4CF4A

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
223
structure length
222
Chain Sequence
GILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWATIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 81
structure length 222
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cf4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cf4A01
1EK1A 3QUTA 3WGVA 2Q4TA 5AM4A 3KC2A 2WF7A 3NIWA 2FPWA 1RLMA 5AW8A 3WGUA 1RQNA 2RARA 4ZEVA 5AKIA 2YMPA 4HGOA 5ALWA 4UM7A 3U7FB 5AVTA 1AQ6A 4KNWA 1J8DA 1ZD3A 2WF5A 2IOHA 3NUQA 1RKQA 4HGRA 2QYHA 3UMGA 3ED5A 3OCUA 3A1CA 2EATA 4Y2UA 5ALLA 2I54A 3ZTWA 2EAUA 2B1QA 2WF9A 4OFZA 1ZD5A 1ZD4A 2MU2A 2NYVA 4C4RA 2CFSA 5ALFA 3QU4A 4Y2TA 4YCNA 2HF2A 3S6JA 4NFLA 2YJ5A 1Y8AA 5ALSA 1YDFA 2IA5A 1NRWA 3DAOA 3L1VA 2B1RA 4HGPA 3QUQA 2WF6A 4JB3A 2O9JA 4G9BA 3KDPA 1PW5A 2YMQA 4NAVA 4F72A 2Q4RA 3PDWA 3FM9A 4IFTA 2IYEA 3ZI4A 3B8EA 1YV9A 5AKZA 2ZBEA 1XPJA 3P96A 4QJBA 3AR9A 3L5KA 3SKXA 2RBKA 3AR5A 4NWIA 3ZW7A 5AW7A 4UARA 5AVRA 2BDUA 1L8OA 2G80A 3N5KA 5ALKA 2PR7A 5ALXA 4UMFA 5AVUA 2YFYA 4XOUA 1RKUA 1RRCA 5AVYA 1TA0A 2G09A 1RC8A 3SKYA 1S2OA 4BX3A 5ALRA 2G07A 1NNLA 1RDFA 1RLTA 4BNDB 3OCVA 3ZTYA 5ALQA 4Y2RA 3FVVA 5ALMA 3WK5A 5A3RA 5ALJA 4G63A 4CF5A 5AICA 2C8KA 3FPSA 2GMWA 1CR6A 1WZCA 1ZD2P 1Z4QA 3TLMA 1ZOLA 4OCZA 1J97A 4UMEA 1Z4MA 3R09A 3HYCA 4JDPA 5T41A 1SWVA 1QQ5A 2VKQA 1O03A 1Z4JA 3KZXA 4HGQA 1Z4LA 1Z4IA 2BY4A 3N8GA 3EF1A 1L6RA 3BWVA 2HHLA 3RF6A 3L8FA 2CFRA 5AKYA 1YJ5A 3L1UA 1RQLA 3AR3A 3ZWDA 5AM1A 5IT4A 5IT0A 4UAUA 1LVHA 3U7EB 3ZU6A 3QXGA 3KBBA 2JGAA 2B30A 3OCXA 2G08A 2AGVA 2AH5A 4L57A 4IG4A 4YGYA 4HYTA 4O8CA 3UMBA 5E0OA 2HO4A 2P9JA 2AMYA 2YJ6A 2DQSA 3L0CA 1TJ3A 2AUTA 4GIBA 3E84A 3E58A 5AK3A 3ET5A 5AVZA 4XQ0A 3QU5A 1Z5GA 3BA6A 1LTQA 3DNPA 3HLTA 3OCZA 3MN1A 3EF0A 5AW3A 5AVWA 2FPUA 3B9BA 4PNHA 5AHXA 2JAOA 1F5SA 1T9ZA 1WPGA 4AP9A 5AW0A 1XP5A 4Y2XA 3QGMA 3L0BA 4CF4A 2C9MA 3PGVA 2IOFK 4Y2QA 2ZOSA 3B9RA 1Z4KA 3WK9A 2YJ3A 3F9RA 2HI0A 3QYPA 2I34A 4KX3A 3M1YA 5AK6A 4UAVA 5ALYA 5AKGA 3I6BA 5AW9A 3OTQA 1Q91A 4CNQA 2HOQA 1Z5UA 3QU7A 4FYPA 4YIHA 3K1ZA 3ZUPA 2MU1A 3A1EA 4DCCA 3CNHA 4ZEWA 4BNDA 3QUCA 3OPXA 2JAUA 1U7OA 1TJ4A 5AK5A 1RMQA 2HDOA 1O08A 5AKHA 2CN1A 3AR7A 4L6CA 3U7HB 1NF2A 3QLEA 2WFAA 2G1AA 1QQ7A 2I7DA 4BX2A 1RKVA 4E88A 3QUBA 1RMYA 2HSZA 1VJRA 2RAVA 3ESQA 4UM5A 4UU1A 1Q92A 2QLTA 4OD0A 3R4CA 2I33A 3ZVLA 1RMTA 3NANA 5ALDA 5ALGA 3U13A 2G06A 3W5BA 5AIBA 2YBDA 3DDHA 3FPBA 3IJ5A 4KX5A 1SU4A 1VFPA 3AR4A 2HX1A 1S8OA 3NALA 3GYGA 2FDRA 3AR8A 2ZG6A 1U7PA 5ALZA 2I6XA 3FZQA 5AKKA 2G0AA 3ZX4A 2GO7A 1ZRNA 4BYGA 5AKEA 2O2XA 3VAYA 1IWOA 5AI0A 5AM3A 1JUDA 3A3YA 1L7NA 4C4TA 2ZBGA 4GXTA 1TE2A 1KYTA 4UMDA 5AIAA 2NO4A 5AM5A 5AVSA 4AS2A 1RPZA 4NV0A 4BX0A 2B8EA 2P11A 1XVIA 1T5SA 5FP0A 4J03A 2PKEA 3AR2A 4MWOA 3L7YA 2C4NA 2YMMA 4YCMA 2HCFA 3N1UA 5AW6A 3QU9A 2FPSA 5AW4A 3J7TA 2FEAA 4J2TA 5AESA 3IRUA 1U2TA 4HAIA 5AI4A 1ZS9A 1L7PA 3QX7A 5A3QA 3SF0A 1MH9A 2WF8A 4Y2YA 4UASA 3D6JA 2ZXEA 2FUEA 5AVVA 2R8YA 4AS3A 4Y3UA 2ODAA 3KOOA 4EEKA 2C88A 2GHTA 2WHEA 2PQ0A 3U19A 3A1DA 2B8JA 3W5DA 4F71A 1CQZA 1L8LA 2JAWA 4NABA 3M9LA 5AI6A 2FPRA 5AI8A 2YJ4A 3W5AA 4MUMA 2W43A 4DW8A 3MC1A 3SMVA 5ALPA 2NO5A 3EPRA 4OHFA 1L7OA 5ALOA 1QQ6A 3L0YA 1TJ5A 2R8ZA 4RETA 3CZ4A 4ZEXA 5ALEA 2FUCA 3WK8A 1Z4PX 4Y2JA 3E81A 2I55A 2YMLA 3I1YA 2JARA 1YMQA 2ZBFA 4YIKA 2Q5EA 2MSNA 4Y2PA 4CE6A 3ONNA 5ALUA 3PCTA 2W4MA 3UMCA 2IOFA 1RLOA 4L6AA 5IS2A 4BBJA 3QU2A 2D2VA 3UM9A 3N28A 1U2SA 4HGNA 2OYCA 3ZVMA 3NRJA 3ET4A 4Y2SA 4EX6A 3WKBA 2B82A 3AR6A 4QQFA 3I28A 4H1WA 3PGLA 4Y2VA 3R9KA 3DV9A 3WKEA 4I9FA 2CFTA 3I76A 5A3SA 1YNSA 3FGOA 3E8MA 4YH1A 2FPXA 3NAMA 4EELA 3IB6A 3WK6A 5AW2A 1N9KA 1YS9A 1T5TA 1WR8A 1QYIA 4EENA 4FE3A 3OCYA 4KNVA 1ZJJA 3WKAA 3L8EA 2P69A 2EARA 2YN4A 5AI9A 5ALVA 5AKLA 3ZWKA 4C4SA 5AW1A 3SLRA 5ALTA 5AM0A 1EK2A 3SD7A 1Z4NA 4DFDA 1WVIA 3U26A 1K1EA 4FFDA 5ALHA 3MPOA 1ZRMA 4UATA 3N07A 1VJ5A 3KD3A 3U7GA 5AVQA 3WK7A 3QNMA 2GFHA 3ZX5A 1X42A 2R8XA 3SHQA 2WM8A 4CF3A 2RB5A 4KYTA 4B6JA 4XE5A 4YCLA 3ESRA 4UU0A 3RFUA 4RESA 2OA0A 5AM2A 5AI5A 2OBBA 5AKJA 3EWIA 4KN8A 2BDEA 2OM6A 3WKDA 3WKCA 2FI1A 2HF7A 5ALIA 1QH9A 4DWOA 3W5CA 4BEWA 2HEGA 2GHQA 5AK4A 4XPZA 1SWWA 2W11A 3L8HA 5JJBA 4I9GA 5ALNA 4BKMA 4EZEA 3NASA 1N8NA 2YY6A 2X4DA 2B0CA 2P27A 2ZBDA 4EX7A 3WK4A 2C8LA 3ZVNA 3L8GA 1Z4OA 4UW9A 1Z88A 1FEZA 5AVXA 3MMZA 1L7MA 1U02A 2R8EA 5AW5A 5AKXA 4UMVA 4BEVA 3OCWA
chains in the Genus database with same CATH superfamily
