4CFAA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cfaA00
2ZD1A 5KI6A 4W5TA 1W0HA 1ASUA 4OLAA 4FJIA 1RDCA 2Q3SA 3L2RA 4CEDA 1CXUA 3AA2A 4FLYA 4KHNA 4KI6A 4M3YA 4CJUA 5SZTA 2HW3A 3OYDA 3DLBA 3SUQA 3DLEA 3IS9A 4H8KA 3P5JA 4B8AB 3OYJA 3L2VA 3C95A 3SQ4A 1JLAA 3PX4A 3ZSVA 3M8PA 2A1SA 5J1EA 4JRPA 1X9MA 4IG0A 3OYCA 1TKZA 2WOMA 3HL8A 1J5OA 4Q5VA 4FJ8A 3TWHA 1SKRA 1NK4A 3PO5A 1WSHA 3PO4A 1U49A 2JLEA 1HYZA 3EY1A 3SV4A 4ELVA 2RKIA 4DTNA 1NJZA 3F9KA 1L3UA 2VG5A 4PQUA 4FK0A 3TR8A 4PA1A 5FDLA 4ELUA 4BDYA 5CY4A 2RN2A 1RTHA 1WSIA 4W5RA 1A5XA 1NKCA 1JXEA 5I42A 3OY9A 4J2BA 4JS5A 1JLEA 5DK5A 1LWEA 1T03A 4NCAA 2P5GA 2Z1IA 3ASMA 3V1OA 3HT3A 1U47A 1KVCA 2FBXA 4BDZA 2DTUA 1X9SA 1BL3A 3S3MA 4FK2A 3HM9A 3CM6A 4N47A 4RW4A 2GV9A 1SKSA 3NDKA 3AO3A 3QEXA 3ITHA 3ZT2A 1WNSA 4JS4A 2FBVA 4AILC 5KTQA 1BHLA 3V9XA 3PV8A 1GOAA 3L2QA 1KSPA 1F21A 4FK4A 3LDSA 4NCGA 4CJ5A 3PX0A 2XY7A 4Z4FA 2W42A 3RRGA 4E7JA 4FZZA 4HHTA 2FBTA 4O55A 3DYAA 4DQRA 4N56A 3CQ8A 5T7BA 4DQSA 3S3OA 1G15A 3QNOA 1ZBLA 1KFSA 4F3OA 1VRUA 1REVA 1C6VA 2X6NA 1SV5A 3QINA 3LP2A 4AHVA 4CF9A 3I0RA 1IKVA 4KO0A 2HVIA 1R0AA 4I2QA 5JS1A 3A2FA 3TAMA 4CHYA 5J2PA 4FJHA 4J2EA 1FXXA 1WN7A 1IKXA 4LSLA 2HHSA 3IAYA 2HNYA 3ZSYA 2E6MA 3E01A 3ZSZA 3ZT0A 4DU3A 1QTMA 4PY5A 3ZSRA 4YFUA 2EHGA 2Z1GA 4ICLA 3OJSA 3JSMA 4FLZA 2ITGA 1Z25A 3NF8A 4C8OA 4FJLA 1LAVA 1YTAA 2XY8A 3VQQA 3ZT4A 3RMAA 2KZZA 1D9DA 4KREA 4N76A 1SUQA 4KTZA 3O3FA 4DSKA 1L3SA 1VSFA 5J2QA 4BDPA 2QKKA 1C1AA 3D45A 2HHTA 3OYNA 4CF8A 3VA0A 2KZMA 2D0BA 1YT3A 4G1QA 1EXQA 1HQEA 3VQ4A 3SQ2A 3MXIA 1WSEA 4Z0UA 2Z1JA 5KRTA 4E7IA 4FLWA 1MU2A 3DLHA 3ZSQA 3V81A 2RF2A 4CGFA 3TANA 3VQAA 1BQMA 1RT5A 3AVCA 3G0ZA 3ULDA 4DMNA 1TK5A 3DLRA 2OZSA 1XHZA 3HPHA 1Q8IA 2ZQBA 3OYGA 4FJKA 4YNQA 3T3FA 4CHZA 1IKWA 2G8FA 4TSXA 2Y1IA 4DTOA 1BISA 1NJYA 2B6AA 1NK9A 3C94A 1VSDA 4O4GA 5SWMA 3OYFA 3LAMA 5C42A 1GOBA 1RBVA 4NCBA 2QK9A 3RR7A 4NYNA 3V9ZA 1ZYQA 2F8SA 1UOCA 3NBPA 2D5RA 3KKSA 2RPIA 4CJEA 4CK2A 3SI6A 3AA3A 4AH9A 4F4KA 3LWMA 1J53A 3QEWA 3VQDA 3SZ2A 3DRRA 4F2RA 2OZMA 4DSLA 1BIZA 1DTTA 2JGUA 1W9HA 1IKYA 2IC3A 3FFIA 2YNHA 3M8RA 4KFBA 4DG1A 3K57A 4CCHA 4DU4A 2PY5A 3P83D 3AVBA 4E7HA 4CECA 4E3SA 4M3XA 3SUNA 2ZE2A 4DTMA 1RDBA 1RTJA 1VRTA 3OYMA 3RMDA 1Q9YA 3KD5E 4OKJA 1RBTA 4FW1A 1A5VA 1RT1A 4I9LA 3K59A 3L8BA 3SPZA 2KFNA 4HVJA 5KGXA 4AHUA 1XC9A 4DSFA 3MECA 3K58A 2P1JA 1L3VA 4B3OA 4CGIA 4CJPA 4AHTA 4KB0A 3NF7A 1LAWA 4DF8A 4DQQA 4L8RB 1HQUA 4CFDA 3LZIA 4DTUA 3AO1A 3AVHA 3H08A 3QEPA 4HCBA 3VA3A 4C8LA 4NYFA 5DMRA 2G8UA 2HNZA 1QS4A 1ZBUA 5FRMA 4FLXA 4M3UA 2EX3A 2IS3A 4JRQA 2D0AA 2AJQA 4LH5A 3OVNA 3QO9A 4XIUA 3C6TA 2E4LA 1U4BA 4F3TA 4CF1A 1HYSA 4BE2A 4OKKA 1L5UA 2PYJA 4LH4A 1X9WA 3ZSOA 4DSJA 2QXFA 1ITGA 5CYMA 2XY6A 4I2PA 5JS2A 1HJRA 2B4JA 3TAGA 2PYLA 3I0SA 1YVUA 1TAQA 3KK1A 2HB5A 1RT6A 1WSJA 4OGEA 3K5NA 2IOCA 1C0TA 4J2AA 3U3YA 1D9FA 1LW2A 3NFAA 2OPPA 1UWBA 1NK6A 4KTWA 3KJVA 4FCYA 3KLHA 1XWLA 2DFFA 3AV9A 3B6PA 4C8MA 4DTRA 4PUOA 4W5OA 3U3GA 3RTVA 3AVFA 3LALA 4O5BA 3LP0A 5EU7A 4CGGA 1NOYA 5FROA 5E41A 2HHUA 4DSIA 4FVMA 4FM1A 3DOLA 4DFPA 4OJRA 1KTQA 1HPZA 1TK0A 3TARA 4HCCA 4ZTFA 4IKFA 2XRIA 1J54A 2G8VA 3RR8A 4B8CA 2KFZA 2FBYA 1IH7A 1N6QA 4Z4GA 3LAKA 4C8NA 1RCHA 3CG7A 3LPTA 4DQIA 4CEFA 1EKEA 3KK3A 3OS1A 1SL0A 4KHQA 1FKOA 4GMJB 2GUIA 3RRHA 1A5WA 1JXBA 1TL3A 2YKMA 4CJQA 1SL2A 4J2DA 4CHQA 4GVMA 1ZBHA 3RWUA 3NGYA 4CESA 4OVLA 1LV5A 4HUFA 4ID1A 4CJ4A 2PZSA 3SUPA 2XHBA 3NF6A 4BE0A 2O4GA 4M45A 1KFDA 3VQ5A 4N5SA 5HLFA 2G8WA 2HMIA 4KB1A 1NK7A 1B9FA 4N41A 2NUBA 4KKOA 4MQ3A 3DLGA 3QEVA 1JKHA 1BGXT 2DFEA 3SQ0A 1S6PA 1LWCA 4M3ZA 1B92A 1S1WA 4KHWA 2X74A 3O4NA 2X6SA 4I7FA 1WAFA 1KVBA 3KKRA 3CM5A 2IGIA 3AVNA 2OPSA 1VSLA 3AVLA 4BWMA 1IG9A 1RDDA 3HP9A 1Y97A 3AO5A 3AA4A 5CYQA 2O4IA 4RW7A 1RTDA 3K2PA 2YHAA 4CK3A 1EETA 3AA5X 4F8RA 4FM2A 3KD1E 4KHSA 1UA0A 4QCLA 3WNHA 4FJJA 2G8HA 3NGIA 3ZT1A 3S9HA 3HP6A 3KLIA 3MXMA 3WNEA 4BWJA 4DFMA 3V9UA 2KW4A 3V9SA 3ZSXA 1CLQA 3NH0A 4DS4A 2GBZA 3EZ5A 5CZ2A 3OJUA 1C1CA 3SJJA 4H4MA 2HHWA 3WNGA 2WONA 1I3AA 3AO4A 4FM0A 3AVJA 1VK0A 4B08A 3RMBA 4CJSA 2P5OA 1BIUA 3VQCA 3HVTA 4QOZB 4OKEA 3NAEA 4CEBA 3HK2A 1BI4A 4CJFA 2DFHA 4CJTA 1FK9A 3EYZA 4HTUA 1BQNA 3OS2A 1KVAA 1LW0A 1RT4A 4Z4HA 4DQPA 3VQPA 1U04A 4HUEA 3G10A 3V4IA 1NKEA 1J9AA 4CF0A 3B6OA 3D0PA 3RMCA 2ETJA 3M8SA 4EZ6A 3L3UA 3UIQA 1TVRA 2F8TA 3PUFA 1JLGA 4CJVA 5HRRA 3QETA 3LP3A 4CHOA 3BDPA 4RW6A 5K14A 5HRNA 2OA8A 1KLMA 3SUOA 3V9WA 1JL1A 3HPGA 4AHCA 5KRSA 1K6YA 3THVA 1WAJA 1RT3A 5D3GA 3OYIA 1EX4A 1HNVA 1QQCA 3TAEA 1D8YA 2A1RA 5HP1A 4Y1CA 1NJXA 2HHQA 3O3GA 2IDOA 3AO2A 4CJRA 2VG7A 3MEEA 3L2WA 3SCXA 4CERA 2YNGA 4Y1DA 3TAPA 1RNHA 1ASVA 3QESA 1D5AA 3F73A 1VSMA 1S9EA 2HHXA 4LY7A 1IO2A 3HSTB 4PWDA 1QE1A 1RILA 2BGGA 4O0JA 4W5QA 1NJWA 1HRHA 1KRPA 4KTQA 3C6UA 3V6DA 4DWIA 1XHXA 1FKPA 1XI1A 1I39A 4GW6A 3ZT3A 4CJLA 4FJMA 4KAZA 1TAUA 4O44A 4DSEA 4DF4A 1U45A 2D0CA 1C0UA 2B5JA 3LPUA 1VSEA 3AVMA 4CHNA 3NF9A 1UAXA 2YHBA 3NHGA 3OYLA 5HRSA 4FJGA 3HJFA 1S1UA 2HVHA 1NOZA 4IFVA 5CZ1A 4DFKA 3S3NA 5FRNA 1L3TA 2P51A 4CIFA 3IRXA 2VG6A 3NE6A 2X78A 3DLKA 3V1QA 2FC0A 1RT7A 3DMJA 4RW9A 3MAQA 4DU1A 4B9MA 4FZYA 4RG8A 3KK2A 4CE9A 2LSNA 2YKNA 4EP4A 4FLVA 2KQ2A 1B9DA 4CJWA 3TI0A 4FJ5A 4FJXA 2KTQA 1TKTA 1S1TA 1EP4A 4ELTA 1BI4B 3MXJA 4CFCA 4F2SA 4ID5A 1CZ9A 2VWKA 3DRPA 4E7LA 1C0MA 1YTUA 4E1MA 3O3HA 3AVIA 4DTPA 4CEAA 4E1NA 4H4OA 1GOCA 3M8QA 4UQGA 4Z4EA 1JLFA 3L2UA 3VQ7A 3NH2A 4I9QA 1VSKA 3ALYA 4AHSA 3LZJA 4OLBA 2VWJA 1VSIA 4KHUA 3PX6A 1HYVA 3OYEA 4Z4IA 1RTIA 4KV8A 2HHVA 2ATQA 1DTQA 4CGJA 3DRSA 1TKXA 1WSFA 1X1PA 1N5YA 1JL2A 4CIGA 4CJKA 1ZBFA 3L3VA 3O4QA 3QNNA 2YNFA 3VN5A 3AVKA 4CEQA 1BCOA 4CEOA 4OPKA 3CFPA 3QLHA 5J2MA 4FJ7A 4B9LA 1S9GA 1T05A 4LD0A 3OYBA 4FYDA 2BANA 2Z1HA 1WSGA 3MEDA 2IAJA 3TAQA 4IFYA 2XO7A 3NCIA 1RBUA 3QEIA 1QSYA 3ISNC 2XY5A 4CJ3A 3KTQA 2OYQA 1TK8A 1RDAA 1TKDA 5J2NA 1HMVA 3HYFA 1JLBA 4B9UA 3VQEA 1JLCA 1RT2A 2OPQA 1NK8A 4E19A 1HNIA 3QIPA 4AHRA 4CFAA 1KLNA 1VSHA 3LWLA 4EZ9A 2Y1JA 4C8KA 2OPRA 4QAGA 1CXQA 3HO1A 3HPOA 1SKWA 4HUGA 1UA1A 4K8XA 4B9NA 3PY8A 2R7YA 4RW8A 2BE2A 3P1GA 4DFJA 3DM2A 3SNNA 3OYKA 4OPJA 3AVGA 4CFBA 3HXMA 3TAFA 4FLUA 4DS5A 1RBSA 4M42A 4Q0BA 3NGZA 3JYTA 3SYZA 3CFOA 3DI6A 4CK1A 2G8IA 4ZTJA 4B9VA 1U48A 2BDPA 4KRFA 3SV3A 3AVAA 4IBNA 4DLGA 4CGDA 4CF2A 1CZBA 1Z26A 3KLEA 1ZBIA 4FXDA 4E89A 1WLJA 3VQ8A 4MFBA 4M41A 1QSLA 4KPYA 4ZHRA 1BCMA 1C1BA 1SL1A 4CIEA 4BACA 2F96A 3KLFA 1S1VA 1S1XA 1LWFA 3K5OA 4DTXA 3U6FA 4M3TA 4IG3A 2DY4A 4W5NA 4M3WA 4B9TA 4OGCA 4FJNA 3VQ9A 4LSNA 4R5PA 3K5LA 3K5MA 4FJ9A 3OYHA 1KCFA 1TGOA 2E6LA 3BGRA 4DTSA 4Z4CA 4DLEA 3LP1A 3MEGA 1NK5A 3QIOA 5KGWA 4M3RA 4FZXC 3LANA 3DOKA 3CFRA 4IDKA 1ASWA 3T1AA 4CHPA 5HRPA 3OYAA 1DLOA 2G8KA 1T7PA 4KI4A 4JLHA 3ZCMA 4O0IA 5HBMA 1S5JA 1TL1A 4WE1A 3T19A 4CEEA 3KLGA 1TV6A 3ZSWA 1QHTA 2I5JA 3VQBA 4CEZA 4FLTA 3SPYA 1JLQA 4E0DA 4E7KA 4EP5A 5HROA 4K8ZA 3KIOA 4B9SA 2QKBA 3CYMA 3NH1A 3OS0A 3TABA 4KHYA 4FW2A 4CGHA 4DTJA 2YNIA 2YV0X 1O1WA 4BE1A 2HNDA 3I8DA 5C24A 3VQ6A 3IG1A 3HVRA 5I3UA 1RBRA 1Q9XA 1T8EA 3SQ1A 1QSSA 1NK0A 1VSJA 1NKBA 3WNFA 3V1RA 3QERA 5C25A 1S6QA
chains in the Genus database with same CATH superfamily
1ASUA 4X62K 1NGHA 3IMXA 3RSEB 4M3YA 5SZTA 3IS9A 3P5JA 4M63C 3ZYYX 2GX9A 3ZSVA 1TUUA 4WF9L 3M8PA 1QVFM 3OYCA 2WOMA 3HL8A 3A5OC 4Q5VA 4FJ8A 3TWHA 1C0GA 1G99A 3O6WA 4O8UA 3GG4A 4BRCA 5FLXO 3FZKA 3VENA 3EY1A 2RKIA 4PQUA 5AQXA 5M1OA 3WXIA 4A5BA 4ELUA 3O9SA 2NRVA 4FWOA 4W5RA 5M1PA 4J2BA 5EX5A 4H0OA 4JS5A 4GKJK 2NRZA 3QFPA 4OPAA 2P9PA 2P5GA 1KVCA 2FBXA 2YHWA 2DTUA 4BG8A 1VQ4N 3NDKA 2QTDA 2GTDA 1WNSA 4JK9A 4JS4A 1GOAA 4FK4A 4DV5K 4NCGA 4Z4FA 4E7JA 3CQ8A 1KFSA 1ZBLA 3QNOA 1VRUA 1REVA 1C6VA 3QINA 4IXCA 3ZX0A 4CF9A 3I0RA 5JS1A 4I2QA 4FWMA 2V7YA 4J2EA 5AQYA 1IKXA 4LSLA 2HNYA 2E6MA 4YFUA 2Z1GA 4FLZA 3NF8A 4QS8A 2P9IB 4LC9B 5BN9A 1LAVA 1YTAA 2XY8A 2E5LK 3EKSA 1P90A 4CZHA 3HBTA 4KTZA 3O3FA 4DSKA 4YHHK 2QKKA 3D45A 2HHTA 1CZAN 3BY5A 3MX2A 3OYNA 1EXQA 2JWLA 5LJVA 3SQ2A 3BF3A 2W6KA 4B3RK 4FLWA 1MU2A 3QBXA 3V81A 3TANA 3ZETB 3G0ZA 1XMQK 4DMNA 2WBNA 1XHZA 2P9SA 5C25A 3T3FA 3GE1A 5FRNA 2G8UA 1NK9A 1VSDA 5SWMA 5C42A 3RR7A 5AQJA 4IFEA 2D5RA 4AH9A 3SBTA 3LWMA 1KAYA 2YHXA 3QEWA 2OZMA 5AQIA 3THWA 4BRIA 2YI1A 2JGUA 3M8RA 4KFBA 4DG1A 3K57A 5BRFA 3D7EO 4DHYA 4E7HA 2ZE2A 1VQON 2NRHA 1RTJA 1VRTA 1RBTA 4I9LA 5AQQA 5KGXA 2GEMA 3K58A 2P1JA 1WB9A 5AQFA 4AHTA 4FK0A 1LAWA 5FPNA 4BRAA 4CFDA 4JD2B 3LZIA 3H08A 4HCBA 4WQ4A 1QS4A 3TSPA 4JI8K 2IS3A 3QO9A 4XIUA 1NGDA 4F3TA 3MWTA 4OKKA 1L5UA 2GWJA 1X9WA 4I2PA 2FXUA 3ZEUA 3NMUA 2HB5A 4OGEA 1K8AO 3K5NA 5BRHA 5EOYA 4MLEA 2KLAA 3NFAA 4FCYA 3KLHA 3AV9A 3B6PA 3RTVA 4KPYA 3AVFA 3LP0A 1T3VA 3GBTA 4FVMA 4FM1A 1HJOA 1KTQA 1HPZA 3SAGA 4AF1A 4HCCA 4IKFA 2UYTA 4UY8O 3RR8A 2WC9A 4XH1A 4AM7A 1N6QA 3LAKA 2O8EB 3CG7A 2E2PA 3ATUA 1SL0A 1NG9A 4GMJB 1SL2A 2YKMA 2P9LB 4CHQA 4NB4A 4OVLA 1LV5A 4HUFA 4JHDA 