4CF4A

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
223
structure length
222
Chain Sequence
b'GILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWATIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 81
structure length 222
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cf4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cf4A01
1ZRNA 3UMBA 2HCFA 3U7FB 4UARA 2IOFA 4KN8A 1YDFA 2PR7A 3ED5A 3ZTWA 4Y2JA 5A3RA 3KD3A 1Z88A 3NRJA 3ZX4A 3AR7A 3ZW7A 4BBJA 4UW9A 4BX3A 5ALFA 4DFDA 3VAYA 2IYEA 3ZVNA 5FP0A 3QXGA 5T41A 4CF4A 1QQ6A 2EATA 2JAWA 4L57A 1AQ6A 3FPSA 3ZUPA 2IA5A 2P27A 2PQ0A 4Y2VA 4UAVA 5ALOA 1T5SA 2FPUA 2O9JA 5ALWA 2FPXA 4DCCA 1L8LA 3K1ZA 3PGVA 4NFLA 3R9KA 3HYCA 3L0BA 5ALMA 5AI4A 4KNWA 3KZXA 1MH9A 1RLTA 3SKXA 2MU2A 5A3SA 1VFPA 3WGUA 1NNLA 2B0CA 3L1VA 3J7TA 4CF5A 3QX7A 4UM7A 1CQZA 1YMQA 4CNQA 2C88A 2RB5A 3QGMA 3OCYA 3OCXA 2CFTA 3N1UA 4UMDA 3OCZA 2ZBFA 3WK7A 2G80A 1L7NA 1U7OA 3GYGA 2FPSA 4JDPA 3N5KA 3QUBA 5AK6A 1N9KA 1RKUA 5AM0A 2Q5EA 4UMFA 3U7HB 2YJ6A 4KYTA 1TJ3A 1RMTA 3QUTA 2WF5A 2W4MA 1S8OA 3WK9A 3AR8A 3EF0A 3QU7A 4HYTA 5AW9A 3QYPA 4UATA 2I54A 2B1QA 1KYTA 3U26A 4EENA 3SD7A 3QUQA 2DQSA 5ALJA 3OTQA 4BX2A 2C8LA 2I6XA 1K1EA 1L8OA 2YMPA 4UASA 2G06A 2R8XA 1QQ7A 2AH5A 1RKVA 2ODAA 5E0OA 2C8KA 5AVQA 1XPJA 2QYHA 1RLOA 1WZCA 1Q92A 2C9MA 1L7MA 4FE3A 3E81A 2B1RA 3EWIA 4O8CA 5A3QA 3BA6A 1Z4QA 1JUDA 2D2VA 3AR9A 3NALA 2YMMA 2I34A 5IT4A 3ET4A 5AVWA 2WHEA 2EARA 1U02A 4XQ0A 5ALIA 4IG4A 4BEVA 2HO4A 5AVZA 5AW3A 4JB3A 3WK6A 2X4DA 3HLTA 4J2TA 4Y2UA 4Y2YA 4FYPA 1F5SA 3A1EA 4G63A 5AKHA 4MUMA 4HGNA 4EX7A 3ZU6A 2FDRA 4NABA 1U2SA 2I7DA 2YBDA 5AKLA 2JGAA 4OFZA 5ALPA 1YJ5A 5ALHA 5AI6A 1XP5A 1CR6A 3ZVMA 1WPGA 5AIAA 1L7PA 4BNDB 4EEKA 2ZG6A 2G08A 3PDWA 1TE2A 2MSNA 3I6BA 2YN4A 1LTQA 4HGOA 3I28A 5AI8A 1O03A 2R8EA 5AW6A 5AK5A 1YNSA 1RLMA 2AMYA 3QUCA 4C4SA 2G09A 4NWIA 2C4NA 3SLRA 3QU4A 3L1UA 1EK2A 1Z4NA 1J8DA 3WGVA 3I1YA 5AVVA 3SHQA 2W43A 3M1YA 3MMZA 1TA0A 1J97A 4Y2QA 3ZTYA 4I9GA 4UM5A 5AHXA 1RQLA 5IS2A 3U13A 1TJ4A 3L8FA 5AI5A 5AKIA 3L8GA 2IOHA 2PKEA 5AKEA 2VKQA 3ZWDA 4EX6A 1TJ5A 2B8EA 4YH1A 4ZEWA 1QYIA 2RARA 3E84A 4OD0A 3SKYA 1NF2A 4HAIA 4Y2XA 5AK4A 2HF7A 3U7GA 1SWVA 3U19A 3AR3A 4EZEA 4RETA 5AIBA 5AVRA 4CF3A 5AKGA 4Y2SA 5ALZA 5AESA 3MC1A 3I76A 2BDEA 3QLEA 2OM6A 2G1AA 2G07A 5AKXA 4F72A 3W5AA 1ZD5A 3IB6A 3DNPA 1RMYA 3P96A 3R4CA 2WF8A 2P9JA 3L8EA 3FZQA 1VJ5A 2HF2A 3QNMA 5AW7A 5AVYA 5AW8A 4BKMA 1YV9A 5ALSA 2ZOSA 4UMVA 5ALVA 3KBBA 3NIWA 5ALLA 4KX3A 2YY6A 1T9ZA 2Q4TA 3L0YA 2I55A 4C4RA 3QU5A 2FPRA 4KX5A 2HI0A 1Z4KA 4MWOA 4GIBA 2CN1A 4L6AA 3EPRA 1QH9A 5AI9A 3U7EB 1Z5UA 4F71A 3OCUA 2R8YA 1O08A 3B9BA 1SU4A 3NASA 3OCVA 2OBBA 5AM2A 4IFTA 5ALTA 3CZ4A 2WFAA 3KC2A 2GHQA 3PCTA 2W11A 1YS9A 3UMCA 3OPXA 1ZD4A 4HGQA 3FPBA 2NO5A 2YJ4A 1QQ5A 3NAMA 4C4TA 2HEGA 2I33A 2P69A 5AM5A 3MPOA 1Z4PX 4UU0A 4RESA 5AW5A 3UM9A 3ONNA 1RRCA 2YMQA 3DDHA 5ALUA 4B6JA 5AM3A 3AR5A 5ALYA 4PNHA 3IJ5A 2AUTA 5AVTA 2FPWA 4GXTA 4XOUA 4XE5A 1T5TA 2GFHA 3RF6A 3N28A 5AM4A 2YMLA 2MU1A 4DW8A 4UAUA 2JAOA 3AR4A 3N07A 2YJ5A 3A3YA 2FI1A 5AKKA 3WKCA 2R8ZA 3AR6A 2FUEA 5AKYA 4BYGA 4ZEXA 3QU9A 3KDPA 5AW0A 2YFYA 5AKJA 2CFRA 2BY4A 3WK5A 3DAOA 5AI0A 3W5BA 1Z4JA 5AICA 1L6RA 3ET5A 5AW1A 2HOQA 3WK8A 3OCWA 4HGPA 2YJ3A 3CNHA 4ZEVA 4XPZA 1Z4MA 4QJBA 1WR8A 1ZOLA 4AS2A 1RKQA 1ZD3A 4QQFA 1RC8A 2NYVA 4YGYA 4YCMA 4Y2TA 3L8HA 4Y2RA 1N8NA 1SWWA 1U7PA 3ESRA 2OYCA 2G0AA 3IRUA 2P11A 3E58A 5AK3A 4NV0A 5ALEA 5ALXA 2WF7A 2QLTA 2O2XA 2GHTA 4KNVA 3FVVA 3NANA 4UMEA 3L7YA 1S2OA 2B82A 3WKDA 3TLMA 5AVXA 4H1WA 2B8JA 5ALDA 4L6CA 1LVHA 5ALGA 3AR2A 4BX0A 5IT0A 2CFSA 5AVSA 2Q4RA 4E88A 2HX1A 3PGLA 3B8EA 3FGOA 1ZS9A 3ZVLA 2RBKA 4BNDA 2FEAA 3ZWKA 1Y8AA 2HHLA 1FEZA 5ALKA 5ALNA 1Z4LA 3WK4A 3WKAA 3KOOA 4HGRA 1Q91A 4AS3A 4YCLA 4YCNA 1PW5A 1ZD2P 3A1CA 1ZRMA 5AM1A 4BEWA 1RPZA 1WVIA 1RQNA 3ZX5A 3QU2A 4DWOA 4UU1A 3E8MA 4YIKA 5AKZA 4NAVA 5ALRA 5AW4A 2JARA 2RAVA 3ZI4A 2ZXEA 3L5KA 2AGVA 2HDOA 5ALQA 1Z5GA 3NUQA 1RDFA 4FFDA 3S6JA 3R09A 2GMWA 3DV9A 3UMGA 3SMVA 2WF9A 2EAUA 3L0CA 4YIHA 2FUCA 4CE6A 3F9RA 3W5DA 3WKBA 3M9LA 1XVIA 1X42A 2WF6A 2NO4A 2ZBEA 3RFUA 3N8GA 1L7OA 3B9RA 1EK1A 1IWOA 2ZBGA 3D6JA 2WM8A 4AP9A 2ZBDA 4OCZA 1ZJJA 1RMQA 4OHFA 1Z4OA 5AVUA 1NRWA 3BWVA 1U2TA 3FM9A 2GO7A 2B30A 3ESQA 3SF0A 2OA0A 2HSZA 3A1DA 5JJBA 4J03A 4I9FA 3MN1A 3W5CA 5AW2A 4EELA 1VJRA 2BDUA 3WKEA 4G9BA 4Y3UA 2IOFK 4Y2PA 3EF1A 1Z4IA 2JAUA
chains in the Genus database with same CATH superfamily
