4CEYC

Crystal structure of human enterovirus 71 in complex with the uncoating inhibitor nld
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
242
structure length
242
Chain Sequence
GFPTELKPGTNQFLTTDDGVSAPILPNFHPTPCIHIPGEVRNLLELCQVETILEVNNVPTNATSLMERLRFPVSAQAGKGELCAVFRADPGRNGPWQSTLLGQLCGYYTQWSGSLEVTFMFTGSFMATGKMLIAYTPPGGPLPKDRATAMLGTHVIWDFGLQSSVTLVIPWISNTHYRAHARDGVFDYYTTGLVSIWYQTNYVVPIGAPNTAYIIALAAAQKNFTMKLCKDASDILQTGTIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title More-Powerful Virus Inhibitors from Structure-Based Analysis of Hev71 Capsid-Binding Molecules
pubmed doi rcsb
source organism Enterovirus a71
molecule tags Virus
molecule keywords VP1
total genus 44
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ceyC00
1C8M3 5AC93 1RMU2 5BNOB 1RUH3 1GFF2 1POV0 4CDXA 1C8NA 3NAPA 5C8CC 1BMV1 5C4WB 3ZFGC 1VBE3 2RMU1 4YVWC 1EAH3 2HWC1 4CEYC 4NWWA 4RR3C 3VBSC 4WM7A 4RS5A 1PIV3 3CJIB 1ND3B 1TME3 1D4M2 1PO23 1FOD3 5DDJ2 4YVSC 4RQPC 1VRH2 1NCRA 1BEV2 1VBE2 1RUH1 1B35B 2PLV1 1VBC3 5ABJC 1TMF2 1RUC3 2FZ2A 1D4M3 5D8AA 2QQPA 1VBA1 1ZBE2 3VDDB 1NA1B 4AEDB 3VBHB 1RUJ2 3IDEA 1QJX2 1HRV1 1CD3G 1AL21 3J8F2 2WZR3 4RR3B 1ZBA3 1MQTB 3NAPC 4Y5Z0 4FTBA 3JB8A 1PVC2 2WLPA 2DF7A 4CEWB 1NCQC 1RVF2 4IV3B 2RR13 1FOD1 4PDWB 3LOBA 3VBRB 2IZWA 1AR73 1QJU2 1HXS3 5CFDB 3JBG1 4JGYB 3ZFEA 2BUKA 2R043 1HRI1 1FMD3 1AYM2 1PVC3 3JD73 3VBUC 4YVSB 2RS33 5FOJB 1EAH1 4RHV2 2MEV1 4JGZC 1NA1C 5JZGA 3JBG2 3ZXAC 2WZR1 3ZFGB 1QJU1 4YVWB 4QPIB 2HWB2 1OHFA 2WFF3 4CEYA 1PO12 1AL0G 4IV1C 3VBOB 1PVC1 5L7OB 2R063 1FPN3 1PGL2 4N43A 1BBT3 4GH4C 1R083 2RS52 1AYN2 1QJX3 2WS91 4CDQB 1B35C 5BNNC 2VQ0A 4Q4V1 1EV11 1HRV2 5CFDC 4QPGB 1AR62 4WM8C 3ZFEC 2R062 4IV3C 4PDWC 1VBB2 2RM23 4GMP1 2PLV2 1RUH2 1W39A 1VBE1 1VAKA 4N53B 1BEV1 4CDUC 5BNPB 3NAPB 4FSJA 1CJDA 1K5MB 3JBG3 1RUF1 5ACA1 2R071 3HAGA 2FZ1A 3JD71 2RS13 1RUF2 1R081 5FMOL 5A33A 3VBRC 5ACA2 1X36A 4N43C 4Q4X2 1HXS1 1ND3A 3ZFFB 5C9AB 1DDLA 4CDQC 2RS53 1NCQB 3VBOC 1RUE3 2HWE1 1VBB1 4JGZA 4GMP0 1NCRB 1V9U3 1RB8G 3VBUA 1B35A 4Q4V2 4QPIC 1AR72 1QJU3 5D8AB 1NOVA 2PLV3 2RS51 4WM8B 1OOPC 4BCUA 2RS32 1QJY3 5BNNA 5K0UB 1VB2A 4RR3A 5A32B 1AR71 5L7OC 1F8VA 4GH4B 1QQP1 4GB31 2MEV2 4CEWA 1SMVA 2HWD3 3VBRA 1RUE2 4CDWB 1ZBA2 4N53C 3DPRA 1AR93 5C8CA 1PIV2 4JGYA 1ND2B 4Q4X1 1VB4A 1FOD2 5D8AC 1RVF1 3VDDC 1VBB3 4AEDC 4CDUB 5BNPC 5BNOA 5JZGB 1FMD2 2XBO1 5C4WC 1TMF3 4QPIA 5C9AC 1POV1 3VBSA 1RHI1 2X5IB 2WFF1 4RQPA 2BFUL 1RUJ3 2GH8A 4N43B 1COV3 2R061 1RUD1 1RUD2 1VBA2 1AR61 1TME1 4Q4Y2 1PGW2 2MEV3 2WWSA 4GMP3 4WM7B 2WFF2 4NWVA 1RHI2 4RS5B 4EJRA 1H8TA 1Z7S1 2WS92 1F2NA 1AYN1 3VBHC 2RR12 5FMOS 5GKAC 3TN93 1PGL1 5LK7B 1OPOA 1VBA3 3VBFB 1PO11 1AR63 4Q4Y3 4Q4W3 1D4M1 1HRI3 4N53A 5BNPA 2HWB1 5CFCB 2Y26A 2HWF1 4Q4V3 5AC91 1ZBA1 3VDDA 1RVF3 1NA1A 4RHV1 2X5IC 1RUE1 4AEDA 5JZGC 1RHI3 1BMV2 1AYM1 3DPRC 2XBO3 1HRI2 1QQP2 1AR81 3ZFFA 3S6PA 4CEWC 2HWB3 4IV1B 1FPN1 1BEV3 4CDXB 4CDWC 2HWC3 4JGZB 1ASJ3 5DDJ3 1RUF3 5ACA3 5J96B 5C4WA 2RS31 3VBUB 2R041 1VBC2 5BNOC 3ZFEB 1QJY1 4WM8A 2RM21 2WS93 4LLFA 1RUG2 1RUJ1 1R092 5K0UA 5BNNB 5A32A 2HWE2 3CJIC 4Q4W2 2R073 4CEYB 1HXS2 1VRH1 2TBVA 2BPA2 1RUI2 1RUG3 1R1A2 3VBOA 1VBD1 1AL23 4WM7C 1R082 1C8M2 4CDXC 4Q4X3 3FBMA 3JD72 3VBHA 5C8CB 2R072 4CDQA 3JB4C 2HWD2 1HQNA 2BFUS 2HWD1 1RUC1 1M06G 1A6CA 1AUYA 4QPGA 1R1A3 2RMU2 4GB33 4FTEA 1VBD2 3ZFFC 1ZBE3 3TN91 1OOPB 4SBVA 3VBSB 1EV12 4Q4W1 1ND3C 1X33A 1R091 2ZAHA 2ZTNA 5ABJA 1MQTC 1RUG1 4YVSA 2HWE3 1COV1 1RUD3 1MEC2 1IHMA 1V9U1 1NCQA 4FTSA 4Y4YA 2WZR2 2XPJA 3VBFA 1EAH2 5L7OA 1PO22 1AR92 5CFCA 1WCDJ 1FPN2 2RS12 1MEC3 1AR82 5K0UC 2HWF3 1Z7S3 3CJIA 1AR91 1PO21 1R093 1RMU3 1ASJ1 1ND2C 2ZZQA 5AC92 2HWF2 4IV1A 1QQP3 1MEC1 4QPGC 1COV2 1H8TC 4GH4A 4JGYC 1K5MA 1AL22 3J8F1 1QJX1 1RUI3 1POV3 2RR11 1HX6A 2BBVA 1ZBE1 1NY71 1Z7S2 5A33B 1BBT2 1TMF1 1PGW1 5C9AA 1BBT1 1PO13 4Q4Y1 1TME2 3TN92 1NY72 1HRV3 1MQTA 4CDUA 3M8LA 1VBD3 5DDJ1 4RS5C 1VRH3 1AYN3 2GSYA 4IV3A 4PDWA 4RHV3 1QJZA 1RUC2 2X5IA 1E57A 5CFDA 4RQPB 1FMD1 2XBO2 1NCRC 2HWC2 1ASJ2 1C8M1 5CFCC 3J8F3 1R1A1 1RUI1 3VBFC 4Z92B 1H8TB 1PIV1 3ZFGA 2RS11 1K5MC 4YVWA 1RMU1 2RMU3 4GB32 1OOPA 4CDWA 2RM22 1QJY2 3DPRB 5J98B 1V9U2 1AR83 1EV13 1VBC1 1ND2A 4RFT0 1AYM3 1NG0A 2R042 5ABJB
chains in the Genus database with same CATH superfamily
3M7AA 1ONAA 4CUBA 2AR6A 1C8M3 1SLLA 2XUEA 1GFF2 4JRAA 1XRUA 5F39A 2OUHA 1POV0 2WQZC 4GJYA 3PUAA 1ZZ7A 2E26A 3INAA 3LSDA 2PYTA 4MSVA 5F3GA 1C8NA 1CX1A 1J1LA 3LZZA 5C8CC 2TNFA 3OJBA 1YQ8A 5C4WB 1BMV1 2C26A 4XCBA 2BDRA 1FAYA 2MHFA 3J9SA 4YVWC 4JHZA 1A8DA 1EAH3 4XFBA 3VZKA 3WDVA 3TB0A 3HMYA 3JQWA 1ZA4A 3CBNA 3U10A 3W59A 4V2WA 4NWWA 5JCTA 3HT2A 3PIGA 4DB5A 2B5HA 5DQ0A 4RS5A 4Q5OA 1PIV3 3CJIB 1ND3B 2BGCA 2P4EA 4K7JA 2XONA 4GWMA 5LASA 1LECA 5BYNA 2GMPA 1JU3A 4FI9A 1FOD3 2ZGMA 5C3PA 2V4VA 2ZHNA 3ZKYA 2VH9A 3ES1A 2GC1A 4S2HA 2R0FA 4DUXA 1W8FA 1SFNA 2DVBA 4X8PA 3NNJA 3H8RA 1I5ZA 1RUH1 1RINA 2PLV1 1VBC3 4QT6A 1TMF2 1RUC3 2O14A 1UYYA 1S0IA 1DQ5A 2YZ4A 3IAPA 5FZDA 2ZGKA 4YFZA 1JZ4A 1U5YA 4MLOA 2YBKA 1J59A 4K40A 1RUJ2 3WW1A 1IQDC 1HRV1 2PHLA 2WFPA 1PZ7A 5DZGA 5K9YA 