4KFSA 1JDPA 2XMGA 3TZHA 1NUHA 3LFUA 4JI5B 2X4LA 1WD7A 5HE8A 2G8LA 1R66A 3LF2A 4R8KA 5HKBA 3WGYA 3EQZA 3SQNA 3TG8A 3UF0A 4XYEA 3PIRA 1JV2B 1WQ3A 3CT6A 1RLMA 5AW8A 2HLHA 4QPJC 4RS4A 1HE1C 2RRDA 3W3AA 3T41A 4W5QA 5DHQA 4K7JA 3NWBA 4TL6A 1WZUA 4PNZA 4XFDA 2RGDA 4PG5A 1C9YA 3U4HA 3ROZA 4PYQA 2J7KA 3WWYA 4KOAA 5TEVA 2VHVA 3TRKA 5KU1A 3C7TA 2C1XA 3EVCA 3FR8A 2G6TA 5KTMA 2I99A 4QBIA 4NBKA 1FRQA 3CLTC 7REQB 1K8YB 2VSXA 3RYHA 3QMMA 4GL2A 2WHPA 1OPRA 3NB0A 1AQ6A 4WCFA 3H2HA 3K30A 4ZQGA 5C52B 3ZV3A 5L3QB 1EFPA 4OM8A 4LBVA 2WKWA 4KH1A 3GJ3A 3MCAA 4G8CA 4NMLA 4J0GA 3V7UA 3MJSA 1T5IA 2Z04A 5C34B 4B7UA 3ZE9A 4AJNA 9ICGA 2VAPA 2W54A 5J1TB 4MFFA 3E9YA 2H4YA 3DJYA 3T9BA 3VZQA 2ZYUX 4R8VA 2QRZA 2WYVA 3MRSA 3NC1C 1D07A 3HXOA 3DE5X 3KKAC 1NV8A 1UJ5A 1GITA 4IIEA 4RXTA 4KMSA 3I83A 4UVIA 1SBTA 4IO1A 1T3SA 4ZH4A 1R9MA 1TCCA 2OORC 1LGYA 4C6HA 3DM9B 3CX6A 3ZHOA 1CUZA 1ODJA 2ODBA 2QLMA 2VA3A 3AL0B 2G1JA 2ZRAA 1LK5A 4FC6A 4Y2TA 2VYQA 3LCMA 3MSCA 4FI3C 4J49A 2PIDA 4Q21A 5TQ0A 3VM6A 1SCBA 4NFLA 4BPRA 3C5EA 4ETWA 4EQZA 2YJ5A 2WPDD 3K0CC 2EXXA 3WQSB 3NC4A 3BXXA 4AJ2A 5BPCA 1V71A 1W44A 3TQQA 5CYGA 3RRMA 1KFKB 3LSYA 3PEVA 2KX7A 3OZCA 1IQUA 1EX9A 2FSUA 3V55A 1HZJA 1Y1LA 3F6PA 4MV5A 1JJVA 3K1TA 5KFSA 4EYIB 3ZZ0A 4AROA 2O3TA 1GEEA 5IKOA 2DQKA 3TAXA 4IX9A 1FVHA 4CUKA 3B52X 3LMKA 1U7WA 2ZYWX 1X7ZA 4U9IS 1GZVA 5DI3B 1GNPA 1HLFA 1U2RA 5LC1A 2QV0A 3TW8B 3IUPA 3OCJA 1QUFA 2VJKA 3RROA 1BMFA 2C9OA 4BS9A 4C7VA 5KZMB 3KSAC 1QP4A 3CC8A 3LBNA 1SD2A 2FSFA 3IE0A 3VMMA 4K6FA 1PQ4A 3AR9A 4TMKA 4WNIA 2HPAA 4C88A 3A70A 3HX0A 3FOCA 3BJYA 1H3FA 2WT9A 4J1QA 4OHUA 3LQKA 4UARA 3DV2A 4KMUA 4QO7A 1E7RA 4RMHA 4W1SA 5CPBA 4C6SA 2GYWA 1TZBA 2NAPA 2K4PA 2BL4A 5EXSA 4DA4A 4BO7A 4A0SA 4ZI7A 3EFEA 4L8VA 3N2ZB 4I14A 5DF1A 1BN6A 2HA3A 4WFQA 4TWRA 4ACBA 1SVNA 5BXYA 4CEHA 2DWUA 3RH6A 3ORFA 4MUFA 2Q27A 3OKCA 4DLUA 4E3WA 4YJ3F 2DT8A 1D2NA 3MAAC 2GLEA 1R8SA 2L82A 4U7FA 1XTBA 5CIYA 3UICA 1G20A 3MEQA 1KVTA 3DEKA 2ESEA 3GUCA 2ZB4A 1G291 5CXXA 5IUKC 5JS2A 3UG6A 2BFAA 3G79A 1DEKA 4O4JF 1G9SA 4G1FA 3UGJA 3EARA 2P9ZA 1RDFA 3L8YA 1U90A 3N0TA 3N8HA 1EMDA 4HX2A 4X7BA 2UUBB 5FFNA 3EGCA 3QLTA 1KQ3A 3VAZA 1E3DA 3KR1A 4AY3A 1I9CA 1L5OA 3ANXA 3I0ZA 2BJHA 2PLFA 3JV7A 4FHEA 5GGXA 4PSKA 1N57A 2YJZA 1RYHA 4US2R 1DDIA 1W5EA 2Q1TA 4IGIA 4URZR 5HBGA 2AVNA 4IDNA 4RA6A 5JMOA 1ZJ6A 3BHIA 4RVGA 3SSOA 1RHRA 1S97A 3G6WA 1WUKS 2BQRA 4PWYA 1W6UA 3M83A 3MILA 4ER6A 3I05A 1W19A 5BXQC 4ZDKA 3ME5A 3P52A 4R1TA 4U6NA 4EPXA 5E7JA 1SKUA 1VHJA 2BM8A 4Q3KA 3FDZB 1OLUB 2FKAA 2CMFA 4OHWA 2FZKA 3Q3EA 4QPPA 2ZEJA 1MNAA 4RHEA 5FWXA 3UFXA 3ZIAA 4E1BA 1XNSA 3K5IA 1BMTA 3FFXA 4ECZA 1YSCA 1C0IA 2R8GA 1FUKA 3K6KA 2K2WA 1RI1A 1UPFA 2QJRA 5K3OA 4Z6CA 1PFYA 4M46A 1HDZA 3CVWA 5KSPA 1NIJA 3DCNA 5TT1A 4PLGA 2DOKA 3DTYA 4EHDA 5CVTA 4ZCSA 1VKRA 4ZYXA 4UHCA 3U6BA 4LDNA 2DJ5A 1BDIA 1K2WA 3K9CA 5NULA 2CYBA 1I1NA 3C2QA 3QX9A 3JALA 2OV4A 3HCOA 4G5SA 4NPAA 5HKLA 3UH0A 1O5IA 3QLVC 4CMJA 1E2IA 1JJFA 1ZN8A 1TU0A 1A69A 2H52A 4R1MA 3LTNC 1D3AA 1FRZA 1B2LA 3L18A 4ZT3A 2ZDGA 3WFIA 2FOIA 5CP2A 3DHEA 4J9SA 3BAFA 5ILGA 2HHTA 3WIVA 4RE5A 3MUNA 5F9MA 1PFKA 4YXFA 4LC9A 4L57A 3PXUA 4NIMA 4BQSA 5KG7A 4CGZA 1W2WB 4AXBA 2P9EA 1LA2A 2DFPA 3HWSA 4X5OA 2R6HA 1Y1KE 3QFCA 5I9IA 1US8A 3TIGA 5C8DA 1ZM3A 2XVZA 2Z1NA 1NR1A 3L0CA 2JC3A 1ZQPA 1SXJD 5E9WA 1ENPA 1FDVA 2H54A 3COVA 3UAGA 3G23A 5BSRA 3LP5A 4B45A 4F6CA 2IUYA 1REQB 2RHRA 3DNPA 4KSYA 1TTPB 1RYNA 3U6KA 2L17A 3S7TA 4IILA 3IUJA 5KFGA 4LHYA 2JLWA 5AHXA 3AEXA 2EF1A 3ACBA 3HLYA 4GSLA 1K0FA 4PG7A 3KSUA 1K6XA 1GN8A 3CBGA 3E61A 3L0BA 1LQ2A 3R7AA 1FP2A 3D2NA 4H6WA 2A57A 2OCIA 3PYLA 4QWAA 4I4LA 4PBSA 2RHLA 1Q0UA 4QWDA 3OOJA 3L9WA 3E0XA 3NM4A 1UXOA 4M88A 1CW2B 4BEBA 3QZUA 2ORVA 1Y8CA 4FUTA 1UDRA 4LCEA 1P61B 3AUTA 4CIWA 1X7HA 3A9TA 2DYKA 5FT9A 3WGLA 5GV7A 4QASA 3TADA 3W2IA 1PX0A 3K1JA 3DPIA 3NTXA 4JFAA 4QKQA 2D2XA 2Z0MA 4LISA 1EQUA 4EBBA 1X7YB 3WSWA 2BMJA 1QDUA 4YIHA 4FNAA 4D4HA 4QNLA 2AQ4A 4BHTA 2XGQA 1D2HA 4TV9B 2QUIA 4U8GA 1Q74A 1KI7A 2GA8A 4LRTB 3VJRA 1SQGA 1WTCA 2XYHA 3QJ5A 1E1CB 4GICA 5JBNA 2W8BA 1U2ZA 5I9MA 2ZSKA 5TMBA 2ZTMA 1JPUA 1U0JA 1RQGA 4FOSA 3LKZA 4PRKA 4B3XA 4M04A 5FHRA 1R3DA 2JZOA 3DMTA 4TUYA 1V9CA 4DQ0A 4RV4A 5CD1A 2CLCX 2PU5A 3AB8A 2XSZD 3H0CA 5IJXA 3VISA 5A2QA 4XLTA 5DH9A 4ID9A 3COYA 4I1IA 2IY9A 3PF9A 1S9HA 4NF2A 1VSTA 4BN0A 2CPRA 4DNQA 5LN1A 3V1TC 3K0FB 1JJ7A 2QRPA 3ZDYB 3BYZA 1W36B 1SL2A 1BZYA 2ZJ4A 2NWQA 9MHTA 1CF4A 4L8LA 4OQFA 3EWSA 3T7IA 2F9MA 3BQ7A 3NANA 4AO6A 8ICYA 3MRTA 4E08A 3N7TA 4BWFB 2B8WA 1J70A 2ZBQA 4FHZA 4MVJH 4RAQA 4XQEA 4B3MB 1IM4A 2GEUA 2OLJA 2JCGA 4DSZA 2DKFA 3HNOA 2CYCA 1MAUA 4URHA 3TE7A 3U4CA 3WLFA 5TEWA 1EJBA 5BOLA 3BS7A 2PBZA 2MCFA 1N5LA 3VHLB 3UWDA 4ZJPA 5LPNA 3E1SA 2YVLA 2J45A 4FWIB 1IEVA 4G5OA 4GQBA 1V0JA 3EBLA 4NC9A 4Y1FA 5F5XA 3GB9A 4CT4B 1UBCA 1WCWA 1M2JA 1PEYA 2HV9A 3T1OA 1N9GB 5B36A 1XSEA 5BMOA 2PKQP 1PNRA 1UL1X 4LJ5A 4AUKA 1OUQA 2RHJA 3C3MA 5B58T 2HXSA 4HUQA 4BVFA 4JEUA 3JQBC 3L02A 5EIEA 3OSNA 3K1AA 2AJCA 1Q7EA 3I2JA 1GQQA 3KB2A 3EZ5A 3DEZA 4C5CA 2BM9A 1IK4A 3AU9A 3PSHA 1EXVA 1NKTA 1SZDA 1YDMA 3IQXA 4MITA 1T9HA 3N0RA 2K7ZA 4BX0A 1W2HA 2RHCA 3R5JA 5AJHA 5KMGA 4A16A 2PT5A 2X4IA 1FRNA 1ZIXA 1I30A 3ALRA 2QNBA 3HV0A 5DN6D 3MJEA 1R0WA 1UQRA 5DHTA 3SZMA 5M5BA 2QLFA 4OQZA 4BO4A 1NBEA 2Y2UA 2IYXA 4GR4A 1X7GA 3R9WA 2WP0A 1U9CA 4CM6A 2FEAA 4NY8A 4I2JA 3NDIA 3ZK8A 8ICPA 1TYAE 4FR2A 2JJQA 3LLCA 4XB2A 3TX2A 2HRZA 4I6JA 5EJMA 4MXDA 3PFCA 3H5RA 2YOGA 3RRYA 1A88A 2UVVA 3ISCA 1WBJB 4QARA 4UHHA 4ZRNA 3UANA 2ZRMA 5IK2D 5K6AC 3LHIA 1D7OA 4EZ9A 4JMLA 4U2DA 5FB3A 1ZXLA 4WY2A 3FE2A 3I01M 1U63A 5DT2A 2R8YA 3MNFA 2LR0A 4KQ2A 3KE8A 5AJYA 5ECYA 1PWYE 1BVSA 4EEKA 