4FDUA 3V8PA 4A5SA 3HADA 5CXUA 2JFBA 1FP7A 2WD7B 2LCQA 1G66A 5BXYA 5BW6B 1PGOA 5BSWA 1KTQA 4OHYA 1KEEB 5T6MA 1XALA 3D5QA 1KDZA 3ABZA 3D8BA 5FTMA 1WWVA 3I2KA 1RLTA 3P4YA 2XCUA 4EW1A 3LGXA 2J9GA 1QYDA 1NASA 1YOBA 2JJ2D 1T1RA 3W6ZA 5GQSA 3LPMA 3II6X 1E5LA 3TBFA 3ZOZA 1SBYA 4PO3X 4EJ6A 5D5HA 5CB4F 5ER6A 3FETA 3ZJYA 4UTNA 4JB0A 2XZDA 5BSKA 1P9WA 5E3JA 1V11B 1XVVA 1ADBA 1IV8A 4WEQA 4YDSA 4JASB 3MJ4A 4TTSA 1QH1B 5D49A 2IEZA 4JJIA 1ZSVA 3AU9A 2C4WA 3C3WA 4UAYA 5T67A 5TQ0B 5K3BA 3T4XA 1LQUA 1XE3A 2W48A 3DZJA 2QV7A 5FEUA 4XD2A 5CA0F 1G8YA 5F3DA 1WXWA 4CLEA 4BECA 4YJHB 4K4HA 2ZREA 3ZJUA 4G63A 4UZSA 2QB1A 1FS5A 1X40A 3E3MA 3M0EA 3B1FA 1TIKA 1XZBA 1L7EA 7REQA 2L17A 4ACOA 5EJ9A 1VZ3A 1HWYA 1U2DA 3LQ1A 5K8IA 1KK2A 3MMZA 2H16A 3EXFB 2E6UX 4AG5A 5D8DA 4M98A 4YP6A 2VTBA 3D54D 2H48A 1LDGA 1TJ5A 3I30X 4LSWA 5IF9A 3WY9A 3BHNA 3SJ7A 4UXHA 1PGPA 4LMRA 5CT9A 4TUQA 1THTA 2ZYGA 3MD9A 1X6IA 2BKLA 4XQ8A 4NJMA 4JKYA 2G1AA 3C1TA 2QX8A 3TTXA 2IV7A 1BQ3A 1HXHA 1VL0A 5ITZB 1B93A 4IEIA 1M83A 2ID9A 4JOBA 2HBYA 3V8EA 5DB6A 4RKRA 3DULA 3KEMA 2BELA 1EUCA 2IXFA 2R11A 4D4HA 5IFKA 2DBVO 3QV1A 4XQGA 2KWIA 4AKIA 1I13A 3ZDQA 2QLMA 2P30A 1ZD4A 1ETUA 3HA3A 2B20A 3ABSB 2ZM6B 1WMDA 3FIUA 2KS6A 1Q95A 1R0CA 1AG9A 2WW8A 1CNFA 4O02B 2C2GA 3DHNA 4M0PA 5CVJA 1C1XA 4LJLA 2O4CA 1ESDA 3TW4A 3MQFA 3DEKA 1ZBDA 4RFSB 1N8TA 2NXNA 3G88A 1HTBA 3MYRA 3THYA 4AZ0B 4BNZA 3PUXA 3QV2A 1KNQA 4QGFA 1DC3A 4RPZA 1GPMA 3OC6A 2QN9A 2D5IA 3I9V6 3HXQA 3RKSA 2VUUA 1U1EA 2AU0A 1MDFA 4DQUA 13PKA 1E5VA 3Q88A 3E2MA 5I8ZA 3H2HA 4OHBA 5E2BA 4X91A 1PT5A 5CB4A 2WNIA 1HT2E 4BMVA 1PF7E 4Q7QA 2YQ4A 1UBSB 4DL2A 4J3JA 1BO6A 3H1GA 5ALNA 3DLIA 2DMRA 1TC1A 5E79U 2IYVA 3NUZA 5TT0A 2DWQA 2FW6A 3JSXA 1IHDA 3AP3A 5BT8A 5J2DA 3OFSA 3EPLA 1KAMA 1RABA 4MITA 4HNQA 3OA0A 2X22A 2Q0QA 3V33A 4CQMB 2XVTA 3BQNB 4UBBA 5CA0A 4IDBA 1XJCA 5EIEA 4UOQA 2WWTA 5FQNA 4KMUA 3E9RA 1K9SA 1OFTA 3OY2A 4KPYA 3TQ1A 4EHNA 4LXHA 2VRCD 3GLFB 2DFTA 4DLKA 2CLSA 5CFQA 2B4RO 2XB9A 4PG4A 3A6ZA 4GEKA 4I9FA 4QWEA 1GQSA 3RH6A 5CLLA 5J0SA 3ZKWA 2VDQB 3FZNA 2AOUB 3VCBA 3C5FA 2VPIA 4Y2JA 5DB9A 1JT2A 1ILWA 4DKJA 1XSNA 5CA1F 4PLPA 4MKZA 4J9QA 2J0QA 5JWRA 2CKDA 3LF2A 3MJEA 4UBKA 2O8DA 1EP1B 3GFGA 4KJXA 1UM8A 4U2GA 3DTVA 2FYTA 4HG2A 3VH3A 1WDMA 2GZ2A 3EQ2A 3T9EA 1HQKA 1O8CA 2W37A 2J85A 1KRXA 2WJJA 2C2EA 4D3XA 2OSVA 5DLEA 2Y0DA 1USVA 4DLNA 5MDHA 4DA8A 2PJRA 2FPKA 1MJGM 1N25A 2BTOA 2ETVA 1WEHA 1QYRA 2LBOA 3IAM6 3GAFA 2Z4RA 1JR6A 4N6NA 4N18A 1E3LA 5EI5A 3DMTC 2FMUA 1C4XA 1F6BA 3GX1A 1PVDA 3F6SA 2HFJA 1SGGA 5C1DA 1U2PA 2ZBVA 3RC3A 3DB2A 1RLIA 3R75A 1JHOA 2ATXA 4JGIA 4IG9A 5T7BA 1F7VA 2HMAA 4D8WA 2YNMA 1P7PA 1NJ6A 1TCBA 4K9PA 4JJKA 1DOQA 3ZXSA 3PWTA 1JVSA 1FSZA 3Q7TA 4JLBA 2AQHA 4A8JB 4FNAA 2WNHA 2CDRA 4Q7MB 3EC7A 3A6GA 4LE2A 3ZV5A 4CUKA 2ZBRA 4KDRA 4MWZA 3THVA 4PINA 2NV3A 4YJKA 4KVAA 4PX2A 1VJDA 2PKRA 4KUEA 1I4WA 2RB4A 4B2IA 1ZQPA 3A1SA 3T7AA 3GHYA 2VWGA 2GBGA 4M0FA 3ISDA 3PMNA 4DQPA 1QVRA 1Y8RB 2EFGA 2Q4EA 1V3QE 3RUEA 5KFAA 1MC5A 1HDCA 2I8LA 4TQAA 1YMUA 5E6RB 3KOYA 5ESXA 4DB2A 1TT7A 2ZE8A 4X9XA 3S7ZA 3OCUA 1P1IA 2OBMA 1C3EA 4FHDA 1ZINA 4D5EA 1QJCA 5GIPE 3MUFA 5U9CA 2HGZA 1LF5A 4WY8A 2IU6A 1QK5A 5KCZA 1QMGA 4DT1B 2IVFA 3FTQA 3DJFA 4ZJPA 1ISHA 1AKWA 5IIOA 1IM5A 1NVWQ 2QRVA 3PNOA 4UAUA 3RH4A 3O8NA 5DYYA 2EANA 1SULA 2ROQA 2RHWA 3A6KA 2EZXA 4BO6A 5CA1A 1KC1A 4ZO7A 1JPUA 3NJRA 2DFNA 1Y7PA 4JJFA 5I3ZA 4ZEXA 4GLXA 3GV0A 1SCKA 3BILA 3VHLB 4Y2GA 3VXKA 4YI5A 3SY8A 1KL9A 2LM4A 3JD0A 3WGNA 2Q1XA 1TKBA 2HHQA 3WLMA 5FI1B 2ISOA 1DWQA 1CY6A 5K0EA 3MWEA 3SI8A 1ODIA 5C9ZA 3EOZA 3KKAC 5H2FU 5TB5A 5AVJA 2FW8A 3DBLA 3RJMA 3R4VA 4MKXA 5ES4B 3FNFA 2ZE5A 4D6PA 4FNOA 4INZA 4UU7A 1PHRA 4LG1A 3FWPA 2REBA 2HNKA 3TOCA 1W4LA 1V48A 3IR7A 4FLFA 4UU1A 4UVEA 1E7MA 1VI5A 2EDAA 4H7JA 3FKQA 1T0JB 2E18A 3HO8A 1Z5GA 3R8XA 5HQ3A 4RY0A 4YP3A 3SMVA 1B6SA 3WAKA 2ZUDA 4WVLA 3R3WA 4ZK6A 2R1TA 1GZDA 4WSOA 2VSXA 5CWRA 1PSDA 2CUKA 3UO8B 4OCZA 4HOYA 1TQ2A 3BWVA 4OMCA 3UJ6A 1XMXA 3SDZA 1TTQB 3CEPB 1MEEA 5JW6A 4HQKA 3GRKA 4ZAVA 1MOPA 4YAUA 2DC1A 4HQNA 2RHMA 3JVEA 1BOFA 1PO7A 3CNLA 2LXNA 2CJFA 1V2HE 1P8JA 1QUFA 4R84A 4JP5A 1G2IA 1YBVA 1VL6A 2O05A 5BWBA 3ZH9B 4MV9A 5EJAA 3VDMA 4BP3A 4D2IA 2J0SA 2YZNA 4BB0A 3STWA 3U39A 1WD7A 4NATA 1BTOA 3K1YA 3WB0A 2QQFA 4PNPA 4I7EA 1NBAA 2O2CA 1KE1A 3KKPA 1VZ2A 1FSGA 4HI0E 4JH0A 3G17A 3MTGA 3ZPXA 4KYTA 2GK7A 3EWNA 3OJUA 3AL0C 2HBMA 5KHOC 5DGIA 3ERCA 3SG0A 1G4AE 5TPWB 3AILA 1Z15A 3U26A 4EENA 3SD7A 5IYZB 2YW2A 2HH9A 1ENPA 5CMLA 1NJ1A 5GZ3A 1VCNA 3OUUA 1QB8A 4EFDA 2C2XA 3VMMA 4O8CA 4LZPA 2I34A 1E9FA 3MABA 3V8RA 4DCVA 4YRRA 2ZJ2A 5CDHA 4UFNA 4MW0A 3OSNA 5EUBA 3TSWA 1HOXA 2OFFA 3QE4A 2VYFA 3MT9A 1EGQA 3UJ8A 1Q44A 2XC9A 1GCOA 4LWPA 1ZGJA 2J9FA 2G40A 1LSJA 1XTSA 3USCS 3IDFA 4RQ2A 1Z6PA 5HFJA 4CN9A 2BI7A 4F5WA 5JWHA 1JXOA 5BV8A 1Z16A 3A9CA 2D1YA 4DA9A 1KEUA 3I28A 3KTQA 1WDKA 4K9DA 3ZK9A 1P1FA 1NPDA 4M89A 4ZZ1A 1ADJA 1CUWA 3V2HA 4X54A 4EB6B 3T3FA 3WNDA 1VE7A 4E08A 4RK5A 1T2UA 1KZGB 4OJKA 3BM5A 3GJ8A 3UT5B 2RARA 2YWFA 2CSUA 3ZLUA 3A3KA 3E9YA 2B1GA 4E33A 2OR3A 2I6UA 5DNDA 3TLGB 3KPVA 5KNIA 3ZHRA 3R7FA 1W5EA 3EVEA 4HTFB 1TEZA 4WACA 3IB6A 1KYWA 1S89A 4MUJA 1AGXA 1RPNA 3CH6A 3RRFA 4X8LA 1YV9A 1JF8A 3QX8A 1MTZA 4MLCA 2XT9A 5DB8A 1HUZA 4JLNA 2FDCA 4MUBA 2R25B 5IDYA 1OSNA 3V55A 1YCDA 3ROQA 3FSJX 1SU4A 3WJ2A 2OBBA 1LTHR 1O95A 2WYUA 4ZCPA 2VZEA 3VR2D 4EEXA 3T5AA 1YL6A 1XZEA 1BCRA 1ODLA 3KQYA 3OHPA 1Z7GA 3SR0A 1M8KA 1NDQA 2IYSA 4JLMA 4D80A 2OV6A 4QYWA 3KHRA 1X0XA 2HW3A 3EW7A 4E12A 2ZIFA 3ADPA 4S24A 3DBIA 4NLCA 4V0RA 4W9RA 3AKZA 2IY8A 4G8JA 1CE8B 3K70D 5DYNA 2QQGA 3GDOA 5HNKA 1EJBA 1W5BA 2PZGA 4KPUB 5C7IO 5E95A 2OWDA 4G5FA 1NQ5A 4FBLA 3VVLA 5JNRA 