4CEYC

Crystal structure of human enterovirus 71 in complex with the uncoating inhibitor nld
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
242
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTGTIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title More-Powerful Virus Inhibitors from Structure-Based Analysis of Hev71 Capsid-Binding Molecules
pubmed doi rcsb
source organism Enterovirus a71
molecule tags Virus
total genus 44
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ceyC00
1VBE3 2HWD2 1HRI3 1RHI3 4EJRA 5JZGC 1VBD2 1AR81 4RHV1 1B35A 1NG0A 1COV1 1VBB1 1BBT2 1RUF3 3M8LA 4WM8C 1AYM2 1ND3C 1PGW1 2BFUL 4PDWC 4QPGC 2R061 2MEV3 2RMU3 5BNNA 2HWD1 2RS33 1QJX2 1EAH2 1RUH3 2RS53 4CDXA 3VBRC 1RUC3 5FMOL 4CDQC 2RR12 4RS5C 5K0UA 4FTBA 4WM7B 4NWWA 1V9U2 4RQPC 1RMU2 1PO23 3JB4C 3TN91 1MQTB 4YVWB 5A33B 3ZFGB 4Y4YA 1QJX1 1CD3G 1VRH3 2R071 4QPIC 1EAH1 3JBG1 4Q4Y2 1QQP3 4CDUA 1RUE2 1C8M3 4AEDC 1RUD2 1D4M3 1OOPA 1AR71 1QJY3 4YVSB 4FTSA 4Q4V3 1RUG3 5C4WB 4CDWA 2RR11 1NY72 4JGYB 4Y5Z0 1F8VA 4FSJA 1RUI3 1RMU1 3VDDC 3DPRC 1RVF2 3NAPB 1R081 5BNOC 1K5MB 5C9AB 1ASJ2 5D8AA 3VBFB 4Q4Y1 1H8TB 1ND2B 1BEV2 2DF7A 1H8TA 1RUE1 3VBOA 3VBUC 3JD72 1RUD1 1NOVA 4RR3B 1HXS3 4RR3A 1FOD1 4GB32 5L7OA 1ZBE3 2WS93 4JGZC 1NY71 1HRV2 3J8F2 2XBO2 1AL23 1GFF2 1HQNA 3S6PA 3ZFFC 4BCUA 1RVF1 3CJIB 1EV11 2HWC3 2PLV2 4Q4X1 1NA1A 5CFDB 1W39A 4IV3B 1BEV1 5ACA2 3JD71 1FPN3 1TME1 2X5IA 4GB31 4GH4C 2Y26A 4CEWC 1HRV1 2HWE3 2HWF1 1NCQA 3J8F1 4CEYC 5C8CC 3VBHB 2GH8A 2BPA2 4N53C 5ABJB 2PLV1 4RHV2 1Z7S1 4IV1B 1QJU1 3ZXAC 1PO12 5AC93 1OPOA 1X33A 1OHFA 5ACA1 1AR62 3VBSC 2WZR3 5BNPA 1AYN2 1PIV3 1R093 1NCRC 1PVC3 2WFF3 4Z92B 1HRI1 2RS32 4NWVA 1RHI1 5JZGB 1FMD3 1RUC2 1AR93 1PO11 1VAKA 4N43B 4N43A 2HWB3 1AR61 1R1A2 1RUF1 1VBA3 4WM8B 1AYN1 2R043 1ND3B 1POV1 1IHMA 3ZFEC 1M06G 4PDWB 3TN92 4QPGB 2ZZQA 2RS31 2R072 1RUH1 3JBG2 2RS51 1B35C 3VBRB 1RUC1 1COV3 1AR72 1TMF2 4CDQB 1VBB3 4RS5B 1R1A1 4WM7A 1F2NA 2BFUS 4RQPB 2R063 5BNNC 1PGL2 1MQTA 4YVWA 5A33A 1R082 2HWD3 3ZFGA 1VRH1 4CDXC 1DDLA 4QPIB 1VBD3 2TBVA 4AEDB 5FMOS 1D4M1 1TMF1 1FOD2 4Q4V1 1RUG1 4YVSA 5K0UC 5C4WA 2WLPA 1BBT3 4JGYA 5J96B 1AYM3 3VDDB 3DPRB 1EV12 1PGL1 4Q4X2 3NAPA 4CDUC 2GSYA 5BNOB 1QJX3 1EAH3 1K5MA 5C9AA 2RS12 3VBFA 1ND2A 2RM22 1OOPC 3VBUB 2VQ0A 1FPN2 1TME2 1HXS1 1VBC2 4CDWC 5DDJ2 1ZBE1 2WS91 1ZBA2 3IDEA 4JGZB 2HWF2 1V9U3 1RUJ2 1RMU3 3ZFFB 3HAGA 3CJIA 1POV0 5D8AC 1Z7S2 5CFDA 1QJU2 4Q4Y3 4IV3A 2RS11 3VBOC 1RUE3 2RM21 1MEC2 1RUD3 5L7OC 1FPN1 1VBC1 4GMP1 5DDJ1 4GH4B 1ZBA1 2HWE1 4CEWB 5CFCB 1VBE2 5CFCA 4CEYB 5C8CB 1HRI2 1RUJ1 4CEYA 3VBHA 1RHI2 1RVF3 2FZ2A 1NA1C 2BBVA 4N53B 4Q4W3 1C8NA 5ABJA 1ASJ3 1BEV3 4IV1A 2X5IC 1MEC1 3JD73 1RUF2 3VBSB 4GB33 3LOBA 1PIV1 1BMV2 1NCQC 1NCRB 2MEV2 2RMU2 1HRV3 3J8F3 1VBE1 2XBO3 1VB4A 1RUH2 2RS52 2PLV3 5JZGA 5A32B 3JB8A 5BNPC 4RFT0 5ACA3 1VBA1 5GKAC 5LK7B 4WM8A 1BMV1 1PO22 3ZFEB 1ND3A 2MEV1 2RMU1 4PDWA 4QPGA 1VRH2 1QQP2 1C8M2 1A6CA 1AR83 1B35B 4RHV3 1VB2A 1D4M2 3VBRA 1QJY2 1PO13 4Q4V2 1RUG2 4N43C 4CDQA 1AR63 4RS5A 1AYN3 1RUI2 1POV3 1PO21 4RQPA 5BNNB 2BUKA 4GMP0 4CDXB 1QQP1 4QPIA 1C8M1 1VBD1 4AEDA 1HXS2 1QJY1 1ZBE2 5K0UB 2WS92 1BBT1 1R1A3 4WM7C 1RUI1 1AYM1 1AL22 1MQTC 4YVWC 4SBVA 3TN93 2HWC2 1HX6A 3VDDA 4LLFA 3DPRA 3ZFGC 1QJZA 4CDUB 2R073 5BNOA 3JBG3 2IZWA 2QQPA 1RB8G 1OOPB 3VBUA 4YVSC 1AR73 1TMF3 5C4WC 4CDWB 1AUYA 2RR13 5FOJB 4JGYC 2HWE2 4JGZA 1V9U1 1AL21 1AL0G 3ZFFA 3NAPC 2HWC1 4Q4W2 1R083 1K5MC 5D8AB 5C9AC 2ZTNA 3VBFC 1E57A 1H8TC 1ND2C 5AC92 3VBOB 4RR3C 2WZR2 5L7OB 1FOD3 1PIV2 1R092 1PVC2 2WFF2 4GH4A 5J98B 4CEWA 2WWSA 5C8CA 3CJIC 1EV13 1NA1B 4Q4X3 4Q4W1 5CFDC 1FMD2 4N53A 1AR92 4IV3C 1ASJ1 2RS13 3FBMA 5AC91 4FTEA 2RM23 1SMVA 2HWB2 2X5IB 2WZR1 1TME3 1VBC3 1VBA2 2FZ1A 3VBSA 4GMP3 2R042 5DDJ3 1R091 1PVC1 1ZBA3 2WFF1 1NCQB 5CFCC 1NCRA 2HWF3 1RUJ3 3VBHC 2XBO1 1WCDJ 2ZAHA 1CJDA 5ABJC 1AR82 1Z7S3 1FMD1 1COV2 1AR91 4IV1C 1QJU3 5A32A 1VBB2 2XPJA 1X36A 5BNPB 1MEC3 2HWB1 2R041 1PGW2 2R062 3ZFEA
chains in the Genus database with same CATH superfamily
4D8MA 2OUHA 5L73A 1W3XA 3U37A 1Y3TA 1HRI3 5T5JA 3BU7A 4BK5A 2QQNA 3WT3A 1LU1A 3MZHA 3J9SA 2JECA 4H3WA 4MV2A 4ISRA 4XUOA 4RHV1 1VIWB 1J3QA 4AFAA 4E8CA 2IXKA 1WW5A 4W65A 2CSGA 4PLMA 5FZAA 4CP0A 3N4MA 1LGCA 1UU5A 4XQ4A 3ZXFA 3AYDA 1QY4A 3RZJA 4UF0A 5DAWA 1ND3C 1PGW1 2FD8A 2OIIA 3HN1A 1W05A 4QPGC 4AGRA 5IVJA 4DXSA 4IETA 4E2SA 4IEQA 2VMEA 4XFBA 1GR3A 3ZXEA 2J1TA 1IPJA 2WC2A 1UKRA 1ULCA 1UMZA 3LCPA 3MI8A 1DZTA 4YW3A 5FK8A 2E32A 2CYFA 3VBRC 1WA6X 4M0HA 2Z4FA 3OOXA 1RUC3 2JDAA 4PI2A 4CDQC 2PHLA 1W9FA 2YMZA 4KWUA 3PDQA 5I8SA 4GQ7A 2WBKA 1O4YA 3PVNA 4RN5A 4RS5C 5AVAA 5K0UA 3D0SA 1I5ZA 5FP9A 4BM8A 2E7AA 4IXLA 3ZXJA 4WM7B 4MXVA 1V9U2 3EJKA 1XE8A 3AX4A 2W95A 4LK7A 1OVSA 4IW3A 4ZS3A 3K3OA 3NKGA 4DPNA 3IPVB 2D98A 3NJXA 4LOSA 3E97A 3HNMA 4O9GA 4Y4YA 5FYSA 5IUQA 3ZFGB 1CD3G 1S0EA 2R071 4QPIC 1EAH1 1EPWA 3MIEA 1QQP3 1OC1A 4FVVA 4ZY9A 2GALA 1C8M3 1GU3A 3O12A 3WF4A 4AEDC 4R8HA 4RFRB 3VKNA 2SBAA 2ZAAA 1PGSA 4YZ3A 1D4M3 1XSRA 4N90A 1OOPA 1AR71 1CESA 2BW8A 4YVSB 3LF7A 3WP6A 4FTSA 