2GHTA 2PGAA 4ENRA 7ICRA 2B8JA 1ZQIA 4UBCA 4PYLA 2DUYA 1BPDA 4YXMA 3OMXA 4AYXA 2VH5R 4B32A 4A15A 2VRCA 3ZNNA 3VC1A 3X0DA 3OQNA 3T5JA 1S10A 2CUNA 4RIIA 3DR3A 2FTKE 2B9VA 4RFSA 1B0XA 2R0QC 5D51S 4KLJA 3L7CA 2AMJA 5ENVA 3KKPA 1A4XA 3EQ6A 4E5PA 2X0KA 4QZ9A 1ISMA 1DWQA 2K60A 4US9A 2PEZA 1ZK3A 3PW7A 2ACKA 1YI0A 2H7CA 3FZNA 3OC0A 4EUEA 1JXAA 4I29A 1HDOA 1VDZA 1X1BA 2F2TA 3AF2A 3UNXA 4BE4A 1IYZA 5KOJA 1ZIDA 2ORIA 4QIWF 2H1FA 1XTUA 5HM8A 4FJ2A 3QY9A 3GRUA 1OXJA 1FDRA 2XMRA 2LRHA 4L27A 2I8CA 1A97A 4HBGA 4V0LA 4KSBA 3TYXA 2XOEA 4BLWA 5ILOA 5J1SB 1UJ2A 2WU4A 3L6DA 1QR6A 3GBVA 4HMQA 2QJFA 4LN1A 3V4RA 4JZKA 2O6KA 4AKSA 1WUTA 1AVTA 5BSGA 1J1UA 4AWAA 3IPAA 4NENA 5B3LA 3D3JA 3HA5A 3N05A 4LOAA 5B1HA 4DL6A 1CQJA 1ZAKA 2VATA 2O19A 3HN7A 2ZR0A 4AJJA 2KQUA 1W0CA 4PZYA 5DYTA 3F5SA 2F64A 3PDJA 3SSNA 4F4UA 4CETA 1GUFA 1L4BA 4AMBA 1QGAA 4NDZA 4IDEA 3T9EA 2D2VA 3K71B 1QZZA 3VR5H 1PGNA 2P4QA 4KMOA 4P3KA 4PGFA 3AI3A 1ANKA 3RS7A 2GTIA 1QCKA 1CBUA 1MJHA 3RD5A 3SEZA 1S1CA 3MMXA 3WP0A 4YJ2A 4Y2SA 2ZE6A 1F8UA 1JI3A 3O1LA 1SXJA 3NR2A 1AKMA 1EJ6A 3F6RA 1IUPA 1UA1A 3Q3CA 4HWOA 4JKOA 4OH7A 2EQYA 3AL3A 3NHJA 4HN2A 2EKPA 4GE0A 1EJ2A 1UBTS 4I3GA 3BH7A 3V5NA 1SK9A 3W8RA 2JKYA 1JZQA 1L7AA 1L5HA 1M8PA 3OX3A 1WXWA 5AP9A 4QWBA 4A6EA 2CVFA 4D4MA 3CG4A 3RSQA 4X7MA 2WPDA 4IIJA 3HKZF 1YQXA 3DTVB 5JI2E 1E3MA 3MMPA 3PE4A 4NEHB 2V1XA 4C0XA 2OXTA 1KY5A 4C0KA 4UE6A 1I6KA 1JHRA 2HNAA 4IXDA 1JXEA 1X1CA 1PG2A 5G1PA 3R76A 1J07A 2F6RA 1GNRA 4IMJB 3C8HA 4I2BA 1Z37A 5EUMA 2R65A 3SLRA 1O0BA 1UPAA 2ATCA 2ZW9A 2X9NA 3R0ZA 3TQSA 1Q57A 1VIDA 2A3RA 4MS4A 5FBKA 1BRTA 2VQ3A 3TJRA 4A8PA 4GOMD 3S1AB 4BV8A 2ZRJA 3SE7A 4CI9A 8ATCA 4P58A 4NBUA 3B20A 3PUJA 1NVXQ 1Z83A 3BMXA 4PLWA 1YA6A 3MWLA 4GSYA 1AHPA 5DM2A 3DLHA 1VBNA 3CWQA 1F1JA 1BXGB 1OZ0A 4B83A 5C8VA 3UPDA 1B43A 3R7FA 4RACA 1GAXA 3GD7A 2JGKA 2QNRA 1ISFA 1RKBA 2W71A 1SOMA 1ELOA 4PTLA 2X58A 3MUEA 1B00A 3T7DA 2G8NA 3QA3E 1C1XA 5FAKA 4OHYA 3FYUB 2ORYA 3IBYA 4YTEA 3HY6A 1DHTA 3CR8A 3H2SA 3D6AA 3UB3A 3X1ZA 5MN4A 1DRKA 5C4GB 2BMFA 5K3BA 5KJFA 3W5CA 4KP7A 4E1AA 4RQNA 5JRDS 2Q5QA 2AFHB 1FP1D 2R6GA 1IPFA 3HN6A 2R7NA 2Q4OA 2YJNA 3RC9A 1CPYA 4F2SA 1XDDA 2VHWA 5BWMA 4YAUA 3DMRA 2EC5A 3GNLA 1R50A 4OIFA 4MLZA 4P9NA 5JH7B 1QONA 3NHWA 3OD5A 2QX8A 3IUSA 1TLTA 1O97C 1WDTA 4YMWA 2OQVA 4TXMA 4YMVA 3F3MA 2QU7A 4H27A 2HHHB 1LK0A 1NDQA 2NTEA 2YQ5A 1T2FA 3FYTA 1USIA 3A2LA 5GTHU 5T67A 5BRJA 2YS6A 2IBSA 3NGMA 2XMPA 3EPKA 3E4DA 2AW5A 2H29A 5FIUA 1M6EX 2WJGA 1XNRB 2BRUC 1GZDA 1V11A 4HT3B 1N0UA 1Q77A 1WBDA 1J90A 2DFTA 3OKPA 3BCUA 2RHFA 2DRIA 3DE3X 3KZMA 5EUBA 2Y76A 3R3JA 2E49A 4QJ5A 2IU0A 3ZOKA 2NZJA 5HXAA 1HDGO 5JCPA 5KYYB 4Z3DA 3K2QA 4ZVSA 1UAGA 3AZQA 1XRNA 1Q3VA 1VL8A 1ZVKA 3OO0A 3OPQA 4LOHA 1JHAA 3BK1A 3RSLA 3VOTA 4ZEVA 4KIUA 4A2WA 3HILA 5G0VA 4AKIA 2VTKA 2EP7A 2Z09A 2AN3A 4GYYA 5KFHA 1Z82A 3B1WA 4DV5B 3P2OA 2C0PA 1RAHA 1ECFA 1S3SA 1X1EA 2X4GA 5ALWA 3PFIA 1AKNA 4RHTA 4G1BA 4YCJA 3TW0A 3PR4A 9LDTA 5LQSA 4HTFB 3F8TA 1RCFA 1H8ED 1KR2A 2K4IA 1ECGA 1MH1A 5LUBA 2ZXUA 1SUSA 5KJ1A 1ODFA 5KFRA 5EPOA 4EK9A 5TVGA 5ABPA 1CZKA 4ZI2A 4HQLA 3MJVA 1B41A 1NJYA 2VDOB 2OM2A 3CNEA 3DDCA 2W70A 8ICUA 3F3SA 5DTMA 4A23A 1HOTA 3EAGA 4W5WA 1DDOA 3OCUA 4QUEA 2IOQA 1QTNA 4YLGA 4S1OA 4U8HA 3DR5A 1E61A 3ZTWA 3JS5A 3PUZA 1CVLA 4UCQA 4BMSA 4Y2HA 4JWTA 3FKQA 5AUPB 1RTTA 1JKFA 1D4FA 4F7DA 4AG5A 1XZMA 4L08A 1HG0A 4LZNA 4RW0A 4X7RA 4TSFA 2JFVA 4P33A 5EHNA 1ZD4A 4C7XA 4E4YA 3ISTA 1FFBA 3ORSA 3O7WA 2Y71A 4X3CA 3ICVA 5CCXA 1GR1A 2C2YA 2E1PA 1CWUA 1QE5A 1MENA 1KMCA 2FXIA 2BSAA 1GGKA 3AMVA 4BXOB 1QE0A 3GEMA 3OIVA 4RGQA 3HCFA 2OZVA 5CTAA 2QP4A 5J2UF 3L41A 2YZKA 1DPGA 2J0UB 3FR7A 4HXFB 4MAFA 4CN8A 1BEUB 1JMSA 3LYHA 4Y8VA 5EL0A 4DPKA 2W98A 4BFWA 2P78A 1GHTA 4MQ6A 4FWTA 3LVQE 2IS4A 2EZUA 2I65A 3C4QA 1U5CA 2AJTA 3N0XA 3BD9A 4MMXB 3RBVA 4ZXPA 1WWUA 5KG0A 1U7UA 5EFZA 2XCRB 5LBTA 3OIUA 3UYKA 3D2SA 1YE5A 2Q4BA 2H1VA 4UDXX 5DBGA 2H1OA 2X13A 4C0LA 2Q1YA 3LZ6A 2IY7A 1MQ8B 4UOZA 2F00A 5T3YA 4WZAA 7ICTA 2I3AA 3TLBA 3RC8A 1FU8A 4YECA 2AD5A 2JXJA 2Q3BA 2O07A 4QUDA 5DLYA 1MMFB 4C20A 4EA7A 1R6VA 1WG8A 2GXSA 3DFFA 4QFMA 4YACA 1GUDA 2WUFA 1ZOIA 4QW9A 3JPWA 3OT1A 4IJ6A 2PWPA 4OSOA 1XEXA 5JMTA 3FXAA 3P26A 1U8ZA 4YAIA 4DQIA 2OLKA 3CUVA 2PVSA 2A35A 1NQXA 1GQYA 3JQ7A 2P2SA 3N5KA 5ALKA 2V7BA 4FYXA 4OJYA 4BATA 4WQMA 2KVCA 3A1WA 3O1JC 4ECEA 3FTDA 4YPFA 1HNWB 1P3Y1 1BCSA 2B0JA 1H4VB 2BE7A 2JI4A 3GXBA 3KTDA 4M1EA 4P4GA 3WWOA 2XLCA 3OHSX 3G9TA 4Z49A 4PH5A 1M1YA 1Y81A 3CB2A 3GLHA 1KSPA 1JSCA 2BN4A 2H4XA 3Q7SA 1DKUA 4REOA 3HBMA 2EGUA 3SKYA 4BX3A 3M6LA 3WAKA 1Y63A 3ETJA 3FNBA 2C5BA 5DBBA 4GI3A 2R79A 1M1NA 4DWWA 2BEJA 1NNLA 3FHJA 2F3NA 4I08A 5FLYA 3SOPA 1Q11A 3U3ZA 5IZCC 3NEYA 4BMCA 1OA1A 4K6KA 4WLOA 5C1DA 5KTRA 1YFJA 3HDYA 1D8TA 2GRAA 4W8GA 2QB1A 2GPNA 3PJDA 4AN1A 4BFYA 2HPZA 1D4AA 1NRIA 1YL6A 3JZFA 1X7XA 2BFOA 3WL8A 5KG4A 3THYB 4OREX 1ODIA 2OUIA 4OHBA 1O95A 4CM8A 1RC1A 1ZD2P 4IQFA 4EY6A 3RUPA 4I9HA 2H51A 3CPEA 5J59A 3KETA 4ASUA 2IX9A 4RQ3A 1QBGA 3BMQA 5CBPB 4B4UA 1ZOLA 4MSUA 1C7YA 2CWDA 3O4RA 4YR3A 1SBZA 4GGPA 1DFIA 4JC0A 