2UYBA 2K2SA 2IFRA 3HQXA 4Y33A 2C24A 1AF9A 3BPSA 4LITA 1ZBA3 2B45X 4MG2A 3NAPC 1TEIA 3I97A 5A7WA 1MVQA 3J7LA 4FTBA 3JB8A 3SXWA 4AHXA 2E32A 4F7ZA 1OT5A 3W20A 1OPMA 2QQVA 1PK6B 3I2OA 5ISLA 3WINE 3LOBA 2QKDA 3WNLA 1AR73 3B7MA 3H9AA 2FCTA 2XVKA 5CFDB 5E8AA 3GHMA 2QQUA 1CESA 3JU9A 1OURA 4K21A 4P9JA 3VDCA 2DVGA 2ZXQA 5KXCA 1EP0A 2OVUA 1UAIA 3JD73 3ZPYA 2UWAA 4YVSB 3WDXA 5KXEA 1ENQA 3ENRA 4GKXA 5FUIA 4JC1A 2W2IA 4QD2A 3T1MA 2PQQA 1YCIA 4U2AA 2WZR1 3KWVA 4QQOA 3RYKA 4UAPA 1QJU1 4JCKA 2JECA 2WNVA 1UMHA 3G6JB 4NPRA 4YVWB 2WFF3 2X10A 2W52A 3NJVA 1OSGA 4D3WA 5L7OB 2R063 1JYCA 2JWPA 3C7OA 4GWIA 1PGL2 1HQLA 2AZ5A 2V5YA 2VMGA 4QQLA 3ZYFA 3AM2A 1QJX3 2WS91 4NRPA 4UF0A 4DXTA 3B69A 1CAWB 1GU3A 2H0BA 4HL0A 3MZHA 1DHKB 3ZYJB 4YW3A 4XBLA 4LUKA 3SLIA 2A5ZA 5ANNA 4W6XA 1AR62 3ZFEC 2R062 4Z1VA 4PDWC 4FFFA 5C5UA 3PVOA 5FFOC 1GQHA 3QH7A 4EROA 1YQ2A 4B1LA 3RZLA 4QB1A 3WQBA 2J1SA 4QQ2A 3LIHA 4YG0A 5FZEA 4YG3A 1ENRA 1N3PA 2BU9A 3OY8A 5FO8B 2XVLA 5KHJA 4FOVA 4Y3OA 2VUCA 1WA6X 1YFUA 4XXAA 3JD71 3MF6A 1W05A 1W6MA 4DEVA 4JRLA 1LTEA 4BQ3A 5A33A 1S0EA 5ACA2 3F2ZA 1FT9A 1N47A 4MO3M 5J37A 2E7TA 2JEMA 4XC9A 1ND3A 5DUWA 1O3SA 3C7GA 1JHJA 2ILMA 1DDLA 2W46A 4CDQC 1UYPA 2GNTA 2XKPA 3VBOC 2GDFA 2PMWB 3N9LA 5FLIA 4YGCA 4IEVA 2J1AA 4KG8A 3ZYBA 5C7GA 1JODA 3NSTA 4J25A 1WUVA 1CAXB 1K5JA 4XCAA 3VBUA 1B35A 4E9KA 1PX3A 4Q4V2 3RPQA 1MS0A 1AR72 2HYKA 2YB7A 3PDQA 2Q1MA 1NOVA 3RJRA 4SLIA 2PLV3 1DF0A 2RS51 2EAKA 4WM8B 1LEMA 2BRTA 3AFKA 1K12A 3DKWA 4KNCA 2FHRA 4XFHA 3GXUA 4DUVA 1QJY3 1U0AA 3EQEA 1C1LA 1HDKA 2WAOA 3B5LB 3BIWE 2W92A 5BNNA 1VB2A 2WBKA 5JAXA 1D2SA 1UIKA 2VOWA 2VMHA 3Q8AA 4RR3A 4AI1A 3C7EA 3AZWA 3PMSA 5J48A 5L7OC 4HSLA 4O9GA 5FZ8A 2RHPA 4XAEA 4LBQA 2JDZA 2YC4A 3ZSEA 4AGRA 2RV9A 2D5HA 4CCJA 3VBRA 4DPNA 5FOBB 3HJRA 1SACA 5DG1A 1AR93 4UWDA 2VMFA 3I2KA 1J3RA 4N8MA 4LHSA 2PXJA 5FP8A 2ZBJA 1SLAA 3RMYA 2ZEYA 1W8UA 5LRSA 2OYZA 4JQTA 1ZZ8A 1EY2A 4UOJA 1ZVFA 5FYUA 3SKVA 4DY5A 5LEJA 1BKZA 3OUJA 1W8NA 5D2AA 1RC6A 4ZU5A 1GZ9A 2XBO1 3T3YA 5C4WC 3B01A 3T2PA 3BTZA 1TNRA 1P8JA 3GZTB 5IJRA 2WNVB 4G3YC 3HNBM 4M00A 2JB8A 1POV1 5T5PA 3VBSA 1LODA 2WFF1 4A3XA 1A78A 4RQPA 3NV1A 3OTFA 3PJQA 3OOXA 2RE9A 5L9RA 3H50A 1RUD1 2OPKA 2QZ2A 2R061 1IG0A 1GR3A 2QQKA 3VL9A 1XNTA 2CDPA 2VZPA 2JG9B 1PGW2 2MEV3 2WUHA 3POSA 4QB6A 1DGLA 2VCMA 4WM7B 4NWVA 4NVPA 4XF0A 1OKOA 1CVNA 1DGWA 1H4GA 1Z7S1 1HQWA 1XSRA 1DIWA 4TLFA 3VBHC 1QNWA 2RR12 5FMOS 3LPGA 1A8MA 1ST8A 4FPFA 1W3XA 2LTNA 4Q0SA 5FYMA 1FATA 1PO11 4QKFA 1JU4A 3U1XA 2BV4A 5BNPA 1WCQA 4HMZA 4BDVB 5CFCB 4S2DA 2WZPP 4FVVA 1REFA 3ZM8A 3DF0A 2ZX3A 2HWF1 4Q4V3 5HCHA 2XR4A 1S2BA 5FXVA 1LHWA 5FWEA 1H0BA 2OW4A 1YFYA 3VDDA 1MZEA 3POGA 4PF1A 4CE8A 1CAVB 1RHI3 1V6NA 2QQNA 4MZUA 3WNPA 4HK9A 3H1YA 1AYM1 1NT0A 4IDZA 2UY8A 1PGSA 1POQA 2XBO3 4L99A 5LRRA 1G9AA 1OQ1A 1AR81 3POJA 3NNGA 3WD5A 2EALA 3ZFFA 4BWOA 1OA4A 3J4UH 4Y5SA 4QX5A 3FN9A 1O8PA 3U75A 1BEV3 4CDXB 5A7WB 1WBLA 3FE5A 1OI6A 1G9BA 3PTYA 1GZWA 4JGZB 2OQ6A 4ORFA 4NN0A 1QHDA 5DDJ3 2ZX4A 1RUF3 3AC0A 4C0BA 4FOYA 4QQPA 1CAXA 3AP5A 1XB9A 4FO9A 4GD4A 1QXPA 2YV8A 2NMOA 4X8NA 3ZFEB 4FPOB 1OA2A 5CAZA 4ZZ8A 1N1TA 3WDTA 3RJ2X 4AWDA 1QOTA 3RDIA 2Y6JA 2W0XA 1LOFA 2WJSA 1X9TA 4EWDA 1GNHA 4XPVA 1HB1A 5K0UA 2VY0A 3LEGA 3V0AA 2HWE2 3OPTA 4MYEA 4AI0A 2ZGPA 4B7EA 2VXRA 2OS2A 4ZXEA 2B9VA 5FZKA 3M3EA 1NQJA 4IE0A 2XUMA 3KMHA 3PU3A 3I2DA 1HXS2 3IMMA 1NE4A 2BPA2 2R32A 3GJAA 4E4ZA 1VBD1 4HVOA 2NN8A 3FHIB 4Q4X3 4K1YA 4QXKA 3D82A 3VBHA 4KL1A 2D6MA 2UY9A 4CDQA 1V6IA 4W6YA 3SKJE 2HWD2 1RIRA 2V4AA 3AP4A 1UWWA 4Y1XA 3SQOA 1YWKA 2JG8A 1AUYA 4KWUA 3O14A 4QPGA 1AJOA 4PLNA 2W47A 4IEWA 3VD9A 1JUHA 1NXD1 4BQ2A 4GB33 3H8UA 4IERA 3OG2A 1YI7A 2WO1A 2NPIA 5FPXA 2GC0A 5A3OA 1BVP1 2GN7A 4UBHA 4K1ZA 1ULFA 4MH0E 1ZZ6A 5FYTA 3ZXEA 4ASMB 2WNUA 4KU8A 3WG2A 1E5HA 4LBQD 3ACGA 2E33A 3WDUA 4ES8A 1W6QB 1BJQA 1W2NA 4A6OA 3A7QA 3AJYA 5LY1A 4M3CE 5KC5A 5CB7A 1R091 2ZTNA 2ET1A 4BMEA 4QXCA 4LBJA 5C71A 2WSUA 3CZUA 1QWRA 4CVUA 3IDAA 3GZUC 4AVCA 3NJXA 2VULA 5A3MA 5F5AA 1COV1 5IYYA 3WEZA 4C8DA 1QF3A 1O6UA 5FZ4A 5A7SA 1YNAA 1NCQA 3KS7A 1QMJA 2ZHLA 3JUUA 1GYKA 4FT8A 2F17A 2FDJA 2WZR2 3ITQA 4OHZA 4AFCA 3WG4A 2VVEA 1LKNA 4BE3A 2UWBA 1HLCA 5LW9A 1IG3A 2RDRA 4COZA 2HJIA 5J36A 3VB9A 3HPNA 3K4AA 1DQ0A 1WCDJ 3N7KA 4K8FA 4OZOA 1UY4A 2WNVC 5GLTA 2WNEA 2D44A 5B4NA 1DYKA 3O1RA 4B1MA 2HWF3 1IGOA 2PHFA 4YGEA 3H8OA 2DCZA 1CAVA 2DUOA 1VE0A 4FQ4A 2N7GA 4QX2A 3T4HB 5FPZA 4A45A 3BOPA 5FZLA 3E5XA 2VUDA 3ASIA 3ZXLA 4OI2A 5A3NA 1JI6A 2XHNA 1U5IA 5AC92 3M3QA 4IV1A 3ORJA 3PLQA 3VKNA 2ZEZA 1MEC1 2C9AA 3A0KA 5GZGA 5FKCA 4JGYC 3FHAA 3FJSA 2ZEXA 2JG9C 4IGPA 4R9BA 1C1FA 4LNVA 3APBA 4NIAA 2XKOA 5CVRA 2PHUA 2RR11 3OB8A 3VGIA 3VV1A 1ZBE1 3KT1A 1FX5A 1MS1A 1BBT2 4CU9A 4O61A 1JYIA 5FZGA 2Z42A 5AVPA 3QCWA 3H3ZA 2GMMA 5C9AA 1NLQA 1PO13 3D0JA 3TN92 4AK3A 2P2KA 4EN6B 4MXVA 4YGBA 4CDUA 4CU6A 1PHMA 2VBDA 4RS5C 1OC1A 1VRH3 4FFHA 4UFJA 5A7OA 1NAEA 1ALYA 4I01A 4A4AA 4PDWA 3KQRA 2WNOA 3SITA 3LFIA 3UGHA 2EXIA 4AI9A 3V64A 1KS5A 4HPKA 2LUWA 4RQPB 1Y9GA 5KHHA 4WVZA 4NROA 1XC6A 4C90A 1NCRC 4OCTA 4QXHA 4EN8B 3AKTA 2GN3A 3AKRA 3J8F3 1UU4A 4GQ7A 1R1A1 4XETA 2WSVA 