3WK8A 1K2WA 2YINC 5FH9A 2PBRA 3DPIA 4ZJUA 4B8YA 2KJ8A 2NYVA 3CLUC 4EL0A 3ACCA 5E2AA 2YTUA 3GMSA 4QXOA 2JD1A 3HVRA 4YRLA 1S2MA 1H5UA 1JLKA 1JBQA 3B1KA 4LI0A 4A7PA 3HKZF 3JXEA 2BEWA 2B8JA 5HBGA 4A03A 4IDPA 1P1KA 3Q8KA 4QECA 1BS2A 2GTIA 1QDLB 3Q6NA 4J3FA 4AN0A 5ILQA 4XQCA 2D5CA 2GLUA 4UTRA 4W1SA 4EG5A 2K60A 3ZWNA 1I80A 4RY8A 2ZUSA 2ZUWA 4ZVOA 4M86A 3FDXA 3PITA 3HJBA 4GRIA 4S0XA 4IGEA 5JD5A 1P7YA 1Y88A 4NS1A 3CVJA 3MERA 2EAUA 4CV2A 1FP1D 3I23A 3BB4A 3KYDA 1E1YA 1NKTA 5T4HA 4LWQA 2H5IA 3BJIC 3K31A 2IDZA 3GFKB 2HHAA 4IQFA 2YJTD 4PN7A 2DCUA 4QLOA 4GBJA 1J2YA 2ZYHA 3TE6A 2ADMA 4H6WA 3CJQA 3RJEA 2QQ0A 2JK0A 3HMQA 5KFCA 4YDRA 1C7IA 5A9RA 5CYOA 1FVOA 1VL8A 1YZHA 2PD3A 2JIDA 5FLYA 4M4SA 2WVAA 1K8YB 1NNI1 1T9GS 5LMZA 4H0NA 1R0BA 2CCKA 1M1YB 2ECQA 2NZVG 3N2KA 4MWCA 5K0LA 4LF9B 4RVSA 1MJGA 3Q72A 4NDNE 1WS6A 4E3WA 1JPNA 3OLZA 3OLVA 1E9AA 4CLOA 4G1MB 5FUVA 4MV5A 1B22A 1GRQA 4EVQA 1O97D 1YK1A 2RSLA 3BIFA 1E6KA 1YXMA 2ZRBA 1K5PA 2O0MA 3G1WA 3KJQA 3MW8A 1L5SA 4F9FA 4G24A 1E9RA 2G9VA 1U7OA 4D9MA 2ZI7A 4G37A 3I9KA 3DLHA 5F1OA 4M7RA 4YCBA 1WXQA 1P4GA 3HHPA 1ZNZA 1EFAA 3TZLA 3Q0TA 3N2YA 3O03A 1JAZA 3WIOA 1F6DA 2WZCA 1L5QA 1GAXA 3X0DA 4EJMA 3DVRX 3AVXA 2F4NA 3IVXA 4X1YA 5CVDA 5ENDA 1VJ0A 5CPBA 1WLYA 3A1NA 3SU8A 5DGAA 2ZB7A 2PJUA 2C3MA 4FP9A 2WHPB 4J49A 4UUNA 2DR2A 5DBCA 1Q0TA 4QOEA 2WAQF 1QRSA 3PDWA 3KHSA 5LQNA 2EG9A 1T5OA 1EGAA 4BRZA 2QHXA 4TWRA 2IHUA 2P2DA 1MFPA 3TZCA 3WHPA 2OHOA 3L0ZA 1F5NA 3BQ0A 4TYPA 3TB6A 5K4AA 2V74B 4HPWA 5JLAA 1J2TA 1R15A 3JQAD 3ZLJA 3HFJA 1JEDA 3LDGA 3LY8A 3AUOA 1C7YA 4IS2A 2IV3A 4LF5B 3KKMA 4HDRA 2WJYA 5DGDA 5CK4A 4Y2SA 1OMOA 5L1MA 2FPLA 2GWHA 2REXB 3V7WA 3B0XA 3GA0A 3G0IA 2XNDD 3PV0A 1BKYA 4AJ2A 3L1HA 2B7CA 2ZTUA 3D7RA 1N2CA 1XVUA 1I6KA 3H16A 3U7EB 4F71A 4YMGA 2IT1A 5K6TA 1ZH0A 1O08A 1N9ZA 3TNDA 1SK8A 1QB7A 4DOCA 3PCTA 3MGBA 3RC1A 3C1AA 3CH5A 3A1UA 1ZR4A 1PK8A 3T9DA 2OQVA 4D0GA 1VSBA 3HRHA 4CMBA 3L7OA 3HI4A 3DR3A 2Q07A 3ZDDA 1M1NB 2DTEA 4DW8A 1DDIA 4JC5A 4F4IA 4WLUA 1LNZA 5AKKA 5JS8A 2O2JA 3VR5A 3ELDA 2ZSUA 5AKYA 5FA6A 2YH2A 4XX1A 3UT6A 1MABB 4C07A 5BP7A 1L6RA 1Z56C 2HOQA 3KXPA 1LSOA 3C5HA 1ULAA 4ON9A 3ZIUA 3E8XA 1HNWB 4QQ8A 1R5NA 3KOZA 1N9GA 4H16A 1Z73A 5FJIA 2AEMA 3LT4A 1DC4A 3OCCA 2CHGA 4GXRA 2I29A 2P0YA 4IR1A 3SCZA 2WI8A 3ECAA 4OHWA 2PFSA 1S0VA 2QUJA 1H4VB 3MGHA 4WCDA 4DAEA 3KWFA 4QTXA 1NT4A 2VEDA 1N0VC 2J3IA 2QW1A 2G9RA 4F2RA 4TKUA 1I8TA 4PG7A 4B2YA 1DGSA 4BU1A 1O3YA 1UPTA 4U2BA 4WKCA 1RJ9B 3IAFA 4OJOA 4MIOA 1JKIA 1XMVA 2CEKA 3Q87B 3G9TA 3WNQA 1NI4B 1X42A 9ICRA 3DQPA 1QGOA 4RWEA 2HR1A 2HSDA 2XCIA 3SMQA 1U7UA 2AG5A 2GGSA 3ZWCA 2HPHA 3LSTA 4ZCSA 2FW1A 1N36B 4ZEOA 1U0FA 2RI0A 3J7TA 3BBPA 8LDHA 1OFUA 4JBWA 5EJFA 1FTGA 4QULA 4TXNA 1UDXA 4B7CA 1RXVA 2LE0A 2PS3A 4PPQA 3EGOA 3LY9A 5LP6F 5T41A 2XCTB 3MBKA 2OUKA 3H2BA 4DCCA 2JI8A 1M6VB 3T3HA 2WC1A 1J49A 2FCRA 3PICA 2E7ZA 4KE9A 1JG3A 1L9XA 5D6NA 2G1JA 3SSNA 3ILYA 4JZYA 2FLKA 1AZTA 3AIIA 1K6IA 3G82C 3RADC 1R2QA 3O31A 3GZTB 3FOEC 1ISJA 5CP8A 1RFLA 3OCZA 1FUIA 1YA8A 1EA7A 3GYGA 1IM8A 1PSZA 2F43A 2Q29A 3HI6A 3DCJA 3TZ6A 1H9BA 1VMAA 4RQTA 1OXBB 3NVAA 1QE3A 3LQRA 4AURA 3N3AC 1DK3A 2HCBA 3UAOA 2QT9A 4GH5A 1RYYA 1G38A 1TJNA 3LU1A 1ES9A 4R8RA 1ATIA 4ER3A 1GPH1 2R4UA 1R74A 5KDLA 2XMBA 2F9LA 1WSBA 1DLJA 4IG4A 1HQDA 3LX5A 1GNQA 4DTCA 3O8OA 1FNDA 5KFKA 3OX4A 3TIVA 5IDWA 2IYYA 3CYFA 1ND6A 4Z2AA 4MOWA 2ZJ0A 4GM4A 4Q4AB 1P4AA 2KIVA 3NPMA 1M5UA 5IIMA 1SOWA 1J20A 3MXTA 1XSEA 2CYBA 4UB2A 5FYDA 5AI8A 1ZQ1A 1QYWA 4HHEA 1XZDA 5C51B 2V4UA 1YBFA 2VF7A 5D3MA 5JEEA 3L18A 5DW0A 4COKA 3A0UA 5FBKA 3FWZA 5J2FA 1U7DA 3RANA 1MIOA 5EOZA 4GMGA 1CDZA 1UBRS 4H3HB 4ZHSA 1XLTC 3C85A 5EESA 2BRUA 4HWRA 4Q1DA 1QSGA 1W85A 3NHBA 3T61A 1SQSA 3ZCVA 4DEVA 4DEYA 1GRVA 1IAVA 1M33A 2UVPB 1KHHA 4NCKA 4IINA 4YMUA 4QUHA 1UOEA 1WQ1R 1UMBA 1G6Q1 2PZAA 3K0HA 3JATA 4BLWA 2JW5A 1UHUA 4ZQHA 3FTCA 2H57A 2A84A 1I24A 4M8LA 1TU4A 2AF3C 2F17A 2WU3A 4XRHA 1Y5IA 1BXRA 4KLSA 3FOWA 4CEJA 2J45A 4NHEA 2O0HA 1ISIA 1UXGA 2XZLA 5CFZA 5SZJA 3PNYA 1CI4A 4CHGA 1RRPA 4E51A 1OOEA 3OZAA 2XY5A 4XPIA 1D0SA 2J31A 5LP6A 3TAQA 4MTCA 4JT4A 4HLCA 4QSHA 3M4YA 4Y1EA 4XEHA 4IIJB 4B6OA 3CRW1 1I7LA 2OD2A 1OXTA 4AKSA 5IAKA 4FFVA 2A3RA 1RKQA 5JEDA 3JD2A 2AC4A 3CVYA 3QM1A 2AOXA 2EP8A 4Q12A 2JLYA 4MZDA 4Y2RA 1DVRA 2O1EA 1T0HB 3AUTA 1ZQKA 5T8KC 5G4KA 3HXTA 3S2YA 2CXSA 4L4XA 2R97A 2AFIA 4ALNA 1JQ3A 4YO8A 3DOHA 1KQQA 1MHTA 621PA 5J4KA 3VDRA 4EVRA 1N0WA 5JAIA 5K3EA 2DLCX 2WHYA 1DKOA 5HIIA 4LOKA 3R6DA 3BK7A 2I4NA 4X8HA 3ZGYA 5JWOA 3EASA 1A97A 2G5HB 4LC0A 1E6WA 3OWHA 4TS4A 4U0KA 2WAYA 3RVJA 2FR8C 2IZOA 4J9MA 1D8TA 3HN7A 4YCCA 3B9RA 1CRXA 4Q18A 3NEPX 5ESDA 2F1KA 2EJUA 4FINA 1J5XA 2VEOA 3V4FA 5FOWA 1CD5A 1Y82A 1K5DA 3DCYA 2HKIA 4E2WA 5FT9A 4UTVA 2OLJA 1BDJA 1L3VA 1NNSA 3KLPX 2REOA 2FMIA 4FKZA 1E3MA 3LZCA 5C1BA 2R4TA 3T06B 3F2CA 3G9ZA 1SIBE 2I9GA 3WRWA 3A9RA 4QLAA 1C4KA 1IQ0A 1WHTB 4H3VA 3DWIA 4ERXA 4KQ9A 2WU4A 3NONA 1CPYA 3NEAA 5BV0A 3WGJA 5LYYA 3A4YA 3IPXA 4I28A 4N76A 4N65A 4DL5A 1PWYE 2B1QA 3PQ7A 1IXZA 1I2AA 1TAHA 4CDGA 3NH9A 1OFUX 3Q0IA 4IJ5A 5JE8A 