ALYA 1ENXA 5L19A 3ZIWA 4S2FA 3VN4A 4IXLA 4AI8A 4MH0E 4DQAA 4TZDA 2DU0A 5FREA 4QQPA 2X5IA 4FP2A 1LHOA 1HV0A 3N4MA 2JECA 4YZ3A 5L7OC 4UW4A 2WNVB 1OI6A 1PZ8A 4NHLA 3TN93 1KFUL 1U5YA 3I7DA 1ND2C 4MX3A 5FAXA 1K5MC 2D6MA 2RS52 4HT1T 4AI1A 4ONUA 4XFFA 1D0HA 3V56A 1VP6A 2QFEA 1H0BA 5F6KA 1UF2C 2AH2A 4AEDC 3ZN6A 2RS51 2AENA 1FNYA 1DQ6A 1JH5A 4Y22B 4LE3A 3APBA 2NLRA 4I02A 3AMHA 2GMMA 2YV8A 4MYEA 2BGCA 1AJOA 1A3KA 4A2UA 2A5ZA 2ZGMA 2ZMLA 4R9AA 3S0MA 3RYPA 2OW4A 4LUMA 3WDVA 2D6LX 4PLMA 2JE9A 1R093 1LCLA 2F6BA 1NLRA 3AP7A 2TNFA 1WCDJ 4R4ZA 4IQPA 4D94A 2P34A 1MR5A 1C5IA 5JAXA 1IKPA 4YM3A 1BCXA 4RR3C 2OYZA 3ZXKA 4B8EA 3H3ZA 2VXRA 4XBQA 3ZMOA 2FBEA 1ND2B 1YNAA 3AZVA 1K5MB 3EJKA 5H9PA 1EV12 1MQTA 3ILFA 4A7YA 2VNOA 1O3QA 1PNFA 1EAH1 1ULEA 2B9UA 3FFQA 3KCCA 2QKDA 2WA4A 3ECQA 1HLCA 1OQ1A 1IS4A 2ATFA 3ZXFA 1LHWA 2AUYA 2ZGPA 4RFT0 5C9AA 5LK7B 2E7AA 3IPVB 3IBMA 3TN92 2DFBA 3M7AA 5JZGA 3N7KA 4Q4W1 2PELA 1CQ9A 1G9BA 4JGZB 1RL3A 2ZMNA 3V64A 3C2UA 2EAKA 1RUF2 4M0NA 2HWC3 3USUA 1H30A 1QJX3 1LOGA 4YGEA 1DGLA 2RS12 4OHXA 5GLZA 3WZ1A 4WV8A 2HEYF 1GBGA 1RUF1 4LBNA 4EN6B 1PHMA 3J9SA 3VHNA 3KCXA 3GHNA 3M3IA 1C28A 3IIAA 1OPOA 4FO9A 3JQXA 3CL1A 4Y1UA 2RS11 2EAAA 1QJU3 5C8WA 3WP4A 3VBSC 3FFZA 3RYRA 5FLIA 4EN8B 5KXDA 1QH6A 4OI2A 1LOCA 1UIKA 4FPLA 2OA2A 2W08A 1SLCA 3IDCB 1QKQA 1WLCA 2ZZQA 3EQEA 3NJZA 1AR83 5KC5A 2C9AA 4K9SA 4DNYA 1WW4A 4AFCA 4I0BA 4QPIA 4CDWC 3GBFA 1MZ5A 3E6BA 2ZZJA 2ZHKA 4Y20A 1KQRA 2XVKA 4GULA 1D2SA 1DZQA 2R49A 5LRSA 4I30A 4Y1YA 3WG3A 4M3CE 5CIRA 1QQP1 4KWKA 1RUG3 4JVAA 3VBRC 1G9DA 2VPVA 2AZ5A 3RJ2X 4PBPA 4AEJA 5HI0A 1A8DA 1GV9A 4FAGA 2ZGLA 1IS5A 2ARXA 2UY9A 4OVEA 1GQGA 1HRI3 5FTTC 1LOAA 1W6MA 4HSJA 4XYXA 1ASJ3 1TNRA 1PO12 1LOFA 1V6OA 3D4KA 4XBLA 2YZ4A 1FYUA 4M01A 4OI4A 3VBSB 4JGYC 1YHFA 5JSPA 3CO2A 3KT4A 3WW3A 3ZXEA 2G9FA 4U2AA 4I2OA 4HBNA 1AL23 1MS3A 1PO11 4NR1A 1Y3TA 3VL8A 3DGTA 2BEOA 3C3VA 4IEQA 1KS4A 4Z07A 