2EA7A 1YQCA 5GJ6A 4Y1UA 3T1LA 3VZNA 1W6OA 3O1MA 2JG8B 2QQOA 3VZLA 4ATEA 5EIYB 5JXHA 3ZFGA 2XGXA 2RS11 2C6SA 4R9CA 1WKYA 5D21A 1J3QA 4MHRA 1QJEA 4MGKE 2XOMA 2GC3A 2K0GA 3N9QA 1JZ5A 1S55A 2QTWB 5FR3A 3JCIA 3K4DA 4IE4A 2KM2A 3S30A 1QJY2 2EIGA 3DPRB 3ES4A 1W6QA 3ILNA 1NLSA 3KV4A 3MW3A 1EV13 4QKNA 5J98B 5J3UA 3B00A 3SCFA 2BBAA 4MXWB 1AYM3 3AZZA 4I0WB 5FYIA 3UL2A 4CA9A 3R05A 4AG4A 3RZMA 1NG0A 1LNSA 5ABJB 3UV9A 2XJQA 1D2QA 5FWJA 2H0VA 1YO8A 1PMIA 4L9BA 3ZKUA 4AR2A 1TZOA 1KS4A 5DZEA 5EJ3A 2W87A 3POIA 4L2NA 4XJWA 5T55A 5AC93 5BNOB 5FZAA 2E63A 4LO5B 1UOFA 3RZKA 3QD6A 3VZJA 3AX4A 3SC7X 1AX2A 2VZQA 4PI2A 3ZN4A 4EN9B 3C7FA 3J7MA 4CDXA 1ZNPA 5ANQA 4AI8A 3NQHA 3EMRA 4M01A 5IVBA 2BOJA 5JMCA 2EVXA 3VN4A 1DQ6A 4Q8KA 3FFQA 4IE7A 5HPOA 3D3AA 2VM9A 1DLLA 5G05L 1CJPA 3TBDA 3ACIA 4YZ1A 5C3OA 1K3IA 3PU8A 4UW3A 1UOJA 1QH6A 2YGLA 1X8EA 4IGOA 1HW5A 1D4M2 4U36A 1F4AA 2OX0A 4UFLA 5GZCA 3P6BA 4CUAA 1LOCA 4YVSC 3ZXDA 3B93A 3TEYA 3BCWA 4URTA 3ZSKA 5I0SA 1VRH2 1NCRA 3NV2A 1OD3A 3M3IA 4LO4B 5CBLA 4L11A 1B35B 1JTZX 5FMDA 1CQ9A 1KXGA 2FCVA 1D4M3 4M4PA 5D8AA 1G7YA 1JZ7A 2QQPA 1T6GC 1VBA1 2VQTA 2YUEA 1NA1B 1UZYA 1N1VA 5JIAA 5M0TA 2DFCA 3RFRA 3J7NA 2YGMA 4META 1CD3G 1YQ5A 1AL21 3J8F2 3BTXA 2ZJCA 4NHYA 4I2OA 2JKBA 4RR3B 5DZFA 1YFWA 2BNOA 1MQTB 3DV8A 5LBCA 3BUCA 4HETA 3O12A 3VKLA 4KG0A 1PVC2 2DF7A 1ODMA 5JOYA 3ZDSA 3UGGA 3GBGA 5FYHA 2BTVC 5A6YA 4PDWB 1FOD1 2WZ8A 2VNVA 2ZHMA 3NWKA 1QJU2 3VBRB 5F6KA 2ARXA 5GALA 3TEXA 3DKQA 3PMEA 4NHLA 4M3CF 5DUUA 3ZYGA 4JGYB 3ZFEA 2FCUA 2GAUA 1BLZA 2WYSA 1HRI1 2E7QA 3L2HA 1AYM2 1PVC3 3VBUC 3U4SA 4FPYA 1XE7A 5FYCA 2RS33 2DWRA 3T0AA 4EYUA 1EAH1 2VZ1A 3H7JA 4PBOA 2IWGB 4JGZC 5CG8A 1YXWA 3EJKA 4HZFA 3ZXAC 4CCKA 1D0GA 1UZVA 2ZA9A 4IUGA 1WMXA 3ZFGB 4BB3A 4ATFA 4JTOA 5FZ1A 5CISA 3NKGA 4FPJA 1O91A 4I0BA 2ID4A 2WAAA 1OHFA 2PAMA 1F15A 4QPIB 4XDOA 3BKZA 4EN0A 4XJZA 3VUOA 1AX1A 1PO12 5FYSA 4IV1C 2OKXA 2BOIA 4XDPA 2OIIA 3P3NA 3OBRA 3ZXJA 2W1SA 2ZCWA 1CIWA 3E6DA 4LUMA 1RXGA 2XJRA 3LB9A 5JPNB 4BLIA 4BIOA 5JPMB 2OT7A 4AQ2A 2G19A 1EV11 3KV9A 1W9FA 2DBIA 3KM5A 2ZGLA 5CFDC 1UL9A 5JOXA 5IK5A 4QPGB 4WM8C 1R64A 3T0DA 1VBB2 3WQ1A 4RYDA 4H7LA 2QDRA 1RUH2 1W39A 3PUSA 1VBE1 3PVNA 4XACA 4B8EA 2A73B 4P08A 4BISA 5A7QA 2QNKA 2XJTA 2G9FA 2GU9A 3WXPA 3GZEA 2AGSA 5ACA1 1LEDA 3ZVXA 3BB6A 2NM1A 1OH4A 3IM0A 1LOAA 3NNFA 2FDHA 2QZ3A 3BODA 4Q8LA 2RS13 5D1IA 3THPA 4BH9A 1RUF2 1R081 5I8YA 1GP6A 5FZ3A 2LALA 3BTAA 1X36A 3NJYA 3ZSMA 1WZXA 3NV3A 4N43C 2PELA 5FLHA 1OVPA 4F8AA 1W06A 4P9YA 4M0HA 5KHGA 1H8VA 3MW2A 2BP6A 3R0RA 4PIYA 4CPBD 1CGPA 1KD7A 3P5BA 1EYBA 3HN3A 1GWLA 1VBB1 3MO4A 4UYBA 5FO9B 5G04L 4W50A 5LWBA 3LEKA 1PMJX 4BK4A 2G1MA 5I0TA 1OUXA 2VOVA 3UESA 2XHKA 4ONUA 4K20A 1V9U3 1ZRRA 2VZSA 1NX9A 2J1TA 4H2AA 4TZDA 5EPAA 1QJU3 4IEUA 2O1QA 2EICA 1IS5A 4XUOA 2VJXA 5FRAA 4BCUA 2RS32 2WDBA 3OBZA 2J22A 4ASLA 1MACA 4KMQA 4Y1VA 1IOAA 3ABZA 4BQ4A 1XOYA 4HLTA 4ZU4A 3EBRA 1H9WA 1W9WA 5A32B 1MPXA 3VD3A 1CZVA 1S0CA 4HN1A 5FP7A 1RUOA 1QOSA 3NRUA 2YBSA 5ERLA 4B4QA 5JDBA 1KRIA 1F8VA 3KCCA 1M4WA 1DCSA 1GNYA 3PHMA 4BLJA 1ZRDA 2VCAA 1SMVA 3W21A 1TNFA 2QDNA 2B46X 4CDWB 5FCCA 3LIGA 4XTPA 5A6ZA 1LGBA 3KCYA 1UPIA 5FPLA 1PIV2 2W95A 2OQ7A 3GCWA 5C8CA 4E8CA 1W99A 3UT0A 1O5UA 4Q29A 2ET7A 5FZOB 4D6RA 1FOD2 3JQXA 1RVF1 2VZVA 4COWA 5EFUA 4OUMA 2H6BA 4Q0PA 3P3PA 1VBB3 4QMAA 4UFMA 4AEDC 5BNOA 3AYEA 3MPBA 3ZIWA 1FMD2 4FP2A 1N1YA 1TMF3 3MI8A 3K75B 5DAQA 3ZX7A 5IVFA 4EQVA 4AF9A 5C9AC 5E6HA 3I3BA 4AAPA 1O5LA 3PNAA 3PURA 4ZS3A 2HYXA 2EXKA 2J1RA 3IN9A 1UOGA 2I74A 1RUJ3 4N43B 3MYXA 3T2QA 1COV3 1LU1A 3HT1A 4NJ4A 4D94A 1RUD2 5F9TA 1AR61 4YARA 1DGWX 3LQCA 2A6ZA 4QHZA 4GMP3 3S5QA 3WG1A 4RS5B 1RHI2 4OZXA 3WHTA 4EJRA 1W9TA 2BW8A 2VOTA 1ZRCA 1ULCA 1H8TA 4COVA 1YIFA 3WZ1A 1AYN1 1YJKA 4PCRA 3KT4A 1OVSA 3PUIA 4R8HA 1UZWA 2VQUA 4KGQA 1CIYA 2YG0A 5LK7B 1JYVA 2A6WA 1PGL1 1OA3A 5B2GB 4HANA 3POBA 4GKYA 1D4M1 2ORXA 1HRI3 2B9UA 4P02B 4WBBA 5DAXA 4AYUA 1URXA 2JDAA 2D40A 2Y26A 3KVAA 5LATA 5I0DA 3POYA 1SPPB 4XFFA 4XYXA 4TYSA 5F3IA 2GZWA 1ZBA1 4NIDA 1RVF3 1NA1A 5FY7A 4KU7A 1RUE1 1W6PA 4AEDA 5JZGC 4CRQA 2P37A 2WNUC 1NZIA 4HKLA 3R4UA 4HKOA 5FYYA 4CP9B 2XJUA 1HRI2 1QQP2 4XABA 3U11A 1L7QA 4RA0A 4YZ4A 3OEAA 4IV1B 1WBFA 1UU6A 2ADEA 1QIQA 2EIEA 3D0SA 2NMNA 3SMHA 2AH2A 4P9GA 2HWC3 1WMEA 3WF3A 3M2MA 3RZHA 4NAMA 5J96B 1VJ2A 2VZUA 1LGCA 2IVIB 4CP2A 3VBUB 5FMBA 4XEZA 2YDEA 1VBC2 5GLUA 2Y38A 1JMUB 4CCCA 2KD7A 2GP5A 5BNOC 3SEEA 4WM8A 1DYPA 3K2OA 2VC9A 3AXDA 1Y3TA 4Q1PA 3CEWA 2WS93 4MGQA 4LA3A 4XE9A 3TEZA 5LCWL 2ZGUA 2OA2A 1MS9A 4AHZA 1UX7A 2RVAA 5T5JA 1SLTA 4D0QA 2CL2A 2JB4A 5IFPA 1UQXA 3TOJA 3VZMA 1LHOA 5T5OA 4Q4W2 2VW1A 3R4SA 4E2SA 3VHNA 1OLME 1UW8A 4QHBA 1WA4A 1SLBA 4BK5A 2VMDA 4E8DA 2ZX2A 4LBMA 2KXLA 2OZ6A 4FFGA 4GULA 1RUI2 2P3KA 3AL5A 4JDOA 4XBNA 3SISA 3VBOA 3ZMOA 1QXRA 4EWAA 4CDXC 1Q8SA 4WVWA 4JVAA 2VBPA 3U07A 4L97A 1BQPA 1RGSA 4XVHA 4XFAA 1GICA 1JZ8A 3O5SA 2HWD1 1M06G 5FZOA 1SFPA 1S4CA 1S0DA 2A6XA 2CU5A 2QFEA 4O7XA 4A2UA 3W9AA 4P9IA 1AZDA 1AHSA 2RMU2 3MLKA 3WHUA 2WN3A 3PIJA 4I09A 4RL7A 5CEHA 5KBFA 5FZ0A 1SCSA 5LA1A 5FBJA 4XFIA 2IXCA 5FO7B 1C4RA 3ZYPA 1NKGA 3AMQA 4Q2FA 1E5SA 2DCKA 