5C4WB 5FPLA 4CDWA 5FZKA 4FAHA 1JU4A 4OULA 1F5FA 4HXCA 2KXLA 4JGYB 3OSDA 4XUQA 1F15A 5FPBA 1YNAA 1EP0A 1GP5A 2YU1A 1YQCA 3A23A 2XJVA 4FSJA 1F8VA 3ILFA 3VD4A 5LRRA 5H9PA 1LOFA 3AMPA 3VDDC 1LHUA 5IK7A 1OPMA 3RMXA 4GIQA 3H3ZA 1GV9A 3NAPB 5KC5A 1S4CA 1R081 3RDIA 2ZBJA 5BNOC 1SPPA 2DYCA 1XNBA 5C9AB 5D8AA 2BNNA 1BLZA 1H8TB 1UU6A 2GNTA 2AH2A 3KM5A 4XVHA 3WDWA 1JS9A 2OS2A 4LKDA 1RUD1 2A5ZA 1HXS3 1SZBA 1MPXA 3AMNA 3VKMA 1ZBE3 3T0DA 2WS93 3LA7A 1U5YA 4WVMB 5T54A 3LE0A 3WG4A 1NY71 2EIGA 4LBQD 4J6GA 4AHYA 3BYWA 3I8TA 2BJSA 2P3JA 3IDCB 4DY5A 5CFCC 2XBO2 3S6PA 5KHIA 3VLBB 1XPWA 4LO5B 1PZ7A 2J1UA 3DXUA 4FPJA 1T6BX 3M1HA 1CPMA 2HWC3 3RI9A 4Q4X1 1NA1A 1RC6A 3MPPG 4AGVA 1ZZ8A 2A71A 5FZIA 1YUDA 5GLTA 3POIA 1BEV1 1KXGA 4Q1PA 3MLLA 4P5HA 4IQPA 4B4QA 1X7NA 3KSCA 4QQPA 5FY4A 1NX9A 2WUHA 4LHKA 4MOAA 3J26N 2OKXA 1I9RA 4ORFA 5L9BA 3I3DA 4GH4C 2Y26A 1UF2C 3RMYA 3FUOA 2EXJA 5CNAA 1SHWB 5GLWA 3WUDA 1W8HA 1LNSA 1X82A 4INDA 3NNJA 2BPA2 4M0NA 2R7EB 4MXWA 4BK4A 3VDBA 4M01A 4ZKTB 1CX4A 4N53C 5F2SA 3VD9A 1WLCA 3ZSKA 1PNFA 1UXXX 3LOIA 4I01A 5DMYA 2QQOA 2XVKA 4HPKA 2CAVA 3GCWA 4OMCA 4YLZA 4OQ9A 5J09A 5ACA1 3GALA 4JHZA 3IDBB 4M3CF 2DU1A 4AFDA 2B8MA 2I2SA 3OBZA 4XUNA 2WFF3 3AP5A 1CIYA 3ITQA 4AXOA 4QD2A 2JJ6A 1V6JA 3ACFA 2ZCWA 4BQ1A 3BVCA 2VZRA 4NWVA 5F3CA 1J3RA 3DYMA 1PMHX 3GZUC 1RXGA 4XJWA 1KDMA 2DCTA 2YY1A 3IMMA 3VGIA 3MICA 2P34A 1CQ9A 1UOGA 3AKRA 4OMDA 3M3OA 5I8TA 2X29A 1PO11 1W8OA 1W6MA 3UGFA 3WP3A 2WQ4A 4HSJA 2DDUA 1RUF1 1V6KA 1YYNA 1VBA3 1XNKA 3PUAA 2XJTA 2R043 5C3PA 5FY5A 3AYCA 3W20A 2WT2A 1POV1 1IHMA 4NPLA 2VMIA 2Q1MA 2VQAA 1W90A 2WZPP 3HT1A 2VULA 4XIOA 3WDUA 4BXFA 4C0BA 5B4XA 5A70A 2RS31 3JBG2 2KM2A 2RS51 2Y8KA 2DBIA 3U4SA 1XRUA 4RGKA 5EJ3A 4K7JA 1D2QA 2OZ6A 3BN6A 2YC2A 3MGUA 1COV3 2NP0A 4JV4A 1TMF2 5EP9A 3WW1A 3OGJA 4BQXA 2ZHMA 3GBWA 2ZX2A 3D0JA 1I6XA 4B4RA 5FZMA 3OGVA 1F2NA 2WWUA 2EXIA 4Y22A 1JOPA 2JD4A 1AF9A 1JUHA 1H1MA 1LHOA 1E5SA 1MQTA 3EB7A 3IKWA 5A33A 4XTPA 2GMPA 4A44A 1NAEA 1BCXA 2TEPA 5FYYA 5AFBA 1SDWA 1W8WA 4ATFA 2TBVA 4PHZA 3SKVA 1SLLA 3LDRA 2QKDA 2WNVB 4YG6A 4IERA 4WVVA 3R05A 4XUPA 1PM7A 1FOD2 1OKOA 5FY8A 1CZTA 4I02A 5K0UC 2JWPA 2RDSA 3NRUA 4CCKA 1OH3A 5H9QA 2LS6A 2ZEXA 3LEMA 3ZYGA 2RG4A 5FZ6A 4DZGA 3ZPYA 5J96B 2C4XA 4H7LA 5CG8A 4Y1VA 1V6MA 2YXSA 5FZ7A 3OPZA 4UI9L 4X8NA 5FOBB 1IOAA 2VL4A 3AJYA 4RD7A 4D6RA 5I0SA 1REFA 2QJVA 2GSYA 5DAXA 2Q8CA 5T3NA 2A70A 1K5MA 1XYPA 2BBAA 1KFUL 3MF9A 5FPVA 1QOOA 3NV4A 1V00A 2IXIA 5HCFA 3TB0A 4YZ2A 3KCXA 4YM0A 4K8FA 1H9PA 1UXZA 4A4AA 1OOPC 1K3IA 3VBUB 5KC6A 2VQ0A 1FPN2 2CGNA 1TME2 2ZGQA 4CA9A 3VUOA 4CDWC 3K75B 3OUIA 2JDUA 1W8ZA 5GZDA 4MGZE 4ZONA 3BODA 3HQRA 1YFWA 3M3EA 1V9U3 4Y1ZA 3SQOA 3N9LA 1OSGA 3GYDA 4ZZ8A 3ZFFB 1ODMA 2OQ7A 2XOMA 3BTAA 4QDQA 4FPHA 2EIDA 1Z7S2 5D8AC 4KI5M 4AW7A 4CP9A 5L9VA 4H14A 4EWAA 4IL7A 5ERLA 5EXOA 2VTXJ 2XWJB 4JQRA 4FP2A 4DUXA 2RM21 2JEMA 3PUSA 3H0OA 3ZN5A 1NKGA 2RDNA 1VBC1 1W9TA 5DDJ1 3BOWA 4FBFA 3GGLA 1ZBA1 4CEWB 2WQ8A 1JZ5A 1VJ2A 3A7QA 3AKSA 4QX0A 4LORA 4CEYB 3W5MA 4LHSA 4NMIA 4UFLA 3U78A 5BXXA 1BK1A 4LBNA 3UETA 5GLVA 1NA1C 2BBVA 2ARXA 1Q56A 1C8NA 2BWAA 2VMCA 4P5YA 1W0NA 5ABJA 5FPXA 3H8XA 4LXLA 4FFFA 3C8XA 5FUNA 4KBBA 2VJXA 3TEXA 2EICA 5T5LA 1KQRA 3RI8A 1S2BA 4HK8A 1NQDA 3PTYA 3JU9A 1V6LA 3Q8CA 1W03A 1IS5A 4OCTA 4DXRA 1BMV2 1S0IA 4NHKA 1IGOA 1NCRB 3ES1A 1DGWX 2JD9A 2MEV2 2RMU2 3UK9A 2XONA 1KJLA 2EALA 3WNNA 2XBO3 2VVEA 5FJHA 3Q8AA 2UWAA 1O4ZA 4QB1A 1ZX5A 1LENA 5B2GB 4IEUA 4QKFA 3ZKYA 3ZSEA 4X8PA 1FATA 5C5TA 3OYWA 1Q8PA 1MVQA 4LBMA 3HMYA 1NZCA 4RFT0 3IB3A 4X6RB 3LGRA 2PMWB 1KS4A 4A3ZA 1DYOA 3NV1A 5JI7A 2GN3A 2ZGMA 3WV6A 2WO1A 3ENRA 3LDKA 3DKWA 3ZFEB 1W06A 3C7FA 3T30A 2R6QA 3PUIA 4FPFA 4XF1A 4E4ZA 3THTA 2OPWA 3I2OA 3HJRA 1VRH2 3USUA 3ASIA 3B5LB 1WA4A 1DQ2A 2D3PA 2OXBA 4MLOA 5HCHA 1A6CA 2VMDA 2YG0A 4HBNA 5FIXA 3URFA 2VM9A 3AL5A 5FJKA 4AVTA 5K7PA 1YC61 4AHXA 5C3RA 3BIWE 3NVCA 5FP3A 1FXZA 1GLHA 3N9MA 5FYUA 2JG8A 2XWBB 3OG2A 4TN7A 1VP6A 3AP6A 1Z78A 3OGGA 1OURA 1PO21 2XLAA 3KT1A 3PL0A 1MZFA 4RL7A 1LTEA 3DGTA 4S2HA 3JCIA 3K3NA 2QQUA 2WN3A 3AK0A 3T2OA 3OD4A 4XILA 3IT8A 3WW2A 4AI1A 2EAAA 1VBD1 3S5QA 2GP3A 4NRQA 3MUZ1 1J3PA 3OGRA 4CTEA 1QJY1 4XXPA 2ADEA 1R1ZA 1XQNA 4ZXKA 2GC1A 2QZ3A 2ZXQA 3EO6A 4HKWA 4OUMA 5FREA 2GU9A 4MZUA 2AENA 5A7WA 3HD8B 1RUI1 3POBA 2E63A 3RZKA 4R9DA 3WG3A 1HIXA 1MQTC 2VXJA 2YUEA 4L2NA 5JPMB 1Q8VA 2A7AA 1HX6A 4XZUG 3DPRA 3C7OA 1JZ2A 3I49A 5FZOA 1WW4A 3CLPA 1N1VA 3JBG3 4AHZA 2IZWA 1NQJA 1ST8A 4NIIA 4P9LA 3W21A 3TAYA 3OEAA 2P1BA 3KV9A 4Y1YA 1TMF3 1ZRIA 3RWNA 3KQ4B 3H42B 1AXZA 1AUYA 4KQ7A 4YZ4A 4LT5A 2RR13 1SLAA 5CZKA 2W5FA 2HWE2 3UJQA 4JGZA 3V65A 3C7EA 1FV2A 2A6WA 5IAXA 4HN0A 1C28A 1STMA 3OPTA 4PLNA 4QX2A 4XIKA 2I45A 2DCZA 4Q4W2 4AEKA 4ZZ5A 2HEYF 1O3QA 1UZWA 1WUVA 1K5MC 3I7DA 1LHNA 3OEBA 2BOIA 4XF4A 2QQLA 4UXAA 3UT0A 1GOHA 4NR1A 4XW3A 2Q1ZB 4KGQA 4RR3C 2LALA 2B9VA 5AFEA 3CEWA 4IGPA 1FOD3 3HBKA 5D2AA 1PIV2 1R092 4XMAA 1PVC2 1NLSA 1ENSA 3SISA 1JI6A 2AZ5A 5D21A 1LGBA 5CKQA 2R0HA 5JXJA 4IUGA 3QACA 2UY9A 5C8CA 5ISLA 2QCSB 3H3UA 2NN8A 3I2JA 4EROA 1LHWA 3HNBM 1KEXA 2P6HA 2QQKA 3N7MA 3SMHA 5J7MA 