4S1NA 2DETA 3SDSA 5EJ5A 2LGJA 3DBVO 1WZCA 4ZTUB 3FMFA 1YONA 2VA2A 1CF2O 3R40A 1E8MA 3TTVA 2KSQA 4AW9A 5BUCA 3AEUA 2YVQA 2QG4A 2AXNA 2WIKA 1KI2A 1HR0B 1EFHA 4PLGA 1E2EA 4J7UA 4O4JB 3ZY6A 1RWNA 1XRLA 5IM4F 2YWDA 1BMFD 4O3NA 2BMWA 3EODA 4NE9A 1FXSA 4MX8A 5BQ3A 4JEHA 2OVBA 4P08A 4ZDIA 2FLNA 1HC7A 2R44A 4DMMA 2G09A 4TZTA 2GDJA 3H11A 1Z0FA 1X80A 2HSJA 5B7NA 4O33A 3GFPA 2Q6KA 1RHMA 5KREA 1E58A 1Z8HA 1CETA 3O95A 3K9QO 1DZ3A 4G81A 9MHTA 3G0DA 1RTKA 1SG6A 1SXJA 2Q45A 2YBEA 4ZT4A 4D0LB 2H2DA 1MABA 2ISSD 4OTZA 2E5FA 4AN4A 3LDUA 3WRVA 1CY2A 3DL7A 3KLMX 2Q5OA 4DL9A 4DBLC 3REOA 4QRIA 2C57A 1IZYA 1TVKB 2MUTB 2XYVA 1ULBA 3GPIA 1EK6A 4FYVA 2NZXA 4LIPD 3JQFC 1S0MA 1JDJA 2XMSA 1ZXIA 3AEVA 2Z1NA 4DV6B 2GFHA 5FRDA 3BRWA 4WNAB 5FI3A 3AERB 4QASA 1O0CA 1Z0KA 2YXLA 1CNEA 2CB9A 1G3UA 4FD3A 1X6VA 4AP6A 4MUHA 3D6FA 3UHJA 3QQPA 1MQ2A 3D0OA 4LJ8A 2BGRA 3BERA 3DAHA 1P1BA 3PLNA 4RQMA 1DG3A 4E07A 1NUHA 2Y68A 5G5GA 3PEEA 1X7YA 2G5GX 5AVXA 1ZQEA 4INPA 1PV1A 1CU1A 4DKXA 3KAQA 5GOZA 3I4FA 3EPHA 1D09A 4NNPA 3KQTA 2WAOA 3HJUA 1Z4LA 2YCBA 1COWA 1KK0A 2RH8A 2VS1A 1Y1LA 2X9LA 2JRZA 2F9MA 2OV3A 4RK7A 4DIBA 1WVIA 1J9GA 4X45A 3RB8A 4EFNA 1J06A 4HSGA 3ZY2A 1BQ4A 3N7SC 3ZHOA 3P27A 1TO6A 5G2OA 4Z0TA 1KH1A 1WVGA 2KPOA 4J1NA 3T7EA 2NIPA 3T5MA 2QRNA 3GQCA 2SCUB 2H0AA 2R86A 1T36B 4UB6U 1I30A 5IM4A 4Z7JA 2H4YA 4CM9D 5I7OA 2DBQA 2CXPA 2QTLA 3C2KA 3C87A 2CNNA 1RMQA 4JP1A 1P60A 4QBFA 4C0LA 3E9NA 2P6RA 3RJZA 1DAFA 1GU1A 2WUGA 1JEQA 4NKRA 3OEYA 4JODA 3GD7A 2D7CA 1ISFA 2VIXA 2YZ2A 1TCAA 1XU4A 4ZH4A 3OUTA 4DILA 4DOAA 2VT6A 3I64A 8ICXA 4WOBA 4IF6A 4LZZA 1S5PA 5CNKA 1UQTA 1FFAA 3HLKA 5K8VA 5CFLA 4HFRA 1S7CA 2FN4A 1MGPA 2VUIB 5DH9A 5DX0A 2K4EA 2X9QA 5B1DA 1PL7A 2NN3C 1H05A 4OQ4A 3H1EA 4Q3EA 1HRDA 2DWOA 2BH9A 3EUB2 3OCYA 2GR9A 1K1QA 4B4VA 2GPTA 4YAIA 1YKSA 1HSZA 1D6MA 4XRRA 4GPZA 3NHWA 5CDYA 5JYDA 1MEOA 3U3OA 3LP5A 2BQRA 1XDZA 2FWJA 2VHZA 1QRAA 2TMDA 4HLUC 3H4MA 1PJTA 4J9VA 4MV7A 4AJKA 1YBAA 2IXDA 1TVEA 3ETHA 1P2VA 3WGTA 2AG0A 4GXQA 1B15A 1PR1A 5KL8B 4BVHA 3GDWA 3D8TA 3VO8A 3W5SA 4BVKA 1UWCA 5KFYA 3TLZA 1KW4A 1SCJA 3SV3A 3BMCB 2G9NA 1Q46A 4WE3A 2ZWMA 3GH3A 4DEZA 3T94A 4N12A 4FKBA 3EXEA 4X1IB 1C0IA 3CW8X 1C1YA 1C7ZA 2OC9A 4IKOA 1HY3A 1J2EA 5DWVA 4G5RA 4EGCB 4CF7A 1A9OA 3GLQA 3CF4G 1O0SA 4UM5A 1LK7A 3IUBA 3W6PA 1CFJA 4NNOA 1MT0A 4AUKA 3HSKA 3B8HA 3BS5A 3RV3A 1CZNA 2GOYA 3LNTA 2VKQA 5AKEA 1XUOA 1IC6A 4EB3A 2WSIA 3UATA 1KJJA 5C32A 3FTPA 4E2YA 2RK3A 3FIJA 4FZNA 3LLCA 1W19A 4BKPA 1JXAA 1RZRA 2QE6A 3BIXA 5KNDD 3JV7A 2C9YA 4BFYA 2SNIE 2NXEA 5U4XA 3PFGA 3OE7A 3PFWO 1IB0A 3WADA 4KG7A 1KY3A 3TTWA 1GZ6A 2NVBA 1XROA 2CXYA 3IUYA 1V7QA 4HEJA 2O8VA 4G1EB 1ZJWA 2R60A 1T4MA 3B9PA 3AW8A 1D07A 4DMFA 2FPOA 4TXLA 3SNKA 3HJNA 1QOZA 2N1MA 5TQVA 1G8HA 1GCAA 1W4RA 5C7OO 2VZLA 3QG1A 2BGWA 2Y93A 3NCTA 1FJHA 2ALJA 1Y98A 2FW9A 2YFYA 3H1PA 4WOPA 3ET5A 3QVMA 5IAJA 1ADFA 5G0UA 3SX0A 1NKSA 4N3AA 2UVRA 2XBMA 2W98A 1N7GA 1UMDA 2GK3A 4DIMA 3ESZA 3M5CA 3LIPA 2Q49A 1XNJA 4PAOA 3GPDG 5H4HA 2LYBA 4FE4A 4XIIA 2JLCA 3OEEA 2A3NA 3UMJA 3SYMA 4B17A 721PA 8ICEA 1G3IA 1W2GA 5BVGB 3VKUA 2GERA 5F9HA 3D0QA 3Q7RA 5DDIP 2RHTA 4RK1A 4V0QA 1XMQB 2HRBA 1V37A 1LY1A 1A8PA 2AT1A 1EAMA 1SXHA 3WMFA 2WJAA 2JCBA 3H5TA 4L8WB 2X19A 2GZ3A 5JXHA 4PQEA 4YJ2B 1WDLA 1GSAA 2NACA 2LKYA 4X94A 3IA2A 4M21A 3RVLA 4IX9A 3W6NA 5D1HA 1G8GA 1MHPA 4Q66C 1NVFA 2OMKA 2BUCA 3R6LA 1QXSA 3COWA 3WQHA 3ZHQA 5L3VA 1USWA 3NBKA 2F3RA 1EDDA 4ISBA 1CUEA 1N2IA 4CM8A 4KOAA 4C5BA 4IH1A 4OK5A 5LXTB 2VJOA 1SBZA 1WB4A 1YR7A 2BZSA 2RHLA 4Z4HA 5CCBA 2AN5A 4HDQB 3RJ9A 5SYNA 1SV0C 2QJRA 5G1PA 4W63A 4TMKA 1UPUA 2OYRA 1H1DA 1RRGA 4N4AA 4MW6A 2FE9A 3PQ3A 1KFTA 1Z2DA 5EWGA 4LZAA 2WUDA 3ISTA 3FBGA 4ZVPA 4OK3A 1IATA 3P2OA 2QRPA 2ZBFA 3DEYX 4RF5A 1U0GA 1E3WB 3M3HA 8ICIA 3LUDA 4AYBC 3D8UA 1T8PA 4NY8A 4R8UA 1INLA 5A1TA 3N74A 1H4TA 3TFQA 2IRWA 3B7GA 3DE5X 4BGUA 4DV2B 1ZM3A 4XYGA 2AH5A 2PO7A 4MV8A 4ZV4A 3ZZ1A 4J0EA 2QRGA 2VP9A 2XECA 3TK1A 2RGAA 1RWPA 4LV6A 2HRDA 1ADCA 2EARA 3BGSA 2IUYA 4J0DA 3GZFA 4U2DA 4FQ5A 3UAVA 5EJEA 5J40A 2UZ1B 1L5VA 3I52A 2LNDA 4DCJA 1YJBA 2PYDA 3GRFA 4HX5A 3M49A 3C3MA 2PI4A 3M8KA 1Z6YA 2VT3A 1G5IA 4X61A 1KQPA 4XYLA 2XB4A 3LK6A 3N8DA 4BQPA 5HHHA 4MS1B 5K03A 2AXTU 4EPVA 3IV9A 3QVUA 3BZBA 4M54A 3ETEA 3VBCA 3VO9A 1ZC4A 4Q4JA 2JHAA 3B9JA 4C7XA 1E7RA 1I51A 1FNMA 5JMTA 5G0WA 4EF4A 2A5YB 4OD0A 3HNOA 4UQGA 1B8NA 1IN8A 2G3YA 1LBQA 4K2AA 4FS1A 1PGNA 1FFSA 1YE3A 2ZYTX 5B2ZA 2MSKA 3I76A 3ZLVA 1WM1A 5CHEA 3N58A 1C8LA 4Z51A 1C14A 3SQWA 1BYUA 4OLAA 3ADCA 5IJAA 4R0NA 1KMCA 3QU5A 4TRMA 2Q3EA 3SLKA 1SG0A 3EDRA 2Y0SF 2IDMA 1LPSA 3DWGA 1PVRA 1DRGA 3NYQA 2XXAB 2C1EA 2OXCA 4JZKA 2EJCA 2HLNA 1E2GA 2GAAA 1J1IA 3H18A 1VB3A 5LR6A 5CW2A 3QK7A 1BPYA 3MT0A 3WA7A 3MTAA 3MPOA 3B3AA 1TKRA 4LFAB 1LNSA 4BQSA 1QRDA 3DGFC 3LFTA 3K73O 3AR5A 1TM5E 4YYEA 4ZPJA 1EVIA 5KHAA 4GDFA 1NNUA 2I2XB 2EL7A 3L7KA 4YFKA 3KBOA 3TR5A 5B3LA 4RDCA 4WADA 4AQDA 1RKBA 4WZBB 3VKHA 2JIRA 3EQ8A 4D9HA 2G4VA 1FFBA 1SB3C 4ZEVA 4W4TA 2EBUA 1MRNA 4J1SA 2OYCA 1ORDA 2DHRA 2RFLA 3IEKA 2DUNA 4BAUA 2Z6VA 5KOHB 3PT5A 3PNBA 1TZJA 