4QDQA 3GDBA 3O1PA 3O7OA 2IXHA 1OD5A 1JS9A 1OUSA 3MPPG 3UKNA 2C9KA 2D93A 2VR4A 3DUIA 5F2SA 5GLWA 1X33A 2EAAA 2ZAHA 2JKXA 2X05A 1DYOA 4QHOA 3I3MA 5IK4A 5DUVA 2PFWA 1RL3A 2DBNA 4UT5A 4D6QA 5KHKA 2LRPA 2UWCA 2YFUA 5GZFA 3FHQA 3T08A 5J7MA 1T2XA 4YNIA 2VMCA 3MIGA 1IHMA 4NHKA 5FY1A 1LR5A 3N4MA 4ITCA 5KHIA 1WLWA 4ARYA 3WV6A 4AI2A 1W03A 3WNKA 4UXAA 3VBFA 4D7TA 5DG2A 4I0AA 4R9AA 5FIXA 1EAH2 2VTFA 1G9CA 5L7OA 2A71A 1RITA 1AR92 3BN6A 1VPHA 4MUVA 4XW3A 3R6SA 5CFCA 4C1WA 1N1SA 4ASKA 1LULA 4W6WA 4UF0B 2BZDA 4DZGA 4N90A 1AR82 1C5IA 1X50A 3BVCA 2YU2A 2E7AA 1DLCA 5A3UA 1AR91 4LKDA 4NUBA 3BALA 3B94A 1LAJA 1IS3A 1ND2C 3EB7A 2D6NA 4G4FA 4QKDA 4E2GA 3OEBA 5T3NA 5IAXA 3S5AA 1UO9A 1SLIA 1G86A 2FDKA 1NE6A 4FPGA 1GP5A 1QEXA 4QDSA 1Q3EA 4DMIA 2DU1A 2ZACA 3VDBA 1REDA 1F9KA 4GH4A 3N3HA 3W5NA 1XBFA 3B9CA 3E6CC 1K5MA 1CWPA 4XHXA 1RUI3 2ZMLA 4IE5A 2ZKNA 2CSGA 1DZQA 1POV3 4CYDA 1UIJA 1YQ6A 2X09A 2W3JA 1N3QA 2CWSA 1NY71 1Z7S2 5A33B 4R52A 3E6BA 4MOAA 4YFWA 4AVBA 1W0PA 3T0BA 1XYOA 4GJZA 2W08A 1WMDA 2GNMA 1BBT1 3ILRA 1NUKA 1UY3A 3CF6E 4UFIA 1HRV3 4XAAA 4FAGA 1Q8QA 3PTRB 2WIIB 4Z07A 4B7KA 1WD4A 4A42A 5J09A 4HKWA 3MLJA 4I30A 3NKTA 3HIFA 4XTMA 3ELNA 5E1RA 3HBKA 4IW3A 5EJZB 5LA2A 3AVSA 1DQ2A 2XLFA 2P6HA 1E57A 1SHWB 4I02A 1SQ4A 2XBO2 4YG6A 1V6OA 2HWC2 5F8PA 4E2QA 2JJ6A 3OPWA 3OSDA 4AZZA 1C8M1 3IKWA 3RI9A 1G9FA 2E6VA 1V6LA 5I8SA 1WCSA 3ZN6A 2WWJA 5BPXA 3SCHA 2FMYA 4NRQA 3VBFC 4LOSA 1Q8OA 3KGLA 2Q1ZB 3LPFA 5HV4A 4HFSA 2G9ZA 1K5MC 2WA4A 3Q8FA 4YVWA 1ZM1A 4I3PA 5H9SA 5C3RA 2B8MA 4KH9A 1GBGA 2R30A 1FNZA 2P6CA 4H3WA 2DYCA 5TSWA 2Z2SB 4OMCA 3AK0A 3PJYA 4E4HA 1BXHA 5JXJA 1XXNA 2AUYA 4OHXA 3MV11 3I54A 3CZJA 3HQUA 2XG3A 2NQYA 1JZ2A 1AR83 1AXYA 4IL7A 4XJUA 1ND2A 1H4HA 4JQRA 4RFT0 4V2VA 3VLBB 1YC61 2IXJA 1GV9A 1XSQA 1OLQA 5FP3A 4Y22A 4WVMB 4JKMA 3H3UA 4WVVA 1JH5A 1O59A 3CO2A 3H8XA 3D5OA 1XE0A 4RN5A 5JMOA 2CYFA 4OI0A 2AACA 1ULPA 5AFEA 4Q27A 1WLCA 1KQRA 1QKQA 2Y6GA 2VMEA 2XL7A 3A21A 2FD8A 3WG3A 4MADA 5AVAA 3EXUA 3DCQA 2PHWA 4FOWA 3QBQA 4EN7B 2EF6A 1W3VA 2E51A 2GNDA 4OQ9A 4K8RB 2XJPA 3B3QE 3OY8B 1X82A 2RMU1 1VALA 1D0HA 4LXLA 3MUZ1 1PX4A 3ROUA 1JYNA 5GZEA 2XB6C 4RR3C 5FY5A 2JE8A 3VBSC 3AKSA 2C5DA 1D7PM 1YHFA 2F4LA 2ZHKA 1G6NA 2Z79A 3GGLA 4AGVA 1W9YA 2QE3A 3I2GA 4V1PA 2WO7A 4GA9A 4LBLA 4LEJA 5H9PA 4OUSA 2VGDA 1DG6A 2QQIA 3ZYIB 4LE3A 5EHDA 2VZTA 1BEV2 5A70A 1VBE2 2IFWA 3A22A 4W8JA 5GLZA 4COUA 2XJVA 1E5RA 3DGTA 3WDWA 3WW4A 5ABJC 2FZ2A 2P1BA 2OZJA 4AQTA 2Z69A 4FXGB 3EYPA 1HB3A 2Q5TA 4FCAA 5KXBA 1I3HA 3GZAA 5F3CA 1QJX2 1ZYBA 1Q5OA 1C28A 2WZR3 4INDA 3FUOA 4ES9A 4YLZA 3OUIA 3MF9A 4BXSV 4CP1A 1OFNA 1VAVA 3FBYA 1SEFA 1UU5A 4UW4A 3WNOA 4XF1A 3AP6A 4DY3A 1ZA7A 1JOJA 2PTMA 4OI4A 2W91A 3NW4A 4XDQA 3KHBA 5EQUA 1DZRA 3WSOA 4CEWB 2DV9A 1NCQC 4Q0QA 1RVF2 5JXIA 1IPSA 3K77A 3OBTA 2WO2A 2PHRA 2ZAAA 1QY4A 3OBAA 2IZWA 2WNUB 4K3UA 4QX0A 2WR9A 3LFMA 5E88A 3RRDA 3TNQA 1HXS3 1UY0A 4AFBA 2W9XA 4CZSA 3KF5A 2R6QA 1HB4A 4LKEA 1W6NA 2BUKA 1DBNA 3U78A 3IPVB 3IIIA 2IXIA 1J3PA 2YMZA 2VW2A 1T6BX 2J1UA 4QM9A 4YW4A 2W68A 3X29B 5JUVA 5FP4A 1IKPA 4G9SB 2MEV1 4XJ8A 5LY2A 3AYAA 1NA1C 4XXPA 5FZBA 4NR1A 5JZGA 3JBG2 4CU8A 5IK8A 2ARCA 3I59B 3R4DB 3BTYA 1IS4A 2XLGA 1EUTA 3N9NA 4UI9L 1IKQA 2HWB2 4RSUA 4YPJA 1WGPA 1PVC1 3M70A 1YEWA 1VRBA 4N43A 1J83A 3WW3A 1BBT3 1O3TA 4GH4C 2KA3A 2RS52 3SH4A 3WCSA 5EP9A 2EIBA 5C3QA 2WL1A 4AAXA 2WA3A 5IVVA 1BVVA 1UPSA 4UW5A 5BNNC 4Q4V1 1LGNA 1RJ7A 2HH9A 2VZ3A 5FXXA 4LK7A 3N36A 2AC1A 3AVRA 3CKHA 3OYWB 5FTTC 3RZJA 4JKKA 1H1MA 2P5BA 4IV3C 4A7KA 1PM4A 1PVXA 4QU2A 4GMP1 4UW6A 4TLGA 4AFDA 2J42A 1GZTA 3H3LA 5GM0A 4FQZA 1R1ZA 3MGUA 5CADA 1WW6A 4N53B 1JYWA 5KWRA 1BEV1 4CDUC 5BNPB 5KR7A 3CMGA 3NAPB 4IEPA 1CJDA 4EZ4A 3NV4A 1K5MB 1UKRA 4LBOA 5APAA 1FYUA 1RUF1 1D4VB 2ETEA 2R071 3L9JT 2BQPA 2IC1A 4IGQA 1UYZA 1ZZBA 4PQ9A 1NLRA 2FZ1A 3KCXA 4Y5TA 3ZDVA 5IFTA 2LROA 2YFZA 2J1VA 3PVEA 4TXWA 2ERFA 3S0MA 4P9LA 1QDOA 2VVDA 4XURA 2IVJA 3IB3A 1C3HA 1MS4A 4H55A 2KR2A 1QJFA 3UKTA 1DQ1A 2V5DA 4FPCA 3ZFFB 1Y7BA 1V6JA 2Y0IA 2A3YA 2Q8OA 1NCQB 1AJKA 2ZZJA 1RUE3 3K4ZA 2WWUA 2HWE1 2YPDA 4FPLA 2DUPA 4Z2AA 2DCYA 4AE2A 5FPUA 3AMNA 4AQSA 4LA2A 4BOWA 1UKGA 3UJOA 1DGRA 1W8ZA 4NMIA 1RB8G 5DN2A 3HOBA 3MIFA 1O4ZA 2XH6A 1H2LA 1KDKA 1LOBA 4CCNA 3WF2A 4MGYE 4NOTA 3ST7A 4FPKA 1JHNA 4PQQA 3UK9A 2XL9A 4QQHA 2HKXA 5C33A 1ZRFA 4J6GA 4PT6A 4YYOA 1MR5A 2W5FA 4BXFA 4HBNA 5FUPA 4HVQA 1J84A 3C7HA 5L9BA 3AP7A 3ZLIA 4GH4B 5T54A 3WT3A 2CAUA 4LO8A 4GB31 1O4TA 2QBXA 4AL9A 2FDIA 4CEWA 3OGVA 2SLIA 2W1UA 4E4DX 4LHLA 2C0ZA 3ZSLA 2HWD3 3BGAA 4IEQA 1VIWB 5F2WA 3VKMA 4YRDA 1JYXA 4RGGA 3DL3A 4M3CB 4N53C 3GYDA 4JGYA 1ND2B 3LDBA 3PL0A 1LJ7A 4Q4X1 4R4ZA 5DAPA 4PF5A 5D8AC 3USSA 4XIKA 4YM0A 3FC0A 2X8KA 3V0BB 4CDUB 5BNPC 5JZGB 2YBPA 3I49A 4JTNA 5A1FA 3I59A 1Y9QA 3IBMA 2Y34A 3OGRA 1X8MA 4RD7A 1ZX5A 1N3OA 2RJKA 3WF0A 2CHHA 2VZOA 2JDNA 5CYYA 3AXEA 2X5IB 4FPHA 4RGAA 4HPKB 2DVFA 3HR9A 3MHZA 2WO3A 3OD4A 1BYHA 4OFGA 2K46A 1VBA2 4B4RA 1RTVA 2YHJA 3JXSA 1XYPA 2K9ZA 2WWSA 3H0OA 3LKJA 3ZN6B 4Y1YA 1VMHA 3VD5A 2WC2A 1H2NA 1GOFA 1OF3A 4IESA 3KHCA 1DP0A 2CAVA 1UZZA 1MZ5A 1KJRA 1F2NA 1Q56A 1NZCA 1W9SA 3NMBA 4OHYA 4DINB 