2Q2RA 3NF6A 2O4GA 3VQ5A 1ESVA 1KFDA 3UKUA 1XNRK 5GADP 5LMUK 3BZCA 3SQ0A 4LF6K 1B92A 4KHWA 3O4NA 3D2EB 3VGLA 3LDNA 4I7FA 4ISEA 3VPZA 3AVNA 2OPSA 1VSLA 2NNWA 3PSFA 3KD1E 2OTJN 4QCLA 4FJJA 3PIPL 3S9HA 4FOIA 3WNEA 4KBOA 2KW4A 3V9SA 3ZSXA 1MA9B 2UUCK 3OJUA 3WNGA 2WONA 3AO4A 4CJSA 1BIUA 4QOZB 4DQPA 1NKEA 3G10A 3V4IA 1J9AA 4EZ6A 3RMCA 3MN9A 2CGKA 2O8EA 1NGBA 4CJVA 1NWKA 2I7PA 3QETA 5JVGL 3LM2A 3R1XA 1EWQA 2ZM6K 1KLMA 3O9UA 1JL1A 3HPGA 3THVA 4YOTA 1VQ6N 2FSKA 5AQRA 1EX4A 4YOXA 3TAEA 3O3GA 3CIPA 3F9MA 3MEEA 3L2WA 2VCPA 3D2FB 3F73A 1VSMA 1S9EA 4LY7A 2A6AA 3IFRA 4Z94A 4A2BA 4O0JA 5C12A 4PL8A 4DWIA 4YY3K 1FKPA 4CJLA 1DGKN 1TAUA 1Q18A 4IJAA 1U45A 1C0UA 4CZMA 3K0SA 3OHRA 1HNZK 4NLBA 1UAXA 2YHBA 2A3ZA 3OYLA 3HI0A 3S3NA 4CIFA 3IRXA 4BRLA 4YORA 4DV1K 3KK2A 4FLVA 2YKNA 4GV6A 1XQSC 2HBJA 2KTQA 5C2FA 1EP4A 4ELTA 2YCHA 4ID5A 4IEEA 4E7LA 5AQLA 4JKDA 3AVIA 2J4RA 1OKJA 3M8QA 2UXDK 4Z4EA 5TKYA 3L2UA 3NVKA 3NH2A 1VSKA 5LY3A 3J7ZO 1TYQA 3PX6A 1HYVA 4Z4IA 2ATQA 1DTQA 4WFBL 1WSFA 1ILYA 3QNNA 1X3MA 3VN5A 4CEQA 2Z1HA 3RVCA 2IAJA 3NCIA 2AA4A 4PHTX 1RBUA 2OYQA 3M1FA 1RDAA 3LDOA 5J2NA 1XC3A 4BRFA 4B9UA 3PSIA 2OPQA 4JNEA 4K42A 1NK8A 2D1KA 1KLNA 4EZ9A 1HPMA 3HO1A 3TTCA 4Y0WA 1UA1A 4FWLA 5BREA 3OTOK 3OYKA 4OPJA 3HXMA 1T6CA 4FLUA 4DS5A 4IZ9A 4CK1A 2BDPA 3AVAA 4IBNA 1CZBA 1Z26A 3EEQA 1RDUA 3FGUA 1U2VB 1U6ZA 5FPDA 3L6QA 3KLFA 1LWFA 2D0OA 4IG3A 4M3WA 1QHAA 4B9TA 4FJ9A 3OYHA 1KCFA 3DXKB 4Z4CA 3MEGA 1NK5A 2E2QA 3QIOA 2Q0RA 4GVEA 4M3RA 5AFUA 1BO5O 3VEVA 3OYAA 1DLOA 3A0IX 1BDGA 4O0IA 3CQYA 3A8YA 1QHTA 3VQBA 3WXJA 3M5RA 4B9SA 4DCHA 1QQNA 3BP8A 3KZBA 1BOTO 2Q0UA 2YV0X 4B1XB 1X9JA 3J81O 5I3UA 1Q9XA 3U9ZA 4BROA 3U8XA 2AP1A 1NGFA 3WNFA 4IO9L 4CZJA 3QERA 5KI6A 1T44A 3LDPA 1HNXK 1RDCA 4BRDA 3M6GA 4YOWA 4B3TK 4CJUA 3DLBA 3SUQA 3OYJA 4FWRA 4CVNE 1JLAA 3DWLA 4JRPA 1X9MA 4HWIA 1TKZA 3DXMA 5AQGA 3PO4A 3LM9A 4BR7A 4RCHA 2JLEA 3U4LA 3SV4A 1S72N 1L3UA 3TR8A 5BN8A 5FDLA 2O8FA 5CY4A 3GL1A 2UU9K 3DXKA 1WSIA 1NKCA 5AQMA 5I42A 4E1JA 3OBYA 1T03A 4BRMA 3HT3A 3CM6A 3WEEB 4RW4A 1KAZA 4LFAK 3ITHA 4AILC 3CXCM 2FBVA 1BHLA 3PV8A 1IG8A 3L2QA 1N34K 3BF1A 4BVPA 1VQ8N 3SMPA 3PX0A 3RRGA 2HOEA 3DYAA 4O55A 4DQRA 4DQSA 1G15A 3HM9A 2F4VK 4AHVA 4BRKA 1R0AA 5KQDA 3TAMA 4FJHA 1FXXA 4XEIA 4K25A 1GLAG 3ZX3A 5DM6L 3IAYA 4PY5A 1ZC6A 3T1HK 3TTDA 5TKWA 3MCPA 3VEYA 3VEWA 1Z25A 2HBLA 4C8OA 3RMAA 3VQQA 1D9DA 4V19S 1L3SA 4BG9A 4CF8A 1HQEA 3MWPA 3L4QA 4Z0UA 1S3XA 4MO4A 4PKHA 3EL2A 3E66A 4CZIA 3SJHA 2ZQBA 4B1YB 5GAGP 4FWNA 2G8FA 4TSXA 4DTOA 4NO7A 3OYFA 4O4GA 2QK9A 1RBVA 3WEEA 4NCBA 2P9PB 3GOIA 4NYNA 2F8SA 1P8ZA 3C6HA 2I7NA 1NGGA 4FZYA 4ILHA 3KKSA 5IT9O 3VQDA 4F2RA 2ZF5O 4A5AA 4B9QA 4DR3K 5ADXA 1BA0A 3FFIA 4BC5A 2UXBK 2Q97A 2OANA 3AVBA 4E3SA 4CECA 2A40A 4WFAL 3RMDA 5BR8K 5BPNA 4OKJA 1E4GT 1HNWK 5BR9A 1RT1A 3L8BA 4HVJA 3O1WA 3CC4N 4DF8A 4DQQA 4DTUA 3AVHA 1W2BM 4C8LA 5C0YA 1OVQA 5DMRA 5FRMA 4M3UA 4KH6A 2D0AA 3OA9A 2AJQA 3FZFA 1V4SA 4DV6K 3CC2N 3CPEA 5KPZA 3C6TA 5F1XA 1JCFA 1EO1A 3ZSOA 4DSJA 1ITGA 3FFKB 5CYMA 3P4IA 5JS2A 2B4JA 2PYLA 1YVUA 2E1ZA 4JKBA 4IOAL 1WSJA 2P9SB 2IOCA 3P38A 3U3YA 1UWBA 1NK6A 2O8CB 1XWLA 1NOYA 3LALA 5FROA 5M1QA 3DOLA 3A5LC 1TK0A 3THWB 2XRIA 1J54A 3R9PA 2G8VA 2ZWHA 4B8CA 4BR4A 1IH7A 4DR6K 4C8NA 3LPTA 2QW9A 3OS1A 2GUIA 1KD1O 1JXBA 1ATRA 4ISGA 1BUPA 3A5MC 2RE2A 3NGYA 1ZBHA 3N4PA 1WOQA 1YUWA 3AGRA 5HLFA 4BE0A 2D0PA 2FLOA 4M45A 2VYPA 4N5SA 2G8WA 2HMIA 1WUAA 1B9FA 3E1YA 2NUBA 3UE5A 1NGIA 4YOUA 1SAZA 4BR9A 4M3ZA 2X74A 4WYBA 1SQKA 2CGLA 3BZKA 3AVLA 1RDDA 5CYQA 3AO5A 3AA4A 2O4IA 3TU5A 1RTDA 3CMEN 3AA5X 4EIAA 5GAEP 4KHSA 3LDQA 2G8HA 4MDBA 3HP6A 3KLIA 3MXMA 3S41A 1D4XA 3NH0A 2YHYA 4DS4A 3ZEUB 3EZ5A 4H0YB 5CZ2A 4DR4K 1K9MO 2O8CA 2QWOA 4H4MA 3ZX2A 4B08A 1VK0A 4OKEA 4CEBA 1LW0A 4Z4HA 2E88A 4BC2A 1U04A 4HUEA 3D0PA 5AQNA 2F8TA 1GLLO 1JLGA 3LP3A 4B1UB 1Q82O 2OA8A 4CJ7A 4CW7B 1BU6O 3V9WA 4FL9A 2NLXA 4H5RA 1HNVA 2A1RA 3UB5A 5IWAK 4BQLA 5HP1A 4Y1CA 2HF4A 2HHQA 4JHDB 5C2DA 3AO2A 4CJRA 3SCXA 3TAPA 2YNGA 3UKUB 4C1NI 1RNHA 5GIOA 3QESA 1D5AA 2HHXA 4W5QA 4CBUA 4BC4A 1W7AA 1OH6A 3R8EA 2QWNA 3THYB 3V6DA 1XHXA 1XI1A 4GW6A 4FJMA 2FF6A 1X3NA 1VSEA 1N36K 5JVHL 3BUZB 3EE9A 3SMSA 2CGJA 3ENOA 3CHWA 3J7AP 2HVHA 1M1KO 4WQ5C 4IFVA 5CZ1A 2DPNA 1L3TA 3D6RA 1VQMN 3V1QA 3DMJA 2P9KB 4RG8A 4BGBA 4EP4A 5CE3A 3HZ6A 4FJ5A 4FJXA 4BRGA 3W3DA 3O9RA 1GLFO 1SZ2A 4H5VA 4E1NA 4H4OA 1JLFA 4PKIA 4XH5A 3LZJA 3C7NA 1VSIA 2EWSA 3H1VX 4IOXA 1ATNA 4B1ZA 4KV8A 2HHVA 4CGJA 3O9TA 3DRSA 1NBWA 1X1PA 4ISFA 4CJKA 5AQKA 3H3OB 3QMLA 3CJ9A 3CFPA 4CEOA 2UUAK 4A2AA 4LD0A 2F7TA 2BANA 4YDUC 1QSYA 4IFYA 3KTQA 2XY5A 3P31A 1TKDA 3THYA 3E9OA 1HMVA 3HYFA 3VQEA 1RT2A 1Q86O 4DR5K 4CFAA 3MDQA 1S22A 1YVNA 2OPRA 5AJ3K 4NXMK 4HUGA 4K8XA 3PY8A 2R7YA 3P1GA 3DM2A 2P9UA 5JLHA 1WBBA 4M42A 3JYTA 3FR0A 3ULEA 2P9KA 4DLGA 1KC8O 4LF4K 4E89A 1WLJA 4BRNA 4O5FA 3MX5A 4MFBA 5KPRA 4CIEA 4BACA 2F96A 3I8BA 1S1VA 4M3TA 3N4QA 1YITN 1Z6RA 4W5NA 5M1NA 4DR2K 4FJNA 3K5MA 2NZTA 3EN9A 3K5LA 1TGOA 4DLEA 3LP1A 3H46O 1I94K 2YX6A 3DOKA 4IWVA 4JKAA 4IOCL 1ASWA 3T1AA 1TYQB 5HBMA 4WE1A 5AR0A 3ZSWA 4FLTA 4LF5K 4K8ZA 5HROA 1YF5L 3KIOA 3T1YK 1YHQN 3CYMA 3NH1A 4KHYA 4DTJA 2YNIA 1HR0K 2UUBK 1O1WA 2F9TA 4BE1A 3JXUA 2WTUA 3ID8A 2HNDA 3I8DA 4B1WB 3IG1A 5EY4A 5B8HA 3CQXA 1QSSA 4BR5A 1NKBA 3DAWA 4W5TA 1J6ZA 3K9JA 4FJIA 2Q3SA 3L2RA 4CEDA 3AA2A 4FLYA 4KHNA 4KI6A 4KH5A 2HW3A 3OYDA 3CCEN 1Z05A 3DLEA 3L2VA 3C95A 5AZIA 2HF3A 3PX4A 2A1SA 5J1EA 2FSNA 4IG0A 3DJCA 2UXCK 1VQPN 1NK4A 1WSHA 1U49A 4PKGA 5AQSA 4FWQA 4ELVA 1NJZA 4DTNA 4PA1A 4A62A 3CC7N 1FW6A 1RGIA 2NRRA 1JXEA 4YOVA 2Z1IA 3ASMA 4BDZA 1X9SA 1BL3A 3S3MA 2GV9A 1NGJA 4C23A 3CCQN 3VOVA 3V9XA 1KSPA 2O8BB 5C10A 4IDHA 4CJ5A 3WXLA 2W42A 2ZJRL 4FZZA 3HOSA 3S3OA 5C15A 3O1BA 2X6NA 3SYZA 5JMVA 4H0TB 4KO0A 2HVIA 4JI4K 4CHYA 3EZWA 1WN7A 1NGAA 3ZSZA 3ZT0A 4DU3A 3ID6A 1QTMA 4CD1A 3ZSRA 2EHGA 4BY9C 3ZT4A 2KZZA 4N76A 1GLJO 2KHOA 1RDWX 1K8KB 5J2QA 1C1AA 1BA1A 3UKRA 2KZMA 2D0BA 4G1QA 3VQ4A 3MXIA 1WSEA 5KRTA 4E7IA 3DXMB 1GLDG 3VTIA 4RWTA 3ZSQA 2RF2A 4CGFA 2QWPA 2PAVA 1RT5A 3CPWM 2OZSA 3HPHA 2O8FB 1Q8IA 3OYGA 4CI6A 4FJKA 4H5TA 4YNQA 1IKWA 1MWKA 2Y1IA 1BISA 1GOBA 2V51B 3CMAN 4YOYA 4H5NA 3J7YP 3KWGA 1UOCA 3SI6A 4F4KA 1DEJA 2RPIA 4KHPK 1C0FA 3AA3A 2O8BA 3DRRA 1BIZA 4H0XB 4M7YA 2IC3A 5AFUH 2YNHA 5CR4A 1V4TA 4JI2K 4DU4A 3Q7CA 2PY5A 3P83D 4DTMA 1Q9YA 3KD5E 3OYMA 4LFCK 4FW1A 2KFNA 3K59A 4JI7K 4GNIA 4AHUA 3MECA 4DKWA 1L3VA 4B3OA 4M7XA 4K0KK 1YIJN 4CJPA 3WT0A 4KB0A 3NF7A 3VEZA 1YI2N 2HSTA 4LFBK 3SAHA 3AO1A 3VA3A 1K8KA 2V7ZA 1VQ9N 4JV5K 3I33A 2HNZA 5CHIA 1ZBUA 4FLXA 4JRQA 1QQOA 3T69A 3MN5A 4LH5A 4BRPA 3F2KA 2E4LA 1U4BA 1HYSA 4BE2A 4BGAA 2JWKA 5GINA 4LF9K 1GLEG 4FWSA 4I6MA 4IO8A 5AQHA 3HM8A 3CCMN 2XY6A 4QS7A 2QXLA 1HJRA 3TAGA 1VQKN 2A5XA 3I0SA 4AQYK 3KK1A 1RT6A 2NRWA 3A5NC 4F9OA 4BC3A 1LW2A 2OPPA 4B3SK 4KTWA 3KJVA 2DFFA 3L4IA 4DTRA 2YJFA 4W5OA 5AQVA 3WUHA 1KAXA 4O5BA 4CGGA 5EU7A 2HHUA 4DFPA 4OJRA 5KPTA 4WFNL 3TARA 4ZTFA 4CZEA 4WCEL 2ASMA 2FBYA 4Z4GA 3PIOL 1EKEA 4KHQA 5EXWA 4OX9K 5E26A 1JJ2M 3MN6A 4KH4A 3RRHA 4J2DA 4GVMA 3RWUA 4CESA 1YJNN 2HMPA 2HHHK 4ID1A 2PZSA 3SUPA 2ZGZA 2XHBA 1NGEA 4BRQA 3DLGA 5M1FA 1BGXT 3ENBA 1S6PA 1S1WA 4DUYK 1KVBA 3CM5A 2IGIA 2BTFA 4BWMA 1IG9A 3CJAA 1Y97A 3HP9A 4RW7A 2YHAA 4CK3A 1EETA 4PL7A 2QWLA 3ZT1A 5AQTA 2O8DA 3T7ZA 1CLQA 3L0QA 4JKHA 4IEIA 2GWKA 3J8AA 5FPEA 3NAEA 4DQ8A 3SAFA 1BI4A 3FLCO 4CJFA 5LL6Z 2DFHA 4CJTA 4HTUA 1BQNA 1KVAA 4DQIA 4G9ZA 4CF0A 1E3MA 3M8SA 1IBLK 2CH6A 3L3UA 1TVRA 5ELZA 2FSJA 3PUFA 5HRRA 3OW2M 1NM1A 4CHOA 4RW6A 5K14A 2PBDA 4AHCA 4JAXA 1K6YA 5D3GA 3OYIA 1QQCA 3QDKA 4CD3A 4X65K 1NJXA 4EHUA 5ADXH 3WQTA 3OBWA 3CETA 3CERA 4PWDA 1NU0A 4FVUA 1RILA 2BGGA 1KRPA 3SLCA 4KTQA 3WXMB 4WQ4C 2E1YA 2VQEK 3MK6A 4KAZA 3CI5A 4MO5A 3HOTA 4DF4A 4A57A 2B5JA 4H03B 3FE1A 2QM1A 4H0VB 1TUYA 1Q81O 1YJWN 3NHGA 1WBDA 5HRSA 4FJGA 3IUCA 5BPMA 1S1UA 4NLCA 3HJFA 3G71N 1NOZA 5AQZA 2P51A 4LF8K 4DFMA 3DLKA 2FC0A 1RT7A 4RW9A 3MAQA 3U9DA 2E8AA 4CE9A 2LSNA 4R79A 1RFQA 5F2RA 2KQ2A 4CJWA 3HTVA 1XUPO 2IIRA 3TI0A 1TKTA 2RHKA 4CFCA 4F2SA 1M90O 3H1QA 1C0MA 1YTUA 3VMFB 3O3HA 5AZJA 1QZ5A 2F9WA 3MN7A 4UQGA 5AQPA 4I9QA 3ALYA 4LF7K 1LCUA 3TSQA 5LJWA 4KHUA 2OCEA 3OYEA 1RTIA 3F5TA 4AM6A 1TKXA 1Q7YO 1JL2A 2P9NA 3G25A 3LDLA 3MMVA 4J8FA 1HX1A 3AVKA 4OPKA 4GV3A 4ILJA 4B9LA 1S9GA 3VERA 1T05A 3OYBA 4FYDA 1HUXA 1MDUB 1HKGA 3TAQA 3HRGA 3QEIA 3VEOA 3QICA 2HBMA 2ZJPL 1JLCA 1HNIA 1QZ6A 3CJ1A 2BUPA 3QIPA 4AHRA 1VSHA 2QWRA 4C8KA 3RSEA 1SKWA 1VQNN 3HSCA 4DFJA 2BE2A 3SNNA 4DV2K 4CFBA 1RBSA 3CFOA 3H3NO 3TTFA 4B9VA 1U48A 4KRFA 3SV3A 1N32K 2IVNA 4ZHRA 1BCMA 1C1BA 1S1XA 3K5OA 3U6FA 4O8KA 3CJ7A 2ASOA 3K9KA 4OGCA 3VQ9A 5MLCQ 2E6LA 4DTSA 2FF3B 5KGWA 3CFRA 4JKEA 4CHPA 2G8KA 1QVGM 3C7NB 1T7PA 4KI4A 3ZCMA 3ATVA 1TL1A 3T19A 3KLGA 1VQ5N 4CEEA 1TV6A 4CBWA 3SPYA 1JLQA 4E0DA 4E7KA 3O9QA 2QKBA 3OS0A 4CGHA 3HVRA 4DR7K 1RBRA 