4A5OA 4AJIA 2V97A 3KDSE 3QY0A 2V6GA 5JDCA 1TUIA 2J3HA 4HXEB 4KQJA 2IQIA 4HP8A 1VA5A 4B7ZA 5L3VA 1F2DA 1ID8A 9ABPA 4Q9DA 4E2YA 4AX4A 2O8DB 3IG8A 1Z4JA 2AZTA 2VJQA 4RZSA 3AUYA 4HG2A 3OKFA 2NO9A 5FQNA 1EKXA 1EPUA 3OX2A 4I5IA 4XM1A 5DM4A 5KYUB 3U49A 5C7LO 5EZYB 2XWQA 5DLQC 1G7SA 3X1KA 4AJEA 3ZE2B 2WYUA 2XOXA 3R3UA 2AQHA 2KSOB 5IF3A 1I7QB 3P9QA 3DAHA 5D2CA 2P41A 3FCYA 3W2GA 3JD1A 1SRQA 2NG1A 2IXDA 3FRHA 4MRNA 2BGTA 2PFPA 2QKYA 4KLGA 4PVCA 4B3JA 1A27A 2G0NA 2CNNA 2XCOA 2ZLBA 1C8BA 3ONDA 2J5RA 4D97A 2FEXA 1U3TA 4UAUA 3QKSB 3SN6A 1EFUA 4PPFA 4O59O 4LNUA 3X1MA 3PQ6A 3KBBA 2EZZA 4G3IA 3MS2A 3ZCXA 3IDAA 1IN8A 1NQ5A 1YAHA 2XNDD 4TS3A 4C03A 3GYBA 1CB0A 4JLBA 2JAQA 1WCV1 3K9WA 2GYYA 3DOOA 3LUBA 4L22A 4MEYA 3O0TA 1W8DA 4HYYA 3PW4A 3AINA 1X2EA 4QTYA 1VA4A 2B20A 2GXQA 4EARA 3WGKA 3TD6A 1P0IA 2E48A 4YJGB 3MOGA 2JCBA 3BB4A 2FFAA 4RZHA 3IIJA 1VMAA 7ICUA 1JDZA 4PZAA 5CRIA 3HXQA 1I0ZA 3Q87B 3DBLA 4CLRB 1G63A 3F3KA 3JRXA 1KFDA 4KDEA 4UFOA 3NPMA 3MJDA 1LTQA 3C7DB 4LBYA 2VPQA 2NTVA 3CB4A 4H18A 1Y33E 2QMEA 3K72B 1V25A 4CKWA 5IM4F 3EPJA 2UUAB 3B9BA 3PMNA 1EGVB 1YRHA 2AU0A 1UM9B 1OWPA 2WSSA 3PYXA 1E62A 2GJ8A 3HP6A 4Q1DA 4YRAA 4OB6A 5C35A 3GFFA 4MQEA 1Q1BA 2HBKA 3LWMA 5CXQA 1XPUA 2C5FA 2AOUB 1G8FA 4F06A 1O94C 3P5SA 4F4DA 2WWFA 2J6BA 3D2CA 1O9GA 5LOVA 4M9XA 5K99A 2CLSA 2WTAA 1KSJA 1YL7A 2QL9A 3NUZA 4MULA 4E13A 4PX3A 3PT9A 2JGIA 2XQGA 1TC1A 1AKYA 3T0IA 5IDXA 3GLHE 2VFAA 2VK4A 4X6XA 3TS1A 3KOMA 3EPPA 4E2WA 5B6IA 1OI2A 3B5EA 1XLTC 4G1VA 1Y9JA 2HJSA 2HOQA 2PX6A 3H6HA 4CCWA 4ED2A 4X91A 1XTQA 1X7WA 1A9XA 2YYSA 1JSZA 3WJ1A 4UCFA 2WHQA 1H4SA 3ZXSA 1IPEA 1JJAA 4ALLA 3TEFA 1QGYA 1E94E 4JX9A 4ZEWA 2VR1A 2YWFA 1Z18A 1ZUD1 4LGYA 3FB1A 4E03A 2HIMA 2XWSA 5JJCA 2NACA 3RF9A 2GNAA 2ZS8A 5IJ0A 4DR5B 2GK7A 3TL6A 5J4LA 5I7VA 1JDNA 2JMGA 3AI1A 4MWCA 5CT9A 1Z36A 2O8FA 1H66A 3PEFA 3DEFA 2BFCA 2QTVA 3QUBA 1UBRS 2G36A 3BAZA 1URPA 4J0EA 5EMHA 1Z00A 4EUNA 7ICMA 3PQ7A 1Z56C 3GT7A 1T26A 4OQYA 2J87A 4I7EA 1JLLA 3UA4A 1AMNA 2I3BA 4YQEA 3WNZA 3R4CA 5C7YA 1KI8A 2G83A 2PBLA 1O94D 5FLXA 2FZLA 4LZOA 2XTMA 4EHHA 2O4UX 3LC2O 2XQJA 1XJ0A 1XHFA 4A3SA 4BNFA 1FP6A 1STOA 2PN1A 3OF2A 4OMCA 2A30A 4UNRA 4BCCA 3GGDA 4TXLA 1Q8KA 1X1QA 3IELA 4LTMA 3TOSA 1QF7A 4CKBA 4YV0A 5KFCA 5BN3A 3AR8A 4CR7A 1M6HA 3OA0A 4TVSA 2V4ZA 3CBQA 1Y4SA 1J6UA 1NGSA 3GFVA 4M38A 3HDTA 3O7MA 1ZMXA 3FZQA 1VCIA 3H19A 3HYNA 5CLGA 4DCJA 5I4CA 2DUJA 4MR8B 2FW0A 1YMVA 5CB4B 2ZRHA 1WUHS 1WF6A 4FGKA 4ZRMA 3OJOA 3GGGA 1NYRA 3UUGA 2Y0CA 5HW0A 1XTTA 4NJ8A 3GGOA 2GO7A 2ZSJA 1QHSA 1ZNWA 3VJMA 2HBYA 3H1FA 3L4SO 3VAYA 3MDAA 1U11A 4QW8A 2Z2JA 4GO1A 4LC1A 4LRSB 3T3IA 5SY4A 2Z2KA 3AETB 3HTXA 4C4TA 3NGDA 2I6SA 4EKIA 4F86A 4PLZA 1FVXA 1GGJA 1NI5A 3B1VA 1ULZA 4P7JA 4B2PA 1JILA 2WTFA 3FCCA 2JFQA 4EAQA 2BFCB 3IJEB 5TRTA 2HYDA 2ZWAA 4ILEA 4RUCA 1H0KA 4AS2A 4KI0A 2Y1WA 3EA5A 4WXPA 4PFSA 3WICA 5KTKA 5FFFA 3V8MA 3DF9A 4CV0A 1RS0A 2GZMA 1NNSA 3CF2A 4IV8A 2PKEA 2GF0A 3G7SA 2OH2A 4H77A 2JZBB 4I8IA 3OPYI 2IXBA 1TK5A 2PWBA 2XB9A 2AFRA 2QRNA 3VU9A 4ZZIA 4D6PA 3ZHZA 3EUAA 3DMDA 1RXIA 2HCFA 1HC7A 3CEAA 4BMNA 5AW6A 5FUYA 3S8EA 2F3RA 4N7BA 3PSTA 4LGCA 1RHMA 5C2JB 1T0PA 5FTJA 3VNVA 3QBVA 1E3IA 4HWGA 1CR2A 3UC9A 1CT9A 1JIKA 3ZD8A 1NXXA 1VGRA 4CHGA 2P65A 4O3SA 4BC0A 4BKPA 3WLEA 3NAZA 3PNYA 1AS2A 3T3PB 2WA1A 1CK4A 1EHIA 5TXGA 4ND8A 1R6BX 2NU7A 4AECA 1QZTA 2PWAA 3GGJA 3V1MA 3FDZA 5B64A 1JE0A 2H6EA 5KSYA 4ZVOA 1Z2CA 5ICGA 5KMGB 1C4OA 3PGJA 3D6MA 1J0BA 1U8UA 5C32A 2H5XA 4LZZA 4BWYA 4DGSA 2IOYA 2C28A 4QRHA 1FIQA 3KWMA 4LMPA 2JAWA 3TMAA 1MC5A 3E2IA 4O3NA 2C4TA 5BOMA 2GARA 5EI5A 2FK7A 5SICE 2WTNA 3FYCA 2CKMA 3KB6A 5GJVC 2AG1A 3HGTA 2X1MA 3RH4A 2KZZA 1EWVA 4P7BA 3W3AH 3SICE 1RXWA 3CO0S 1TOAA 4P4OA 4BNLA 1UJNA 3DAYA 3NVZA 2GKOA 2MR6A 5E1MA 1Q0TA 1Y3BE 3D5QA 5EIOA 3KQTA 3LX4A 3MAGA 4N49A 1BO6A 3GZTB 3AHEA 3DT9A 4RETA 3CUEF 1QMPA 5JYBA 4HLUA 3G6YA 4PGGA 5DIZA 3HE3A 4EBDA 1B73A 1FFGA 3KJXA 1UP6A 4C2TA 3PX3A 4JP5A 3EULA 1XD2A 4B33A 2PGXA 5IUNC 2JHFA 4XPIB 1ZSVA 2I55A 1UCVA 3X2SA 3PRKE 2VHYA 2AC4A 3R0QA 1BYIA 2FEWB 2I2AA 4H1HA 3ADPA 3T61A 4JP1A 2P62A 4EJFA 2ZDHA 2Q5EA 1I2ZA 4CE6A 1O96B 1S01A 3LKBA 1YIOA 5LIPA 1S2LA 3SEIA 4GE3A 4GHWA 3UCEA 1AQIA 5C46F 5DNUA 3UM9A 5KYXB 1YCFA 2JJ1D 4ZVQA 1VXRA 2C57A 4JN6B 4XIGS 5HDQA 2RCYA 3IOBA 3ZVLA 4O02B 2OYCA 5BYAA 3BMNB 1QZXA 2HGSA 3IAS6 1YZFA 2KZMA 2QQFA 4MCIA 4PHHA 3NTRA 1NJWA 2Q1WA 2YS7A 4PZUA 2PA0A 3RE1A 4QRDA 2RLTA 2O20A 4EO4A 4CM9D 1N2BA 3DVQX 4YQYA 4P84A 5HSGA 3LWZA 3HKBB 3MBIA 2CXPA 3HU3A 4HDRA 3CR7A 2VH2A 4CG2A 3EPLA 1Z07A 3NAMA 3FMFA 3NWJA 3VH2A 1U6JA 1VRCA 2FWAA 3HR4A 3JRWA 5CBPA 1MAAA 5JCZA 3U09A 2PFSA 4IF4A 4R5HA 4A1FA 1GCGA 1YKGA 4NBNA 3TQ1A 4FHFA 1E92A 2J33A 4MW5A 3FYUC 1BS1A 3R8FA 4DLTA 2BEUA 2CGEA 2WG1A 3A6LA 1WUJS 4WJZA 1ETUA 1ZJJA 3F7OA 4RTLA 2OHFA 5DN9A 5K01A 3IERA 3TI7A 4FNGA 5AI9A 4LRYA 3HB9A 4G1MB 1KKUA 1ZMRA 3I9LA 4PZLA 4QYTA 4ZT7A 3UV6A 4ALKA 1UAAA 4JA2A 4AULA 2PUDA 4UJ3A 1VPLA 1E1KA 5ALTA 3JQRA 3BVPA 3HEMA 1ODTC 1Z4NA 4DFDA 1NMEA 1Q17A 2H7VA 1Z12A 1T4BA 2H48A 4MRPA 1GV1A 1SBYA 4RDIA 2AZMA 1N2CA 2GJ4A 