5GKAC 1HJGA 5T50A 4NIIA 4LT5A 5JXGA 3RVHA 2YYOA 1OPOA 2W94A 1VBA3 2Z4FA 1AR63 3RMXA 1EUUA 4XZPA 2NP0A 4N53A 1UD1A 2HWB1 4AVTA 5EWSA 3VD4A 5JOWA 3CHXA 5B4XA 3MW4A 1RYYA 2VCBA 3MIHA 5FV3A 1S1AA 5A1AA 2CV6A 4LKFA 3LEIA 3N7LA 5BXXA 3IDBB 3KGZA 1S2EA 4Y24A 3J26N 3DPRC 3K46A 2ZOEB 3KSCA 3LEMA 1UNBA 4YGDA 3AZXA 1GOHA 4LLOA 5FZ9A 1VR3A 1CN1A 1H6XA 2P17A 2VW0A 3S6PA 4CEWC 2QUOA 1OLMA 3DYPA 4KWKA 5CZKA 1WLDA 1LESA 4XF9A 2YU1A 3LCPA 2ZKLA 3C3VA 2BWCA 5DMYA 4YM2A 4RFRB 3UETA 4AFAA 4MGZE 4AEJA 1SFYA 1GP4A 2RS31 1GWKA 1QOOA 2AENA 1QJY1 3DECA 4HN0A 2GC2A 1FXZA 4MV2A 3WUDA 3LDKA 5K8SA 4LLFA 1RUG2 1ZZ9A 1RUJ1 2QCSB 4LK6A 1ZREA 1R092 3WF1A 5FYVA 1AX0A 2R0HA 4YW7A 4LQRA 2FDFA 3I2JA 3VHOA 4FBFA 5LA9A 4YZ5A 2R073 5A32A 3WCRA 2CWMA 1ULOA 2DVDA 4DFSA 4QX3A 1WMFA 5BUVA 1W8HA 3N9MA 3WOGA 2BNNA 4NAOA 5FDBA 1Y9MA 2HBTA 4LBNA 1VRH1 2TBVA 3W5MA 2BYVE 4NO4A 1RUG3 1R1A2 1PNFA 3G7DA 3TWIA 4WM7C 1R082 2WN2A 1HIXA 1GQPA 1LU2A 3UJQA 4J1WA 3I8TA 3JD72 5I93A 1XNAA 2R072 4O9EA 4BU2A 2A1XA 3JB4C 4BYYA 2BFUS 3I7DA 1RUC1 1CZTA 2D5FA 2ZPXA 2PA7A 3KT7A 1R1A3 4YWAA 3WVJA 3VKOA 4H7MA 3NNLA 2H6CA 2P34A 1K42A 1U12A 3OCPA 4LULA 4A7YA 2AEYA 1H2MA 1PK6A 3FL7A 3H1WA 4YW2A 2FQPA 3TN91 3WY6A 1IZ3A 1QXJA 4DOUA 4OUEA 5A3LA 3IT8A 5L36A 3Q8EA 3AZYA 1EV12 2VE1A 3LWCA 4D6SA 5FZ6A 4Q4W1 3WW2A 1XPWA 3NL1A 1JUIA 4CU7A 1W6NB 5K7PA 3MICA 3LOIA 5I8TA 4S2GA 5FY0A 1W6MB 5HI0A 5ABJA 1MVEA 4HOOA 4JDNA 2PHTA 2IXLA 4YVSA 4PIXA 3M4FA 2V09A 2HBUA 2HLEA 2BWAA 2VAUA 5A7NA 2HWE3 2RDSA 5CG9A 2JDKA 2A7AA 5BNQA 1V9U1 4HG6B 4XJ9A 5FP9A 4BMBA 3CDZB 3B02A 1LENA 1OLRA 3ZYRA 3RZZA 2BJSA 4QAWA 1XYNA 1W28A 3NNMA 4DXRA 4N9IA 5IVCA 2D43A 3RQ0A 2YC2A 5H9RA 1W8WA 1PZ8A 3WP4A 1UY2A 2RJLA 4ZONA 3VHRA 4EZHA 1QU0A 3SCGA 3KF3A 3OGJA 1Z7S3 3CJIA 4IETA 3MFAA 3DYOA 1PO21 3HNYM 1R093 1RMU3 3OGSA 1ASJ1 2MPFA 5LBFA 3U37A 4CP9A 2JIJA 3A0NA 5CU1A 4YW5A 5JOZA 2ZGSA 4C0HA 4R4XA 2GMEA 4O65A 1S0JA 1CONA 2R1BA 4LIUA 5LK5A 3QACA 4QPGC 3LF7A 1COV2 1GSLA 3I3QA 3OUHA 1UXXX 3BI3A 3FX3A 3GBWA 4XMAA 2W1QA 3WF4A 3QLQA 5I0RA 4QPWA 1QJX1 5JIUA 3UKVA 3S57A 3GALA 4YZ2A 2EIDA 2DUQA 2BBVA 1XQNA 4OHVA 2BERA 5JSOA 4M3CA 2D97A 4NHXA 4LIVA 2GH2A 1TE1B 1TMF1 1JYTA 3KZ4C 3N9OA 2UU8A 1EPZA 1PGW1 2DCTA 3Q9OA 3GJBA 1OQDA 1TME2 2MNGA 3AMMA 4IE6A 5A3WA 1MQTA 2ATFA 3M8LA 2PHXA 1S0GA 2G9GA 5DDJ1 3EO6A 3RSJA 1AYN3 2GSYA 3N9PA 3HWJA 2ZGTA 2YROA 3KD4A 1OFSA 4OULA 5DAVA 2W39A 3QOPA 4IV3A 2VOXA 3OGGA 3C2UA 5F6LB 2VG9A 2A6VA 2VPVA 3IAQA 2X5IA 5H9QA 4Z2WA 2O8QA 1XJAA 4HXCA 1FMD1 3ZIXA 2Y8KA 4BPZA 2BVBA 2GP3A 2WKKA 3J7HA 3ZPOA 2E31A 2JG9A 2QQLA 3BOWA 1KDMA 4HVRA 4EWEA 1RUI1 3MV01 4LOTA 1SCRA 2NLRA 2ZGOA 4LTAA 3KV5A 4ZU7A 4JV4A 3LA3A 4Z92B 5DXDA 1H8TB 2EXJA 5IVEA 4R9DA 2WT2A 3FMGA 5HCBA 4J1XA 2Q30A 4P5HA 2VO5A 3FFZA 4LBQB 1EPWA 1UY1A 1DFQA 3N35A 2JIGA 2RDQA 4GB32 2PAKA 3O1SA 5FK7A 1VP6A 3IDCB 1CX4A 1OOPA 1SZBA 5JI7A 1V6KA 5T5LA 3W58A 4CCMA 2VZRA 3HN1A 3VD7A 3U4XA 1SBFA 3B9IA 3FLTA 4HSJA 1TVGA 3MIBA 3MLLA 5DAWA 2I45A 1F4HA 2AEZA 5K4LA 3O1OA 2R042 4FXKB 1MZ6A 4A41A 2D6LX 4XBQA 5JI9A 3ZXKA 3OYWA 3V0BA 1XU2A 4F3JA 1RMU2 3QH6A 4HONA 4XIOA 1W2TA 4AOCA 1RUH3 1UF2C 3ZXFA 4ISQA 1S0FA 3K3NA 4JHTA 4CCDA 2JICA 3N7JA 2Y33A 2D6KA 3ALQA 2Y6LA 2XQRA 3ACFA 1I1EA 3NAPA 1LB2A 2XMLA 3WP6A 4PBPA 4JKLA 1JBCA 1HV1A 1VBE3 3ZFGC 4DXSA 4QB2A 2XLAA 3MFCA 4WV8A 1W0NA 1O8SA 1XE8A 3K51A 4L92A 1I6XA 5JSRA 5E89A 2HWC1 4LBKA 4CEYC 4Q1RA 3TAYA 4NRMA 4WM7A 1LRHA 1YYNA 4F83A 3I3EA 4AXOA 3ECQA 2IUWA 5HXVA 1TME3 5A6QA 4TSVA 2DTWA 5EJ1B 1PO23 3I3DA 4IEYA 1IS6A 1UOBA 3T2TA 1PM7A 1RJ8A 5DDJ2 2A70A 3SHRA 4Q0UA 1KGYA 4RQPC 1F35A 4XQWA 3RS6A 5JSPA 3WNMA 3WDYA 5FKBA 2R16A 2J1EA 3TRSB 3WP3A 2DFBA 4MGSA 2B4KA 4RGKA 1V70A 2QVSB 4AW7A 5FPAA 4DXZA 2VTXJ 1ZBE2 3VDDB 2CNAA 3PUQA 5J1XA 4AEDB 3VBHB 1ODNA 1HN1A 3IDEA 3UYJA 3VHPA 1XNBA 2Q8DA 4BHPA 2WZEA 2JE7A 4Q0VA 1BZWA 1J1TA 1CR7A 2C1FA 4FPEA 4MVTA 4QGLA 4S2FA 5GZDA 5FPBA 3KQ4B 5IATA 1G8WA 1OKQA 4Y5Z0 5LZ6A 2J7MA 2JDYA 2WLPA 5I0UA 4KQ7A 3RNSA 4WZFA 2CTVA 4XFCA 4XUNA 4ZZ5A 4IV3B 3LSEA 2RR13 4KWJA 5L19A 3UGFA 5DABA 1VLNA 2ARBA 2Q4SA 3T4VA 1QNYA 4QWNA 1FV3A 2P3IA 1V0AA 3E97A 4XMIA 1Y43B 4GAZA 3USUB 3JBG1 4QGNA 1WCUA 2WT1A 1A34A 2AYHA 2R043 2VQAA 4QX7A 3CLPA 1FMD3 2WQ8A 2ZMKA 1GKBA 4AVSA 2D6OX 4EV0A 3CU7A 3KVBA 3MIDA 4PLOA 5FOJB 2EXHA 1L7LA 4RHV2 4ZKTB 1F31A 1S0BA 3M3CA 4BQ5A 2ZX0A 3ZSJA 1H6YA 3KV6A 4IEOA 4D7SA 3V0AB 5FXZA 3F95A 1U5ZA 2VUAA 3AJZA 4OVEA 5IWFA 4UFKA 1UN1A 2WYFA 5IVJA 4LORA 1RUNA 2QQMA 4CEYA 5FPVA 2RDNA 1LOEA 2VD7A 1O3RA 5IUQA 3IMNA 1AL0G 5LEKA 3VBOB 5F1RA 3CIHA 2ZS6B 2VMIA 3THCA 1FPN3 1PNGA 4XOGA 5IVYA 4YM1A 4FFIA 3FLPA 5KXDA 1X9PA 1R083 3MUY1 1AYN2 4OI1A 4GIQA 4CCEA 1CPNA 4CDQB 5CKNA 1G9DA 3GBFA 1B35C 5BV6A 3U0ZA 2LW8A 2VQ0A 5FZ7A 1IPKA 5F5QA 4YSFA 1HRV2 1H1IA 1ULEA 5JVVA 3RI8A 4WVMA 2A6YA 5FZMA 5E16A 4CCLA 4PIZA 4CUGA 3BIEA 1GLHA 3WNXA 3THTA 2NYYA 2TEPA 4LKSA 3AP9A 5F5CA 1JOPA 4NPLA 5EXOA 2RM23 1NQDA 1AXZA 2CGOA 2PLV2 1LOGA 2V73A 2OXBA 1VAKA 1PZ9A 3A23A 3ON7A 4TTGA 4FSJA 1GANA 4GZ9A 3WUCA 3S7IA 3JBG3 2VL4A 4PI0A 2ARAA 5FJHA 4DRRA 1LCLA 1OXCA 3WP5A 4QX8A 3HAGA 2P3JA 3K48A 4COYA 4DRVA 4N7IA 2JG8C 