4CFAA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cfaA00
3NHGA 4CJUA 1SUQA 1G15A 2JLEA 1WSGA 3VQAA 4B08A 3QEXA 4AHRA 4NYFA 1YT3A 3QETA 2DFEA 4H4MA 3O3GA 4JS5A 3ULDA 1RBVA 3RMCA 4FZXC 3KLHA 4J2DA 4FJ7A 3DRPA 3VQ5A 3MEEA 5HROA 4CGFA 4E89A 3RMBA 3ZT2A 1NKBA 3LWLA 3TARA 3LPTA 4OKEA 4FZYA 1L3SA 1K6YA 3DRRA 4CEBA 3AVNA 1N6QA 4RW7A 4CJRA 4LSNA 4FJKA 3LP3A 2IAJA 4N47A 2PY5A 2HHUA 4HCCA 4CF8A 2ITGA 2ZE2A 4YNQA 3SPYA 3SQ1A 1T7PA 2PZSA 2VG7A 5E41A 3V4IA 3V6DA 4FJGA 3QESA 5HBMA 2PYJA 2BE2A 3WNHA 1X9MA 4IG0A 3RR7A 4FW1A 4RW8A 3U3YA 3RMDA 4KO0A 4CHQA 4C8OA 1NK4A 3KJVA 5K14A 4F3OA 4R5PA 3U6FA 3K5NA 2Z1JA 1SKWA 1KCFA 2LSNA 1J9AA 3IG1A 4EP4A 3TAGA 4CJQA 1YVUA 4JLHA 1SL1A 1UA0A 2OA8A 1TKXA 3QNNA 2JGUA 4OKJA 1TL3A 1S6QA 1VSFA 4E7KA 1C1AA 2OPPA 1S9GA 1QE1A 4N76A 3K57A 1TK5A 3WNEA 5CYMA 1ZBLA 2A1SA 1RT1A 4HVJA 1QQCA 3SI6A 3UIQA 4J2EA 4W5RA 4M3UA 4CHOA 4DSFA 2OZSA 4ICLA 1T05A 4BDYA 1B92A 3NDKA 5KTQA 1I3AA 3TAPA 3DLBA 1HNVA 3VQ9A 5DK5A 4CEDA 3AA3A 3DLGA 1DTTA 3E01A 4UQGA 3VQBA 1U48A 1JLCA 1HMVA 4CGHA 4CJSA 5KRTA 3CYMA 4DTMA 3SQ0A 3SQ2A 4DS4A 3ZSVA 2G8IA 2Z1HA 2EX3A 3K58A 2HHWA 4CHNA 3OYCA 4CFCA 4M42A 4CIGA 2VG6A 1W9HA 2P51A 3MXJA 1U49A 4ELTA 4DFPA 1WAFA 4IFYA 4FLVA 4AHTA 2X74A 2HNDA 4DQPA 2YNIA 2Y1IA 4Z4FA 1LWCA 3LANA 3NF9A 2I5JA 3DI6A 5EU7A 3VQ8A 4MQ3A 1NJXA 4C8LA 2X6SA 2KQ2A 4NCAA 2RN2A 3DLRA 1JLQA 4DU4A 4B9UA 3T1AA 1ZBFA 1S9EA 4O0IA 3C6UA 3V9UA 1TKDA 4CEEA 1BI4B 1HQEA 3AO4A 5HP1A 5C25A 4IFVA 3JSMA 3NF7A 2FBXA 1LWEA 3DM2A 1TV6A 3RTVA 1EETA 1RT2A 1VSKA 4TSXA 4OPJA 3OYFA 5J2NA 4I2QA 2A1RA 4KAZA 4FJXA 2YNGA 1KFDA 5DMRA 4H8KA 1RBUA 4FJJA 5FRMA 2BGGA 4O55A 4MFBA 1S1WA 2YHBA 5HRNA 3F9KA 3MECA 4DLEA 3OY9A 1RNHA 1IH7A 3L2WA 3SUPA 4DTXA 4FVMA 4N56A 4RW9A 3VQPA 3OJSA 2YNHA 1Y97A 3I0RA 4H4OA 4Z4EA 1JLAA 1NOZA 4KTZA 3HO1A 4Z4HA 1XC9A 1RTJA 3LAKA 3QINA 4CF9A 1UWBA 1ASUA 1IKWA 4FJMA 4ZTFA 1ZBUA 1JLFA 1KVBA 3HPHA 4CJ4A 2HHVA 3CM5A 2XRIA 3KK1A 1B9DA 3NF6A 2YV0X 3RRGA 4DSIA 4KTWA 1JLEA 4CF0A 1S1UA 3SZ2A 3K2PA 3TR8A 4IDKA 3DLEA 4C8MA 1S5JA 1SKSA 3V81A 4CGIA 4CF2A 4N41A 4JS4A 3RRHA 3LP1A 1L3TA 3AO5A 5I3UA 1L3UA 1CXUA 4DFJA 4CGJA 4Z4IA 1JXBA 4KI4A 4OLAA 4PUOA 2Y1JA 3AO2A 3VQ7A 3ZSZA 1WSEA 3VQ6A 2YNFA 3HT3A 4DSEA 4M3XA 3RMAA 4CECA 2OPSA 1NOYA 4AHVA 2XHBA 2FBVA 3K5LA 1CXQA 4DQRA 4FJLA 3NF8A 4CFBA 1W0HA 3ASMA 1RBRA 4CEZA 3K5MA 1J54A 2DY4A 1HJRA 4I2PA 2HNYA 4W5NA 3DYAA 3LZIA 4Z0UA 1NJYA 1IG9A 2G8FA 1SV5A 3NE6A 4ELUA 4NYNA 2Z1IA 1REVA 4FW2A 4E7HA 3CG7A 3O4NA 1GOCA 2WONA 2FBYA 4AHUA 4CIFA 3P1GA 4CJFA 4FM0A 1A5VA 4DTRA 2QKBA 1S1VA 3IS9A 3VA0A 2HNZA 3B6OA 3FFIA 3LALA 3BDPA 1NK9A 4DLGA 1GOBA 4OLBA 1D5AA 1RDDA 3ISNC 2D0AA 3ZT1A 3OYMA 1RT7A 2Q3SA 3DOLA 3NBPA 5T7BA 2VWKA 3EZ5A 4E7JA 1Q9YA 3AVFA 1Q9XA 4FLYA 1JL2A 3K5OA 1RDCA 3PUFA 3VQ4A 3OYEA 3L2QA 2X6NA 2F8TA 4DQIA 4DQQA 1HPZA 3OYBA 3O4QA 1EX4A 1KVAA 3NCIA 4GW6A 5CZ1A 5KI6A 1JKHA 3KTQA 2HMIA 3LP2A 4B9LA 1BQMA 3OYIA 3RR8A 1KVCA 3AVCA 3P5JA 1TL1A 4CGDA 4BWJA 1NK7A 1BQNA 4BWMA 1NK0A 2G8WA 2G8HA 4F2SA 4RW6A 4Y1CA 3V9WA 1VSJA 3NAEA 3SUQA 3S9HA 3SJJA 4FK4A 2VWJA 3ZT0A 4KHYA 4CJ5A 4HUGA 4CJVA 5CY4A 3ZSQA 3OVNA 4W5TA 1TK0A 2XY7A 4KB0A 5KGWA 3SUNA 2W42A 1RT6A 2G8UA 4RW4A 1JXEA 2ZQBA 4Q5VA 1QSSA 3ITHA 3M8QA 4Y1DA 4FLWA 2O4GA 3SQ4A 3AA4A 3VQDA 4BE2A 5HRSA 4I7FA 4F8RA 4OGEA 3PX0A 1DTQA 1HQUA 1RBSA 4FZZA 1X9SA 4E3SA 4KRFA 2HHXA 4E1MA 3M8PA 4CJKA 3WNFA 1BI4A 1HNIA 4Z4GA 3TAEA 4M3TA 1WNSA 2KW4A 3OYLA 3OYHA 3HPGA 4BDZA 4IBNA 2IGIA 3SNNA 1T03A 1CZ9A 4DU3A 1NJZA 3KLGA 2B4JA 4ZTJA 1T8EA 1FKOA 2HVHA 1BL3A 2FC0A 4ELVA 1IO2A 1RILA 4CESA 3C6TA 2R7YA 5FDLA 1SKRA 4CGGA 4M3ZA 4BE0A 1LWFA 3SUOA 3HJFA 4DWIA 1EKEA 1C0TA 3OYNA 3I0SA 3CM6A 2DFFA 4IG3A 3V1QA 2BDPA 3LPUA 3KKRA 1VRTA 3DRSA 3OS1A 2BANA 2OPQA 3OJUA 4LD0A 1RDAA 3IAYA 4K8XA 1O1WA 4KHWA 2D0CA 4DTJA 1R0AA 1Z26A 2FBTA 3OS2A 3S3NA 2HHTA 3NGZA 4W5QA 1KSPA 3HP6A 1BIZA 3PV8A 4J2BA 3AV9A 2E4LA 3QEVA 4CERA 4B8AB 1NJWA 3NH2A 3OYDA 4HHTA 3G0ZA 1NK5A 4BACA 3AVMA 3TANA 1YTUA 3L2VA 4FK2A 4CEQA 4CIEA 1VSIA 4OKKA 4FLZA 4KKOA 5SWMA 4FJ8A 2YHAA 2G8VA 1IKVA 2P5OA 2AJQA 1KFSA 3AVHA 3QEWA 3ZSRA 1D9FA 4YFUA 1XHZA 4CK2A 1L5UA 4FJIA 1A5WA 4DMNA 4DTNA 3HM9A 3QO9A 3HXMA 3V9SA 4QOZB 5HLFA 1U45A 3AO1A 3L3VA 2YKMA 1ASVA 1RCHA 4B9SA 3PY8A 3ZSXA 1TKZA 3MEGA 4B8CA 3PO4A 4FJ5A 4J2AA 4G1QA 4DFKA 1C0MA 2ZD1A 4C8NA 5J2MA 4E19A 3JYTA 4FJ9A 4HTUA 4M3YA 1JL1A 4OVLA 3LWMA 3AVAA 4CEAA 3D45A 2GUIA 2RF2A 2XO7A 3EY1A 3F73A 4DSLA 1BCOA 1DLOA 3P83D 4K8ZA 3CFPA 2GV9A 4DQSA 4RG8A 4HCBA 1QHTA 1YTAA 3AA2A 4KPYA 3M8SA 4I9QA 4DTUA 2X78A 3LP0A 5CZ2A 3TAFA 4KHUA 1S1TA 1UAXA 2F8SA 3LZJA 3MXIA 1QS4A 5FRNA 4F2RA 1RT5A 3PO5A 4DTPA 3C95A 1TAUA 2KFNA 5HRRA 3L2UA 4FYDA 1WLJA 4KHSA 1C0UA 1QSYA 1EXQA 4O5BA 3HPOA 3AO3A 1ITGA 3L2RA 4ID1A 1BCMA 4DF8A 2Z1GA 3AVKA 3O3HA 1ASWA 1Z25A 3QLHA 4E7LA 2XY5A 1S6PA 3V9ZA 4PWDA 1KLNA 3OYGA 3CFRA 3NGYA 4LH4A 4CJTA 3ZCMA 1BGXT 4FM2A 4KFBA 4JRQA 4KTQA 4LH5A 1X1PA 5C24A 3VQQA 3S3MA 4CFAA 1QTMA 3V1RA 1SL2A 2GBZA 3NGIA 4L8RB 2O4IA 1VSMA 3QEIA 1NK8A 1VSDA 4AILC 3AVLA 4EP5A 3QERA 1RTDA 2B5JA 2QK9A 5I42A 3CQ8A 3KLEA 1LAVA 4LY7A 1RDBA 1MU2A 3MEDA 4BDPA 3OYAA 3KLFA 3TI0A 3HVTA 1VSLA 4HUEA 1KTQA 1TGOA 4NCGA 4CJPA 3V1OA 3KK3A 3G10A 3TABA 5CYQA 3AVGA 4CHPA 4OJRA 5HRPA 4CEFA 5J2QA 2HVIA 3TWHA 1L3VA 2HW3A 4WE1A 1RT4A 4I9LA 3K59A 4FCYA 4B9TA 4PA1A 3WNGA 4EZ6A 4F3TA 3OS0A 4B9MA 4F4KA 4PY5A 4M45A 2RPIA 3IRXA 4DG1A 4B3OA 1WAJA 2IC3A 4CK1A 3I8DA 4E0DA 1BISA 3VQCA 1CLQA 1WSJA 2NUBA 2P5GA 1NKCA 1C1CA 4GVMA 3M8RA 3EYZA 3HP9A 4FM1A 4Q0BA 4AHCA 1XI1A 3MAQA 4QAGA 5KRSA 2PYLA 4IKFA 3ALYA 4FXDA 1JLGA 1SL0A 3KKSA 3NH1A 3U3GA 3TAMA 2HHQA 4CEOA 1QSLA 3NH0A 3D0PA 2XY8A 4M3WA 4OGCA 2HHSA 2OZMA 4NCBA 4Z4CA 3PX4A 4JRPA 3DOKA 1RTIA 2OYQA 1TVRA 3QEPA 1RTHA 4EZ9A 3QNOA 3TAQA 3KD5E 1EP4A 4DSJA 1WSIA 4DF4A 2G8KA 4O4GA 2DTUA 4O0JA 3HVRA 1JLBA 4DTOA 1U4BA 1ZYQA 3DLHA 4M3RA 4ID5A 1IKXA 3AVBA 3KIOA 1U47A 1HYSA 2D0BA 3SCXA 1XHXA 4BE1A 3MXMA 4KI6A 4CK3A 4CFDA 1VSHA 1N5YA 3KLIA 1FK9A 2DFHA 3C94A 3QIOA 1KLMA 4CF1A 4AHSA 4GMJB 3V9XA 1J5OA 5SZTA 1HRHA 4W5OA 4E7IA 2P1JA 1UOCA 4ZHRA 1HYVA 3PX6A 4HUFA 3AVIA 3T19A 2IS3A 3RWUA 1D8YA 4CJ3A 3LDSA 1Q8IA 1TKTA 2IDOA 3QIPA 3A2FA 4M41A 1ZBHA 4QCLA 1I39A 3CFOA 2XY6A 1NKEA 3NFAA 3ZSYA 1LW2A 3SV3A 2KZZA 1U04A 3HL8A 4CHZA 1B9FA 4PQUA 2EHGA 3L8BA 2KTQA 1A5XA 3OYKA 1FKPA 5J2PA 2IOCA 4O44A 4CHYA 4CCHA 4KB1A 5J1EA 5JS2A 4FJHA 3VA3A 1IKYA 4CJWA 5JS1A 3AVJA 4CJEA 3KD1E 1ZBIA 2D5RA 1S1XA 4DS5A 3H08A 2KFZA 2F96A 3B6PA 1WSFA 1NK6A 5C42A 3ZSWA 4OPKA 3SYZA 4DFMA 1BIUA 1TAQA 3S3OA 3HK2A 1FXXA 2VG5A 1D9DA 5KGXA 3ZT3A 2ATQA 4CJLA 1C1BA 1KRPA 2E6LA 1WN7A 4DSKA 2KZMA 2RKIA 4FLTA 4C8KA 1HYZA 4KV8A 1XWLA 4CE9A 4KHQA 3HSTB 4FJNA 1GOAA 1RT3A 2HB5A 1TK8A 5D3GA 3T3FA 3HYFA 2ETJA 3VN5A 1LV5A 4FLUA 3SV4A 1WSHA 1RBTA 4XIUA 2OPRA 3THVA 4LSLA 1CZBA 3BGRA 3SPZA 4DU1A 4KHNA 4B9NA 3LAMA 1VK0A 2QKKA 1C6VA 1LW0A 3AA5X 3L3UA 5FROA 3OYJA 1UA1A 1BHLA 2E6MA 3DLKA 3ZSOA 4AH9A 1X9WA 4E1NA 4KREA 2YKNA 2B6AA 1F21A 3ZT4A 3O3FA 4N5SA 3VQEA 3KK2A 4FLXA 2QXFA 4B9VA 4FK0A 1J53A 2WOMA 4DTSA 1VRUA 3DMJA 1VSEA 1LAWA
chains in the Genus database with same CATH superfamily
1NU0A 2DPNA 4CJUA 4FWKA 1G15A 3K9KA 2FSKA 4AHRA 3QEXA 1YT3A 5FPMA 4IFEA 1RBVA 3N4QA 3RMCA 4FJ7A 3DRPA 3LPTA 4FZYA 4AQYK 5ADXH 3AVNA 4FJKA 4RW7A 4CJRA 5BPNA 3LP3A 2IAJA 3ZX0A 4JK7A 5F2RA 1W2BM 4CF8A 2PZSA 5IWAK 3PLAA 3DXKB 1FW6A 5HBMA 2BE2A 1X9MA 4FVUA 3U8XA 4KO0A 2QWMA 3KJVA 4GV6A 5AQMA 4F3OA 4IJAA 3VEWA 2Z1JA 1KCFA 2YJEA 2J4RA 3MX2A 5AQYA 4JI5K 2QWNA 4E7KA 3ULEA 1C1AA 3R3LA 2OPPA 1QQOA 4BRHA 5AZIB 3UIQA 3CXCM 2Q0UA 4CHOA 2JWLA 3O9SA 4BDYA 1B92A 3NDKA 1I3AA 3EE8A 1HNVA 1VQNN 4J8FA 3DLGA 4UQGA 2CH5A 3P38A 4LC9B 2EWSA 4CGHA 4ISFA 1XMQK 4DS4A 2EX3A 4BVOA 1VHXA 3K58A 3F5TA 2E2OA 3VENA 4CIGA 1W9HA 4DR3K 2QTDA 5AQOA 4AHTA 2HNDA 3QFUA 2P9PB 3DLRA 2RE2A 3T1AA 4LF7K 1ZBFA 3SLCA 1VQ7N 1BI4B 4IFVA 5JMVA 4BR7A 1LWEA 4A5AA 3RTVA 1EETA 3CETA 4FJXA 2A1RA 3D2FB 1NNEA 3Q7CA 5DMRA 1RBUA 1P8ZA 2NRRA 1VQLN 1IH7A 4CZMA 3I0RA 5EOYA 1RTJA 4MDBA 1EWRA 2BH1A 1EWQA 4CJ4A 3CM5A 3KK1A 1B9DA 4DSIA 1ATNA 1VQ8N 1JLEA 4LF5K 4IDKA 4YHHK 3V81A 3O5BA 4CF2A 4N41A 4JS4A 4JKDA 3RRHA 4DHYA 5I3UA 5FPDA 3DJCA 4DFJA 5MLCQ 4BGAA 4A2BA 3VQ7A 5KPRA 2YNFA 4CECA 4AHVA 2FBVA 3FZKA 1CXQA 3CJ7A 4KHPK 4YOUA 1N33K 3ASMA 3O1BA 5F0XA 4DCHA 4JI6K 4I2PA 4K41A 2E1ZA 3THYB 3NE6A 4ELUA 4NYNA 4AHUA 3IUCA 2WONA 3O4NA 4CJFA 4DV3K 2QKBA 1EQYA 2HNZA 3B6OA 3LALA 4F9OA 1GOBA 4OLBA 4IXCA 5M1PA 1QZ6A 3ZT1A 3OYMA 1RT7A 3DOLA 3NBPA 5T7BA 3EZ5A 3A8YA 4FLYA 3KWIA 5FLXO 3K5OA 1RDCA 3L2QA 3WEEA 3VERA 1HPZA 1HJOA 3KK7A 1KVAA 5HL7L 4FWNA 5AZJB 5KI6A 3OHRA 3P5JA 1QVFM 1TL1A 4BWMA 1BUPA 2ZJPL 2G8WA 4DR6K 3CCRN 3OBYA 4KHYA 4BR2A 1XQSC 5CY4A 3OVNA 3J80O 3SUNA 5AQXA 4EAHD 1JCGA 4RW4A 1JXEA 4PKIA 2D4WA 5LY3A 2O4GA 4NO7A 4M63C 5HRSA 4F8RA 4OGEA 3PX0A 4B3RK 2IVPA 2D0PA 