1O6BA 1CERA 4H3KB 5HX7A 1PI3A 5K0TA 5JQGB 3FYCA 1VLMA 5BWLA 3X1JA 4GYYA 3F6EX 3GA5A 2CLFB 5IAOA 3RYIA 3R7NA 3H7IA 2O3UA 3E7XA 2RIPA 4A27A 3BCRA 3PX4A 5KUTA 4KC0A 3RVBA 4Z86A 2XQFA 3KWMA 3LO5A 2QQ5A 2WMOB 2BSXA 2F90A 3U7IA 4DA6A 2PANA 2PXIA 1V47A 3DMRA 3C2LA 1TF7A 2P2ZA 1KBQA 1NMXA 2QT0A 5EMJA 4F5OA 3P0JA 1H0SA 4FFDA 2GEKA 5K0SA 3U3XA 3IT0A 3TQFA 2HMYB 3RB3A 4K9RA 1F7UA 4NMLA 6ADHA 1Y1QA 1IWOA 4TKVA 1RBMA 1AO0A 4AP9A 4OHFA 3RUIA 5GINE 1RYUA 5C5EA 5GTDA 2ZKIA 5BOSA 1Y3AA 3T0FA 3PD0A 2QOEA 3E22B 4QXMA 3BUSA 1YD7A 1YZUA 4RM2A 5IRCD 1KFSA 4XJXA 4RQ5A 1LBHA 3TR0A 2BQ3A 1Z88A 2I4TA 4D99A 4EY4A 3G8DA 1ED1A 4DFDA 3IEMA 4BZPA 4MQFA 1IQRA 3LPAA 4H6PA 1C2YA 3VTKA 2PUHA 5AH0A 4Y67A 1Q0UA 2VK4A 3CNEA 1YRLA 2CGEA 1JSZA 1XEXA 1JG1A 4C7MA 1VP9A 1ZIPA 4AY2A 2FXVA 1V9SA 4M8NE 4B7ZA 2O8BB 1F0NA 1QIEA 4HAOA 3HWRA 1U0TA 2YN2A 3WG9A 5E6SA 1X74A 1BE1A 1M7BA 1WZNA 3HP6A 2WZBA 3PFBA 3KQVA 5F3RA 3PY8A 3QKRB 3NV7A 4G84A 3N2IA 4PFKA 1L4NA 2QTVB 4MROA 1R6DA 1R5JA 1AQUA 4IJQA 1B42A 4LOJA 2VJDA 2ZRGA 3C8DA 4WERA 1DAOA 5BYJA 1ZA1A 1GP2A 1XQVA 2RQ5A 1OU4A 1II8B 1EXMA 4IZIA 4RJJA 5D7NA 4QQNA 4YRBA 1YUBA 5KNBA 4IQGA 1TMOA 3WGHA 1S1MA 1N5XA 2V1UA 2PGJA 1FU7A 5AKHA 2HN9A 4IQ4A 2GK6A 2X6RA 3SENA 4NABA 3CX3A 4JWKA 9LDTA 3FVWA 3RQIA 4UHCA 1CR6A 4ODIA 3BCHA 1RZUA 4GMXA 2BFDB 2JAXA 4TSRA 1VE3A 5AJXA 4MWDA 4XZ3A 2YC2C 1P73A 3VR3A 4C8KA 4JC0A 4U9HS 4D6YA 1KGSA 3ZCTA 3S2GA 1TUGA 2P40A 4O29A 2ZI5A 1M75A 5AKIA 5FADA 2CNDA 5DNEA 5SY9A 4MO2A 3S1SA 2JBHA 1DFGA 3UKOA 1AZWA 3G9UA 4N0MA 1WY7A 4FSXA 2WD7A 2L18A 4IP0A 3ZBTA 2B69A 3FPFA 4QU8A 1FJ2A 5AW7A 1ND5A 1KEEA 5D01A 1QIGA 3QEOA 3H8MA 3G9XA 1PG5A 5EQJB 4RV5A 2PLFA 2UZAA 1GXSB 3NHFA 1FC0A 3A4VA 4J0FA 1E6LA 3LUCA 3PHBE 3R5TA 3D0RA 4D74A 2P1DA 2ST1A 4IIVA 3RTCA 1E2UA 4YO7A 4I2IA 3RVSA 4XTCS 4DUGA 3H2JA 3K3PA 1NOJA 1WIWA 3KUUA 4I1SA 1V11A 1KAOA 1NUPA 1U7XA 1UZLA 1S3FA 3MG9A 4F1WA 2H1IA 1QH1A 4GKAA 1BEEA 4MHTA 3E7DA 4RQ8A 2HLPA 2RMKA 5TQ0A 3UWDA 4JOQA 4P2GA 4CVNA 2RG1A 5L4NA 3EZXA 4MMYB 2QJOA 5A5FA 2K7ZA 3DEAA 4FR2A 3ESXA 3IRUA 4OFXA 4DWVA 5BYAA 4YJHA 5DYIA 2WWWA 5CBKA 4A26A 1VI2A 4YN4A 3QE2A 4QDTA 4Z6EA 1KI7A 4QGHA 4Q9KA 1FFUA 5AVSA 4MEAA 1GFSA 1TKCA 1Q3VA 2VHCA 3R77A 2I6GA 4LXTA 4N48A 5BRAA 3ITEA 3HT3A 2J7KA 2K4PA 3EXFA 3F2VA 5IDQA 5A4DA 3ZVKA 4G25A 5DBAA 5KG7A 3HPOA 2R85A 2YZMA 4DTIA 5H16A 1YZKA 4J7XA 1TVCA 3E0QA 4UULA 1YI1A 2DQYA 4X1KB 2UVQA 3E0XA 2X1HA 4X5VA 4UEJA 3X2SA 3R7DA 5HZMA 3ZV6A 5HR6A 5DKWA 2AGPA 3CLRD 3TNLA 2GN9A 2CJWB 2XWQA 1N6RA 2PIDA 4XKJA 3LF1A 5ITZA 4G9BA 1DELA 2FSPA 4RZ2A 2IW3A 3IUSA 4X5OA 3K6JA 4BX3A 3QTLA 4DQSA 1MO2A 4P54A 2FWRA 5HA5A 1KOLA 2GBPA 2BD0A 5ICCA 1CF9A 4PHPA 4JROA 2PYZA 1CRLA 3PQCA 4MVJG 1YE8A 4OQXA 3EB9A 4F2WA 1HO3A 3TAXA 1IIRA 2ASJA 3CZPA 4NYIR 4PO1A 4GD3Q 4RFSA 3M9OB 3O7WA 3D2CA 3QEJA 3WL7A 3FFTA 4AZ0A 3ER6A 1JXMA 2PI5A 4RL4A 4JDPA 1HUQA 1R4AA 1X7XB 4DLBA 3QLUC 3EF0A 4OLBA 4QZIA 5ECWA 3FCUB 3R7BA 2RHDA 1QONA 4ARZB 1O6FA 3GNTA 4DYHA 3OTIA 1GRNA 1Y9DA 2AZXA 2NTNA 4Y30A 3LVBA 3V72A 4ELTA 4A0GA 2CL6X 2GO1A 3PS9A 3M3DA 4KSYA 4W1QA 2HK9A 1AS2A 2HRZA 5C53B 5A2QA 2G9UA 4R2JA 7MHTA 3G89A 5AKLA 2V0CA 3RIYA 4J2OA 3K09C 4QDZA 4R81A 4BVEA 1TUIA 5CFMA 4BNDB 3TEFA 4CQMA 3DE6X 3O6VA 2QTGA 2G5CA 3SZUA 3B1WA 5B3JC 1GEGA 4WDRA 3EAQA 1V8DA 5ED4A 4D3DA 4LHWA 3EDYA 1OW3B 3GLFA 3G5MA 4RMNA 3E4DA 4FS8A 4BX9C 2I80A 1Q1BA 1V5EA 2WUVA 1KVRA 4E5PA 3E7WA 5GOTA 2O48X 4DSTA 1Q8KA 2AOUA 4HNHA 2W58A 3CX7A 1AC5A 3T3NA 3IBTA 2OYSA 2A7QA 3N2LA 3STTA 1NUSA 3UHOA 2F3NA 2ZATA 5DK4A 1NULA 1TF5A 4ENQA 3HUUA 1RYEA 2IOYA 1COKA 3K5HA 3THXB 4KVGA 3UXEA 3KXDA 5JDCC 2J3DA 2CD9A 3RVOA 4JD5A 2O2SA 3ZE0B 1BQEA 1ESCA 3VSEA 5AM2A 3W1EA 4KCGA 3TLCA 9ICXA 1ZU4A 2C7GA 4U0JA 3RFAA 5JTIA 3VC2A 5K20A 3PI7A 3W34A 4GNKA 4V24A 2IYQA 5JFTA 2M6KA 1JR2A 2G28A 2QP4A 5AM4A 3VU0A 1TD9A 3DO6A 4G4GA 3IODA 3PFHA 2WTMA 5FWXB 1EE2A 1QG6A 3M1AA 3CXUA 3TI0A 1E66A 1C2TA 4X6XA 1JEJA 4GXJA 4UVGA 1NOKA 1OFIA 4BZQA 2EZZA 3BIOA 2ZYWX 3G2KA 5CVCA 4GWGA 1ZMRA 1CRQA 4H27A 4NCIA 3VH4A 1FZQA 2XUZA 3TQHA 5BO5A 4OKSA 1NK8A 5DBEX 1E9VA 1BH2A 3O94A 1XD9A 1WUKS 3OFJA 1ACMA 5DF1A 4PPGA 4RKWA 3WNVA 3VO1A 3I72A 5KG0A 2QUBA 2DKZA 5JXJA 1Q50A 2W70A 3O1LA 4B9MA 1G7SA 1Q7TA 4A0HA 2V7GA 4MHSA 4A8JA 1YRWA 1QV6A 5KFSA 4R9SA 2YXDA 3NHUA 3FPJA 4HF7A 4NAVA 2O5RA 4AUEA 5E8RA 1FOEB 4FZRA 2PVCA 3MYYA 3MR3A 3ORFA 1SC6A 4XD7D 4I5EA 5GY7A 1R66A 1DIOB 3REQB 2CJYA 1N61A 3DR5A 2CVFA 5DNVA 4JIMA 4O4LB 2Y1WA 4ZOHC 3ROXA 3HA7A 5B3AA 3DEZA 5LDHA 7ADHA 4MV6A 3R0XA 2DPMA 5DYGA 3FTEA 5KYYB 5JD6A 3MN1A 4I8IA 4M60A 1NBEA 1Y8RA 1Z4IA 3DPUA 4P4LA 4KFUA 3UH1A 1E5QA 5E6RA 4N6GA 3GQBB 1HV8A 1ABBA 3E0FA 1G0NA 5IYZF 4QKQA 1TLTA 2KFNA 1Z0UA 1VKJA 3NM6B 3KT0A 4YMMA 1XNHA 3LPNA 2VDMB 2FZWA 2CWDA 4F5EA 1FB5A 4DT1A 3KZXA 4U8HA 2NLOA 5ERGB 2QJFA 3U1BA 2HF9A 1KOGA 3K15A 3H5OA 1KYQA 3AVPA 1ZWLA 5TV2A 2EKDA 4GAEA 3T1OA 4EG4A 4TQRA 1M1XB 3V00A 3RB4A 3S2FA 2WINI 2WP8J 1Y4ZA 3FJOA 2J5XA 2KVCA 4W5OA 2A3VA 1I4LD 5AW9A 3VRHA 1X92A 3NNSA 4KIWA 5G53C 1RJFA 3ZHVA 1YJXA 3VAAA 1KHTA 3DZCA 4UFOA 1UKVY 3MCUA 4E70A 5DB4A 