1CAVA 4ZPIA 4BU2A 4NJ4A 1W2NA 1S0JA 2D6MA 1OUXA 3PUHA 4BQ5A 3V0AB 4YYOA 5T5OA 2VH9A 3BPSA 2O8QA 2WZR1 1FNYA 1TME3 4D0QA 5E16A 3VBSA 4Y20B 5JXGA 3ZSMA 2GZWA 1N1YA 5F5AA 3TEZA 3LD8A 2G9GA 4LR4A 4N7IA 4XXAA 2QDNA 3DCQA 2WAOA 5F2WA 4Y4RA 2J1VA 4B1LA 4IEVA 1UZZA 1WCDJ 2YV8A 5FO9B 1MS3A 3R4DB 4DEVA 3RYPA 5ABJC 3FHIB 4XHBA 4XAAA 5DG2A 2XMLA 1GNHA 1Z7S3 4E2GA 5CKNA 2F4LA 1AR91 3V0BB 4MYEA 2QQMA 1RTVA 1TNFA 2VOXA 4COWA 3JZVA 5A7PA 3AC0A 1F35A 2HWB1 2ID4A 2OUJA 3FLTA 3S30A 4GULA 3UGGA 2B45X 2GP5A 3QBQA 4OI2A 5I8YA 1PGW2 3ZO0B 1ZRDA 4F8AA 4Q8LA 5M0TA 1PVXA 4X6QB 2E53A 1IG3A 1N3QA 3WF1A 1O8SA 4Y3OA 3C3VA 3NV3A 1VLNA 4LIVA 5GZEA 2XB6C 3I3MA 4IGQA 2NM1A 2ZA9A 3ZYBA 4UBGA 4EJRA 1OUSA 4PQQA 3E6CC 5H9RA 1AR81 4UAPA 2VZSA 1B35A 2OPKA 3MYXA 2YC0A 3P5BA 4XDQA 4BIOA 1VBB1 1REEA 4CUAA 2LUWA 4J25A 4Q27A 3ORJA 2VTXA 2CWMA 3THCA 5HV4A 3AKPA 2PHUA 4TSVA 1AYM2 2UWCA 3CDZB 1W28A 2R061 2MEV3 2RMU3 3PLQA 1YI7A 5GLUA 1UYZA 4NPRA 1W6OB 2K2SA 1CZSA 2Q30A 1CVNA 1FX5A 1EAH2 4QDSA 5CKMA 1S55A 5IK4A 5EYXA 3SC7X 5IFTA 4IEWA 4TLGA 2A3XA 1CPNA 1DQ0A 2WNUA 5JCTA 2KR2A 2DVFA 5FO8B 3WNLA 4K40A 4B8EA 1H4HA 2JG8C 3VD7A 1W0PA 1UZVA 4FTBA 1W8UA 4CP1A 4XF9A 4A41A 2ZHLA 3AZVA 2VGDA 3WQBA 1XE0A 2B4KA 4N9IA 4URTA 3TN91 1OLQA 4PIXA 4GKYA 3CMGA 3MFAA 3FE5A 3F2ZA 4UW3A 2K9ZA 2CDOA 1VRH3 2WO3A 1NXD1 4CDUA 4B3NA 2J1EA 4C90A 3ILRA 4YM1A 1PZ8A 2F4PA 4O7XA 4PBOA 2A3YA 5J3UA 1RUD2 2EAKA 3HT2A 4LOTA 5FXZA 1G9FA 1UMIA 4GZ9A 5C33A 3VHNA 5GJ6A 2H0VA 1NY72 2WFPA 3IN9A 4LBLA 1S0BA 4XURA 1JZ7A 1ONAA 4A42A 2I74A 2NMNA 2JDNA 1QKQA 2K0GA 3DPRC 5CVRA 1BHGA 1OFNA 1PM4A 2BDRA 4XQWA 2Q8DA 4AWDA 5LB6A 3GXUA 1RXFA 4Q4Y1 1BEV2 1H8TA 4LPLA 1GMMA 4LEJA 1LODA 4HL0A 5LA0A 4XMIA 5IK8A 2VZPA 3WCSA 5BYNA 4JGZC 4WVMA 1DF0A 4JRLA 3T1MA 4AEMA 4NAOA 4Q0UA 3ACHA 3VZMA 4BJ0A 2C5DA 4OVEA 2R16A 3PVEA 1GFF2 1HQNA 2WRAA 4G9SB 5JIAA 4NUBA 4BCUA 2PHRA 4S2DA 4JDMA 3QH6A 1GP6A 4OHZA 1HB4A 4FCAA 5T50A 5C6CA 3PHMA 4IV3B 3I3QA 1UNBA 1L7QA 3MIDA 4EWEA 2Y34A 4ISQA 3WNKA 1HKDA 3WDYA 1ZZ9A 4YWAA 5FMBA 4AGGA 5ACA2 2D97A 1AX0A 3K4DA 3JD71 2X5IA 2G1MA 1D0HA 4LMFA 2V5YA 2VMGA 2P37A 4FXKB 1GWLA 3WINE 4CXYA 2R32A 1LR5A 5IVBA 1H2MA 3AZWA 2WO7A 4TYSA 3AM2A 4XEZA 2XDVA 2HWE3 2HWF1 3O5SA 4QX3A 4UW6A 3J8F1 3NNFA 5C8CC 2VUAA 3VBHB 4AVCA 5GZCA 4V1PA 3ZN4A 1CAWB 1H0BA 1VRBA 3EBRA 4K3UA 2NYYA 3BTYA 2DVGA 3ETQA 4QU2A 3UYJA 4QQ2A 4IV1B 3ZIXA 1PO12 3PIGA 4QKNA 1W6NB 1WWYA 1K5JA 2IXCA 2Y0OA 4XAEA 2OYZA 3VBSC 1GICA 1G9AA 3IZOA 3KT7A 5C70A 3N7KA 1PIV3 1R093 3EQEA 3N36A 4A7KA 3MUY1 3ZR5A 1PVC3 3T2QA 3LFIA 1ZYBA 3D5OA 1UYXA 1RYYA 5FZ3A 2PA7A 4DXZA 4ES8A 2E7QA 1HRI1 4OFGA 1MZ5A 2RS32 3FC0A 5DABA 2YDEA 1RJ7A 2Y64A 3MV11 1Z0HA 5EZWA 3U10A 4NIAA 4J1WA 3W9AA 1O3SA 5FWEA 2VCMA 3QOPA 1JYIA 1MS9A 1G8WA 1REDA 4N43B 4YW6A 1V70A 2CNAA 3E5QA 2JIJA 2UWBA 5JMCA 1CAXB 4O9EA 3BCWA 2XQRA 1YJKA 1G9BA 2FDKA 5HCAA 5FDBA 1ND3B 1ZNPA 4BH9A 4PLOA 4XFGA 4ASMB 1LOEA 4ONUA 3KCCA 3AZYA 4QPGB 2ZZQA 4AEJA 2ZS6B 5DQ0A 2A6VA 3AP9A 5A3TA 3GDBA 3WP4A 4CRQA 1OKQA 3NJYA 4GALA 5F5IA 2VCBA 4TWTA 1Y9QA 1B35C 4BQWA 3VBRB 1RUC1 5FQ0A 2W3JA 4CDQB 1ZREA 2R30A 4AE2A 2G9ZA 4DMIA 4RS5B 3N9QA 5JAXA 1R1A1 4XFIA 3ZYPA 1A8DA 2SLIA 3FFZA 2BFUS 2HYXA 1UOBA 4LO8A 3HIFA 3ZXKA 4AOCA 1NLRA 1W6QA 2D6KA 2E31A 1WD4A 4YVWA 3ZSLA 2VW0A 4ITCA 1M4WA 1IPSA 3PJQA 5C3QA 1VMJA 1WMFA 2JB4A 4QPIB 3OB8A 4WZFA 4LHNA 2ZGRA 3Q8BA 4GWJA 4L11A 1Y7BA 3BTXA 4AEDB 1PK6A 3X29B 5FMOS 2WNUC 1J1TA 1D4M1 2WLQA 5JXHA 1Q5OA 2AR6A 3AFKA 2Y6LA 3NWKA 3NJVA 2ZEWA 4RGAA 3A4UA 1UW8A 3U07A 1PHMA 1XU1A 2XH6A 1FNZA 3V56A 1LB2A 5KXEA 1H2NA 5EJZB 1CONA 4N9HA 1AYM3 5F1RA 5F9TA 1J83A 3IIIA 4Z07A 2VNVA 3VDDB 3KD4A 1EV12 1AHSA 4CZSA 4CCCA 3PUQA 4QQHA 3O1MA 4UFHA 4CDUC 5BNOB 2X10A 1EAH3 4DB5A 2DFBA 3VBFA 1OLRA 1ND2A 2RM22 3N7LA 4D69A 1E5IA 4DRVA 1GZ9A 5FR3A 5F39A 5FY7A 1VBC2 1HXS1 3W5NA 4BYYA 1GBGA 1QJFA 4Y24A 5DDJ2 1ZBE1 4K6BA 3RS6A 3UKNA 3POJA 4BMEA 2WS91 3CO2A 1ZBA2 2D93A 2QTWB 5EQUA 2ZGNA 3KS7A 4OHVA 1JXNA 4ATEA 1ULEA 2DUOA 3I2KA 4ARYA 1OFSA 3MEPA 5LATA 4K1YA 2XHNA 2ZGLA 5LW9A 1CAUB 5L9RA 1GP4A 4HFSA 3KT4A 4M3CB 5HPOA 2VAUA 2VW1A 3CJIA 2Q1FA 3MIFA 4KU7A 1LCLA 5FY1A 4KMQA 4LUMA 2EXHA 5CFDA 4MHRA 1GWMA 1QJU2 1DCSA 1LRHA 5G05L 5FZLA 1RUD3 1C1FA 4ZU4A 5A1LA 3CF6E 2XKPA 2RJ2A 1W9SA 5FO7B 4GH4B 5APAA 2JKBA 1CR7A 1YFUA 4BB3A 1RUJ1 4COUA 4CEYA 3H7JA 4TLFA 1ZZBA 3DYPA 5T5PA 3I2IA 5I91A 1RHI2 1X50A 3CKHA 3VZJA 1QEXA 3BOPA 4N53B 3K48A 2VOWA 3ROUA 3ST7A 1TNRA 4HANA 3WF0A 4XTMA 1NUKA 3O1PA 1BEV3 2PXJA 4IE6A 4F3JA 3CNAA 5LEJA 2X5IC 2CTVA 1KFXL 1MEC1 2EIBA 2WSVA 4QPYA 3SH4A 3D82A 2D5FA 4AVSA 4META 5FZ0A 5A6XA 3AP7A 3AVSA 1VBE1 4CE8A 3LIHA 3TOJA 1OQEA 1VB4A 1RUH2 3F95A 4LHLA 3RZHA 1LOCA 3N9NA 2Y6HA 2C9AA 1IQAA 3K46A 5JZGA 2W87A 3THDA 2ATFA 2BERA 3AXDA 5JIUA 1VPHA 4LNVA 3JB8A 4V2VA 2W52A 2ZKNA 2CGOA 5FZ8A 5ACA3 4QQOA 2IFWA 4AI0A 1VBA1 3ELNA 3OJBA 4WM8A 2A6XA 5A3MA 2LTNA 3P3NA 3D3AA 4AFMA 1PO22 4I0WB 4A2UA 4AVBA 2WN2A 3MW2A 4PDWA 2PHFA 3TNPB 3ZYIB 4BMBA 4YRDA 3VZKA 5H9SA 4FP3A 2D3SA 1KD7A 1VE0A 2OA2A 3KMHA 1W8FA 1N1SA 1QOTA 1VB2A 3LEIA 5A7NA 4E27A 3AVRA 1QJY2 5FY0A 