3DAWA 4CJKA 1BI4A 5GAGP 4Z4GA 3TAEA 4IBNA 3CC2N 3L6QA 1NJZA 4CBXA 2HVHA 2FC0A 4ELVA 1IO2A 1ZC6A 3A5LC 4CGGA 3HJFA 1D4XA 3I0SA 2DFFA 4IG3A 2BDPA 3LPUA 1VRTA 4IO8A 1M1KO 3O9UA 5JLHA 3IAYA 5AQHA 2D0CA 1NM1A 4DTJA 1R0AA 1WBDA 3G6EN 3OS2A 5BRHA 4NLBA 1BIZA 3PV8A 2E4LA 3QEVA 1NJWA 3OYDA 3H1VX 5JVHL 5BRFA 2D1KA 4FL9A 1K8AO 4OKKA 2QW9A 4FJ8A 2P5OA 2G8VA 2AJQA 2E2NA 1IG8A 4DUZK 2P9SA 4YFUA 4B3MK 1C0GA 3HM9A 2QI2A 5HLFA 4FO0A 1QHAA 5M1NA 2YKMA 5E84A 2HHQA 1TKZA 2OCEA 5AQPA 2W6KA 2IVOA 1C0MA 4FJ9A 4M3YA 1RGIA 1NGEA 2WC9A 4YDUC 2RF2A 5BR9A 2XO7A 1DLOA 1P90A 3CFPA 4HCBA 1NGIA 2A6AA 1YTAA 3AA2A 4CZKA 3M8SA 3CMAN 4DTUA 3KZBA 3TAFA 4KHUA 1S1TA 3LZJA 1QS4A 4BRFA 5HOOA 2NNWA 2E1YA 5JVGL 4KHSA 4FWLA 2YHYA 2P9LB 3WEEB 5IT9O 3CJ9A 3HPOA 3AO3A 3FZMA 1Z25A 3QLHA 5C15A 4FM2A 4HTLA 1SL2A 2HBKA 2WBNA 4JI3K 1VQKN 3KLEA 4G9ZA 3FLCO 4HUEA 3G10A 4CHPA 4QS8A 4LF4K 5J2QA 2HSTA 2UUBK 2A41A 1S3XA 2RPIA 3IRXA 4B3OA 2VGMA 1XC3A 1NKCA 3E1YA 3LDPA 4C1NI 4AHCA 1SAZA 4FXDA 2GWKA 3L4IA 4JN4A 1BG3A 4M3WA 2XY8A 4OGCA 2F9TA 2OZMA 1RTIA 4JI7K 2O8DB 4IOAL 4JKAA 3KD5E 4DSJA 3HVRA 4M3RA 2NRXA 1IKXA 4JNEA 4EFHA 3AVBA 2D0BA 3SCXA 2VWBA 1N5YA 2DFHA 3KWGA 3QIOA 4CF1A 4GMJB 4H03B 4ZHRA 4HUFA 1I94K 1HKCA 3RWUA 1D8YA 4CJ3A 4MO4A 2KZZA 4PQUA 2EHGA 3OYKA 3TPQA 4KB1A 3W0LA 4JV5K 5JS1A 4CJEA 4DS5A 2ASPA 4PL8A 5C42A 3ENBA 4DFMA 3S3OA 1BIUA 1TAQA 1FXXA 2VG5A 5LJWA 4RTFD 2E6LA 4ISGA 4DSKA 3D6RA 1N32K 4KHQA 1TK8A 3T3FA 2ETJA 3PSIA 4XIUA 3IMXA 4LSLA 4B1YB 2QKKA 1LW0A 3AA5X 2O8CA 4KREA 1OVYA 1NGBA 2YKNA 4BRIA 2B6AA 3ZT4A 3O3FA 4N5SA 3KK2A 1ATSA 2QXFA 1HKBA 5GIPA 3VQCA 3O6WA 3O4QA 1VSEA 1NBWA 3PSFA 5H1SQ 1SUQA 1WSGA 3O9RA 3O3GA 1GLLO 3ULDA 1VQMN 3KLHA 4J2DA 1V4TA 3MWTA 3VQ5A 1YJ9N 4E89A 4WF9L 3ZT2A 4CZGA 5CHIA 3QFPA 1N6QA 3C65A 4MLEA 4HCCA 4YNQA 1T44A 1RDUA 2VG7A 5E41A 3V4IA 4IO9L 3N4PA 3V6DA 2GEMA 3M5RA 3QESA 3JS6A 4CZJA 4IG0A 3O08A 4FW1A 4RW8A 3U3YA 3RMDA 2OTLN 4CHQA 1NK4A 3FZLA 3U6FA 4CZFA 1RDWX 1J9AA 3TTFA 4EP4A 3CCQN 3T1HK 4BRKA 4CJQA 2O8BB 1SL1A 1TKXA 4OKJA 3NVKA 3K57A 3WNEA 1ZBLA 5AQUA 4CI6A 4ICLA 2NZTA 1KXPA 4OO1J 4IOCL 1T05A 4CD1A 1DTTA 3E01A 5AQJA 3VQBA 5AR0A 1HMVA 2QWRA 3BZCA 4CJSA 3CYMA 5KRTA 4DTMA 4OX9K 1VQ5N 1BO5O 3E9OA 4X64K 3CQYA 4FWQA 3BF1A 2GELA 4CHNA 4CFCA 4M42A 2VG6A 2P51A 3P31A 4DFPA 4I6MA 5AQNA 3VQ8A 1YUWA 4C8LA 5KPZA 2X6SA 4BR5A 3TSPA 5B8HA 2RN2A 4DU4A 4GV3A 3C6UA 3V9UA 3EL2A 1TKDA 4CEEA 4Z94A 5C25A 3O4WA 5C12A 1KAYA 1VSKA 4TSXA 2CH6A 2RHKA 4OPAA 4DR5K 1WB9A 5FRMA 3P39A 1S1WA 3LDLA 3F9KA 1NGAA 4K0KK 5AQGA 1NWKA 4H0PA 1NGFA 4RW9A 3OJSA 2YNHA 3L0QA 4KTZA 4XH1A 3HO1A 4Z4HA 1XC9A 3IDHA 4CF9A 1UWBA 3D2EB 3EO3A 1ZBUA 3OTOK 3VEZA 2FSNA 2HHVA 2PFUA 4KTWA 3SZ2A 3TR8A 4JKGB 1MDUB 3DLEA 2JWKA 4C8MA 3F2KA 1TUYA 1SS6A 2HBMA 1CXUA 4CGJA 5I9EB 1N34K 2V7ZA 4DB3A 1ZXOA 2Y1JA 3SAHA 3ZSZA 3HT3A 3AARA 2OPSA 4FJLA 4DQRA 3KHYA 1RBRA 1J54A 2DY4A 3DYAA 3LZIA 1DEJA 3MX5A 1NJYA 2G8FA 3CG7A 4ILGB 4CIFA 1A5VA 2E2QA 3IS9A 3FFIA 2UUAK 4JI0K 1RDDA 2Q3SA 4BC5A 4E7JA 1Q9YA 4WQ4C 1JL2A 3VQ4A 3PUFA 4JD2B 2X6NA 4NLCA 4BRLA 4DQIA 4CZEA 3THXA 4R79A 3OYBA 1YITN 2HBJA 3FZFA 5CZ1A 1JKHA 3KTQA 2NRVA 4B9LA 3VGMA 3CJCA 3AVCA 1KD1O 2O8FA 4RW6A 4Y1CA 3V9WA 1VSJA 3NAEA 3SJJA 3T7ZA 4CJ5A 5AFUA 4CJVA 3GOIA 5KGWA 2UUCK 3E9LA 3LL3A 4Q5VA 4K43A 2HMPA 5ELZA 3CCSN 4BE2A 4I7FA 3JAMO 4B9QA 4FZZA 4E1MA 4CD3A 4LF6K 1HNIA 2KW4A 3OYHA 3HPGA 3SNNA 1CZ9A 4JEPA 1T8EA 5C2FA 3IFRA 3C7NB 1Q86O 3EZWA 4C23A 4M3ZA 1TYQB 4WFBL 4DWIA 1EKEA 1SQKA 3NVMA 3OYNA 2FF6A 2ASMA 3V1QA 4FOIA 3DRSA 2ZGZA 2OPQA 3C6AA 3FFKB 3TSUA 3OJUA 4FWPA 3I56N 4O5FA 1Z26A 2P9NA 2HHTA 3NGZA 3HP6A 3CPEA 5AFUH 4B8AB 3VTHA 3TANA 1E3MA 3L2VA 4CEQA 3O1WA 3VTIA 4CIEA 1VSIA 2QEXN 4JKGA 4KKOA 3C6HA 3G71N 2P9UB 3AVHA 3ZSRA 3OW2M 1XHZA 4FJIA 1WUAA 4YDUA 4DTNA 4QOZB 3V9SA 4BRDA 1OH7A 2HOEA 4A5BA 1ASVA 4B9SA 4J2AA 3ZSXA 3MEGA 4FJ5A 4DFKA 2ZD1A 3JYTA 3LWMA 4CEAA 3D45A 2GUIA 3EY1A 4QS9A 4DR2K 4DSLA 4U7BA 3G25A 3R6MA 4DQSA 4KPYA 3VMFB 4BG8A 4M7YA 2F8SA 3MXIA 4WQ5A 1RT5A 4F2RA 3R1XA 4DR7K 1TAUA 5HRRA 3L2UA 3CJ1A 4JD2A 1QSYA 4O5BA 3L2RA 4ID1A 1BCMA 4JKFA 2NRTA 4DUYK 4DF8A 3AVKA 1BDGA 4LF8K 3FZHA 1KAZA 1HNWK 4EHUA 4JHDA 4KFBA 4JRQA 1TUUA 3VF6A 4L8RB 4LF9K 3QEIA 1YJNN 2P9IB 3QB0A 4AILC 3AVLA 3CIPA 4NXNK 3O8MA 2B5JA 1RTDA 3AGRA 3WQUA 1RDBA 1MU2A 3OYAA 4U67L 3VESA 1VSLA 1YI2N 1Y64A 3GE1A 4NCGA 3V1OA 3SAGA 2W40A 2HBLA 5CYQA 4BRCA 3GL1A 1X3MA 4WCEL 2HVIA 3TWHA 3K59A 4FCYA 4F3TA 3M1FA 2IC3A 3C7NA 1BA1A 4L3QA 4CK1A 4E0DA 1BISA 1DKGD 2NUBA 3MN6A 5LMUK 4V19S 2W6LA 3HP9A 4CW7B 3MAQA 1SL0A 3Q7BA 3NH1A 3U3GA 4CBWA 4BVPA 2HHSA 1ESVA 2HF3A 5BPMA 3DOKA 3U4LA 4H0YB 3HZ6A 4BC2A 3P4IA 1EP4A 4DF4A 2DTUA 1JLBA 4DTOA 1K73O 4ID5A 3KIOA 5GINA 2P9UA 5AQTA 3JXUA 5AQKA 4AHSA 4BQLA 4E7IA 2P1JA 1UOCA 5TKWA 3ZX2A 1HYVA 3AVIA 3QIPA 2ZJRL 5AQWA 3VEVA 1I39A 3UE5A 2UYTA 1ATRA 1NGCA 1X3NA 3ZSYA 2XY6A 1LW2A 3SV3A 1U04A 1B9FA 4GVEA 3K0SA 1XNRK 4I6MB 4BR0A 1FKPA 4O44A 5KQ8A 3VA3A 2VYPA 3AVJA 3H3NO 2YCHA 2D5RA 1S1XA 4DV7K 4OPKA 3SYZA 1X9JA 3VF2A 1D9DA 5KGXA 1C1BA 2QWPA 1BA0A 3D2FA 1HYZA 4KV8A 1XWLA 2P9LA 3I33A 3CPWM 2I7NA 4FJNA 1GOAA 3HYFA 1OKJA 1WSHA 4GKJK 3QDKA 3CMEN 5GIOA 3THVA 4KHNA 1NGJA 3CHWA 2H3GX 1C6VA 5FROA 5BREA 1BHLA 3DLKA 3O80A 2P9IA 2FXUA 1GLFO 1F21A 4FLXA 4B9VA 4KH5A 1KC8O 1WOQA 4WYBA 3DMJA 2JLEA 3VQAA 4NYFA 3BEXA 3UKUA 2DFEA 3QETA 1OH8A 3ZEUA 3R8EA 2Q97A 3MEEA 5HROA 4CGFA 3RMBA 1NKBA 3CQXA 1BWFO 3DRRA 4H5WA 4LSNA 1T6CA 2HHUA 3SQ1A 4FWRA 4UY8O 3WNHA 1YVNA 4C8OA 5K14A 4R5PA 1SKWA 3C0BA 2LSNA 3NMUA 3IG1A 4JLHA 2QA4N 1U2VA 3QNNA 4M7XA 1TL3A 1S6QA 1VSFA 3HM8A 1QQNA 1HPMA 3F9MA 1YXQA 1TK5A 1GLJO 5CYMA 1RT1A 3EE9A 1QQCA 3SI6A 4J2EA 3MMVA 4W5RA 4M3UA 2UXDK 4DSFA 1NGHA 3THXB 1S72N 3ATVA 5KTQA 3TAPA 3DLBA 2Q2RA 3VQ9A 4K42A 3AY9A 1JLCA 1VQ4N 5AQSA 4X65K 4EIAA 2Q0RA 4NXMK 2G8IA 2QWQA 2Z1HA 4BROA 3OA9A 3OYCA 5LL6Z 2AA4A 4ELTA 3SMSA 3WXLA 4Z4FA 3LANA 3NF9A 2I5JA 3DI6A 2P9KB 3DXMB 4H5RA 4MQ3A 5EU7A 5GADP 1NJXA 2KQ2A 4B9UA 4O0IA 1HQEA 3VGKA 3CC4N 3NF7A 4KAZA 3OYFA 4OPJA 1KFDA 4FJJA 4MFBA 3BF3A 4JKEA 1TYQA 1VAZA 4DLEA 3OY9A 3SUPA 4DTXA 4FVMA 4JI4K 3VQPA 4N56A 1Y97A 4H4OA 1JLAA 1JCFA 1LCUA 1NOZA 3CJAA 3LM9A 3AAPA 3LAKA 3QINA 2YI1A 1IKWA 4FJMA 4ZTFA 1JLFA 1KVBA 2XRIA 5E26A 2YHXA 3NF6A 4BRQA 4CZIA 1S1UA 2A3ZA 5AQVA 2ITMA 3ZETA 3MN9A 1S5JA 1SKSA 5M1KA 1HNZK 4C1NK 1L3TA 3AO5A 3H3OB 4B1XB 2F7TA 3MK6A 1JXBA 4PKGA 3SBGA 4GNIA 5A2QO 3VQ6A 4DSEA 2BTFA 2VQEK 4OPHA 4CFBA 5ADXA 1W0HA 2WUSA 3K5MA 1HJRA 2HNYA 4Z0UA 1SV5A 2GTDA 2Z1IA 3S41A 3CCMN 4E7HA 2FBYA 3P1GA 4FM0A 1N36K 1QQMA 4RCHA 3VA0A 3BDPA 1NK9A 5GAHP 4DLGA 5AQIA 5BPLA 2ASOA 3ULEB 1D5AA 3ISNC 2VWKA 1O13A 3AVFA 3M6GA 4IDHA 4B3TK 3OYEA 4LFBK 4DQQA 3NCIA 1E4FT 4GW6A 4FOEA 2HMIA 3LP2A 5EVZA 4ILJA 1Q18A 1NK7A 4ILHA 4CGDA 4DR4K 1BQNA 4LFCK 3S9HA 3ZYYX 4FK4A 3ZT0A 5LJVA 4B1WB 4W5TA 1TK0A 4H5VA 4A59A 1GLAG 2W42A 1RT6A 2G8UA 3VEYA 2ZQBA 1QSSA 3M8QA 4DV4K 2P9KA 3DXMA 3QBWA 3RVCA 4DV0K 3T1YK 1GLDG 1RBSA 4KRFA 4E3SA 2NRZA 3MN5A 3HOSA 3W3DA 3SMPA 4BDZA 2B4JA 1FKOA 3LM2A 2R7YA 4BRNA 5FDLA 1SKRA 1U6ZA 3SUOA 1IBMK 3ID8A 4FWMA 1C0TA 4AM7A 3G4SN 4B1UB 1YHQN 3KKRA 3OS1A 4LD0A 1RDAA 4K8XA 1O1WA 3RSEA 4KHWA 3HSCA 1FJGK 4W5QA 3J7AP 4J2BA 4GY2B 4HHTA 3G0ZA 1NK5A 4BACA 1YTUA 2HHHK 3T69A 1YJWN 2UXBK 1Q7YO 2YHAA 1OVQA 1WBBA 1KFSA 1YIJN 3E9PA 1A5WA 2IVNA 3L4QA 3QO9A 3HTVA 5DM7L 3VEXA 1U45A 2Q1NA 3PY8A 2E5LK 1R59O 5J2MA 2AP1A 4E19A 4HTUA 1JL1A 3AVAA 3WXKA 2D0OA 3F73A 2QM1A 1XNQK 4K8ZA 2GV9A 4RG8A 3WXJA 2OTJN 3IKMA 4JI2K 4BC4A 4I9QA 4JKCA 2YHWA 2X78A 3LP0A 1HR0K 4KH6A 1HUXA 3KVGA 3PO5A 2ZF5O 4DTPA 1NGDA 4DKWA 5BN8A 1K8KA 5EX5A 4FYDA 1WLJA 1C0UA 4B1ZA 1XMOK 3VF4A 1EXQA 5FPEA 2Z1GA 1ASWA 4E7LA 2XY5A 1S6PA 3OYGA 3AAQA 3CFRA 4LH4A 3CF5L 3ZCMA 1BGXT 4ISEA 4YOVA 2KLAA 5C24A 1QTMA 1T6DA 4CFAA 3S3MA 5AQQA 2UU9K 4JYAK 2O4IA 4A2AA 2UXCK 1VSDA 4EP5A 2PBDA 3BP8A 3HRGA 4DR1K 5I42A 1LAVA 4LY7A 3MEDA 3KLFA 3TI0A 1VQ9N 1KTQA 4CJPA 3TABA 1H1VA 3MN7A 3EEQA 4CEFA 4XEIA 1L3VA 2HW3A 1RT4A 4PA1A 4IOXA 4PY5A 3FE1A 1HLUA 2P5GA 2GX9A 2W41A 4GVMA 4FM1A 3WQTA 4Q0BA 3DXKA 1GLEG 2V52B 3E66A 4QAGA 2PYLA 4H0TB 3LDQA 3RSEB 4CEOA 2P9NB 1VQPN 2CGLA 4NCBA 3I8BA 4Z4CA 3PX4A 1TVRA 5M1FA 3A0IX 3QEPA 4EZ9A 3TAQA 1WSIA 2G8KA 1U4BA 3CI5A 3DLHA 3A5OC 3VOVA 1HYSA 3CCUN 1XHXA 4BE1A 3MCPA 4CFDA 4XH5A 5FPNA 3KLIA 3CCJN 4BC3A 3BZKA 1J5OA 3QBXA 3I55N 3V9XA 3PIOL 1BOTO 3H46O 2FSJA 3GG4A 4X66K 4BR9A 1IJJA 3LDSA 1TKTA 2IDOA 3A2FA 1NKEA 4YOXA 2VGNA 3WXIA 4CHZA 3L8BA 5J2PA 1V4SA 2IOCA 4CHYA 4CCHA 3CCEN 5J1EA 5JS2A 4FJHA 5C2DA 4BGBA 3B6PA 1K9MO 1WSFA 4JK8A 3ZSWA 3M3ZA 4CJLA 2ATQA 1K8KB 2KZMA 1WN7A 1BU6O 4FLTA 4CE9A 4PKHA 5D3GA 1LV5A 4FLUA 1J6ZA 2OPRA 1CZBA 3BGRA 4JHDB 4DU1A 3LAMA 4JKBA 1VK0A 2HF4A 3L3UA 4WFAL 3OYJA 1UA1A 1X9WA 3ZSOA 1DT9A 2E6MA 4KI6A 4E1NA 2PAVA 3SJHA 4O8UA 3D2EA 4FWSA 3VQEA 4FK0A 1J53A 2WOMA 4DTSA 1VRUA 5F1XA 3TAGA 