2RMU2 3PVEA 4GIQA 1RMU3 2WFF3 3OF1A 4TWTA 3WW2A 3FMGA 3ZDSA 1UKGA 1V6NA 4GH4C 3OGGA 4RQPA 4TSVA 4CDWB 2RMU1 4GALA 2VULA 1HV1A 3FUQA 2HWD2 4NOTA 1AXKA 2A73B 2PLV3 4FPEA 3OGJA 4EROA 2EXJA 1N1YA 5DUWA 2Z42A 5FOJB 2P2KA 4AHXA 1FATA 1NZCA 2DCYA 3MDPA 2YXSA 1JHNA 2HWD1 4LHKA 3HT1A 5JR7B 4XFHA 1AR82 1AX0A 3ZYPA 1OOPB 1U5IA 1FOD3 3VZMA 4WM7A 4Q4V2 5FFOC 4OHZA 5BNNA 1ZBA2 4LLOA 5JPMB 3VV1A 1H2LA 1FAYA 2CY6A 4HKLA 5JVVA 3AFKA 1FNZA 4EN0A 1UL9A 4Q4V1 1F2NA 3HT2A 5EYYA 4AXOA 1ZBA1 1H8TA 1PNGA 4YM1A 4Q0QA 1ZYBA 2HYKA 1CJPA 1H4HA 1N1TA 4YG3A 1H2MA 3NKTA 2CV6A 3VBHA 1AX2A 1DLLA 1UD1A 3NL1A 1BBT3 1G9CA 1W39A 4YARA 2OUHA 3M2MA 4JDMA 4CP2A 4JDNA 3WNXA 4W6XA 1UU6A 3N7LA 5ACA2 1SBEA 3VKFC 3WHUA 5H9QA 4PLNA 1XU2A 2A6VA 2HWB3 3VKLA 4XXPA 5FOBB 5FQ0B 4HETA 5F6LB 3AMPA 2RS32 1PM7A 2VQAA 4DZGA 5ACA1 2K2SA 1AL22 3IN9A 4JTNA 5AC93 1AXYA 3OBRA 1VJ2A 1VRH3 1DQ1A 1RMU2 2RS31 4YW5A 3GNEA 1HKDA 5JCTA 3QH7A 2BNMA 5AVPA 3AYDA 2WQZC 3GBWA 4LO6B 3CEWA 1R082 4ZU4A 3R0RA 4Q4X2 2VOVA 5IUQA 2WZR2 1ZRRA 2A75A 3I59A 2VNGA 2Y26A 5F1RA 1LENA 1RHI1 2XGXA 4D7SA 5TSWA 5A32B 3JBG3 1R081 3LA7A 5FLJA 4Q4X1 4LNVA 1RITA 1N3OA 2WZR1 1V70A 1V9U2 4CEWC 3KQRA 4QPGA 3ASIA 1FOD2 2WLQA 1UZYA 4P9JA 2X53S 1O5LA 2DUQA 2N7GA 3S30A 5BUVA 3SH4A 1ZBE3 2GMPA 4LEJA 1V9U1 4YSFA 4WVVA 2FQPA 1WW7A 5BNPA 1XYOA 5I8YA 1VBB1 4HK9A 5DUXA 1CAVB 4RD7A 4UW5A 1ZX5A 1SMVA 4NPRA 1O3TA 3H9AA 1EPZA 4ATFA 2BWAA 2XWJB 2X5IC 4XFIA 2R30A 4OI0A 2RR13 1MACA 5BV6A 4XMIA 4PIYA 5JLVA 4JCKA 1FMD2 3AKRA 5JOZA 4F7ZA 4F83A 1DYKA 1LRHA 4Y4YA 2ENRA 1QXJA 4QQ2A 2HWB2 2GNDA 3G6JB 2D3SA 1UCXA 1BK1A 2A6YA 1SLAA 4MXWA 3VHOA 1X8EA 1YLLA 4IEUA 4Q8KA 4DOUA 2WQ4A 1QDOA 3SCFA 3V0AA 1W2UA 4EWDA 1S0EA 1RIRA 4I01A 4CEWB 3M3EA 2XPJA 2W52A 3TNPB 3ZVXA 2KA3A 4FOWA 2ERFA 2GNMA 2R072 2YDEA 3LSEA 5A3LA 5J48A 2IXKA 3R4UA 2A71A 3ZFEA 1QOTA 1OLQA 2DCTA 5D8AA 1R1A2 2DCKA 1XE8A 3JBG2 5IK4A 2DUPA 3N3HA 1W0PA 4ZXKA 3VHPA 