2C26A 2JXAA 1PO13 4M4RA 5FCCA 4Q4V2 1ENRA 1RUG2 1MACA 4I0BA 4XFFA 2Y6JA 3CZJA 4OI4A 1C1LA 5SV8A 3TRSB 4BQ3A 4NN0A 2X09A 1H2KA 4UF0B 4QHZA 1UAIA 2YROA 3P6BA 1RUI2 3HNYM 4LTAA 3OY8A 3ZYRA 1POV3 4YSFA 4ZU7A 5KHKA 4RQPA 2VZOA 2BUKA 3E5XA 4GMP0 2NLRA 1SFPA 5A7OA 3E6DA 1IS3A 3KQRA 4UFIA 3BIEA 4HONA 2V5DA 1O8PA 2VNGA 1GZWA 2XVGA 3C7GA 4QHBA 1S2EA 1K12A 4FPOB 3CJXA 4JDOA 3N9OA 5K0UB 1BJQA 4YM2A 4COVA 4PCRA 3OBTA 2PAKA 1U12A 1JODA 1QHDA 2WINB 4P9YA 4QXCA 4XJ8A 2ZJCA 2WIIB 3LAGA 4LE3A 4YVWC 2XUEA 5IW0A 1O5UA 4LO6B 4Q0SA 1JU3A 4LBQA 1QJZA 5CAZA 2PTMA 1QIQA 1KRIA 2JDMA 2QQPA 1PK6C 3L2YA 4OQ8A 5IJRA 2KA3A 3GM8A 1OOPB 3O1SA 1GUIA 1OA3A 1C4RA 2VC9A 4CDWB 3N3HA 3ZKUA 3H8UA 1DGWA 2F17A 4W50A 4HN1A 4XE9A 3ZLIA 4A7YA 4YGEA 1V9U1 4KWKA 1LOFC 2AACA 5FYTA 3D6EA 1AL21 1XU2A 2BVBA 4HG6B 3ACLA 5JXIA 1GSLA 3NV2A 1SPPB 3U1XA 3WP5A 5D8AB 3VBFC 4MGTA 4JDNA 1E57A 1ND2C 4QB6A 1MR5A 1SEFA 2MPFA 2WT0A 5FPAA 1HN0A 5FZFA 2JG9A 3C7HA 5JSRA 3ME2A 3APBA 2WZR2 2JICA 1GZTA 1G9CA 3K77A 4IDZA 3LFMA 2PFWA 2DTWA 2NZ9A 2AYHA 2BGCA 1LOGA 2XUMA 4FOVA 5IVYA 3KV4A 1QNWA 4IGOA 4JHTA 4XQDA 1ZRFA 4W6XA 1X8EA 3AXEA 2VBPA 3KGZA 1W04A 1UX6A 3CJIC 5I0TA 4BDVB 5J1XA 1EV13 5HI0A 1NA1B 3OCPA 5A3NA 5CFDC 4LKSA 5F3EA 2E6VA 1AR92 5FZDA 2VVDA 4C91A 4AQTA 5AC91 1C5HA 3H9AA 1N3OA 2RM23 3T4HB 5JOYA 4LE4A 2HWB2 2PQSA 4OI0A 3LA3A 1VBC3 3GBGA 5FZ4A 2D7FA 5DDJ3 4P9GA 3RZMA 4XBLA 3RQ0A 1OD3A 5E88A 5KXCA 5A3OA 1ZBA3 1HB1A 2RDQA 1AVBA 3MO4A 2HBTA 2J22A 5KHHA 1W9WA 3UESA 2XBO1 2NQYA 4MXWB 1CJDA 2G4IA 1UQXA 2Z42A 2RE9A 2ZHKA 3LIGA 1TEIA 4Q8KA 5A1FA 1DGLA 2FMDA 3QH7A 2ZX0A 1Q8QA 2E9QA 1AR82 1ULDA 4OUSA 1FMD1 3B7MA 5IK5A 1OI6A 1RL3A 2JDZA 5E8AA 1QJU3 5G04L 4HPKB 3U4XA 3HOBA 5A32A 1VBB2 5LCWL 3POEA 1X36A 2VZ3A 3EXUA 4KG0A 3GBFA 2YZ4A 4KU8A 2ZGKA 4D6QA 3DEMA 5FK7A 1O7FA 2JDYA 3GF6A 3K51A 2R062 3ZXDA 2ET7A 5LK5A 3SLIA 1SBEA 1HW5A 1S0DA 3RZLA 3NKTA 3KZ4C 4EN9B 4F83A 1RHI3 2B9UA 4P02B 4Q29A 4RSUA 4DIQA 5JZGC 3DXTA 1UL9A 1XNTA 2WNEA 4NRPA 1OQ1A 1WGPA 2ZHNA 2ADDA 4QX5A 1NG0A 4XUTA 4HKLA 3WW3A 1W2TA 4H55A 4HMZA 4R52A 2CHHA 1WLDA 3V64A 2RVAA 1HJGA 4I3GA 1F9KA 4SLIA 1BBT2 3IMNA 2VCCA 1YWKA 4WM8C 4BA6A 1W99A 3WW4A 1QNYA 5DXDA 4K20A 3T0BA 4XBNA 2BFUL 4NIGA 1JYWA 1YRZA 2D6LX 4PDWC 4S2GA 1DYPA 2VR4A 3TWIA 5FZBA 5BNNA 3Q8FA 2CY6A 3PTRB 4Z2WA 2HWD1 4JX0A 1LOAA 1W8NA 2VOVA 4QHOA 5BUVA 1RUH3 2UY8A 4CDXA 2XKOA 1XE7A 4E4HA 4WZCA 2LROA 3RYKA 4QT6A 5FMOL 1XXNA 4WVZA 3OUHA 4YW4A 4MUVA 1WCUA 4ZHNA 5I0UA 4Y22B 2C6SA 4RQPC 2ZX1A 4EE2A 1PO23 1GQPA 1MQTB 4P9XA 1D2SA 5A33B 2PELA 3MW3A 3WCRA 1MZEA 5C3SA 1QJX1 4GWMA 4HLTA 3JBG1 4Q4Y2 2VY0A 1UD1A 1SLIA 2YPDA 3M70A 3PIJA 3AL6A 3KLSA 1QJY3 1PX4A 4Q4V3 1RUG3 4YG0A 1DQ6A 2RR11 2V4VA 4QMAA 4XJAA 2QDRA 1MS8A 1RGSA 4Y5Z0 1J84A 2B46X 3ZYFA 2PQQA 2W08A 1RUI3 3S5AA 1D7PM 2W94A 1RMU1 3WOGA 3QLQA 3TBDA 3SH3A 3AYEA 2J7MA 5K8SA 2ARCA 1A78A 4DY3A 3I4IA 3RRDA 2X8KA 3WHTA 4UBHA 3O14A 1K5MB 1JUIA 5A3PA 1ASJ2 5EV7A 1EY2A 4QXBA 5IAVA 1LU2A 1RUE1 3VBOA 3JD72 4RR3B 1FOD1 1V6NA 5L7OA 3BTZA 2OT7A 5KBFA 2YGMA 2WYSA 1ZZ6A 2WJSA 1APNA 1RITA 1J1LA 4Q1RA 1DHKB 5C5UA 3J8F2 3IM0A 2VZVA 3J7HA 2R1DA 4XPVA 3BPZA 4BXSV 4CPBD 3WF3A 3O1OA 3ZXLA 3RNSA 3NNMA 1RVF1 2FDJA 1DP0A 4EZ4A 2D6OX 2QE3A 1F5JA 3MLJA 3WQ1A 3R6SA 4CP9B 2GC3A 2A3WA 3B94A 1W39A 3ALQA 1NYWA 3WHUA 1L3JA 1JZ8A 3IAQA 1W6PA 2JG9C 1OVPA 3LSEA 5A1AA 1GNZA 1YIFA 2LM3A 2D44A 2XR4A 3ZN6A 1U5XA 3D8CA 1FPN3 1TME1 2XVLA 4GB31 4MVTA 1I1EA 2YHJA 1HRV1 3LWCA 4JVAA 1NCQA 2RHPA 2X53S 4YW5A 4HKOA 3LA2A 5E6HA 3H1MA 3WR0A 4EWDA 1CAWA 4COZA 5ABJB 3ACGA 2PLV1 4RHV2 1Z7S1 2BOJA 3M3QA 3ZXAC 2P3IA 2D43A 4AQ2A 2WAAA 2BP6A 1OPOA 1X33A 3AMHA 4MH0E 1OHFA 1DLCA 5F3GA 3VD3A 1W6NA 2OZJA 4YM3A 3DECA 2WZR3 3FLRA 3PJYA 5BNPA 4E9KA 5FZHA 4KH9A 2XJPA 4E4SA 2RJKA 2YYOA 4KL1A 2ZZJA 4NPMA 2DFCA 3KF5A 4W6WA 4MO3M 4NIDA 1LHVA 3I54A 1LOBA 2WA4A 3R4SA 5HXMA 4CCEA 1PMIA 4URAA 5FKCA 2ARBA 3ZVXA 3B69A 1YIPA 4XDOA 1S0GA 5FYCA 1Q8SA 1RUC2 3OYWB 1AR93 5FY9A 4IE4A 2JDHA 2XLGA 1S1AA 4MGYE 5LA9A 3WDVA 3O0XA 4AK3A 2ILMA 4N43A 1TQ5A 2HWB3 1AR61 1R1A2 2FDGA 4GWNA 1TZOA 1LKNA 1AYN1 5DUUA 4ZS2A 5F6LB 1LECA 3ES4A 4R9BA 1FT9A 5LEKA 3L2HA 1GANA 1I5PA 4AR2A 4IEYA 3OTFA 4FFIA 3A22A 4H7MA 3USUB 5FXWA 2J1RA 2R072 3CQOA 5BY5A 1OH4A 4EN0A 5EFUA 1A34A 5BPXA 4FPYA 3WG1A 2BEOA 1Y43B 2AC1A 4CYDA 2WZEA 4QM9A 1AR72 2DCJA 3PNAA 4FQ4A 1VBB3 3IWZA 4B7EA 2JG8B 2B39A 4CCMA 1N47A 4BLIA 3GJBA 3PMSA 4HVOA 4WM7A 5JPNB 5JSOA 4LQRA 2RDRA 4GJYA 2R063 5BNNC 2O14A 5FLIA 4BLJA 2FCTA 2BGPA 1R082 5FYZA 3IPVA 3KB5A 4D7SA 1TVGA 3KHCA 2FMYA 3R0RA 3ZFGA 1VRH1 4B29A 4GAZA 4CDXC 1DDLA 4YGBA 3BALA 3KVBA 3WDTA 3VHRA 3VKOA 2N7GA 2XJRA 4CUCA 2B42B 3GHNA 1JHNA 4K8RB 1O4TA 1Q8OA 4YVSA 2VNRA 2YBKA 3BI3A 3TEYA 5C4WA 1ZRRA 2VZQA 1BBT3 1IKQA 3A0KA 5A7WB 4JGYA 2AUYA 1HQLA 1V6OA 2E33A 4NE9A 4FAGA 1UYYA 2TUNA 4L99A 2Q8OA 2JDKA 1JOBA 3DPRB 1PGL1 3LKJA 1ULGA 1P8JA 4Q4X2 2DURA 3NAPA 5FZOB 1XOYA 1S0CA 4CXXA 2VOTA 4HK9A 5FLJA 5C9AA 1ZA7A 2PHXA 4EYUA 2LRPA 2P2KA 3WVJA 5IVEA 2A6ZA 2W2IA 2D40A 1G86A 5BNQA 3HN3A 3ECQA 2PAEA 2YFUA 5F32A 1URXA 1OLMA 4CU7A 1OBNA 1WW7A 1US2A 3SITA 