1LAWA 1U47A 3NHGA 4CVNE 4WFNL 4B08A 3ZETB 4H4MA 4BRPA 4JS5A 1IV0A 4FZXC 5BN9A 2CGJA 3LWLA 3TARA 2BUPA 4OKEA 1QVGM 1L3SA 3UB5A 1K6YA 4BQZA 4CEBA 3CCLN 2O8EB 4N47A 2PY5A 3QICA 2ITGA 2ZE2A 1T7PA 3SPYA 3A5MC 5EXWA 4FJGA 4CZLA 2PYJA 2ZJQL 3RR7A 5M1OA 4E1JA 1NJIO 3GBTA 3K5NA 1YVUA 4WQ5C 3K9JA 1UA0A 2OA8A 2O8DA 2E2PA 2JGUA 5BR8K 2E88A 3ID6A 4K25A 1S9GA 1QE1A 4MDAA 4N76A 4B3SK 4O8KA 5KQDA 2A1SA 4HVJA 2ZWHA 4LFAK 4NB4A 5DK5A 4CEDA 2GWJA 3AA3A 3TU5A 1U48A 3SQ0A 2QXLA 3OBWA 3SQ2A 3ZSVA 3DLLL 2HHWA 4KH4A 3MXJA 4BY9C 1U49A 4A61A 1WAFA 4IFYA 4FLVA 5EY4A 2X74A 4DQPA 2YNIA 5AQFA 2Y1IA 1LWCA 1NLVA 4NCAA 1JLQA 1S9EA 3TTCA 3AO4A 5HP1A 3JSMA 2FBXA 4DV2K 3DM2A 1TV6A 1RT2A 3A5NC 2F4VK 1YF5L 2ZGYA 5J2NA 4I2QA 2YNGA 4H8KA 2BGGA 4O55A 4DV6K 2OANA 2YHBA 5HRNA 3MECA 1RNHA 1NGGA 3L2WA 4YORA 4Z4EA 4CBUA 1IBLK 4FWOA 1ASUA 5JICA 2V7YA 1OH6A 1ZBSA 3HPHA 2QWLA 3ENOA 1S22A 2E20A 2YV0X 3RRGA 2A40A 2WTUA 4CF0A 3SK3A 3K2PA 3UKUB 3ZEUB 4JI8K 4CGIA 4BG9A 3WXMB 3LP1A 2QWOA 1L3UA 2P9SB 4Z4IA 1CZAN 2ZM6K 4KI4A 4OLAA 4PUOA 4EHTA 3AO2A 1WSEA 4M3XA 3RMAA 1NOYA 5TKYA 2XHBA 4CJ7A 3K5LA 3NF8A 4H0XB 4CEZA 4H0OA 4A57A 3THWB 3ENHA 4JKHA 3J81O 5AQRA 4W5NA 2F9WA 3VGLA 3H6EA 1IG9A 2A42A 3DWLA 1REVA 4FW2A 1GOCA 3TSQA 3AGKA 4DTRA 1S1VA 1MWKA 3HOTA 2D0AA 1HNXK 1Z05A 1Q9XA 4IZ9A 3PIPL 2F8TA 3CJBA 4AF1A 1EX4A 3J7ZO 1Z6RA 1VQON 1BQMA 3OYIA 3RR8A 4DQ8A 1KVCA 4BWJA 1NK0A 4F2SA 2G8HA 3SUQA 2VWJA 4X62K 4HUGA 4KB0A 3ZSQA 2XY7A 4MLHA 3FR0A 3ITHA 4Y1DA 4FPAA 4FLWA 3SQ4A 3AA4A 3VQDA 1NG9A 1DTQA 1HQUA 2P9PA 2HHXA 1X9SA 3M8PA 3QMLA 4YOYA 3WNFA 3GDQA 1JCEA 4FPBA 4M3TA 1WNSA 3OYLA 2IGIA 1T03A 4BREA 4DU3A 3KLGA 1G99A 4ZTJA 1BL3A 1RILA 4CESA 3ATUA 3C6TA 5LMNK 2YX6A 4BE0A 1LWFA 3D7EO 4IWVA 3CM6A 4DV5K 2BANA 5AQZA 5DM6L 3MCAB 2GUPA 2FBTA 5KPTA 3S3NA 3CC7N 1KSPA 2CGKA 3AV9A 4CERA 3LDNA 3NH2A 4KBOA 3AVMA 1MA9B 4FK2A 5GAEP 4FLZA 5SWMA 2I7PA 5CE3A 1IKVA 2NLXA 3CD6N 3J7YP 1HKGA 3QEWA 1D9FA 3CCVN 2WFBA 4CK2A 1L5UA 4DMNA 4A62A 3HXMA 5JLFA 2VQFK 2A5XA 3AO1A 3L3VA 4BR4A 1RCHA 4B8CA 3PO4A 4YY3K 4G1QA 1RFQA 3UKRA 4C8NA 2NRWA 1KAXA 4OVLA 3THWA 5C10A 1BCOA 1QZ5A 1LOTB 3P83D 3THYA 1HX1A 5AQLA 1QHTA 4YOWA 3J8AA 3WUHA 5CZ2A 1E4GT 1UAXA 1OH5A 1VQ6N 5FRNA 4AM6A 3C95A 3B8AX 4YOTA 2V51B 3BY5A 2KFNA 3VETA 1MWMA 4JAXA 2IIRA 1ITGA 4B1VA 4CZHA 1SZ2A 3O3HA 4PWDA 3V9ZA 5AZJA 1NMNA 1KLNA 5C0YA 3NGYA 4CJTA 4KTQA 1NMDA 4LH5A 1X1PA 3VQQA 2O8FB 1YAGA 3V1RA 3MDQA 2GBZA 2E8AA 3NGIA 1DGKN 2O8CB 1VSMA 4IEEA 2Q36A 1NK8A 3R9PA 3EKUA 3QERA 2QK9A 3CQ8A 2NRHA 3ZX3A 4BDPA 1J5EK 3HVTA 3EN9A 1IBKK 1TGOA 3KK3A 3AVGA 4OJRA 1KQSM 5HRPA 3SBTA 4WE1A 4I9LA 1N8RO 4B9TA 3WNGA 4EZ6A 3OS0A 4B9MA 4F4KA 3U9DA 4M45A 4DG1A 1Q81O 1WAJA 3I8DA 1CLQA 2O8EA 1WSJA 1GLBG 2VCPA 1C1CA 4HWIA 3U9ZA 4JK9A 4PHTX 3H1QA 3M8RA 3EYZA 4H0VB 1JJ2M 1XI1A 4GKKK 1EO1A 1GLCG 5KRSA 5BRDA 4IKFA 3ALYA 2YJFA 1ILYA 1JLGA 3KKSA 4FSVA 4IJNA 3TAMA 3CERA 1QSLA 3NH0A 3D0PA 4H5TA 2Q31A 2O8BA 4JRPA 2OYQA 1U2VB 3TTDA 1RTHA 3QNOA 4O4GA 4O0JA 3BUZB 1ZYQA 1XUPO 5AZIA 3O9QA 4Y0WA 4XH4A 4BRMA 3MXMA 4CK3A 1VSHA 1FK9A 3C94A 1KLMA 4H5NA 5SZTA 1HRHA 4W5OA 4BRAA 3PX6A 3T19A 2IS3A 3UKRB 1Q8IA 4QCLA 4M41A 2KKZA 1ZBHA 3SAFA 3CFOA 2KHOA 3NFAA 3HL8A 5CR4A 4QS7A 2KTQA 1Q82O 4IEIA 1A5XA 3FGUA 1IKYA 4CJWA 1W7AA 3VEOA 3KD1E 1ZBIA 2KFZA 3H08A 1M90O 2F96A 1NK6A 3HK2A 3H45C 3ZT3A 1KRPA 3EKSA 2RKIA 2FF3B 4C8KA 5M1QA 2FLOA 4RWTA 3HSTB 1T3VA 4WQ4A 1RT3A 2HB5A 4GV9A 3WT0A 3VN5A 3SV4A 3MWPA 1RBTA 4PL7A 1C0FA 3SPZA 4DV1K 4B9NA 3VPZA 1W97L 4AH9A 4MO5A 3HBTA 4JI1K 4BRGA 3ZLJA 3HI0A 3O9TA 3LDOA 2OZSA 5AJ3K
chains in the Genus database with same CATH topology
3NHGA 4CJUA 1SUQA 1G15A 2JLEA 1WSGA 3VQAA 4B08A 3QEXA 4AHRA 4NYFA 1YT3A 3QETA 2DFEA 4H4MA 3O3GA 4JS5A 3ULDA 1RBVA 3RMCA 4FZXC 3KLHA 4J2DA 4FJ7A 3DRPA 3VQ5A 3MEEA 5HROA 4CGFA 4E89A 3RMBA 3ZT2A 1NKBA 3LWLA 3TARA 3LPTA 4OKEA 4FZYA 1L3SA 1K6YA 3DRRA 4CEBA 3AVNA 1N6QA 4RW7A 4CJRA 4LSNA 4FJKA 3LP3A 2IAJA 4N47A 2PY5A 2HHUA 4HCCA 4CF8A 2ITGA 2ZE2A 4YNQA 3SPYA 3SQ1A 1T7PA 2PZSA 2VG7A 5E41A 3V4IA 3V6DA 4FJGA 3QESA 5HBMA 2PYJA 2BE2A 3WNHA 1X9MA 4IG0A 3RR7A 4FW1A 4RW8A 3U3YA 3RMDA 4KO0A 4CHQA 4C8OA 1NK4A 3KJVA 5K14A 4F3OA 4R5PA 3U6FA 3K5NA 2Z1JA 1SKWA 1KCFA 2LSNA 1J9AA 3IG1A 4EP4A 3TAGA 4CJQA 1YVUA 4JLHA 1SL1A 1UA0A 2OA8A 1TKXA 3QNNA 2JGUA 4OKJA 1TL3A 1S6QA 1VSFA 4E7KA 1C1AA 2OPPA 1S9GA 1QE1A 4N76A 3K57A 1TK5A 3WNEA 5CYMA 1ZBLA 2A1SA 1RT1A 4HVJA 1QQCA 3SI6A 3UIQA 4J2EA 4W5RA 4M3UA 4CHOA 4DSFA 2OZSA 4ICLA 1T05A 4BDYA 1B92A 3NDKA 5KTQA 1I3AA 3TAPA 3DLBA 1HNVA 3VQ9A 5DK5A 4CEDA 3AA3A 3DLGA 1DTTA 3E01A 4UQGA 3VQBA 1U48A 1JLCA 1HMVA 4CGHA 4CJSA 5KRTA 3CYMA 4DTMA 3SQ0A 3SQ2A 4DS4A 3ZSVA 2G8IA 2Z1HA 2EX3A 3K58A 2HHWA 4CHNA 3OYCA 4CFCA 4M42A 4CIGA 2VG6A 1W9HA 2P51A 3MXJA 1U49A 4ELTA 4DFPA 1WAFA 4IFYA 4FLVA 4AHTA 2X74A 2HNDA 4DQPA 2YNIA 2Y1IA 4Z4FA 1LWCA 3LANA 3NF9A 2I5JA 3DI6A 5EU7A 3VQ8A 4MQ3A 1NJXA 4C8LA 2X6SA 2KQ2A 4NCAA 2RN2A 3DLRA 1JLQA 4DU4A 4B9UA 3T1AA 1ZBFA 1S9EA 4O0IA 3C6UA 3V9UA 1TKDA 4CEEA 1BI4B 1HQEA 3AO4A 5HP1A 5C25A 4IFVA 3JSMA 3NF7A 2FBXA 1LWEA 3DM2A 1TV6A 3RTVA 1EETA 1RT2A 1VSKA 4TSXA 4OPJA 3OYFA 5J2NA 4I2QA 2A1RA 4KAZA 4FJXA 2YNGA 1KFDA 5DMRA 4H8KA 1RBUA 4FJJA 5FRMA 2BGGA 4O55A 4MFBA 1S1WA 2YHBA 5HRNA 3F9KA 3MECA 4DLEA 3OY9A 1RNHA 1IH7A 3L2WA 3SUPA 4DTXA 4FVMA 4N56A 4RW9A 3VQPA 3OJSA 2YNHA 1Y97A 3I0RA 4H4OA 4Z4EA 1JLAA 1NOZA 4KTZA 3HO1A 4Z4HA 1XC9A 1RTJA 3LAKA 3QINA 4CF9A 1UWBA 1ASUA 1IKWA 4FJMA 4ZTFA 1ZBUA 1JLFA 1KVBA 3HPHA 4CJ4A 2HHVA 3CM5A 2XRIA 3KK1A 1B9DA 3NF6A 2YV0X 3RRGA 4DSIA 4KTWA 1JLEA 4CF0A 1S1UA 3SZ2A 3K2PA 3TR8A 4IDKA 3DLEA 4C8MA 1S5JA 1SKSA 3V81A 4CGIA 4CF2A 4N41A 4JS4A 3RRHA 3LP1A 1L3TA 3AO5A 5I3UA 1L3UA 1CXUA 4DFJA 4CGJA 4Z4IA 1JXBA 4KI4A 4OLAA 4PUOA 2Y1JA 3AO2A 3VQ7A 3ZSZA 1WSEA 3VQ6A 2YNFA 3HT3A 4DSEA 4M3XA 3RMAA 4CECA 2OPSA 1NOYA 4AHVA 2XHBA 2FBVA 3K5LA 1CXQA 4DQRA 4FJLA 3NF8A 4CFBA 1W0HA 3ASMA 1RBRA 4CEZA 3K5MA 1J54A 2DY4A 1HJRA 4I2PA 2HNYA 4W5NA 3DYAA 3LZIA 4Z0UA 1NJYA 1IG9A 2G8FA 1SV5A 3NE6A 4ELUA 4NYNA 2Z1IA 1REVA 4FW2A 4E7HA 3CG7A 3O4NA 1GOCA 2WONA 2FBYA 4AHUA 4CIFA 3P1GA 4CJFA 4FM0A 1A5VA 4DTRA 2QKBA 1S1VA 3IS9A 3VA0A 2HNZA 3B6OA 3FFIA 3LALA 3BDPA 1NK9A 4DLGA 1GOBA 4OLBA 1D5AA 1RDDA 3ISNC 2D0AA 3ZT1A 3OYMA 1RT7A 2Q3SA 3DOLA 3NBPA 5T7BA 2VWKA 3EZ5A 4E7JA 1Q9YA 3AVFA 1Q9XA 4FLYA 1JL2A 3K5OA 1RDCA 3PUFA 3VQ4A 3OYEA 3L2QA 2X6NA 2F8TA 4DQIA 4DQQA 1HPZA 3OYBA 3O4QA 1EX4A 1KVAA 3NCIA 4GW6A 5CZ1A 5KI6A 1JKHA 3KTQA 2HMIA 3LP2A 4B9LA 1BQMA 3OYIA 3RR8A 1KVCA 3AVCA 3P5JA 1TL1A 4CGDA 4BWJA 1NK7A 1BQNA 4BWMA 1NK0A 2G8WA 2G8HA 4F2SA 4RW6A 4Y1CA 3V9WA 1VSJA 3NAEA 3SUQA 3S9HA 3SJJA 4FK4A 2VWJA 3ZT0A 4KHYA 4CJ5A 4HUGA 4CJVA 5CY4A 3ZSQA 3OVNA 4W5TA 1TK0A 2XY7A 4KB0A 5KGWA 3SUNA 2W42A 1RT6A 2G8UA 4RW4A 1JXEA 2ZQBA 4Q5VA 1QSSA 3ITHA 3M8QA 4Y1DA 4FLWA 2O4GA 3SQ4A 3AA4A 3VQDA 4BE2A 5HRSA 4I7FA 4F8RA 4OGEA 3PX0A 1DTQA 1HQUA 1RBSA 4FZZA 1X9SA 4E3SA 4KRFA 2HHXA 4E1MA 3M8PA 4CJKA 3WNFA 1BI4A 1HNIA 4Z4GA 3TAEA 4M3TA 1WNSA 2KW4A 3OYLA 3OYHA 3HPGA 4BDZA 4IBNA 2IGIA 3SNNA 1T03A 1CZ9A 4DU3A 1NJZA 3KLGA 2B4JA 4ZTJA 1T8EA 1FKOA 2HVHA 1BL3A 2FC0A 4ELVA 1IO2A 1RILA 4CESA 3C6TA 2R7YA 5FDLA 1SKRA 4CGGA 4M3ZA 4BE0A 1LWFA 3SUOA 3HJFA 4DWIA 1EKEA 1C0TA 3OYNA 3I0SA 3CM6A 2DFFA 4IG3A 3V1QA 2BDPA 3LPUA 3KKRA 1VRTA 3DRSA 3OS1A 2BANA 2OPQA 3OJUA 4LD0A 1RDAA 3IAYA 4K8XA 1O1WA 4KHWA 2D0CA 4DTJA 1R0AA 1Z26A 2FBTA 3OS2A 3S3NA 2HHTA 3NGZA 4W5QA 1KSPA 3HP6A 1BIZA 3PV8A 4J2BA 3AV9A 2E4LA 3QEVA 4CERA 4B8AB 1NJWA 3NH2A 3OYDA 4HHTA 3G0ZA 1NK5A 4BACA 3AVMA 3TANA 1YTUA 3L2VA 4FK2A 4CEQA 4CIEA 1VSIA 4OKKA 4FLZA 4KKOA 5SWMA 4FJ8A 2YHAA 2G8VA 1IKVA 2P5OA 2AJQA 1KFSA 3AVHA 3QEWA 3ZSRA 1D9FA 4YFUA 1XHZA 4CK2A 1L5UA 4FJIA 1A5WA 4DMNA 4DTNA 3HM9A 3QO9A 3HXMA 3V9SA 4QOZB 5HLFA 1U45A 3AO1A 3L3VA 2YKMA 1ASVA 1RCHA 4B9SA 3PY8A 3ZSXA 1TKZA 3MEGA 4B8CA 3PO4A 4FJ5A 4J2AA 4G1QA 4DFKA 1C0MA 2ZD1A 4C8NA 5J2MA 4E19A 3JYTA 4FJ9A 4HTUA 4M3YA 1JL1A 4OVLA 3LWMA 3AVAA 4CEAA 3D45A 2GUIA 2RF2A 2XO7A 3EY1A 3F73A 4DSLA 1BCOA 1DLOA 3P83D 4K8ZA 3CFPA 2GV9A 4DQSA 4RG8A 4HCBA 1QHTA 1YTAA 3AA2A 4KPYA 3M8SA 4I9QA 4DTUA 2X78A 3LP0A 5CZ2A 3TAFA 4KHUA 1S1TA 1UAXA 2F8SA 3LZJA 3MXIA 1QS4A 5FRNA 4F2RA 1RT5A 3PO5A 4DTPA 3C95A 1TAUA 2KFNA 5HRRA 3L2UA 4FYDA 1WLJA 4KHSA 1C0UA 1QSYA 1EXQA 4O5BA 3HPOA 3AO3A 1ITGA 3L2RA 4ID1A 1BCMA 4DF8A 2Z1GA 3AVKA 3O3HA 1ASWA 1Z25A 3QLHA 4E7LA 2XY5A 1S6PA 3V9ZA 4PWDA 1KLNA 3OYGA 3CFRA 3NGYA 4LH4A 4CJTA 3ZCMA 1BGXT 4FM2A 4KFBA 4JRQA 4KTQA 4LH5A 1X1PA 5C24A 3VQQA 3S3MA 4CFAA 1QTMA 3V1RA 1SL2A 2GBZA 3NGIA 4L8RB 2O4IA 1VSMA 3QEIA 1NK8A 1VSDA 4AILC 3AVLA 4EP5A 3QERA 1RTDA 2B5JA 2QK9A 5I42A 3CQ8A 3KLEA 1LAVA 4LY7A 1RDBA 1MU2A 3MEDA 4BDPA 3OYAA 3KLFA 3TI0A 3HVTA 1VSLA 4HUEA 1KTQA 1TGOA 4NCGA 4CJPA 3V1OA 3KK3A 3G10A 3TABA 5CYQA 3AVGA 4CHPA 4OJRA 5HRPA 4CEFA 5J2QA 2HVIA 3TWHA 1L3VA 2HW3A 4WE1A 