4JXZA 1MC8A 4EYOA 2Z95A 5K3AA 3FBWA 4H1HA 5JD3A 1R6UA 4BUCA 5ALIA 1G4UR 3RWBA 8ICQA 4ZCQA 2WJGA 4QZGA 5AJHA 1H23A 5GVRA 4TUPA 1URPA 2DUYA 1XLWA 3LVWA 3F6CA 4PRLA 2QL5A 2PKQP 2JGAA 3PPIA 5B37A 4RE6A 2AFHE 5DCUA 3INRA 1TECE 4TKZA 1QOPB 5JQWA 1HLDA 4K46A 2M6RA 4Z1MD 1DEOA 4EMSA 4QWMA 1U0NA 5LD2C 5T3YA 3CE6A 5KO2A 2GBIA 5CFRA 1Q84A 1I2BA 3U62A 3U48A 5CT6A 3AFMA 4H77A 1T3QA 3SQNA 3IYLW 5KWJA 5C0OE 4DLWA 3ZDAA 3MUNA 1OXSC 1A8UA 2Q0HA 2MDTA 3I3OA 1ZQQA 1DS6A 3NEYA 1L7VC 1BGVA 1OASA 3FRIA 5DK6A 2EQYA 5ICMA 1B0UA 2ERYA 2E48A 2OBFA 1RM5A 2WBLC 1NJ5A 1NVUQ 3H0MB 4QTTB 2HB6A 1YKFA 4ZEMA 2LBPA 3KL2A 3SNHA 1W5FA 4PFSA 2AK3A 3C29A 1PIWA 1IEQA 3GF4A 3A26A 3A6LA 4JWTA 4UVIA 1UF9A 4M9CA 1JDTA 1CZKA 3RUCA 3QYFA 3VYVA 3MD0A 1E2LA 1RRCA 1Z37A 2VPXA 1YK0A 5IVIA 3T3GA 4DN6A 2GF0A 3SSMA 4BO2A 4PGMA 5DXAA 5TPWA 4NVRA 1T3LA 4N3GA 4TTVA 5IYZA 2XOEA 2A5LA 2OM2A 3SIPA 3AINA 3AR6A 2KB0A 3AJ9A 1GCIA 1YRHA 4QIWF 2QBYB 1IVYA 3PGKA 3AF0A 4WKBA 1G3QA 2QT1A 5BSTA 4CF6A 1CCWA 3D8RA 5TX7A 3QWIA 2JJMA 3S2IA 2OL4A 3OA2A 1F2VA 2MIIA 5IWAB 4Z53A 3AR2A 2W6NA 1G41A 2EGHA 3PKJA 3GC6A 1F4LA 1EQAA 2BGLA 3OP4A 1AHNA 2F3QA 2HV8A 4JP2A 4ECAA 4BFTA 3QYJA 1L5OA 5J63A 2QM3A 4BLTA 1VA5A 3DBHB 5IEJA 4ID3A 1UJCA 4IS3A 4EB6A 3EXHC 4WFKA 3GGJA 1U5AA 5LOVB 1KEPA 4YVZA 3VPBA 2AGVA 4IVPA 1NMEA 7ICOA 3UT5A 3WWCA 4PZ0A 1MJFA 4BGDA 4PYQA 1UM9B 5AXAA 1MA7A 3TLGA 3MJSA 4F1JA 4IDEA 4FYMA 3O1JC 4O0IA 2WDZA 1NRWA 4HTFA 4B3RB 1U8ZA 1AUPA 4KLEA 4LMPA 2C58A 2QY9A 4ADSG 4IM7A 3DLPX 1AJEA 4AJ9A 1N60A 2HIMA 2JGKA 4XSGA 3CNNA 2R96A 1P2BA 1BW9B 1OE0A 4FQ7A 3I9JA 2EJBA 4OSEA 5DEIA 5EMNA 5AJVB 2ZB2A 2H7YA 2XE7A 5TDHA 2FUKA 4M2LA 3PVCA 5AI4A 2J6SA 6CHYA 4DMKA 3O4HA 3L77A 3L9XA 4N82A 2X4GA 3TDKA 4FI3C 2CFTA 2PT5A 1Z6TA 2PQMA 2JGDB 1J22A 3BG5A 1CE8A 1OBHA 2MHCA 4KPUA 3PTZA 3GZNB 1B8VA 2BMAA 2KKPA 5CAEB 4ND4A 4LN1A 4HMPA 9LDBA 3MB8A 5KT2A 4LRXA 5SYMA 1J8VA 1RWXA 5BRNA 2R6JA 5IEBA 1Z35A 2IUUA 1U2GA 2Q2VA 1T5BA 1BDMA 4YPOA 4KXWA 4OPMA 3C6MA 2XY7A 2R7NA 4E09A 1K97A 1GL9B 1IZZA 2W2PA 1UPCA 2FWPA 3UUGA 2IGTA 1BC5A 1RQ2A 5JRZA 3GEHA 4MIKA 2WVGA 2ZT7A 4NH4A 1SUWA 1P29A 4A2PA 3Q6IA 2C78A 3PFFA 4MAFA 3MAJA 3OH8A 5LL6P 3DVSX 6NULA 3H3XA 3DW3X 1KH2A 4D97A 4BWGA 4PBSA 2J9RA 4L76A 2BONA 1NJSA 2DY1A 2PUVA 4EZEA 3W3AD 4JL5A 2VRNA 3HKBB 3ZXUB 1JA0A 2BBWA 1ADYA 3I01M 2B8WA 2WF8A 4IIFA 2AYYA 4YV7A 1JHUA 1M1YA 2V8BA 4EUEA 2IIVA 3NIWA 2AOVA 1T9ZA 1WF3A 3U9SA 3CRZA 4MULA 3COVA 1XL0A 4RMIA 1Y6RA 1BE6A 1PN3A 3ICVA 4JI7B 2ZCVA 4IFTA 4FOSA 2PK3A 2POCA 4NXNB 5B58T 1IMOA 4E0BA 4R6XA 3BTOA 3TCXB 2A9FA 1JFVA 1N5WA 4WAUA 2I33A 2HPZA 2A0UA 3NO4A 8ICJA 4KW7A 5BYKA 1GYRA 1Z29A 3PK0A 3CZQA 3P9YA 1PNRA 3LL4A 4JJGA 4FYKA 3QHPA 3LVFO 4M22A 3O74A 4RLQA 2I99A 1GN9A 4KH0A 4RANA 3H97A 2X77A 1GPUA 5DHFA 4OI0A 3LCUA 3IE0A 2XTMA 2ZRMA 5G4LA 1B8UA 5DQHA 3FF1A 1GOTA 1T8SA 4FTWA 1CEXA 1E1CB 4B4KA 1W6UA 1S8FA 5FBZA 3ID6C 4G1FA 4I2DA 3Q8QB 1SCQA 4R54A 2ILVA 2O7QA 1SU8A 2WHPA 4PANA 4ETIA 1Y0BA 3UXOA 1TFUA 4BP1A 3D7KA 2QRUA 3U7QB 5AXBA 3ZWPA 4UHEA 5FFMA 4ZVQA 4TS1A 2LUOA 3TLBA 9ICSA 1PZMA 1PR3A 4DIOA 3CUKA 2XNJA 4OFWA 2PG3A 1A0PA 4EY7A 1D9ZA 3CVVA 2ZPUA 5TPZD 4WVFA 3ESDA 1ZESA 2PMCA 4WN3A 4UNPA 2EKPA 3PKIA 1C80A 1Z8FA 2FX5A 2CHFA 2IHNA 2ZTHA 3F1KA 5BQOA 3BH0A 1KKUA 2GO7A 3FKSA 4NZ9A 4HB3A 1PQYA 3FVQA 1USKA 4KN8A 3UWSA 1SH7A 1R4MB 1OLUB 4DNQA 2Q3BA 3OQ6A 1TMGE 3TOSA 4NY1A 3EF3A 4X71A 5JU5A 1DJQA 4QDUA 4QTYA 6PFKA 4KIJA 3FUVA 3P9CA 1JTFA 4H1TA 4F92B 2ZLBA 2AR9A 1M1NA 5KJ6A 1G19A 3PR5B 2IPAB 4NBTA 4OO1J 3CA8A 1Z68A 1RKUA 2XE6A 4KKXB 1Z83A 3HDVA 5FF9A 4QT4A 3HB0A 1MQ9A 4B3TB 2CUNA 1Z7WA 5L7WA 1GPWB 4DLEA 5IKOA 3EISA 4QWDA 1DUIA 3O4JA 1XD2B 3IB3A 3F78A 1OR8A 3QPAA 4OA5A 4CR6A 2Y6VA 3R3HA 3TSZA 3LCRA 1T9DA 2JH1A 1R0RE 4P2HA 3PUHA 1EP2B 3COZA 3RSGA 3WK6A 3GJTA 2RKBA 3VPFA 1KRWA 2GSWA 4L5AA 3VC1A 4ER0A 3K70C 1X1RA 1Q21A 5KC9A 4R5MA 4BFSA 1SXDA 1Y7HA 1H1LB 1RJ9A 3O3CA 1F8FA 1JJ7A 1RBYA 2XTZA 1BMDA 3M6FA 1NI4A 1EFRA 2UU9B 3SOZA 2JLRA 1IBSA 3C4JA 1XOIA 5I9LA 4Y6RA 3U3DA 2W2QA 1TADA 2YIVX 4DL4A 3ICPA 4P33A 1G20E 4QHSA 5JCPA 3AR3A 3TL2A 2P5UA 3UT0A 3UPQA 1D4AA 4O2AB 1JG7A 1ITZA 1RYDA 4DG8A 1T9KA 4EL5A 3P96A 4ND5A 2IF0A 3EIOA 4IIJF 4OP2A 2Y1KA 3TF5A 4MV1A 2BDPA 3FYUB 5H1YA 1M6VA 3MCZA 2X5OA 2I4OA 2XVYA 3KXLA 3IV7A 2XQJA 5CDTA 5JPCA 2CJPA 3PQ8A 1PX2A 1NW5A 3GEDA 1ZH6A 3ZLTA 3M6VA 1W1UA 4HRXA 1ZQHA 2Y9PB 1J21A 1NE2A 4K9NA 3KUKA 8AT1A 4K05A 3FFWA 1X1CA 5JECA 4FZJA 5LQDA 4IR7A 2IIBA 1Z3EB 1MZVA 4KE8A 5FUQA 5L6LB 4WZAE 1FVHA 2JAHA 4AF8A 4K03A 3UPTA 4C06A 5EWFA 5TSDA 2BI8A 3GRUA 4X6UA 1X7DA 4G85A 4P82A 5LWHA 4HBGA 5ITWA 3EFEA 2GBCA 2Y05A 1E0SA 1OX4B 3I3SR 4DMLA 2C9BA 3A9SA 1UPXA 3QW2A 1NDHA 4A2WA 2PH3A 4PSCA 3ABOB 1BGWA 3ZHUA 4Q4AA 1M2VB 1DBRA 5CYFA 4IUYA 1M76A 3W1WA 3R6GA 4NP6A 2AN1A 1NP6A 4PR0A 3QBVA 3S2UA 2XCPA 2GFQA 3I73A 3K0CC 4HXEB 3CB4A 4A4DA 1XD8A 3EEIA 1AROP 2ODQA 1CR0A 4U9IS 5CIYA 5FI0B 4KQ6A 5G1OA 1Z7BA 5EG5A 4BJQA 5IBRA 4DLZA 5ITVA 2OECA 3VR4A 2IYZA 1BPEA 2R7AA 2UVPA 1SBHA 5CR9A 4H15A 3NDIA 3DPSA 1VYVA 3NTRA 3GEEA 3CKKA 4UARA 4U5XA 3SAJA 