5HBAA 3ZR6A 3HEIA 3HVDA 3AMMA 3TNQA 1UOFA 1UU4A 3KV5A 4JGZB 5EPAA 4XDPA 3I2GA 4JKKA 1RUJ2 1Y4WA 2NMOA 4LIUA 5FKBA 3UKVA 5JI9A 5GM0A 4G4FA 4W4ZA 4D3WA 2HJIA 4PI0A 3VKLA 1AX2A 5IHRA 4UFJA 3OBRA 3H50A 2ZACA 4Q4Y3 4ARXA 2RS11 3VBOC 3VHOA 2CAUA 3BGAA 5J36A 1MEC2 5FXVA 4QGNA 5L7OC 3POWA 2BNMA 1BXHA 4GMP1 3WNXA 2Q4SA 4LJHA 4XABA 4DRRA 4HT1T 4PF1A 2H6BA 4A3XA 4MX3A 4FOWA 2HWE1 5CFCB 1VBE2 1YQ8A 2GNBA 2V4AA 4ZXEA 5C8CB 2FDIA 2OX0A 3WF2A 4NROA 1YHFA 3FLPA 5HV0A 5LBBA 4L97A 2FZ2A 2ORXA 3D4KA 4JAAA 1CAVB 2VUJA 4JZRA 4Q4W3 2ZGTA 4IEPA 1HLCA 4DQAA 2WKKA 3ABZA 1ASJ3 1XNAA 2WO2A 2G19A 2XL9A 2BTVC 3WUCA 4QX1A 1VR3A 2O1QA 1RUF2 2QUOA 2Y60A 3JD73 3VBSB 2O8OA 4BQ2A 3MDPA 5J48A 1QMJA 5D1IA 4UOJA 1PIV1 5FUIA 1AJOA 2FCVA 4K9SA 1NCQC 1WBLA 5IT6A 5LA1A 2V09A 2VE1A 3GZTB 2OW4A 3J8F3 2CV6A 3KCYA 4NHYA 2J42A 1LAJA 3IAPA 1LJ7A 1HQWA 2RS52 4ASKA 5FP4A 3C2UA 1SG3A 2V72A 4EN8B 2P6CA 3QD6A 4N8MA 5F6KA 4LO4B 4CCLA 4QDRA 1B09A 5BNPC 3GJAA 2F6BA 4Y1UA 1UPSA 3INAA 1W8TA 2YC4A 2WR9A 5GKAC 2VZUA 1QH6A 1HB2A 1VALA 2B5HA 3LQCA 1N3PA 3P1IA 4WV8A 2BWCA 3I59B 2VVFA 1O3RA 2GN7A 5JR2A 4TTGA 4BIFA 2DCKA 3LPGA 4PJYA 1SBFA 1PZ9A 2GMEA 1JTZX 4XFAA 1GNYA 1UYPA 2Y38A 1ZA4A 1WCQA 2GNMA 5FMDA 4MGKE 3U75A 1YCIA 4DXTA 1GOGA 3VHPA 2W46A 1B35B 1A3KA 2FBEA 4RHV3 4ZU5A 1L7RA 1DFQA 2HLEA 2WNOA 3T3YA 2JE9A 2BZDA 4N43C 3ZM8A 2VU9A 5CBLA 1O91A 2DWRA 3B9IA 3I97A 4L9BA 3WEZA 5JUVA 4M4PA 4BZ4A 2PHTA 2W0XA 4QAWA 1MS1A 3PVBB 3OD0A 4EQVA 3WXPA 1W3VA 3ZYJB 1RUNA 3WLUA 2QQJA 4JKLA 1F31A 5EYYA 5A7QA 3VDAA 3N7JA 5CEHA 4B4PA 1O3TA 4GA9A 4AI9A 1WMEA 1QQP1 4DNYA 3AYAA 3MFCA 1C8M1 4D94A 3O1TA 4JTNA 2WNUB 2WQZC 4Z1VA 2WNVA 2ZMLA 4U2AA 3SXWA 5I0DA 3FN9A 3I3EA 2Q8EA 4XCAA 1ULOA 4P08A 5LA2A 1JZ3A 1OXCA 1R1A3 4WM7C 5IVVA 5FP8A 1JYTA 1BVVA 5F3IA 5LZ6A 1AYM1 3NMBA 1AL22 4RA0A 4XETA 2VQUA 3SKJE 1GOFA 3VL9A 1MVEA 3LPFA 2CU5A 1XNDA 4LLFA 1H6XA 1ODNA 4QGLA 3ZFGC 1QU0A 2XXZA 5HXVA 5F5QA 4CDUB 2R073 4BHPA 1H8VA 1QDOA 1BKZA 1WLWA 4UW4A 4O61A 3ZDSA 4W6YA 3LZZA 2B7YA 5CA6A 1IKPA 2EXKA 2VO5A 3VBUA 4YVSC 1AR73 1UN1A 5C4WC 1GWKA 1NT0A 2XLFA 5K4LA 5FOJB 4I09A 4JGYC 2VMHA 1OLME 3WX5A 4CUGA 3W59A 3AZXA 3UL2A 2XL7A 2IVIB 2XHKA 1DIWA 4AYUA 3HQXA 4BQYA 4W8JA 4QXHA 2J1AA 3ZFFA 3NAPC 2HWC1 4DUVA 1R083 4IE7A 5C9AC 2ZTNA 3H3LA 4RGGA 3KF3A 3FHQA 3GCXA 1XBFA 1H8TC 2W39A 3CZUA 4M3CE 5A80A 1WBFA 3ZYHA 5AC92 3H7YA 3O1UA 2YBSA 5JSPA 4AAXA 2DV9A 5LBFA 4FPLA 4Q0VA 2GH2A 5C71A 5A3WA 3FUQA 2W68A 2VBBA 3NJZA 4XFHA 3VV1A 4OZXA 1DYKA 4AG4A 3KWVA 1E5HA 1CJPA 5LRSA 4Z82A 4CEWA 2WWSA 1KITA 5IATA 3DF0A 2O0OA 4JCKA 4D7YA 2ZEZA 2Z2SB 4Q4X3 4XF0A 2CGPA 2VUDA 1FMD2 3O0WA 3MPBA 3FFQA 1ZZCA 4BPZA 3JQWA 4FTEA 1DQ4A 1SMVA 3AB0A 4OI1A 2X5IB 3GZEA 3USSA 4CVUA 4AQ6A 4YW2A 3O0VA 1QXRA 2ENRA 3T2TA 1W2UA 3B3QE 4IESA 4LLOA 2YGLA 2WFF1 2X05A 1NCRA 1BZWA 3AP4A 3SCGA 1JOJA 5CB7A 1MS0A 4XHXA 5A6QA 1RUJ3 1XB9A 5KXBA 4QPWA 4LBKA 4JRAA 4R9CA 1YLLA 2DVDA 4OHYA 1OT5A 5FTTC 3GZAA 3SNMA 4BE3A 4OZOA 4BOWA 4I3PA 1W9YA 5JOXA 3DN7A 4XJZA 3LSDA 4AI8A 2XPJA 3EMRA 2GC0A 4Q5OA 2VPVA 1MEC3 5DAPA 5CU1A 4UYBA 4Y5TA 1W2AX 2R041 1EPZA 4LA2A 3U11A 3WY6A 3WD5A 1RINA 1DQ1A 2W9XA 2E7TA 1UY3A 3FMGA 3ZFEA 1JYCA 3B01A 1VBE3 4QKDA 1H1AA 2HWD2 4JC1A 1YXWA 5FYMA 1LEMA 4BQ4A 3CHXA 4DO0A 2LW8A 2P17A 5F37A 5IYYA 4YGDA 4AHWA 5A6ZA 1VBD2 3NO8A 2WDBA 2MNGA 2DVBA 2OQ6A 1COV1 4D6SA 1HJFA 1IPKA 4XYXA 2ZKLA 1AJKA 1FAYA 2XG3A 1VMHA 1CGPA 3RZZA 1IZ3A 2Y0IA 2P3YA 1GZCA 1RUF3 3A21A 1EYBA 2GNDA 3M8LA 3ZOIA 1SDDB 4C1XA 4YZ1A 2QZ2A 2BYVE 5FPUA 1UX7A 1NE6A 1HV1A 5CYYA 4PF5A 1S2KA 3ZPOA 4Q0QA 3T1LA 1NXMA 2RS33 1QJX2 2A1XA 2GAUA 4FPGA 4FT8A 1VAVA 4MGIE 2RS53 1DGRA 2ARAA 2GMMA 4DINB 2ET1A 4DEQA 3M2MA 4LBOA 2NPIA 5FQ0B 4CCJA 4YGCA 3ZXGA 5FBJA 5FPZA 4JTOA 3FX3A 4KWJA 5DUXA 3NSTA 2ZMKA 1POQA 2RR12 4CCNA 1YQ6A 4UW5A 3RWKX 4QWNA 4XACA 2HKXA 2Q5TA 1UIKA 4NWWA 1DU3D 1SLCA 3NNGA 2JE8A 1RMU2 1OF4A 5F7UA 2W1UA 1W6QB 3JB4C 1H2LA 4YVWB 1NLQA 1QF3A 2HEVF 1JBCA 1WLTA 2WYFA 3S57A 2PYTA 2VNOA 3E6BA 5E89A 3RFRA 4CP2A 1OQDA 2HBUA 1XSQA 4XBQA 1XYOA 4LULA 1TG7A 5KHGA 4CCOA 1AX1A 1RUE2 2C24A 1PK6B 3EYPA 4LA3A 1QXJA 2VECA 4RYDA 2WNVC 4AL9A 3NNLA 5CG9A 3RJ2X 3ZMOA 1BVP1 1UPIA 2IC1A 2IXLA 2ZMNA 4GD4A 3ZIWA 1ZRCA 4P00B 2L9LA 3CBNA 5TSWA 2W92A 3MIHA 4YFZA 4DFSA 3T2PA 4YPJA 5JOZA 4I30A 5CISA 1RVF2 2W47A 1AXYA 3POYA 5LBCA 4EV0A 1CX1A 3LDBA 3EHKA 1G9DA 4AQSA 3N9PA 2A6YA 2FDHA 1ULPA 4XZPA 3VBFB 3POFA 1ND2B 4QM8A 2DF7A 2UYBA 5LY1A 1N1TA 4FPEA 2ZGOA 4FOYA 3VBUC 3VDCA 1NOVA 2QQIA 4RR3A 1YI9A 4GB32 1UY2A 5JVVA 1H9WA 4NHMA 1H1IA 3DV8A 2VZ1A 1GQHA 4IE0A 1DZQA 1HRV2 1SQ4A 3UKTA 1ZZ7A 1AL23 3ZFFC 3B00A 1L7LA 3ILNA 3CJIB 4UFMA 1BYHA 1EV11 2H0BA 5DUVA 2PLV2 3G7DA 1ENXA 1QGLA 5CFDB 2VOKA 2QQVA 5LY2A 1ENQA 3GNEA 2FDFA 1GYKA 1UY4A 2HYKA 2Q0AA 3M3IA 1K45A 3MLKA 4FI9A 3PMEA 2IXJA 4Q26A 5FYBA 3CIHA 5A3LA 5KR7A 3V0AA 4B1MA 1AXKA 1U0AA 5EWSA 3T09A 4R4ZA 4Q2FA 2PAMA 3K2OA 4Y20A 2A73B 4IE5A 1FV3A 4CEWC 1SLBA 4P9IA 3DKQA 3KGLA 2R49A 2ORZA 5FFOC 1UOJA 1XJAA 1XC6A 4CEYC 4DOUA 1XYNA 3E1F1 2GH8A 4Z2AA 2W91A 2VUCA 1BK0A 4TXWA 3BU0A 1VMFA 3IDAA 2AEZA 1QH7A 1W2OA 2Z69A 5JDBA 