5BOSA 2ZJ7A 5ALHA 2IZZA 2QV7A 4NARA 4NMHA 3RJEA 2XMZA 3IT3A 1ZY2A 3LVVA 3F1LA 3UK7A 3C7CB 2EKDA 4EYEA 2WUDA 1H6AA 4F1JA 3MINB 4Y7CA 2XECA 4IRUB 1CUXA 3E9ZA 4AP5A 3WU2U 1EIWA 4O3OA 3GIKA 3R3ZA 4WKBA 1NY6A 2IXGA 3EUFA 3GVIA 4QULA 5H0IA 4J4BA 2BLNA 1ZICA 4IHJF 4N5NA 5DBHX 2JLXA 5ITSA 2H00A 3VZCA 3G5MA 2GM3A 4GC9A 4IIJF 16PKA 3VYTB 1G2IA 2FZCA 3ACDA 1YI8A 4MW2A 1GIAA 4X95A 1CFJA 3WKCA 3FNRA 3Q7IA 1E3QA 4DNXA 3T3NA 1J2UA 3HBJA 4M98A 2NZYA 2WLTA 2H4WA 4DWOA 2N1MA 2O1EA 4EL0A 3UPTA 2PUEA 1SOVA 2XYRA 2CHQA 4XJSA 1P7DA 1HYGA 1O3YA 1R6DA 3ST7A 4JI4B 4LXXA 2W11A 4OOFA 3AU8A 4I1UA 4M83A 4RL6A 1TEHA 1PR5A 1AD2A 4I8DA 4NBSA 3ZWBA 4LBZA 2GZ2A 3C6XA 1MJFA 4Y1EA 1U4SA 1GSIA 3VX3A 4NY1A 5EJIA 3VYUB 4AF7A 5DBAA 4AJKA 1DADA 5JSZA 5KQPA 2BYTA 1QRUA 4EW2A 2VHTA 1SKRA 4ZVUA 3LKVA 4OLJA 3V46A 3KOXA 8ICIA 3BUSA 4FNOA 3C3DA 2Q4EA 3DOFA 3L8GA 4XX0B 5DYYA 3RAPR 5HIAA 3IQEA 1EYZA 3KQYA 3V32A 4NXMB 5J2TF 1GZ4A 1R8QA 5AVTA 1I3KA 3EH1A 5L3SB 4U00A 4ZCPA 2D0IA 5TQ0B 3HJFA 3ZPXA 1XFDA 3G88A 4YXWA 3VR3A 2WF7A 1D5WA 2AE1A 1G64A 1UMCB 3FOZA 1EBFA 2B1IA 4X65B 2VWPA 3KLMX 4X97A 4EG5A 1TTHA 4F38A 5L8VA 4YP1A 5FNVB 4RPIA 4MLPA 4YYZA 3SIRA 4TL9A 2RC6A 4LZJA 2QT0A 4WOJA 2FN8A 3PW0A 1JDSA 1GVNB 4XSHA 1FFWA 4P0PB 1J8YF 5F76A 3WMWA 5JISA 4J6FA 1NUAA 1AV7A 3BL6A 3W9UA 2WU8A 4EQ6A 5BMVA 2DAPA 1FDWA 1UQVA 1UKZA 3FFTA 5HJEA 3TIVA 2PZKA 1MVOA 3NUQA 1KI3A 5DASA 1X92A 1WM1A 4KLHA 3VU8A 3EFOA 5CB0A 3MGCA 2DPYA 3Q8WA 3VZSA 1KBOA 1UBHS 4XQGA 4Z2YA 4HZGA 5IIJA 2GBPA 2AG0A 2CXXA 3O8DA 4HX5A 1IJKA 2QAGA 5C5JA 4IIHA 4MVJM 3VI4B 3VO2A 5I45A 4OFZA 1C8LA 1K3UB 1RYUA 4F1KA 2CFSA 2BKXA 2XF8A 3V72A 2AGPA 3K53A 4CIXA 1MQ3A 4R83A 4YAJA 2G3YA 4B3FX 2OAGA 3OLYA 5CLLA 1BGVA 3RTVA 1X6IA 1M7BA 1DZIA 2P5UA 2VHUA 3E2PA 3PC8A 1E1NA 4HFJA 2P9FA 4MMZB 4CTJA 1FSPA 4I50B 3DZKA 3KJNA 1I2MA 2B9EA 2YBEA 3GLGE 4B48A 3MUFA 4M6WB 2QD3A 1HDYA 4ARVA 4FB4A 3H2YA 2NPIA 1DX4A 3RR8A 1HE3A 2H1RA 8ICEA 2NPFA 3I5YA 5CEHA 2BCJQ 1G5TA 4MQUA 4MYRA 3R2JA 3K6SA 2DKOA 4P38A 5DG7A 2EZXA 1SA0B 5TS3A 1WOYA 1WU7A 3B36A 1S2GA 3ZS8A 5KHLB 2ATVA 2Q4RA 2Q1UA 3ZY2A 1LS6A 3A10A 3EXG2 3WG9A 1L1QA 1JMVA 4F7WA 2OGZA 1FP4B 3SQXA 4QJBA 2IT1A 4J75A 2HKIA 3SKXA 2OWDA 2B35A 3ENVA 4RCZA 5EE3A 2Z58A 1U2EA 3CX7A 3UMRA 2HK8A 4P5PA 4PBTA 5AW7A 1C3JA 4U4AA 1BEZA 1YUMA 4IXWA 4Q4HB 4C21A 1MO5A 5FADA 4IVNA 1LQUA 3O94A 1ZC4A 1U5BA 3ZU5A 1FYEA 2KNJA 1U7XA 3O6VA 4O33A 4IRXA 2JDIA 4CTNA 4YMMA 4G67A 1NVDA 2YHSA 3ONVA 1YDWA 4JGIA 2VO1A 3SVZA 2C2DA 1RKUA 5KG3A 1H6BA 2VP6A 3IQWA 1JPNA 2W00A 2WWHA 3IBCA 1Q3HA 1NI4B 1W0KA 4YY3B 3F2DA 3CRNA 3QXHA 3CV3A 1SCUB 1A5BB 2Z6VA 3ROMA 1BNCA 5JHGB 4Q9AA 1TYBE 5COQA 4UZEA 2FE9A 4H2DA 2ARKA 4LZGA 1WDLA 3EDQA 2J3QA 3P2MA 3RVKA 3TJZA 4PYRA 4IOMA 5A3RA 3C3CA 5ALJA 3HU1A 1P1BA 1P44A 1BCRA 4ZWNA 1X2IA 1FX0A 4ENVA 3K4QA 2Q0QA 5KYYA 4BMPB 1SQ0A 4QHSA 3SDBA 3AF5A 3C8MA 4QU0A 3RFFA 4CU5A 4B1FA 1PTJC 1W52X 2ZYRA 3QQPA 4HPXB 3W6OA 3JPRA 4RCYA 4B80A 2KICA 3UJCA 4J94A 1DIOB 4KXQA 4F4IA 4ZYVA 2YHBA 1TVAA 3CRVA 4QHTA 2A1TR 1N9ZA 4DAOA 5CB6A 2E4AA 3KFLA 4BWGA 4TQRA 2EW1A 1MB4A 2DKNA 1QQ5A 3JYLA 3ZEAA 4QIWC 2D06A 4GL4A 4B3GA 3MD9A 1DFHA 4PZ9A 1HLPA 1B6TA 1M9NA 1OWLA 1FFDA 2X7XA 3EQ8A 4GP7A 3U48A 5JROA 2O0JA 3QW4B 2VDLB 3ZDQA 3FMPB 1ND5A 5LZ7A 3NS1A 3HRDD 4BNMA 2FMUA 3JQ8A 2CD7A 4TZ6A 3B3FA 2B4KA 3DB1A 3LK7A 1NC1A 4HWSA 3BF7A 4QDZA 1KEVA 1XTZA 2HA6A 5H59A 4QGAA 3E7DA 1KYZA 3K09C 5F9HA 3OFKA 3AK4A 4PYMA 4E46A 1DBPA 4HQRA 4RLSA 4ZKDA 1VPWA 2QPAA 4GT1A 2V3CC 2JIBA 2ONYA 2A86A 8ICSA 1HYEA 1U1EA 7ICVA 4MKZA 1KY4A 3KFXA 1NHGA 2ZJFA 4ND8B 4XQCA 4I27A 2FVYA 4HLCA 1VJ1A 1DKNA 5HBRA 1I33A 1CEYA 3BOSA 3RYTC 2IYNA 4UBKA 3OCXA 5EJ2A 2G1PA 3RASA 3NAGA 2XIJA 5EKSA 3G1TA 5J0RA 3HR7A 4FZVA 3VVLA 5LVAA 2OYSA 2VUTA 5CNKA 2G7MC 1Q19A 4ED1A 2HY7A 2EWWA 2OFOA 3A9VA 1R0RE 4Q9NA 5E0OA 1NU6A 2HO4A 2W42A 4S04A 2DBYA 4JIMA 4YP0A 4O1MA 3O3MB 3NVMB 2BD0A 3GQVA 3PRJA 1KU6A 4C2AA 5EJ6A 3JR3A 4O4LF 3KT8A 3OY2A 1YR2A 2I4MA 3SZRA 3DHWC 1TC2A 3F2IA 5GONF 1U9IA 2P4SA 2YVQA 4DM7A 2FPUA 2PKXA 2PRKA 4U63A 2ID9A 2JAOA 1Z7BA 1HRDA 3BHNA 1DLJA 1LNZA 4MW0A 5CUQA 4D8TA 2DHEA 4JLDA 5BRNA 4MUEA 4G1UC 1ECWA 2A0FA 5CP8A 2P6RA 5IABA 1W49A 2AJDA 2C03A 1IFXA 2QVCA 1GTRA 3KQLA 3BSSA 3G2NA 1U4BA 2RGBA 3CH5A 1IXRA 7ABPA 3OQHA 4F5RA 3I8OA 1KWGA 2L42A 4K2AA 5AK6A 3ZD9A 2HJHA 3HADA 3D1LA 3IDSA 3PC2A 5JAQA 2RGXA 2ZRCA 1GJRA 2PD4A 3GXOA 5ALYA 3X1XA 1LBSA 5AKGA 1Q50A 2HUNA 2VYVA 3KKQA 3OTQA 3NPAA 3PV0A 1QIKA 3LDHA 4CNQA 2WAAA 3D7MA 4POAA 4D99A 2AEMA 1O95D 1XEWX 4S0XA 3PEUA 1CY2A 1NI4A 1FBTA 1JJIA 4M0AA 4TMZA 2IUUA 1UIRA 1F2UA 1AXGA 1L5YA 3I9JA 3IURA 3KSRA 1V3UA 2QZJA 1NKVA 3L2OB 4H7FA 1F2TB 2JAUA 4DFMA 2OD9A 1VSUA 2VPTA 3M1LA 4EY5A 5AK5A 2HDOA 4ED7A 1JEEA 3NWEA 5HK8A 3AM1A 2R751 3U7HB 3P20A 1VG0B 1RQ7A 1NQOA 3QLEA 3UG7A 3N39C 4JEIA 5J2UA 4FYKA 3OUTA 3KJZA 1A0OA 1WQ4A 3SR3A 5JVDA 3CKYA 5MFPA 1Y9DA 2CY0A 1GRRA 4IRDA 2GQ0A 3AF4A 3ULKA 3BFJA 2QY6A 4JLPA 3RRJA 1U0LA 4BV3A 4JT2A 4MW1A 3FNEA 5FULA 3Q8RB 3QIVA 5AQEA 1JEYA 1ODSA 1Y98A 1VGQA 5AVOA 3TFOA 2OWOA 5T3UA 2G06A 2ZI4A 1A9XB 3PX4A 