5FMOL 3VBRC 2LM3A 1BK1A 4WZCA 1XNDA 1DQ4A 4XUPA 3THDA 3T30A 4M0NA 1TG7A 4Q4X2 1HXS1 4MX3A 5FK8A 2XXZA 3ETQA 5C9AB 5L73A 3PUHA 2RS53 4IEZA 3MDPA 4H14A 3WLUA 3AMHA 3POEA 5EZWA 1BCXA 2L9LA 4IXLA 4P5YA 4QKBA 5JR7B 1GZWB 1AXKA 4JGZA 4QU1A 3U14A 4GMP0 4EE2A 5I91A 2JXAA 4DS0A 4M4RA 2Y64A 5F5IA 3NJZA 1NCRB 3ACHA 3V65A 3LE0A 4L0PA 1HN0A 2HEWF 3FLRA 1CZSA 3OF1A 1JN2P 3EHKA 4QPIC 3T09A 5L9VA 1WD3A 2D6PA 3MIEA 5D8AB 3MBWA 2BEOA 1MS5A 2B42B 3KB5A 2BGPA 4KBBA 3GM8A 4XHBA 3JZVA 1SDWA 1OOPC 1W2OA 4Y20A 3PVBB 2PQSA 4FP3A 4LJHA 5A7PA 2YC0A 2HEVF 3E1F1 2IXKA 3GNEA 2ADDA 1BHGA 3ILFA 5K0UB 2JE9A 2VBBA 1W6OB 5EYXA 5F32A 4TWTA 5FY4A 3O1VA 2VU9A 3FZ3A 1AR71 4QXBA 3TNPB 3VKFC 5HXMA 3DXTA 5SV5A 4E27A 2Z5WA 1JW6A 4BQ1A 1WCKA 2Q0AA 4NIHA 4FAHA 3M3OA 1QQP1 4QX1A 2MEV2 2VVFA 3D4KA 1KEXA 2W1WA 4AI3A 1W8TA 2DURA 1RUE2 3DEMA 4C91A 5A80A 2RJ2A 1ZBA2 3DPRA 4GXLA 3BU0A 2JD4A 5C3SA 2ZX1A 5DUXA 4ZHNA 3WQ0A 1Q43A 1VB4A 2OPWA 2F6BA 1K45A 2Y0OA 5C6CA 2CY6A 3Q8BA 1WW5A 3VDDC 3I2FA 4BA6A 1JZ3A 1NYWA 2R7EB 2RG4A 3O0WA 3VL8A 4AHWA 2XDVA 1ACCA 4AQ6A 4IEXA 1C5HA 4NIGA 4YW6A 1GQGA 1PMHX 2ENRA 2XWJB 4QPIA 5IK7A 5C8WA 4CXWA 2VTXA 5FMCA 2QQWA 2VNOA 2YPJA 3CQOA 3TEWA 4N7UA 1RHI1 1UMIA 2E9QA 1HV0A 2P3YA 2GNBA 2SBAA 1ENXA 1VMJA 2F4PA 1WLTA 2ZGQA 2BFUL 4ZPIA 3HQRA 4FOQA 2Q8EA 3SH3A 3ZXGA 1UYXA 2GH8A 2A75A 3HD8B 1ZZCA 1H2KA 3H7YA 1TME1 4AVVA 4LO6B 4Q4Y2 5EV7A 3POWA 2X29A 3CNAA 4GWNA 2WFF2 3RYPA 2JDMA 1YIPA 1HKDA 3T2OA 4CP0A 1GOGA 2GALA 5LB6A 4CXXA 4YM3A 3URFA 1UX6A 4DNYA 2WS92 2BVVA 2I07B 4ZXKA 5BY5A 4PHZA 4AVAA 4DO0A 3FUQA 2A3XA 3TN93 3WR0A 4B3NA 4ET7A 2G4IA 4URAA 3AYCA 1JOBA 3RZGA 3VBFB 4KI5M 4Q4Y3 4Q4W3 2R49A 5F7UA 2ZABA 5FZHA 4AEMA 3VDAA 5CNAA 4GWJA 4K6BA 2DTYA 3ETPA 3ME2A 4DQAA 3DYMA 4A44A 3D6EA 3MEPA 1NXMA 4BQXA 3AMPA 4BIFA 5AC91 1PK6C 1UMZA 4MHUA 5SV8A 5A3TA 2D7FA 5GLVA 3AKQA 4RHV1 2X5IC 5HCFA 1XNKA 4BQWA 1J58A 1MS3A 1OF4A 2TUNA 2B7YA 3ZO0B 2BGOA 4NHMA 4ISRA 4PJYA 1BMV2 1ULGA 2VECA 3RYRA 4TN7A 4QDRA 2WABA 1QGLA 4X6RB 3ZN5A 3S7EA 1FV2A 2HWB3 2LS6A 4LMFA 1FPN1 5HBAA 4OMDA 4Z82A 4K9SA 2UYAA 2AREA 1UCXA 3CJXA 4NPMA 1Q8PA 1BK0A 2PAEA 5FXWA 2WINB 4CDWC 5DPNA 4YW1A 2CDOA 1ASJ3 5CA6A 5ACA3 2JDHA 2D3PA 4I3GA 2WT0A 5C4WA 1CAUB 1GWMA 1LHUA 1E5IA 5JLVA 2R041 4LO7A 3D8CA 1UXZA 5JR2A 2FBEA 1S2KA 4JDMA 1SDDB 3USUA 1F5FA 5FQ0A 2RM21 1SLCA 3IPVA 1YI9A 5C5TA 4HT1T 4P9WA 3RWKX 5LBEA 4P14A 3A4UA 1H30A 5FY9A 3H1MA 4OYUA 1W0OA 5FUNA 1YRZA 5FYZA 3VZOA 1SBDA 4B4PA 2JENA 3V56A 5BNNB 2QQJA 1W8OA 3CJIC 3WX5A 4MGIE 4E4SA 1JXNA 1AVBA 5IT6A 4GALA 5FLJA 1B09A 3P1IA 4CEYB 1VAMA 2CGPA 2ZGRA 1W90A 3UNPA 1W2AX 1OQEA 1YFXA 4D8MA 3GCXA 2E53A 1AL23 1Z0HA 1C8M2 5A1LA 5LA0A 3HEIA 2O0OA 4Y26A 3HNMA 3FBMA 3AZVA 2ZEWA 5HV0A 5C8CB 4OLLA 3N7MA 3SNMA 1CAWA 2JDPA 4OHWA 5F3EA 5FZFA 1HQNA 5FYBA 4CPBA 1MZFA 4L8QA 2D98A 3M1HA 4XUTA 1UZ0A 2X53S 1A6CA 5FZIA 4XQDA 3ZR5A 2DCJA 4MGTA 4ZS2A 1O7FA 1YLLA 4CCOA 4FTEA 4A7ZA 1VBD2 1W04A 3ZFFC 3IZOA 4BJ0A 1ZBE3 4KBZA 4XF3A 1OOPB 4SBVA 3IIAA 3LA2A 2ZGNA 1IPJA 5FY8A 3VBSB 2JDUA 3ZYHA 4AGGA 4BZ4A 1O4YA 1ND3C 3AFGA 3E5QA 3TYJA 2R1DA 1H1AA 5JWPA 3BU7A 2DDUA 2YY1A 1GNZA 4MXWA 4DIQA 5IHRA 4UBGA 2HEYF 5FAXA 4LHNA 1V00A 1HB2A 1MQTC 3NVCA 2PN5A 4KGGA 4Y22B 2Q8CA 1RUG1 1W2UA 5CKMA 2WLQA 1OBNA 4P9XA 5KC6A 1I5PA 4LPLA 5CIRA 1RUD3 2Y60A 2D3SA 5LBBA 1F5JA 1KITA 1MEC2 2WQ4A 2XWBB 3NO8A 1GMMA 3IWZA 4FTSA 3I2IA 2CGNA 4DEQA 4W4ZA 3ZMNA 4Y4YA 3RG0A 2XPJA 3KLSA 4N9HA 3WNNA 1Z78A 2ES3A 1PO22 2BNMA 4PLMA 4Y1ZA 3ACLA 3AYDA 1A3KA 1C57A 1FPN2 1LOFC 1RXFA 1U5XA 2RS12 3HVDA 1SPPA 5FZCA 1MEC3 4BQYA 2FDGA 4HK8A 1MS8A 2V72A 4YZ3A 3O0XA 4Y4RA 4XZUG 4A3ZA 5K0UC 3OPZA 1DGRN 2A3WA 3I4IA 5AFBA 2C4XA 3LD8A 4Y20B 5F37A 1O3QA 1SBEA 4AEKA 1QH7A 1ENSA 2ZZQA 4ZY9A 3RWNA 4CXYA 2VCCA 1FNYA 2HWF2 2WRAA 2DVAA 4XFGA 1GZCA 4Z8BA 1QQP3 1CPMA 2D3RA 3LAGA 4XQ4A 1OMIA 4D69A 3BPZA 2QJVA 1H8TC 1TQ5A 3K3OA 5IW0A 3RGBA 3O1TA 1KFUL 3WQ7A 1AL22 3CL1A 2UURA 3J8F1 1CAUA 1V6MA 1WW4A 1DU3D 3SH5A 4C1XA 4XJAA 1LHVA 1HX6A 4QGMA 4KWLA 5HCAA 2NZ9A 2VUJA 5IAVA 1VMFA 3ZOIA 1KFXL 4B29A 3SEPA 4XF4A 1QDCA 2Y6KA 5FQ0B 4D7YA 1Q8VA 4UFHA 1YJLA 5A3PA 1L3JA 4QM8A 1JZ6A 4LR4A 1WWYA 1L7RA 4Q4Y1 4CTEA 1NY72 3DXUA 2O8OA 1I9RA 2VNGA 1HJFA 2XVGA 1VBD3 1OH3A 2DU0A 2XJSA 2JD9A 3AL6A 1ZRIA 3HBZA 4Q26A 3POFA 4JZRA 4QPYA 4RHV3 1QJZA 3GF6A 1RUC2 3C8XA 3H42B 5FJKA 3GHNA 4CSWA 1X7NA 2Y6FA 2B39A 1H9PA 5CFDA 4W65A 1WW7A 2Q1FA 3FWEA 1ASJ2 4JX0A 5EYYA 4ARXA 2VOKA 2ZMNA 3I2HA 4IQPA 4A6SA 1LHNA 2I2SA 5CFCC 3AKPA 3ATGA 3L2YA 1FI2A 4P00B 5T52A 1DZTA 1PIV1 5FBZA 1APNA 2JX9A 2VNRA 1KJLA 3LGRA 4OQ8A 3BYWA 4LE4A 3E5UA 4XILA 2PHDA 2Y6HA 5FREA 2FMDA 3O0VA 4AFMA 5C70A 1RMU1 4JAAA 4NE9A 2RMU3 1IQAA 1REEA 3Q8CA 1Y4WA 2VXJA 2YXSA 4LHKA 4XUQA 1GUIA 2XQXA 3LA7A 3O1UA 1STMA 3AB0A 4X6QB 3OD0A 3DN7A 4CDWA 1ULDA 2RM22 2ORZA 1US3A 4CUCA 5A6XA 1V9U2 1SG3A 1XNCA 4BM8A 1VBC1 5CKQA 3ZR6A 3LDRA 1US2A 1W6PB 1XU1A 4DUWA 2OUJA 1YUDA 4AHYA
chains in the Genus database with same CATH topology