1NK0A 1K73O 1NLVA 3V1RA 2Z1JA 4BREA 2ZD1A 1W0HA 3QB0A 4OLAA 3CCSN 1N8RO 2P9IA 3E9LA 1NJIO 1CXUA 3DLLL 4OO1J 4FO0A 4H8KA 4B8AB 5KQ8A 3SQ4A 2P9UB 3VF6A 3ULEB 1SS6A 1J5OA 4X64K 4JI5K 1SKRA 1J5EK 3PO5A 3EKUA 3SK3A 2E2NA 4EHTA 3QBWA 1HYZA 3PLAA 3ZETA 3CJCA 3F9KA 2VG5A 3O8MA 4BDYA 2RN2A 1RTHA 1A5XA 3OY9A 1JLEA 5DK5A 1LWEA 3W0LA 2OTLN 4NCAA 2QWMA 1NGCA 2Q31A 3V1OA 1U47A 4GV9A 3IKMA 4GY2B 5EVZA 4FK2A 4N47A 1SKSA 3QEXA 3AO3A 1NMNA 2E2OA 3ZT2A 4DV4K 3I56N 4A61A 5KTQA 2H3GX 3M3ZA 1IBMK 1F21A 3LDSA 4BR0A 2XY7A 4HHTA 2FBTA 1KXPA 4N56A 5T7BA 5I9EB 4F3OA 2VWJA 1SV5A 3LP2A 1IKVA 1DT9A 3TSUA 2QI2A 3A2FA 4FPAA 5FPMA 5J2PA 2BH1A 5JICA 3AGKA 3LL3A 2HHSA 1HKCA 3ZSYA 3E01A 5HL7L 2VQFK 2ZGYA 3JSMA 1NMDA 4ICLA 3OJSA 2ASPA 2ITGA 1JCGA 4FJLA 3C0BA 1Y64A 4JD2A 2KKZA 4KREA 1N33K 1SUQA 5AZIB 1VSFA 3E9PA 4BDPA 1JCEA 2VWBA 5A2QO 2CH5A 3VA0A 1EQYA 1YT3A 1ATSA 3C6AA 1MWMA 3DLHA 4EFHA 3VQAA 3R6MA 3R3LA 1BQMA 3AVCA 3JAMO 3ULDA 1TK5A 1H1VA 3DLRA 4QS9A 4CHZA 3FZLA 2QA4N 1NJYA 2B6AA 3C94A 3LAMA 3H6EA 3TPQA 3V9ZA 1ZYQA 1XNQK 4JN4A 4CJEA 3NBPA 1GLBG 4CK2A 1J53A 2VGNA 3SZ2A 3C65A 1DTTA 1W9HA 1IKYA 5AQUA 4CCHA 4DV0K 4FWPA 1XMOK 4M3XA 4JK7A 3SUNA 2P9LA 4DB3A 1RDBA 3SPZA 1A5VA 3KVGA 1XC9A 4DSFA 3SBGA 3WQUA 4CGIA 4L8RB 4JEPA 1HQUA 2GUPA 2WUSA 4BVOA 3QEPA 3D2EA 4NYFA 3CJBA 4L3QA 2EX3A 5M1KA 3UKRB 3OVNA 3EE8A 4CF1A 1OH7A 5GIPA 5F0XA 2PYJA 4WQ5A 4LH4A 2NRTA 2QXFA 3CCLN 1BG3A 4MLHA 4MDAA 1TAQA 2V52B 4JK8A 2W6LA 1C0TA 1ZBSA 4J2AA 1D9FA 2QEXN 3Q7BA 4C8MA 4JI0K 4PUOA 3U3GA 3EO3A 5BPLA 5LMNK 5E41A 4DSIA 2VGMA 1ZXOA 2KFZA 4DR1K 3AARA 3O4WA 3CCVN 3GDQA 1HKBA 1RCHA 4CEFA 1OVYA 4A59A 3KK3A 4JI1K 1FKOA 1A5WA 1TL3A 4CJQA 1VAZA 1O13A 4NXNK 3JS6A 4JI3K 4CJ4A 4YDUA 1KQSM 3D2FA 4KB1A 4H5WA 2NRXA 4JKCA 1NK7A 4N41A 2Q36A 4KKOA 4MQ3A 4JI6K 3P39A 3QEVA 1JKHA 2DFEA 1OH8A 1LWCA 4JKFA 3ZLJA 2X6SA 1WAFA 3O80A 3KKRA 2HBKA 4CBXA 3IDHA 4U67L 3K2PA 1NNEA 4JYAK 4B3MK 4F8RA 4FM2A 1UA0A 5GAHP 1DKGD 3WNHA 3NGIA 1IBKK 5HOOA 4BWJA 4I6MB 3V9UA 2A41A 2GBZA 4IJNA 3WXKA 4K43A 1C1CA 3SJJA 2HHWA 3VEXA 1I3AA 4FM0A 3AVJA 3RMBA 2P5OA 3VQCA 3HVTA 3G6EN 3HK2A 1FK9A 3EYZA 3OS2A 4CZGA 1RT4A 4FSVA 3VQPA 3FZMA 3B6OA 4BRHA 2ETJA 4JKGB 3UIQA 3VGMA 3VTHA 3QFUA 3BDPA 4H0PA 5HRNA 3SUOA 3KWIA 2W40A 5KRSA 4U7BA 1WAJA 1RT3A 1D8YA 4X66K 4DV3K 2IDOA 3I55N 1IV0A 2VG7A 4CERA 4Y1DA 1ASVA 4FWKA 5AQWA 1IO2A 4FPBA 3HSTB 3MCAB 1QE1A 2ZJQL 1NJWA 1HRHA 3C6UA 5JLFA 4ILGB 1I39A 3ZT3A 4HTLA 4O44A 4DSEA 5H1SQ 2D0CA 3LPUA 3AAQA 3AVMA 4CHNA 2IVOA 3NF9A 1VHXA 1FJGK 2O8DB 2PFUA 3FZHA 3BEXA 5AQOA 4K41A 4RTFD 4DFKA 3CD6N 3NE6A 1BWFO 2VG6A 2X78A 2GELA 4B9MA 4DU1A 1U2VA 4GKKK 1B9DA 4CZFA 1S1TA 1BI4B 3MXJA 2D4WA 1YJ9N 1CZ9A 2VWKA 3DRPA 3THXB 4JKGA 4E1MA 4DTPA 4CEAA 1E4FT 3ENHA 1GOCA 1LOTB 3VQ7A 3O08A 3J80O 4AHSA 2W41A 4OLBA 3CF5L 3B8AX 1R59O 1N5YA 4CIGA 1ZBFA 3L3VA 3O4QA 3O5BA 2YJEA 4B1VA 2YNFA 1EWRA 1BCOA 3AY9A 3QLHA 4DV7K 5J2MA 4FJ7A 4BQZA 3CCJN 4DUZK 1YXQA 4EAHD 1WSGA 3MEDA 2XO7A 1YAGA 3ISNC 4CJ3A 1W97L 1TK8A 3VF2A 1JLBA 4E19A 1VQ7N 3LWLA 2Y1JA 3G4SN 4QAGA 1CXQA 3HPOA 4B9NA 4RW8A 3VGKA 3AVGA 3TAFA 4Q0BA 4CZKA 3NGZA 3DI6A 2G8IA 4ZTJA 3VESA 4CGDA 4CF2A 3KK7A 3KLEA 5BRDA 1ZBIA 4FXDA 1T6DA 3VQ8A 4M41A 1VQLN 1QSLA 1SL1A 4XH4A 4DTXA 3CCUN 5E84A 2DY4A 3THXA 1OH5A 2QWQA 4R5PA 3AAPA 4LSNA 3BGRA 2A42A 5AZJB 3NVMA 4FOEA 4FZXC 3LANA 3H45C 4BR2A 3VF4A 4CZLA 4IDKA 5HRPA 3KHYA 4OPHA 4JLHA 4C1NK 2WFBA 1QQMA 1S5JA 4DSLA 2I5JA 4CEZA 3VETA 3CCRN 4EP5A 2P9NB 2ITMA 3TABA 4FW2A 1IJJA 1GLCG 2Q1NA 5DM7L 5C24A 3VQ6A 1T8EA 1HLUA 3SQ1A 1VSJA 2IVPA 2E20A 1S6QA
chains in the Genus database with same CATH topology
2ZD1A 5KI6A 4W5TA 1W0HA 1ASUA 4OLAA 4FJIA 1RDCA 2Q3SA 3L2RA 4CEDA 1CXUA 3AA2A 4FLYA 4KHNA 4KI6A 4M3YA 4CJUA 5SZTA 2HW3A 3OYDA 3DLBA 3SUQA 3DLEA 3IS9A 4H8KA 3P5JA 4B8AB 3OYJA 3L2VA 3C95A 3SQ4A 1JLAA 3PX4A 3ZSVA 3M8PA 2A1SA 5J1EA 4JRPA 1X9MA 4IG0A 3OYCA 1TKZA 2WOMA 3HL8A 1J5OA 4Q5VA 4FJ8A 3TWHA 1SKRA 1NK4A 3PO5A 1WSHA 3PO4A 1U49A 2JLEA 1HYZA 3EY1A 3SV4A 4ELVA 2RKIA 4DTNA 1NJZA 3F9KA 1L3UA 2VG5A 4PQUA 4FK0A 3TR8A 4PA1A 5FDLA 4ELUA 4BDYA 5CY4A 2RN2A 1RTHA 1WSIA 4W5RA 1A5XA 1NKCA 1JXEA 5I42A 3OY9A 4J2BA 4JS5A 1JLEA 5DK5A 1LWEA 1T03A 4NCAA 2P5GA 2Z1IA 3ASMA 3V1OA 3HT3A 1U47A 1KVCA 2FBXA 4BDZA 2DTUA 1X9SA 1BL3A 3S3MA 4FK2A 3HM9A 3CM6A 4N47A 4RW4A 2GV9A 1SKSA 3NDKA 3AO3A 3QEXA 3ITHA 3ZT2A 1WNSA 4JS4A 2FBVA 4AILC 5KTQA 1BHLA 3V9XA 3PV8A 1GOAA 3L2QA 1KSPA 1F21A 4FK4A 3LDSA 4NCGA 4CJ5A 3PX0A 2XY7A 4Z4FA 2W42A 3RRGA 4E7JA 4FZZA 4HHTA 2FBTA 4O55A 3DYAA 4DQRA 4N56A 3CQ8A 5T7BA 4DQSA 3S3OA 1G15A 3QNOA 1ZBLA 1KFSA 4F3OA 1VRUA 1REVA 1C6VA 2X6NA 1SV5A 3QINA 3LP2A 4AHVA 4CF9A 3I0RA 1IKVA 4KO0A 2HVIA 1R0AA 4I2QA 5JS1A 3A2FA 3TAMA 4CHYA 5J2PA 4FJHA 4J2EA 1FXXA 1WN7A 1IKXA 4LSLA 2HHSA 3IAYA 2HNYA 3ZSYA 2E6MA 3E01A 3ZSZA 3ZT0A 4DU3A 1QTMA 4PY5A 3ZSRA 4YFUA 2EHGA 2Z1GA 4ICLA 3OJSA 3JSMA 4FLZA 2ITGA 1Z25A 3NF8A 4C8OA 4FJLA 1LAVA 1YTAA 2XY8A 3VQQA 3ZT4A 3RMAA 2KZZA 1D9DA 4KREA 4N76A 1SUQA 4KTZA 3O3FA 4DSKA 1L3SA 1VSFA 5J2QA 4BDPA 2QKKA 1C1AA 3D45A 2HHTA 3OYNA 4CF8A 3VA0A 2KZMA 2D0BA 1YT3A 4G1QA 1EXQA 1HQEA 3VQ4A 3SQ2A 3MXIA 1WSEA 4Z0UA 2Z1JA 5KRTA 4E7IA 4FLWA 1MU2A 3DLHA 3ZSQA 3V81A 2RF2A 4CGFA 3TANA 3VQAA 1BQMA 1RT5A 3AVCA 3G0ZA 3ULDA 4DMNA 1TK5A 3DLRA 2OZSA 1XHZA 3HPHA 1Q8IA 2ZQBA 3OYGA 4FJKA 4YNQA 3T3FA 4CHZA 1IKWA 2G8FA 4TSXA 2Y1IA 4DTOA 1BISA 1NJYA 2B6AA 1NK9A 3C94A 1VSDA 4O4GA 5SWMA 3OYFA 3LAMA 5C42A 1GOBA 1RBVA 4NCBA 2QK9A 3RR7A 4NYNA 3V9ZA 1ZYQA 2F8SA 1UOCA 3NBPA 2D5RA 3KKSA 2RPIA 4CJEA 4CK2A 3SI6A 3AA3A 4AH9A 4F4KA 3LWMA 1J53A 3QEWA 3VQDA 3SZ2A 3DRRA 4F2RA 2OZMA 4DSLA 1BIZA 1DTTA 2JGUA 1W9HA 1IKYA 2IC3A 3FFIA 2YNHA 3M8RA 4KFBA 4DG1A 3K57A 4CCHA 4DU4A 2PY5A 3P83D 3AVBA 4E7HA 4CECA 4E3SA 4M3XA 3SUNA 2ZE2A 4DTMA 1RDBA 1RTJA 1VRTA 3OYMA 3RMDA 1Q9YA 3KD5E 4OKJA 1RBTA 4FW1A 1A5VA 1RT1A 4I9LA 3K59A 3L8BA 3SPZA 2KFNA 4HVJA 5KGXA 4AHUA 1XC9A 4DSFA 3MECA 3K58A 2P1JA 1L3VA 4B3OA 4CGIA 4CJPA 4AHTA 4KB0A 3NF7A 1LAWA 4DF8A 4DQQA 4L8RB 1HQUA 4CFDA 3LZIA 4DTUA 3AO1A 3AVHA 3H08A 3QEPA 4HCBA 3VA3A 4C8LA 4NYFA 5DMRA 2G8UA 2HNZA 1QS4A 1ZBUA 5FRMA 4FLXA 4M3UA 2EX3A 2IS3A 4JRQA 2D0AA 2AJQA 4LH5A 3OVNA 3QO9A 4XIUA 3C6TA 2E4LA 1U4BA 4F3TA 4CF1A 1HYSA 4BE2A 4OKKA 1L5UA 2PYJA 4LH4A 1X9WA 3ZSOA 4DSJA 2QXFA 1ITGA 5CYMA 2XY6A 4I2PA 5JS2A 1HJRA 2B4JA 3TAGA 2PYLA 3I0SA 1YVUA 1TAQA 3KK1A 2HB5A 1RT6A 1WSJA 4OGEA 3K5NA 2IOCA 1C0TA 4J2AA 3U3YA 1D9FA 1LW2A 3NFAA 2OPPA 1UWBA 1NK6A 4KTWA 3KJVA 4FCYA 3KLHA 1XWLA 2DFFA 3AV9A 3B6PA 4C8MA 4DTRA 4PUOA 4W5OA 3U3GA 3RTVA 3AVFA 3LALA 4O5BA 3LP0A 5EU7A 4CGGA 1NOYA 5FROA 5E41A 2HHUA 4DSIA 4FVMA 4FM1A 3DOLA 4DFPA 4OJRA 1KTQA 1HPZA 1TK0A 3TARA 4HCCA 4ZTFA 4IKFA 2XRIA 1J54A 2G8VA 3RR8A 4B8CA 2KFZA 2FBYA 1IH7A 1N6QA 4Z4GA 3LAKA 4C8NA 1RCHA 3CG7A 3LPTA 4DQIA 4CEFA 1EKEA 3KK3A 3OS1A 1SL0A 4KHQA 1FKOA 4GMJB 2GUIA 3RRHA 1A5WA 1JXBA 1TL3A 2YKMA 4CJQA 1SL2A 4J2DA 4CHQA 4GVMA 1ZBHA 3RWUA 3NGYA 4CESA 4OVLA 1LV5A 4HUFA 4ID1A 4CJ4A 2PZSA 3SUPA 2XHBA 3NF6A 4BE0A 2O4GA 4M45A 1KFDA 3VQ5A 4N5SA 5HLFA 2G8WA 2HMIA 4KB1A 1NK7A 1B9FA 4N41A 2NUBA 4KKOA 4MQ3A 3DLGA 3QEVA 1JKHA 1BGXT 2DFEA 3SQ0A 1S6PA 1LWCA 4M3ZA 1B92A 1S1WA 4KHWA 2X74A 3O4NA 2X6SA 4I7FA 1WAFA 1KVBA 3KKRA 3CM5A 2IGIA 3AVNA 2OPSA 1VSLA 3AVLA 4BWMA 1IG9A 1RDDA 3HP9A 1Y97A 3AO5A 3AA4A 5CYQA 2O4IA 4RW7A 1RTDA 3K2PA 2YHAA 4CK3A 1EETA 3AA5X 4F8RA 4FM2A 3KD1E 4KHSA 1UA0A 4QCLA 3WNHA 4FJJA 2G8HA 3NGIA 3ZT1A 3S9HA 3HP6A 3KLIA 3MXMA 3WNEA 4BWJA 4DFMA 3V9UA 2KW4A 3V9SA 3ZSXA 1CLQA 3NH0A 4DS4A 2GBZA 3EZ5A 5CZ2A 3OJUA 1C1CA 3SJJA 4H4MA 2HHWA 3WNGA 2WONA 1I3AA 3AO4A 4FM0A 3AVJA 1VK0A 4B08A 3RMBA 4CJSA 2P5OA 1BIUA 3VQCA 3HVTA 4QOZB 4OKEA 3NAEA 4CEBA 3HK2A 1BI4A 4CJFA 2DFHA 4CJTA 1FK9A 3EYZA 4HTUA 1BQNA 3OS2A 1KVAA 1LW0A 1RT4A 4Z4HA 4DQPA 3VQPA 1U04A 4HUEA 3G10A 3V4IA 1NKEA 1J9AA 4CF0A 3B6OA 3D0PA 3RMCA 2ETJA 3M8SA 4EZ6A 3L3UA 3UIQA 1TVRA 2F8TA 3PUFA 1JLGA 4CJVA 5HRRA 3QETA 3LP3A 4CHOA 3BDPA 4RW6A 5K14A 5HRNA 2OA8A 1KLMA 3SUOA 3V9WA 1JL1A 3HPGA 4AHCA 5KRSA 1K6YA 3THVA 1WAJA 1RT3A 5D3GA 3OYIA 1EX4A 1HNVA 1QQCA 3TAEA 1D8YA 2A1RA 5HP1A 4Y1CA 1NJXA 2HHQA 3O3GA 2IDOA 3AO2A 4CJRA 2VG7A 3MEEA 3L2WA 3SCXA 4CERA 2YNGA 4Y1DA 3TAPA 1RNHA 1ASVA 3QESA 1D5AA 3F73A 1VSMA 1S9EA 2HHXA 4LY7A 1IO2A 3HSTB 4PWDA 1QE1A 1RILA 2BGGA 4O0JA 4W5QA 1NJWA 1HRHA 1KRPA 4KTQA 3C6UA 3V6DA 4DWIA 1XHXA 1FKPA 1XI1A 1I39A 4GW6A 3ZT3A 4CJLA 4FJMA 4KAZA 1TAUA 4O44A 4DSEA 4DF4A 1U45A 2D0CA 1C0UA 2B5JA 3LPUA 1VSEA 3AVMA 4CHNA 3NF9A 1UAXA 2YHBA 3NHGA 3OYLA 5HRSA 4FJGA 3HJFA 1S1UA 2HVHA 1NOZA 4IFVA 5CZ1A 4DFKA 3S3NA 5FRNA 1L3TA 2P51A 4CIFA 3IRXA 2VG6A 3NE6A 2X78A 3DLKA 3V1QA 2FC0A 1RT7A 3DMJA 4RW9A 3MAQA 4DU1A 4B9MA 4FZYA 4RG8A 3KK2A 4CE9A 2LSNA 2YKNA 4EP4A 4FLVA 2KQ2A 1B9DA 4CJWA 3TI0A 4FJ5A 4FJXA 2KTQA 1TKTA 1S1TA 1EP4A 4ELTA 1BI4B 3MXJA 4CFCA 4F2SA 4ID5A 1CZ9A 2VWKA 