2D43A 1WBFA 4XFAA 1BKZA 2R1DA 1AYM2 2BQPA 5T3NA 4M00A 1A8MA 1R1A1 4AFBA 5KHGA 1QDCA 4WVWA 3VBUB 2QQPA 1VR3A 3POYA 1CAWA 5JOXA 4XTMA 1LU2A 2NMOA 4ES8A 1AYM1 1TE1B 4LA2A 4BIFA 2JEMA 2B42B 2B39A 3H0OA 4JDOA 1Y7BA 4MXVA 2EA7A 4K40A 1OLRA 1W6OA 4FTBA 1Y9QA 3D8CA 3DV8A 3SISA 4LBKA 2R042 5C9AC 5JSOA 4CTEA 1REDA 4B7KA 3SHRA 1LKNA 4FPKA 5E1RA 1AR71 1KS5A 5H9RA 5JZGC 3KGLA 4GKYA 1BYHA 5EZWA 2I74A 1YFWA 2R041 4KNCA 4PCRA 1GANA 2GC3A 5IT6A 2JENA 4QQHA 3RMYA 1LHVA 1TEIA 1C1LA 2DF7A 5DDJ1 2WZPP 1CAXA 4AVCA 4CP1A 1O3SA 2E7QA 2UURA 1CAUB 1PGL2 3I54A 2WS93 3E5QA 4PDWA 4YZ4A 4K21A 5FO7B 5EFUA 1UU5A 4K20A 2VW0A 1U0AA 2PTMA 2UYBA 4J1WA 5I8TA 2GDFA 1CD3G 4FPOB 1D4VB 3KGZA 1PGL1 4QXKA 1RUNA 3CJIA 3PJQA 4IV1C 2JG9B 4AGVA 4N43A 1AR63 4YGDA 3SH5A 1MS8A 1VAKA 1UU4A 2PHWA 2ZGQA 3GYDA 1ND3B 1MS9A 4XEZA 4Q27A 1S55A 2HWE2 5HCAA 1YIFA 2DVAA 1LB2A 4QPIC 2ZGOA 2NQYA 2VOWA 1LTEA 4IEOA 2HWE1 5JZGB 1PVC3 1C8M3 1TME2 2ZOEB 3HD8B 1LOBA 1HIXA 3ATGA 3ES1A 4F8AA 4Y1ZA 1X36A 2K0GA 3BALA 4WVMB 3VZOA 1EY2A 1TME1 2PAEA 2VOKA 4JC1A 2NPIA 4IEXA 5JIAA 3ST7A 1OFSA 3OD0A 4OI1A 1N3PA 1UAIA 3MW2A 4IV3A 3INAA 3QH6A 3SNMA 3MIEA 3N7MA 1AYN2 1W6NB 4GQ7A 3POWA 4Z82A 4RHV2 1LOFC 2B46X 3NAPA 4P14A 1D0GA 2QDNA 5JI9A 1AYN1 1DHKB 2MNGA 1X8MA 5K0UC 1AXZA 2WNUC 3SCGA 1PK6A 2R062 4RHV1 4IV1B 2RS53 4LBJA 3H8UA 5E89A 4LUKA 2WSVA 2A3YA 1OQDA 2YC0A 3HMYA 2R061 2DURA 4FP3A 2WS92 3WW4A 4RQPC 4C91A 3EO6A 3B02A 4ORFA 5GLWA 2EVXA 1FV3A 3E97A 1GFF2 3QOPA 5IK7A 1AVBA 3ELNA 2Z2SB 3AJYA 4YM2A 4BCUA 3HQXA 3AP5A 1H8VA 3ZMNA 1DU3D 1WGPA 2SLIA 4FOVA 4HPKA 1G9AA 5FPZA 2XG3A 5LEJA 4X8PA 1YXWA 1UX6A 4EWEA 1NA1B 2ZABA 4EV0A 4KWLA 1SLTA 4CDQA 3T1LA 4LBQB 4RS5A 4E9KA 4CDXB 1C8M2 3UKTA 3WQ1A 2ZKNA 3FBYA 1NQJA 4XF9A 2YGMA 1JN2P 4P9WA 2GC0A 1EAH3 3TAYA 2VY0A 5K0UB 5DXDA 2WNUB 4OHVA 3VBHC 4Q0SA 3ZIXA 1J3PA 2ES3A 2C5DA 2RHPA 4FPYA 3NV3A 4B3NA 1EV13 1SBDA 4AVVA 3WQ7A 3AMNA 3VBFA 2WFPA 