3M7AA 1ONAA 2AR6A 1C8M3 1SLLA 1GFF2 4JRAA 1XRUA 2OUHA 1POV0 2WQZC 1ZZ7A 3INAA 3LSDA 4MSVA 2PYTA 1C8NA 1J1LA 3LZZA 5C8CC 2TNFA 3OJBA 1BMV1 5C4WB 1FAYA 2MHFA 3J9SA 4YVWC 3WDVA 1A8DA 1EAH3 4XFBA 3VZKA 3TB0A 3HMYA 3JQWA 1ZA4A 3U10A 3W59A 5JCTA 4NWWA 3HT2A 4DB5A 2B5HA 4RS5A 1PIV3 3CJIB 1ND3B 2BGCA 4K7JA 4GWMA 1LECA 5BYNA 2GMPA 1FOD3 2ZGMA 2ZHNA 2VH9A 3ES1A 2GC1A 4S2HA 2R0FA 1SFNA 2DVBA 4X8PA 1I5ZA 1RUH1 1RINA 2PLV1 1VBC3 4QT6A 1TMF2 1RUC3 2YZ4A 1S0IA 1DQ5A 4YFZA 2ZGKA 1U5YA 4MLOA 1J59A 4K40A 1RUJ2 3WW1A 1HRV1 2PHLA 2WFPA 1PZ7A 5DZGA 5K9YA 2UYBA 2K2SA 2IFRA 3HQXA 1AF9A 1ZBA3 2B45X 3NAPC 1TEIA 1MVQA 4FTBA 3JB8A 3SXWA 4AHXA 4F7ZA 1OPMA 1PK6B 3WINE 3LOBA 2QKDA 1AR73 3B7MA 3H9AA 2XVKA 5CFDB 5E8AA 3GHMA 1CESA 3JU9A 4K21A 4P9JA 2DVGA 5KXCA 1EP0A 2OVUA 1UAIA 3JD73 3ZPYA 2UWAA 4YVSB 3WDXA 5KXEA 1ENQA 3ENRA 4GKXA 4JC1A 4QD2A 3T1MA 2PQQA 1YCIA 4U2AA 2WZR1 4QQOA 3RYKA 1QJU1 4JCKA 2JECA 2WNVA 4NPRA 3G6JB 4YVWB 2WFF3 2W52A 1OSGA 4D3WA 5L7OB 2R063 1JYCA 1PGL2 1HQLA 2AZ5A 2V5YA 2VMGA 4QQLA 3AM2A 1QJX3 2WS91 3B69A 1CAWB 4HL0A 2H0BA 3MZHA 1DHKB 3ZYJB 4YW3A 4XBLA 4LUKA 3SLIA 2A5ZA 4W6XA 1AR62 3ZFEC 2R062 4Z1VA 4PDWC 3PVOA 5FFOC 1GQHA 3QH7A 4EROA 4QQ2A 4YG0A 4YG3A 1ENRA 1N3PA 3OY8A 5FO8B 2XVLA 5KHJA 4FOVA 1YFUA 4XXAA 3JD71 3MF6A 1W6MA 4JRLA 1LTEA 5A33A 1S0EA 5ACA2 1FT9A 1N47A 5J37A 2E7TA 2JEMA 1ND3A 5DUWA 1O3SA 2ILMA 1DDLA 4CDQC 2GNTA 2XKPA 3VBOC 2GDFA 5FLIA 4YGCA 4IEVA 4KG8A 3NSTA 1WUVA 1CAXB 3VBUA 1B35A 4E9KA 4Q4V2 3RPQA 1MS0A 1AR72 2HYKA 2Q1MA 1NOVA 3RJRA 4SLIA 2PLV3 1DF0A 2RS51 2EAKA 4WM8B 1LEMA 3AFKA 3DKWA 4KNCA 2FHRA 4XFHA 1QJY3 1U0AA 3EQEA 1C1LA 1HDKA 3B5LB 3BIWE 5BNNA 1VB2A 5JAXA 1D2SA 1UIKA 2VOWA 2VMHA 4RR3A 4AI1A 3AZWA 3PMSA 5J48A 5L7OC 4HSLA 4O9GA 2RHPA 4LBQA 2JDZA 3ZSEA 4AGRA 2D5HA 3VBRA 4DPNA 5FOBB 1SACA 5DG1A 1AR93 1J3RA 3RMYA 2ZBJA 1SLAA 5LRSA 2OYZA 1ZZ8A 1EY2A 4DY5A 1ZVFA 5LEJA 1BKZA 1RC6A 4ZU5A 1GZ9A 2XBO1 5C4WC 3B01A 1TNRA 3GZTB 2WNVB 4G3YC 4M00A 1POV1 5T5PA 3VBSA 1LODA 2WFF1 4A3XA 1A78A 4RQPA 3NV1A 3OTFA 3PJQA 2RE9A 3H50A 1RUD1 2R061 2OPKA 2QZ2A 1GR3A 3VL9A 2JG9B 1PGW2 2MEV3 3POSA 1DGLA 4WM7B 4NWVA 4NVPA 4XF0A 1CVNA 1DGWA 1H4GA 1Z7S1 1HQWA 1DIWA 4TLFA 3VBHC 1QNWA 2RR12 5FMOS 1A8MA 4FPFA 2LTNA 4Q0SA 1FATA 1PO11 5BNPA 4HMZA 5CFCB 4S2DA 2WZPP 4FVVA 1REFA 3DF0A 2ZX3A 2HWF1 4Q4V3 1S2BA 1LHWA 1H0BA 2OW4A 1YFYA 3VDDA 1MZEA 1CAVB 1RHI3 1V6NA 4MZUA 4HK9A 3H1YA 1AYM1 5LRRA 1G9AA 2UY8A 1PGSA 2XBO3 4L99A 1OQ1A 1AR81 3ZFFA 3WD5A 4BWOA 2EALA 1OA4A 3J4UH 4QX5A 1BEV3 4CDXB 1WBLA 3FE5A 1OI6A 1G9BA 3PTYA 1GZWA 4JGZB 4ORFA 4NN0A 1QHDA 5DDJ3 2ZX4A 1RUF3 4C0BA 4FOYA 4QQPA 1CAXA 3AP5A 4FO9A 1QXPA 2YV8A 2NMOA 4X8NA 3ZFEB 4FPOB 1OA2A 5CAZA 1N1TA 3WDTA 3RJ2X 4AWDA 1QOTA 3RDIA 2W0XA 1LOFA 2WJSA 4EWDA 1GNHA 4XPVA 5K0UA 2VY0A 3V0AA 2HWE2 4MYEA 4AI0A 2ZGPA 4B7EA 2VXRA 3M3EA 1NQJA 2XUMA 3KMHA 3I2DA 1HXS2 1NE4A 2BPA2 2R32A 4E4ZA 1VBD1 4HVOA 2NN8A 3FHIB 4Q4X3 4K1YA 4QXKA 3D82A 3VBHA 4KL1A 2D6MA 2UY9A 4CDQA 1V6IA 4W6YA 2HWD2 1RIRA 3AP4A 4Y1XA 1YWKA 2JG8A 1AUYA 3O14A 4QPGA 1AJOA 4PLNA 4IEWA 1JUHA 1NXD1 4GB33 3H8UA 4IERA 1YI7A 2NPIA 5FPXA 2GC0A 1BVP1 2GN7A 4UBHA 4K1ZA 1ULFA 4MH0E 1ZZ6A 3ZXEA 4ASMB 2WNUA 4KU8A 3WG2A 4LBQD 3WDUA 4ES8A 1W6QB 1BJQA 3AJYA 4M3CE 5KC5A 5CB7A 1R091 2ZTNA 2ET1A 4BMEA 4LBJA 2WSUA 1QWRA 4AVCA 3GZUC 5A3MA 2VULA 1COV1 1QF3A 1YNAA 1NCQA 3KS7A 1QMJA 2ZHLA 3JUUA 1GYKA 4FT8A 4BE3A 2WZR2 4OHZA 4AFCA 3WG4A 2VVEA 1LKNA 2UWBA 1HLCA 4COZA 2HJIA 5J36A 1DQ0A 1WCDJ 3N7KA 4K8FA 2WNVC 5GLTA 2WNEA 2D44A 1DYKA 2HWF3 1IGOA 2PHFA 4YGEA 2DCZA 1CAVA 2DUOA 4FQ4A 2N7GA 5FPZA 3BOPA 3E5XA 3ASIA 3ZXLA 4OI2A 1U5IA 5AC92 3M3QA 4IV1A 3PLQA 3VKNA 1MEC1 2C9AA 3A0KA 5GZGA 4JGYC 3FJSA 2JG9C 4R9BA 1C1FA 4LNVA 3APBA 2XKOA 5CVRA 2PHUA 2RR11 3VGIA 3VV1A 1ZBE1 3KT1A 1FX5A 1MS1A 1BBT2 1JYIA 2Z42A 5AVPA 3QCWA 3H3ZA 2GMMA 5C9AA 1PO13 3D0JA 3TN92 4AK3A 2P2KA 4EN6B 4MXVA 4YGBA 4CDUA 1PHMA 4RS5C 1VRH3 1ALYA 4I01A 4PDWA 3KQRA 3SITA 2EXIA 3V64A 1KS5A 4HPKA 2LUWA 4RQPB 5KHHA 4WVZA 4C90A 1NCRC 4EN8B 3AKTA 3AKRA 2GN3A 3J8F3 1UU4A 4GQ7A 1R1A1 4XETA 2WSVA 2EA7A 5GJ6A 3T1LA 4Y1UA 3VZNA 1W6OA 2JG8B 3VZLA 4ATEA 3ZFGA 2XGXA 2RS11 4R9CA 1J3QA 4MGKE 2GC3A 2K0GA 1S55A 3JCIA 3S30A 2KM2A 1QJY2 2EIGA 3DPRB 3ES4A 1W6QA 3ILNA 1NLSA 3MW3A 5J98B 1EV13 5J3UA 3B00A 3SCFA 4MXWB 1AYM3 3AZZA 4I0WB 3UL2A 3R05A 4AG4A 1NG0A 5ABJB 3UV9A 2XJQA 1D2QA 2H0VA 1YO8A 1PMIA 4L9BA 1KS4A 5DZEA 5EJ3A 4L2NA 5AC93 4XJWA 5T55A 5BNOB 2E63A 4LO5B 3QD6A 3VZJA 3AX4A 1AX2A 3ZN4A 4EN9B 4CDXA 1ZNPA 4AI8A 4M01A 5JMCA 2EVXA 3VN4A 1DQ6A 4Q8KA 3FFQA 1DLLA 1CJPA 3TBDA 4YZ1A 4UW3A 1QH6A 2YGLA 1X8EA 1HW5A 1D4M2 4U36A 5GZCA 1LOCA 4YVSC 3ZXDA 3B93A 3BCWA 4URTA 3ZSKA 5I0SA 1VRH2 1NCRA 3NV2A 3M3IA 4LO4B 5CBLA 4L11A 1B35B 1JTZX 1CQ9A 1KXGA 1D4M3 5D8AA 1G7YA 2QQPA 1T6GC 1VBA1 2YUEA 1NA1B 1UZYA 1N1VA 5JIAA 2DFCA 2YGMA 4META 1CD3G 1AL21 3J8F2 2ZJCA 4I2OA 2JKBA 4RR3B 5DZFA 1YFWA 2BNOA 1MQTB 3DV8A 4HETA 3O12A 3VKLA 4KG0A 1PVC2 2DF7A 5JOYA 3ZDSA 3GBGA 2BTVC 4PDWB 1FOD1 2ZHMA 3NWKA 3VBRB 1QJU2 5F6KA 2ARXA 5GALA 3PMEA 4NHLA 4M3CF 5DUUA 3ZYGA 4JGYB 3ZFEA 2GAUA 1HRI1 2E7QA 3L2HA 1AYM2 1PVC3 3VBUC 4FPYA 1XE7A 2RS33 2DWRA 5CG8A 1EAH1 3H7JA 4PBOA 2IWGB 4JGZC 1YXWA 3EJKA 4HZFA 3ZXAC 1D0GA 2ZA9A 3ZFGB 4ATFA 4JTOA 3NKGA 4FPJA 1O91A 4I0BA 4QPIB 1OHFA 