4DSJA 3V4VB 4G2NA 1EVQA 1OUMA 4NARA 2H06A 3EZ7A 4QUKA 3L0IB 4PPFA 3FYSA 3D2LA 5ALWA 4TWJA 3TTUA 4BVAA 3NTXA 4DDWA 1NJZA 4RE5A 4GX2A 4J0GA 4WW0A 3F4KA 2WB4A 4W99A 1VL5A 4DQRA 2JZNA 4NM1A 1I10A 4O4JF 2ERXA 5KFDA 5DISB 4YRKA 4BRUA 4IIJA 1QGAA 3HR7A 2CSXA 5K8UA 2BP7B 4A6XA 2VKTA 5GP1A 3TLEA 1HFWA 3EH1A 3NT4A 4N3CA 4EA8A 5JATA 1IL0A 2ZRCA 3KKKA 5F3WB 1NT2A 4NR0A 2DECA 3W9YA 4LXQA 1PNQA 4YT5A 1H2HA 1E79A 5REQB 5IH3A 1H85A 1CEZA 2BFAA 2FP4B 3W2HA 5I8PA 2J5KA 2DCMA 4F9GA 3RIGA 1UBUS 3R3ZA 5NULA 2VK1A 1K88A 1M74A 3S3TA 1I6MA 4Z8YA 2XJ9A 1I4OA 1WULS 3S1LA 2Q6LA 1NXOA 2ZRDA 3PI6A 2ZWPA 2BDTA 3IEIA 2B92A 3WYGA 3CEMA 2FLVA 4R2XA 1JEYB 4RPYA 4C7BA 2WIFA 4CMEA 1YT3A 1GV1A 5IVHA 2B4TO 4P4GA 2GCGA 3I01A 1SKRA 2HQOA 3CE9A 1SL2A 2QTNA 3KV3O 5AJUA 4WA8A 1NR1A 4YMNA 3GJYA 3SS8A 1JKXA 1IRXA 4OX9B 1PTJA 2CHUA 2FFJA 4BTVA 4JI8B 2I76A 4RQ7A 1HA3A 2K2QB 1K7FB 1ZQBA 3CEAA 4IXDA 4G3XA 1LBSA 3HJRA 3UJNA 3S29A 1ZOSA 2EGGA 2D54A 1FFVA 1U11A 1VSTA 1NUTA 2YJNA 2HCJB 2D4HA 1SXQA 4DV5B 4ZU6X 4H7KA 5IPFA 1VJ5A 2LRHA 4BGEA 4PRYA 4MTLA 4WUTA 3KBBA 3KHLA 1N2BA 2W3RA 4OJYA 2JIZA 3COYA 3T7CA 4BNFA 1XZCA 1XHEA 3WTCA 2B83A 3VSAA 1WHTA 4N0EA 2GXQA 5TGTA 3C3KA 4LZNA 2UYOA 1J7JA 4C6TB 1OYOA 1T2CA 4KN5A 3L6UA 1FBNA 2EP7A 4DJ5X 2MSWA 2B8NA 1EWRA 4ITVA 2VJQA 4OMFG 2J09A 5M29A 1I2ZA 1TTPB 4J7AA 4IHQA 5JSHA 1R16A 1E96A 1XZPA 4XUSA 2IYPA 3AOEC 3BF8A 3BSSA 3BRQA 2IHJA 3OCWA 1V25A 4TQUS 2EFHB 4MA0A 4IKPA 2OHFA 1O94C 3E03A 1THGA 3VPAA 3OJCA 4BNXA 1XZLA 2QRKA 3INTA 1YHZA 4O4JA 5KQSA 1WDTA 5ECDA 3D6AA 2JL1A 1ZQLA 1UFRA 2J5QA 1FUUA 3A04A 3RRMA 1O6CA 3NFRA 3FAHA 1P9LA 3LP8A 3OZXA 1JZTA 4RYDA 2FSHA 1RFGE 3N8KA 4CI0B 4RPXA 1SC3A 3WSTA 3T0GA 3D3JA 2R8KA 1PZNA 4YEDA 3KHTA 4ZAGA 4KO2S 2GCIA 4MVJI 2C3PA 1ZEJA 3PX6A 4X8MA 2Z3ZA 3NUGA 3L0CA 2XWBF 3L0OA 1HL7A 2IEYA 3F9RA 3WKBA 5E7JA 3HR8A 2WM8A 3S8MA 3F98A 1MH1A 1TZBA 4RPKA 5J0UA 4EEYA 5KKNB 3D7SA 2IEAA 3KKNA 3UK2A 8ICAA 5DYWA 3QBEA 1PJBA 2E4VA 1ISMA 3R0JA 2DQZA 1TVKA 4YXWD 3PUKA 4KVZA 2O7SA 5HOEA 2J6HA 2MUTA 2GJ8A 4X95A 1B41A 5HKKD 2VA3A 4ZAWA 5ESRA 5L7YA 3ZDRA 5E8JA 1BWQA 1VDZA 2PGLA 4O5OA 3K2QA 4OGLA 3VYWA 1NM5C 3H9CA 3UZUA 1ZH8A 1FXUA 4WNAA 4BOYA 1VSQA 5DM1A 3AERA 3LVRE 4P0QB 1YQWA 2UUBB 2N1BA 2H8KA 4ER7A 4NCBA 3A70A 4ND8B 5EJIA 2YJ6A 5J0TA 2XNKA 2WNSA 2IU3A 5L6MB 1JLLB 4K5QA 1XTVA 4UATA 1MV5A 3MWKA 3TJZA 3CWQA 4YDHB 1DAHA 3B12A 1TCCA 3FMVA 2WYVA 3UBTA 4EB8A 2P9EA 1SUFA 2CDAA 2WHEA 1CJKC 3A3OA 5FTJA 3M6KA 3MRTA 3HS3A 2QTWB 3DQZA 1JLMA 3SSOA 2NZ2A 4OQQA 4KJZA 1CYEA 3Q9LA 4KLAA 4L08A 1BXZA 1DUVG 3I9OA 4XFKA 4A36A 4WWHA 3JZAA 3AB8A 1U28C 1PVPA 1HZZC 1AD2A 2NUPB 3VNVA 5KFEA 3S5UA 2SCUA 1TK3A 2RHJA 1T36A 4GWKA 2RKOA 4Q93A 2BI4A 3DUFB 1IWPB 4KN4A 1NW8A 1V1MB 3FFBA 3L8DA 5AYVA 1M34B 3NWJA 3U7GA 1SWVA 4I27A 1F1BA 1GU0A 4OQDA 1GL6A 1ONPA 1PT8A 2B9EA 3OZ7A 4NAHA 2QMQA 4F60A 1AMUA 2Q3MA 4MP3A 4GQAA 3B2NA 1H38A 1S96A 3DFZA 3PL5A 3GAMA 1PQPA 1TOAA 2VP2A 4H7DA 2GH1A 2I5HA 1PVOA 5DHUA 3S27A 3OZSA 3TACB 4OHXA 3OETA 3OX1A 3KVVA 4U1RA 5DBBA 2P65A 5DCWA 1VBKA 2Y2UA 1ID8A 5AW5A 4RV4A 4I2NA 5KFLA 1SOAA 3VNRA 3CJRA 4D41A 3MMPA 4OAQA 1E6CA 3NTOA 4K28A 2YMLA 4HY3A 4OY3A 2O5EA 4BFVA 2NPIA 1XZHA 2MSDB 4RQNA 2ZRJA 3MTBA 4IEEA 4ESVA 1VPTA 3E5MA 4B9UA 4JT8A 1T6ZA 3EPPA 4D56A 4URVR 3SHWA 3FTNA 5G3YA 3SC2B 2VYQA 1Q2UA 4YALA 4FJ0A 1OPRA 2JKYA 5JASA 1YC2A 1OJLA 1P61B 4G9GA 3LXRA 5B6JA 4OVKA 4RY9A 4YJ2F 3HC7A 1Q5PA 4WJ3B 2D5LA 5ALEA 3BMCA 2ZS8A 2W9BB 1R1DA 3VV3A 2ZSKA 3EK2A 2B78A 1Z74A 3LX6A 3GUVA 1Z47A 1A2BA 4PGGA 3K5IA 4X1IA 1IUPA 1RADA 3LA8A 3LPCA 3CINA 4YCNA 5CG2A 1ATZA 1YQ9A 3RGGA 1FRNA 1QCKA 4RV9A 4L75A 3CIOA 2CZQA 4M99A 1MF7A 1Z3IX 5LXTF 3PEWA 2FHPA 5ALRA 2GJAA 5KYWB 4S12A 4IW3B 2WA2A 1F3OA 2P9YA 2IP1A 1DXYA 2HQRA 3GFTA 2QVLA 3ENVA 3HYNA 2FAXA 1YFJA 2FW7A 3LG2A 3CRMA 2VHUA 4QRHA 3IQZA 3ESQA 1WXHA 1MO4A 4ZOCA 5DBOA 1PEYA 1WP4A 5IG2A 4HZUB 1IY8A 2IWRA 1Y6JA 3N4MB 3THWB 3CH7A 4X7RA 1DO8A 2PX2A 2HU2A 4PSUA 2XUDA 4E21A 3AF2A 4AULA 2PMWB 4BNLA 1H8HA 4FEYA 3I1FA 4KAXA 4EFMA 1FFYA 2XT0A 4H4EA 4O25A 4QYSA 1CIVA 3L7MA 4JVMA 4KSBA 1UCFA 4NONA 4OO3A 4HP8A 2UVWA 2V7PA 1J33A 2C28A 5K0BA 5I4CA 3X1DA 4M0UA 4JKIA 2ZJOA 2NVUB 3K1RB 1AGPA 1RWWA 2FPSA 1K7EB 3RUDA 3V4RA 1N2OA 1SJ9A 1FTSA 5H0IA 2GPYA 3V6KA 2OCYC 4TN1A 1Z6AA 2CL5A 4ZQGA 4I4CA 4BRSA 4ZCIA 4A3SA 4BX8A 3CLTC 4UBOA 2G72A 4B9SA 4TL6A 2HUNA 3TQSA 2HGSA 3BQMB 5A3QA 1QYCA 3S28A 4QGSA 3A10A 1G21B 4HLNA 4IBOA 2OK7A 3D3WB 1XLVA 4TMZA 2Z43A 4KSCA 5BVGA 1ABFA 4B31A 4ESHA 5C18A 4PPXA 4RKYA 2VTVA 4BNIA 2M6SA 2E8MA 1EDBA 1YO6A 3UQ0A 1R7RA 3TL6A 1B16A 2JGFA 4YJ2A 1AMOA 1SB9A 4I9HA 4TVBA 4WXRA 2NXCA 3BQ9A 4ZWNA 5CW1A 4WRRA 4DCPA 3CM0A 2NADA 4L74A 3TZHA 2VI5A 2F2AB 1FNSA 5LDDC 3C3JA 2JBWA 3K0AB 4EJSC 5A4KA 2DQNB 1FFHA 1DI0A 1IG3A 3FFXA 4F38A 5GJBA 2QGZA 3RHSA 1CP3A 5L53A 3PSHA 5LXTA 3RCBA 4F72A 4Q8EA 4OJTA 3ICWA 1QKIA 1I3KA 1PVVA 1P4JA 1U0LA 3LT5A 5TIIA 1D7AA 2A0YA 4RSMA 2X0EA 3SZGA 2JLVA 3D0KA 3L49A 2BPGA 4G0WA 3SP1A 3T4UA 1IM4A 3WNZA 1KVUA 2Q5LA 4DQXA 4IO1A 4ZAYA 2ZIEA 2QR3A 2J6TA 4ND1A 3H5AA 5M5BA 1E3WA 3I2YX 5JQGF 