5KHJA 3OUJA 4LK6A 4NHLA 4COYA 1QJU1 1OMIA 2D6NA 2G9FA 4UWDA 5AC93 3TEWA 3V0BA 4HVQA 3POGA 4A6OA 1AR62 4MSVA 5GLZA 3RG0A 4L8QA 2E51A 1AYN2 4HOOA 4KBZA 5JLVA 1EUUA 1UZYA 1WD3A 1NCRC 5CIRA 4A6SA 1PMJX 5FZGA 4Z92B 2ZGUA 3B93A 1H4GA 3ZSJA 4N7UA 1RHI1 4YW1A 5JZGB 2BRTA 1FMD3 2W1SA 2VD7A 5GZFA 2YB7A 4GKXA 1QJEA 4QX8A 1W6MB 1VAKA 1S0FA 2JE7A 1DGRN 1GQGA 2QQWA 1DBNA 2DUQA 2FCUA 4PBPA 3PURA 4TZDA 3FL7A 2YU2A 3OF1A 4WM8B 3UJOA 2WT1A 3BKZA 4BWOA 1DZRA 1WZXA 3ZFEC 1M06G 4PDWB 3TN92 2P4EA 3M3CA 5B4NA 2ZX3A 1SCRA 4LUKA 4AAPA 1QOSA 1JMUB 1CWPA 5FZEA 5FAXA 1W6OA 1JW6A 1RUH1 3AZZA 5FXXA 3S0MA 4EZHA 3N35A 2ZX4A 5L19A 4NRMA 2JB8A 1PX3A 4LITA 5DAVA 3ACIA 2JKXA 3OGSA 4R9AA 3M4FA 3RZGA 2DVAA 2Y33A 1LESA 2VXRA 5JWPA 1K42A 3R4UA 3MHZA 3OY8B 2QFEA 4IEZA 3VB9A 4MGSA 3WZ1A 3UGHA 4RQPB 1HB3A 2AEYA 2BV4A 2HH9A 3LEKA 1PGL2 5DPNA 2TNFA 1TE1B 1ZVFA 2HWD3 2DTYA 2JX9A 3J7NA 3J7MA 3L9JT 4XJ9A 4AVVA 3H8RA 3W58A 4DS0A 2VTFA 2JIGA 3NW4A 2BNOA 4HZFA 3FZ3A 5FMCA 2VCAA 3VD5A 2WWJA 1HN1A 2Y6FA 1VBD3 4IEOA 1GZWB 4YW7A 3AKTA 3T0AA 4KGGA 2WA3A 2ZGSA 1QDCA 1JHJA 2Y6KA 4Y1XA 1TMF1 4R4XA 1RUOA 5L36A 4Q4V1 1RUG1 2IWGB 2OVUA 2ZGPA 1SBDA 2WLPA 2DCYA 4JQTA 5LASA 2XGXA 5SV5A 3POSA 4UFKA 4CCDA 5FV3A 3I2DA 2W1WA 4ASLA 4JKMA 3B9CA 4LBQB 5E1RA 3MIGA 5K9YA 3GHMA 2FQPA 2PN5A 4YG3A 4Y26A 1O5LA 1IS4A 1QJX3 2ERFA 1Q43A 1V0AA 2RS12 2IUWA 3LB9A 4OUEA 3UNPA 2P5BA 3O1RA 1JZ4A 4OHXA 2AREA 2D5HA 3HBZA 4CU6A 1CIWA 2ETEA 1LEDA 1WMXA 1JYNA 3THPA 4AFCA 4YNIA 2VMFA 5EJ1B 3M7AA 1ULFA 1C3HA 4HETA 3IDEA 3LEGA 2VW2A 2HWF2 1O59A 4FOQA 2R1BA 5JMOA 4OHWA 4NOTA 3FBYA 4C1WA 4FQZA 1RMU3 2YPJA 3MF6A 3HQUA 3HAGA 1OA2A 1POV0 1EUTA 4Z8BA 5IVFA 1FI2A 4IV3A 1Y9GA 5FZ9A 1I3HA 2R0FA 2JG9B 1RUE3 4QGMA 5HCBA 1UMHA 3ZMNA 4XOGA 4ET7A 2CDPA 2C1FA 1FPN1 2ZEYA 2ZPXA 5DG1A 1X8MA 1H6YA 1UO9A 1YO8A 4NVPA 2JENA 2RJLA 1JYVA 5A3UA 5DAQA 1X9PA 5A6YA 5CFCA 5GALA 1HRI2 1WKYA 4K21A 5AVPA 1D0GA 4GWIA 1MS4A 3VBHA 1RVF3 4KNCA 4E2QA 3ATGA 3H8OA 4KG8A 3TYJA 1SFNA 3SCHA 3A0NA 2Z5WA 1F4HA 4U36A 4MGQA 4AFBA 4IV1A 3WNPA 2UYAA 5CADA 2H6CA 2VZTA 3I2HA 4E4DX 2VG9A 3HR9A 4NIHA 1G6NA 2C0ZA 4IEXA 1LGNA 1O6UA 3KV6A 4GB33 4YZ5A 2W1QA 3LOBA 2QVSB 1HV0A 2C9KA 4PT6A 4XCBA 1HRV3 2P3KA 1XNCA 3I2FA 4OYUA 4UT5A 3S7IA 1OA4A 5FRAA 5T52A 4CXWA 2CWSA 2A75A 2Y6GA 1US3A 1CN1A 2MHFA 2PLV3 3DUIA 4P9JA 4QXKA 1CZVA 1KGYA 2IVJA 1A8MA 1UIJA 5A32B 4A7ZA 4G3YC 2XQXA 3ZX7A 5IFPA 3Q8EA 4BISA 5LBEA 3AJZA 3AMQA 3NQHA 3KVAA 4GXLA 2WL1A 3WG2A 1CAXA 3WQ7A 3OBAA 5LK7B 1J58A 3ETPA 4NAMA 4XC9A 4MG2A 3KHBA 1BMV1 1ND3A 4V2WA 4OLLA 3T4VA 2MEV1 2RMU1 1KDKA 3I59A 3K4ZA 3P3PA 4P14A 4QPGA 1WMDA 4S2FA 3SCFA 4CU9A 1V6IA 5DZFA 1DLLA 3ON7A 3HWJA 1NE4A 5C8WA 1LULA 1QQP2 4FPKA 3RPQA 1WW6A 1C8M2 2D6PA 5FP7A 1AR83 1Y9MA 3DL3A 1AZDA 4A45A 1D4M2 3VBRA 3VZNA 4CSWA 2WSUA 4AI2A 4CDQA 3IIAA 4LBJA 3JQXA 1JZ6A 1AR63 4AI3A 1VAMA 4CUBA 1G7YA 4RS5A 1AYN3 3NL1A 3VZLA 4FFGA 4YFWA 4C8DA 1WCSA 4WVWA 1F4AA 4KWLA 3ZDVA 5BNNB 4FFHA 1R64A 4H2AA 5GZGA 2CL2A 1JYXA 4GJZA 5F8PA 2HEWF 3SH5A 3FHAA 4L0PA 4CDXB 4XJUA 1ZM1A 2EIEA 1YQ2A 4QPIA 4QKBA 3H1YA 2UU8A 3VN4A 3OPWA 1YEWA 3I3BA 4AEDA 1RIRA 1HXS2 3CU7A 3IBMA 2GC2A 2IXHA 4Q0PA 1ZBE2 1QXPA 1SACA 1QWRA 1OF3A 2WS92 4HSLA 5EHDA 5FYVA 3T08A 3Q9OA 1NZIA 4FPCA 1BBT1 5IVCA 4J1XA 1WCKA 3PU8A 4LKEA 1C5IA 1J59A 1E5RA 5DZGA 2RV9A 1BQPA 2XJQA 5JR7B 4D7TA 5C3OA 2KD7A 2XJUA 3TN93 4SBVA 1KS5A 2FHRA 2HWC2 3HPNA 3VDDA 1UY0A 1YFYA 2XJSA 5EIYB 4CPBA 5JOWA 1C57A 5BNOA 1KJRA 2J1SA 4EN6B 1RB8G 4Y33A 2PHDA 2BU9A 1X9TA 4XF3A 2BQPA 3U0ZA 1UCXA 3RGBA 5LWBA 1IS6A 5FYHA 4PIYA 4QX7A 4O65A 2D3RA 5ANQA 5BV6A 1PNGA 3AKQA 4E8DA 2ES3A 2YBPA 5FZ1A 1SLTA 4QU1A 3CL1A 5I93A 2DUPA 5FBZA 1H30A 3MBWA 4WBBA 3UV9A 2ZABA 5DUWA 3BUCA 1AL0G 3FWEA 1CAUA 5FWJA 4QB2A 2VQTA 5C7GA 1FYUA 1U5ZA 4M3CA 1SFYA 1DQ5A 2E26A 3RSJA 5I0RA 1JN2P 4C0HA 1YFXA 3VBOB 1UZ0A 3O1VA 3BB6A 5FYIA 3SEPA 2V73A 3MIBA 1OD5A 1D4VB 2DU0A 2QNKA 1W0OA 2Z79A 3DYOA 2VBDA 4MADA 4P9WA 3WSOA 3WNOA 5L7OB 3RVHA 3SEEA 4I2OA 1SCSA 4NO4A 2WFF2 4AZZA 1HDKA 4GH4A 1UKGA 2IFRA 1ACCA 5J98B 5DZEA 1UWWA 1Q3EA 2DBNA 3JUUA 4PIZA 3O7OA 2GDFA 3B02A 1MS5A 4DUWA 5ANNA 5FUPA 1RJ8A 3WDXA 2K46A 4Q4W1 3K4AA 4N53A 4IV3C 1ASJ1 1W6PB 2RS13 1YQ5A 3FBMA 3AFGA 5DN2A 1U5IA 3VZOA 3PU3A 3ZN6B 1DG6A 3MV01 5J37A 3J7LA 3VL8A 2WABA 1VBA2 2FZ1A 3MW4A 3U14A 4CU8A 4GMP3 2R042 5A7SA 5KXDA 4AVAA 2EA7A 1MZ6A 3G6JB 1R091 3PVOA 5FLHA 1PVC1 1NCQB 2BVVA 2QBXA 2ZOEB 1IG0A 2HWF3 4ES9A 4AF9A 4Y5SA 2BGOA 2UURA 4MHUA 3SHRA 4FO9A 3VBHC 4HVRA 2WZ8A 2YFZA 2ZAHA 1UY1A 4B7KA 5T55A 2JDPA 4M00A 2AGSA 3H1WA 5IWFA 4XFCA 4I0AA 1T2XA 3J4UH 2PHWA 4PQ9A 4YARA 1T6GC 4L92A 1YJLA 4LKFA 1COV2 4IV1C 4QQLA 4EN7B 3WNMA 5KWRA 4K1ZA 5BNPB 1GKBA 5FZCA 3JXSA 4NHXA 3QCWA 2EF6A 4LO7A 2I07B 3S7EA 3FJSA 3WQ0A 1IQDC 1ALYA 3E5UA 4FXGB 5F5CA 1JH5A 2EVXA 4F7ZA 3RYRA 3RJRA 3VKFC
chains in the Genus database with same CATH topology
