4CF4A

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
223
structure length
222
Chain Sequence
GILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACHIWATIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 81
structure length 222
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4cf4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4cf4A01
2Q4RA 4G63A 3E84A 2ZBGA 1TE2A 5ALZA 5AHXA 4C4TA 2ZG6A 1RKUA 5AM2A 2RARA 3WKAA 3WK5A 3U7EB 3QLEA 4AS2A 4Y2UA 2IOFA 4BBJA 1Y8AA 4UU1A 1QYIA 3N5KA 3WKBA 3L1UA 3M9LA 2P11A 4QJBA 4ZEVA 1CQZA 5ALNA 1RLOA 4PNHA 2R8ZA 1QH9A 3MPOA 1XPJA 2AH5A 3W5BA 3PGLA 4OFZA 1L6RA 1ZRMA 5AVWA 5AKXA 2FPXA 3L8EA 1Z4IA 2P69A 4UU0A 3AR6A 5ALRA 2P9JA 3CZ4A 3AR8A 1RRCA 3RFUA 2OYCA 3B8EA 4UM7A 4I9FA 4UMVA 5AVTA 3ET4A 2BDUA 2NO4A 1TJ5A 2HO4A 4HGRA 3EF0A 2C4NA 4J2TA 5A3SA 5AKKA 4IG4A 4XPZA 3N28A 3UM9A 4ZEWA 1YS9A 3AR5A 5AKLA 1Q92A 4BKMA 2WF7A 2HSZA 4DCCA 1Z4KA 5ALGA 3L7YA 4IFTA 3K1ZA 2YJ5A 5ALTA 2IOFK 3AR3A 1RMTA 4XQ0A 4XOUA 4UM5A 2HCFA 3U26A 2GO7A 4NWIA 4BX3A 2G08A 2WFAA 2YFYA 2AUTA 3L0BA 4EEKA 3SKXA 5AW5A 3QU2A 4OHFA 4RESA 3U13A 2I54A 2WM8A 5AKYA 1LTQA 5AI4A 3ZUPA 1EK2A 3L0CA 3ZX4A 5AK4A 1LVHA 5ALKA 1EK1A 2YY6A 1L8LA 3FPBA 5AW4A 2B8EA 2G0AA 1U7OA 2FI1A 1KYTA 3ZU6A 4RETA 3A1EA 1ZJJA 3L0YA 1YNSA 2Q5EA 5E0OA 2YJ6A 2O9JA 3OCWA 1RPZA 5AI9A 3R4CA 3QUQA 3SD7A 3FPSA 3ZI4A 3MMZA 3EF1A 4UW9A 4H1WA 3OCVA 5IS2A 3FM9A 3U7FB 1O03A 5AW1A 5AK3A 5AM4A 5A3QA 4HGQA 1L7NA 3QYPA 3N07A 5AESA 3WK8A 4NAVA 4UAVA 4UAUA 5A3RA 3MC1A 5ALOA 5ALPA 1RMYA 2GHQA 3L1VA 1N9KA 4CF5A 2RB5A 4YGYA 3WKCA 2ZBFA 2YMPA 4HGOA 4FE3A 4DWOA 2MU1A 3UMBA 5FP0A 5AK6A 2FPWA 3I76A 1X42A 4I9GA 2FPUA 2X4DA 2ZXEA 2EATA 3FGOA 3I6BA 5AKEA 1L7OA 3A1DA 1NF2A 1YMQA 5AI6A 3E8MA 1Z4JA 1Z4MA 5AI8A 4KNWA 2YJ3A 1TA0A 1U02A 3IB6A 3U7GA 2B8JA 3QU4A 3NANA 2G80A 1WPGA 4Y2XA 4XE5A 2I6XA 2WF5A 1VJ5A 4C4SA 5AVYA 2JGAA 5ALMA 4UMFA 4YH1A 2I7DA 3ZVNA 5ALSA 2CFSA 2GFHA 3EWIA 3N1UA 4HGPA 4L6CA 3ZVMA 2Q4TA 4O8CA 3OCYA 2HOQA 3ET5A 5ALWA 1RKVA 2QLTA 5AKJA 1VJRA 2ZBEA 3SF0A 5ALUA 4EELA 3QU7A 2FUCA 1ZOLA 2FPRA 3F9RA 3HLTA 4UATA 2PR7A 1L8OA 1RMQA 2R8EA 3CNHA 5AW0A 3DAOA 3ZTWA 3FVVA 4B6JA 4G9BA 3A1CA 5AW3A 4F72A 1Z4OA 3NALA 3WK9A 2C88A 4HGNA 5ALEA 4EX7A 4KX3A 4KN8A 3SKYA 2YBDA 3QUCA 5T41A 2EARA 3SLRA 1WZCA 3PDWA 3L8GA 4GXTA 3PCTA 1ZD5A 3VAYA 1SU4A 1AQ6A 2OBBA 3RF6A 5AK5A 3N8GA 1N8NA 2ODAA 4BEVA 1RKQA 2WF6A 4AP9A 5AM3A 2B1RA 2PQ0A 5ALYA 4KX5A 2CFTA 4DW8A 3W5DA 2B1QA 3B9RA 4UASA 1Z4PX 5AVRA 2ZOSA 4BNDA 3I1YA 3DDHA 1L7PA 3ZTYA 4YIHA 3J7TA 1T9ZA 2W4MA 4MUMA 1F5SA 3E58A 4YCMA 3DV9A 5IT0A 1XP5A 3EPRA 5AM1A 4UMEA 3B9BA 2BY4A 2WF9A 3AR4A 3WGVA 4E88A 3R9KA 3ZWDA 2YN4A 3QNMA 3P96A 2FPSA 1U7PA 3L8FA 3NASA 3OCXA 3WKDA 2I33A 4QQFA 1YJ5A 1QQ6A 1ZD2P 3E81A 3KBBA 2C9MA 4Y2YA 2QYHA 3A3YA 2B0CA 3KC2A 4ZEXA 4EENA 2EAUA 1RQLA 2PKEA 3SHQA 4KYTA 4Y2SA 2HI0A 3FZQA 4FYPA 2R8XA 4Y2VA 3QX7A 2B82A 2JAWA 5AKIA 3NAMA 2BDEA 4BX0A 2VKQA 1TJ3A 4L6AA 1JUDA 2GHTA 1Z88A 4Y2RA 1Q91A 2NYVA 1RC8A 3M1YA 2G1AA 4FFDA 4BEWA 3BA6A 2AMYA 1SWVA 4YCLA 2HHLA 2B30A 5AI0A 1SWWA 3IRUA 2YMQA 3WKEA 2P27A 2OM6A 3QGMA 5ALLA 1VFPA 1Z4QA 4F71A 2WHEA 4BYGA 1Z5GA 3KOOA 3ESRA 4OCZA 5AVVA 5ALDA 2RAVA 1QQ5A 1RLMA 1K1EA 5AW9A 2G09A 3BWVA 2I34A 2DQSA 1FEZA 2FUEA 5AICA 1Z4LA 2G07A 5AW7A 1YDFA 2OA0A 4YCNA 2IOHA 4JB3A 5AKZA 3ONNA 4BNDB 4C4RA 3KZXA 5ALFA 1WVIA 5AKHA 2NO5A 4HAIA 5AM0A 3TLMA 2JARA 2GMWA 4Y2QA 3ZVLA 2HEGA 4Y2JA 1J8DA 2YMMA 4KNVA 3ESQA 3UMGA 4GIBA 1WR8A 2O2XA 1IWOA 5AIAA 5JJBA 3W5CA 4Y3UA 2W43A 4NFLA 5AW6A 2CN1A 2AGVA 1NNLA 1S2OA 3OPXA 1TJ4A 5IT4A 1RQNA 3AR2A 3QU9A 2JAOA 2HF7A 1Z5UA 4MWOA 2JAUA 3DNPA 3MN1A 2FEAA 2FDRA 5ALVA 5AVUA 4L57A 1ZRNA 3NIWA 2G06A 1T5SA 1YV9A 3OCZA 1NRWA 1MH9A 1U2TA 3S6JA 4HYTA 4AS3A 2ZBDA 3QUTA 4YIKA 1ZD4A 5AIBA 3QU5A 3UMCA 1S8OA 3WGUA 2C8LA 2WF8A 3OCUA 3ED5A 5ALJA 5AVXA 3QUBA 4OD0A 3SMVA 1U2SA 4CE6A 1ZD3A 3I28A 4EZEA 5AVSA 4CF3A 5AKGA 2HDOA 5AI5A 1RLTA 1CR6A 2CFRA 4CF4A 3ZX5A 4CNQA 1XVIA 2YMLA 3D6JA 5AVQA 5ALIA 2RBKA 2YJ4A 4Y2PA 4EX6A 5AM5A 3AR7A 2IA5A 2HX1A 3ZW7A 3W5AA 4UARA 1RDFA 1PW5A 3U19A 3KD3A 1O08A 2IYEA 2W11A 3PGVA 3GYGA 3NRJA 4BX2A 3AR9A 3U7HB 3IJ5A 4J03A 3HYCA 5ALXA 5ALQA 1Z4NA 2HF2A 2C8KA 3ZWKA 2D2VA 3WK7A 3R09A 3L5KA 3QXGA 1T5TA 3OTQA 4JDPA 3WK6A 4NV0A 1J97A 5AVZA 5ALHA 4NABA 4DFDA 1ZS9A 5AW2A 4UMDA 2I55A 2MSNA 3NUQA 3L8HA 4Y2TA 2MU2A 2R8YA 1QQ7A 1L7MA 5AW8A 3WK4A 3KDPA
chains in the Genus database with same CATH superfamily