3DRPA 4E7LA 1C0MA 1YTUA 4E1MA 3O3HA 3AVIA 4DTPA 4CEAA 4E1NA 4H4OA 1GOCA 3M8QA 4UQGA 4Z4EA 1JLFA 3L2UA 3VQ7A 3NH2A 4I9QA 1VSKA 3ALYA 4AHSA 3LZJA 4OLBA 2VWJA 1VSIA 4KHUA 3PX6A 1HYVA 3OYEA 4Z4IA 1RTIA 4KV8A 2HHVA 2ATQA 1DTQA 4CGJA 3DRSA 1TKXA 1WSFA 1X1PA 1N5YA 1JL2A 4CIGA 4CJKA 1ZBFA 3L3VA 3O4QA 3QNNA 2YNFA 3VN5A 3AVKA 4CEQA 1BCOA 4CEOA 4OPKA 3CFPA 3QLHA 5J2MA 4FJ7A 4B9LA 1S9GA 1T05A 4LD0A 3OYBA 4FYDA 2BANA 2Z1HA 1WSGA 3MEDA 2IAJA 3TAQA 4IFYA 2XO7A 3NCIA 1RBUA 3QEIA 1QSYA 3ISNC 2XY5A 4CJ3A 3KTQA 2OYQA 1TK8A 1RDAA 1TKDA 5J2NA 1HMVA 3HYFA 1JLBA 4B9UA 3VQEA 1JLCA 1RT2A 2OPQA 1NK8A 4E19A 1HNIA 3QIPA 4AHRA 4CFAA 1KLNA 1VSHA 3LWLA 4EZ9A 2Y1JA 4C8KA 2OPRA 4QAGA 1CXQA 3HO1A 3HPOA 1SKWA 4HUGA 1UA1A 4K8XA 4B9NA 3PY8A 2R7YA 4RW8A 2BE2A 3P1GA 4DFJA 3DM2A 3SNNA 3OYKA 4OPJA 3AVGA 4CFBA 3HXMA 3TAFA 4FLUA 4DS5A 1RBSA 4M42A 4Q0BA 3NGZA 3JYTA 3SYZA 3CFOA 3DI6A 4CK1A 2G8IA 4ZTJA 4B9VA 1U48A 2BDPA 4KRFA 3SV3A 3AVAA 4IBNA 4DLGA 4CGDA 4CF2A 1CZBA 1Z26A 3KLEA 1ZBIA 4FXDA 4E89A 1WLJA 3VQ8A 4MFBA 4M41A 1QSLA 4KPYA 4ZHRA 1BCMA 1C1BA 1SL1A 4CIEA 4BACA 2F96A 3KLFA 1S1VA 1S1XA 1LWFA 3K5OA 4DTXA 3U6FA 4M3TA 4IG3A 2DY4A 4W5NA 4M3WA 4B9TA 4OGCA 4FJNA 3VQ9A 4LSNA 4R5PA 3K5LA 3K5MA 4FJ9A 3OYHA 1KCFA 1TGOA 2E6LA 3BGRA 4DTSA 4Z4CA 4DLEA 3LP1A 3MEGA 1NK5A 3QIOA 5KGWA 4M3RA 4FZXC 3LANA 3DOKA 3CFRA 4IDKA 1ASWA 3T1AA 4CHPA 5HRPA 3OYAA 1DLOA 2G8KA 1T7PA 4KI4A 4JLHA 3ZCMA 4O0IA 5HBMA 1S5JA 1TL1A 4WE1A 3T19A 4CEEA 3KLGA 1TV6A 3ZSWA 1QHTA 2I5JA 3VQBA 4CEZA 4FLTA 3SPYA 1JLQA 4E0DA 4E7KA 4EP5A 5HROA 4K8ZA 3KIOA 4B9SA 2QKBA 3CYMA 3NH1A 3OS0A 3TABA 4KHYA 4FW2A 4CGHA 4DTJA 2YNIA 2YV0X 1O1WA 4BE1A 2HNDA 3I8DA 5C24A 3VQ6A 3IG1A 3HVRA 5I3UA 1RBRA 1Q9XA 1T8EA 3SQ1A 1QSSA 1NK0A 1VSJA 1NKBA 3WNFA 3V1RA 3QERA 5C25A 1S6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZD1 A;  5KI6 A;  4W5T A;  1W0H A;  1ASU A;  4OLA A;  4FJI A;  1RDC A;  2Q3S A;  3L2R A;  4CED A;  1CXU A;  3AA2 A;  4FLY A;  4KHN A;  4KI6 A;  4M3Y A;  4CJU A;  5SZT A;  2HW3 A;  3OYD A;  3DLB A;  3SUQ A;  3DLE A;  3IS9 A;  4H8K A;  3P5J A;  4B8A B;  3OYJ A;  3L2V A;  3C95 A;  3SQ4 A;  1JLA A;  3PX4 A;  3ZSV A;  3M8P A;  2A1S A;  5J1E A;  4JRP A;  1X9M A;  4IG0 A;  3OYC A;  1TKZ A;  2WOM A;  3HL8 A;  1J5O A;  4Q5V A;  4FJ8 A;  3TWH A;  1SKR A;  1NK4 A;  3PO5 A;  1WSH A;  3PO4 A;  1U49 A;  2JLE A;  1HYZ A;  3EY1 A;  3SV4 A;  4ELV A;  2RKI A;  4DTN A;  1NJZ A;  3F9K A;  1L3U A;  2VG5 A;  4PQU A;  4FK0 A;  3TR8 A;  4PA1 A;  5FDL A;  4ELU A;  4BDY A;  5CY4 A;  2RN2 A;  1RTH A;  1WSI A;  4W5R A;  1A5X A;  1NKC A;  1JXE A;  5I42 A;  3OY9 A;  4J2B A;  4JS5 A;  1JLE A;  5DK5 A;  1LWE A;  1T03 A;  4NCA A;  2P5G A;  2Z1I A;  3ASM A;  3V1O A;  3HT3 A;  1U47 A;  1KVC A;  2FBX A;  4BDZ A;  2DTU A;  1X9S A;  1BL3 A;  3S3M A;  4FK2 A;  3HM9 A;  3CM6 A;  4N47 A;  4RW4 A;  2GV9 A;  1SKS A;  3NDK A;  3AO3 A;  3QEX A;  3ITH A;  3ZT2 A;  1WNS A;  4JS4 A;  2FBV A;  4AIL C;  5KTQ A;  1BHL A;  3V9X A;  3PV8 A;  1GOA A;  3L2Q A;  1KSP A;  1F21 A;  4FK4 A;  3LDS A;  4NCG A;  4CJ5 A;  3PX0 A;  2XY7 A;  4Z4F A;  2W42 A;  3RRG A;  4E7J A;  4FZZ A;  4HHT A;  2FBT A;  4O55 A;  3DYA A;  4DQR A;  4N56 A;  3CQ8 A;  5T7B A;  4DQS A;  3S3O A;  1G15 A;  3QNO A;  1ZBL A;  1KFS A;  4F3O A;  1VRU A;  1REV A;  1C6V A;  2X6N A;  1SV5 A;  3QIN A;  3LP2 A;  4AHV A;  4CF9 A;  3I0R A;  1IKV A;  4KO0 A;  2HVI A;  1R0A A;  4I2Q A;  5JS1 A;  3A2F A;  3TAM A;  4CHY A;  5J2P A;  4FJH A;  4J2E A;  1FXX A;  1WN7 A;  1IKX A;  4LSL A;  2HHS A;  3IAY A;  2HNY A;  3ZSY A;  2E6M A;  3E01 A;  3ZSZ A;  3ZT0 A;  4DU3 A;  1QTM A;  4PY5 A;  3ZSR A;  4YFU A;  2EHG A;  2Z1G A;  4ICL A;  3OJS A;  3JSM A;  4FLZ A;  2ITG A;  1Z25 A;  3NF8 A;  4C8O A;  4FJL A;  1LAV A;  1YTA A;  2XY8 A;  3VQQ A;  3ZT4 A;  3RMA A;  2KZZ A;  1D9D A;  4KRE A;  4N76 A;  1SUQ A;  4KTZ A;  3O3F A;  4DSK A;  1L3S A;  1VSF A;  5J2Q A;  4BDP A;  2QKK A;  1C1A A;  3D45 A;  2HHT A;  3OYN A;  4CF8 A;  3VA0 A;  2KZM A;  2D0B A;  1YT3 A;  4G1Q A;  1EXQ A;  1HQE A;  3VQ4 A;  3SQ2 A;  3MXI A;  1WSE A;  4Z0U A;  2Z1J A;  5KRT A;  4E7I A;  4FLW A;  1MU2 A;  3DLH A;  3ZSQ A;  3V81 A;  2RF2 A;  4CGF A;  3TAN A;  3VQA A;  1BQM A;  1RT5 A;  3AVC A;  3G0Z A;  3ULD A;  4DMN A;  1TK5 A;  3DLR A;  2OZS A;  1XHZ A;  3HPH A;  1Q8I A;  2ZQB A;  3OYG A;  4FJK A;  4YNQ A;  3T3F A;  4CHZ A;  1IKW A;  2G8F A;  4TSX A;  2Y1I A;  4DTO A;  1BIS A;  1NJY A;  2B6A A;  1NK9 A;  3C94 A;  1VSD A;  4O4G A;  5SWM A;  3OYF A;  3LAM A;  5C42 A;  1GOB A;  1RBV A;  4NCB A;  2QK9 A;  3RR7 A;  4NYN A;  3V9Z A;  1ZYQ A;  2F8S A;  1UOC A;  3NBP A;  2D5R A;  3KKS A;  2RPI A;  4CJE A;  4CK2 A;  3SI6 A;  3AA3 A;  4AH9 A;  4F4K A;  3LWM A;  1J53 A;  3QEW A;  3VQD A;  3SZ2 A;  3DRR A;  4F2R A;  2OZM A;  4DSL A;  1BIZ A;  1DTT A;  2JGU A;  1W9H A;  1IKY A;  2IC3 A;  3FFI A;  2YNH A;  3M8R A;  4KFB A;  4DG1 A;  3K57 A;  4CCH A;  4DU4 A;  2PY5 A;  3P83 D;  3AVB A;  4E7H A;  4CEC A;  4E3S A;  4M3X A;  3SUN A;  2ZE2 A;  4DTM A;  1RDB A;  1RTJ A;  1VRT A;  3OYM A;  3RMD A;  1Q9Y A;  3KD5 E;  4OKJ A;  1RBT A;  4FW1 A;  1A5V A;  1RT1 A;  4I9L A;  3K59 A;  3L8B A;  3SPZ A;  2KFN A;  4HVJ A;  5KGX A;  4AHU A;  1XC9 A;  4DSF A;  3MEC A;  3K58 A;  2P1J A;  1L3V A;  4B3O A;  4CGI A;  4CJP A;  4AHT A;  4KB0 A;  3NF7 A;  1LAW A;  4DF8 A;  4DQQ A;  4L8R B;  1HQU A;  4CFD A;  3LZI A;  4DTU A;  3AO1 A;  3AVH A;  3H08 A;  3QEP A;  4HCB A;  3VA3 A;  4C8L A;  4NYF A;  5DMR A;  2G8U A;  2HNZ A;  1QS4 A;  1ZBU A;  5FRM A;  4FLX A;  4M3U A;  2EX3 A;  2IS3 A;  4JRQ A;  2D0A A;  2AJQ A;  4LH5 A;  3OVN A;  3QO9 A;  4XIU A;  3C6T A;  2E4L A;  1U4B A;  4F3T A;  4CF1 A;  1HYS A;  4BE2 A;  4OKK A;  1L5U A;  2PYJ A;  4LH4 A;  1X9W A;  3ZSO A;  4DSJ A;  2QXF A;  1ITG A;  5CYM A;  2XY6 A;  4I2P A;  5JS2 A;  1HJR A;  2B4J A;  3TAG A;  2PYL A;  3I0S A;  1YVU A;  1TAQ A;  3KK1 A;  2HB5 A;  1RT6 A;  1WSJ A;  4OGE A;  3K5N A;  2IOC A;  1C0T A;  4J2A A;  3U3Y A;  1D9F A;  1LW2 A;  3NFA A;  2OPP A;  1UWB A;  1NK6 A;  4KTW A;  3KJV A;  4FCY A;  3KLH A;  1XWL A;  2DFF A;  3AV9 A;  3B6P A;  4C8M A;  4DTR A;  4PUO A;  4W5O A;  3U3G A;  3RTV A;  3AVF A;  3LAL A;  4O5B A;  3LP0 A;  5EU7 A;  4CGG A;  1NOY A;  5FRO A;  5E41 A;  2HHU A;  4DSI A;  4FVM A;  4FM1 A;  3DOL A;  4DFP A;  4OJR A;  1KTQ A;  1HPZ A;  1TK0 A;  3TAR A;  4HCC A;  4ZTF A;  4IKF A;  2XRI A;  1J54 A;  2G8V A;  3RR8 A;  4B8C A;  2KFZ A;  2FBY A;  1IH7 A;  1N6Q A;  4Z4G A;  3LAK A;  4C8N A;  1RCH A;  3CG7 A;  3LPT A;  4DQI A;  4CEF A;  1EKE A;  3KK3 A;  3OS1 A;  1SL0 A;  4KHQ A;  1FKO A;  4GMJ B;  2GUI A;  3RRH A;  1A5W A;  1JXB A;  1TL3 A;  2YKM A;  4CJQ A;  1SL2 A;  4J2D A;  4CHQ A;  4GVM A;  1ZBH A;  3RWU A;  3NGY A;  4CES A;  4OVL A;  1LV5 A;  4HUF A;  4ID1 A;  4CJ4 A;  2PZS A;  3SUP A;  2XHB A;  3NF6 A;  4BE0 A;  2O4G A;  4M45 A;  1KFD A;  3VQ5 A;  4N5S A;  5HLF A;  2G8W A;  2HMI A;  4KB1 A;  1NK7 A;  1B9F A;  4N41 A;  2NUB A;  4KKO A;  4MQ3 A;  3DLG A;  3QEV A;  1JKH A;  1BGX T;  2DFE A;  3SQ0 A;  1S6P A;  1LWC A;  4M3Z A;  1B92 A;  1S1W A;  4KHW A;  2X74 A;  3O4N A;  2X6S A;  4I7F A;  1WAF A;  1KVB A;  3KKR A;  3CM5 A;  2IGI A;  3AVN A;  2OPS A;  1VSL A;  3AVL A;  4BWM A;  1IG9 A;  1RDD A;  3HP9 A;  1Y97 A;  3AO5 A;  3AA4 A;  5CYQ A;  2O4I A;  4RW7 A;  1RTD A;  3K2P A;  2YHA A;  4CK3 A;  1EET A;  3AA5 X;  4F8R A;  4FM2 A;  3KD1 E;  4KHS A;  1UA0 A;  4QCL A;  3WNH A;  4FJJ A;  2G8H A;  3NGI A;  3ZT1 A;  3S9H A;  3HP6 A;  3KLI A;  3MXM A;  3WNE A;  4BWJ A;  4DFM A;  3V9U A;  2KW4 A;  3V9S A;  3ZSX A;  1CLQ A;  3NH0 A;  4DS4 A;  2GBZ A;  3EZ5 A;  5CZ2 A;  3OJU A;  1C1C A;  3SJJ A;  4H4M A;  2HHW A;  3WNG A;  2WON A;  1I3A A;  3AO4 A;  4FM0 A;  3AVJ A;  1VK0 A;  4B08 A;  3RMB A;  4CJS A;  2P5O A;  1BIU A;  3VQC A;  3HVT A;  4QOZ B;  4OKE A;  3NAE A;  4CEB A;  3HK2 A;  1BI4 A;  4CJF A;  2DFH A;  4CJT A;  1FK9 A;  3EYZ A;  4HTU A;  1BQN A;  3OS2 A;  1KVA A;  1LW0 A;  1RT4 A;  4Z4H A;  4DQP A;  3VQP A;  1U04 A;  4HUE A;  3G10 A;  3V4I A;  1NKE A;  1J9A A;  4CF0 A;  3B6O A;  3D0P A;  3RMC A;  2ETJ A;  3M8S A;  4EZ6 A;  3L3U A;  3UIQ A;  1TVR A;  2F8T A;  3PUF A;  1JLG A;  4CJV A;  5HRR A;  3QET A;  3LP3 A;  4CHO A;  3BDP A;  4RW6 A;  5K14 A;  5HRN A;  2OA8 A;  1KLM A;  3SUO A;  3V9W A;  1JL1 A;  3HPG A;  4AHC A;  5KRS A;  1K6Y A;  3THV A;  1WAJ A;  1RT3 A;  5D3G A;  3OYI A;  1EX4 A;  1HNV A;  1QQC A;  3TAE A;  1D8Y A;  2A1R A;  5HP1 A;  4Y1C A;  1NJX A;  2HHQ A;  3O3G A;  2IDO A;  3AO2 A;  4CJR A;  2VG7 A;  3MEE A;  3L2W A;  3SCX A;  4CER A;  2YNG A;  4Y1D A;  3TAP A;  1RNH A;  1ASV A;  3QES A;  1D5A A;  3F73 A;  1VSM A;  1S9E A;  2HHX A;  4LY7 A;  1IO2 A;  3HST B;  4PWD A;  1QE1 A;  1RIL A;  2BGG A;  4O0J A;  