2OUHA 5L73A 1Y3TA 1HRI3 5T5JA 3BU7A 3MZHA 3WT3A 1LU1A 3J9SA 2JECA 4H3WA 4MV2A 4ISRA 4RHV1 1VIWB 1J3QA 4AFAA 2IXKA 1WW5A 4W65A 4PLMA 4CP0A 3N4MA 1LGCA 1UU5A 4XQ4A 3ZXFA 3AYDA 1QY4A 1ND3C 1PGW1 2OIIA 3HN1A 4QPGC 4AGRA 4IETA 4E2SA 4IEQA 4XFBA 1GR3A 3ZXEA 1IPJA 2WC2A 1UKRA 1ULCA 1UMZA 3LCPA 3MI8A 1DZTA 4YW3A 2CYFA 3VBRC 4M0HA 1RUC3 4CDQC 2PHLA 2YMZA 5I8SA 4GQ7A 1O4YA 3PVNA 4RS5C 5AVAA 5K0UA 3D0SA 1I5ZA 4BM8A 2E7AA 4IXLA 3ZXJA 4WM7B 4MXVA 1V9U2 3EJKA 1XE8A 3AX4A 3NKGA 4DPNA 3IPVB 2D98A 5IUQA 3ZFGB 3E97A 4O9GA 4Y4YA 1CD3G 1S0EA 2R071 4QPIC 1EAH1 1EPWA 3MIEA 1QQP3 4FVVA 2GALA 1C8M3 3O12A 4AEDC 4R8HA 3VKNA 2SBAA 2ZAAA 1PGSA 4YZ3A 1D4M3 4EWAA 4N90A 1OOPA 1AR71 1CESA 2BW8A 4YVSB 3WP6A 4FTSA 5C4WB 4CDWA 4FAHA 4OULA 1F5FA 2KXLA 4JGYB 1YNAA 1EP0A 2XJVA 4FSJA 1F8VA 3ILFA 5LRRA 5H9PA 1LOFA 3AMPA 3VDDC 1LHUA 5IK7A 1OPMA 3RMXA 4GIQA 3H3ZA 1GV9A 3NAPB 5KC5A 1R081 3RDIA 2ZBJA 5BNOC 2DYCA 1XNBA 5C9AB 5D8AA 2BNNA 1H8TB 1UU6A 2GNTA 2AH2A 3KM5A 3WDWA 1RUD1 2A5ZA 1HXS3 3VKMA 3AMNA 1ZBE3 2WS93 3LA7A 1U5YA 4WVMB 5T54A 3WG4A 1NY71 2EIGA 4LBQD 4J6GA 4AHYA 3I8TA 3IDCB 4DY5A 2P3JA 2XBO2 3S6PA 5KHIA 3VLBB 4LO5B 1PZ7A 4FPJA 3M1HA 1CPMA 2HWC3 3RI9A 4Q4X1 1NA1A 1RC6A 3MPPG 4AGVA 1ZZ8A 2A71A 1YUDA 5GLTA 1BEV1 1KXGA 4Q1PA 3MLLA 4P5HA 4IQPA 4B4QA 1X7NA 3KSCA 4QQPA 4LHKA 3J26N 1I9RA 4ORFA 4GH4C 2Y26A 1UF2C 3RMYA 3FUOA 2EXJA 5CNAA 5GLWA 3WUDA 1X82A 4INDA 2BPA2 4M0NA 4MXWA 4M01A 4ZKTB 1CX4A 4N53C 1WLCA 3ZSKA 1PNFA 3LOIA 4I01A 2XVKA 4HPKA 2CAVA 5J09A 4YLZA 5ACA1 3GALA 3IDBB 4M3CF 2DU1A 4AFDA 2B8MA 2I2SA 2WFF3 3AP5A 4AXOA 4QD2A 2JJ6A 1V6JA 4BQ1A 2ZCWA 4NWVA 1J3RA 3GZUC 4XJWA 1KDMA 2DCTA 2YY1A 3VGIA 3MICA 2P34A 1CQ9A 3AKRA 5I8TA 3M3OA 2X29A 1PO11 1W6MA 3WP3A 2WQ4A 4HSJA 1RUF1 1V6KA 1YYNA 1VBA3 1XNKA 2XJTA 2R043 3AYCA 2WT2A 1POV1 1IHMA 2VMIA 2Q1MA 2VQAA 2WZPP 3HT1A 2VULA 4XIOA 3WDUA 4C0BA 2RS31 3JBG2 2KM2A 2RS51 1XRUA 5EJ3A 4K7JA 1D2QA 2OZ6A 3MGUA 1COV3 2NP0A 4JV4A 1TMF2 3WW1A 3OGJA 2ZHMA 3GBWA 2ZX2A 3D0JA 1I6XA 4B4RA 1F2NA 4Y22A 2EXIA 2JD4A 1AF9A 1JUHA 1H1MA 1LHOA 1MQTA 3IKWA 5A33A 4XTPA 2GMPA 1BCXA 2TEPA 5AFBA 1SDWA 4ATFA 2TBVA 1SLLA 4YG6A 2QKDA 2WNVB 4IERA 4WVVA 3R05A 1PM7A 1FOD2 4I02A 5K0UC 5H9QA 3ZYGA 4DZGA 3ZPYA 5J96B 4H7LA 5CG8A 4Y1VA 1V6MA 2YXSA 3OPZA 4X8NA 5FOBB 1IOAA 3AJYA 4RD7A 5I0SA 1REFA 2QJVA 2GSYA 5T3NA 2A70A 1K5MA 1XYPA 1KFUL 3MF9A 1QOOA 3NV4A 1V00A 2IXIA 5HCFA 3TB0A 4YZ2A 3KCXA 4YM0A 4K8FA 1H9PA 1OOPC 3VBUB 5KC6A 2VQ0A 1FPN2 2CGNA 1TME2 2ZGQA 3VUOA 4CDWC 5GZDA 4MGZE 3BODA 1YFWA 3M3EA 1V9U3 4Y1ZA 1OSGA 3GYDA 3ZFFB 3BTAA 4FPHA 5D8AC 1Z7S2 4AW7A 4H14A 4IL7A 5EXOA 2XWJB 4JQRA 4FP2A 2RM21 2JEMA 3H0OA 3ZN5A 1VBC1 5DDJ1 3BOWA 4FBFA 1ZBA1 4CEWB 1VJ2A 3AKSA 4CEYB 5BXXA 1BK1A 4LBNA 5GLVA 1NA1C 2BBVA 2ARXA 1Q56A 1C8NA 2BWAA 5ABJA 5FPXA 4KBBA 5T5LA 1KQRA 3RI8A 1S2BA 4HK8A 1NQDA 3PTYA 3JU9A 1V6LA 1IS5A 1BMV2 1S0IA 4NHKA 1IGOA 1NCRB 3ES1A 1DGWX 2MEV2 2RMU2 3UK9A 1KJLA 2EALA 2XBO3 2VVEA 2UWAA 1O4ZA 1ZX5A 1LENA 5B2GB 4IEUA 3ZSEA 4X8PA 1FATA 3OYWA 1Q8PA 1MVQA 4LBMA 3HMYA 1NZCA 4RFT0 4X6RB 3LGRA 1KS4A 3NV1A 5JI7A 2GN3A 2ZGMA 3WV6A 3ENRA 3DKWA 3ZFEB 2R6QA 4FPFA 4XF1A 4E4ZA 3THTA 1VRH2 3USUA 3ASIA 3B5LB 1WA4A 1DQ2A 2D3PA 4MLOA 1A6CA 4HBNA 3URFA 4AVTA 5K7PA 4AHXA 3BIWE 3NVCA 1FXZA 1GLHA 2JG8A 2XWBB 1VP6A 3AP6A 1Z78A 3OGGA 1PO21 2XLAA 3KT1A 4RL7A 1MZFA 1LTEA 3DGTA 4S2HA 3JCIA 3AK0A 3OD4A 4XILA 3IT8A 3WW2A 4AI1A 2EAAA 1VBD1 1J3PA 4CTEA 1QJY1 4XXPA 1R1ZA 1XQNA 4ZXKA 2GC1A 2QZ3A 3EO6A 4HKWA 4OUMA 5FREA 2GU9A 4MZUA 2AENA 3HD8B 1RUI1 2E63A 4R9DA 3WG3A 1HIXA 1MQTC 5JPMB 2YUEA 4L2NA 1Q8VA 1HX6A 2A7AA 3DPRA 1WW4A 3CLPA 1N1VA 3JBG3 4AHZA 2IZWA 1NQJA 4P9LA 3TAYA 4Y1YA 1TMF3 3RWNA 1AXZA 1AUYA 4KQ7A 4YZ4A 4LT5A 2RR13 1SLAA 2HWE2 3UJQA 4JGZA 3V65A 1FV2A 2A6WA 4HN0A 1C28A 4PLNA 4XIKA 2I45A 2DCZA 4Q4W2 4AEKA 2HEYF 1O3QA 1WUVA 1K5MC 3I7DA 1LHNA 4XF4A 4UXAA 4NR1A 4XW3A 2Q1ZB 4KGQA 4RR3C 2LALA 5AFEA 3CEWA 1FOD3 1PIV2 1R092 4XMAA 1PVC2 1NLSA 1ENSA 3SISA 2AZ5A 1LGBA 2R0HA 3QACA 2UY9A 5C8CA 2QCSB 3H3UA 2NN8A 4EROA 1LHWA 3SMHA 3N7MA 5J7MA 1CAVA 1S0JA 2D6MA 3V0AB 4YYOA 5T5OA 2VH9A 2O8QA 2WZR1 1FNYA 1TME3 5E16A 3VBSA 4Y20B 3ZSMA 2GZWA 1N1YA 2G9GA 4LR4A 4N7IA 4XXAA 2QDNA 4IEVA 1UZZA 1WCDJ 2YV8A 5FO9B 1MS3A 3R4DB 3RYPA 5ABJC 3FHIB 4XHBA 5DG2A 1GNHA 1Z7S3 4E2GA 1AR91 3V0BB 4MYEA 1RTVA 1TNFA 2VOXA 4COWA 3JZVA 2HWB1 2OUJA 3S30A 3FLTA 4GULA 2B45X 3QBQA 4OI2A 5I8YA 1PGW2 3ZO0B 1ZRDA 4F8AA 4Q8LA 1PVXA 4X6QB 2E53A 1N3QA 3C3VA 3NV3A 1VLNA 5GZEA 2XB6C 2NM1A 2ZA9A 4UBGA 4EJRA 3E6CC 5H9RA 1AR81 1B35A 2OPKA 3MYXA 2YC0A 4XDQA 4BIOA 1VBB1 1REEA 2LUWA 4Q27A 2CWMA 3AKPA 2PHUA 4TSVA 1AYM2 2UWCA 2R061 2MEV3 2RMU3 3PLQA 1YI7A 5GLUA 4NPRA 1W6OB 2K2SA 2Q30A 1CVNA 1FX5A 1EAH2 1S55A 5IK4A 5EYXA 4IEWA 2A3XA 1CPNA 1DQ0A 2WNUA 5JCTA 2DVFA 5FO8B 4K40A 4B8EA 1H4HA 2JG8C 1W0PA 4FTBA 4CP1A 4XF9A 2ZHLA 3AZVA 2VGDA 3TN91 4N9IA 4URTA 1OLQA 4PIXA 4GKYA 3MFAA 3FE5A 4UW3A 2K9ZA 1VRH3 1NXD1 4CDUA 4B3NA 4C90A 3ILRA 4YM1A 1PZ8A 2F4PA 4PBOA 5J3UA 2A3YA 1RUD2 2EAKA 3HT2A 1G9FA 5C33A 3VHNA 5GJ6A 2H0VA 1NY72 2WFPA 3IN9A 4LBLA 1S0BA 1ONAA 2I74A 2NMNA 1QKQA 2K0GA 3DPRC 5CVRA 1OFNA 4AWDA 4XQWA 4Q4Y1 1BEV2 1H8TA 4LEJA 1LODA 4HL0A 4XMIA 5IK8A 3WCSA 5BYNA 4JGZC 4WVMA 1DF0A 4JRLA 3T1MA 4AEMA 4Q0UA 3VZMA 2C5DA 4OVEA 2R16A 3PVEA 1GFF2 1HQNA 4G9SB 5JIAA 4BCUA 2PHRA 4S2DA 4JDMA 3QH6A 4OHZA 4FCAA 5T50A 5C6CA 3PHMA 4IV3B 3MIDA 4EWEA 4ISQA 1HKDA 3WDYA 1ZZ9A 4AGGA 5ACA2 2D97A 1AX0A 3JD71 2X5IA 3WINE 1D0HA 2V5YA 2VMGA 2P37A 4FXKB 2R32A 1LR5A 1H2MA 3AZWA 4TYSA 3AM2A 4XEZA 2HWE3 2HWF1 3O5SA 4UW6A 3J8F1 5C8CC 2VUAA 3VBHB 4AVCA 5GZCA 4V1PA 3ZN4A 1CAWB 1H0BA 3EBRA 4K3UA 2NYYA 2DVGA 3ETQA 4QU2A 4QQ2A 4IV1B 3ZIXA 1PO12 1W6NB 2IXCA 2Y0OA 3VBSC 2OYZA 1GICA 1G9AA 3KT7A 3N7KA 1PIV3 1R093 3EQEA 3N36A 4A7KA 1PVC3 1ZYBA 3D5OA 4ES8A 4DXZA 2PA7A 2E7QA 1HRI1 4OFGA 1MZ5A 2RS32 3FC0A 2YDEA 1RJ7A 1Z0HA 5EZWA 3U10A 1O3SA 4J1WA 3W9AA 3QOPA 1JYIA 1MS9A 1G8WA 1REDA 4N43B 1V70A 2CNAA 3E5QA 5JMCA 2UWBA 1G9BA 1CAXB 4O9EA 3BCWA 1YJKA 5HCAA 5FDBA 1ND3B 1ZNPA 4BH9A 4PLOA 4XFGA 4ASMB 1LOEA 4ONUA 3KCCA 3AZYA 4QPGB 2ZZQA 4AEJA 2ZS6B 2A6VA 3AP9A 3WP4A 4CRQA 1OKQA 4GALA 4TWTA 1Y9QA 1B35C 3VBRB 1RUC1 5FQ0A 4CDQB 1ZREA 2R30A 4AE2A 4DMIA 4RS5B 5JAXA 1R1A1 4XFIA 3ZYPA 1A8DA 2SLIA 3FFZA 2BFUS 4LO8A 3HIFA 3ZXKA 1NLRA 1W6QA 2D6KA 1WD4A 4YVWA 3ZSLA 2VW0A 4ITCA 1M4WA 3PJQA 1WMFA 4QPIB 4WZFA 4LHNA 2ZGRA 4L11A 1Y7BA 4AEDB 1PK6A 3X29B 5FMOS 2WNUC 1J1TA 1D4M1 2WLQA 1Q5OA 2AR6A 3AFKA 3NWKA 4RGAA 3A4UA 1UW8A 3U07A 1PHMA 1XU1A 2XH6A 1FNZA 3V56A 1LB2A 5KXEA 1H2NA 1CONA 4N9HA 1AYM3 5F1RA 5F9TA 4Z07A 3VDDB 3KD4A 1EV12 1AHSA 4CZSA 4QQHA 4CDUC 5BNOB 1EAH3 4DB5A 2DFBA 3VBFA 1OLRA 1ND2A 2RM22 3N7LA 4D69A 4DRVA 1GZ9A 1VBC2 1HXS1 4BYYA 1GBGA 4Y24A 5DDJ2 3UKNA 1ZBE1 4K6BA 3RS6A 4BMEA 2WS91 3CO2A 1ZBA2 2D93A 2ZGNA 3KS7A 4OHVA 1JXNA 4ATEA 1ULEA 2DUOA 1OFSA 3MEPA 4K1YA 2ZGLA 1CAUB 4HFSA 3KT4A 4M3CB 2VW1A 3MIFA 3CJIA 4KU7A 1LCLA 4LUMA 2EXHA 5CFDA 1QJU2 1LRHA 1RUD3 1C1FA 4ZU4A 3CF6E 2XKPA 5FO7B 4GH4B 2JKBA 1CR7A 1YFUA 4COUA 1RUJ1 4CEYA 3H7JA 4TLFA 1ZZBA 5T5PA 5I91A 1RHI2 1X50A 3VZJA 3BOPA 4N53B 3K48A 2VOWA 3ROUA 3ST7A 1TNRA 4HANA 4XTMA 1BEV3 4F3JA 5LEJA 3CNAA 2X5IC 2CTVA 1KFXL 1MEC1 2WSVA 4QPYA 3SH4A 3D82A 2D5FA 4AVSA 4META 3AP7A 1VBE1 3TOJA 1OQEA 1VB4A 1RUH2 4LHLA 1LOCA 2C9AA 1IQAA 5JZGA 5JIUA 2ATFA 3AXDA 4LNVA 3JB8A 2W52A 2ZKNA 2CGOA 5ACA3 4QQOA 2IFWA 4AI0A 1VBA1 3ELNA 3OJBA 4WM8A 2A6XA 5A3MA 2LTNA 3P3NA 4AFMA 1PO22 4I0WB 4A2UA 4AVBA 3MW2A 4PDWA 2PHFA 3TNPB 3ZYIB 4BMBA 4YRDA 3VZKA 5H9SA 4FP3A 2D3SA 1KD7A 2OA2A 3KMHA 3U0ZA 1N1SA 1QOTA 1VB2A 4E27A 1QJY2 2JXAA 5FCCA 1PO13 4Q4V2 1ENRA 1RUG2 1MACA 4I0BA 4XFFA 5SV8A 4OI4A 1C1LA 3TRSB 4NN0A 1H2KA 1UAIA 2YROA 4LTAA 1RUI2 3OY8A 3ZYRA 1POV3 4YSFA 4ZU7A 5KHKA 4RQPA 2BUKA 3E5XA 4GMP0 2NLRA 3E6DA 1IS3A 3KQRA 2VNGA 1GZWA 2XVGA 4QHBA 4FPOB 3CJXA 4JDOA 5K0UB 1BJQA 4YM2A 4COVA 4PCRA 3OBTA 2PAKA 1U12A 1QHDA 2WINB 4P9YA 4XJ8A 2ZJCA 2WIIB 3LAGA 4LE3A 4YVWC 1O5UA 4LO6B 4Q0SA 4LBQA 1QJZA 5CAZA 2PTMA 1KRIA 2QQPA 1PK6C 3L2YA 2KA3A 1OOPB 1OA3A 1C4RA 4CDWB 3N3HA 3H8UA 1DGWA 4HN1A 4XE9A 4A7YA 4YGEA 1V9U1 4KWKA 1LOFC 3D6EA 1AL21 1XU2A 2BVBA 3ACLA 1GSLA 3NV2A 3WP5A 5D8AB 3VBFC 4JDNA 1E57A 1ND2C 1MR5A 1SEFA 2MPFA 2WT0A 2JG9A 5JSRA 3ME2A 3APBA 2WZR2 2JICA 1G9CA 2PFWA 2DTWA 2NZ9A 2AYHA 2BGCA 1LOGA 2XUMA 4FOVA 1QNWA 4XQDA 1ZRFA 4W6XA 1X8EA 3AXEA 3KGZA 1UX6A 3CJIC 5I0TA 1EV13 5HI0A 1NA1B 3OCPA 5CFDC 2E6VA 1AR92 2VVDA 4C91A 4AQTA 5AC91 1C5HA 3H9AA 1N3OA 2RM23 5JOYA 4LE4A 2HWB2 4OI0A 3LA3A 1VBC3 3GBGA 2D7FA 5DDJ3 4P9GA 4XBLA 3RQ0A 5KXCA 5E88A 1ZBA3 1AVBA 5KHHA 2XBO1 2NQYA 4MXWB 1CJDA 2G4IA 2Z42A 2ZHKA 2RE9A 4Q8KA 1TEIA 1DGLA 2FMDA 3QH7A 2ZX0A 1Q8QA 2E9QA 1AR82 1ULDA 4OUSA 1FMD1 3B7MA 5IK5A 1OI6A 1RL3A 2JDZA 5E8AA 1QJU3 3U4XA 4HPKB 5A32A 1VBB2 1X36A 3EXUA 4KG0A 3GBFA 2YZ4A 4KU8A 2ZGKA 1O7FA 3GF6A 3K51A 2R062 3ZXDA 2ET7A 5LK5A 3SLIA 1SBEA 1HW5A 1S0DA 3NKTA 3KZ4C 4EN9B 4F83A 1RHI3 2B9UA 4Q29A 4RSUA 5JZGC 1UL9A 2WNEA 1OQ1A 1WGPA 2ZHNA 4QX5A 1NG0A 4HKLA 3WW3A 4H55A 4HMZA 4R52A 1WLDA 3V64A 4I3GA 4SLIA 1F9KA 1BBT2 3IMNA 1YWKA 4WM8C 4BA6A 3WW4A 1QNYA 5DXDA 4K20A 4XBNA 2BFUL 1YRZA 2D6LX 4PDWC 4S2GA 1DYPA 3TWIA 5BNNA 2CY6A 4Z2WA 2HWD1 1LOAA 2VOVA 5BUVA 1RUH3 2UY8A 4CDXA 2XKOA 1XE7A 4WZCA 3RYKA 4QT6A 5FMOL 1XXNA 4WVZA 4YW4A 4MUVA 5I0UA 4Y22B 4RQPC 2ZX1A 1PO23 1MQTB 4P9XA 1D2SA 5A33B 2PELA 3MW3A 3WCRA 1MZEA 1QJX1 4GWMA 4HLTA 3JBG1 4Q4Y2 2VY0A 1UD1A 1SLIA 3M70A 3KLSA 1QJY3 4Q4V3 1RUG3 4YG0A 1DQ6A 2RR11 4QMAA 4XJAA 2QDRA 1MS8A 1RGSA 4Y5Z0 2B46X 2PQQA 2W08A 1RUI3 1RMU1 3WOGA 3QLQA 3TBDA 3SH3A 3AYEA 5K8SA 4DY3A 1A78A 3I4IA 3RRDA 2X8KA 3WHTA 4UBHA 3O14A 1K5MB 1JUIA 1ASJ2 5EV7A 1EY2A 1LU2A 1RUE1 3VBOA 3JD72 4RR3B 1FOD1 1V6NA 5L7OA 5KBFA 2YGMA 1ZZ6A 2WJSA 1APNA 1RITA 1J1LA 4Q1RA 1DHKB 3J8F2 3IM0A 4XPVA 2R1DA 3BPZA 3ZXLA 3RNSA 1RVF1 2D6OX 2QE3A 1F5JA 3MLJA 3WQ1A 3R6SA 2GC3A 2A3WA 3B94A 1W39A 3ALQA 1NYWA 3WHUA 1L3JA 1W6PA 2JG9C 3LSEA 1GNZA 1YIFA 2LM3A 2D44A 3ZN6A 1U5XA 3D8CA 1FPN3 1TME1 2XVLA 4GB31 4MVTA 1I1EA 2YHJA 1HRV1 3LWCA 4JVAA 1NCQA 2RHPA 2X53S 4YW5A 4HKOA 3LA2A 3H1MA 3WR0A 4EWDA 1CAWA 4COZA 5ABJB 2PLV1 4RHV2 1Z7S1 3M3QA 3ZXAC 2P3IA 2D43A 4AQ2A 1OPOA 1X33A 3AMHA 4MH0E 1OHFA 4YM3A 1W6NA 2OZJA 3FLRA 2WZR3 5BNPA 3PJYA 4E9KA 4KH9A 2XJPA 4E4SA 2RJKA 2YYOA 4KL1A 2ZZJA 4W6WA 2DFCA 1LHVA 3I54A 1LOBA 2WA4A 3R4SA 1PMIA 2ARBA 3ZVXA 3B69A 1YIPA 1S0GA 1Q8SA 1RUC2 3OYWB 1AR93