3L7NA 1EVQA 2X3UA 1LLFA 3KKAA 1CEYA 4C6SA 1KS9A 2R25B 1VMKA 4NARA 1XU7A 5EHIA 4LSMA 2RP5A 3E0FA 2NTJA 4HP8A 4DA6A 1GUAA 2C78A 1F9AA 3KCNA 2H1LA 4RFSA 1D2NA 4P36A 2FZWA 2CMDA 2RGCA 3INNA 3X44A 4KXYA 3OIVA 3CUVA 4OXKA 3OPVA 2G40A 4J1NA 3RS7A 1U5BA 2FWAA 3GLUA 1EUCA 4L72A 4R2IA 3WGGA 2X3YA 1QYWA 2IE0A 3O92A 1ID1A 2H3HA 5KS2A 4TV9F 5AVKA 4KLUA 5H70A 2WF7A 1OI4A 1KO1A 5KFJA 4H6WA 4R5MA 2QX6A 3DEFA 4AC9A 4J0HA 4AMVA 4MMXB 1J5XA 4RPCA 2XIJA 4C4AA 3RJMA 4EEKA 721PA 1XZPA 1OMOA 1A8QA 1LBSA 3BMCA 4WNYA 5BN3A 3WC4A 5HQ3A 5AD1A 1Y33E 4RK7A 4RZUA 3MQFA 5FAXA 4XSGA 3OI7A 4IQFA 2REXB 4IIGA 4C3UA 1TC2A 3TS1A 2IW3A 1VE7A 4Q01A 2ZUTA 5J23A 2C2DA 8ICVA 1SCUB 4I46A 4YRGA 3AM1A 1T2NA 1BHSA 5G0VA 3GCZA 1MB9A 1RFLA 1F4VA 3B2QA 1QHXA 2ZKLA 1T2DA 2IZ0A 4KLOA 2VUSA 3OPYB 4JC0A 1UJMA 4ZODA 2XUIA 4LZWA 4IJUA 2O2ZA 3DF9A 3JR3A 3BJRA 3D7KA 2IU3A 4J9SA 1RWOA 1FC0A 1GZHB 3F2BA 1ZXIA 4XDZA 5CFOA 5C5DA 5KFWA 3STHA 4KO8A 1F51E 1JJVA 3CZRA 3LX4A 3EUAA 5IAOA 3BA1A 4YHHB 2XB6A 4OXYA 4DBLC 4HNQA 4NC9A 4BQPA 3KSMA 3I6QA 1KH3A 3SKYA 1Q7CA 2OWDA 3SLRA 1WPRA 1NXSA 2BMEA 4AJ9A 2QI9C 3RF6A 3P0HA 2X77A 4V1CB 2VANA 1CVIA 1JQEA 2ZOSA 4RFSB 3QE9Y 2ALZA 2XTZA 4E14A 2ZB4A 2IK8A 3JQAA 3I2YX 2OCAA 1UFOA 3UK6A 3DE1X 3V7YA 5J2BA 1EUCB 5FA6A 4CV1A 2WWIA 4KVFA 2K5UA 5IJAA 3TPFA 2HI0A 1QAQA 3HFRA 3ZWAA 3V32A 2QG6A 3WFIA 1DT5A 5HR6A 4Z6DA 4LNAA 1AK2A 4WK0B 4YMSA 2DC1A 3ILXA 4BMYA 1SU7A 5JDIC 1E7RA 3RM3A 1P2DA 5HDQA 3U9LA 4MRAA 4B4DA 1Q74A 4MUJA 4N49A 5GM1A 2FLWA 4K88A 5SZKB 3A58B 2J4DA 4QYWA 1JA9A 3AL3A 4LF8B 3G85A 1KGDA 1WVMA 4G01B 4QEDA 1EJ0A 4FGWA 5BN3B 2QTRA 5HQ3B 3HY3A 1XRPA 3JVEA 4X8LA 3RTBA 1E2LA 3KU4A 1QP8A 3DNPA 2RHHA 4M0AA 4JFRA 4Y6GB 1A8UA 4C1NA 5DIZA 3CKYA 1U2TA 1YC5A 2FMQA 4IV8A 4YIKA 1H6BA 2ZSEA 3DEJA 3IESA 3SMVA 1CDDA 2XCAA 3TB4A 4LVCA 4PZUA 2C2HA 3W9YA 4WKNA 4Q39A 3WLIA 1VKHA 1FVXA 4DCVA 2ZYIA 4I2JA 2NU8A 4TXNA 5DASA 3FUCA 4QJ3A 4URVR 1I0ZA 3S68A 2OC9A 1Y7PA 4B7XA 4IGAA 3ZGNA 4FX2A 2O8NA 5HILA 3AJAA 1BWSA 1P62B 3BTUA 3ZPXA 1T1GA 2FRVA 4QYIB 4M1QA 1EKXA 3RJZA 4Q45A 5HZHA 1U8EA 3ZDBA 1GKYA 1NN5A 2LDXA 5SY9A 1Y89A 1L7AA 4QSHA 5JMTA 4CM8A 2VPQA 4UU1A 2GSWA 3HZOA 4MS4A 2YVQA 3P2KA 5JJKA 3EZ7A 3H2JA 4Q9LA 3JQAB 1QSSA 1NI3A 3A32A 2D6FA 1WZ2A 2AH5A 1WMSA 1IUPA 1LI4A 2PFQA 2XDWA 4KJZA 1R9JA 3IBYA 1F8FA 3C48A 3C5FA 5LZ2A 1AIPA 2IY9A 4I55A 4WADA 4Y6PA 4UM7A 5CVUA 4IRXA 3UAOA 1S1CA 3K15A 4J49A 2FEMA 2XBLA 4DLRA 1YS9A 4KLFA 3O8BA 4EA9A 4WEOA 4I4CA 3P7MA 4HNAA 9ICJA 5F9HA 3AETB 1KVUA 4DV4B 5HG0A 2QLJA 3OOEA 1W5BA 3RC3A 1K7YA 2WFLB 4IHQA 4PZEA 9ICSA 1JLKA 1KKUA 1T8TA 4HFMA 1RRGA 2R8GA 3HUDA 4QASA 3D02A 1UPHA 4AZWA 4MW1A 4E7PA 3TACB 2CVPA 3UMVA 3IR5A 4UHCA 4ADSG 3DPSA 2FMIA 5JQWA 2JIBA 5JCOC 1TCUA 1P18A 4WBSA 1AQLA 1VBMA 5IILA 2WLTA 2WE7A 1GNVA 4E5UA 1H23A 3A6FA 4MH0R 3AUYA 5HA5A 2GN6A 2R5WA 1GP2A 4F7WA 5JZMA 4U9UA 2VK4A 2D5CA 5CRXA 1MC4A 4NRDA 1YR1A 3VOTA 3K2BA 4JYZA 4AICA 4G0OA 3DDCA 1HRKA 4L6CA 1W4CA 4I0WB 3ZNQA 3PHGA 4CL0A 2AGPA 2H17A 1QHGA 3F5QA 3QVJA 1NDHA 2R8EA 2ZBRA 4TXMA 2QENA 3JQ9C 3RUFA 3NTLA 4NMLA 2IWRA 5KKCA 3E9EA 2V6IA 5A9SA 4MHOA 2QV7A 2I2FA 3JWGA 1V96A 1VIDA 3KSRA 2XT0A 1Y6RA 4KQ1A 1LQUA 2GBFA 4X7MA 1PGNA 3PHBE 4FHDA 4OGLA 5A0LA 3ETGA 3N8IA 4JJZA 2X0IA 1OAOC 2FX3A 3IDAA 3TAXA 4Y98A 3PVXA 4I55B 2DLNA 3OZEA 1Y3DE 3NP9A 2JB9A 1OWNA 2XICA 2DPLA 2BCSA 3CN7A 3UH0A 3N2KA 3K0BA 3UW1A 2G9QA 2XIQA 3RF9A 4AG6A 3BK1A 2CNKA 1EB9A 4ZOEA 1UBKS 5A62A 1QIFA 2PT7A 3OM0A 2WD7A 2FX5A 4NG5A 4YRZA 4I8XA 3I4FA 2WWTA 4M1MA 1A5ZA 2FE1A 1NK9A 4QELA 5JPDA 1FXUA 4BECA 2JI7A 3SEQA 5CB4A 2P41A 1XHFA 2XE4A 3EWNA 3W6OA 1OH6A 4K9PA 3CX4A 3VZPA 2D54A 1PFKA 4K2HA 4N48A 1JT2A 1ZQSA 2INGX 1NNLA 2OAGA 2GK4A 4IIBA 5A4AA 7ADHA 1KLNA 4ZZIA 2YWCA 2GM3A 4QU9A 3ABOB 5E3HA 3M34A 1XRRA 1XCOA 2IBKA 2RGXA 2OK7A 3CLTC 3FCSB 1GRNA 4F2WA 4HXFB 4IJWA 4WOBA 3G0DA 5CM8B 5C5CA 4X85A 1H6AA 1KQGA 4GVLA 2MYNA 3G2LA 5K3DA 1DQPA 1G66A 3WJAA 1V85A 3QVKA 2C58A 2RAPA 5L4NA 1L5KA 3GNSA 1Z16A 3N0RA 5ENDA 5KYUA 2W4QA 1TO2E 1OSNA 3NTQA 3ZCSA 3HDQA 3HYCA 1GUYA 4RXMA 2P5TB 2IV3A 3DDSA 4EF5A 4ATNA 3BCHA 4D3FA 4EY5A 1TB4A 5DQHA 9ICUA 1CTQA 1NU8A 4B4OA 1YDWA 5B2ZA 4MKZA 1DCKA 3S8YA 5A9SB 3AHJA 3GEIA 4EJ2A 2IVZA 5ECGC 5KB3A 4C3VA 4TN1A 2IS4A 2IEZA 2JDID 3KFXA 2JH8A 4UVGA 1KZ9A 2IOFA 4FKBA 1A9QA 3V1YA 1CQZA 5DHQA 5F2OA 2H92A 1ZQVA 4YAWA 4O33A 4XQCA 1P2FA 1E89A 4AAYA 3FR7A 1LLDA 1EEHA 1PCXA 3O8CA 4AZTA 2TMKA 3LGAA 4X60A 3CKMA 3OSZA 4OU5A 3N2KB 2KNJA 1F0YA 4D9IA 4UTPA 4K9RA 1EK0A 5EZQA 2GZSA 4O5AA 4EYEA 3Q7QA 4PL2A 3S3TA 3EJ6A 5JRZA 4YWHA 4OQYA 1OJLA 1MJ5A 4ICIA 4NXNB 3HT3A 1TZCA 3CFYA 3EMKA 3QBJA 4LJ9A 2HJSA 1DAPA 4K0RA 1LVUA 3HGQA 4M9XA 4EABA 4C05A 5DP1A 3KQNA 1WWUA 5C8YF 8ICEA 3KE9A 2VJQA 3OG9A 3K8OE 3TUJC 3WMWA 2XVMA 3OU6A 5BNTA 2H0QA 4IDQA 1ZKMA 4MVYA 2HXSA 3ZVRA 2XB4A 4C0ZA 3A9SA 1ZITA 2IQIA 1PFVA 3BE6A 1C4OA 4F8JA 3ER8A 1KTVA 3MUEA 3IXLA 2Q3MA 3EB9A 4BNXA 4YPFA 2G9UA 2XXBA 3ACDA 4RJIA 5BOSA 4MQ5A 5CYOA 3CVYA 4J16A 4G4JA 4LSZA 3PC6A 5E1MA 3LC7O 3BS4A 2JKVA 4WNIA 5K0GA 1SXHA 3BMXA 3P27A 1RMQA 2IEGA 4AB1A 2YIDA 5BN5B 5TDHA 3EOZA 3A3OA 2BUAA 3BMOA 3GRVA 1SMKA 2QRHA 2VAVA 5IZ4A 1XSPA 5ULLA 3OQPA 5BSWA 4DOBA 5FBLB 5K6AC 4BP9A 2TYSB 1IBKB 3IOEA 1KNQA 1KDOA 1F5SA 3DV9A 4U5XA 3U16A 2CUKA 1WDMA 2KJ9A 3NASA 4GECA 5DHPA 4N8DA 5HTKA 5TPWA 3VNQA 3PR4A 2WYWA 4FYPA 4J0CA 3KUCA 3BF7A 3JYPA 3E7PA 3LLMA 4ENPA 2C4TA 2AZTA 5DT2A 4QZ9A 3IDWA 1VA4A 4C8NA 4BN4A 2FWMX 2P5UA 3SNKA 2QT0A 1RPAA 3LH5A 1KKLA 2QYTA 1NK4A 2FUEA 3C39A 1PVDA 4JB3A 2OCXA 1YQUA 4OHOA 1JQBA 3ZEIA 1A98A 1X3LA 3KHSA 2P6NA 4PLFA 2ZT5A 3UV7A 3JRXA 1M72A 3KPVA 3PEFA 1R6AA 4ZO6A 4WLUA 3I9OA 5HWSA 4QPCA 4XEHA 4QLBA 2XB9A 1NM5C 