2PAMA 4EN0A 4XJZA 3VUOA 1AX1A 1PO12 4IV1C 2OIIA 3P3NA 3OBRA 3ZXJA 2ZCWA 1CIWA 3E6DA 4LUMA 2XJRA 3LB9A 5JPNB 4BLIA 4BIOA 5JPMB 4AQ2A 1EV11 3KM5A 5CFDC 2ZGLA 5JOXA 1UL9A 5IK5A 4QPGB 4WM8C 1VBB2 3WQ1A 4H7LA 2QDRA 1RUH2 1W39A 1VBE1 3PVNA 4B8EA 2A73B 2QNKA 2XJTA 2G9FA 2GU9A 3WXPA 2AGSA 5ACA1 1LEDA 3ZVXA 3BB6A 2NM1A 3IM0A 1LOAA 2QZ3A 3BODA 4Q8LA 2RS13 5D1IA 3THPA 4BH9A 1RUF2 1R081 5I8YA 2LALA 3BTAA 1X36A 3ZSMA 3NV3A 4N43C 2PELA 5FLHA 4F8AA 4P9YA 4M0HA 5KHGA 1H8VA 3MW2A 3R0RA 4PIYA 1CGPA 1KD7A 1EYBA 5FO9B 1VBB1 5I0TA 2VOVA 2XHKA 4ONUA 4K20A 1V9U3 1ZRRA 4TZDA 1QJU3 4IEUA 2O1QA 1IS5A 5FRAA 4BCUA 2RS32 4ASLA 1MACA 4Y1VA 1IOAA 4HLTA 4ZU4A 3EBRA 1H9WA 5A32B 1S0CA 4HN1A 1RUOA 1QOSA 4B4QA 5JDBA 1KRIA 1F8VA 3KCCA 1M4WA 3PHMA 4BLJA 1ZRDA 1SMVA 1TNFA 2QDNA 2B46X 4CDWB 5FCCA 4XTPA 1LGBA 3KCYA 1UPIA 5C8CA 1PIV2 1O5UA 4Q29A 2ET7A 1FOD2 3JQXA 1RVF1 4COWA 5EFUA 4OUMA 2H6BA 4Q0PA 3P3PA 1VBB3 4QMAA 4AEDC 5BNOA 3AYEA 3MPBA 3ZIWA 1FMD2 4FP2A 1N1YA 1TMF3 3MI8A 3ZX7A 4AF9A 5C9AC 1O5LA 3PNAA 2EXKA 3IN9A 2I74A 1RUJ3 4N43B 3MYXA 1LU1A 1COV3 3HT1A 4D94A 1RUD2 5F9TA 1AR61 4YARA 1DGWX 2A6ZA 4GMP3 3WG1A 4RS5B 1RHI2 4OZXA 3WHTA 4EJRA 2BW8A 1ZRCA 1ULCA 1H8TA 4COVA 1YIFA 3WZ1A 1AYN1 1YJKA 4PCRA 3KT4A 4R8HA 4KGQA 1PGL1 5LK7B 2A6WA 1OA3A 5B2GB 4HANA 4GKYA 1D4M1 4WBBA 1HRI3 2B9UA 4AYUA 1URXA 2D40A 2Y26A 3POYA 4XFFA 4XYXA 4TYSA 2GZWA 1ZBA1 1RVF3 1NA1A 5JZGC 4KU7A 1RUE1 1W6PA 4AEDA 4CRQA 2P37A 2WNUC 4HKLA 3R4UA 4HKOA 2XJUA 1HRI2 1QQP2 3U11A 4RA0A 4YZ4A 4IV1B 1WBFA 1UU6A 3D0SA 2NMNA 3SMHA 2AH2A 4P9GA 2HWC3 1WMEA 3M2MA 5J96B 1VJ2A 1LGCA 4CP2A 3VBUB 4XEZA 2YDEA 1VBC2 5GLUA 2Y38A 5BNOC 4WM8A 1DYPA 3AXDA 1Y3TA 4Q1PA 3CEWA 2WS93 4LA3A 4XE9A 2ZGUA 2OA2A 1MS9A 4AHZA 5T5JA 1SLTA 2CL2A 3TOJA 3VZMA 1LHOA 5T5OA 4Q4W2 2VW1A 3R4SA 4E2SA 3VHNA 1UW8A 4QHBA 1WA4A 1SLBA 2ZX2A 4LBMA 2KXLA 2OZ6A 4GULA 1RUI2 2P3KA 4JDOA 4XBNA 3SISA 3VBOA 4EWAA 1QXRA 4CDXC 1Q8SA 4WVWA 4JVAA 3U07A 4L97A 1BQPA 1RGSA 4XFAA 1GICA 3O5SA 2HWD1 1M06G 1S0DA 2A6XA 2QFEA 4A2UA 3W9AA 4P9IA 1AZDA 1AHSA 2RMU2 3MLKA 3WHUA 4I09A 4RL7A 5KBFA 1SCSA 4XFIA 2IXCA 5FO7B 1C4RA 3ZYPA 3AMQA 4Q2FA 2DCKA 3O7OA 2IXHA 1OD5A 3MPPG 3UKNA 2D93A 3DUIA 5GLWA 1X33A 2EAAA 2ZAHA 5IK4A 5DUVA 2PFWA 1RL3A 5KHKA 2UWCA 5GZFA 5J7MA 4YNIA 3MIGA 1IHMA 4NHKA 1LR5A 3N4MA 4ITCA 5KHIA 1WLWA 3WV6A 4AI2A 4D7TA 4UXAA 3VBFA 5DG2A 4I0AA 4R9AA 1G9CA 1EAH2 5L7OA 2A71A 1RITA 1AR92 4XW3A 4MUVA 3R6SA 5CFCA 4C1WA 1N1SA 1LULA 4W6WA 4DZGA 4N90A 1AR82 1C5IA 1X50A 2E7AA 1AR91 3BALA 3B94A 1IS3A 1ND2C 2D6NA 4G4FA 4E2GA 5T3NA 1SLIA 1G86A 1NE6A 4FPGA 1Q3EA 4DMIA 2DU1A 2ZACA 1REDA 1F9KA 4GH4A 3N3HA 3E6CC 3B9CA 1K5MA 4XHXA 1RUI3 2ZMLA 2ZKNA 1DZQA 1POV3 4CYDA 1UIJA 1N3QA 2CWSA 1NY71 1Z7S2 5A33B 4R52A 3E6BA 4YFWA 4AVBA 1W0PA 1XYOA 2W08A 1WMDA 2GNMA 1BBT1 3ILRA 3CF6E 1HRV3 4FAGA 1Q8QA 2WIIB 4Z07A 4B7KA 1WD4A 5J09A 4HKWA 3MLJA 4I30A 3NKTA 3HIFA 4XTMA 3ELNA 5E1RA 1DQ2A 2XLFA 1E57A 4I02A 1SQ4A 2XBO2 4YG6A 1V6OA 2HWC2 4E2QA 2JJ6A 1C8M1 3IKWA 3RI9A 1G9FA 2E6VA 1V6LA 5I8SA 1WCSA 3ZN6A 5BPXA 3SCHA 2FMYA 3VBFC 1Q8OA 3KGLA 2Q1ZB 4HFSA 1K5MC 2WA4A 4YVWA 1ZM1A 4I3PA 5H9SA 2B8MA 4KH9A 1GBGA 2R30A 1FNZA 5TSWA 4H3WA 2DYCA 2Z2SB 3AK0A 3PJYA 1BXHA 1XXNA 2AUYA 4OHXA 3I54A 2XG3A 2NQYA 1AR83 1AXYA 4IL7A 4XJUA 1ND2A 1H4HA 4JQRA 4RFT0 3VLBB 2IXJA 1GV9A 1OLQA 4Y22A 4WVMB 3H3UA 4WVVA 1JH5A 3CO2A 3D5OA 4OI0A 2CYFA 5AFEA 4Q27A 1WLCA 1KQRA 1QKQA 2XL7A 3WG3A 5AVAA 3EXUA 2PHWA 4FOWA 3QBQA 4EN7B 2EF6A 2E51A 2GNDA 2XJPA 3B3QE 3OY8B 1X82A 2RMU1 1VALA 1D0HA 3ROUA 5GZEA 2XB6C 4RR3C 3VBSC 3AKSA 2C5DA 1YHFA 2ZHKA 1G6NA 2Z79A 4AGVA 2QE3A 4V1PA 4GA9A 4LBLA 4LEJA 5H9PA 4OUSA 2VGDA 1DG6A 3ZYIB 4LE3A 1BEV2 1VBE2 2IFWA 5GLZA 4COUA 2XJVA 3DGTA 3WDWA 3WW4A 5ABJC 2FZ2A 2OZJA 4AQTA 2Z69A 4FXGB 2Q5TA 4FCAA 5KXBA 1I3HA 3GZAA 1QJX2 1ZYBA 1Q5OA 1C28A 2WZR3 4INDA 3FUOA 4ES9A 4YLZA 3MF9A 4CP1A 1OFNA 1VAVA 3FBYA 1SEFA 1UU5A 4UW4A 4XF1A 3AP6A 4DY3A 1JOJA 2PTMA 4OI4A 3NW4A 4XDQA 1DZRA 4CEWB 2DV9A 1NCQC 4Q0QA 1RVF2 3OBTA 2PHRA 2ZAAA 1QY4A 3RRDA 2IZWA 2WNUB 4K3UA 3TNQA 5E88A 1HXS3 4AFBA 4CZSA 2R6QA 1W6NA 2BUKA 1DBNA 3IPVB 2IXIA 1J3PA 2YMZA 2VW2A 4QM9A 4YW4A 2W68A 3X29B 1IKPA 4G9SB 2MEV1 4XJ8A 3AYAA 1NA1C 4XXPA 5JZGA 4NR1A 5IK8A 3JBG2 3I59B 3R4DB 1IS4A 2XLGA 1IKQA 2HWB2 4RSUA 1WGPA 1PVC1 3M70A 4N43A 3WW3A 1BBT3 1O3TA 4GH4C 2KA3A 2RS52 3SH4A 3WCSA 2WL1A 2WA3A 1BVVA 1UPSA 4UW5A 5BNNC 4Q4V1 1LGNA 1RJ7A 3N36A 5FTTC 3OYWB 1H1MA 4IV3C 4A7KA 1PVXA 4QU2A 4GMP1 4UW6A 4AFDA 5GM0A 4FQZA 1R1ZA 3MGUA 5CADA 1WW6A 4N53B 5KWRA 1BEV1 4CDUC 5BNPB 3NAPB 4IEPA 1CJDA 3NV4A 1K5MB 1UKRA 4LBOA 1FYUA 1RUF1 1D4VB 2ETEA 2R071 3L9JT 2BQPA 2IC1A 4PQ9A 1ZZBA 3ZMOA 1NLRA 2FZ1A 3KCXA 3PVEA 2ERFA 3S0MA 4P9LA 1QDOA 2VVDA 1C3HA 1MS4A 4H55A 3UKTA 1DQ1A 4FPCA 3ZFFB 1Y7BA 1V6JA 2Y0IA 2A3YA 2Q8OA 1NCQB 1AJKA 2ZZJA 1RUE3 4FPLA 2HWE1 2DUPA 2DCYA 4AE2A 3AMNA 4AQSA 4LA2A 4BOWA 1UKGA 3UJOA 1DGRA 1RB8G 3MIFA 1O4ZA 2XH6A 1H2LA 1KDKA 1LOBA 4MGYE 4NOTA 3ST7A 4FPKA 1JHNA 3UK9A 2XL9A 4QQHA 2HKXA 5C33A 1ZRFA 4J6GA 4YYOA 1MR5A 4HBNA 4HVQA 3AP7A 4GH4B 5T54A 3WT3A 2CAUA 4LO8A 4GB31 1O4TA 4CEWA 2SLIA 4E4DX 4LHLA 2C0ZA 3ZSLA