4B40A 2GCEA 5DNAA 1SC6A 4C8KA 1GCUA 1Q15A 1RZ3A 1EGAA 4Z1MD 3KEFA 1T4GA 1SV0C 2ZVDA 3AR4A 4K9KA 1NOKA 3A1TA 5DRTA 2GBCA 1DGSA 3ILVA 1WKBA 1OBVA 3JQAB 4BRSA 2KW5A 1V38A 1UBSB 3DOHA 4II3A 1L7DA 1T5LA 5KYUA 2FPKA 3FYDA 1UJ6A 3KB1A 4E33A 1SXEA 4URYR 1KJIA 1DKOA 1FLNA 2BGKA 4YRRA 3UB4A 1JIXA 4JMUA 3UK1A 5ICSA 1VC2A 2BV3A 4OK6A 5GGYA 3R9XA 2BEWB 2PZ8A 3JR7A 4R7GA 3H8JA 1US8B 3LA8A 3MIZA 4QRIA 1ZRNA 1K86A 1GQRA 2MINA 2P5TB 3WLPA 3B3GA 3F3YA 2EX4A 2DPHA 3UT6A 3E9RA 4QBGB 3RYCA 1UQTA 3MJHA 3LJKA 1CCWA 5GOTA 2H1IA 1K63A 3A9SA 3RBEA 1KZHA 1TE2A 3ANYB 2NVUA 3QBTA 5KB3A 2WINI 2ZAYA 3OZEA 2DGZA 1RBQA 1ULSA 1D4OA 3ZJYA 4BKOA 3C3WA 3LO5A 4K0KB 1IG0A 1VCNA 2G6BA 5H3HA 1N0VC 1YB7A 2G76A 1TRHA 5BNFA 3W9YA 3CCBA 4TV9A 2DPJA 3OZSA 4AZ3B 2VUHB 4IQVA 1V9SA 4Z99A 2OCDA 1M74A 1EXMA 4OJLA 3DB2A 1CNMA 4QYWA 1YOVB 1PWZA 3NRZA 1TTQB 5H82A 8ICQA 1IC6A 2IBKA 5JCOC 2QTRA 2UUCB 4F11A 5J0SA 5FEMA 4D4JA 2OXFA 3IB3A 3TIIA 3WFJA 1AUOA 1T4MA 2A9RA 2D0OB 4LNUB 1DCMA 5H70A 1H8EA 3OHPA 1HI9A 1T36A 3HCNA 4DA6A 5CFPA 3S81A 4C1NA 4ACOA 3BM5A 1VE1A 5T4FA 3VQTA 2FMIA 1H5QA 3B6ZA 3AUXA 3EDYA 4IQWA 3RB0A 4M9HA 1J0EA 1ZSYA 3G2LA 2XQFA 1G8GA 3LCUA 4GRDA 2QX9A 1VBKA 2PO5A 4XWAA 4JROA 3M9LA 3MOSA 2R4UA 3G0OA 9ICWA 4D9CA 3BMOB 1BGWA 4Q1AA 3JQCA 4MPPA 2EZ4A 3QIAA 4Q1EA 3H4TA 2Q5FA 3RLIA 3TW8A 4FS8A 4D0SA 4PZPA 4Q1BA 3RK0A 1KERA 1QG4A 4MKIA 3SYMA 3VC2A 4PU0A 1SC4A 1P0CA 3JQAA 4GI1A 1E0AA 3IAEA 4Z4CA 2DKZA 4E0DA 2R8ZA 5JU5A 4UTNA 2SCUA 1P4RA 5KFEA 4DDKA 2XY6A 1F6DA 5F2EA 1JECA 1PBTA 3OZGA 2W2XA 3HVJA 3NT5A 5HRAA 1E4YA 1RVV1 1M72A 4F91B 3CNBA 3OFNA 3BKWA 2BMEA 1XHLA 4HMPA 3E4CA 3H87A 2V54A 2VA9A 4NLCA 1PZGA 1MT3A 3L0IB 4CV2A 4EG3A 1S7GA 1RP7A 4JUDX 4O5OA 2ZS7A 3RFAA 4KLAA 4KAXA 5DHRA 5FOQA 1UWCA 5A4JA 4DQLA 4N76A 3Q9SA 4JLNA 3VHXA 3LA6A 1WHTA 5D3MA 3T15A 3OLZA 3FJ1A 5CDUA 2LDXA 1HX7A 1W94A 2J3IA 3M81A 4HGNA 2VSNA 3F6SA 3N2NA 3R4VA 3MD0A 3MTQA 2BCVA 3AR6A 4WNAB 1KDZA 4CEIB 3DW1X 3ZWOA 3AG6A 1FFSA 3DDNA 3WKEA 1YB6A 4I9FA 3ERCA 3N7PD 3P9PA 2JHDA 1AOXA 4ZJZA 2GF2A 2GK6A 1PSZA 4WZ6A 1I7NA 3ILXA 5A3SA 4GFJA 3B3JA 3BE5A 2W6PA 3OKAA 4YH1A 5TJ9A 1F4PA 4GWGA 4A8HA 1QCZA 2AOUA 3CUSA 2FP4B 2E21A 4DSJA 3M5PA 4X6YA 3WLLA 5HJ7A 4RU9A 2G70A 4BZPA 5G41A 4GR9A 2J6UA 2PG3A 2Z1MA 3NT2A 3U1BA 3IPYA 2DPGA 1XZBA 4MYDA 3BGDA 4YRKA 2Q3FA 1G3MA 5SV2A 2IXTA 1JHVA 3G2OA 1UDBA 3TKLA 4BJ5A 4CF6A 4Y67A 3FUWA 3WSVA 3SZOA 3L0DA 1BHJA 1QHYA 2I62A 3T5AA 1RRMA 3GILA 1NAIA 4TKUB 1IZZA 1XDWA 1SXDA 2IUSA 3G6KA 3LT2A 4TTIA 4DS3A 1U7DA 5KFKA 5DHFA 1CI4A 1FFAA 2ZANA 4YCXA 1Y5MA 2AEEA 2DE0X 4XEUA 2W2NA 1L7RA 1KOLA 4P4SA 5KWJA 3B2NA 1KI4A 1WULS 3KPJA 4B4KA 1G4HA 4CPDA 2IPLA 5LQRA 2PX4A 1DMSA 1XWFA 1B0AA 4RV9A 3KUUA 3GDHA 3QBDA 4OA5A 1S3IA 3V4FA 4DXHA 4JWMA 1W4ZA 2JGJA 2PCLA 2PKQO 3PFGA 5LQDA 3GGSA 5BN4A 221PA 1F0MA 2OA0A 3H1BA 1G17A 4CDMA 1NJ5A 2XT0A 2ZK7A 1JLLB 3E22A 2BFMA 3FIJA 2A1IA 3IQZA 2RC5A 3Q0TA 4WXMA 4LDRA 3OQIA 2Y0PA 4LJYA 1D03A 3VPCA 5KNCH 1K3FA 1MJGA 3E05A 3BTUA 3C2MA 1NN3A 4OL9A 4R9NA 1B76A 5A9SB 2ZIFA 1R64A 2HMYB 2QTFA 3FLBA 4NU8X 4WSOA 1FRFS 5CU7A 5DT9A 2YZMA 5CXSA 3KV1A 2W04A 1JG1A 1L4NA 3EXFA 4LY9A 1BCSB 5BN5B 3AFHA 8GPBA 4WDRA 3ENZA 4WOBA 1RI5A 3HUUA 1NOMA 2O52A 7ICPA 2OZPA 2BH9A 4BKMA 1E0KA 2Z3ZA 2ZSBA 4GMGA 5FBHA 4WGFA 3KWLA 1EUDA 3WGOA 5A4AA 2EBFX 2QROA 2QG6A 3R3XA 4REMA 5EMJA 3T94A 1EZ4A 2ZBDA 3HCBA 4IDGA 4QODA 2FMFA 4EA8A 4TKVA 1PJBA 5KNLA 1Z88A 4PSUA 2GVZC 1QFMA 1SQSA 2I2FA 2W2KB 5AUOB 2HLPA 5B37A 4OQDA 3FRIA 2UV8A 4KJZA 4BEVA 3KXDA 1A9YA 3F5FA 4B6GA 1ATZA 4TOIA 3CE9A 3LT5A 3HPOA 3HB4X 4ZU3A 4D0GA 4X1IB 4EHFA 5JI3E 2EANA 1MBZA 1C30B 2VCHA 4QVKA 4E12A 1VMEA 1XUOA 4IKOA 4RD4A 2B6GA 4M2YA 1OE0A 5CH3A 1OD6A 3ZBTA 3KKMA 3U16A 1SHTX 1G59A 3ZWXA 5A0VA 2FCAA 1LPOA 2CRXA 1GAEO 4TMWA 1EVZA 4K4IA 3CRQA 4IDPA 1R9GA 4FS1A 4PQFA 5DP2A 3LWDA 5BR7A 3HJEA 3QOXA 4L0CA 3KYCB 4RNMA 2JCXA 3F4BA 5E6SB 3ZKWB 1RM5A 3ZLTA 3B7WA 2Q9UA 3AOEA 3QKRB 3ZI7A 2O2HA 1VLJA 1L5KA 3SM3A 1DJMA 2VPIA 4ARBA 4JLWA 5A1TA 1HE8B 2W8BB 1GTVA 2GOLA 3OZDA 4JNCA 4UAGA 1S5PA 3HPRA 3BEDA 1RACA 1KJNA 1XNHA 1T1IA 2ONZA 1CJCA 1EGQA 1SCKA 3G85A 3VTAA 4ZHSA 1RHJA 2ANBA 3L6RA 3HA3A 4UVEA 2P2GA 4XEHA 3E9MA 4YT4A 3MGGA 4I5FA 5ED4A 1XSNA 1XEXB 4YMSA 2I54A 1Y82A 1YC2A 2FUKA 5KAMA 3EEOA 4B31A 2NSYA 1T8PA 2RMKA 1AS0A 3F1KA 2WB1C 1GCOA 1NY5A 3OPYA 5B1EA 3L7AA 1XMOB 4UAWA 4M1ZA 3MB8A 5ALFA 4GC6A 3FLMA 2YTZA 5EXXA 3PNSA 2GLXA 1E1QA 3WBBA 3N7AA 8ICGA 2A6PA 1TUBB 2V6JA 2HF2A 3IILA 3JSAA 2GEDA 2ZROA 3OF5A 4HYEA 2F67A 5PGMA 4FZJA 3TMYA 4DNPA 3HKDA 1WXIA 2TECE 2J6IA 2TMYA 1JHUA 5DTRA 3PL5A 4GKJB 1FYXA 3DWGA 4LCBA 4OBWA 2ERCA 2HOIA 2BEVA 3N7SC 1G8PA 1GPYA 1X6VA 3LXMA 4KXVA 4WIAA 4BNVA 2REQA 3DEIA 1TO6A 2DR2A 3AUFA 3O4GA 4FGUA 2DERA 3BFPA 1N2GA 2C95A 2IY8A 3A2KA 1QIIA 1P19A 4Q3EA 3HVRA 4Q4DA 3ZW8A 2CBZA 7ICSA 3LOPA 5TMPA 3A6DA 1TEZA 3NOOA 4WZBB 4HVCA 1V7PC 3ZNQA 5C8YB 3BQ1A 4PAMA 5IJZA 1RR6A 3K31A 2MUTB 3FM9A 4F4WA 4IFTA 4DY4A 1I6MA 2QAIA 4RIFA 1TGVA 1YULA 2GJAA 4XTCS 1WCIA 3NC0C 2Q5LA 4Q6BA 5E8RA 1T5DX 1P91A 4DIUA 2QENA 1SNYA 2EBHX 1ZW1A 3G9ZA 