2XPCA 1DUIA 2NUPA 4L57A 3R7WA 5JDCC 4DMKA 3MWLA 4BQRA 1HY3A 1QTQA 2WAOA 1BU5A 4GI2A 3MBOA 4R8LA 5K0EA 3HJCA 5T64A 3AVQA 2YRWA 1NSTA 4AWBA 1U90A 1GT91 2VYVA 4YT8A 1E92A 1VBFA 1N34B 1JI7A 2Y2VA 4LCJA 2Q6TA 3H1GA 4MCAA 1KRWA 3KT3A 1U2RA 1L7EA 2G9RA 3K2QA 1TYBE 1Z5ZA 1S76D 1I51A 4JODA 2C7PA 4BNGA 8ICJA 3OETA 2JIOA 2C2YA 2D2VA 1K3FA 2QM3A 5BSVA 1NBEA 3BMOB 5KTPA 3ZGZA 4B9MA 3ROKA 5ED4A 4IDGA 3LZ6A 4X1KB 3NUQA 4I4TF 4PXAA 1WD7A 2R5FA 1KEWA 5DPMA 4GXNA 4IPTA 1KP9A 3VNUA 1VTKA 3WHPA 1JSZA 3T0FA 3WKBA 2AUNA 1PZHA 1AUVA 1X9GA 1EX6A 3V7JA 1OHHD 4I50F 3THYA 4Y6OA 3UHOA 1AUPA 3OUZA 1TAQA 3KJZA 1WMAA 4CDNA 4RDHA 5DNVA 4IWNA 3RPEA 3U44A 3EMVA 3PXDA 1YCGA 3ET4A 2F8SA 1NR7A 3TLYA 2B7LA 4Z9YA 3LCRA 1ZVVA 1RZUA 5DB4A 2H5EA 1CZUA 2KMLA 1U80A 4X66B 3K30A 2ODBA 3CLKA 3C1UA 4DABA 3O1LA 4MRPA 1W88A 2R1UA 5K7SA 3C4VA 1SVKA 3FGZA 4RE6A 1JHXA 4OHUA 5HBRA 4OJOA 1CQIA 4OHMA 2LR0A 4AMBA 1QBGA 2G5PA 3O21A 4K9LA 3LUKA 5ECYA 5I9TA 1RLIA 4NYIR 4R69A 4YJHB 3JW8A 3WNBA 4YMUA 1E98A 2ZAGA 1XNJA 3IMCA 4PG8A 2F9FA 1E3MA 4LI0A 4G5FA 4LTNA 1R6UA 6GPBA 3I83A 1D03A 3F7TA 4YCAA 2OVFA 7YASA 1I7PA 1ZUHA 1KXJA 2YVUA 3ASYA 3AKDA 1JLSA 1BMQA 4CKEA 1GR0A 2DH5A 5GY7A 3NKLA 4C6HA 5F64A 4PX2A 3RBDA 4D9BA 4WLOA 4R1OA 3RVKA 4F04A 4RGBA 2G8LA 1G21A 4O63O 4RTOA 3KFUF 1ZL0A 3UMMA 4RV9A 2VPZA 1ANKA 2WDZA 4QFBA 1HURA 3QLUA 3EWIA 4R9UC 2ID4A 2PPVA 2R6ZA 5EESA 1V1JA 1T3GA 5CB8A 2OXOA 2QMQA 4RK0A 1BMFD 6REQB 3TAUA 5FEMA 1T15A 2WU1A 3DXXA 4CR8A 4TTVA 3O91A 4RTJA 4XUCA 3EGCA 4ECZA 1O2DA 5HKKD 1YR6A 3IE1A 4E2WA 4Q7EA 5LYJF 2XNDD 2FKNA 4NOKA 3OBIA 2O5EA 4ER3A 4XW2A 2ERYA 3SJBA 4MJ7A 2HA2A 3DKRA 1NP6A 3LP5A 1OZAA 5KX5A 2J6BA 2HPHA 3TVDA 3SLKA 2ZE6A 3THYB 3BXEA 1EBBA 1OFGA 3L8MA 4TVOA 1KFDA 1NQTA 5KPDA 1Z25A 1G0NA 3BTOA 3USZA 1C80A 2PCJA 4CHTA 5M2QA 4YMIA 1FMTA 1PZGA 1I30A 3QEMB 2WPDD 3PRHA 3C6BA 2XO7A 1E60A 4O2AA 1KEJA 3EA4A 3NBAA 4AFNA 2Q50A 4CM5A 1KQ3A 1JP7A 2X1VA 2EAOA 1E1QD 1W88B 2Y05A 3UJNA 3HN6A 4D9FA 4CQNA 1KI9A 1NV9A 2C9ZA 2PQMA 5ICSA 1V25A 3B0XA 1CQIB 1PS8A 1N5WA 2GM9A 5K0TA 2HMWA 3T1QA 3C3CA 1BDIA 3HBJA 4MW9A 5EFOA 3E4CA 1DOAA 1D1QA 3Q3IA 2WV9A 1L1FA 3VO1A 1E1KA 2GK3A 4EW6A 1SHUX 5INTA 3NWEA 4WCVA 3O4RA 4Q00A 1E61A 4RQ7A 4E13A 1BS9A 2WQZA 5MN4A 4MX8A 2TMGA 4PNPA 4EBCA 1JAYA 5LMUB 3E0XA 3EGXB 4KGXA 1I10A 4DC1A 4EZEA 5DV9A 3RR2A 3V8QA 4GOJA 2VIXA 3RSZA 1HKHA 3AY6A 3HY6A 4G3IA 3JY6A 4BE7B 1U1CA 2HX1A 3OX4A 3UGTA 2HCJB 1KZ7B 5KFOA 4MYSA 1KL7A 3ORRA 4UUPA 5COBA 4DEZA 4GSLA 3PSTA 4UE2A 3V4FA 1PSDA 3SX2A 2UZ0A 4DIUA 3OP4A 3BZBA 4MFFA 4IGKA 4J0IA 2NXJA 1QGED 2O2DA 2X9LA 1N9GA 5F4BA 2RGEA 4F2HA 1KBZA 2YJNA 1KFSA 3GLIA 2IS1A 2H9IA 3EN0A 2LYHA 4QJBA 1NQVA 3SHVA 2A92A 5FOWA 4MW0A 3UCFA 1SBZA 1U31A 3RRNA 5H80A 1VGVA 2O50A 2AOWA 1MC8A 4EYIB 2Y1LA 2V59A 4CGYA 9ICEA 2WIDA 1OB2A 1R8XA 3UB4A 2GD0A 3QHQA 4XD7A 5AKKA 2NMVA 2O3TA 4O2AB 5ALTA 3AJ8A 3TFWA 2DJIA 1UKAA 2R97A 1FLAA 3ONEA 4BP3A 4BB6A 1A0PA 1BC5A 1HXHA 2DFPA 3RTGA 3TD6A 5TT0A 3GRAA 4YS6A 3U0VA 2YXDA 4D8WA 1OU4A 2FDXA 3GOQA 2VJYA 4LOJA 5ENZA 3ZS8A 2Y2UA 1N0HA 2XVZA 1ZQDA 1XRQA 1ACLA 3SENA 5DHAA 2LI6A 3FM9A 3E18A 2QNBA 3MGKA 2V4QA 1QUEA 1GR1A 4MW4A 4U3JA 3N07A 1E63A 2PU7A 4CM9D 3H1EA 4A73A 4WTOA 4L7QA 1YCHA 3DD5A 3ETJA 4H1UA 1UKBA 2C4UA 4DC9A 4AZ0A 1ZNQO 4MQUA 1EFKA 3A1DA 3J7AC 5J2UF 3WB2A 1MQAA 1B2LA 3WJ2A 4RT3A 3ISDA 3MTGA 3LBYA 1R5NA 1O6GA 3ZWBA 3ROEA 3W8NA 2FSUA 4ND8B 1VL0A 1L7QA 4MVCA 3R7DA 4AULA 1C9YA 3SR4A 1UEXC 3QX9A 1PUZA 3TRJA 4XLZA 1C9EA 4F72A 2J87A 4KQMA 3NOQA 4DQSA 1N9GB 1MAUA 3PKIA 2ZIZA 1AQ6A 3GLIB 3IUMA 1WWKA 3TZEA 1U8CB 3ZE8A 3LFHA 3WYEA 1H38A 1LPSA 1NK0A 1HLFA 1UPTA 3ZLBA 4BAZA 3N2IA 4HATA 1J49A 5HCUA 3R3YA 4KE7A 4F3TA 2QX8A 1RW4A 3TOXA 3LTEA 3IHKA 2G4CA 1GCAA 5FI1B 1Y5NA 4BWVA 2YV2A 3NX4A 3LQKA 3I61A 5J0RA 4IOJA 4QOJA 3LTNC 4MWSA 3GPCA 1JE1A 3V7FA 3OKAA 5LQUA 2DTXA 3CCBA 2XKKA 3R6LA 4D96A 1JBQA 4PGAA 1YAJA 2Y3IA 5LNK6 3NJ8A 3JPYA 4EITA 2DE0X 4RHYA 4FBMA 8ICRA 1IB0A 3WKEA 3T1NA 4F86A 1IY2A 2OBMA 4OJNA 1T3LA 1FJHA 4GFDA 2WMDA 1VE9A 1SBQA 3AUXA 1ILWA 1IG3A 2VJBA 5EKSA 3V9AA 2B61A 3IUQA 5CGZA 5HOQA 2F55A 5JW6A 3LQ4A 4N3NA 3C45A 2E89A 3M6IA 4EPXA 2HW3A 4K6MA 4DDTA 1EM8A 2VRBA 4OXIA 2DOKA 4PZNA 4QYSA 3OZXA 5BOMA 1HDYA 2BISA 5EWGA 4OHWA 5IXJA 4JEMA 3DUWA 3FCUB 4YRCA 1Y1QA 2WKSA 4CEJB 2AJLI 1PJ2A 1QDLB 2Y1FA 1MUUA 1QRSA 4NYJR 1IWPB 2WJIA 4GPIB 3D8RA 5BR1A 5B2FA 4Z4GA 5BQPA 2JI9A 3M6WA 3UTDA 2MYPA 4MAAA 5CDUA 2X42A 2D8MA 1P9LA 3UK1A 3ZD7A 1NDUA 4WKPA 4PC7A 4LSWA 4OB6A 3AQFA 1X7YB 1QZZA 1AKTA 3R0ZA 2H9YA 4MF8A 1NR5A 3PQDA 3CCCA 4JVMA 4MUXA 3SC2A 3EFHA 2NXNA 4ZVUA 3H40A 3PU6A 3ZHYA 1GAJA 5KREA 1WXFA 4CG0A 1XZHA 4B73A 4Q7JB 1X8JA 1V1RA 3L1UA 1SCDA 1JA1A 2ZB8A 1GAXA 1QH9A 2TMYA 2ASEA 2R66A 4U0KA 4J9MA 4NK5A 2RAFA 3FTDA 4NE2A 3ICWA 1U2QA 4JJ8A 3LZCA 2EF0A 3ILHA 2X8WA 3V2UA 4E5MA 2KG5A 2FGKA 2ZYDA 1V4VA 4OMDA 4L08A 4QGFA 3NV7A 5A6SA 3PI7A 4OGWA 4KOAA 3C2LA 1PFGA 2P2LA 2ZJBA 4MEBA 3ZCVA 1A0OA 1Y81A 2CCJA 3L41A 2ZTVA 2A4KA 1LTQA 3ZUPA 4JBLA 1IIPA 4BQOA 1OFHA 1DTSA 3JVVA 4FZ3A 2PWBA 2ZDGA 1ZRSA 3CRXA 4FZ5A 4JBXA 4M9SA 2C5EA 