2R48A 4JNKA 3PW0A 5AVTA 4IHJB 4NXZA 3FYTA 1QHSA 3RSQA 1IUKA 2KJQA 1CQIB 4C4AA 4C6SA 4Y0NA 2QI9F 1E0KA 3KQKA 2YV4A 1V9CA 4P3YA 3T7IA 1V96A 2H11A 1SVIA 2QZZA 2ZSDA 3GVPA 1A4IA 3PC3A 3KQOA 2RHBA 3GCZA 3SAGA 1NI5A 3WX0A 4MDHA 1ZCJA 4EPXA 1Q7RA 4ZT5A 5KMGB 3P0FA 3WRYA 4R9VA 3BMOB 2GA8A 1IXRA 1SU6A 2EYQA 2UZ1A 3UGQA 4BV9A 1RW4A 5DN6A 3EUAA 4JP3A 3ISBA 4CKZA 4KHPB 4K87A 2I2AA 2VJYA 1FFCA 1J5PA 4B9NA 3C7DB 5ALKA 2HYDA 3UBMA 3K7EA 3N9IA 2RHFA 3SI7A 4MS1A 1VLLA 4X3CA 1P7VA 1V5WA 1C7EA 3AX6A 4RFLA 3VKGA 5FL7A 3JAKB 5JV5A 5KCMA 5DM0A 1SKQA 1E1LA 3ZC3A 3ZE8A 3ICCA 1SGWA 2FUCA 3IKJA 1UUFA 1NBMD 3R0ZA 4N40A 5DIZA 4G2TA 1QLHA 4E30A 4NESA 5FA5A 4OHOA 4UBNA 3BSWA 3EZYA 7ICHA 1Y3HA 2H3VA 3VYSB 16PKA 4Z9AA 4PXAA 4J9OA 2J5BA 1E59A 1NURA 3C5EA 4X20B 3KAKA 2IOFA 3UXNA 1E32A 4PBRA 2YTZA 1H3EA 2GFIA 2XXAA 1AQ6A 3EVAA 4OL9A 4PZNA 4FR5A 1N0UA 1WZIA 1NBOA 4IQ8A 2C5HA 3NHSA 4HSEA 4TTRA 4XGRA 4RNOA 2OE2A 3FPHA 1YS6A 5KSYA 1S3GA 5DM4A 2IEDA 1WA5A 1JW9B 2KBEA 4M0AA 5KL1B 3V6LA 2KKVA 1F17A 4RHTA 4LTDA 1ZEMA 1W34A 4RPCA 2DAPA 5E4YA 4WZBA 4TLEA 3C5CA 3JW8A 4YECA 3ETJA 2HU8A 2O8EB 4F93B 2GEVA 4LVUA 2CDNA 1Q1ZA 1Y3DE 1E1QD 5KOHA 3EYAA 1EJ2A 1NN3A 3P9RA 4OAPA 5JQGA 3H42B 3C7CB 3GLGB 2P4HX 3BEDA 1N34B 3CSSA 4IZHA 3S99A 2PSEA 2PRJA 1VYUA 1CR2A 1SCBA 5IIIA 4PW0A 1CUCA 4ARCA 3OFKA 5EJ8A 4EX7A 3WL3A 3N7RC 1Z82A 2DKFA 5KFUA 2ZG6A 4CM5A 4QELA 4UKDA 5JYBA 3ZDEA 4WI1A 1W2HA 4PYKA 3VKWA 2O8CB 2AMLA 4TLMB 5LNK1 3CUEF 2IBKA 4CR7A 1NLYA 1YNOA 1CZLA 1ZBQA 1SKAA 3AHGA 1Q7CA 1DAMA 1Q6ZA 1KQ3A 1X9XA 3MOGA 2QMHA 2PKEA 2WJ4A 4W9NA 3ZWDA 2YIDA 2BFEB 3FNHA 4DDTA 3IPRA 4AX4A 2H3QA 2YOHA 1SRQA 3E22A 2P9FA 1YI8A 2B21A 3PIIA 2COKA 4OBBA 5BNIA 2Q41A 1PEDA 1TA4A 5IJXA 3EZ5A 1ZK1A 3FUCA 5HTOA 2PM8A 3PR1A 4ZYTA 2CVZA 2F2TA 4EZ9A 1LK5A 3TLXA 2G1KA 5ICGA 2LCIA 3N0WA 6YASA 1OJ7A 1QFZA 1Q3UA 5JJIA 3RNOA 2O8BA 1PKXA 3U61B 4LZWA 5CVVA 3ZCSA 2RRDA 3IDWA 5CD1A 3G49A 1WDWB 4ZTZB 1X1BA 4BASA 1VDMA 2Q6TA 1QMPA 3QKRA 3U16A 1X9MA 5SY6A 3FVTA 2IODA 2PQ2A 3L2OB 3O4FA 1V3VA 5B4UA 1WTAA 4GPAA 2QTVA 4J0CA 1GD1O 1FW8A 1UEIA 1S7GA 4Q6WA 1II8A 4YR0A 1WV1A 4QUIA 1A69A 5JZSA 4LW8A 1KPHA 5BOVA 1GAQA 1W93A 1OLXB 2CE2X 5H68A 4M9NA 5JCXA 1VL2A 3LW7A 4G0MA 4BEBA 3P4XA 3AKEA 4CFSA 5LZ5A 1DRUA 3E1KA 5IK2D 3DT9A 3SVLA 4EHKA 4M9ZA 2C2YA 2XYPA 2BFDA 3P5BA 3SHTA 5IN4A 1Y6ZA 2VLIA 5K6AC 2H31A 2ZRAA 1QFXA 3W9UA 1DL5A 3VA7A 4Q7JB 1FFEA 3GVXA 3IT2A 1ZNYA 3V8MA 3IQDB 3K8QA 3M6AA 1BXGB 4DSFA 4BVBA 5J3JA 1T3GA 4OP1A 2XBLA 4RA6B 4F3NA 4PYOA 2FSVA 3UTCA 4B3JA 3PGXA 4O2RA 1L7OA 4JI2B 2CY0A 4N9WA 1Q3TA 3ZS8A 1ISPA 3SS9X 3LYAA 1O96B 4MFFA 4V1CB 2B94A 4J03A 1G1AA 2HQSA 4HN9A 4ZK2A 4K8RB 3ODGA 2R68A 2WSMA 1ZRNA 2G25A 2ZE7A 1XAGA 5JNSA 4IDDA 2BCQA 4XTRA 4F0JA 1GXSA 1VKNA 3WMXA 1QCDA 1KORA 4S1WA 4FHEA 3O0FA 1LZKA 2P2CA 3HCNA 1HLFA 4ZYUA 1NVTA 4A8EA 4JJAA 2WZDA 3FMOB 5C4MA 1F38A 1KK1A 3HHEA 3KFLA 1G8JA 2VDWB 4ALKA 1QZTA 3L3FX 1YRQA 3VOAA 4M3NA 1Z0ZA 4RIHA 1MUUA 2JEFA 5GTIU 1M2NA 5DGCA 1CJVC 1WUIS 4RTKA 2WFZA 3E9EA 1II0A 1KJQA 9ICUA 4MUEA 3K72B 5I9TA 2FFAA 1A27A 3D6UA 1I14A 1A88A 2W8LA 2BCSA 1VE9A 4PLCA 1PFGA 1E4VA 3IPLA 1EG7A 1TU0A 3RHFA 3TSCA 3AR9A 3ZKAA 1TO2E 1GDHA 1U02A 1OGYA 1QVAA 1SPXA 4ZOEA 4BJ3A 2PZEA 4ID9A 2XI9A 4M04A 3CCFA 5HE9A 2GXSA 1YHYA 4ZQIA 2XB2A 2X8LA 1QG4A 4RQUA 1P72A 3T9BA 5F51A 4Q34A 5C52B 5BY2A 3HDTA 1KEWA 1JSXA 4X97A 2PLAA 3GN1A 4WIAA 5LWQA 3BFKA 3M4NA 4QFBA 4JT2A 1E9EA 4H60A 4PYJA 2XIQA 4X1KA 2GAOA 4NZMA 3RVMA 3D1JA 1EP3B 1B26A 3IQXA 1RJDA 2CJWA 1L2TA 4MVXA 2B8EA 5J2GA 2L82A 3BHMA 8ABPA 4PZAA 4QGAA 5F77A 3U19A 4PGXA 3FW1A 4MW5A 3PWSA 3RSOA 1J5EB 4NLNA 1NQTA 3NHLA 1XNGA 2HWXA 2IQIA 1OTHA 5J47A 2CL7X 2VXYA 3QNMA 4Y9SA 1E6UA 1WWKA 2YUIA 3FLMA 4O6VA 4COOA 2WZQA 2FPPB 2E3TA 4JLSA 2IU0A 4ALJA 4TOIA 2ZYAA 4QJFB 3GPCA 3I9NA 3L1IA 2R8HA 4DJTA 5BV7A 3CZ4A 4J9SA 2Y2VA 2CUZA 9ICKA 8ICZA 4K3UA 3B13B 1K7CA 2W2KB 3H5VA 4CEIB 4ND6A 2Q1TA 1X7XA 5AM3A 3GK3A 3NBYC 2FF7A 2JD2A 2J33A 4ZT2A 2VWQA 3ULKA 3A06A 3RS7A 3LWZA 2WHXA 4DQLA 2BOVA 2V8OA 4ZOBA 1HZJA 1CHDA 1GUDA 4ARZA 4QTUB 1GILA 2VHTA 4OU4A 5AKJA 1W0CA 4RA9B 4Q3LA 2I9PA 3GELA 1QRRA 2PD6A 3OJLA 3V8NA 1UL1X 1JP7A 3VYTB 1VMEA 1ZD3A 3DDCA 1OUQA 1H2ZA 3JQBA 1LD3A 3GXBA 1SVOA 3HL4A 3LHDA 1Z5PA 1YIDA 4O4LF 2J4DA 4A16A 2WSSA 2GPNA 1JGTA 5K0ZA 4I2GA 4BNDA 2QYTA 1S0UA 2NM0A 5D87A 1RAGA 3J7AC 3TG8A 1EHCA 3PTLA 3D59A 1M5TA 3DE3X 3E5HA 4CIWA 1PW5A 2Y9TA 3TRFA 2Q1UA 1W8IA 2EIHA 4KR9A 2KSOB 5CJJA 4PLZA 3PWKA 2PKCA 1DTEA 1DAKA 5AW4A 5EWEA 1W73A 2B1JA 3HVIA 2H4XA 3BXZA 1WUYA 3EGCA 1V1RB 5IASA 3C3XA 4NYJQ 3DP7A 5U4QA 2JVIA 8ICMA 3VTZA 5HOQA 1ZYQA 4UJ3A 3HNPA 4UOEA 4NAUA 3KEFA 1LB2B 5F4ZA 3AYXB 2OTCA 1PKEA 2Q0ZX 3ZD6A 3UMBA 3THXA 3DKVA 3VPHA 4M88A 3GN2A 4KWEA 1E1NA 1KK3A 1F51E 2C42A 5JCOA 4YRSA 1UKEA 2OO5C 4BQIA 1QIMA 2SHKA 5HK8A 4BMNA 4UPVA 1XKLA 3FNEA 1N1GA 1HE2A 1SV4A 4KR2A 2F64A 3UJ7A 1RZTA 4LRYA 1QP4A 3QX7A 4GC5A 1HE4A 5DRTA 5A1JA 1XGKA 1TX4B 1GPDG 5FWXA 1IK4A 2JHFA 4GF5A 3ZCUA 3ASVA 4BO3A 4I1OA 1P45A 3HEAA 1IEWA 1VJ1A 1R50A 4YMWA 2DFDA 5TISU 4AKEA 4PV7A 1G63A 4JJ4A 3I39X 1NBME