4W5Q A;  1NJW A;  1HRH A;  1KRP A;  4KTQ A;  3C6U A;  3V6D A;  4DWI A;  1XHX A;  1FKP A;  1XI1 A;  1I39 A;  4GW6 A;  3ZT3 A;  4CJL A;  4FJM A;  4KAZ A;  1TAU A;  4O44 A;  4DSE A;  4DF4 A;  1U45 A;  2D0C A;  1C0U A;  2B5J A;  3LPU A;  1VSE A;  3AVM A;  4CHN A;  3NF9 A;  1UAX A;  2YHB A;  3NHG A;  3OYL A;  5HRS A;  4FJG A;  3HJF A;  1S1U A;  2HVH A;  1NOZ A;  4IFV A;  5CZ1 A;  4DFK A;  3S3N A;  5FRN A;  1L3T A;  2P51 A;  4CIF A;  3IRX A;  2VG6 A;  3NE6 A;  2X78 A;  3DLK A;  3V1Q A;  2FC0 A;  1RT7 A;  3DMJ A;  4RW9 A;  3MAQ A;  4DU1 A;  4B9M A;  4FZY A;  4RG8 A;  3KK2 A;  4CE9 A;  2LSN A;  2YKN A;  4EP4 A;  4FLV A;  2KQ2 A;  1B9D A;  4CJW A;  3TI0 A;  4FJ5 A;  4FJX A;  2KTQ A;  1TKT A;  1S1T A;  1EP4 A;  4ELT A;  1BI4 B;  3MXJ A;  4CFC A;  4F2S A;  4ID5 A;  1CZ9 A;  2VWK A;  3DRP A;  4E7L A;  1C0M A;  1YTU A;  4E1M A;  3O3H A;  3AVI A;  4DTP A;  4CEA A;  4E1N A;  4H4O A;  1GOC A;  3M8Q A;  4UQG A;  4Z4E A;  1JLF A;  3L2U A;  3VQ7 A;  3NH2 A;  4I9Q A;  1VSK A;  3ALY A;  4AHS A;  3LZJ A;  4OLB A;  2VWJ A;  1VSI A;  4KHU A;  3PX6 A;  1HYV A;  3OYE A;  4Z4I A;  1RTI A;  4KV8 A;  2HHV A;  2ATQ A;  1DTQ A;  4CGJ A;  3DRS A;  1TKX A;  1WSF A;  1X1P A;  1N5Y A;  1JL2 A;  4CIG A;  4CJK A;  1ZBF A;  3L3V A;  3O4Q A;  3QNN A;  2YNF A;  3VN5 A;  3AVK A;  4CEQ A;  1BCO A;  4CEO A;  4OPK A;  3CFP A;  3QLH A;  5J2M A;  4FJ7 A;  4B9L A;  1S9G A;  1T05 A;  4LD0 A;  3OYB A;  4FYD A;  2BAN A;  2Z1H A;  1WSG A;  3MED A;  2IAJ A;  3TAQ A;  4IFY A;  2XO7 A;  3NCI A;  1RBU A;  3QEI A;  1QSY A;  3ISN C;  2XY5 A;  4CJ3 A;  3KTQ A;  2OYQ A;  1TK8 A;  1RDA A;  1TKD A;  5J2N A;  1HMV A;  3HYF A;  1JLB A;  4B9U A;  3VQE A;  1JLC A;  1RT2 A;  2OPQ A;  1NK8 A;  4E19 A;  1HNI A;  3QIP A;  4AHR A;  4CFA A;  1KLN A;  1VSH A;  3LWL A;  4EZ9 A;  2Y1J A;  4C8K A;  2OPR A;  4QAG A;  1CXQ A;  3HO1 A;  3HPO A;  1SKW A;  4HUG A;  1UA1 A;  4K8X A;  4B9N A;  3PY8 A;  2R7Y A;  4RW8 A;  2BE2 A;  3P1G A;  4DFJ A;  3DM2 A;  3SNN A;  3OYK A;  4OPJ A;  3AVG A;  4CFB A;  3HXM A;  3TAF A;  4FLU A;  4DS5 A;  1RBS A;  4M42 A;  4Q0B A;  3NGZ A;  3JYT A;  3SYZ A;  3CFO A;  3DI6 A;  4CK1 A;  2G8I A;  4ZTJ A;  4B9V A;  1U48 A;  2BDP A;  4KRF A;  3SV3 A;  3AVA A;  4IBN A;  4DLG A;  4CGD A;  4CF2 A;  1CZB A;  1Z26 A;  3KLE A;  1ZBI A;  4FXD A;  4E89 A;  1WLJ A;  3VQ8 A;  4MFB A;  4M41 A;  1QSL A;  4KPY A;  4ZHR A;  1BCM A;  1C1B A;  1SL1 A;  4CIE A;  4BAC A;  2F96 A;  3KLF A;  1S1V A;  1S1X A;  1LWF A;  3K5O A;  4DTX A;  3U6F A;  4M3T A;  4IG3 A;  2DY4 A;  4W5N A;  4M3W A;  4B9T A;  4OGC A;  4FJN A;  3VQ9 A;  4LSN A;  4R5P A;  3K5L A;  3K5M A;  4FJ9 A;  3OYH A;  1KCF A;  1TGO A;  2E6L A;  3BGR A;  4DTS A;  4Z4C A;  4DLE A;  3LP1 A;  3MEG A;  1NK5 A;  3QIO A;  5KGW A;  4M3R A;  4FZX C;  3LAN A;  3DOK A;  3CFR A;  4IDK A;  1ASW A;  3T1A A;  4CHP A;  5HRP A;  3OYA A;  1DLO A;  2G8K A;  1T7P A;  4KI4 A;  4JLH A;  3ZCM A;  4O0I A;  5HBM A;  1S5J A;  1TL1 A;  4WE1 A;  3T19 A;  4CEE A;  3KLG A;  1TV6 A;  3ZSW A;  1QHT A;  2I5J A;  3VQB A;  4CEZ A;  4FLT A;  3SPY A;  1JLQ A;  4E0D A;  4E7K A;  4EP5 A;  5HRO A;  4K8Z A;  3KIO A;  4B9S A;  2QKB A;  3CYM A;  3NH1 A;  3OS0 A;  3TAB A;  4KHY A;  4FW2 A;  4CGH A;  4DTJ A;  2YNI A;  2YV0 X;  1O1W A;  4BE1 A;  2HND A;  3I8D A;  5C24 A;  3VQ6 A;  3IG1 A;  3HVR A;  5I3U A;  1RBR A;  1Q9X A;  1T8E A;  3SQ1 A;  1QSS A;  1NK0 A;  1VSJ A;  1NKB A;  3WNF A;  3V1R A;  3QER A;  5C25 A;  1S6Q A; 
#chains in the Genus database with same CATH topology
 1ASU A;  4X62 K;  1NGH A;  3IMX A;  3RSE B;  4M3Y A;  5SZT A;  3IS9 A;  3P5J A;  4M63 C;  3ZYY X;  2GX9 A;  3ZSV A;  1TUU A;  4WF9 L;  3M8P A;  1QVF M;  3OYC A;  2WOM A;  3HL8 A;  3A5O C;  4Q5V A;  4FJ8 A;  3TWH A;  1C0G A;  1G99 A;  3O6W A;  4O8U A;  3GG4 A;  4BRC A;  5FLX O;  3FZK A;  3VEN A;  3EY1 A;  2RKI A;  4PQU A;  5AQX A;  5M1O A;  3WXI A;  4A5B A;  4ELU A;  3O9S A;  2NRV A;  4FWO A;  4W5R A;  5M1P A;  4J2B A;  5EX5 A;  4H0O A;  4JS5 A;  4GKJ K;  2NRZ A;  3QFP A;  4OPA A;  2P9P A;  2P5G A;  1KVC A;  2FBX A;  2YHW A;  2DTU A;  4BG8 A;  1VQ4 N;  3NDK A;  2QTD A;  2GTD A;  1WNS A;  4JK9 A;  4JS4 A;  1GOA A;  4FK4 A;  4DV5 K;  4NCG A;  4Z4F A;  4E7J A;  3CQ8 A;  1KFS A;  1ZBL A;  3QNO A;  1VRU A;  1REV A;  1C6V A;  3QIN A;  4IXC A;  3ZX0 A;  4CF9 A;  3I0R A;  5JS1 A;  4I2Q A;  4FWM A;  2V7Y A;  4J2E A;  5AQY A;  1IKX A;  4LSL A;  2HNY A;  2E6M A;  4YFU A;  2Z1G A;  4FLZ A;  3NF8 A;  4QS8 A;  2P9I B;  4LC9 B;  5BN9 A;  1LAV A;  1YTA A;  2XY8 A;  2E5L K;  3EKS A;  1P90 A;  4CZH A;  3HBT A;  4KTZ A;  3O3F A;  4DSK A;  4YHH K;  2QKK A;  3D45 A;  2HHT A;  1CZA N;  3BY5 A;  3MX2 A;  3OYN A;  1EXQ A;  2JWL A;  5LJV A;  3SQ2 A;  3BF3 A;  2W6K A;  4B3R K;  4FLW A;  1MU2 A;  3QBX A;  3V81 A;  3TAN A;  3ZET B;  3G0Z A;  1XMQ K;  4DMN A;  2WBN A;  1XHZ A;  2P9S A;  5C25 A;  3T3F A;  3GE1 A;  5FRN A;  2G8U A;  1NK9 A;  1VSD A;  5SWM A;  5C42 A;  3RR7 A;  5AQJ A;  4IFE A;  2D5R A;  4AH9 A;  3SBT A;  3LWM A;  1KAY A;  2YHX A;  3QEW A;  2OZM A;  5AQI A;  3THW A;  4BRI A;  2YI1 A;  2JGU A;  3M8R A;  4KFB A;  4DG1 A;  3K57 A;  5BRF A;  3D7E O;  4DHY A;  4E7H A;  2ZE2 A;  1VQO N;  2NRH A;  1RTJ A;  1VRT A;  1RBT A;  4I9L A;  5AQQ A;  5KGX A;  2GEM A;  3K58 A;  2P1J A;  1WB9 A;  5AQF A;  4AHT A;  4FK0 A;  1LAW A;  5FPN A;  4BRA A;  4CFD A;  4JD2 B;  3LZI A;  3H08 A;  4HCB A;  4WQ4 A;  1QS4 A;  3TSP A;  4JI8 K;  2IS3 A;  3QO9 A;  4XIU A;  1NGD A;  4F3T A;  3MWT A;  4OKK A;  1L5U A;  2GWJ A;  1X9W A;  4I2P A;  2FXU A;  3ZEU A;  3NMU A;  2HB5 A;  4OGE A;  1K8A O;  3K5N A;  5BRH A;  5EOY A;  4MLE A;  2KLA A;  3NFA A;  4FCY A;  3KLH A;  3AV9 A;  3B6P A;  3RTV A;  4KPY A;  3AVF A;  3LP0 A;  1T3V A;  3GBT A;  4FVM A;  4FM1 A;  1HJO A;  1KTQ A;  1HPZ A;  3SAG A;  4AF1 A;  4HCC A;  4IKF A;  2UYT A;  4UY8 O;  3RR8 A;  2WC9 A;  4XH1 A;  4AM7 A;  1N6Q A;  3LAK A;  2O8E B;  3CG7 A;  2E2P A;  3ATU A;  1SL0 A;  1NG9 A;  4GMJ B;  1SL2 A;  2YKM A;  2P9L B;  4CHQ A;  4NB4 A;  4OVL A;  1LV5 A;  4HUF A;  4JHD A;  2Q2R A;  3NF6 A;  2O4G A;  3VQ5 A;  1ESV A;  1KFD A;  3UKU A;  1XNR K;  5GAD P;  5LMU K;  3BZC A;  3SQ0 A;  4LF6 K;  1B92 A;  4KHW A;  3O4N A;  3D2E B;  3VGL A;  3LDN A;  4I7F A;  4ISE A;  3VPZ A;  3AVN A;  2OPS A;  1VSL A;  2NNW A;  3PSF A;  3KD1 E;  2OTJ N;  4QCL A;  4FJJ A;  3PIP L;  3S9H A;  4FOI A;  3WNE A;  4KBO A;  2KW4 A;  3V9S A;  3ZSX A;  1MA9 B;  2UUC K;  3OJU A;  3WNG A;  2WON A;  3AO4 A;  4CJS A;  1BIU A;  4QOZ B;  4DQP A;  1NKE A;  3G10 A;  3V4I A;  1J9A A;  4EZ6 A;  3RMC A;  3MN9 A;  2CGK A;  2O8E A;  1NGB A;  4CJV A;  1NWK A;  2I7P A;  3QET A;  5JVG L;  3LM2 A;  3R1X A;  1EWQ A;  2ZM6 K;  1KLM A;  3O9U A;  1JL1 A;  3HPG A;  3THV A;  4YOT A;  1VQ6 N;  2FSK A;  5AQR A;  1EX4 A;  4YOX A;  3TAE A;  3O3G A;  3CIP A;  3F9M A;  3MEE A;  3L2W A;  2VCP A;  3D2F B;  3F73 A;  1VSM A;  1S9E A;  4LY7 A;  2A6A A;  3IFR A;  4Z94 A;  4A2B A;  4O0J A;  5C12 A;  4PL8 A;  4DWI A;  4YY3 K;  1FKP A;  4CJL A;  1DGK N;  1TAU A;  1Q18 A;  4IJA A;  1U45 A;  1C0U A;  4CZM A;  3K0S A;  3OHR A;  1HNZ K;  4NLB A;  1UAX A;  2YHB A;  2A3Z A;  3OYL A;  3HI0 A;  3S3N A;  4CIF A;  3IRX A;  4BRL A;  4YOR A;  4DV1 K;  3KK2 A;  4FLV A;  2YKN A;  4GV6 A;  1XQS C;  2HBJ A;  2KTQ A;  5C2F A;  1EP4 A;  4ELT A;  2YCH A;  4ID5 A;  4IEE A;  4E7L A;  5AQL A;  4JKD A;  3AVI A;  2J4R A;  1OKJ A;  3M8Q A;  2UXD K;  4Z4E A;  5TKY A;  3L2U A;  3NVK A;  3NH2 A;  1VSK A;  5LY3 A;  3J7Z O;  1TYQ A;  3PX6 A;  1HYV A;  4Z4I A;  2ATQ A;  1DTQ A;  4WFB L;  1WSF A;  1ILY A;  3QNN A;  1X3M A;  3VN5 A;  4CEQ A;  2Z1H A;  3RVC A;  2IAJ A;  3NCI A;  2AA4 A;  4PHT X;  1RBU A;  2OYQ A;  3M1F A;  1RDA A;  3LDO A;  5J2N A;  1XC3 A;  4BRF A;  4B9U A;  3PSI A;  2OPQ A;  4JNE A;  4K42 A;  1NK8 A;  2D1K A;  1KLN A;  4EZ9 A;  1HPM A;  3HO1 A;  3TTC A;  4Y0W A;  1UA1 A;  4FWL A;  5BRE A;  3OTO K;  3OYK A;  4OPJ A;  3HXM A;  1T6C A;  4FLU A;  4DS5 A;  4IZ9 A;  4CK1 A;  2BDP A;  3AVA A;  4IBN A;  1CZB A;  1Z26 A;  3EEQ A;  1RDU A;  3FGU A;  1U2V B;  1U6Z A;  5FPD A;  3L6Q A;  3KLF A;  1LWF A;  2D0O A;  4IG3 A;  4M3W A;  1QHA A;  4B9T A;  4FJ9 A;  3OYH A;  1KCF A;  3DXK B;  4Z4C A;  3MEG A;  1NK5 A;  2E2Q A;  3QIO A;  2Q0R A;  4GVE A;  4M3R A;  5AFU A;  1BO5 O;  3VEV A;  3OYA A;  1DLO A;  3A0I X;  1BDG A;  4O0I A;  3CQY A;  3A8Y A;  1QHT A;  3VQB A;  3WXJ A;  3M5R A;  4B9S A;  4DCH A;  1QQN A;  3BP8 A;  3KZB A;  1BOT O;  2Q0U A;  2YV0 X;  4B1X B;  1X9J A;  3J81 O;  5I3U A;  1Q9X A;  3U9Z A;  4BRO A;  3U8X A;  2AP1 A;  1NGF A;  3WNF A;  4IO9 L;  4CZJ A;  3QER A;  5KI6 A;  1T44 A;  3LDP A;  1HNX K;  1RDC A;  4BRD A;  3M6G A;  4YOW A;  4B3T K;  4CJU A;  3DLB A;  3SUQ A;  3OYJ A;  4FWR A;  4CVN E;  1JLA A;  3DWL A;  4JRP A;  1X9M A;  4HWI A;  1TKZ A;  3DXM A;  5AQG A;  3PO4 A;  3LM9 A;  4BR7 A;  4RCH A;  2JLE A;  3U4L A;  3SV4 A;  1S72 N;  1L3U A;  3TR8 A;  5BN8 A;  5FDL A;  2O8F A;  5CY4 A;  3GL1 A;  2UU9 K;  3DXK A;  1WSI A;  1NKC A;  5AQM A;  5I42 A;  4E1J A;  3OBY A;  1T03 A;  4BRM A;  3HT3 A;  3CM6 A;  3WEE B;  4RW4 A;  1KAZ A;  4LFA K;  3ITH A;  4AIL C;  3CXC M;  2FBV A;  1BHL A;  3PV8 A;  1IG8 A;  3L2Q A;  1N34 K;  3BF1 A;  4BVP A;  1VQ8 N;  3SMP A;  3PX0 A;  3RRG A;  2HOE A;  3DYA A;  4O55 A;  4DQR A;  4DQS A;  1G15 A;  3HM9 A;  2F4V K;  4AHV A;  4BRK A;  1R0A A;  5KQD A;  3TAM A;  4FJH A;  1FXX A;  4XEI A;  4K25 A;  1GLA G;  3ZX3 A;  5DM6 L;  3IAY A;  4PY5 A;  1ZC6 A;  3T1H K;  3TTD A;  5TKW A;  3MCP A;  3VEY A;  3VEW A;  1Z25 A;  2HBL A;  4C8O A;  3RMA A;  3VQQ A;  1D9D A;  4V19 S;  1L3S A;  4BG9 A;  4CF8 A;  1HQE A;  3MWP A;  3L4Q A;  4Z0U A;  1S3X A;  4MO4 A;  4PKH A;  3EL2 A;  3E66 A;  4CZI A;  3SJH A;  2ZQB A;  4B1Y B;  5GAG P;  4FWN A;  2G8F A;  4TSX A;  4DTO A;  4NO7 A;  3OYF A;  4O4G A;  2QK9 A;  1RBV A;  3WEE A;  4NCB A;  2P9P B;  3GOI A;  4NYN A;  2F8S A;  1P8Z A;  3C6H A;  2I7N A;  1NGG A;  4FZY A;  4ILH A;  3KKS A;  5IT9 O;  3VQD A;  4F2R A;  2ZF5 O;  4A5A A;  4B9Q A;  4DR3 K;  5ADX A;  1BA0 A;  3FFI A;  4BC5 A;  2UXB K;  2Q97 A;  2OAN A;  3AVB A;  4E3S A;  4CEC A;  2A40 A;  4WFA L;  3RMD A;  5BR8 K;  5BPN A;  4OKJ A;  1E4G T;  1HNW K;  5BR9 A;  1RT1 A;  3L8B A;  4HVJ A;  3O1W A;  3CC4 N;  4DF8 A;  4DQQ A;  4DTU A;  3AVH A;  1W2B M;  4C8L A;  5C0Y A;  1OVQ A;  5DMR A;  5FRM A;  4M3U A;  4KH6 A;  2D0A A;  3OA9 A;  2AJQ A;  3FZF A;  1V4S A;  4DV6 K;  3CC2 N;  3CPE A;  5KPZ A;  3C6T A;  5F1X A;  1JCF A;  1EO1 A;  3ZSO A;  4DSJ A;  1ITG A;  3FFK B;  5CYM A;  3P4I A;  5JS2 A;  2B4J A;  2PYL A;  1YVU A;  2E1Z A;  4JKB A;  4IOA L;  1WSJ A;  2P9S B;  2IOC A;  3P38 A;  3U3Y A;  1UWB A;  1NK6 A;  2O8C B;  1XWL A;  1NOY A;  3LAL A;  5FRO A;  5M1Q A;  3DOL A;  3A5L C;  1TK0 A;  3THW B;  2XRI A;  1J54 A;  3R9P A;  2G8V A;  2ZWH A;  4B8C A;  4BR4 A;  1IH7 A;  4DR6 K;  4C8N A;  3LPT A;  2QW9 A;  3OS1 A;  2GUI A;  1KD1 O;  1JXB A;  1ATR A;  4ISG A;  1BUP A;  3A5M C;  2RE2 A;  3NGY A;  1ZBH A;  3N4P A;  1WOQ A;  1YUW A;  3AGR A;  5HLF A;  4BE0 A;  2D0P A;  2FLO A;  4M45 A;  2VYP A;  4N5S A;  2G8W A;  2HMI A;  1WUA A;  1B9F A;  3E1Y A;  2NUB A;  3UE5 A;  1NGI A;  4YOU A;  1SAZ A;  4BR9 A;  4M3Z A;  2X74 A;  4WYB A;  1SQK A;  2CGL A;  3BZK A;  3AVL A;  1RDD A;  5CYQ A;  3AO5 A;  3AA4 A;  2O4I A;  3TU5 A;  1RTD A;  3CME N;  3AA5 X;  4EIA A;  5GAE P;  4KHS A;  3LDQ A;  2G8H A;  4MDB A;  3HP6 A;  3KLI A;  3MXM A;  3S41 A;  1D4X A;  3NH0 A;  2YHY A;  4DS4 A;  3ZEU B;  3EZ5 A;  4H0Y B;  5CZ2 A;  4DR4 K;  1K9M O;  2O8C A;  2QWO A;  4H4M A;  3ZX2 A;  4B08 A;  1VK0 A;  4OKE A;  4CEB A;  1LW0 A;  4Z4H A;  2E88 A;  4BC2 A;  1U04 A;  4HUE A;  3D0P A;  5AQN A;  2F8T A;  1GLL O;  1JLG A;  3LP3 A;  4B1U B;  1Q82 O;  2OA8 A;  4CJ7 A;  4CW7 B;  1BU6 O;  3V9W A;  4FL9 A;  2NLX A;  4H5R A;  1HNV A;  2A1R A;  3UB5 A;  5IWA K;  4BQL A;  5HP1 A;  4Y1C A;  2HF4 A;  2HHQ A;  4JHD B;  5C2D A;  3AO2 A;  4CJR A;  3SCX A;  3TAP A;  2YNG A;  3UKU B;  4C1N I;  1RNH A;  5GIO A;  3QES A;  1D5A A;  2HHX A;  4W5Q A;  4CBU A;  4BC4 A;  1W7A A;  1OH6 A;  3R8E A;  2QWN A;  3THY B;  3V6D A;  1XHX A;  1XI1 A;  4GW6 A;  4FJM A;  2FF6 A;  1X3N A;  1VSE A;  1N36 K;  5JVH L;  3BUZ B;  3EE9 A;  3SMS A;  2CGJ A;  3ENO A;  3CHW A;  3J7A P;  2HVH A;  1M1K O;  4WQ5 C;  4IFV A;  5CZ1 A;  2DPN A;  1L3T A;  3D6R A;  1VQM N;  3V1Q A;  3DMJ A;  2P9K B;  4RG8 A;  4BGB A;  4EP4 A;  5CE3 A;  3HZ6 A;  4FJ5 A;  4FJX A;  4BRG A;  3W3D A;  3O9R A;  1GLF O;  1SZ2 A;  4H5V A;  4E1N A;  4H4O A;  1JLF A;  4PKI A;  4XH5 A;  3LZJ A;  3C7N A;  1VSI A;  2EWS A;  3H1V X;  4IOX A;  1ATN A;  4B1Z A;  4KV8 A;  2HHV A;  4CGJ A;  3O9T A;  3DRS A;  1NBW A;  1X1P A;  4ISF A;  4CJK A;  5AQK A;  3H3O B;  3QML A;  3CJ9 A;  3CFP A;  4CEO A;  2UUA K;  4A2A A;  4LD0 A;  2F7T A;  2BAN A;  4YDU C;  1QSY A;  4IFY A;  3KTQ A;  2XY5 A;  3P31 A;  1TKD A;  3THY A;  3E9O A;  1HMV A;  3HYF A;  3VQE A;  1RT2 A;  1Q86 O;  4DR5 K;  4CFA A;  3MDQ A;  1S22 A;  1YVN A;  2OPR A;  5AJ3 K;  4NXM K;  4HUG A;  4K8X A;  3PY8 A;  2R7Y A;  3P1G A;  3DM2 A;  2P9U A;  5JLH A;  1WBB A;  4M42 A;  3JYT A;  3FR0 A;  3ULE A;  2P9K A;  4DLG A;  1KC8 O;  4LF4 K;  4E89 A;  1WLJ A;  4BRN A;  4O5F A;  3MX5 A;  4MFB A;  5KPR A;  4CIE A;  4BAC A;  2F96 A;  3I8B A;  1S1V A;  4M3T A;  3N4Q A;  1YIT N;  1Z6R A;  4W5N A;  5M1N A;  4DR2 K;  4FJN A;  3K5M A;  2NZT A;  3EN9 A;  3K5L A;  1TGO A;  4DLE A;  3LP1 A;  3H46 O;  1I94 K;  2YX6 A;  3DOK A;  4IWV A;  4JKA A;  4IOC L;  1ASW A;  3T1A A;  1TYQ B;  5HBM A;  4WE1 A;  5AR0 A;  3ZSW A;  4FLT A;  4LF5 K;  4K8Z A;  5HRO A;  1YF5 L;  3KIO A;  3T1Y K;  1YHQ N;  3CYM A;  3NH1 A;  4KHY A;  4DTJ A;  2YNI A;  1HR0 K;  2UUB K;  1O1W A;  2F9T A;  4BE1 A;  3JXU A;  2WTU A;  3ID8 A;  2HND A;  3I8D A;  4B1W B;  3IG1 A;  5EY4 A;  5B8H A;  3CQX A;  1QSS A;  4BR5 A;  1NKB A;  3DAW A;  4W5T A;  1J6Z A;  3K9J A;  4FJI A;  2Q3S A;  3L2R A;  4CED A;  3AA2 A;  4FLY A;  4KHN A;  4KI6 A;  4KH5 A;  2HW3 A;  3OYD A;  3CCE N;  1Z05 A;  3DLE A;  3L2V A;  3C95 A;  5AZI A;  2HF3 A;  3PX4 A;  2A1S A;  5J1E A;  2FSN A;  4IG0 A;  3DJC A;  2UXC K;  1VQP N;  1NK4 A;  1WSH A;  1U49 A;  4PKG A;  5AQS A;  4FWQ A;  4ELV A;  1NJZ A;  4DTN A;  4PA1 A;  4A62 A;  3CC7 N;  1FW6 A;  1RGI A;  2NRR A;  1JXE A;  4YOV A;  2Z1I A;  3ASM A;  4BDZ A;  1X9S A;  1BL3 A;  3S3M A;  2GV9 A;  1NGJ A;  4C23 A;  3CCQ N;  3VOV A;  3V9X A;  1KSP A;  2O8B B;  5C10 A;  4IDH A;  4CJ5 A;  3WXL A;  2W42 A;  2ZJR L;  4FZZ A;  3HOS A;  3S3O A;  5C15 A;  3O1B A;  2X6N A;  3SYZ A;  5JMV A;  4H0T B;  4KO0 A;  2HVI A;  4JI4 K;  4CHY A;  3EZW A;  1WN7 A;  1NGA A;  3ZSZ A;  3ZT0 A;  4DU3 A;  3ID6 A;  1QTM A;  4CD1 A;  3ZSR A;  2EHG A;  4BY9 C;  3ZT4 A;  2KZZ A;  4N76 A;  1GLJ O;  2KHO A;  1RDW X;  1K8K B;  5J2Q A;  1C1A A;  1BA1 A;  3UKR A;  2KZM A;  2D0B A;  4G1Q A;  3VQ4 A;  3MXI A;  1WSE A;  5KRT A;  4E7I A;  3DXM B;  1GLD G;  3VTI A;  4RWT A;  3ZSQ A;  2RF2 A;  4CGF A;  2QWP A;  2PAV A;  1RT5 A;  3CPW M;  2OZS A;  3HPH A;  2O8F B;  1Q8I A;  3OYG A;  4CI6 A;  4FJK A;  4H5T A;  4YNQ A;  1IKW A;  1MWK A;  2Y1I A;  1BIS A;  1GOB A;  2V51 B;  3CMA N;  4YOY A;  4H5N A;  3J7Y P;  3KWG A;  1UOC A;  3SI6 A;  4F4K A;  1DEJ A;  2RPI A;  4KHP K;  1C0F A;  3AA3 A;  2O8B A;  3DRR A;  1BIZ A;  4H0X B;  4M7Y A;  2IC3 A;  5AFU H;  2YNH A;  5CR4 A;  1V4T A;  4JI2 K;  4DU4 A;  3Q7C A;  2PY5 A;  3P83 D;  4DTM A;  1Q9Y A;  3KD5 E;  3OYM A;  4LFC K;  4FW1 A;  2KFN A;  3K59 A;  4JI7 K;  4GNI A;  4AHU A;  3MEC A;  4DKW A;  1L3V A;  4B3O A;  4M7X A;  4K0K K;  1YIJ N;  4CJP A;  3WT0 A;  4KB0 A;  3NF7 A;  3VEZ A;  1YI2 N;  2HST A;  4LFB K;  3SAH A;  3AO1 A;  3VA3 A;  1K8K A;  2V7Z A;  1VQ9 N;  4JV5 K;  3I33 A;  2HNZ A;  5CHI A;  1ZBU A;  4FLX A;  4JRQ A;  1QQO A;  3T69 A;  3MN5 A;  4LH5 A;  4BRP A;  3F2K A;  2E4L A;  1U4B A;  1HYS A;  4BE2 A;  4BGA A;  2JWK A;  5GIN A;  4LF9 K;  1GLE G;  4FWS A;  4I6M A;  4IO8 A;  5AQH A;  3HM8 A;  3CCM N;  2XY6 A;  4QS7 A;  2QXL A;  1HJR A;  3TAG A;  1VQK N;  2A5X A;  3I0S A;  4AQY K;  3KK1 A;  1RT6 A;  2NRW A;  3A5N C;  4F9O A;  4BC3 A;  1LW2 A;  2OPP A;  4B3S K;  4KTW A;  3KJV A;  2DFF A;  3L4I A;  4DTR A;  2YJF A;  4W5O A;  5AQV A;  3WUH A;  1KAX A;  4O5B A;  4CGG A;  5EU7 A;  2HHU A;  4DFP A;  4OJR A;  5KPT A;  4WFN L;  3TAR A;  4ZTF A;  4CZE A;  4WCE L;  2ASM A;  2FBY A;  4Z4G A;  3PIO L;  1EKE A;  4KHQ A;  5EXW A;  4OX9 K;  5E26 A;  1JJ2 M;  3MN6 A;  4KH4 A;  3RRH A;  4J2D A;  4GVM A;  3RWU A;  4CES A;  1YJN N;  2HMP A;  2HHH K;  4ID1 A;  2PZS A;  3SUP A;  2ZGZ A;  2XHB A;  1NGE A;  4BRQ A;  3DLG A;  5M1F A;  1BGX T;  3ENB A;  1S6P A;  1S1W A;  4DUY K;  1KVB A;  3CM5 A;  2IGI A;  2BTF A;  4BWM A;  1IG9 A;  3CJA A;  1Y97 A;  3HP9 A;  4RW7 A;  2YHA A;  4CK3 A;  1EET A;  4PL7 A;  2QWL A;  3ZT1 A;  5AQT A;  2O8D A;  3T7Z A;  1CLQ A;  3L0Q A;  4JKH A;  4IEI A;  2GWK A;  3J8A A;  5FPE A;  3NAE A;  4DQ8 A;  3SAF A;  1BI4 A;  3FLC O;  4CJF A;  5LL6 Z;  2DFH A;  4CJT A;  4HTU A;  1BQN A;  1KVA A;  4DQI A;  4G9Z A;  4CF0 A;  1E3M A;  3M8S A;  1IBL K;  2CH6 A;  3L3U A;  1TVR A;  5ELZ A;  2FSJ A;  3PUF A;  5HRR A;  3OW2 M;  1NM1 A;  4CHO A;  4RW6 A;  5K14 A;  2PBD A;  4AHC A;  4JAX A;  1K6Y A;  5D3G A;  3OYI A;  1QQC A;  3QDK A;  4CD3 A;  4X65 K;  1NJX A;  4EHU A;  5ADX H;  3WQT A;  3OBW A;  3CET A;  3CER A;  4PWD A;  1NU0 A;  4FVU A;  1RIL A;  2BGG A;  1KRP A;  3SLC A;  4KTQ A;  3WXM B;  4WQ4 C;  2E1Y A;  2VQE