5L3VA 1PT6A 1EDBA 3H18A 3E9CA 3SVLA 5L51A 4MGIR 3BQNB 1XA3A 3SSAA 3D7LA 3K6SA 3VBEA 5EKTA 4UREA 3PSFA 2QA5A 4UEQA 1F3OA 4X92A 3AKZA 3COVA 3R8FA 1W96A 2PGJA 1HDXA 1GYQA 1HX7A 4IWXA 1X1SA 2LTAA 2ZWPA 3BB1A 1IPHA 5ALUA 4M37A 2B4YA 5KFTA 2ZRAA 5BR7A 4JV1A 4JN6B 4MDFA 2GEUA 3U17A 2DF4B 2PXXA 1RABA 3NALA 8ICIA 3KB2A 4A03A 3WNDA 2B4KA 2BTQA 2WG0A 5E6RA 4HYKA 5DK4A 1MV5A 1EFTA 2ATLA 2QDKA 4MB2A 1TV9A 4G4SP 1V1RB 2X2OA 1KRXA 1IZ8A 3FNFA 1U7TA 5J2GA 4OK3A 1PF7E 1TECE 2IDMA 3ICXA 1NW3A 3DW3X 3PUVA 2G67A 5CPFA 1A7JA 3RAFC 3U56A 1G20E 4KAFA 4J3JA 2PFPA 5FB3A 3EPHA 5HMLA 3AVPA 3C43A 2JZCA 5A6SB 4MW5A 1QFYA 4LRWA 1DP4A 1NBAA 3IKJA 4JSRA 3TAHA 2W2LD 4WACA 1RM0A 3GT0A 1NAIA 3BREA 1OLXA 1CK4A 4W82A 3JVIA 5AVVA 1OXBB 2DBVO 2XOKD 1FRNA 4UEOA 3VH3A 2JKZA 2WAMA 3RH5A 5LQAA 3C70A 4PW0A 2NO5A 2P9FA 1EVJA 4M9JA 1Q21A 3BS5B 3I9JA 1L9KA 3PDIA 1U0FA 2LYAA 3FYUB 5JQGF 3MT9A 3PIDA 3VJRA 3MN1A 1SQGA 4JWTA 4HLCA 3KYDB 4I5EA 1NDQA 3W0LB 4RU1A 1S8NA 5KC8A 3KT8A 1U63A 1L5MA 4U00A 1BHQ1 2C20A 1AURA 5SZJA 5EP4A 4RGVA 4IXMA 4ZVVA 4DLGA 3TNLA 2QRGA 4OJKA 3T5PA 4IVNA 2P0YA 1NYTA 3BM5A 3E3MA 4WZBE 3P26A 1E3WA 4URYR 4W99A 5BYKA 4EPWA 5CA0B 1FMJA 3RRJA 4DSOA 2XYHA 2DWCA 1ZQKA 5K8UA 4NLZA 4WPGA 1ZC3A 3WLMA 3G2KA 2BTQB 2CHEA 4YVFA 5E6RB 3HU3A 4JL6A 2GPNA 1JT9A 3BHNA 1E7QA 1N7JA 3WRXA 4K9DA 1N3IA 4DM4A 1NVWQ 1QGOA 1R6DA 4CIVA 1SIWA 4RMHA 7ICSA 4IDAA 2Y4NA 4AJJA 4Z1OA 3WNZA 1QS0A 5LPNA 4X20B 5JS8A 5HBGA 3H16A 3WNQA 1TTTA 1HSZA 3LYAA 4KR3A 2XE7A 5JNWA 1DAOA 2FJUA 1AZLA 4I1YA 3KR0A 2WHQA 1CQXA 3CZ9A 3NG1A 3RVRA 1O0BA 1WO8A 4B79A 1U9IA 3BD7A 2JIMA 5AUQA 1NF3A 3CVUA 2RG1A 3WVNA 1WEKA 1OLXB 2G76A 3F5MA 2K89A 1JA0A 1SXQA 2NGRA 4JBIA 2XZDA 3LHKA 3SJAA 1EWTA 5K3EA 4E2XA 1H2XA 2C4WA 1VOTA 3EVEA 4FZMA 1GNRA 2BMJA 4DCPA 1DUVG 1DMSA 1HE2A 2A86A 3K9WA 1PD1A 2EQAA 1SXJD 1JVSA 1E2JA 5KCZA 2AR7A 4XARA 2A0WA 1V3QE 3PDIB 1AXRA 3H5IA 1ZQFA 4LHZA 4NCKA 3MD9A 1S3IA 1A82A 2BTEA 3RVQA 2F4NA 2ZSDA 4G3XA 3LPLA 2LKCA 1JR3D 4C76A 4HNVA 1ZUWA 3MXOA 1GTRA 3ENZA 2CDAA 3GRYA 2CPRA 5I7OA 2PUAA 1ZNWA 4Z99A 4YDHB 1KVTA 5CW1A 3KBOA 3J80A 3TBFA 7REQB 1GQYA 2PVPA 1UFVA 1GN9A 3N53A 3PGMA 9ICWA 1XHEA 1TVKB 3KT0A 3BRWA 4PF1A 4EG3A 4JEHA 1W4ZA 3DNFA 4AMZA 3DR5A 2F59A 4UATA 4AD8A 2CLIB 2E5WA 4R8VA 4JLSA 4RF5A 5E3JA 3FVVA 2HA7A 4L74A 5KTQA 5CX1A 4HDSB 2X4LA 3FZNA 2IY8A 1XDDA 1Z12A 1KFKB 5C81A 1VLZA 5JALA 2EHJA 4DN6A 2OT3B 3UPQA 4N8SA 1R18A 5A3JA 1V7CA 3N7TA 2ZULA 2QW1A 2Z09A 4XWYA 2WB1C 5IEBA 1T1EA 4TWZA 1LKYA 2MHCA 1YVDA 4L4XA 3OA2A 4S0ZA 2PZBA 4UHHA 1MEJA 2CNNA 1Z5NA 3GP3A 2PUDA 2HCRA 4J1SA 3PZPA 3TAQA 2BGKA 5EGSA 4FD3A 4DOMA 2Y0SF 3N8NA 1MVOA 2VJNA 2WMYA 1T3ZA 4PQFA 5ENVA 4JX8A 1M2JA 4DCJA 2IIPA 4XFKA 3ESDA 1EG7A 4EG4A 4R1LA 5IH3A 1N2CB 3FWYA 3JARA 2FDCA 2Z6UA 3G5AA 3WRVA 4KVZA 5FT9A 5TNXA 3BRCA 2VQ3A 2VYNA 3QKSB 2R44A 3LY8A 2C2ZA 4IIHA 3PFCA 1NK6A 4KLEA 1WUYA 2E4XA 1QSYA 3AF2A 2G77B 3VPBA 1ZCJA 3ZGXA 3AONB 3NONA 2VDQB 4MNTA 3M6XA 4R2XA 2G4VA 2PQ2A 1O0CA 4I99A 1UOQA 1RD4A 3C3JA 3L79A 4XVQA 3QUAA 5EYPA 4JI1B 4KR6A 2HF7A 3Q6MA 1E0KA 1VG9B 4ETMA 3DE7X 4IDHA 4ARSA 3QRWA 4D1YA 2AOVA 4LJ7A 5KNCD 2YJTD 2O1XA 3SBXA 1U28C 1GZ4A 2Q3LA 1KZYC 2WWGA 3VPHA 1SHLA 1S2IA 4MPJA 3THXA 1FX1A 3HA3A 4Q3LA 2ZTLA 4R2HA 5J2FA 3OFSA 1YSCA 4EHAA 1U47A 4K6GA 4UOZA 3I92A 5FBKA 1OV6A 4ZO9A 5F23A 3K2IA 3L46A 1RXUA 3JQDA 3PPIA 1TX4B 3TOVA 3ORSA 4P34A 2IYYA 1DPGA 1K3UB 4HY3A 3CG0A 5KFXA 2KVSA 3WB1A 2O2CA 3PNMA 3FLEA 3NIFB 5DSZA 5A4JA 5L1LA 3BVPA 2X4IA 3QLTA 3O8QA 2JZOA 5G0UA 1NPTO 2FAXA 4HL6A 1M83A 4XWWA 3UO8B 1KEPA 3G0GA 2GUGA 4X95A 4O9MA 1RYEA 3OJCA 4CQLB 3P9XA 3LHDA 3AUJB 2EIXA 4EUKA 3OQMA 4Y2UA 2PXHA 5TMPA 2CVQA 3AT1A 3QW4B 2C3OA 1VZ2A 5CEEA 4FN5A 3OIYA 1LKYB 4D8YA 3STYA 1OXKB 3DWEX 1J5EB 2E7ZA 3KOUA 1KSFX 1ZMOA 4N8EA 5IWAB 1YL5A 4BVBA 1ZM7A 3IOBA 3UG6A 2HO4A 4EYQA 3X1ZA 1IXYA 3ZZUA 4CDGA 4RQ1A 2ODWA 3ABSB 3QLVA 3TDMA 2R7AA 4H7DA 3CB2A 4C20A 2LWIA 5HQJA 3MRXA 2MSKA 3DP9A 1FMCA 1B1CA 3P19A 1DTWB 3OPYI 2XVTA 5EUCA 3VSAA 2GO7A 3TYXA 4GMGA 3ZE7A 4O08A 4F84A 2NADA 3ZHXA 4IIJA 5KYNA 3L0CA 2Y71A 2PX3A 5T8KC 1X1TA 2YY6A 4P4SA 2F1KA 3JRWA 2WYHA 3Q3VA 2NZYA 3WLLA 5HHTA 1Q17A 1IM4A 3MMPA 4KRYA 1YZ7A 4F4XA 2ERCA 2QT9A 3SD7A 4YG2A 1U5BB 1B00A 5KSWB 1IUOA 3OPQA 2P62A 4OQXA 2BP7A 1LV7A 2ZWVA 2GTHA 2Z43A 5D1HA 3S2FA 1K6XA 1L5RA 2DVMA 2W55A 1Q0HA 1LZLA 2VPIA 3OZ7A 1Q15A 4RPKA 1TK8A 3DTVD 3KKNA 4C87A 4J9RA 3WLHA 4I1SA 2V6MA 1S2LA 2XNSA 4G85A 4V1CI 1U99A 4RC9A 1JECA 2BKAA 3GIJA 2LPMA 3A3PA 4X1IA 3O0FA 1SHTX 5K4AA 4ZCTA 4PPYA 1RP7A 2YJ3A 1S4MA 1W35A 3CZMA 3PTLA 3EQ6A 3EDCA 1QKJA 4FBTA 5FXMA 3ANSA 3UAGA 4IHJF 3M5WA 1GNPA 4PJ0U 3BMCB 5HW0A 1MTZA 1K8ZB 3T7JA 3SXUA 5EMLA 3N1UA 3ZVMA 3AU9A 2G36A 2CDRA 4P9NA 4B3TB 3W4KA 4F4WA 2NACA 1I6LA 2XKAA 1D1TA 3VZQA 5IULC 5DWDA 4JOSA 4DVJA 3UMSA 3OEEA 4FR5A 1X80A 1GL3A 3O8QB 4RMNA 1NASA 5KG3A 2RI1A 4JMPA 2PGXA 4QHYA 2RC5A 1CUKA 4MWGA 3AF4A 4QOHA 1RZ3A 3Q8SB 2CXXA 1RYHA 4XH9B 3MCAA 1EX9A 3L02A 4YALA 2MSEB 1ZSNA 2P9TA 1MJGM 5E4JA 2AFHA 1E2HA 1P5HA 3M9MB 4RVFA 1ZI8A 2JLYA 1D6NA 3JATA 2CXNA 2IZ6A 3TH5A 1JEEA 