1RT4A 4I9LA 3K59A 4FCYA 4B9TA 4PA1A 3WNGA 4EZ6A 4F3TA 3OS0A 4B9MA 4F4KA 4PY5A 4M45A 2RPIA 3IRXA 4DG1A 4B3OA 1WAJA 2IC3A 4CK1A 3I8DA 4E0DA 1BISA 3VQCA 1CLQA 1WSJA 2NUBA 2P5GA 1NKCA 1C1CA 4GVMA 3M8RA 3EYZA 3HP9A 4FM1A 4Q0BA 4AHCA 1XI1A 3MAQA 4QAGA 5KRSA 2PYLA 4IKFA 3ALYA 4FXDA 1JLGA 1SL0A 3KKSA 3NH1A 3U3GA 3TAMA 2HHQA 4CEOA 1QSLA 3NH0A 3D0PA 2XY8A 4M3WA 4OGCA 2HHSA 2OZMA 4NCBA 4Z4CA 3PX4A 4JRPA 3DOKA 1RTIA 2OYQA 1TVRA 3QEPA 1RTHA 4EZ9A 3QNOA 3TAQA 3KD5E 1EP4A 4DSJA 1WSIA 4DF4A 2G8KA 4O4GA 2DTUA 4O0JA 3HVRA 1JLBA 4DTOA 1U4BA 1ZYQA 3DLHA 4M3RA 4ID5A 1IKXA 3AVBA 3KIOA 1U47A 1HYSA 2D0BA 3SCXA 1XHXA 4BE1A 3MXMA 4KI6A 4CK3A 4CFDA 1VSHA 1N5YA 3KLIA 1FK9A 2DFHA 3C94A 3QIOA 1KLMA 4CF1A 4AHSA 4GMJB 3V9XA 1J5OA 5SZTA 1HRHA 4W5OA 4E7IA 2P1JA 1UOCA 4ZHRA 1HYVA 3PX6A 4HUFA 3AVIA 3T19A 2IS3A 3RWUA 1D8YA 4CJ3A 3LDSA 1Q8IA 1TKTA 2IDOA 3QIPA 3A2FA 4M41A 1ZBHA 4QCLA 1I39A 3CFOA 2XY6A 1NKEA 3NFAA 3ZSYA 1LW2A 3SV3A 2KZZA 1U04A 3HL8A 4CHZA 1B9FA 4PQUA 2EHGA 3L8BA 2KTQA 1A5XA 3OYKA 1FKPA 5J2PA 2IOCA 4O44A 4CHYA 4CCHA 4KB1A 5J1EA 5JS2A 4FJHA 3VA3A 1IKYA 4CJWA 5JS1A 3AVJA 4CJEA 3KD1E 1ZBIA 2D5RA 1S1XA 4DS5A 3H08A 2KFZA 2F96A 3B6PA 1WSFA 1NK6A 5C42A 3ZSWA 4OPKA 3SYZA 4DFMA 1BIUA 1TAQA 3S3OA 3HK2A 1FXXA 2VG5A 1D9DA 5KGXA 3ZT3A 2ATQA 4CJLA 1C1BA 1KRPA 2E6LA 1WN7A 4DSKA 2KZMA 2RKIA 4FLTA 4C8KA 1HYZA 4KV8A 1XWLA 4CE9A 4KHQA 3HSTB 4FJNA 1GOAA 1RT3A 2HB5A 1TK8A 5D3GA 3T3FA 3HYFA 2ETJA 3VN5A 1LV5A 4FLUA 3SV4A 1WSHA 1RBTA 4XIUA 2OPRA 3THVA 4LSLA 1CZBA 3BGRA 3SPZA 4DU1A 4KHNA 4B9NA 3LAMA 1VK0A 2QKKA 1C6VA 1LW0A 3AA5X 3L3UA 5FROA 3OYJA 1UA1A 1BHLA 2E6MA 3DLKA 3ZSOA 4AH9A 1X9WA 4E1NA 4KREA 2YKNA 2B6AA 1F21A 3ZT4A 3O3FA 4N5SA 3VQEA 3KK2A 4FLXA 2QXFA 4B9VA 4FK0A 1J53A 2WOMA 4DTSA 1VRUA 3DMJA 1VSEA 1LAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHG A;  4CJU A;  1SUQ A;  1G15 A;  2JLE A;  1WSG A;  3VQA A;  4B08 A;  3QEX A;  4AHR A;  4NYF A;  1YT3 A;  3QET A;  2DFE A;  4H4M A;  3O3G A;  4JS5 A;  3ULD A;  1RBV A;  3RMC A;  4FZX C;  3KLH A;  4J2D A;  4FJ7 A;  3DRP A;  3VQ5 A;  3MEE A;  5HRO A;  4CGF A;  4E89 A;  3RMB A;  3ZT2 A;  1NKB A;  3LWL A;  3TAR A;  3LPT A;  4OKE A;  4FZY A;  1L3S A;  1K6Y A;  3DRR A;  4CEB A;  3AVN A;  1N6Q A;  4RW7 A;  4CJR A;  4LSN A;  4FJK A;  3LP3 A;  2IAJ A;  4N47 A;  2PY5 A;  2HHU A;  4HCC A;  4CF8 A;  2ITG A;  2ZE2 A;  4YNQ A;  3SPY A;  3SQ1 A;  1T7P A;  2PZS A;  2VG7 A;  5E41 A;  3V4I A;  3V6D A;  4FJG A;  3QES A;  5HBM A;  2PYJ A;  2BE2 A;  3WNH A;  1X9M A;  4IG0 A;  3RR7 A;  4FW1 A;  4RW8 A;  3U3Y A;  3RMD A;  4KO0 A;  4CHQ A;  4C8O A;  1NK4 A;  3KJV A;  5K14 A;  4F3O A;  4R5P A;  3U6F A;  3K5N A;  2Z1J A;  1SKW A;  1KCF A;  2LSN A;  1J9A A;  3IG1 A;  4EP4 A;  3TAG A;  4CJQ A;  1YVU A;  4JLH A;  1SL1 A;  1UA0 A;  2OA8 A;  1TKX A;  3QNN A;  2JGU A;  4OKJ A;  1TL3 A;  1S6Q A;  1VSF A;  4E7K A;  1C1A A;  2OPP A;  1S9G A;  1QE1 A;  4N76 A;  3K57 A;  1TK5 A;  3WNE A;  5CYM A;  1ZBL A;  2A1S A;  1RT1 A;  4HVJ A;  1QQC A;  3SI6 A;  3UIQ A;  4J2E A;  4W5R A;  4M3U A;  4CHO A;  4DSF A;  2OZS A;  4ICL A;  1T05 A;  4BDY A;  1B92 A;  3NDK A;  5KTQ A;  1I3A A;  3TAP A;  3DLB A;  1HNV A;  3VQ9 A;  5DK5 A;  4CED A;  3AA3 A;  3DLG A;  1DTT A;  3E01 A;  4UQG A;  3VQB A;  1U48 A;  1JLC A;  1HMV A;  4CGH A;  4CJS A;  5KRT A;  3CYM A;  4DTM A;  3SQ0 A;  3SQ2 A;  4DS4 A;  3ZSV A;  2G8I A;  2Z1H A;  2EX3 A;  3K58 A;  2HHW A;  4CHN A;  3OYC A;  4CFC A;  4M42 A;  4CIG A;  2VG6 A;  1W9H A;  2P51 A;  3MXJ A;  1U49 A;  4ELT A;  4DFP A;  1WAF A;  4IFY A;  4FLV A;  4AHT A;  2X74 A;  2HND A;  4DQP A;  2YNI A;  2Y1I A;  4Z4F A;  1LWC A;  3LAN A;  3NF9 A;  2I5J A;  3DI6 A;  5EU7 A;  3VQ8 A;  4MQ3 A;  1NJX A;  4C8L A;  2X6S A;  2KQ2 A;  4NCA A;  2RN2 A;  3DLR A;  1JLQ A;  4DU4 A;  4B9U A;  3T1A A;  1ZBF A;  1S9E A;  4O0I A;  3C6U A;  3V9U A;  1TKD A;  4CEE A;  1BI4 B;  1HQE A;  3AO4 A;  5HP1 A;  5C25 A;  4IFV A;  3JSM A;  3NF7 A;  2FBX A;  1LWE A;  3DM2 A;  1TV6 A;  3RTV A;  1EET A;  1RT2 A;  1VSK A;  4TSX A;  4OPJ A;  3OYF A;  5J2N A;  4I2Q A;  2A1R A;  4KAZ A;  4FJX A;  2YNG A;  1KFD A;  5DMR A;  4H8K A;  1RBU A;  4FJJ A;  5FRM A;  2BGG A;  4O55 A;  4MFB A;  1S1W A;  2YHB A;  5HRN A;  3F9K A;  3MEC A;  4DLE A;  3OY9 A;  1RNH A;  1IH7 A;  3L2W A;  3SUP A;  4DTX A;  4FVM A;  4N56 A;  4RW9 A;  3VQP A;  3OJS A;  2YNH A;  1Y97 A;  3I0R A;  4H4O A;  4Z4E A;  1JLA A;  1NOZ A;  4KTZ A;  3HO1 A;  4Z4H A;  1XC9 A;  1RTJ A;  3LAK A;  3QIN A;  4CF9 A;  1UWB A;  1ASU A;  1IKW A;  4FJM A;  4ZTF A;  1ZBU A;  1JLF A;  1KVB A;  3HPH A;  4CJ4 A;  2HHV A;  3CM5 A;  2XRI A;  3KK1 A;  1B9D A;  3NF6 A;  2YV0 X;  3RRG A;  4DSI A;  4KTW A;  1JLE A;  4CF0 A;  1S1U A;  3SZ2 A;  3K2P A;  3TR8 A;  4IDK A;  3DLE A;  4C8M A;  1S5J A;  1SKS A;  3V81 A;  4CGI A;  4CF2 A;  4N41 A;  4JS4 A;  3RRH A;  3LP1 A;  1L3T A;  3AO5 A;  5I3U A;  1L3U A;  1CXU A;  4DFJ A;  4CGJ A;  4Z4I A;  1JXB A;  4KI4 A;  4OLA A;  4PUO A;  2Y1J A;  3AO2 A;  3VQ7 A;  3ZSZ A;  1WSE A;  3VQ6 A;  2YNF A;  3HT3 A;  4DSE A;  4M3X A;  3RMA A;  4CEC A;  2OPS A;  1NOY A;  4AHV A;  2XHB A;  2FBV A;  3K5L A;  1CXQ A;  4DQR A;  4FJL A;  3NF8 A;  4CFB A;  1W0H A;  3ASM A;  1RBR A;  4CEZ A;  3K5M A;  1J54 A;  2DY4 A;  1HJR A;  4I2P A;  2HNY A;  4W5N A;  3DYA A;  3LZI A;  4Z0U A;  1NJY A;  1IG9 A;  2G8F A;  1SV5 A;  3NE6 A;  4ELU A;  4NYN A;  2Z1I A;  1REV A;  4FW2 A;  4E7H A;  3CG7 A;  3O4N A;  1GOC A;  2WON A;  2FBY A;  4AHU A;  4CIF A;  3P1G A;  4CJF A;  4FM0 A;  1A5V A;  4DTR A;  2QKB A;  1S1V A;  3IS9 A;  3VA0 A;  2HNZ A;  3B6O A;  3FFI A;  3LAL A;  3BDP A;  1NK9 A;  4DLG A;  1GOB A;  4OLB A;  1D5A A;  1RDD A;  3ISN C;  2D0A A;  3ZT1 A;  3OYM A;  1RT7 A;  2Q3S A;  3DOL A;  3NBP A;  5T7B A;  2VWK A;  3EZ5 A;  4E7J A;  1Q9Y A;  3AVF A;  1Q9X A;  4FLY A;  1JL2 A;  3K5O A;  1RDC A;  3PUF A;  3VQ4 A;  3OYE A;  3L2Q A;  2X6N A;  2F8T A;  4DQI A;  4DQQ A;  1HPZ A;  3OYB A;  3O4Q A;  1EX4 A;  1KVA A;  3NCI A;  4GW6 A;  5CZ1 A;  5KI6 A;  1JKH A;  3KTQ A;  2HMI A;  3LP2 A;  4B9L A;  1BQM A;  3OYI A;  3RR8 A;  1KVC A;  3AVC A;  3P5J A;  1TL1 A;  4CGD A;  4BWJ A;  1NK7 A;  1BQN A;  4BWM A;  1NK0 A;  2G8W A;  2G8H A;  4F2S A;  4RW6 A;  4Y1C A;  3V9W A;  1VSJ A;  3NAE A;  3SUQ A;  3S9H A;  3SJJ A;  4FK4 A;  2VWJ A;  3ZT0 A;  4KHY A;  4CJ5 A;  4HUG A;  4CJV A;  5CY4 A;  3ZSQ A;  3OVN A;  4W5T A;  1TK0 A;  2XY7 A;  4KB0 A;  5KGW A;  3SUN A;  2W42 A;  1RT6 A;  2G8U A;  4RW4 A;  1JXE A;  2ZQB A;  4Q5V A;  1QSS A;  3ITH A;  3M8Q A;  4Y1D A;  4FLW A;  2O4G A;  3SQ4 A;  3AA4 A;  3VQD A;  4BE2 A;  5HRS A;  4I7F A;  4F8R A;  4OGE A;  3PX0 A;  1DTQ A;  1HQU A;  1RBS A;  4FZZ A;  1X9S A;  4E3S A;  4KRF A;  2HHX A;  4E1M A;  3M8P A;  4CJK A;  3WNF A;  1BI4 A;  1HNI A;  4Z4G A;  3TAE A;  4M3T A;  1WNS A;  2KW4 A;  3OYL A;  3OYH A;  3HPG A;  4BDZ A;  4IBN A;  2IGI A;  3SNN A;  1T03 A;  1CZ9 A;  4DU3 A;  1NJZ A;  3KLG A;  2B4J A;  4ZTJ A;  1T8E A;  1FKO A;  2HVH A;  1BL3 A;  2FC0 A;  4ELV A;  1IO2 A;  1RIL A;  4CES A;  3C6T A;  2R7Y A;  5FDL A;  1SKR A;  4CGG A;  4M3Z A;  4BE0 A;  1LWF A;  3SUO A;  3HJF A;  4DWI A;  1EKE A;  1C0T A;  3OYN A;  3I0S A;  3CM6 A;  2DFF A;  4IG3 A;  3V1Q A;  2BDP A;  3LPU A;  3KKR A;  1VRT A;  3DRS A;  3OS1 A;  2BAN A;  2OPQ A;  3OJU A;  4LD0 A;  1RDA A;  3IAY A;  4K8X A;  1O1W A;  4KHW A;  2D0C A;  4DTJ A;  1R0A A;  1Z26 A;  2FBT A;  3OS2 A;  3S3N A;  2HHT A;  3NGZ A;  4W5Q A;  1KSP A;  3HP6 A;  1BIZ A;  3PV8 A;  4J2B A;  3AV9 A;  2E4L A;  3QEV A;  4CER A;  4B8A B;  1NJW A;  3NH2 A;  3OYD A;  4HHT A;  3G0Z A;  1NK5 A;  4BAC A;  3AVM A;  3TAN A;  1YTU A;  3L2V A;  4FK2 A;  4CEQ A;  4CIE A;  1VSI A;  4OKK A;  4FLZ A;  4KKO A;  5SWM A;  4FJ8 A;  2YHA A;  2G8V A;  1IKV A;  2P5O A;  2AJQ A;  1KFS A;  3AVH A;  3QEW A;  3ZSR A;  1D9F A;  4YFU A;  1XHZ A;  4CK2 A;  1L5U A;  4FJI A;  1A5W A;  4DMN A;  4DTN A;  3HM9 A;  3QO9 A;  3HXM A;  3V9S A;  4QOZ B;  5HLF A;  1U45 A;  3AO1 A;  3L3V A;  2YKM A;  1ASV A;  1RCH A;  4B9S A;  3PY8 A;  3ZSX A;  1TKZ A;  3MEG A;  4B8C A;  3PO4 A;  4FJ5 A;  4J2A A;  4G1Q A;  4DFK A;  1C0M A;  2ZD1 A;  4C8N A;  5J2M A;  4E19 A;  3JYT A;  4FJ9 A;  4HTU A;  4M3Y A;  1JL1 A;  4OVL A;  3LWM A;  3AVA A;  4CEA A;  3D45 A;  2GUI A;  2RF2 A;  2XO7 A;  3EY1 A;  3F73 A;  4DSL A;  1BCO A;  1DLO A;  3P83 D;  4K8Z A;  3CFP A;  2GV9 A;  4DQS A;  4RG8 A;  4HCB A;  1QHT A;  1YTA A;  3AA2 A;  4KPY A;  3M8S A;  4I9Q A;  4DTU A;  2X78 A;  3LP0 A;  5CZ2 A;  3TAF A;  4KHU A;  1S1T A;  1UAX A;  2F8S A;  3LZJ A;  3MXI A;  1QS4 A;  5FRN A;  4F2R A;  1RT5 A;  3PO5 A;  4DTP A;  3C95 A;  1TAU A;  2KFN A;  5HRR A;  3L2U A;  4FYD A;  1WLJ A;  4KHS A;  1C0U A;  1QSY A;  1EXQ A;  4O5B A;  3HPO A;  3AO3 A;  