K;  3MK6 A;  4KAZ A;  3CI5 A;  4MO5 A;  3HOT A;  4DF4 A;  4A57 A;  2B5J A;  4H03 B;  3FE1 A;  2QM1 A;  4H0V B;  1TUY A;  1Q81 O;  1YJW N;  3NHG A;  1WBD A;  5HRS A;  4FJG A;  3IUC A;  5BPM A;  1S1U A;  4NLC A;  3HJF A;  3G71 N;  1NOZ A;  5AQZ A;  2P51 A;  4LF8 K;  4DFM A;  3DLK A;  2FC0 A;  1RT7 A;  4RW9 A;  3MAQ A;  3U9D A;  2E8A A;  4CE9 A;  2LSN A;  4R79 A;  1RFQ A;  5F2R A;  2KQ2 A;  4CJW A;  3HTV A;  1XUP O;  2IIR A;  3TI0 A;  1TKT A;  2RHK A;  4CFC A;  4F2S A;  1M90 O;  3H1Q A;  1C0M A;  1YTU A;  3VMF B;  3O3H A;  5AZJ A;  1QZ5 A;  2F9W A;  3MN7 A;  4UQG A;  5AQP A;  4I9Q A;  3ALY A;  4LF7 K;  1LCU A;  3TSQ A;  5LJW A;  4KHU A;  2OCE A;  3OYE A;  1RTI A;  3F5T A;  4AM6 A;  1TKX A;  1Q7Y O;  1JL2 A;  2P9N A;  3G25 A;  3LDL A;  3MMV A;  4J8F A;  1HX1 A;  3AVK A;  4OPK A;  4GV3 A;  4ILJ A;  4B9L A;  1S9G A;  3VER A;  1T05 A;  3OYB A;  4FYD A;  1HUX A;  1MDU B;  1HKG A;  3TAQ A;  3HRG A;  3QEI A;  3VEO A;  3QIC A;  2HBM A;  2ZJP L;  1JLC A;  1HNI A;  1QZ6 A;  3CJ1 A;  2BUP A;  3QIP A;  4AHR A;  1VSH A;  2QWR A;  4C8K A;  3RSE A;  1SKW A;  1VQN N;  3HSC A;  4DFJ A;  2BE2 A;  3SNN A;  4DV2 K;  4CFB A;  1RBS A;  3CFO A;  3H3N O;  3TTF A;  4B9V A;  1U48 A;  4KRF A;  3SV3 A;  1N32 K;  2IVN A;  4ZHR A;  1BCM A;  1C1B A;  1S1X A;  3K5O A;  3U6F A;  4O8K A;  3CJ7 A;  2ASO A;  3K9K A;  4OGC A;  3VQ9 A;  5MLC Q;  2E6L A;  4DTS A;  2FF3 B;  5KGW A;  3CFR A;  4JKE A;  4CHP A;  2G8K A;  1QVG M;  3C7N B;  1T7P A;  4KI4 A;  3ZCM A;  3ATV A;  1TL1 A;  3T19 A;  3KLG A;  1VQ5 N;  4CEE A;  1TV6 A;  4CBW A;  3SPY A;  1JLQ A;  4E0D A;  4E7K A;  3O9Q A;  2QKB A;  3OS0 A;  4CGH A;  3HVR A;  4DR7 K;  1RBR A;  1NK0 A;  1K73 O;  1NLV A;  3V1R A;  2Z1J A;  4BRE A;  2ZD1 A;  1W0H A;  3QB0 A;  4OLA A;  3CCS N;  1N8R O;  2P9I A;  3E9L A;  1NJI O;  1CXU A;  3DLL L;  4OO1 J;  4FO0 A;  4H8K A;  4B8A B;  5KQ8 A;  3SQ4 A;  2P9U B;  3VF6 A;  3ULE B;  1SS6 A;  1J5O A;  4X64 K;  4JI5 K;  1SKR A;  1J5E K;  3PO5 A;  3EKU A;  3SK3 A;  2E2N A;  4EHT A;  3QBW A;  1HYZ A;  3PLA A;  3ZET A;  3CJC A;  3F9K A;  2VG5 A;  3O8M A;  4BDY A;  2RN2 A;  1RTH A;  1A5X A;  3OY9 A;  1JLE A;  5DK5 A;  1LWE A;  3W0L A;  2OTL N;  4NCA A;  2QWM A;  1NGC A;  2Q31 A;  3V1O A;  1U47 A;  4GV9 A;  3IKM A;  4GY2 B;  5EVZ A;  4FK2 A;  4N47 A;  1SKS A;  3QEX A;  3AO3 A;  1NMN A;  2E2O A;  3ZT2 A;  4DV4 K;  3I56 N;  4A61 A;  5KTQ A;  2H3G X;  3M3Z A;  1IBM K;  1F21 A;  3LDS A;  4BR0 A;  2XY7 A;  4HHT A;  2FBT A;  1KXP A;  4N56 A;  5T7B A;  5I9E B;  4F3O A;  2VWJ A;  1SV5 A;  3LP2 A;  1IKV A;  1DT9 A;  3TSU A;  2QI2 A;  3A2F A;  4FPA A;  5FPM A;  5J2P A;  2BH1 A;  5JIC A;  3AGK A;  3LL3 A;  2HHS A;  1HKC A;  3ZSY A;  3E01 A;  5HL7 L;  2VQF K;  2ZGY A;  3JSM A;  1NMD A;  4ICL A;  3OJS A;  2ASP A;  2ITG A;  1JCG A;  4FJL A;  3C0B A;  1Y64 A;  4JD2 A;  2KKZ A;  4KRE A;  1N33 K;  1SUQ A;  5AZI B;  1VSF A;  3E9P A;  4BDP A;  1JCE A;  2VWB A;  5A2Q O;  2CH5 A;  3VA0 A;  1EQY A;  1YT3 A;  1ATS A;  3C6A A;  1MWM A;  3DLH A;  4EFH A;  3VQA A;  3R6M A;  3R3L A;  1BQM A;  3AVC A;  3JAM O;  3ULD A;  1TK5 A;  1H1V A;  3DLR A;  4QS9 A;  4CHZ A;  3FZL A;  2QA4 N;  1NJY A;  2B6A A;  3C94 A;  3LAM A;  3H6E A;  3TPQ A;  3V9Z A;  1ZYQ A;  1XNQ K;  4JN4 A;  4CJE A;  3NBP A;  1GLB G;  4CK2 A;  1J53 A;  2VGN A;  3SZ2 A;  3C65 A;  1DTT A;  1W9H A;  1IKY A;  5AQU A;  4CCH A;  4DV0 K;  4FWP A;  1XMO K;  4M3X A;  4JK7 A;  3SUN A;  2P9L A;  4DB3 A;  1RDB A;  3SPZ A;  1A5V A;  3KVG A;  1XC9 A;  4DSF A;  3SBG A;  3WQU A;  4CGI A;  4L8R B;  4JEP A;  1HQU A;  2GUP A;  2WUS A;  4BVO A;  3QEP A;  3D2E A;  4NYF A;  3CJB A;  4L3Q A;  2EX3 A;  5M1K A;  3UKR B;  3OVN A;  3EE8 A;  4CF1 A;  1OH7 A;  5GIP A;  5F0X A;  2PYJ A;  4WQ5 A;  4LH4 A;  2NRT A;  2QXF A;  3CCL N;  1BG3 A;  4MLH A;  4MDA A;  1TAQ A;  2V52 B;  4JK8 A;  2W6L A;  1C0T A;  1ZBS A;  4J2A A;  1D9F A;  2QEX N;  3Q7B A;  4C8M A;  4JI0 K;  4PUO A;  3U3G A;  3EO3 A;  5BPL A;  5LMN K;  5E41 A;  4DSI A;  2VGM A;  1ZXO A;  2KFZ A;  4DR1 K;  3AAR A;  3O4W A;  3CCV N;  3GDQ A;  1HKB A;  1RCH A;  4CEF A;  1OVY A;  4A59 A;  3KK3 A;  4JI1 K;  1FKO A;  1A5W A;  1TL3 A;  4CJQ A;  1VAZ A;  1O13 A;  4NXN K;  3JS6 A;  4JI3 K;  4CJ4 A;  4YDU A;  1KQS M;  3D2F A;  4KB1 A;  4H5W A;  2NRX A;  4JKC A;  1NK7 A;  4N41 A;  2Q36 A;  4KKO A;  4MQ3 A;  4JI6 K;  3P39 A;  3QEV A;  1JKH A;  2DFE A;  1OH8 A;  1LWC A;  4JKF A;  3ZLJ A;  2X6S A;  1WAF A;  3O80 A;  3KKR A;  2HBK A;  4CBX A;  3IDH A;  4U67 L;  3K2P A;  1NNE A;  4JYA K;  4B3M K;  4F8R A;  4FM2 A;  1UA0 A;  5GAH P;  1DKG D;  3WNH A;  3NGI A;  1IBK K;  5HOO A;  4BWJ A;  4I6M B;  3V9U A;  2A41 A;  2GBZ A;  4IJN A;  3WXK A;  4K43 A;  1C1C A;  3SJJ A;  2HHW A;  3VEX A;  1I3A A;  4FM0 A;  3AVJ A;  3RMB A;  2P5O A;  3VQC A;  3HVT A;  3G6E N;  3HK2 A;  1FK9 A;  3EYZ A;  3OS2 A;  4CZG A;  1RT4 A;  4FSV A;  3VQP A;  3FZM A;  3B6O A;  4BRH A;  2ETJ A;  4JKG B;  3UIQ A;  3VGM A;  3VTH A;  3QFU A;  3BDP A;  4H0P A;  5HRN A;  3SUO A;  3KWI A;  2W40 A;  5KRS A;  4U7B A;  1WAJ A;  1RT3 A;  1D8Y A;  4X66 K;  4DV3 K;  2IDO A;  3I55 N;  1IV0 A;  2VG7 A;  4CER A;  4Y1D A;  1ASV A;  4FWK A;  5AQW A;  1IO2 A;  4FPB A;  3HST B;  3MCA B;  1QE1 A;  2ZJQ L;  1NJW A;  1HRH A;  3C6U A;  5JLF A;  4ILG B;  1I39 A;  3ZT3 A;  4HTL A;  4O44 A;  4DSE A;  5H1S Q;  2D0C A;  3LPU A;  3AAQ A;  3AVM A;  4CHN A;  2IVO A;  3NF9 A;  1VHX A;  1FJG K;  2O8D B;  2PFU A;  3FZH A;  3BEX A;  5AQO A;  4K41 A;  4RTF D;  4DFK A;  3CD6 N;  3NE6 A;  1BWF O;  2VG6 A;  2X78 A;  2GEL A;  4B9M A;  4DU1 A;  1U2V A;  4GKK K;  1B9D A;  4CZF A;  1S1T A;  1BI4 B;  3MXJ A;  2D4W A;  1YJ9 N;  1CZ9 A;  2VWK A;  3DRP A;  3THX B;  4JKG A;  4E1M A;  4DTP A;  4CEA A;  1E4F T;  3ENH A;  1GOC A;  1LOT B;  3VQ7 A;  3O08 A;  3J80 O;  4AHS A;  2W41 A;  4OLB A;  3CF5 L;  3B8A X;  1R59 O;  1N5Y A;  4CIG A;  1ZBF A;  3L3V A;  3O4Q A;  3O5B A;  2YJE A;  4B1V A;  2YNF A;  1EWR A;  1BCO A;  3AY9 A;  3QLH A;  4DV7 K;  5J2M A;  4FJ7 A;  4BQZ A;  3CCJ N;  4DUZ K;  1YXQ A;  4EAH D;  1WSG A;  3MED A;  2XO7 A;  1YAG A;  3ISN C;  4CJ3 A;  1W97 L;  1TK8 A;  3VF2 A;  1JLB A;  4E19 A;  1VQ7 N;  3LWL A;  2Y1J A;  3G4S N;  4QAG A;  1CXQ A;  3HPO A;  4B9N A;  4RW8 A;  3VGK A;  3AVG A;  3TAF A;  4Q0B A;  4CZK A;  3NGZ A;  3DI6 A;  2G8I A;  4ZTJ A;  3VES A;  4CGD A;  4CF2 A;  3KK7 A;  3KLE A;  5BRD A;  1ZBI A;  4FXD A;  1T6D A;  3VQ8 A;  4M41 A;  1VQL N;  1QSL A;  1SL1 A;  4XH4 A;  4DTX A;  3CCU N;  5E84 A;  2DY4 A;  3THX A;  1OH5 A;  2QWQ A;  4R5P A;  3AAP A;  4LSN A;  3BGR A;  2A42 A;  5AZJ B;  3NVM A;  4FOE A;  4FZX C;  3LAN A;  3H45 C;  4BR2 A;  3VF4 A;  4CZL A;  4IDK A;  5HRP A;  3KHY A;  4OPH A;  4JLH A;  4C1N K;  2WFB A;  1QQM A;  1S5J A;  4DSL A;  2I5J A;  4CEZ A;  3VET A;  3CCR N;  4EP5 A;  2P9N B;  2ITM A;  3TAB A;  4FW2 A;  1IJJ A;  1GLC G;  2Q1N A;  5DM7 L;  5C24 A;  3VQ6 A;  1T8E A;  1HLU A;  3SQ1 A;  1VSJ A;  2IVP A;  2E20 A;  1S6Q A; 
#chains in the Genus database with same CATH homology
 2ZD1 A;  5KI6 A;  4W5T A;  1W0H A;  1ASU A;  4OLA A;  4FJI A;  1RDC A;  2Q3S A;  3L2R A;  4CED A;  1CXU A;  3AA2 A;  4FLY A;  4KHN A;  4KI6 A;  4M3Y A;  4CJU A;  5SZT A;  2HW3 A;  3OYD A;  3DLB A;  3SUQ A;  3DLE A;  3IS9 A;  4H8K A;  3P5J A;  4B8A B;  3OYJ A;  3L2V A;  3C95 A;  3SQ4 A;  1JLA A;  3PX4 A;  3ZSV A;  3M8P A;  2A1S A;  5J1E A;  4JRP A;  1X9M A;  4IG0 A;  3OYC A;  1TKZ A;  2WOM A;  3HL8 A;  1J5O A;  4Q5V A;  4FJ8 A;  3TWH A;  1SKR A;  1NK4 A;  3PO5 A;  1WSH A;  3PO4 A;  1U49 A;  2JLE A;  1HYZ A;  3EY1 A;  3SV4 A;  4ELV A;  2RKI A;  4DTN A;  1NJZ A;  3F9K A;  1L3U A;  2VG5 A;  4PQU A;  4FK0 A;  3TR8 A;  4PA1 A;  5FDL A;  4ELU A;  4BDY A;  5CY4 A;  2RN2 A;  1RTH A;  1WSI A;  4W5R A;  1A5X A;  1NKC A;  1JXE A;  5I42 A;  3OY9 A;  4J2B A;  4JS5 A;  1JLE A;  5DK5 A;  1LWE A;  1T03 A;  4NCA A;  2P5G A;  2Z1I A;  3ASM A;  3V1O A;  3HT3 A;  1U47 A;  1KVC A;  2FBX A;  4BDZ A;  2DTU A;  1X9S A;  1BL3 A;  3S3M A;  4FK2 A;  3HM9 A;  3CM6 A;  4N47 A;  4RW4 A;  2GV9 A;  1SKS A;  3NDK A;  3AO3 A;  3QEX A;  3ITH A;  3ZT2 A;  1WNS A;  4JS4 A;  2FBV A;  4AIL C;  5KTQ A;  1BHL A;  3V9X A;  3PV8 A;  1GOA A;  3L2Q A;  1KSP A;  1F21 A;  4FK4 A;  3LDS A;  4NCG A;  4CJ5 A;  3PX0 A;  2XY7 A;  4Z4F A;  2W42 A;  3RRG A;  4E7J A;  4FZZ A;  4HHT A;  2FBT A;  4O55 A;  3DYA A;  4DQR A;  4N56 A;  3CQ8 A;  5T7B A;  4DQS A;  3S3O A;  1G15 A;  3QNO A;  1ZBL A;  1KFS A;  4F3O A;  1VRU A;  1REV A;  1C6V A;  2X6N A;  1SV5 A;  3QIN A;  3LP2 A;  4AHV A;  4CF9 A;  3I0R A;  1IKV A;  4KO0 A;  2HVI A;  1R0A A;  4I2Q A;  5JS1 A;  3A2F A;  3TAM A;  4CHY A;  5J2P A;  4FJH A;  4J2E A;  1FXX A;  1WN7 A;  1IKX A;  4LSL A;  2HHS A;  3IAY A;  