1H1TA 1RZRA 3GRPA 1W59A 3B6JA 2Q0SA 2BTOA 4L07A 4F50A 1UMBA 2RIPA 3FYSA 4TZ0A 5LLSA 4NS4A 4Q3NA 4E3WA 1V1MA 3RB0A 2VHCA 5CURA 1NUUA 1U9ZA 3HGTA 1UJ2A 2VA2A 4X7BA 4UUOA 5JXGA 3HVUA 1YR9A 4MKXA 4ILKA 5EIOA 1H1LA 3EDYA 4RXUA 1JMYA 4UKDA 5I01A 4KQ2A 3NBXX 4P4MA 3HDYA 4QTXA 2BL4A 1XAHA 3LIIA 2AS0A 4K0KB 1JROA 8ICOA 4I66A 5H59A 4XYBA 1FS5A 2BP7B 1O89A 2PD4A 4CJXA 3CF6R 2FKAA 1ST3A 3KB1A 1DLJA 2N75A 1KP3A 3PNQA 5FAKA 3U3XA 4GZ3A 5TMBA 4BNMA 1J70A 3IOYA 2XA9A 1NMYA 1EI9A 4MIOA 3SK0A 4Z0PA 1LDBA 1XCJA 1FYEA 1YB5A 3WHLA 1PHPA 5L7WA 3DMTC 1QUFA 2OFWA 3RABA 3L9WA 2VPWA 3MBKA 4WX2B 4EHIA 3T4EA 1C0IA 1LPNA 5MGNA 1QP7A 5H3LA 1W2GA 2MSCB 2WP0A 2P4HX 3NVYA 2EKQA 4OAOA 4K9MA 4YMVA 2RH9B 4WBNA 5ESXA 1KZ4A 3NAQA 5KYKA 2H2AA 3AO0B 3FAKA 2VYFA 2QZZA 3DF7A 1U1FA 3HP4A 3I5YA 4TLEA 3LO5A 3KOZA 3O2SB 1NLFA 2LVBA 1C1YA 4ECVA 1XEWY 3DEIA 3CF4A 1FDSA 2D1TA 1XPJA 2EJBA 4DIKA 2NU8B 1LVGA 3TW6A 3JATB 2V3VA 4JVSB 1VSBA 3RUCA 4KRFA 2E0IA 4AL4A 1BE0A 3I5MA 3PE3A 2IYLD 1NATA 1JAIA 5CR9A 3CP8A 2HW8A 3SY8A 1KJWA 3VHQA 2IXFA 1D9DA 4HFJA 1UMBB 4W5NA 2HSGA 4JT8A 4E2FA 1G20A 1V1MB 5HF9A 5KFZA 3UW3A 2F00A 4FMDB 2DLDA 1KMMA 1FPMA 1SUAA 1Q5PA 2GYVA 5DBAA 2V7GA 4KGVA 4KQKA 4KR2A 1KHTA 4CM8B 7ICOA 2RGYA 3PQFA 3WO0A 3RJGA 1SVSA 4NH0A 4HX5A 5BPCA 2YW2A 4MS4B 1RYUA 4CM1A 4FMPA 2YYAA 3GIMA 2OQ2A 3NYRA 2DULA 1M10A 3ZI4A 4A10A 4XFJA 3AJ9A 1X6IA 2ISPA 1SBNE 3MWYW 4MWCA 4DTCA 1JRPA 1Z0ZA 2EP5A 4GWKA 3I1JA 3OOSA 1EXNA 2HWKA 3P2YA 3E48A 5LP6A 1V48A 4HNAB 1PTJA 4L5YA 3SQMA 5K3SA 1SV0C 3WSWA 1CY4A 1JNYA 2ID7A 4A7PA 4B7ZA 4YO7A 2X76A 1FNBA 4KV9A 1X74A 3AYXB 3UPUA 4Q0MA 5EHZA 3ADPA 2PXCA 1I80A 2WFZA 1KL9A 3RHTA 2XWQA 1IULA 3BXZA 2IY7A 4ESHA 2RHLA 1KTQA 2LCIA 2N1MA 3E27A 3IUBA 4NAUA 1TDJA 1A9ZA 3AVOA 4QZHA 2PR7A 4BLWA 1DRJA 4GU5A 2WZBA 2J7PA 1V39A 3GP5A 4BUJA 3GGJA 3E53A 3A3NA 1XA4A 2Z8XA 5HFAA 3HWSA 3VSEA 2Q2OA 1EIWA 4BO7A 5J4LA 5IKXA 1L1QA 4BJQA 2JH7A 1L4HA 5EJ7A 1SAYA 3H87A 4FFBA 5KT4A 2JFQA 1OVMA 4LZNA 3ZJVA 5J0SA 2H7YA 1XLVA 3AH8A 2KIWA 3GH3A 4P0QA 1E1RA 4B7UA 1YKSA 3OOWA 1VL8A 5ITWA 3RDPA 4KLHA 1SQFA 1JR4A 4D41A 1ED1A 3DZ8A 5CFNA 1Z5GA 1D8AA 4IJMA 2FQXA 2OZPA 4I4LA 3E1SA 4OCZA 4H0CA 1GYPA 3DOEA 1K1EA 2ZBVA 2R3SA 3DAYA 4Q4JA 4WLVA 1T9CA 4IOKA 1X70A 1VRWA 3DKVA 2X2PA 1BX3A 1WVIA 5AKHA 1VIAA 4CL3A 5CR0A 4Z6KA 2OY0A 5HJ5A 2OCGA 5H2FU 1T24A 4CHGA 9ICLA 3QBVA 3WLKX 4OJTA 3ML1A 1N92A 3BHIA 3F46A 3Q8LA 3DNMA 2FPLA 1D4ZA 2Q46A 3K6RA 2H2WA 1R5JA 3O94A 2IOYA 4RTLA 5LP6B 2Y68A 4TUQA 4Q44A 2JA1A 2OLEA 4KI0A 2WD7B 3F8TA 1V4BA 3TGWA 2QL9A 3DE2X 5C3MA 1DEAA 1PZXA 4XDYA 2PBFA 5CB4B 4MULA 1PW5A 1J2MA 2C1EA 2N3ZA 3JQPA 1BEZA 1LBQA 1Y5RA 2GKSA 5AK0A 1QIMA 1HF3A 4D3YA 3WLPA 1K86A 3TRHA 3WK7A 3Q5DA 2FXIA 3E8SA 1E3IA 3DKPA 3D6FA 1N5XA 4TM7A 4QUGA 2V5UA 1NOMA 5JXIA 3RAGA 4KN4A 2XUOA 4CI9A 4NEHB 3ZGVA 1Q0RA 1TXGA 4JSYA 1FQOA 2ZJ0A 1ORDA 3Q41A 2Y6VA 1CJTC 3RB6A 3DZIA 1E1NA 2EAPA 5FNVA 2OZVA 4I2DA 1VP9A 5KYUB 2C96A 4XQGA 2V98A 1H69A 4Q3CA 5DGCA 2VI5A 1XEAA 4B44A 4P0QB 4FX5A 1NJZA 4BNJA 3FHCB 1OBFO 2GXQA 2IEAA 1D6JA 3RR8A 3H8SA 3DC2A 1XOIA 3OJSA 3E35A 4CIYA 2P8JA 5BXYA 1VLVA 4LMPA 3IUYA 1QLHA 1JPUA 4H35A 2Z04A 3O8RA 3C6XA 1CUGA 2PMBA 2Z4SA 1PQ4A 2ATXA 1UPBA 4CGZA 2PRJA 3LXMA 2C00A 4M0MA 3EXG1 3RSGA 2PL3A 3W78A 2YXEA 3B2NA 4E3ZA 5E2AA 1MHTA 4FGKA 4FQ5A 3KJGA 4RETA 1NMXA 3C23A 1PN3A 4QVKA 2BQ3A 1Q19A 3GN2A 1OUQA 5DH9A 5DTEA 3ZHVA 4TV8A 1Y6QA 1X87A 1XNHA 1XSNA 3MRSA 5DGHA 5IC5A 3RJ5A 2DFKB 2YWJA 1CJBA 1PL7A 2AQ0A 3B0YA 4LDZA 5TGZA 4ZCMA 1U0GA 5IW8A 5GVRA 2HQOA 5A0TA 4HGOA 1P1FA 4NICA 3P52A 1C3VA 2OYYA 1MN6A 3LO8A 3OFKA 4Q9NA 2ZRMA 4RIHA 5IP5A 1ZGZA 2BGJA 4EH1A 5FA5A 4RPGA 3UATA 1BS1A 1NKCA 3VR5D 2R47A 2OFPA 5JFGA 2FN7A 2H1IA 4JEUA 3NBZC 2CMHA 2GFHA 3OSPA 5A4MS 3EUFA 1D8BA 4O8CA 2IP1A 4U9HS 3B3AA 4B82A 3QVMA 3CNHA 2XV1A 3PI6A 2HSWA 5D7NA 3IEMA 3CEPB 4NQZA 1CF4A 4ND4A 4V0RA 4GL4A 5F9NA 5HK8A 1Q7GA 5GJCA 5JXJA 3D6NB 4J07A 3TIGA 1GGHA 3HUFA 5T14A 3K09C 1YHYA 3KYJB 1XTRA 1JE0A 3CZQA 3QITA 3GDWA 3H8WA 2WF9A 4MV8A 1KU0A 3P9IA 2FN3A 2IV2X 8ATCA 2XADA 1V35A 1X92A 2M1XA 3GPLA 5BOSB 1W9HA 2XLCA 3ITKA 2IYWA 5JEEA 2RHGB 5DCUA 2WICA 3B70A 1I5EA 4M6WA 5DQIA 4MYHA 5DTQA 4KWEA 3U39A 1ZQBA 4R3UC 2JEOA 1I4DD 1H22A 2J0VA 1NKTA 5IDXA 3JQEA 1NBIA 2A88A 5L7TA 4WMLA 1JSCA 2PVSA 1GPH1 4B3JA 4IVRA 4Q7LA 4UFOA 1QTRA 1GG5A 3T5DA 1KI2A 2RAVA 3D54D 4YD1A 4UB6U 4BO5A 5AICA 1KDPA 1W8IA 2PUBA 4P35A 3WRWA 3TIXB 3GH1A 3W06A 3JPTA 1L4KA 2B21A 2I99A 4TV8B 1W581 3IIMA 5C8DA 5TPWB 1XE3A 4KXLA 5IWCA 4URWR 4C6RA 1K2WA 1CQPA 2MSWA 5KKNB 3VMMA 1Z0AA 2D5LA 1YV9A 2LXNA 3VX4A 4LFBB 1ZD4A 2CDCA 4GFJA 3WGUA 5HFJA 3TSWA 2OCBA 4DIFA 2JGKA 3GUZA 3L05A 3PJGA 1HFJA 5HTOA 1P39A 5K0JA 1OXSC 3R9WA 2JVKA 1CEQA 5KNIA 4Y2PA 4KO3S 4KE8A 4AS1A 7ICMA 2A1TS 3GJ3A 1UADA 3WWPA 1Y5LA 3QBDA 4UFNA 2CWDA 1ENOA 2HBJA 5TC4A 2I29A 3KEGA 3O4FA 2EVWX 3T9DA 4ESOA 4JV5B 3U80A 4CNBA 3R6GA 5KG1A 2NUPB 3A4VA 3N8HA 4OX9B 3R7WB 7ICPA 4MRVA 5AW8A 5JG7A 1W36B 2PV7A 3DOOA 1T5IA 3RVBA 1U1EA 1SHJA 2JCYA 3H6KA 4CPDA 3SOZA 4M88A 1U65A 2CUTA 2PI4A 3LBNA 2F1JA 2XUHA 5C31A 4FFOA 5JAPA 4WNAA 2Y77A 1PK3A 1XALA 2AEJA 2ZRBA 1TGYA 2Z2IA 4FEEA 1XL0A 1Q1NA 1Y9JA 3GFOA 1GPUA 1CZHA 3H7IA 1SCQA 1X7DA 3K9NA 5F7ZA 1U4SA 4MB6A 5A3SA 2ST1A 4M6WB 2MIIA 3RVDA 3V6MA 3PA6A 2JJ1D 4QWEA 4U7HA 1P73A 1UXKA 1Z8DA 1KQQA 4BC0A 3MCZA 5ED0A 1NZDA 3WMGA 3QFCA 5AW5A 3IP8A 1ZN2A 4YR3A 4TL9A 1LH0A 3VH4A 3Q10A 1V9SA 3LUJA 3QOXA 3RB3A 4GBJA 3ZU6A 1VMAA 3UHPA 4WESA 1M5UA 4FYMA 3U44B 1CYEA 3R7SA 4M8KA 1H2AS 5JNRA 3QFSA 1K8XB 1A5BB 3EAQA 4BFSA 5EE5B 4NU6A 3GLKA 4DV6B 3HO6A 4FDAA 4QHSA 5LLDA 4DUGD 4C8MA 4HDCA 4HG2A 4A2PA 4UBBA 3BDPA 3FGOA 2RKBA 3PSAA 1FQWA 5AI8A 1E1LA 5FOQA 3C7CB 3O0TA 1NBWB 3ZNPA 1P8AA 1ISFA 1E9EA 4QWCA 3CW8X 1Q1AA 4UPDA 1MF7A 1ULAA 5DYIA 3UNXA 3LXUX 1L4FA 3H1TA 3SEIA 3OQJA 3MYRA 4BNVA 4JYMA 4YR9A 2OG1A 2FQ1A 1Q50A 3W5JA 1EWQA 5IXYA 4R65A 1DRUA 3KJIA 1RQRA 4JT2A 3FRHA 4CKEB 1N1MA 4GSYA 3K0SA 2OV4A 5D5QA 4LRYA 2JEGA 3W9BA 5IANA 1Z36A 4AURA 1N6OA 5EPOA 3K53A 4YB8A 1AY0A 1G21B 4D74A 1GDTA 1KERA 8ICLA 2XDYA 2QJWA 4WXPA 4YQYA 4U2EA 1ADJA 1ZEJA 5DYTA 4HWOA 2P91A 1GSHA 4CRXA 4WI1A 2Z08A 2G0NA 4XDHA 3E7WA 9ICTA 1YB6A 2LBPA 4GGPA 4GXKA 5JYEA 2PUVA 1ELOA 3L0PA 2DX7A 5DTMA 3GARA 4MW6A 1O58A 2QRJA 4MS3A 3EEBA 4IM7A 2AQKA 5GVSA 2CEAA 3HVIA 5CLHA 4PPQA 4JKOA 5KX5B 2XMBA 5J63A 2IUFA 1RYZA 3OE4A 2WJZB 2X40A 2P4UA 3WMRA 1V26A 3ZHBA 2IDZA 4FOSA 1C1HA 5DCLA 3THRA 4GDMA 4WESB 1LC3A 1HNXB 4R63A 1YUNA 4RPIA 4BRSA 2ECFA 3QPUA 3RVJA 3PR1A 1Y9AA 1TQ6A 3R3XA 2DAPA 3PQ8A 2X2EA 3IAFA 3WXBA 4CIDA 1MH9A 3N2EA 4H1TA 1W5TA 1I8TA 5DGAA 3JVDA 3J81A 4HN2A 4X62B 4B3IA 1K9SA 2FWRA 1UOOA 2WJ3A 4HQLA 4CE6A 2DKXA 2XRFA 3QWAA 1XGKA 1YDGA 1HH4A 4NBTA 1DQZA 3F8SA 2F3QA 3C3PA 3OFJA 1VYUA 5F1OA 2VT7A 2VUTA 1FSSA 3W5AA 3WR5A 1GGVA 3NRJA 3AIKA 3OT4A 3N0VA 3SJZA 3B9JA 2AXTU 3E5MA 2GRJA 3Q3EA 2H63A 4EPVA 2A0FA 2VP6A 4YP0A 2J6IA 2A5LA 3O0DA 4P84A 4R5HA 2I2CA 1P77A 4LHXA 1H1DA 3Q9UA 5F1KA 4LV6A 4B4VA 2SKCA 2Q4OA 5F1YA 4O59O 4PRKA 3BQMB 3WK5A 4YROA 2MCFA 4R3WA 1QYIA 4ALIA 2A9VA 3FD8A 1P8JA 2WMOB 3K96A 1M3SA 5MDHA 1AGXA 3FCAA 3NHBA 1WAMA 5KFQA 3ZTTA 4R66A 1RXSA 1GY8A 3T4PA 1NT4A 4ASUD 2RQ5A 1G5FA 4UCFA 4URFA 9ICOA 2P68A 2D2IA 4RQBA 1P0PA 4YRNA 1SKUA 3PVSA 3S2UA 4C7JA 3H8JA 1KAQA 2BCJQ 3OO0A 4HX2A 2HUPA 1RJ9A 2QX9A 1PEYA 3HL4A 4MS3B 4JNCA 1A76A 1ECGA 4Q6WA 1M2VA 4MJ3A 1QQBA 1UFRA 4FFVA 3S40A 1JKXA 3KHTA 4ECSA 4RTKA 2Q2QA 2XUZA 4C80A 1L3TA 4RJKA 2DL0A 1CUEA 4XZ3A 4UCXA 4LRSB 4WINA 4MLPA 5JCXA 3RROA 1VZ3A 3HU5A 1S5LU 4CW7A 3AU8A 4FFPA 5HS6A 3PDCA 1CY0A 5IYZF 1R0LA 5T6BA 2BCEA 4YAKA 3DT9A 3CR7A 1T1JA 3E1KA 2KMDA 2WIJA 1H4QA 1ABFA 2IEBA 4UAVA 2RGBA 2RJ3A 4KRXA 5FQOA 2HOIA 2GN2A 2I66A 4PR3A 4DPLA 4ECRA 3K2EA 3IV7A 1A9SA 2HA4A 2J1LA 4A8HA 4IRMA 2OB2A 3CUSA 4O3RA 1Z4JA 4BTLA 5F21A 3GEDA 4INJA 3TQRA 1UA0A 2SNIE 4OHRA 2O0LA 3MT8A 2VTKA 3QJ5A 3ZVNA 4RKEA 4A0FA 1BXKA 4EYHB 3TGLA 3TLGA 4Q43A 3AOGA 4EI7A 3F4BA 1ZONA 2C28A 2AZMA 3ON5A 4LYDA 4PRYA 1FCJA 1E6MA 4UQOA 4EX7A 4U3JB 4ZICA 4FFMA 1T5OA 2O7SA 2HHUA 1QYDA 2J9XB 5E4TA 1N32B 1ZVMA 4AZ0B 5AXBA 4RUKA 1Q12A 1GTMA 4BNDA 2I91A 1HDCA 4EHKA 3HDJA 5MN5A 2F8KA 2RAUA 5AM1A 4L9AA 2A9RA 1U2DA 1A50B 3VR6D 1EFCA 2PSEA 3V6LA 3KBBA 3QM1A 4GOKA 2YKGA 4IIDA 3ZR4B 3ZZNA 2PZEA 4LHEA 3FZQA 1SC6A 3EWSA 3G2JA 1YK1A 3D2AA 2B82A 3HV0A 3BGSA 4NM1A 3HCNA 3ZQUA 1Z88A 1C9DB 1F8GA 3GEBA 1WNTA 4XJTA 5CLQA 5CFRA 3RRHA 5I9BA 2HMUA 1YS2X 2EKBA 2OO5A 2B34A 5IH7A 1M2VB 4QU5A 4QL3A 4EA8A 3A1FA 1T13A 1SUBA 1YDFA 4DZZA 4XDGA 1I5RA 5FL3A 5FPPA 4BLQA 3UOGA 2YMMA 1DO2A 4CMGA 5B6JA 1N2EA 4B85A 3HI4A 2XWBF 2ATCA 4HDKA 4DKJA 3DLHA 2IHZA 1OX4A 1N1DA 4RYLA 3IKMB 4FXOA 1KQNA 5TQ2A 4OQZA 1XDSA 3EDMA 2VZLA 3PO4A 3JWIA 1W9MA 1K7XB 1LW6E 4NMWA 3I58A 2VA8A 3K5PA 1DSSG 3EQZA 1C7YA 3L93A 1U2SA 4B48A 4FBLA 3PX6A 3T9AA 2O6LA 5JEDA 2EAMA 3QI2A 2QI9F 4TWJA 5LKRA 2VAMA 8ICFA 2E48A 2GEBA 1P3Y1 4OLHA 3M2TA 4DSUA 4L85A 3KL4A 5KG6A 4GPEA 4UEKA 3IXMA 4B6OA 1XFAA 4Z7OB 1B0UA 1EM8B 3NXSA 1TGVA 1LDNA 5BT9A 1FZTA 1IMOA 4J7CA 3L1HA 2ODTX 1L7MA 3VR3D 3QSGA 2F8LA 3BSFA 1TJYA 3ONDA 2ZREA 5IFKA 4XGQA 1XO1A 4DLKA 4DGSA 3E9YA 2N1BA 2CV0A 4GMXA 3WSTA 1VDVA 3M9OB 5BSGA 5KTTA 2AJ8A 4AIIA 4I2FA 4DJDC 1ZD9A 3TM5A 1AO0A 2Q99A 1FUYB 4EW1A 1E1MA 4RY0A 3WGNA 3V55A 5GJVC 4BGDA 3SC2B 2R8OA 2KJ5A 3I2FA 1VPEA 4BFXA 1KC3A 2Q5IA 5FV4A 5K0FA 5IK2D 3A6GA 2JRCA 3I9LA 5FD8A 1M1UA 1TKAA 1EGAA 1Q44A 2R7MA 1JIHA 4CQJA 2MTBA 2OBNA 5IDQA 1JQLB 3L0BA 1YXMA 2BV3A 2E4ZA 3ZX4A 2PMDA 4OREX 1WKBA 2BFPA 3RUEA 5H0IA 3LDGA 4P93A 4G1CA 3NHYA 5KG5A 3HRIA 5DHRA 1HUQA 2YXBA 3STTA 4DDUA 3B38A 5TQ2B 1Z62A 1U9YA 2E2WA 2QRUA 3DWGA 3S8EA 4D8VA 1Y8QA 2PX6A 3VR2D 4L73A 4ZV9A 3U3DA 1JDPA 4EBDA 2RB5A 4ZVOA 3ZWMA 1Y1TA 3NS1A 3UMBA 3GFKB 4UTVA 4RJLA 3DD1A 1WTCA 4JKIA 4GLOA 1XZEA 1GRVA 4DL2A 4OJ5A 2REBA 4ZVKA 4OB7A 5B2EA 1ZCAA 4COKA 2DR3A 4ZAFA 2AC4A 1LD3A 1E8NA 1AHNA 1OREA 3PZBA 5BMVA 2PHZA 1RKVA 4PHGA 3KHUA 4J9NA 4EG8A 3SAFA 1X9MA 4YMNA 1N6PA 3I01A 1LSJA 1PYOA 2ODPA 1OGJA 1RHQA 4RAOA 2VJ5A 1YB1A 3G2PA 4P4NA 2QPOA 3N74A 2WYVA 3UJCA 3VX3A 4QG3A 1PR0A 3K6SB 5KG7A 1FFDA 3IUEA 2FFQA 1IU9A 1S9DA 5CLFA 1FFWA 4B6RA 4ZQEA 4YIHA 2W4MA 