1E6CA 3L5KA 3QWAA 3RVRA 3I32A 1VZ3A 1HUZA 1YB5A 2GAIA 3PKJA 2MSDB 3OQIB 4D6YA 1CDOA 1KSFX 3DBOB 1PLKA 4E5KA 4ZVTA 4M6WA 2QN2A 3OU2A 4AURA 4R4JA 1O8BA 5L9XA 5EJAA 5KOYA 1W76A 1CERA 3FWPA 5L7YA 4BVKA 3FWNA 1KFBB 2WABA 2ZJAA 1YBHA 3QWHA 3QFTA 1H6DA 2BLLA 2PYIA 5FL7D 1TI7A 1WPXA 3WNVA 4NX2A 3WBJA 4BKUA 1RXSA 1Z2OX 4ZIRB 4HNAA 5K09A 2YWCA 4EMUA 1HT1E 2VF5X 2RHTA 3DBHA 1ZN7A 4N3AA 3IKMB 2HU5A 2FJ6A 1X7WB 1VBFA 2NVWA 1ZQGA 2VF7A 1WSWA 2B37A 3NNSA 3DVRX 4IMIB 4DKJA 1E3SA 2YWXA 5EJGA 3BRSA 5FUVA 2CF6A 3A3OA 3BTSA 5JDCC 3SYNA 2GERA 2I7TA 4Z4GA 1L4EA 4Y2RA 2ZQYA 1PT5A 2ZJOA 1OHHA 4NENB 5ENDA 1JBEA 4ZMSA 4Q4JB 2AQIA 3QPDA 1ZKMA 2H9AA 1NBMA 4D79A 1PVDA 3GO4A 1IAQA 4QZIA 1KXZA 3N2GA 4KPUB 5CYFA 1FW8A 1SU7A 4TVKA 3OPYB 1OF1A 4MVJP 3TCXB 1A3CA 1XTJA 2AE2A 2PS3A 2YWEA 2BC9A 2JIPA 3VNUA 4DN6A 3QKUA 3H4BA 3QJGA 3MR5A 3IEVA 1CZOA 1K6MA 1SKSA 2RKOA 1KBZA 4L5BA 2EU8A 5B5SA 1W4AA 1U1CA 1QVRA 4ZOHC 3COPA 3SFTA 2E3TA 3ZWPA 3DE1X 5KYXA 1L4GA 1ZCFA 5DB7A 4GMHA 3A31A 5JE8A 4NJMB 1ZEJA 5DOZA 4O4IB 2GNOA 3FB4A 4N47A 1CC1S 2Q21A 3VKFA 3X1YA 2O59A 3OGUA 1Z4IA 1AJEA 1B26A 1YZGA 2E4UA 4R16A 4YRDA 1G2PA 3QG1A 1OB5A 3CTPA 1J20A 3SYZA 4N7RA 3Q8QB 5BORA 3PQCA 4GBED 2B98A 1UAYA 4GI7A 3K0BA 4WLEA 5CHGA 3UY4A 1I0IA 4HMOA 3IFSA 1VMKA 2WVJA 1B6GA 3NU1A 1OLSA 3Q3IA 2ZTVA 1F1BA 4L2IA 1QSYA 5AVKA 1S9FA 1EUZA 1JQKA 3B5IA 4FWBA 4R8MA 1QP7A 3FWYA 1JI0A 2ODTX 2YNMD 3B1ZA 1VI6A 4J29A 4MV8A 4R9SA 1AMUA 4WDQA 4EGJA 3HO1A 2OOKA 4L07A 2B7CA 4RQMA 4J9LA 4ENTA 1BFUA 2Q2OA 2XAAA 2RIRA 3TOCA 1R4AA 2FN9A 1YK0A 3VJKA 2QUHA 3KYDB 4IG4A 4UDNA 4F5WA 4Y9UA 4FMCB 1EWTA 1TA9A 3C39A 3PUKA 4YD1A 3UMBA 1OBCA 3SIPA 4ZYYA 4J0HA 3JQFA 3GRZA 3DLAA 1H8HA 1R0ZA 5KBYA 4B3HA 1MN6A 2CLLB 2Y92A 4H08A 3UYLA 1T9BA 1DVRA 1NBIA 3HB0A 4QO8A 4RPGA 1S0VA 2CJFA 3NDRA 2HZ7A 1WNTA 9ICPA 2AKYA 4V02A 2NRWA 3EF0A 3DQZA 2JGDA 4DLSA 1J2NA 4KSCA 2VDMB 3ENKA 2ZCUA 4QU5A 9ATCA 2WJJA 2XDYA 3QVVA 4EG8A 2NU9B 1EUYA 3AFIA 4S0ZA 4F4FA 3OI7A 2C9YA 4Q44A 5AFSA 4BO8A 4Q3OA 4INJA 3DM5A 4Y2QA 1KZ6A 3EJ6A 1DJNA 2YFHA 3ROKA 1A5AB 2WZCA 2XKAA 2DZDA 3MABA 1NN5A 1CJUC 1E3LA 1QGUB 2AGOA 1QIHA 2F9LA 2FWBA 2Q0SA 3EDRA 3ND9A 3TIFA 2H5LA 4QVGA 1V16A 3M4XA 3PFKA 1IZ7A 1N8SA 1JAIA 1W5AA 2Q6LA 2OCLA 4D82A 4CKXA 4RDXA 2ZR8A 2D62A 3ZGNA 4JK3A 4DO9A 4KLUA 5IBRA 2ZRPA 2IYYA 2ATEA 3F6EX 3HFRA 1C7IA 3KLNA 5JH7F 4BN5A 1PKEA 2YB4A 3FGZA 4K46A 1VJTA 3MYYA 2OCPA 3V6HA 1AKUA 1WB9A 4JT8A 2QE7D 3RAJA 4WD3A 1C2YA 3A26A 4RTQA 1T8TA 5K0SA 2R5FA 4GOND 1U4NA 3GA0A 4HBZA 1OV4A 2CN1A 2W3SA 3F7MA 1V41E 1RRGA 3CY6A 4JJGA 4G37A 2K4MA 3D2AA 4ZVMA 2H9YA 1V5EA 4V3CA 3A25A 1KTVA 3LK9A 3MJCA 2G5CA 3NIDB 3O8LA 3BL8A 4DSNA 1N5MA 4HNVA 3FHOA 4RABA 1E9DA 2JGMA 2WLSA 3C5WP 1LDYA 1UK9A 3E3OA 1JVBA 3IUQA 2JKZA 3ONWA 5L1KA 2GKSA 3ZHRA 3R9XB 3OZVA 2I6GA 2VNKA 1UK8A 1GL9B 1QHIA 4IM7A 4TV8F 3PJRA 2GN1A 5J0QA 1JB9A 1COKA 1NKSA 2TMGA 1YGPA 3D0OA 1D0IA 3M34A 1W96A 2R8RA 1QF9A 3SZUA 4YUAA 1TADA 5KPJA 4YG2A 4B6RA 4CR6A 1E4EB 1MXHA 1S4QA 1NASA 4ZCMA 2Z2IA 4MB0A 3NALA 2OENG 2Y6UA 4BQRA 3TSYA 2G9RA 1G21B 2VNSA 4O3MA 4ECSA 5G1NA 3WYAA 4Q12A 3H99A 3CHYA 3FMOB 4MARA 1MTZA 3IMGA 4RYDA 3GIIA 4V0ME 1Q14A 3EGXA 3I6YA 4Q45A 1SUWA 4YC7A 3GCZA 4AFNA 4RVUA 4F9GA 3GPLA 2LW7A 1EDBA 1NPTO 3EDMA 4QDXA 4F8JA 1CF2O 1N5OX 2IYFA 2ADFA 1TX4B 1KRXA 1JEDA 2XUPA 4O8ZA 3GUZA 3KQQA 1QHHA 1VECA 4JJ7A 4QGBA 4CM1A 4D4LA 1QUEA 1WEKA 3HXKA 4FE4A 1NJ1A 1IEXA 1YD7A 2BFPA 3O8OB 3JPNA 4GXTA 4HI0E 4M99A 3PLAE 1MIOA 2JNWA 1VIAA 5B30A 3ANTA 1COWD 3BHMA 3EBOA 3PFFA 4D41A 1IHYA 3WAGA 2ECFA 1F12A 1P9NA 2GO1A 3W6UA 1TM3E 3D6NB 2HHWA 1JKJA 1HKUA 1ZLXA 4Q34A 1QH1B 1DINA 1SUPA 2H17A 5GV8A 4CDNA 4CDRA 1UMKA 5JYEA 1YS1X 2RAUA 2FG6C 3FBGA 4PAWA 3WDKA 5BURA 4ZVVA 2OO3A 4ZALA 3UJ8A 2H1CA 1A77A 2A58A 3TQHA 2WUWE 4YK7A 3S2FA 1J1IA 2ST1A 3O21A 3OWOA 5L1JA 1QGZA 2BT4A 4IDAA 4TWIA 5CYOA 2H0RA 4LFCB 1NG1A 2ISPA 1EUCA 3STWA 3QX7A 1H85A 1KPIA 4NLKA 3UJ3X 1KFJB 3QPCA 2CLKB 2HBLA 2QX4A 4N0MA 2YXNA 4QNRA 3VUEA 4M4SA 1KDRA 2WJ6A 5JEDA 1C8VB 2MRLA 1M7HA 1RD4A 2WIKA 1I2AA 2ZXEA 3LE8A 3QITA 4XB1A 2R8IA 2BRUA 3TLYA 4DLAA 4ESVA 1GNSA 2AZXA 3ABQB 2CB0A 1SPBS 1I3NA 5M34A 4FT2A 3KFUF 3KOOA 1N3YA 3GRFA 4Z9FA 3OLVA 2QPLA 3IDFA 1XELA 4IW3B 4RPKA 3ZGYA 3D8RA 4BLVA 4BNKA 1C9KA 1LSUA 3D8BA 4LX8A 2A5YB 4YP5A 4ZCQA 3PTAA 4MVCA 3PD7A 1L8LA 3DC2A 1PT7A 1SC9A 3QPUA 5FD8A 2BR0A 4NABA 2WJWA 4DIEA 2F1IA 2H4HA 3ETDA 3LPAA 3PNBA 4DARA 1E6MA 3G5LA 4G5XA 3QBJA 4ZYLA 4MUMA 1F60A 2X5KO 4YAFA 4DM3A 1WMEA 3UFXB 3AERB 4X54A 3O1IC 2F7SA 4LSMA 4JOSA 3TDMA 3DSRA 4ZTUB 4TLAA 4FVTA 4DUPA 5J0PA 4L8FA 4L72A 4RBNA 2CJPA 4PNEA 2L2QA 3UK6A 3R0VA 1G8YA 3AY3A 2R1VB 5BR4A 3QF4A 1ZQQA 4LMRA 1U8YA 1JS1X 1TA4A 3I39X 4ER3A 5JJIA 1WEHA 1SUEA 5H4GA 4BJ6A 4CIBA 5HMMA 2B2CA 3OE4A 3GJQA 4KVFA 4CKBB 1MGPA 4ZK2A 1NP3A 5FPPA 1N2SA 5KNDH 3BJRA 2L5YA 3SV4A 5CW1A 4YAKA 4FFSA 2CXHA 2FEPA 3C87A 3YASA 5EE0A 2B36A 1ZU5A 5BVGA 1THGA 2XWPA 1WL8A 2JKVA 4QHYA 1J0DA 4I2IA 4CLOB 1ORRA 1Q1ZA 1YOVA 1Z7EA 2X77A 1XLTA 4GNKA 3Q9LA 4Z54A 2ODNA 3A14A 3QPBA 3DZDA 5DB8A 1KVUA 3W3ZB 4ON9A 2C3MA 4DXAA 3AI2A 