1ITG A;  3L2R A;  4ID1 A;  1BCM A;  4DF8 A;  2Z1G A;  3AVK A;  3O3H A;  1ASW A;  1Z25 A;  3QLH A;  4E7L A;  2XY5 A;  1S6P A;  3V9Z A;  4PWD A;  1KLN A;  3OYG A;  3CFR A;  3NGY A;  4LH4 A;  4CJT A;  3ZCM A;  1BGX T;  4FM2 A;  4KFB A;  4JRQ A;  4KTQ A;  4LH5 A;  1X1P A;  5C24 A;  3VQQ A;  3S3M A;  4CFA A;  1QTM A;  3V1R A;  1SL2 A;  2GBZ A;  3NGI A;  4L8R B;  2O4I A;  1VSM A;  3QEI A;  1NK8 A;  1VSD A;  4AIL C;  3AVL A;  4EP5 A;  3QER A;  1RTD A;  2B5J A;  2QK9 A;  5I42 A;  3CQ8 A;  3KLE A;  1LAV A;  4LY7 A;  1RDB A;  1MU2 A;  3MED A;  4BDP A;  3OYA A;  3KLF A;  3TI0 A;  3HVT A;  1VSL A;  4HUE A;  1KTQ A;  1TGO A;  4NCG A;  4CJP A;  3V1O A;  3KK3 A;  3G10 A;  3TAB A;  5CYQ A;  3AVG A;  4CHP A;  4OJR A;  5HRP A;  4CEF A;  5J2Q A;  2HVI A;  3TWH A;  1L3V A;  2HW3 A;  4WE1 A;  1RT4 A;  4I9L A;  3K59 A;  4FCY A;  4B9T A;  4PA1 A;  3WNG A;  4EZ6 A;  4F3T A;  3OS0 A;  4B9M A;  4F4K A;  4PY5 A;  4M45 A;  2RPI A;  3IRX A;  4DG1 A;  4B3O A;  1WAJ A;  2IC3 A;  4CK1 A;  3I8D A;  4E0D A;  1BIS A;  3VQC A;  1CLQ A;  1WSJ A;  2NUB A;  2P5G A;  1NKC A;  1C1C A;  4GVM A;  3M8R A;  3EYZ A;  3HP9 A;  4FM1 A;  4Q0B A;  4AHC A;  1XI1 A;  3MAQ A;  4QAG A;  5KRS A;  2PYL A;  4IKF A;  3ALY A;  4FXD A;  1JLG A;  1SL0 A;  3KKS A;  3NH1 A;  3U3G A;  3TAM A;  2HHQ A;  4CEO A;  1QSL A;  3NH0 A;  3D0P A;  2XY8 A;  4M3W A;  4OGC A;  2HHS A;  2OZM A;  4NCB A;  4Z4C A;  3PX4 A;  4JRP A;  3DOK A;  1RTI A;  2OYQ A;  1TVR A;  3QEP A;  1RTH A;  4EZ9 A;  3QNO A;  3TAQ A;  3KD5 E;  1EP4 A;  4DSJ A;  1WSI A;  4DF4 A;  2G8K A;  4O4G A;  2DTU A;  4O0J A;  3HVR A;  1JLB A;  4DTO A;  1U4B A;  1ZYQ A;  3DLH A;  4M3R A;  4ID5 A;  1IKX A;  3AVB A;  3KIO A;  1U47 A;  1HYS A;  2D0B A;  3SCX A;  1XHX A;  4BE1 A;  3MXM A;  4KI6 A;  4CK3 A;  4CFD A;  1VSH A;  1N5Y A;  3KLI A;  1FK9 A;  2DFH A;  3C94 A;  3QIO A;  1KLM A;  4CF1 A;  4AHS A;  4GMJ B;  3V9X A;  1J5O A;  5SZT A;  1HRH A;  4W5O A;  4E7I A;  2P1J A;  1UOC A;  4ZHR A;  1HYV A;  3PX6 A;  4HUF A;  3AVI A;  3T19 A;  2IS3 A;  3RWU A;  1D8Y A;  4CJ3 A;  3LDS A;  1Q8I A;  1TKT A;  2IDO A;  3QIP A;  3A2F A;  4M41 A;  1ZBH A;  4QCL A;  1I39 A;  3CFO A;  2XY6 A;  1NKE A;  3NFA A;  3ZSY A;  1LW2 A;  3SV3 A;  2KZZ A;  1U04 A;  3HL8 A;  4CHZ A;  1B9F A;  4PQU A;  2EHG A;  3L8B A;  2KTQ A;  1A5X A;  3OYK A;  1FKP A;  5J2P A;  2IOC A;  4O44 A;  4CHY A;  4CCH A;  4KB1 A;  5J1E A;  5JS2 A;  4FJH A;  3VA3 A;  1IKY A;  4CJW A;  5JS1 A;  3AVJ A;  4CJE A;  3KD1 E;  1ZBI A;  2D5R A;  1S1X A;  4DS5 A;  3H08 A;  2KFZ A;  2F96 A;  3B6P A;  1WSF A;  1NK6 A;  5C42 A;  3ZSW A;  4OPK A;  3SYZ A;  4DFM A;  1BIU A;  1TAQ A;  3S3O A;  3HK2 A;  1FXX A;  2VG5 A;  1D9D A;  5KGX A;  3ZT3 A;  2ATQ A;  4CJL A;  1C1B A;  1KRP A;  2E6L A;  1WN7 A;  4DSK A;  2KZM A;  2RKI A;  4FLT A;  4C8K A;  1HYZ A;  4KV8 A;  1XWL A;  4CE9 A;  4KHQ A;  3HST B;  4FJN A;  1GOA A;  1RT3 A;  2HB5 A;  1TK8 A;  5D3G A;  3T3F A;  3HYF A;  2ETJ A;  3VN5 A;  1LV5 A;  4FLU A;  3SV4 A;  1WSH A;  1RBT A;  4XIU A;  2OPR A;  3THV A;  4LSL A;  1CZB A;  3BGR A;  3SPZ A;  4DU1 A;  4KHN A;  4B9N A;  3LAM A;  1VK0 A;  2QKK A;  1C6V A;  1LW0 A;  3AA5 X;  3L3U A;  5FRO A;  3OYJ A;  1UA1 A;  1BHL A;  2E6M A;  3DLK A;  3ZSO A;  4AH9 A;  1X9W A;  4E1N A;  4KRE A;  2YKN A;  2B6A A;  1F21 A;  3ZT4 A;  3O3F A;  4N5S A;  3VQE A;  3KK2 A;  4FLX A;  2QXF A;  4B9V A;  4FK0 A;  1J53 A;  2WOM A;  4DTS A;  1VRU A;  3DMJ A;  1VSE A;  1LAW A; 
#chains in the Genus database with same CATH topology
 1NU0 A;  2DPN A;  4CJU A;  4FWK A;  1G15 A;  3K9K A;  2FSK A;  4AHR A;  3QEX A;  1YT3 A;  5FPM A;  4IFE A;  1RBV A;  3N4Q A;  3RMC A;  4FJ7 A;  3DRP A;  3LPT A;  4FZY A;  4AQY K;  5ADX H;  3AVN A;  4FJK A;  4RW7 A;  4CJR A;  5BPN A;  3LP3 A;  2IAJ A;  3ZX0 A;  4JK7 A;  5F2R A;  1W2B M;  4CF8 A;  2PZS A;  5IWA K;  3PLA A;  3DXK B;  1FW6 A;  5HBM A;  2BE2 A;  1X9M A;  4FVU A;  3U8X A;  4KO0 A;  2QWM A;  3KJV A;  4GV6 A;  5AQM A;  4F3O A;  4IJA A;  3VEW A;  2Z1J A;  1KCF A;  2YJE A;  2J4R A;  3MX2 A;  5AQY A;  4JI5 K;  2QWN A;  4E7K A;  3ULE A;  1C1A A;  3R3L A;  2OPP A;  1QQO A;  4BRH A;  5AZI B;  3UIQ A;  3CXC M;  2Q0U A;  4CHO A;  2JWL A;  3O9S A;  4BDY A;  1B92 A;  3NDK A;  1I3A A;  3EE8 A;  1HNV A;  1VQN N;  4J8F A;  3DLG A;  4UQG A;  2CH5 A;  3P38 A;  4LC9 B;  2EWS A;  4CGH A;  4ISF A;  1XMQ K;  4DS4 A;  2EX3 A;  4BVO A;  1VHX A;  3K58 A;  3F5T A;  2E2O A;  3VEN A;  4CIG A;  1W9H A;  4DR3 K;  2QTD A;  5AQO A;  4AHT A;  2HND A;  3QFU A;  2P9P B;  3DLR A;  2RE2 A;  3T1A A;  4LF7 K;  1ZBF A;  3SLC A;  1VQ7 N;  1BI4 B;  4IFV A;  5JMV A;  4BR7 A;  1LWE A;  4A5A A;  3RTV A;  1EET A;  3CET A;  4FJX A;  2A1R A;  3D2F B;  1NNE A;  3Q7C A;  5DMR A;  1RBU A;  1P8Z A;  2NRR A;  1VQL N;  1IH7 A;  4CZM A;  3I0R A;  5EOY A;  1RTJ A;  4MDB A;  1EWR A;  2BH1 A;  1EWQ A;  4CJ4 A;  3CM5 A;  3KK1 A;  1B9D A;  4DSI A;  1ATN A;  1VQ8 N;  1JLE A;  4LF5 K;  4IDK A;  4YHH K;  3V81 A;  3O5B A;  4CF2 A;  4N41 A;  4JS4 A;  4JKD A;  3RRH A;  4DHY A;  5I3U A;  5FPD A;  3DJC A;  4DFJ A;  5MLC Q;  4BGA A;  4A2B A;  3VQ7 A;  5KPR A;  2YNF A;  4CEC A;  4AHV A;  2FBV A;  3FZK A;  1CXQ A;  3CJ7 A;  4KHP K;  4YOU A;  1N33 K;  3ASM A;  3O1B A;  5F0X A;  4DCH A;  4JI6 K;  4I2P A;  4K41 A;  2E1Z A;  3THY B;  3NE6 A;  4ELU A;  4NYN A;  4AHU A;  3IUC A;  2WON A;  3O4N A;  4CJF A;  4DV3 K;  2QKB A;  1EQY A;  2HNZ A;  3B6O A;  3LAL A;  4F9O A;  1GOB A;  4OLB A;  4IXC A;  5M1P A;  1QZ6 A;  3ZT1 A;  3OYM A;  1RT7 A;  3DOL A;  3NBP A;  5T7B A;  3EZ5 A;  3A8Y A;  4FLY A;  3KWI A;  5FLX O;  3K5O A;  1RDC A;  3L2Q A;  3WEE A;  3VER A;  1HPZ A;  1HJO A;  3KK7 A;  1KVA A;  5HL7 L;  4FWN A;  5AZJ B;  5KI6 A;  3OHR A;  3P5J A;  1QVF M;  1TL1 A;  4BWM A;  1BUP A;  2ZJP L;  2G8W A;  4DR6 K;  3CCR N;  3OBY A;  4KHY A;  4BR2 A;  1XQS C;  5CY4 A;  3OVN A;  3J80 O;  3SUN A;  5AQX A;  4EAH D;  1JCG A;  4RW4 A;  1JXE A;  4PKI A;  2D4W A;  5LY3 A;  2O4G A;  4NO7 A;  4M63 C;  5HRS A;  4F8R A;  4OGE A;  3PX0 A;  4B3R K;  2IVP A;  2D0P A;  3DAW A;  4CJK A;  1BI4 A;  5GAG P;  4Z4G A;  3TAE A;  4IBN A;  3CC2 N;  3L6Q A;  1NJZ A;  4CBX A;  2HVH A;  2FC0 A;  4ELV A;  1IO2 A;  1ZC6 A;  3A5L C;  4CGG A;  3HJF A;  1D4X A;  3I0S A;  2DFF A;  4IG3 A;  2BDP A;  3LPU A;  1VRT A;  4IO8 A;  1M1K O;  3O9U A;  5JLH A;  3IAY A;  5AQH A;  2D0C A;  1NM1 A;  4DTJ A;  1R0A A;  1WBD A;  3G6E N;  3OS2 A;  5BRH A;  4NLB A;  1BIZ A;  3PV8 A;  2E4L A;  3QEV A;  1NJW A;  3OYD A;  3H1V X;  5JVH L;  5BRF A;  2D1K A;  4FL9 A;  1K8A O;  4OKK A;  2QW9 A;  4FJ8 A;  2P5O A;  2G8V A;  2AJQ A;  2E2N A;  1IG8 A;  4DUZ K;  2P9S A;  4YFU A;  4B3M K;  1C0G A;  3HM9 A;  2QI2 A;  5HLF A;  4FO0 A;  1QHA A;  5M1N A;  2YKM A;  5E84 A;  2HHQ A;  1TKZ A;  2OCE A;  5AQP A;  2W6K A;  2IVO A;  1C0M A;  4FJ9 A;  4M3Y A;  1RGI A;  1NGE A;  2WC9 A;  4YDU C;  2RF2 A;  5BR9 A;  2XO7 A;  1DLO A;  1P90 A;  3CFP A;  4HCB A;  1NGI A;  2A6A A;  1YTA A;  3AA2 A;  4CZK A;  3M8S A;  3CMA N;  4DTU A;  3KZB A;  3TAF A;  4KHU A;  1S1T A;  3LZJ A;  1QS4 A;  4BRF A;  5HOO A;  2NNW A;  2E1Y A;  5JVG L;  4KHS A;  4FWL A;  2YHY A;  2P9L B;  3WEE B;  5IT9 O;  3CJ9 A;  3HPO A;  3AO3 A;  3FZM A;  1Z25 A;  3QLH A;  5C15 A;  4FM2 A;  4HTL A;  1SL2 A;  2HBK A;  2WBN A;  4JI3 K;  1VQK N;  3KLE A;  4G9Z A;  3FLC O;  4HUE A;  3G10 A;  4CHP A;  4QS8 A;  4LF4 K;  5J2Q A;  2HST A;  2UUB K;  2A41 A;  1S3X A;  2RPI A;  3IRX A;  4B3O A;  2VGM A;  1XC3 A;  1NKC A;  3E1Y A;  3LDP A;  4C1N I;  4AHC A;  1SAZ A;  4FXD A;  2GWK A;  3L4I A;  4JN4 A;  1BG3 A;  4M3W A;  2XY8 A;  4OGC A;  2F9T A;  2OZM A;  1RTI A;  4JI7 K;  2O8D B;  4IOA L;  4JKA A;  3KD5 E;  4DSJ A;  3HVR A;  4M3R A;  2NRX A;  1IKX A;  4JNE A;  4EFH A;  3AVB A;  2D0B A;  3SCX A;  2VWB A;  1N5Y A;  2DFH A;  3KWG A;  3QIO A;  4CF1 A;  4GMJ B;  4H03 B;  4ZHR A;  4HUF A;  1I94 K;  1HKC A;  3RWU A;  1D8Y A;  4CJ3 A;  4MO4 A;  2KZZ A;  4PQU A;  2EHG A;  3OYK A;  3TPQ A;  4KB1 A;  3W0L A;  4JV5 K;  5JS1 A;  4CJE A;  4DS5 A;  2ASP A;  4PL8 A;  5C42 A;  3ENB A;  4DFM A;  3S3O A;  1BIU A;  1TAQ A;  1FXX A;  2VG5 A;  5LJW A;  4RTF D;  2E6L A;  4ISG A;  4DSK A;  3D6R A;  1N32 K;  4KHQ A;  1TK8 A;  3T3F A;  2ETJ A;  3PSI A;  4XIU A;  3IMX A;  4LSL A;  4B1Y B;  2QKK A;  1LW0 A;  3AA5 X;  2O8C A;  4KRE A;  1OVY A;  1NGB A;  2YKN A;  4BRI A;  2B6A A;  3ZT4 A;  3O3F A;  4N5S A;  3KK2 A;  1ATS A;  2QXF A;  1HKB A;  5GIP A;  3VQC A;  3O6W A;  3O4Q A;  1VSE A;  1NBW A;  3PSF A;  5H1S Q;  1SUQ A;  1WSG A;  3O9R A;  3O3G A;  1GLL O;  3ULD A;  1VQM N;  3KLH A;  4J2D A;  1V4T A;  3MWT A;  3VQ5 A;  1YJ9 N;  4E89 A;  4WF9 L;  3ZT2 A;  4CZG A;  5CHI A;  3QFP A;  1N6Q A;  3C65 A;  4MLE A;  4HCC A;  4YNQ A;  1T44 A;  1RDU A;  2VG7 A;  5E41 A;  3V4I A;  4IO9 L;  3N4P A;  3V6D A;  2GEM A;  3M5R A;  3QES A;  3JS6 A;  4CZJ A;  4IG0 A;  3O08 A;  4FW1 A;  4RW8 A;  3U3Y A;  3RMD A;  2OTL N;  4CHQ A;  1NK4 A;  3FZL A;  3U6F A;  4CZF A;  1RDW X;  1J9A A;  3TTF A;  4EP4 A;  3CCQ N;  3T1H K;  4BRK A;  4CJQ A;  2O8B B;  1SL1 A;  1TKX A;  4OKJ A;  3NVK A;  3K57 A;  3WNE A;  1ZBL A;  5AQU A;  4CI6 A;  4ICL A;  2NZT A;  1KXP A;  4OO1 J;  4IOC L;  1T05 A;  4CD1 A;  1DTT A;  3E01 A;  5AQJ A;  3VQB A;  5AR0 A;  1HMV A;  2QWR A;  3BZC A;  4CJS A;  3CYM A;  5KRT A;  4DTM A;  4OX9 K;  1VQ5 N;  1BO5 O;  3E9O A;  4X64 K;  3CQY A;  4FWQ A;  3BF1 A;  2GEL A;  4CHN A;  4CFC A;  4M42 A;  2VG6 A;  2P51 A;  3P31 A;  4DFP A;  4I6M A;  5AQN A;  3VQ8 A;  1YUW A;  4C8L A;  5KPZ A;  2X6S A;  4BR5 A;  3TSP A;  5B8H A;  2RN2 A;  4DU4 A;  4GV3 A;  3C6U A;  3V9U A;  3EL2 A;  1TKD A;  4CEE A;  4Z94 A;  5C25 A;  3O4W A;  5C12 A;  1KAY A;  1VSK A;  4TSX A;  2CH6 A;  2RHK A;  4OPA A;  4DR5 K;  1WB9 A;  5FRM A;  3P39 A;  1S1W A;  3LDL A;  3F9K A;  1NGA A;  4K0K K;  5AQG A;  1NWK A;  4H0P A;  1NGF A;  4RW9 A;  3OJS A;  2YNH A;  3L0Q A;  4KTZ A;  4XH1 A;  3HO1 A;  4Z4H A;  1XC9 A;  3IDH A;  4CF9 A;  1UWB A;  3D2E B;  3EO3 A;  1ZBU A;  3OTO K;  3VEZ A;  2FSN A;  2HHV A;  2PFU A;  4KTW A;  3SZ2 A;  3TR8 A;  4JKG B;  1MDU B;  3DLE A;  2JWK A;  4C8M A;  3F2K A;  1TUY A;  1SS6 A;  2HBM A;  1CXU A;  4CGJ A;  5I9E B;  1N34 K;  2V7Z A;  4DB3 A;  1ZXO A;  2Y1J A;  3SAH A;  3ZSZ A;  3HT3 A;  3AAR A;  2OPS A;  4FJL A;  4DQR A;  3KHY A;  1RBR A;  1J54 A;  2DY4 A;  3DYA A;  3LZI A;  1DEJ A;  3MX5 A;  1NJY A;  2G8F A;  3CG7 A;  4ILG B;  4CIF A;  1A5V A;  2E2Q A;  3IS9 A;  3FFI A;  2UUA K;  4JI0 K;  1RDD A;  2Q3S A;  4BC5 A;  4E7J A;  1Q9Y A;  4WQ4 C;  1JL2 A;  3VQ4 A;  3PUF A;  4JD2 B;  2X6N A;  4NLC A;  4BRL A;  4DQI A;  4CZE A;  3THX A;  4R79 A;  3OYB A;  1YIT N;  2HBJ A;  3FZF A;  5CZ1 A;  1JKH A;  3KTQ A;  2NRV A;  4B9L A;  3VGM A;  3CJC A;  3AVC A;  1KD1 O;  2O8F A;  4RW6 A;  4Y1C A;  3V9W A;  1VSJ A;  3NAE A;  3SJJ A;  3T7Z A;  4CJ5 A;  5AFU A;  4CJV A;  3GOI A;  5KGW A;  2UUC K;  3E9L A;  3LL3 A;  4Q5V A;  4K43 A;  2HMP A;  5ELZ A;  3CCS N;  4BE2 A;  4I7F A;  3JAM O;  4B9Q A;  4FZZ A;  4E1M A;  4CD3 A;  4LF6 K;  1HNI A;  2KW4 A;  3OYH A;  3HPG A;  3SNN A;  1CZ9 A;  4JEP A;  1T8E A;  5C2F A;  3IFR A;  3C7N B;  1Q86 O;  3EZW A;  4C23 A;  4M3Z A;  1TYQ B;  4WFB L;  4DWI A;  1EKE A;  1SQK A;  3NVM A;  3OYN A;  2FF6 A;  2ASM A;  3V1Q A;  4FOI A;  3DRS A;  2ZGZ A;  2OPQ A;  3C6A A;  3FFK B;  3TSU A;  3OJU A;  4FWP A;  3I56 N;  4O5F A;  1Z26 A;  2P9N A;  2HHT A;  3NGZ A;  3HP6 A;  3CPE A;  5AFU H;  4B8A B;  3VTH A;  3TAN A;  1E3M A;  3L2V A;  4CEQ A;  3O1W A;  3VTI A;  4CIE A;  1VSI A;  2QEX N;  4JKG A;  4KKO A;  3C6H A;  3G71 N;  2P9U B;  3AVH A;  3ZSR A;  3OW2 M;  1XHZ A;  4FJI A;  1WUA A;  4YDU A;  4DTN A;  4QOZ B;  3V9S A;  4BRD A;  1OH7 A;  2HOE A;  4A5B A;  1ASV A;  4B9S A;  4J2A A;  3ZSX A;  3MEG A;  4FJ5 A;  4DFK A;  2ZD1 A;  3JYT A;  3LWM A;  4CEA A;  3D45 A;  2GUI A;  3EY1 A;  4QS9 A;  4DR2 K;  4DSL A;  4U7B A;  3G25 A;  3R6M A;  4DQS A;  4KPY A;  3VMF B;  4BG8 A;  4M7Y A;  2F8S A;  3MXI A;  4WQ5 A;  1RT5 A;  4F2R A;  3R1X A;  4DR7 K;  1TAU A;  5HRR A;  3L2U A;  3CJ1 A;  4JD2 A;  1QSY A;  4O5B A;  3L2R A;  4ID1 A;  1BCM A;  4JKF A;  2NRT A;  4DUY K;  4DF8 A;  3AVK A;  1BDG A;  4LF8 K;  3FZH A;  1KAZ A;  1HNW K;  4EHU A;  4JHD A;  4KFB A;  4JRQ A;  1TUU A;  3VF6 A;  4L8R B;  4LF9 K;  3QEI A;  1YJN N;  2P9I B;  3QB0 A;  4AIL C;  3AVL A;  3CIP A;  4NXN K;  3O8M A;  2B5J A;  1RTD A;  3AGR A;  3WQU A;  1RDB A;  1MU2 A;  3OYA A;  4U67 L;  3VES A;  1VSL A;  1YI2 N;  1Y64 A;  3GE1 A;  4NCG A;  3V1O A;  3SAG A;  2W40 A;  2HBL A;  5CYQ A;  4BRC A;  3GL1 A;  1X3M A;  4WCE L;  2HVI A;  3TWH A;  3K59 A;  4FCY A;  4F3T A;  3M1F A;  2IC3 A;  3C7N A;  1BA1 A;  4L3Q A;  4CK1 A;  4E0D A;  1BIS A;  1DKG D;  2NUB A;  3MN6 A;  5LMU K;  4V19 S;  2W6L A;  3HP9 A;  4CW7 B;  3MAQ A;  1SL0 A;  3Q7B A;  3NH1 A;  3U3G A;  4CBW A;  4BVP A;  2HHS A;  1ESV A;  2HF3 A;  5BPM A;  3DOK A;  3U4L A;  4H0Y B;  3HZ6 A;  4BC2 A;  3P4I A;  1EP4 A;  4DF4 A;  2DTU A;  1JLB A;  4DTO A;  1K73 O;  4ID5 A;  3KIO A;  5GIN A;  2P9U A;  5AQT A;  3JXU A;  5AQK A;  4AHS A;  4BQL A;  4E7I A;  2P1J A;  1UOC A;  5TKW A;  3ZX2 A;  1HYV A;  3AVI A;  3QIP A;  2ZJR L;  5AQW A;  3VEV A;  1I39 A;  3UE5 A;  2UYT A;  1ATR A;  1NGC A;  1X3N A;  3ZSY A;  2XY6 A;  1LW2 A;  3SV3 A;  1U04 A;  1B9F A;  4GVE A;  3K0S A;  1XNR K;  4I6M B;  4BR0 A;  1FKP A;  4O44 A;  5KQ8 A;  3VA3 A;  2VYP A;  3AVJ A;  3H3N O;  2YCH A;  2D5R A;  1S1X A;  4DV7 K;  4OPK A;  3SYZ A;  1X9J A;  3VF2 A;  1D9D A;  5KGX A;  1C1B A;  2QWP A;  1BA0 A;  3D2F A;  1HYZ A;  4KV8 A;  1XWL A;  2P9L A;  3I33 A;  3CPW M;  2I7N A;  4FJN A;  1GOA A;  3HYF A;  1OKJ A;  1WSH A;  4GKJ K;  3QDK A;  3CME N;  5GIO A;  3THV A;  4KHN A;  1NGJ A;  3CHW A;  2H3G X;  1C6V A;  5FRO A;  5BRE A;  1BHL A;  3DLK A;  3O80 A;  2P9I A;  2FXU A;  1GLF O;  1F21 A;  4FLX A;  4B9V A;  4KH5 A;  1KC8 O;  1WOQ A;  4WYB A;  3DMJ A;  2JLE A;  3VQA A;  4NYF A;  3BEX A;  3UKU A;  2DFE A;  3QET A;  1OH8 A;  3ZEU A;  3R8E A;  2Q97 A;  3MEE A;  5HRO A;  4CGF A;  3RMB A;  1NKB A;  3CQX A;  1BWF O;  3DRR A;  4H5W A;  4LSN A;  1T6C A;  2HHU A;  3SQ1 A;  4FWR A;  4UY8 O;  3WNH A;  1YVN A;  4C8O A;  5K14 A;  4R5P A;  1SKW A;  3C0B A;  2LSN A;  3NMU A;  3IG1 A;  4JLH A;  2QA4 N;  1U2V A;  3QNN A;  4M7X A;  1TL3 A;  1S6Q A;  1VSF A;  3HM8 A;  1QQN A;  1HPM A;  3F9M A;  1YXQ A;  1TK5 A;  1GLJ O;  5CYM A;  1RT1 A;  3EE9 A;  1QQC A;  3SI6 A;  4J2E A;  3MMV A;  4W5R A;  4M3U A;  2UXD K;  4DSF A;  1NGH A;  3THX B;  1S72 N;  3ATV A;  5KTQ A;  3TAP A;  3DLB A;  2Q2R A;  3VQ9 A;  4K42 A;  3AY9 A;  1JLC A;  1VQ4 N;  5AQS A;  4X65 K;  4EIA A;  2Q0R A;  4NXM K;  2G8I A;  2QWQ A;  2Z1H A;  4BRO A;  3OA9 A;  3OYC A;  5LL6 Z;  2AA4 A;  4ELT A;  3SMS A;  3WXL A;  4Z4F A;  3LAN A;  3NF9 A;  2I5J A;  3DI6 A;  2P9K B;  3DXM B;  4H5R A;  4MQ3 A;  5EU7 A;  5GAD P;  1NJX A;  2KQ2 A;  4B9U A;  4O0I A;  1HQE A;  3VGK A;  3CC4 N;  3NF7 A;  4KAZ A;  3OYF A;  4OPJ A;  1KFD A;  4FJJ A;  4MFB A;  3BF3 A;  4JKE A;  1TYQ A;  1VAZ A;  4DLE A;  3OY9 A;  3SUP A;  4DTX A;  4FVM A;  4JI4 K;  3VQP A;  4N56 A;  1Y97 A;  4H4O A;  1JLA A;  1JCF A;  1LCU A;  1NOZ A;  3CJA A;  3LM9 A;  3AAP A;  3LAK A;  3QIN A;  2YI1 A;  1IKW A;  4FJM A;  4ZTF A;  1JLF A;  1KVB A;  2XRI A;  5E26 A;  2YHX A;  3NF6 A;  4BRQ A;  4CZI A;  1S1U A;  2A3Z A;  5AQV A;  2ITM A;  3ZET A;  3MN9 A;  1S5J A;  1SKS A;  5M1K A;  1HNZ K;  4C1N K;  1L3T A;  3AO5 A;  3H3O B;  4B1X B;  2F7T A;  3MK6 A;  1JXB A;  4PKG A;  3SBG A;  4GNI A;  5A2Q O;  3VQ6 A;  4DSE A;  2BTF A;  2VQE K;  4OPH A;  4CFB A;  5ADX A;  1W0H A;  2WUS A;  3K5M A;  1HJR A;  2HNY A;  4Z0U A;  1SV5 A;  2GTD A;  2Z1I A;  3S41 A;  3CCM N;  4E7H A;  2FBY A;  3P1G A;  4FM0 A;  1N36 K;  1QQM A;  4RCH A;  3VA0 A;  3BDP A;  1NK9 A;  5GAH P;  4DLG A;  5AQI A;  5BPL A;  2ASO A;  3ULE B;  1D5A A;  3ISN C;  2VWK A;  1O13 A;  3AVF A;  3M6G A;  4IDH A;  4B3T K;  3OYE A;  4LFB K;  4DQQ A;  3NCI A;  1E4F T;  4GW6 A;  4FOE A;  2HMI A;  3LP2 A;  5EVZ A;  4ILJ A;  1Q18 A;  1NK7 A;  4ILH A;  4CGD A;  4DR4 K;  1BQN A;  4LFC K;  3S9H A;  3ZYY X;  4FK4 A;  3ZT0 A;  5LJV A;  4B1W B;  4W5T A;  1TK0 A;  4H5V A;  4A59 A;  1GLA G;  2W42 A;  1RT6 A;  2G8U A;  3VEY A;  2ZQB A;  1QSS A;  3M8Q A;  4DV4 K;  2P9K A;  3DXM A;  3QBW A;  3RVC A;  4DV0 K;  3T1Y K;  1GLD G;  1RBS A;  4KRF A;  4E3S A;  2NRZ A;  3MN5 A;  3HOS A;  3W3D A;  3SMP A;  4BDZ A;  2B4J A;  1FKO A;  3LM2 A;  2R7Y A;  4BRN A;  5FDL A;  1SKR A;  1U6Z A;  3SUO A;  1IBM K;  3ID8 A;  4FWM A;  1C0T A;  4AM7 A;  3G4S N;  4B1U B;  1YHQ N;  3KKR A;  3OS1 A;  4LD0 A;  1RDA A;  4K8X A;  1O1W A;  3RSE A;  4KHW A;  3HSC A;  1FJG K;  4W5Q A;  3J7A P;  4J2B A;  4GY2 B;  4HHT A;  3G0Z A;  1NK5 A;  4BAC A;  1YTU A;  2HHH K;  3T69 A;  1YJW N;  2UXB K;  1Q7Y O;  2YHA A;  1OVQ A;  1WBB A;  1KFS A;  1YIJ N;  3E9P A;  1A5W A;  2IVN A;  3L4Q A;  3QO9 A;  3HTV A;  5DM7 L;  3VEX A;  1U45 A;  2Q1N A;  3PY8 A;  2E5L K;  1R59 O;  5J2M A;  2AP1 A;  4E19 A;  4HTU A;  1JL1 A;  3AVA A;  3WXK A;  2D0O A;  3F73 A;  2QM1 A;  1XNQ K;  4K8Z A;  2GV9 A;  4RG8 A;  3WXJ A;  2OTJ N;  3IKM A;  4JI2 K;  4BC4 A;  4I9Q A;  4JKC A;  2YHW A;  2X78 A;  3LP0 A;  1HR0 K;  4KH6 A;  1HUX A;  3KVG A;  3PO5 A;  2ZF5 O;  4DTP A;  1NGD A;  4DKW A;  5BN8 A;  1K8K A;  5EX5 A;  4FYD A;  1WLJ A;  1C0U A;  4B1Z A;  1XMO K;  3VF4 A;  1EXQ A;  5FPE A;  2Z1G A;  1ASW A;  4E7L A;  2XY5 A;  1S6P A;  3OYG A;  3AAQ A;  3CFR A;  4LH4 