3O7WA 1BKSB 3PLAE 4BKUA 2DUWA 3B9BA 2N9UA 4BJHB 1YK0A 1UXOA 2OHXA 1X14A 2Q5FA 4DR7B 1ISPA 1UPXA 2H1WA 4RLHA 3QOYA 2QW8A 1D3AA 4J0JA 2Z56A 4A4DA 4XGRA 4DMLA 3ZD9A 3U1BA 5J58A 5HPYB 4DA9A 1ZJMA 1DNPA 1OB5A 4H7JA 3NT4A 3FUVA 2JPDA 4F6RA 3KOOA 5JRTA 1OZHA 5F3DA 2H5XA 3PEUA 3EQ9A 2HQSA 5GV7A 4OHVA 1BKYA 2JARA 3N2YA 3BAFA 4WJLA 3LUHA 1L5VA 2JZNA 2FW1A 3W5CA 5B12A 3QXHA 2D4AA 4F3KA 2GLXA 2QMYA 1S2OA 2CFIA 2C54A 2ZTMA 3H04A 4P3KA 5U1PA 3FPLA 3EK2A 3L5OA 2WVHA 3M4YA 2NAPA 4XQ8A 1OFUA 2LKYA 4PO1A 1BWRA 3AWDA 3WXMA 1PWXA 1VHTA 2NO7A 5JUWA 5I7UA 5GOZA 3KD3A 1YZKA 4WECA 3DGEC 5BMVB 1AOXA 2SKDA 1H2EA 4TSFA 2DUUA 2C8KA 2G1JA 2HZ7A 2OXFA 5HCNA 2W54A 3FVRA 1J97A 4GXJA 2V7QD 4JLWA 3VR4A 3GG9A 3DLBA 1QH8A 1YS4A 2JJQA 2ESRA 4J2HA 4JMLA 1C30A 2J6TA 4LXIA 1XMIA 3HILA 1Q84A 1KN5A 4DG8A 1KO8A 2BMVA 3O8OA 4IJKA 5L7YA 1Q3UA 4EZ9A 1GTSA 1QRUA 1XTTA 5CDFE 1QFSA 3MELA 4BMDA 1VGRA 1E3WB 2HJWA 4WY2A 1DKMA 3AJRA 2XAAA 3ZY5A 5KOHA 3K16A 4LISA 2JXJA 2K4PA 1OYOA 2YTZA 1KOGA 5CVTA 1U8TA 5TQ0A 2ATIA 4G6ZA 4DL7A 3FWHA 1E18A 3VDQA 1TEZA 2CDBA 1JJAA 3ZZ1A 1KEUA 2PKQP 1X7WA 1RKBA 3SZOA 2NV6A 4F6RB 4EG5A 4C8LA 2B2NA 4PN7A 3TFQA 2HLDD 3KHHA 3V7UA 4D3DA 2GVDC 2R8JA 3I05A 1KYTA 5THKA 3LT1A 2HB6A 3ICVA 4BFZA 4B43A 1QS0B 3WRYA 4MK4A 1QRDA 3LPAA 2WKQA 4CLOA 4LHYA 1DRGA 5IRCD 1J24A 3O4GA 3BTVA 2W6CX 3VO9A 1T9GS 4ERXA 4UFPA 4PANA 4YRJA 3C1AA 3FYHA 3V1UA 2W6PA 4QLOA 1Z8HA 3RTEA 5CAEA 4ENVA 1NVEA 3ZDFA 3ONVA 1I7NA 3VI4B 1OX5A 16PKA 5A3RA 3CT6A 1UBCA 3FCCA 4HRVA 2HO5A 1WUKS 2ZBFA 3WJ7A 1DBSA 4ALMA 4NULA 2DUJA 4JEIA 1QG4A 4CODB 4NXZA 4HDNA 3UJBA 2B8NA 5F9LA 5EGNA 3Q4GA 3IVRA 1UDXA 3GFSA 1TJPB 4IFBA 1XYYA 3T0IA 1MJHA 3AIIA 2DWQA 1QM5A 2IHVA 5J5AA 5AVYA 3B5IA 4HFNA 4HGPA 3L6RA 3BKXA 4BHTA 1JKIA 1JQAA 2YB4A 3JYNA 3LGSA 2Z5LA 3W6UA 1ZM3A 3UJ7A 3PF9A 5ARCA 3BG5A 3WK9A 5AJVB 3I39X 4FC6A 1S4QA 2ABWA 1C30B 3I4CA 4O1HA 4NECA 3MQ2A 4U6SA 4Q6BA 4AP9A 3RU3A 5BOLA 2CLSA 5JD6A 1G1MA 3QE3A 4NFSA 1I3CA 3O8OB 5I9NA 2JANA 3C6QA 3GGDA 5ER6A 4MUAA 1YE5A 1Z38A 4U5QA 3D4BA 3WWOA 2FPSA 4G25A 4ER7A 2IU0A 4PSAA 1KAMA 2KB0A 1V3UA 3WV5A 5KOHB 3QWHA 1RJWA 2O8DA 1CB7A 5CH3A 3THVA 4U2DA 3B12A 1EQAA 1YI0A 3LBIA 3AKEA 3DLPX 1JFRA 2GJ4A 1ZW6A 3EW7A 3IQDB 4DQLA 4DXHA 1QCYA 4Z2AA 5CX1B 4ZCSA 1O9BA 3VMFA 5HUQA 2WU8A 3ANYB 9ICFA 4GH5A 4V24A 3ZHZA 4MYCA 3R9XA 4S2EA 4CR7A 3FAZA 4KNVA 1FP2A 4CLOB 2BGMA 4NMMA 1FTNA 3S2EA 4M1OA 3I23A 3NRBA 4HJRA 3PUWA 4OBEA 4Q9JA 4HXGA 5F33A 5CAEB 1W6RA 1U0RA 5CFZA 2VVTA 2BLNA 2XW6A 4HQ6A 3MLBA 2IS6A 1IIBA 1TZBA 1QAMA 3ED5A 2YJZA 4GHWA 3JARB 5EOZA 1HZJA 4HDNB 3HJRA 4GVXA 3OEHD 3OLCX 3U4CA 4JC5A 3O1JC 4HSEA 4RK4A 4RTNA 4YQFA 2HK7A 2ZQ5A 3EOAI 2EJCA 1KFJB 1ZOSA 5I45A 4PLWA 1Y3IA 2IJGX 2WT9A 4Q9AA 4OI2A 4EBFA 2XR1A 5EYPB 3R5XA 3P0EA 5CX4A 1VLMA 2WWFA 4BO0A 2A9KA 1PDWA 4ENQA 5AM2A 1SD2A 1E6KA 2D1SA 1D6SA 1CUSA 3THXB 4YMMA 1QVVA 3CO0S 4FP9A 1E3SA 1U04A 1Y6FA 3BXHA 1A72A 1FFSA 4MMZB 5KT5A 2TRSB 1LPPA 2REOA 1NQWA 4PSDA 3RG2A 5JD4A 2PUJA 2ACVA 4P7JA 1KZGB 3P9SA 4B33A 2O8DB 3DXYA 2O0HA 4JS0A 4XM2A 4U8HA 1GNTA 1TKRA 3O26A 3ZLVA 4DS5A 2ZAOA 3ISCA 3OZUA 4QG7A 1NKVA 1YMUA 2FA9A 2F8MA 1YA4A 2LCQA 1GZVA 1J8FA 521PA 3E8XA 4H18A 3IDFA 1HETA 2X5XA 1QONA 3UUWA 4DANA 3EODA 4LZLA 4HBZA 2ZYGA 3Q0IA 1BAPA 5JYBA 1WCWA 2EDUA 4UNIA 1GOTA 3R9XB 2RHBA 1TAHA 1E9RA 5KQGA 3P5SA 3ETRA 3A36A 2HUNA 3A1EA 2Y66A 4JUZA 2NQ2C 2IP4A 4AKHA 2VTDA 3EF1A 2WD9A 2EKLA 1X94A 1GZUA 1K7FB 2H3VA 1EHYA 2OEPA 3Q87B 3ALRA 2FK7A 2YHUA 3VYTB 4FFLA 4YQEA 1K92A 4COOA 4ZQFA 4PPXA 3IQGX 1NW5A 2FPPA 2XWSA 5ALPA 3ORYA 4M1YA 3D0KA 5DN6D 2NTYC 4WFQA 3O5AA 2C0CA 4KFSA 2W6OA 3CXRA 2WHYA 5AJZA 2XGJA 1AKMA 4BDSA 2QSUA 4KWTA 4YY3B 1P3DA 1ZYQA 2YHSA 1ARZA 4FSDA 4YXMA 4IIJB 8ICUA 1JEOA 1FTWA 2H0RA 1JU9A 4RVHA 4FW9A 4P4SB 3MXTA 5BVHA 1YZNA 1MORA 1UZUA 2Q28A 2PL9A 2Q3DA 1BCRA 2ZTCA 3MS4A 4JBYA 2I87A 3IALA 4E4YA 4B8WA 1WLSA 4XIJA 4M0PA 4FZRA 2ZVQX 4G09A 2E85A 4G5HA 4MVWA 2XOXA 3H8MA 4L15A 3SQIA 3EPGA 1CRZA 3T3EA 2BBWA 5DE3A 4X1IB 3PW0A 5EJ6A 3SIWA 2Q2WA 2V9WA 1QQTA 4IGEA 2JAQA 2ASJA 2D1YA 1EBFA 1DX4A 3FPEA 4DE5A 1VG0B 1DLIA 4N0PA 2PZFA 3UT0A 3SXUB 2RGRA 2C9MA 4MVJD 4PHAA 1MA0A 3GGPA 4IILA 3SHQA 2IF2A 1I6MA 1Y3AA 1COOA 2C9YA 2X0FA 1HL7A 1L5FA 1VKJA 3U3MA 1SELA 4A2WA 1WM1A 3BFJA 3REGA 4QTZA 4MKIA 4Y2RA 1FUIA 1X80B 3GBVA 2B1JA 1ORRA 5LDHA 4FCVA 4E09A 4X84A 4TKZA 5BVGA 4RK1A 3QGMA 5F5NA 2XBMA 2Q7OE 1OC4A 2PSSA 4U2GA 2X41A 1UBEA 3IPCA 1OYYA 3KB8A 4LXTA 1A9PA 3CQ9A 2QL5A 2AFHB 4E5DA 1FLDA 5HM8A 4G1MB 2XE8A 2G82A 5EQTA 1RS0A 2F77X 3DEHA 1PHRA 3H05A 4MQEA 4M99A 3S5UA 5CCDA 2IKSA 3OJFA 2FPPB 3LPNA 1U7ZA 2QAGA 1J23A 4RKFA 1TM7E 2FG6C 4YRIA 4LBVA 1AGRA 4IMPA 3AVUA 1ZD3A 2GOLA 2NRVA 5DWVA 1LRKA 4RUAA 2IIBA 3LT0A 4PXSA 3VYRB 1E4EA 3HRKA 4PLHA 3SP1A 5EJ8A 3HM9A 1H1LB 4R1SA 4URZR 5E7MA 3GLVA 1ZZGA 3V4SA 4NNOA 3ZV5A 3BE4A 4I27A 3BJEA 1FVHA 1Z82A 4AKSA 2P6UA 2FY8A 3WIVA 1SCJA 3O38A 4N39A 1XKQA 1OV4A 2X7JA 2W8LA 2BFWA 2OHVA 5DEOA 5LOVF 4UUQA 2JHFA 1KP2A 1TE2A 5ALZA 3MERA 2UVRA 5KYGA 4ZK2A 1KVSA 4QUIA 2FSPA 1NBME 5BNWA 2W2XA 2RB4A 4BFLA 4O3QA 3ZE1B 1LBIA 