3H04A 4PYNA 3MERA 1P60A 3WKBA 2DH5A 3LU1A 4R98A 1YBAA 1BE6A 1D5CA 3I28A 4DLGA 1XZNA 3VPHA 3ZDXB 4LJLA 1ZGBA 4K9RA 1FPMA 5KFUA 5EIWA 3MT7A 4KRGA 3PNOA 2YNMC 4XB6B 3TM4A 3B2QA 3MGIA 3O2JA 2R7MA 4HRYA 2ZP1A 1QYDA 2AC2A 3JPQA 1QAMA 1XSPA 1P62B 2W6NA 1GLVA 1UFQA 1IL0A 4Z7QB 4IQTA 4BJQA 1OV6A 3FNIA 3KKZA 2D7CA 3QRWA 3UMFA 2X0IA 3V1NA 4G26A 4BRUA 1CLUA 3FOWA 4GLLA 2OWEA 4X92A 1PSWA 3L7IA 4D3SA 5A62A 2QDKA 4WLUA 4BMOB 1HO3A 3AIKA 4HB3A 4OX9Y 2GJSA 1DFGA 1PJLA 2QW8A 1Z0JA 2NO6A 3GA7A 3GWGA 3NEAA 2R6ZA 2EJUA 4B84A 1A8UA 1SM4A 2Q07A 5EIAA 5BNWA 4B9AA 1Q7BA 4DJJA 5F33A 5BVHA 1OWMA 3BDVA 4UEKA 4OXQA 5FI1B 3WZ2A 2AGQA 1NPYA 3COSA 3LZCA 2O2CA 4FKMA 4XI9A 3WL5A 4ZK6A 1ECLA 1KFSA 2Q29A 2ZYGA 4OY3A 2EKQA 5IAOA 1DRUA 2ZT8A 1X1SA 2C2MA 2QUKA 1DDGA 4KZKA 4PF1A 2FPOA 1QH8B 3WK7A 3A27A 3Q72A 4O1HA 3S0JA 5GVSA 1DTSA 3DDOA 2BCUA 1AXEA 1T6XA 2OQ2A 3IAAA 2OV3A 3BFXA 3IT1A 4RZUA 3RIXA 2XTNA 3PHCA 3RC1A 2V4RA 3INGA 1XKQA 2X8WA 5E7IA 3TK1A 3WADA 1FB5A 4GBGA 5EESA 5CB4F 4WINA 3FRJA 1YS6A 3ANLA 1FYVA 1VIMA 1PFUA 4PXYA 1PVVA 2H92A 1Z6YA 4G2TA 4PPGA 5GTIU 3ECCA 1WW3A 4W5HA 1ECCA 1OMOA 4X61A 2G40A 1Y9EA 5D1NA 3SSMA 2YY5A 4E15A 5K0GA 1AROP 1DAMA 2QR5A 1QH9A 2FPPA 3DFMA 4Y0AA 2ZREA 5IW8A 3TR5A 3WL3A 3OCCA 4EPTA 4WX2B 2C2RA 1GLGA 1ONNA 2O5EA 4HDKA 5ADUS 3PT5A 3UXNA 1O6GA 1XRJA 2J3MA 3QYJA 2P4UA 3SP1A 3B8HA 3JVEA 4M9RA 4C3VA 4EVIA 4RD2A 1PUXA 2IPXA 2XUAA 4JGGA 3E53A 4DANA 4DPMA 2YB1A 2HA4A 5D46A 3ECAA 3O4VA 4R3WA 4WW0A 3NIFB 1PX2A 1XYVA 3WP1B 2ECKA 1H4QA 2I7XA 4INPA 3HGMA 3Q85A 4HQOA 4UU8A 3RSOA 4W5TA 1NRXA 1XJWA 3KYCA 4S12A 4UW9A 4YUZA 4QSHA 3UXPA 4OLAA 2CXSA 5I7EA 4QSMA 1U94A 1ZI8A 2R8EA 5J40A 4C04A 3L0ZA 1N8KA 4EF4A 1IM5A 1TKAA 1SOUA 1SG0A 2IDZA 1U6KA 3HV2A 4DEXA 3GZNA 5B7PA 3LUDA 3QEKA 2ZJYA 1KYXA 5A7FA 1VE7A 2G77B 5HHHA 3IP3A 3PNPA 2ZE8A 2ZRBA 1ADGA 4HS4A 1C0PA 4LW8A 4TRMA 4UPEA 4XGQA 4MIKA 2F17A 1RAEA 5KC8A 1XIVA 4KLOA 1YKFA 2NUAA 2HA2A 4IGKA 4X8HA 4IL6U 3LL4A 3AU6A 4WI1A 4Z7NB 5LQUA 3KRTA 3RUFA 4JUIA 4EF6A 4HQNA 4QTXA 4XWKA 3CRRA 3BGVA 3UATA 5CM2Z 1WZIA 4XA5A 5DB4A 5FBVB 3T3EA 2PAAA 1L6NA 1IWPB 1QDEA 1KXJA 2VUUA 2O2IA 1KJYA 4P81A 2X0NA 3AONB 2HCRA 4UM8B 4WNCA 4EW6A 5EUCA 3C1AA 4KIFA 4MR9A 4RU1A 4PEVA 3X1JA 5C37A 1F4LA 1LV5A 1H22A 4XPIA 2NU8B 1N7JA 1DQZA 2C7RA 3V7JA 1EBUA 4A0GA 4GGOA 1HJPA 1Z6ZA 3CLSD 5HF9A 1QPGA 4W7SA 4M1TA 1KEZA 4Z7OB 1RRFA 2E9SA 3CF6R 3DBRB 3HMQA 2Y1IA 4I1RA 4KXYA 2KM1A 2DCUA 5E9QA 2J08A 3V2GA 3WS7A 2EAUA 1HG1A 2LCIA 2XI4A 3AHJA 4FBUA 1E1RA 3GLQA 4LXYA 4NH0A 4E4RA 4L28A 2JIOA 3PJEA 3A0BU 3LUCA 4CIYA 2AF3C 2WNHA 4NJEB 4KLEA 3RPEA 3D54D 4DLBA 1PQYA 1PVOA 2MYUA 1S0MA 4RVOA 2B4QA 3U0BA 3TVYA 4IIXA 2XJ4A 2YC4C 4GQIA 3I9FA 4EUSA 5KTNA 1TU4A 1CRLA 4ARUA 3OUZA 4JI8B 4PO1A 4CG0A 4GPAA 3ETLA 1B4DA 5CXUA 4J16A 3PBKA 5TGZA 1R0KA 2M0NA 1HQDA 3HBAA 3PPYA 3VCBA 5J2TB 4MP6A 1TQ4A 2WF6A 4F4XA 1CUSA 1KORA 2SHKA 4JUAA 4UAZA 3IO3A 1XDGA 3QLVA 3KDPA 3LFHA 4I5DA 1UC9A 3UO8B 1YIDA 4B47A 5JSZB 4O1IA 5M2QA 1LPPA 1V3TA 5KX5F 3AVUA 1Z25A 1U7ZA 2AHOA 2QGNA 1P7ZA 4MV4A 4BFZA 7ICIA 3IEXA 1KO8A 5SZJA 3EOAI 2QMHA 5EVJA 4RA9A 4K4HA 1DKQA 2FLKA 1UJ4A 4EKGA 4C30A 10MHA 2HPVA 3DMYA 2PMZF 2ZBEA 1C4KA 1K3TA 2NUPA 2YFKA 1VKHA 4B3CA 4F3CA 3WGIA 1IY2A 1DC3A 5KWEA 2I4TA 1BWPA 3OJ0A 3U0VA 1GA1A 2BDUA 3QXJA 4GLJA 121PA 3NV7A 2Q0XA 1RKXA 4KVZA 4XIFA 4D42A 1D2AA 3A28A 1NXWA 2OE2A 3OESA 5EWJB 1P4GA 4JVMA 4DBZA 4RNNA 4YJFA 3VR6D 2VL7A 1XYGA 2BFFB 3STUA 2AJLI 3QH4A 3AM9A 1TIPA 2D0PB 2JD0A 2OAEA 3E9CA 3H4IA 4G9EA 4H35A 4OTZA 3T12A 5ADVA 4KRYA 1XO0A 2G82A 2HSWA 2PANA 4W63A 1RTKA 3HCCA 3QZ7A 3TQIA 3P0EA 1S2OA 2EDAA 8ICCA 3LHSA 4PM4A 4UOEA 4WBNB 1WRBA 3BE6A 4D0LB 4V1CA 1R5NA 3IV7A 1E2HA 4XAQA 3VSDA 2PY6A 3T9CA 4M87A 5KKNB 2Y1GA 3L4BC 2ZUFA 5BR1A 4PHCA 2NGRA 3QKWA 5JR3A 4UTZA 1TCVA 3BXPA 2J4CA 3I1JA 1NWHA 2HC9A 7MHTA 3KKAA 2IW3A 3IX7A 2PSEA 3THXA 1D1PA 3TTYA 3HUDA 1TYDE 2J5XA 1W4BA 4RH1A 1ZINA 5CR0A 1A8PA 2DPXA 1EXDA 4Z4EA 4C3OB 5IWAB 3SX4A 4HJRA 1WZEA 2QW0X 3D7SA 5E79U 4J9MA 3R3VA 3TLMA 4ITRC 3WLRA 5JU6A 1SOAA 2ZUEA 1DPFA 1LW7A 1C7QA 4BAZA 5JAUA 4LJ7A 1GU0A 4JQSA 5KYTA 3RADC 1PCXA 2I3GA 5A4IS 3R7WB 2PVCA 1X8XA 3LXXA 1Z08A 1H38A 2I2WA 1RBZA 1AF4A 4NBLA 4Y6PA 1NNEA 1DIGA 1FYWA 1X14A 3GV0A 4NSNA 2H16A 1OZFA 4HUTA 3RVOA 1YZVA 2WG0A 3PJGA 4PPYA 1V1RB 1YWGO 4WKGA 5BMVB 4ZEMA 4RM2A 2GHRA 1VOTA 5KOHA 1LDMA 4V3BA 4D0NA 1KJQA 3L93A 4XLLA 5LZ9A 4G85A 4W99A 1YA4A 3M82A 2CNKA 2J9YB 4NYIR 2EFDB 4GSKA 4PINA 5DLEA 3H5WA 4UC0A 1H2BA 2D8MA 1K75A 3QEOA 1YB2A 3G6VA 1GZ7A 3RUDA 3SYTA 1ZQRA 1XRMA 4N5LA 1NVVQ 2XR1A 3PQFA 4KN5A 3ZDZB 2XE8A 4QBKA 3W7AA 2QM7A 2ZSUA 1BXKA 3OQJA 1ZRHA 3TVTA 4ZEOA 2Z8XA 3OEEA 4L3WA 4F4ZA 2B21A 4U7GA 6CHYA 1U2GA 2HCBA 3HGQA 3IP6A 1QE3A 1R0YA 4K8RB 3AC0A 3W5UA 2N1BA 1ZWLA 3AJAA 4OGWA 3DYBA 3WRXC 3CP8A 3TBHA 1P1FA 1ZO8A 2CSUA 3HZHA 3O0DA 4KUHA 3BRQA 4YGYA 5FCDA 4ZICA 5CVJA 2CJYA 1E18A 1BDMA 1JT2A 3FWZA 5HCUA 4KNYA 3RRGA 4D9KA 2AMYA 3SS7X 2V98A 2QIPA 2AUTA 3URMA 2EL7A 4P92A 2FGKA 3E84A 2FW6A 3HG7A 5JVDB 3T0FA 4V1CB 4UHJA 3JZDA 1Z5GA 4O2LA 3BA6A 3RJTA 3ENNA 1XTPA 5FA6A<