A;  3CF5 L;  3ZCM A;  1BGX T;  4ISE A;  4YOV A;  2KLA A;  5C24 A;  1QTM A;  1T6D A;  4CFA A;  3S3M A;  5AQQ A;  2UU9 K;  4JYA K;  2O4I A;  4A2A A;  2UXC K;  1VSD A;  4EP5 A;  2PBD A;  3BP8 A;  3HRG A;  4DR1 K;  5I42 A;  1LAV A;  4LY7 A;  3MED A;  3KLF A;  3TI0 A;  1VQ9 N;  1KTQ A;  4CJP A;  3TAB A;  1H1V A;  3MN7 A;  3EEQ A;  4CEF A;  4XEI A;  1L3V A;  2HW3 A;  1RT4 A;  4PA1 A;  4IOX A;  4PY5 A;  3FE1 A;  1HLU A;  2P5G A;  2GX9 A;  2W41 A;  4GVM A;  4FM1 A;  3WQT A;  4Q0B A;  3DXK A;  1GLE G;  2V52 B;  3E66 A;  4QAG A;  2PYL A;  4H0T B;  3LDQ A;  3RSE B;  4CEO A;  2P9N B;  1VQP N;  2CGL A;  4NCB A;  3I8B A;  4Z4C A;  3PX4 A;  1TVR A;  5M1F A;  3A0I X;  3QEP A;  4EZ9 A;  3TAQ A;  1WSI A;  2G8K A;  1U4B A;  3CI5 A;  3DLH A;  3A5O C;  3VOV A;  1HYS A;  3CCU N;  1XHX A;  4BE1 A;  3MCP A;  4CFD A;  4XH5 A;  5FPN A;  3KLI A;  3CCJ N;  4BC3 A;  3BZK A;  1J5O A;  3QBX A;  3I55 N;  3V9X A;  3PIO L;  1BOT O;  3H46 O;  2FSJ A;  3GG4 A;  4X66 K;  4BR9 A;  1IJJ A;  3LDS A;  1TKT A;  2IDO A;  3A2F A;  1NKE A;  4YOX A;  2VGN A;  3WXI A;  4CHZ A;  3L8B A;  5J2P A;  1V4S A;  2IOC A;  4CHY A;  4CCH A;  3CCE N;  5J1E A;  5JS2 A;  4FJH A;  5C2D A;  4BGB A;  3B6P A;  1K9M O;  1WSF A;  4JK8 A;  3ZSW A;  3M3Z A;  4CJL A;  2ATQ A;  1K8K B;  2KZM A;  1WN7 A;  1BU6 O;  4FLT A;  4CE9 A;  4PKH A;  5D3G A;  1LV5 A;  4FLU A;  1J6Z A;  2OPR A;  1CZB A;  3BGR A;  4JHD B;  4DU1 A;  3LAM A;  4JKB A;  1VK0 A;  2HF4 A;  3L3U A;  4WFA L;  3OYJ A;  1UA1 A;  1X9W A;  3ZSO A;  1DT9 A;  2E6M A;  4KI6 A;  4E1N A;  2PAV A;  3SJH A;  4O8U A;  3D2E A;  4FWS A;  3VQE A;  4FK0 A;  1J53 A;  2WOM A;  4DTS A;  1VRU A;  5F1X A;  3TAG A;  1LAW A;  1U47 A;  3NHG A;  4CVN E;  4WFN L;  4B08 A;  3ZET B;  4H4M A;  4BRP A;  4JS5 A;  1IV0 A;  4FZX C;  5BN9 A;  2CGJ A;  3LWL A;  3TAR A;  2BUP A;  4OKE A;  1QVG M;  1L3S A;  3UB5 A;  1K6Y A;  4BQZ A;  4CEB A;  3CCL N;  2O8E B;  4N47 A;  2PY5 A;  3QIC A;  2ITG A;  2ZE2 A;  1T7P A;  3SPY A;  3A5M C;  5EXW A;  4FJG A;  4CZL A;  2PYJ A;  2ZJQ L;  3RR7 A;  5M1O A;  4E1J A;  1NJI O;  3GBT A;  3K5N A;  1YVU A;  4WQ5 C;  3K9J A;  1UA0 A;  2OA8 A;  2O8D A;  2E2P A;  2JGU A;  5BR8 K;  2E88 A;  3ID6 A;  4K25 A;  1S9G A;  1QE1 A;  4MDA A;  4N76 A;  4B3S K;  4O8K A;  5KQD A;  2A1S A;  4HVJ A;  2ZWH A;  4LFA K;  4NB4 A;  5DK5 A;  4CED A;  2GWJ A;  3AA3 A;  3TU5 A;  1U48 A;  3SQ0 A;  2QXL A;  3OBW A;  3SQ2 A;  3ZSV A;  3DLL L;  2HHW A;  4KH4 A;  3MXJ A;  4BY9 C;  1U49 A;  4A61 A;  1WAF A;  4IFY A;  4FLV A;  5EY4 A;  2X74 A;  4DQP A;  2YNI A;  5AQF A;  2Y1I A;  1LWC A;  1NLV A;  4NCA A;  1JLQ A;  1S9E A;  3TTC A;  3AO4 A;  5HP1 A;  3JSM A;  2FBX A;  4DV2 K;  3DM2 A;  1TV6 A;  1RT2 A;  3A5N C;  2F4V K;  1YF5 L;  2ZGY A;  5J2N A;  4I2Q A;  2YNG A;  4H8K A;  2BGG A;  4O55 A;  4DV6 K;  2OAN A;  2YHB A;  5HRN A;  3MEC A;  1RNH A;  1NGG A;  3L2W A;  4YOR A;  4Z4E A;  4CBU A;  1IBL K;  4FWO A;  1ASU A;  5JIC A;  2V7Y A;  1OH6 A;  1ZBS A;  3HPH A;  2QWL A;  3ENO A;  1S22 A;  2E20 A;  2YV0 X;  3RRG A;  2A40 A;  2WTU A;  4CF0 A;  3SK3 A;  3K2P A;  3UKU B;  3ZEU B;  4JI8 K;  4CGI A;  4BG9 A;  3WXM B;  3LP1 A;  2QWO A;  1L3U A;  2P9S B;  4Z4I A;  1CZA N;  2ZM6 K;  4KI4 A;  4OLA A;  4PUO A;  4EHT A;  3AO2 A;  1WSE A;  4M3X A;  3RMA A;  1NOY A;  5TKY A;  2XHB A;  4CJ7 A;  3K5L A;  3NF8 A;  4H0X B;  4CEZ A;  4H0O A;  4A57 A;  3THW B;  3ENH A;  4JKH A;  3J81 O;  5AQR A;  4W5N A;  2F9W A;  3VGL A;  3H6E A;  1IG9 A;  2A42 A;  3DWL A;  1REV A;  4FW2 A;  1GOC A;  3TSQ A;  3AGK A;  4DTR A;  1S1V A;  1MWK A;  3HOT A;  2D0A A;  1HNX K;  1Z05 A;  1Q9X A;  4IZ9 A;  3PIP L;  2F8T A;  3CJB A;  4AF1 A;  1EX4 A;  3J7Z O;  1Z6R A;  1VQO N;  1BQM A;  3OYI A;  3RR8 A;  4DQ8 A;  1KVC A;  4BWJ A;  1NK0 A;  4F2S A;  2G8H A;  3SUQ A;  2VWJ A;  4X62 K;  4HUG A;  4KB0 A;  3ZSQ A;  2XY7 A;  4MLH A;  3FR0 A;  3ITH A;  4Y1D A;  4FPA A;  4FLW A;  3SQ4 A;  3AA4 A;  3VQD A;  1NG9 A;  1DTQ A;  1HQU A;  2P9P A;  2HHX A;  1X9S A;  3M8P A;  3QML A;  4YOY A;  3WNF A;  3GDQ A;  1JCE A;  4FPB A;  4M3T A;  1WNS A;  3OYL A;  2IGI A;  1T03 A;  4BRE A;  4DU3 A;  3KLG A;  1G99 A;  4ZTJ A;  1BL3 A;  1RIL A;  4CES A;  3ATU A;  3C6T A;  5LMN K;  2YX6 A;  4BE0 A;  1LWF A;  3D7E O;  4IWV A;  3CM6 A;  4DV5 K;  2BAN A;  5AQZ A;  5DM6 L;  3MCA B;  2GUP A;  2FBT A;  5KPT A;  3S3N A;  3CC7 N;  1KSP A;  2CGK A;  3AV9 A;  4CER A;  3LDN A;  3NH2 A;  4KBO A;  3AVM A;  1MA9 B;  4FK2 A;  5GAE P;  4FLZ A;  5SWM A;  2I7P A;  5CE3 A;  1IKV A;  2NLX A;  3CD6 N;  3J7Y P;  1HKG A;  3QEW A;  1D9F A;  3CCV N;  2WFB A;  4CK2 A;  1L5U A;  4DMN A;  4A62 A;  3HXM A;  5JLF A;  2VQF K;  2A5X A;  3AO1 A;  3L3V A;  4BR4 A;  1RCH A;  4B8C A;  3PO4 A;  4YY3 K;  4G1Q A;  1RFQ A;  3UKR A;  4C8N A;  2NRW A;  1KAX A;  4OVL A;  3THW A;  5C10 A;  1BCO A;  1QZ5 A;  1LOT B;  3P83 D;  3THY A;  1HX1 A;  5AQL A;  1QHT A;  4YOW A;  3J8A A;  3WUH A;  5CZ2 A;  1E4G T;  1UAX A;  1OH5 A;  1VQ6 N;  5FRN A;  4AM6 A;  3C95 A;  3B8A X;  4YOT A;  2V51 B;  3BY5 A;  2KFN A;  3VET A;  1MWM A;  4JAX A;  2IIR A;  1ITG A;  4B1V A;  4CZH A;  1SZ2 A;  3O3H A;  4PWD A;  3V9Z A;  5AZJ A;  1NMN A;  1KLN A;  5C0Y A;  3NGY A;  4CJT A;  4KTQ A;  1NMD A;  4LH5 A;  1X1P A;  3VQQ A;  2O8F B;  1YAG A;  3V1R A;  3MDQ A;  2GBZ A;  2E8A A;  3NGI A;  1DGK N;  2O8C B;  1VSM A;  4IEE A;  2Q36 A;  1NK8 A;  3R9P A;  3EKU A;  3QER A;  2QK9 A;  3CQ8 A;  2NRH A;  3ZX3 A;  4BDP A;  1J5E K;  3HVT A;  3EN9 A;  1IBK K;  1TGO A;  3KK3 A;  3AVG A;  4OJR A;  1KQS M;  5HRP A;  3SBT A;  4WE1 A;  4I9L A;  1N8R O;  4B9T A;  3WNG A;  4EZ6 A;  3OS0 A;  4B9M A;  4F4K A;  3U9D A;  4M45 A;  4DG1 A;  1Q81 O;  1WAJ A;  3I8D A;  1CLQ A;  2O8E A;  1WSJ A;  1GLB G;  2VCP A;  1C1C A;  4HWI A;  3U9Z A;  4JK9 A;  4PHT X;  3H1Q A;  3M8R A;  3EYZ A;  4H0V B;  1JJ2 M;  1XI1 A;  4GKK K;  1EO1 A;  1GLC G;  5KRS A;  5BRD A;  4IKF A;  3ALY A;  2YJF A;  1ILY A;  1JLG A;  3KKS A;  4FSV A;  4IJN A;  3TAM A;  3CER A;  1QSL A;  3NH0 A;  3D0P A;  4H5T A;  2Q31 A;  2O8B A;  4JRP A;  2OYQ A;  1U2V B;  3TTD A;  1RTH A;  3QNO A;  4O4G A;  4O0J A;  3BUZ B;  1ZYQ A;  1XUP O;  5AZI A;  3O9Q A;  4Y0W A;  4XH4 A;  4BRM A;  3MXM A;  4CK3 A;  1VSH A;  1FK9 A;  3C94 A;  1KLM A;  4H5N A;  5SZT A;  1HRH A;  4W5O A;  4BRA A;  3PX6 A;  3T19 A;  2IS3 A;  3UKR B;  1Q8I A;  4QCL A;  4M41 A;  2KKZ A;  1ZBH A;  3SAF A;  3CFO A;  2KHO A;  3NFA A;  3HL8 A;  5CR4 A;  4QS7 A;  2KTQ A;  1Q82 O;  4IEI A;  1A5X A;  3FGU A;  1IKY A;  4CJW A;  1W7A A;  3VEO A;  3KD1 E;  1ZBI A;  2KFZ A;  3H08 A;  1M90 O;  2F96 A;  1NK6 A;  3HK2 A;  3H45 C;  3ZT3 A;  1KRP A;  3EKS A;  2RKI A;  2FF3 B;  4C8K A;  5M1Q A;  2FLO A;  4RWT A;  3HST B;  1T3V A;  4WQ4 A;  1RT3 A;  2HB5 A;  4GV9 A;  3WT0 A;  3VN5 A;  3SV4 A;  3MWP A;  1RBT A;  4PL7 A;  1C0F A;  3SPZ A;  4DV1 K;  4B9N A;  3VPZ A;  1W97 L;  4AH9 A;  4MO5 A;  3HBT A;  4JI1 K;  4BRG A;  3ZLJ A;  3HI0 A;  3O9T A;  3LDO A;  2OZS A;  5AJ3 K; 
#chains in the Genus database with same CATH homology
 3NHG A;  4CJU A;  1SUQ A;  1G15 A;  2JLE A;  1WSG A;  3VQA A;  4B08 A;  3QEX A;  4AHR A;  4NYF A;  1YT3 A;  3QET A;  2DFE A;  4H4M A;  3O3G A;  4JS5 A;  3ULD A;  1RBV A;  3RMC A;  4FZX C;  3KLH A;  4J2D A;  4FJ7 A;  3DRP A;  3VQ5 A;  3MEE A;  5HRO A;  4CGF A;  4E89 A;  3RMB A;  3ZT2 A;  1NKB A;  3LWL A;  3TAR A;  3LPT A;  4OKE A;  4FZY A;  1L3S A;  1K6Y A;  3DRR A;  4CEB A;  3AVN A;  1N6Q A;  4RW7 A;  4CJR A;  4LSN A;  4FJK A;  3LP3 A;  2IAJ A;  4N47 A;  2PY5 A;  2HHU A;  4HCC A;  4CF8 A;  2ITG A;  2ZE2 A;  4YNQ A;  3SPY A;  3SQ1 A;  1T7P A;  2PZS A;  2VG7 A;  5E41 A;  3V4I A;  3V6D A;  4FJG A;  3QES A;  5HBM A;  2PYJ A;  2BE2 A;  3WNH A;  1X9M A;  4IG0 A;  3RR7 A;  4FW1 A;  4RW8 A;  3U3Y A;  3RMD A;  4KO0 A;  4CHQ A;  4C8O A;  1NK4 A;  3KJV A;  5K14 A;  4F3O A;  4R5P A;  3U6F A;  3K5N A;  2Z1J A;  1SKW A;  1KCF A;  2LSN A;  1J9A A;  3IG1 A;  4EP4 A;  3TAG A;  4CJQ A;  1YVU A;  4JLH A;  1SL1 A;  1UA0 A;  2OA8 A;  1TKX A;  3QNN A;  2JGU A;  4OKJ A;  1TL3 A;  1S6Q A;  1VSF A;  4E7K A;  1C1A A;  2OPP A;  1S9G A;  1QE1 A;  4N76 A;  3K57 A;  1TK5 A;  3WNE A;  5CYM A;  1ZBL A;  2A1S A;  1RT1 A;  4HVJ A;  1QQC A;  3SI6 A;  3UIQ A;  4J2E A;  4W5R A;  4M3U A;  4CHO A;  4DSF A;  2OZS A;  4ICL A;  1T05 A;  4BDY A;  1B92 A;  3NDK A;  5KTQ A;  1I3A A;  3TAP A;  3DLB A;  1HNV A;  3VQ9 A;  5DK5 A;  4CED A;  3AA3 A;  3DLG A;  1DTT A;  3E01 A;  4UQG A;  3VQB A;  1U48 A;  1JLC A;  1HMV A;  4CGH A;  4CJS A;  5KRT A;  3CYM A;  4DTM A;  3SQ0 A;  3SQ2 A;  4DS4 A;  3ZSV A;  2G8I A;  2Z1H A;  2EX3 A;  3K58 A;  2HHW A;  4CHN A;  3OYC A;  4CFC A;  4M42 A;  4CIG A;  2VG6 A;  1W9H A;  2P51 A;  3MXJ A;  1U49 A;  4ELT A;  4DFP A;  