3BJZA 5EZYA 2GSDA 3EGEA 4F5YA 1JHRA 5TF0A 1L6IA 1E6WA 2NW6A 4NMHA 3WYBA 2YDYA 3DCJA 5K45A 4A0RA 3DVAA 3COYA 3MOGA 2WY2D 2AYZA 1PZEA 5K1ZA 3W8EA 4WZBA 2OG2A 1XMOB 2C7OA 3BWBA 3IURA 3NDPA 4WBNB 3HYNA 3MTIA 5BVGB 1T6YA 1UKZA 2XY4A 2H1CA 2QUKA 5T67A 3ZD6A 1X9IA 1NVVQ 4UNNA 2YYZA 5E9QA 2C03A 3BWXA 4LC1A 3G17A 1PR3A 4IP0A 3JV7A 5KJFA 5AI4A 2PZ8A 1NHWA 1KNXA 1DBRA 4DQQA 4OKSA 1D9ZA 2C0PA 1JRLA 1JZQA 2Q5EA 2C22A 2GZ3A 4IZIA 4R84A 4Y6LA 2O4UX 3A4YA 3FR8A 4MQEB 1S7CA 2CMGA 5EPEA 3WYGA 2Z8ZA 4IAOA 1A04A 4LDPA 3OU7A 3SSNA 3FDIA 3HHEA 1W4BA 1G20B 4ODIA 2BLLA 3K1JA 4ECTA 5FP0A 1YO6A 2BR4A 3OMLA 1Z3IX 4I9GA 2KHZA 4JUCA 4FONA 3K9FC 3MEQA 2PH7A 1P1HA 4ITUA 4IZOA 1E4EB 1TLTA 1PO7A 4JLPA 5ESWA 1IN8A 1PD0A 2HIMA 2W37A 1YFZA 1SK8A 1CERA 3ZI0A 4I2NA 3IPXA 3LNCA 4FJ0A 2OQVA 2EZZA 3HB5X 4AYWA 2CLFB 4RZRA 4ZVSA 3FE2A 3ZU4A 1F8XA 2Z8YA 5DM2A 4WOKA 4F6LA 4RDXA 2ZPTX 5I8PA 4NI5A 1ZQAA 3PEVA 5IKPA 2OBYA 3FOAA 2VF2A 3NHPA 1HDGO 2YIVX 3EZGA 2AXPA 2C2RA 4J94A 3T3MB 5CD9A 1ODCA 2X15A 4Q4CA 2OD7A 3LYUA 2W03A 2VSFA 4GRDA 4XJSA 5CJPA 4MVJM 2OENG 5CCBA 4BZPA 3H13A 8ABPA 2FMUA 1UWCA 5AT1A 2QYHA 4HQNA 2IDKA 3DVAB 1LI7A 1CW2B 4ZZ0A 1EP1B 1USVA 4D4MA 4RHFA 3HCPA 4B9TA 1JPJA 3ESBA 4KLLA 2W6JA 3ZV3A 4WZBB 3DOHA 4TQRA 3H0CA 4AY3A 1IN5A 4Q4AA 3HBMA 3UZUA 2NYUA 4LK2A 4EY4A 1Y34E 1Q83A 4IVPA 4QRDA 3N59A 1DE0A 5CA1A 2DHRA 2DQNB 3W2IA 4EPTA 2VXCA 2HY7A 3U37A 5G1NA 4KLSA 4RSHA 3COZA 2IZ1A 5JXWA 4GIBA 3TADA 4EHDA 1N6IA 3ABIA 3U48A 1C41A 4NLNA 4LFCB 3LE8A 3DHEA 1NG9A 4FFBB 2W0MA 4TYWA 3S7TA 1RRFA 4PO3X 3VO8A 3DM5A 4XJXA 4FGLA 2DHEA 4F21A 4F06A 4HYTA 2F1RA 1ZAKA 1P5RA 5AIBA 1J09A 2WUWE 1E9DA 1TQ2A 1NVTA 1IFXA 3AW8A 2WU4A 4BMCA 4L8WB 1IEVA 4ECUA 4JGGA 4TRRA 1N33B 3G6VA 3PX7A 4WXMA 3GMIA 4PSUA 4Q4JB 4O4HA 5LYYA 2HJRA 1VXOA 4QARA 3MYYA 3GU3A 1ICEA 3IE2A 5DZSA 4PXYA 3CG4A 1TQHA 3R7LA 1C3EA 3KYBA 5G4KA 1JAHA 4R8UA 4O02B 1U6KA 3AUTA 2A1TR 4LV5B 2NXWA 5HZGA 5A4KA 3B53X 4R7GA 1N2BA 2UXCB 5BSFA 3L9XA 3BJIC 3UJAA 2XT6A 4AUKA 3SN6A 4I5DA 4UBLA 4R7ZA 2UUPA 1R0ZA 3ZKAA 4BE4A 2NM0A 3HJGA 3LBAA 3ZDZB 1UDAA 1OE0A 2EZUA 1A9XA 1GUFA 2HHHB 5CEFA 4LHSA 3IR6A 1EFRA 4HEA1 3IHWA 1VKRA 5CDHA 3OE5A 2CT8A 1S2NA 1KBOA 5TZVA 3QX8A 4P0PA 1B8UA 3PUXA 3RFUA 2B94A 3MCTA 5J2IA 4IO1A 1E9CA 4ACAA 1FTSA 3S55A 2PFNA 4EKGA 2B6HA 1ETHA 1T2AA 3E3LA 1WB4A 1J25A 2NZ2A 3JQAD 4IZ6A 2LUOA 4QJ5A 5JJIA 1PJ3A 1V7PC 3BFPA 4Q4AB 1L4GA 5FOTA 4G4GA 1VBKA 1LLUA 4M1TA 1RYBA 3P1JA 2P2ZA 3AEKA 4HADA 2HIAA 3PDHA 5C52B 7ICHA 1F7VA 4F5ZA 4AO6A 4JOQA 2EZTA 5IAAA 1XJ5A 2K4IA 4LK3A 1VLJA 5CA7A 2FLKA 1N6HA 1RAEA 5C1OA 5FNVB 1D0VA 5TARA 2VO1A 2EG9A 4JB8A 2CYAA 3PCXA 2XVYA 4EOGA 4ZH4A 1SXJC 2UYYA 2B7BA 1KWKA 1AM4D 2P79A 1RTKA 1QG2A 2N1RA 3H6GA 4RQ4A 1GQFA 1XXLA 3CO5A 4ZZ1A 1B43A 3AUAA 4YR7A 2FEOA 3E7XA 2PL5A 1YBVA 1WZUA 4M7RA 5T4EA 4LGMA 1LU9A 1WKCA 5A0VA 1TCBA 4ZDWA 3R6WA 3PFIA 3DTNA 4DFPA 2E37A 1YOBA 3BIFA 5LXTF 3KXKA 1OBOA 3HABA 4A8TA 2WB4A 1VCHA 4X3PA 3ZGOA 2QLMA 2ZXFA 5G4KB 3X1YA 2UUBB 4DDVA 2AFRA 2H8GA 5EOVA 4A1FA 2GOYA 1NVMB 3CF0A 4UPEA 4DSTA 2WZQA 1XNQB 5CVDA 2GDZA 3L7JA 2W6ID 4RCZA 4D6XA 4LY6A 3VA7A 3RUPA 1FP4A 2KBFA 4QEZA 1UWLA 1OILA 3NIGB 1AS3A 4OJQA 2GJAA 2PO5A 2J9YB 4TT8A 5K8VA 1U8XX 3MILA 1AK1A 1SVIA 1A9XB 3DO5A 5ADVA 1NJSA 4RZXA 2P0EA 5HMMA 3LWBA 4R0MA 2CLLB 1PI3A 3IL2A 3BQ9A 5IAKA 4QQFA 1DADA 3KQKA 3GZJA 4F85A 3KHKA 3WYNA 4FBGA 1JR2A 1F6WA 3S8MA 1ML4A 4GGOA 2WNSA 4NYJQ 1Q91A 2ATEA 3NHWA 4TQSA 3OJXA 3VTFA 2R6FA 1H8EA 2P3SA 5B4UA 3HCCA 3NVAA 3PHCA 3AEKB 5JSHA 4P31A 1T8WA 1JNXX 2BW0A 3TZKA 2BJVA 3UJ3X 4RIEA 1E64A 5J2DA 2JLAA 3VR4H 1BDJA 3EY4A 4C4ZA 2ILTA 1U9LA 4DMRA 1Q3VA 3T3NA 2CVFA 3W05A 4CTNA 1KYVA 4JLVA 2TECE 4OX9Y 5BORA 1N4DA 1H42A 1X0VA 4L4RA 3WA7A 1JWBB 4X8OA 3BXPA 1SC4A 4V2UA 3U3JA 1GKLA 4PHPA 2OQIA 1I9CA 1IQPA 3E23A 2CLEB 1L0BA 1TC1A 2WC1A 5BW5A 2EDCA 5D00A 2ZANA 3PPWA 3ZIUA 3LKDA 1ZH6A 4ABTA 1XVIA 4MDYA 4K03A 5AVQA 4EEXA 1HR0B 1OXMA 2ZYWX 3WDKA 1KRHA 5C7OO 2AMFA 3CJTA 5JZBA 4G2TA 3IRVA 4E12A 3C98A 4F4CA 4M4SA 3CV3A 2XYVA 1ZQIA 2P3QA 2AE1A 3ZY3A 4O0IA 2F9MA 3EZNA 1T5HX 3LK6A 2BKLA 4J0GA 3QZUA 2PWPA 5ITZA 4KGDA 1FP4B 3KK0A 1T0JB 2NG1A 1OFVA 3GJ0A 5KDOA 5FTJA 1BYUA 2PM8A 1V0JA 1PJRA 1URJA 1QP4A 4ZAXA 3HNOA 2PT6A 4B5KA 4DNFA 4ZFNA 4DV5B 3Q7PA 3PITA 4F1KA 1H6DA 2B83A 5G0SA 4FVTA 5F3XB 1IN4A 1P3JA 3M3HA 5I7VA 5GQSA 4LOIA 3P32A 1YZ3A 1R88A 3HK2A 2C99A 1WOYA 4RBNA 4BEBA 1C7IA 1EK5A 4QJIA 4RFLA 1SPBS 4LQLA 4HNTA 5ERGB 3HDVA 1IEQA 3BOSA 3X43A 1R8SA 2H4YA 3VCBA 3NC4A 1KJIA 2C97A 4UC0A 3V2IA 2NV0A 1CY1A 1EEXB 1KI6A 3OM8A 4X45A 5KFHA 3G9TA 2Z2ZA 5F7OA 4BB5A 4YK7A 1DBIA 4B71A 3ELYA 3MAJA 4MKFA 1O77A 4PGYA 1FDWA 2IOQA 3KG2A 2ISOA 2G1KA 4NV1A 3QV2A 1YA6A 3MCUA 1UJBA 3HKCA 3HN2A 2VRCA 4WNAB 3X2EA 4A92A 1OD6A 1M6YA 2E87A 4JBGA 1AHIA 3FSJX 4D9CA 1TFUA 4MEYA 2YH2A 4EJFA 3EZXA 4HVAA 5DHUA 2RI6A 4O5OA 3MC1A 4XGIA 4RNDB 1KIAA 1COKA 1G42A 5A5GA 2RHMA 4AF7A 4FE3A 1H5QA 2X4DA 2FYTA 3F67A 1CRLA 1E3LA 1OUMA 4DSJA 1GA6A 4DA7A 4YRQA 3I37X 2VHXA 3OZIA 3RU7A 2YC2C 4PZLA 4L22A 2MYUA 4FQ7A 1E2MA 1ZQCA 2FSHA 5GP1A 4MIKA 3N7AA 1LB1B