2HNY A;  3ZSY A;  2E6M A;  3E01 A;  3ZSZ A;  3ZT0 A;  4DU3 A;  1QTM A;  4PY5 A;  3ZSR A;  4YFU A;  2EHG A;  2Z1G A;  4ICL A;  3OJS A;  3JSM A;  4FLZ A;  2ITG A;  1Z25 A;  3NF8 A;  4C8O A;  4FJL A;  1LAV A;  1YTA A;  2XY8 A;  3VQQ A;  3ZT4 A;  3RMA A;  2KZZ A;  1D9D A;  4KRE A;  4N76 A;  1SUQ A;  4KTZ A;  3O3F A;  4DSK A;  1L3S A;  1VSF A;  5J2Q A;  4BDP A;  2QKK A;  1C1A A;  3D45 A;  2HHT A;  3OYN A;  4CF8 A;  3VA0 A;  2KZM A;  2D0B A;  1YT3 A;  4G1Q A;  1EXQ A;  1HQE A;  3VQ4 A;  3SQ2 A;  3MXI A;  1WSE A;  4Z0U A;  2Z1J A;  5KRT A;  4E7I A;  4FLW A;  1MU2 A;  3DLH A;  3ZSQ A;  3V81 A;  2RF2 A;  4CGF A;  3TAN A;  3VQA A;  1BQM A;  1RT5 A;  3AVC A;  3G0Z A;  3ULD A;  4DMN A;  1TK5 A;  3DLR A;  2OZS A;  1XHZ A;  3HPH A;  1Q8I A;  2ZQB A;  3OYG A;  4FJK A;  4YNQ A;  3T3F A;  4CHZ A;  1IKW A;  2G8F A;  4TSX A;  2Y1I A;  4DTO A;  1BIS A;  1NJY A;  2B6A A;  1NK9 A;  3C94 A;  1VSD A;  4O4G A;  5SWM A;  3OYF A;  3LAM A;  5C42 A;  1GOB A;  1RBV A;  4NCB A;  2QK9 A;  3RR7 A;  4NYN A;  3V9Z A;  1ZYQ A;  2F8S A;  1UOC A;  3NBP A;  2D5R A;  3KKS A;  2RPI A;  4CJE A;  4CK2 A;  3SI6 A;  3AA3 A;  4AH9 A;  4F4K A;  3LWM A;  1J53 A;  3QEW A;  3VQD A;  3SZ2 A;  3DRR A;  4F2R A;  2OZM A;  4DSL A;  1BIZ A;  1DTT A;  2JGU A;  1W9H A;  1IKY A;  2IC3 A;  3FFI A;  2YNH A;  3M8R A;  4KFB A;  4DG1 A;  3K57 A;  4CCH A;  4DU4 A;  2PY5 A;  3P83 D;  3AVB A;  4E7H A;  4CEC A;  4E3S A;  4M3X A;  3SUN A;  2ZE2 A;  4DTM A;  1RDB A;  1RTJ A;  1VRT A;  3OYM A;  3RMD A;  1Q9Y A;  3KD5 E;  4OKJ A;  1RBT A;  4FW1 A;  1A5V A;  1RT1 A;  4I9L A;  3K59 A;  3L8B A;  3SPZ A;  2KFN A;  4HVJ A;  5KGX A;  4AHU A;  1XC9 A;  4DSF A;  3MEC A;  3K58 A;  2P1J A;  1L3V A;  4B3O A;  4CGI A;  4CJP A;  4AHT A;  4KB0 A;  3NF7 A;  1LAW A;  4DF8 A;  4DQQ A;  4L8R B;  1HQU A;  4CFD A;  3LZI A;  4DTU A;  3AO1 A;  3AVH A;  3H08 A;  3QEP A;  4HCB A;  3VA3 A;  4C8L A;  4NYF A;  5DMR A;  2G8U A;  2HNZ A;  1QS4 A;  1ZBU A;  5FRM A;  4FLX A;  4M3U A;  2EX3 A;  2IS3 A;  4JRQ A;  2D0A A;  2AJQ A;  4LH5 A;  3OVN A;  3QO9 A;  4XIU A;  3C6T A;  2E4L A;  1U4B A;  4F3T A;  4CF1 A;  1HYS A;  4BE2 A;  4OKK A;  1L5U A;  2PYJ A;  4LH4 A;  1X9W A;  3ZSO A;  4DSJ A;  2QXF A;  1ITG A;  5CYM A;  2XY6 A;  4I2P A;  5JS2 A;  1HJR A;  2B4J A;  3TAG A;  2PYL A;  3I0S A;  1YVU A;  1TAQ A;  3KK1 A;  2HB5 A;  1RT6 A;  1WSJ A;  4OGE A;  3K5N A;  2IOC A;  1C0T A;  4J2A A;  3U3Y A;  1D9F A;  1LW2 A;  3NFA A;  2OPP A;  1UWB A;  1NK6 A;  4KTW A;  3KJV A;  4FCY A;  3KLH A;  1XWL A;  2DFF A;  3AV9 A;  3B6P A;  4C8M A;  4DTR A;  4PUO A;  4W5O A;  3U3G A;  3RTV A;  3AVF A;  3LAL A;  4O5B A;  3LP0 A;  5EU7 A;  4CGG A;  1NOY A;  5FRO A;  5E41 A;  2HHU A;  4DSI A;  4FVM A;  4FM1 A;  3DOL A;  4DFP A;  4OJR A;  1KTQ A;  1HPZ A;  1TK0 A;  3TAR A;  4HCC A;  4ZTF A;  4IKF A;  2XRI A;  1J54 A;  2G8V A;  3RR8 A;  4B8C A;  2KFZ A;  2FBY A;  1IH7 A;  1N6Q A;  4Z4G A;  3LAK A;  4C8N A;  1RCH A;  3CG7 A;  3LPT A;  4DQI A;  4CEF A;  1EKE A;  3KK3 A;  3OS1 A;  1SL0 A;  4KHQ A;  1FKO A;  4GMJ B;  2GUI A;  3RRH A;  1A5W A;  1JXB A;  1TL3 A;  2YKM A;  4CJQ A;  1SL2 A;  4J2D A;  4CHQ A;  4GVM A;  1ZBH A;  3RWU A;  3NGY A;  4CES A;  4OVL A;  1LV5 A;  4HUF A;  4ID1 A;  4CJ4 A;  2PZS A;  3SUP A;  2XHB A;  3NF6 A;  4BE0 A;  2O4G A;  4M45 A;  1KFD A;  3VQ5 A;  4N5S A;  5HLF A;  2G8W A;  2HMI A;  4KB1 A;  1NK7 A;  1B9F A;  4N41 A;  2NUB A;  4KKO A;  4MQ3 A;  3DLG A;  3QEV A;  1JKH A;  1BGX T;  2DFE A;  3SQ0 A;  1S6P A;  1LWC A;  4M3Z A;  1B92 A;  1S1W A;  4KHW A;  2X74 A;  3O4N A;  2X6S A;  4I7F A;  1WAF A;  1KVB A;  3KKR A;  3CM5 A;  2IGI A;  3AVN A;  2OPS A;  1VSL A;  3AVL A;  4BWM A;  1IG9 A;  1RDD A;  3HP9 A;  1Y97 A;  3AO5 A;  3AA4 A;  5CYQ A;  2O4I A;  4RW7 A;  1RTD A;  3K2P A;  2YHA A;  4CK3 A;  1EET A;  3AA5 X;  4F8R A;  4FM2 A;  3KD1 E;  4KHS A;  1UA0 A;  4QCL A;  3WNH A;  4FJJ A;  2G8H A;  3NGI A;  3ZT1 A;  3S9H A;  3HP6 A;  3KLI A;  3MXM A;  3WNE A;  4BWJ A;  4DFM A;  3V9U A;  2KW4 A;  3V9S A;  3ZSX A;  1CLQ A;  3NH0 A;  4DS4 A;  2GBZ A;  3EZ5 A;  5CZ2 A;  3OJU A;  1C1C A;  3SJJ A;  4H4M A;  2HHW A;  3WNG A;  2WON A;  1I3A A;  3AO4 A;  4FM0 A;  3AVJ A;  1VK0 A;  4B08 A;  3RMB A;  4CJS A;  2P5O A;  1BIU A;  3VQC A;  3HVT A;  4QOZ B;  4OKE A;  3NAE A;  4CEB A;  3HK2 A;  1BI4 A;  4CJF A;  2DFH A;  4CJT A;  1FK9 A;  3EYZ A;  4HTU A;  1BQN A;  3OS2 A;  1KVA A;  1LW0 A;  1RT4 A;  4Z4H A;  4DQP A;  3VQP A;  1U04 A;  4HUE A;  3G10 A;  3V4I A;  1NKE A;  1J9A A;  4CF0 A;  3B6O A;  3D0P A;  3RMC A;  2ETJ A;  3M8S A;  4EZ6 A;  3L3U A;  3UIQ A;  1TVR A;  2F8T A;  3PUF A;  1JLG A;  4CJV A;  5HRR A;  3QET A;  3LP3 A;  4CHO A;  3BDP A;  4RW6 A;  5K14 A;  5HRN A;  2OA8 A;  1KLM A;  3SUO A;  3V9W A;  1JL1 A;  3HPG A;  4AHC A;  5KRS A;  1K6Y A;  3THV A;  1WAJ A;  1RT3 A;  5D3G A;  3OYI A;  1EX4 A;  1HNV A;  1QQC A;  3TAE A;  1D8Y A;  2A1R A;  5HP1 A;  4Y1C A;  1NJX A;  2HHQ A;  3O3G A;  2IDO A;  3AO2 A;  4CJR A;  2VG7 A;  3MEE A;  3L2W A;  3SCX A;  4CER A;  2YNG A;  4Y1D A;  3TAP A;  1RNH A;  1ASV A;  3QES A;  1D5A A;  3F73 A;  1VSM A;  1S9E A;  2HHX A;  4LY7 A;  1IO2 A;  3HST B;  4PWD A;  1QE1 A;  1RIL A;  2BGG A;  4O0J A;  4W5Q A;  1NJW A;  1HRH A;  1KRP A;  4KTQ A;  3C6U A;  3V6D A;  4DWI A;  1XHX A;  1FKP A;  1XI1 A;  1I39 A;  4GW6 A;  3ZT3 A;  4CJL A;  4FJM A;  4KAZ A;  1TAU A;  4O44 A;  4DSE A;  4DF4 A;  1U45 A;  2D0C A;  1C0U A;  2B5J A;  3LPU A;  1VSE A;  3AVM A;  4CHN A;  3NF9 A;  1UAX A;  2YHB A;  3NHG A;  3OYL A;  5HRS A;  4FJG A;  3HJF A;  1S1U A;  2HVH A;  1NOZ A;  4IFV A;  5CZ1 A;  4DFK A;  3S3N A;  5FRN A;  1L3T A;  2P51 A;  4CIF A;  3IRX A;  2VG6 A;  3NE6 A;  2X78 A;  3DLK A;  3V1Q A;  2FC0 A;  1RT7 A;  3DMJ A;  4RW9 A;  3MAQ A;  4DU1 A;  4B9M A;  4FZY A;  4RG8 A;  3KK2 A;  4CE9 A;  2LSN A;  2YKN A;  4EP4 A;  4FLV A;  2KQ2 A;  1B9D A;  4CJW A;  3TI0 A;  4FJ5 A;  4FJX A;  2KTQ A;  1TKT A;  1S1T A;  1EP4 A;  4ELT A;  1BI4 B;  3MXJ A;  4CFC A;  4F2S A;  4ID5 A;  1CZ9 A;  2VWK A;  3DRP A;  4E7L A;  1C0M A;  1YTU A;  4E1M A;  3O3H A;  3AVI A;  4DTP A;  4CEA A;  4E1N A;  4H4O A;  1GOC A;  3M8Q A;  4UQG A;  4Z4E A;  1JLF A;  3L2U A;  3VQ7 A;  3NH2 A;  4I9Q A;  1VSK A;  3ALY A;  4AHS A;  3LZJ A;  4OLB A;  2VWJ A;  1VSI A;  4KHU A;  3PX6 A;  1HYV A;  3OYE A;  4Z4I A;  1RTI A;  4KV8 A;  2HHV A;  2ATQ A;  1DTQ A;  4CGJ A;  3DRS A;  1TKX A;  1WSF A;  1X1P A;  1N5Y A;  1JL2 A;  4CIG A;  4CJK A;  1ZBF A;  3L3V A;  3O4Q A;  3QNN A;  2YNF A;  3VN5 A;  3AVK A;  4CEQ A;  1BCO A;  4CEO A;  4OPK A;  3CFP A;  3QLH A;  5J2M A;  4FJ7 A;  4B9L A;  1S9G A;  1T05 A;  4LD0 A;  3OYB A;  4FYD A;  2BAN A;  2Z1H A;  1WSG A;  3MED A;  2IAJ A;  3TAQ A;  4IFY A;  2XO7 A;  3NCI A;  1RBU A;  3QEI A;  1QSY A;  3ISN C;  2XY5 A;  4CJ3 A;  3KTQ A;  2OYQ A;  1TK8 A;  1RDA A;  1TKD A;  5J2N A;  1HMV A;  3HYF A;  1JLB A;  4B9U A;  3VQE A;  1JLC A;  1RT2 A;  2OPQ A;  1NK8 A;  4E19 A;  1HNI A;  3QIP A;  4AHR A;  4CFA A;  1KLN A;  1VSH A;  3LWL A;  4EZ9 A;  2Y1J A;  4C8K A;  2OPR A;  4QAG A;  1CXQ A;  3HO1 A;  3HPO A;  1SKW A;  4HUG A;  1UA1 A;  4K8X A;  4B9N A;  3PY8 A;  2R7Y A;  4RW8 A;  2BE2 A;  3P1G A;  4DFJ A;  3DM2 A;  3SNN A;  3OYK A;  4OPJ A;  3AVG A;  4CFB A;  3HXM A;  3TAF A;  4FLU A;  4DS5 A;  1RBS A;  4M42 A;  4Q0B A;  3NGZ A;  3JYT A;  3SYZ A;  3CFO A;  3DI6 A;  4CK1 A;  2G8I A;  4ZTJ A;  4B9V A;  1U48 A;  2BDP A;  4KRF A;  3SV3 A;  3AVA A;  4IBN A;  4DLG A;  4CGD A;  4CF2 A;  1CZB A;  1Z26 A;  3KLE A;  1ZBI A;  4FXD A;  4E89 A;  1WLJ A;  3VQ8 A;  4MFB A;  4M41 A;  1QSL A;  4KPY A;  4ZHR A;  1BCM A;  1C1B A;  1SL1 A;  4CIE A;  4BAC A;  2F96 A;  3KLF A;  1S1V A;  1S1X A;  1LWF A;  3K5O A;  4DTX A;  3U6F A;  4M3T A;  4IG3 A;  2DY4 A;  4W5N A;  4M3W A;  4B9T A;  4OGC A;  4FJN A;  3VQ9 A;  4LSN A;  4R5P A;  3K5L A;  3K5M A;  4FJ9 A;  3OYH A;  1KCF A;  1TGO A;  2E6L A;  3BGR A;  4DTS A;  4Z4C A;  4DLE A;  3LP1 A;  3MEG A;  1NK5 A;  3QIO A;  5KGW A;  4M3R A;  4FZX C;  3LAN A;  3DOK A;  3CFR A;  4IDK A;  1ASW A;  3T1A A;  4CHP A;  5HRP A;  3OYA A;  1DLO A;  2G8K A;  1T7P A;  4KI4 A;  4JLH A;  3ZCM A;  4O0I A;  5HBM A;  1S5J A;  1TL1 A;  4WE1 A;  3T19 A;  4CEE A;  3KLG A;  1TV6 A;  3ZSW A;  1QHT A;  2I5J A;  3VQB A;  4CEZ A;  4FLT A;  3SPY A;  1JLQ A;  4E0D A;  4E7K A;  4EP5 A;  5HRO A;  4K8Z A;  3KIO A;  4B9S A;  2QKB A;  3CYM A;  3NH1 A;  3OS0 A;  3TAB A;  4KHY A;  4FW2 A;  4CGH A;  4DTJ A;  2YNI A;  2YV0 X;  1O1W A;  4BE1 A;  2HND A;  3I8D A;  5C24 A;  3VQ6 A;  3IG1 A;  3HVR A;  5I3U A;  1RBR A;  1Q9X A;  1T8E A;  3SQ1 A;  1QSS A;  1NK0 A;  1VSJ A;  1NKB A;  3WNF A;  3V1R A;  3QER A;  5C25 A;  1S6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...