4D7YA 4IL7A 3KZ4C 4RL7A 1AR92 4AHWA 4X6RB 2VG9A 1W6QA 2JJ6A 1MVQA 4M3CB 4XJ8A 3OTFA 1YJLA 3V0BA 4Q4W3 3LSDA 2PAKA 1NY71 4YFZA 1AR91 2OIIA 3H50A 3OD4A 3KLSA 4H7LA 4Q4Y2 1KITA 3H7JA 5EXOA 4DXZA 5T5JA 3JD72 4AHYA 5K7PA 2XJUA 4Q4Y1 4L8QA 1ZRDA 1VIWB 1RUF3 1YFUA 1GZWA 4JV4A 3LZZA 2WKKA 3JD71 2OZ6A 3BODA 2JXAA 3LGRA 5FRAA 2RS13 1V6LA 1QXRA 3WDYA 1NCRC 2D44A 4YZ5A 2E63A 3MIDA 4KWJA 1QF3A 1H9WA 2GAUA 3TYJA 4COUA 1NCQB 3W58A 1ZNPA 5A33A 3D82A 3Q9OA 4FQ4A 4YRDA 3AKQA 1YUDA 4QPGC 1ZM1A 4I09A 3U10A 3ETQA 1S2KA 1WCSA 3M8LA 4K8FA 3QACA 1PIV2 1RUD2 2XLGA 1W6PA 4GMP1 4YW1A 3U07A 1XNDA 4URTA 2NMNA 5GALA 4MGZE 2RJKA 5GZFA 1PIV1 5L7OB 1EAH2 4HLTA 1RUD1 4FQZA 1YI7A 2PHRA 5J96B 2WLPA 3H1MA 1NE4A 1QQP3 2TUNA 3VBOA 4N7UA 5ABJA 3X29B 1DBNA 4XDQA 5E88A 1QOOA 4XHXA 5KHHA 2XHKA 2XWBB 1WLDA 4Q4W2 4AEDB 3DF0A 4NWWA 1A6CA 1X50A 1NCRB 1RB8G 2Z79A 3B5LB 5SV8A 1KXGA 2CTVA 5CFDA 4B29A 2PHDA 2VECA 1J1LA 1PO13 1U12A 1LULA 4AQ2A 2JG8A 4PBOA 3WP5A 3D0JA 4QPGB 3NWKA 1RTVA 4B4RA 4XHBA 3PVBB 1DGWA 1IOAA 4AK3A 4DB5A 5KBFA 2VW1A 2WINB 2WT1A 3ZFEC 4CYDA 4BQ1A 1CONA 2RMU3 4Q1PA 4QMAA 3DPRA 3AP6A 3B9IA 1BXHA 5C8CC 1QNWA 2LUWA 3WP3A 4RR3B 1TMF2 3IDEA 2PYTA 3AK0A 2HWD3 4FTEA 1RUH2 4NHMA 1ONAA 1I3HA 5T5PA 4B4QA 3HN1A 1QNYA 3NV4A 5GZGA 1DQ5A 4WM8A 3ZN4A 4AQTA 4O9EA 4QGMA 5CFCC 1TMF1 3HIFA 4QT6A 3LKJA 1ULGA 1LHNA 1BEV1 2JICA 2CGOA 4FOYA 3VLBB 1RUH1 1VBC2 3CJXA 2EXKA 3MW4A 4R52A 2EXIA 3ZXGA 3PMEA 4L2NA 4Q4V3 1PGW2 1VBA2 2IFWA 3ES4A 1ZBA3 4J6GA 4LO4B 1MEC2 1ZZ7A 4BIOA 1C8NA 1VBC1 4NVPA 1CPNA 5J3UA 2ZGUA 3BB6A 1PGSA 2A6WA 3I8TA 1QQP2 1PGW1 1VBA1 1MEC1 1AHSA 5KHIA 3E6DA 1RUJ2 2Y0IA 4UBHA 4KGQA 3PTYA 2A3WA 4MVTA 4YGCA 1YFXA 3LOBA 2R32A 1G7YA 1ENRA 2O0OA 1H1IA 2WNEA 1YRZA 4AVBA 5CU1A 1RUJ1 1DIWA 2BBVA 4ISQA 5C8CB 3R05A 4JTOA 1M06G 3A0KA 2DV9A 5FMOS 5ACA3 3TB0A 1Q56A 1MS5A 2ZJCA 4FSJA 4YVSC 1J3RA 5L36A 5I91A 5E16A 2RS33 4WVZA 5BXXA 5D1IA 3TNQA 3WINE <