1WAF A;  4IFY A;  4FLV A;  4AHT A;  2X74 A;  2HND A;  4DQP A;  2YNI A;  2Y1I A;  4Z4F A;  1LWC A;  3LAN A;  3NF9 A;  2I5J A;  3DI6 A;  5EU7 A;  3VQ8 A;  4MQ3 A;  1NJX A;  4C8L A;  2X6S A;  2KQ2 A;  4NCA A;  2RN2 A;  3DLR A;  1JLQ A;  4DU4 A;  4B9U A;  3T1A A;  1ZBF A;  1S9E A;  4O0I A;  3C6U A;  3V9U A;  1TKD A;  4CEE A;  1BI4 B;  1HQE A;  3AO4 A;  5HP1 A;  5C25 A;  4IFV A;  3JSM A;  3NF7 A;  2FBX A;  1LWE A;  3DM2 A;  1TV6 A;  3RTV A;  1EET A;  1RT2 A;  1VSK A;  4TSX A;  4OPJ A;  3OYF A;  5J2N A;  4I2Q A;  2A1R A;  4KAZ A;  4FJX A;  2YNG A;  1KFD A;  5DMR A;  4H8K A;  1RBU A;  4FJJ A;  5FRM A;  2BGG A;  4O55 A;  4MFB A;  1S1W A;  2YHB A;  5HRN A;  3F9K A;  3MEC A;  4DLE A;  3OY9 A;  1RNH A;  1IH7 A;  3L2W A;  3SUP A;  4DTX A;  4FVM A;  4N56 A;  4RW9 A;  3VQP A;  3OJS A;  2YNH A;  1Y97 A;  3I0R A;  4H4O A;  4Z4E A;  1JLA A;  1NOZ A;  4KTZ A;  3HO1 A;  4Z4H A;  1XC9 A;  1RTJ A;  3LAK A;  3QIN A;  4CF9 A;  1UWB A;  1ASU A;  1IKW A;  4FJM A;  4ZTF A;  1ZBU A;  1JLF A;  1KVB A;  3HPH A;  4CJ4 A;  2HHV A;  3CM5 A;  2XRI A;  3KK1 A;  1B9D A;  3NF6 A;  2YV0 X;  3RRG A;  4DSI A;  4KTW A;  1JLE A;  4CF0 A;  1S1U A;  3SZ2 A;  3K2P A;  3TR8 A;  4IDK A;  3DLE A;  4C8M A;  1S5J A;  1SKS A;  3V81 A;  4CGI A;  4CF2 A;  4N41 A;  4JS4 A;  3RRH A;  3LP1 A;  1L3T A;  3AO5 A;  5I3U A;  1L3U A;  1CXU A;  4DFJ A;  4CGJ A;  4Z4I A;  1JXB A;  4KI4 A;  4OLA A;  4PUO A;  2Y1J A;  3AO2 A;  3VQ7 A;  3ZSZ A;  1WSE A;  3VQ6 A;  2YNF A;  3HT3 A;  4DSE A;  4M3X A;  3RMA A;  4CEC A;  2OPS A;  1NOY A;  4AHV A;  2XHB A;  2FBV A;  3K5L A;  1CXQ A;  4DQR A;  4FJL A;  3NF8 A;  4CFB A;  1W0H A;  3ASM A;  1RBR A;  4CEZ A;  3K5M A;  1J54 A;  2DY4 A;  1HJR A;  4I2P A;  2HNY A;  4W5N A;  3DYA A;  3LZI A;  4Z0U A;  1NJY A;  1IG9 A;  2G8F A;  1SV5 A;  3NE6 A;  4ELU A;  4NYN A;  2Z1I A;  1REV A;  4FW2 A;  4E7H A;  3CG7 A;  3O4N A;  1GOC A;  2WON A;  2FBY A;  4AHU A;  4CIF A;  3P1G A;  4CJF A;  4FM0 A;  1A5V A;  4DTR A;  2QKB A;  1S1V A;  3IS9 A;  3VA0 A;  2HNZ A;  3B6O A;  3FFI A;  3LAL A;  3BDP A;  1NK9 A;  4DLG A;  1GOB A;  4OLB A;  1D5A A;  1RDD A;  3ISN C;  2D0A A;  3ZT1 A;  3OYM A;  1RT7 A;  2Q3S A;  3DOL A;  3NBP A;  5T7B A;  2VWK A;  3EZ5 A;  4E7J A;  1Q9Y A;  3AVF A;  1Q9X A;  4FLY A;  1JL2 A;  3K5O A;  1RDC A;  3PUF A;  3VQ4 A;  3OYE A;  3L2Q A;  2X6N A;  2F8T A;  4DQI A;  4DQQ A;  1HPZ A;  3OYB A;  3O4Q A;  1EX4 A;  1KVA A;  3NCI A;  4GW6 A;  5CZ1 A;  5KI6 A;  1JKH A;  3KTQ A;  2HMI A;  3LP2 A;  4B9L A;  1BQM A;  3OYI A;  3RR8 A;  1KVC A;  3AVC A;  3P5J A;  1TL1 A;  4CGD A;  4BWJ A;  1NK7 A;  1BQN A;  4BWM A;  1NK0 A;  2G8W A;  2G8H A;  4F2S A;  4RW6 A;  4Y1C A;  3V9W A;  1VSJ A;  3NAE A;  3SUQ A;  3S9H A;  3SJJ A;  4FK4 A;  2VWJ A;  3ZT0 A;  4KHY A;  4CJ5 A;  4HUG A;  4CJV A;  5CY4 A;  3ZSQ A;  3OVN A;  4W5T A;  1TK0 A;  2XY7 A;  4KB0 A;  5KGW A;  3SUN A;  2W42 A;  1RT6 A;  2G8U A;  4RW4 A;  1JXE A;  2ZQB A;  4Q5V A;  1QSS A;  3ITH A;  3M8Q A;  4Y1D A;  4FLW A;  2O4G A;  3SQ4 A;  3AA4 A;  3VQD A;  4BE2 A;  5HRS A;  4I7F A;  4F8R A;  4OGE A;  3PX0 A;  1DTQ A;  1HQU A;  1RBS A;  4FZZ A;  1X9S A;  4E3S A;  4KRF A;  2HHX A;  4E1M A;  3M8P A;  4CJK A;  3WNF A;  1BI4 A;  1HNI A;  4Z4G A;  3TAE A;  4M3T A;  1WNS A;  2KW4 A;  3OYL A;  3OYH A;  3HPG A;  4BDZ A;  4IBN A;  2IGI A;  3SNN A;  1T03 A;  1CZ9 A;  4DU3 A;  1NJZ A;  3KLG A;  2B4J A;  4ZTJ A;  1T8E A;  1FKO A;  2HVH A;  1BL3 A;  2FC0 A;  4ELV A;  1IO2 A;  1RIL A;  4CES A;  3C6T A;  2R7Y A;  5FDL A;  1SKR A;  4CGG A;  4M3Z A;  4BE0 A;  1LWF A;  3SUO A;  3HJF A;  4DWI A;  1EKE A;  1C0T A;  3OYN A;  3I0S A;  3CM6 A;  2DFF A;  4IG3 A;  3V1Q A;  2BDP A;  3LPU A;  3KKR A;  1VRT A;  3DRS A;  3OS1 A;  2BAN A;  2OPQ A;  3OJU A;  4LD0 A;  1RDA A;  3IAY A;  4K8X A;  1O1W A;  4KHW A;  2D0C A;  4DTJ A;  1R0A A;  1Z26 A;  2FBT A;  3OS2 A;  3S3N A;  2HHT A;  3NGZ A;  4W5Q A;  1KSP A;  3HP6 A;  1BIZ A;  3PV8 A;  4J2B A;  3AV9 A;  2E4L A;  3QEV A;  4CER A;  4B8A B;  1NJW A;  3NH2 A;  3OYD A;  4HHT A;  3G0Z A;  1NK5 A;  4BAC A;  3AVM A;  3TAN A;  1YTU A;  3L2V A;  4FK2 A;  4CEQ A;  4CIE A;  1VSI A;  4OKK A;  4FLZ A;  4KKO A;  5SWM A;  4FJ8 A;  2YHA A;  2G8V A;  1IKV A;  2P5O A;  2AJQ A;  1KFS A;  3AVH A;  3QEW A;  3ZSR A;  1D9F A;  4YFU A;  1XHZ A;  4CK2 A;  1L5U A;  4FJI A;  1A5W A;  4DMN A;  4DTN A;  3HM9 A;  3QO9 A;  3HXM A;  3V9S A;  4QOZ B;  5HLF A;  1U45 A;  3AO1 A;  3L3V A;  2YKM A;  1ASV A;  1RCH A;  4B9S A;  3PY8 A;  3ZSX A;  1TKZ A;  3MEG A;  4B8C A;  3PO4 A;  4FJ5 A;  4J2A A;  4G1Q A;  4DFK A;  1C0M A;  2ZD1 A;  4C8N A;  5J2M A;  4E19 A;  3JYT A;  4FJ9 A;  4HTU A;  4M3Y A;  1JL1 A;  4OVL A;  3LWM A;  3AVA A;  4CEA A;  3D45 A;  2GUI A;  2RF2 A;  2XO7 A;  3EY1 A;  3F73 A;  4DSL A;  1BCO A;  1DLO A;  3P83 D;  4K8Z A;  3CFP A;  2GV9 A;  4DQS A;  4RG8 A;  4HCB A;  1QHT A;  1YTA A;  3AA2 A;  4KPY A;  3M8S A;  4I9Q A;  4DTU A;  2X78 A;  3LP0 A;  5CZ2 A;  3TAF A;  4KHU A;  1S1T A;  1UAX A;  2F8S A;  3LZJ A;  3MXI A;  1QS4 A;  5FRN A;  4F2R A;  1RT5 A;  3PO5 A;  4DTP A;  3C95 A;  1TAU A;  2KFN A;  5HRR A;  3L2U A;  4FYD A;  1WLJ A;  4KHS A;  1C0U A;  1QSY A;  1EXQ A;  4O5B A;  3HPO A;  3AO3 A;  1ITG A;  3L2R A;  4ID1 A;  1BCM A;  4DF8 A;  2Z1G A;  3AVK A;  3O3H A;  1ASW A;  1Z25 A;  3QLH A;  4E7L A;  2XY5 A;  1S6P A;  3V9Z A;  4PWD A;  1KLN A;  3OYG A;  3CFR A;  3NGY A;  4LH4 A;  4CJT A;  3ZCM A;  1BGX T;  4FM2 A;  4KFB A;  4JRQ A;  4KTQ A;  4LH5 A;  1X1P A;  5C24 A;  3VQQ A;  3S3M A;  4CFA A;  1QTM A;  3V1R A;  1SL2 A;  2GBZ A;  3NGI A;  4L8R B;  2O4I A;  1VSM A;  3QEI A;  1NK8 A;  1VSD A;  4AIL C;  3AVL A;  4EP5 A;  3QER A;  1RTD A;  2B5J A;  2QK9 A;  5I42 A;  3CQ8 A;  3KLE A;  1LAV A;  4LY7 A;  1RDB A;  1MU2 A;  3MED A;  4BDP A;  3OYA A;  3KLF A;  3TI0 A;  3HVT A;  1VSL A;  4HUE A;  1KTQ A;  1TGO A;  4NCG A;  4CJP A;  3V1O A;  3KK3 A;  3G10 A;  3TAB A;  5CYQ A;  3AVG A;  4CHP A;  4OJR A;  5HRP A;  4CEF A;  5J2Q A;  2HVI A;  3TWH A;  1L3V A;  2HW3 A;  4WE1 A;  1RT4 A;  4I9L A;  3K59 A;  4FCY A;  4B9T A;  4PA1 A;  3WNG A;  4EZ6 A;  4F3T A;  3OS0 A;  4B9M A;  4F4K A;  4PY5 A;  4M45 A;  2RPI A;  3IRX A;  4DG1 A;  4B3O A;  1WAJ A;  2IC3 A;  4CK1 A;  3I8D A;  4E0D A;  1BIS A;  3VQC A;  1CLQ A;  1WSJ A;  2NUB A;  2P5G A;  1NKC A;  1C1C A;  4GVM A;  3M8R A;  3EYZ A;  3HP9 A;  4FM1 A;  4Q0B A;  4AHC A;  1XI1 A;  3MAQ A;  4QAG A;  5KRS A;  2PYL A;  4IKF A;  3ALY A;  4FXD A;  1JLG A;  1SL0 A;  3KKS A;  3NH1 A;  3U3G A;  3TAM A;  2HHQ A;  4CEO A;  1QSL A;  3NH0 A;  3D0P A;  2XY8 A;  4M3W A;  4OGC A;  2HHS A;  2OZM A;  4NCB A;  4Z4C A;  3PX4 A;  4JRP A;  3DOK A;  1RTI A;  2OYQ A;  1TVR A;  3QEP A;  1RTH A;  4EZ9 A;  3QNO A;  3TAQ A;  3KD5 E;  1EP4 A;  4DSJ A;  1WSI A;  4DF4 A;  2G8K A;  4O4G A;  2DTU A;  4O0J A;  3HVR A;  1JLB A;  4DTO A;  1U4B A;  1ZYQ A;  3DLH A;  4M3R A;  4ID5 A;  1IKX A;  3AVB A;  3KIO A;  1U47 A;  1HYS A;  2D0B A;  3SCX A;  1XHX A;  4BE1 A;  3MXM A;  4KI6 A;  4CK3 A;  4CFD A;  1VSH A;  1N5Y A;  3KLI A;  1FK9 A;  2DFH A;  3C94 A;  3QIO A;  1KLM A;  4CF1 A;  4AHS A;  4GMJ B;  3V9X A;  1J5O A;  5SZT A;  1HRH A;  4W5O A;  4E7I A;  2P1J A;  1UOC A;  4ZHR A;  1HYV A;  3PX6 A;  4HUF A;  3AVI A;  3T19 A;  2IS3 A;  3RWU A;  1D8Y A;  4CJ3 A;  3LDS A;  1Q8I A;  1TKT A;  2IDO A;  3QIP A;  3A2F A;  4M41 A;  1ZBH A;  4QCL A;  1I39 A;  3CFO A;  2XY6 A;  1NKE A;  3NFA A;  3ZSY A;  1LW2 A;  3SV3 A;  2KZZ A;  1U04 A;  3HL8 A;  4CHZ A;  1B9F A;  4PQU A;  2EHG A;  3L8B A;  2KTQ A;  1A5X A;  3OYK A;  1FKP A;  5J2P A;  2IOC A;  4O44 A;  4CHY A;  4CCH A;  4KB1 A;  5J1E A;  5JS2 A;  4FJH A;  3VA3 A;  1IKY A;  4CJW A;  5JS1 A;  3AVJ A;  4CJE A;  3KD1 E;  1ZBI A;  2D5R A;  1S1X A;  4DS5 A;  3H08 A;  2KFZ A;  2F96 A;  3B6P A;  1WSF A;  1NK6 A;  5C42 A;  3ZSW A;  4OPK A;  3SYZ A;  4DFM A;  1BIU A;  1TAQ A;  3S3O A;  3HK2 A;  1FXX A;  2VG5 A;  1D9D A;  5KGX A;  3ZT3 A;  2ATQ A;  4CJL A;  1C1B A;  1KRP A;  2E6L A;  1WN7 A;  4DSK A;  2KZM A;  2RKI A;  4FLT A;  4C8K A;  1HYZ A;  4KV8 A;  1XWL A;  4CE9 A;  4KHQ A;  3HST B;  4FJN A;  1GOA A;  1RT3 A;  2HB5 A;  1TK8 A;  5D3G A;  3T3F A;  3HYF A;  2ETJ A;  3VN5 A;  1LV5 A;  4FLU A;  3SV4 A;  1WSH A;  1RBT A;  4XIU A;  2OPR A;  3THV A;  4LSL A;  1CZB A;  3BGR A;  3SPZ A;  4DU1 A;  4KHN A;  4B9N A;  3LAM A;  1VK0 A;  2QKK A;  1C6V A;  1LW0 A;  3AA5 X;  3L3U A;  5FRO A;  3OYJ A;  1UA1 A;  1BHL A;  2E6M A;  3DLK A;  3ZSO A;  4AH9 A;  1X9W A;  4E1N A;  4KRE A;  2YKN A;  2B6A A;  1F21 A;  3ZT4 A;  3O3F A;  4N5S A;  3VQE A;  3KK2 A;  4FLX A;  2QXF A;  4B9V A;  4FK0 A;  1J53 A;  2WOM A;  4DTS A;  1VRU A;  3DMJ A;  1VSE A;  1LAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...