4CFAA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
molecule tags Transferase
source organism Human immunodeficiency virus 1
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cfaA00
5K14A 1TK5A 4E89A 3ZSWA 3I8DA 1QE1A 3QEIA 4CFAA 5KRTA 4UQGA 4B9SA 2OA8A 3V1OA 1S1VA 4N76A 2KTQA 3OJSA 4DTJA 3AA5X 3ALYA 4B9NA 1LWCA 4CJRA 3AVFA 1X9SA 4OGCA 4Y1DA 5CZ1A 3AVIA 3CQ8A 1RDBA 3PUFA 4YNQA 2G8HA 4W5NA 5FRMA 2P1JA 4KB0A 2EHGA 3MXMA 2XY7A 1U45A 4DLGA 4DQPA 4CGHA 4EZ6A 4KI4A 4DWIA 3L3UA 4AHRA 2FBYA 4CJTA 5HBMA 5HP1A 5CYMA 1TKDA 1NKEA 3AVAA 1RDAA 1TGOA 4KHSA 2D0CA 3VN5A 2IS3A 4E1MA 3SJJA 1JL2A 4OKKA 2Z1GA 4GW6A 4PUOA 3OYHA 4DQSA 1D5AA 1TL3A 4AHUA 2G8FA 1SL0A 5C24A 3DRSA 3NH2A 1WLJA 1S1UA 2DFHA 5HRPA 2ZD1A 3OYAA 4CJKA 1X9MA 4J2EA 2HW3A 4ELUA 4JRQA 5HROA 4KB1A 2YNHA 5J1EA 4CF8A 1Q8IA 1UA0A 2YNIA 2KQ2A 4BACA 5JS2A 1VSDA 4M3UA 3D0PA 2FC0A 3F9KA 4FLVA 1EP4A 2QK9A 3M8PA 1NK8A 4LH4A 4E19A 3V9UA 3TAGA 4FVMA 4DG1A 3OYKA 3D45A 3OJUA 3V9WA 1ASVA 2G8WA 4CFDA 4FJLA 2KW4A 3V4IA 3K59A 3S3NA 3MAQA 1RNHA 1ZBIA 1TV6A 1WAJA 4LSLA 1JLQA 4CHYA 3HK2A 3CFPA 4HVJA 3MECA 3TWHA 3V9ZA 3TI0A 2ITGA 4C8MA 3WNHA 1EKEA 3K5OA 4DLEA 4M3RA 4N56A 2ZE2A 1KFSA 5KTQA 1TL1A 3VQCA 1I39A 4B9MA 3RRHA 1BCOA 2DY4A 4CEDA 4CJVA 2ZQBA 5FDLA 2QKKA 3DLGA 2Z1JA 3AVNA 5DMRA 2HNZA 4CCHA 5HRRA 4CHQA 2XHBA 3VQ7A 4B3OA 3OS1A 4ELTA 2FBTA 2E4LA 3V1QA 3OYJA 3TAPA 4H4OA 3HO1A 4BE0A 1CZ9A 2I5JA 5DK5A 3RMAA 1BIUA 3VA0A 3MXIA 1HYSA 2HVHA 1GOCA 3PO5A 4CJ5A 3RMCA 1L3VA 3CFOA 4PWDA 4CJ4A 4HUEA 2A1SA 4I2PA 4HCBA 1J53A 3KLEA 4B9UA 1L5UA 2F8SA 4CESA 3AVHA 1C1AA 4I2QA 3AO2A 3VQPA 3HPHA 1FXXA 4HCCA 2G8VA 3KKRA 4J2DA 3G10A 3K5NA 3AVCA 1QSLA 3CYMA 1RTIA 1O1WA 1ZBLA 3SPZA 1BGXT 2VG7A 4FK0A 2OPSA 4KTWA 3TARA 4DQIA 4M42A 4CEOA 2F8TA 5SWMA 3IS9A 2O4IA 2OZSA 4JRPA 4FJJA 4F3OA 1XC9A 2HNDA 3V9SA 1SL2A 4KHUA 2X78A 2HHXA 1EXQA 3JSMA 3ISNC 2IC3A 4KPYA 4FZXC 2KZZA 2RF2A 1VK0A 4E0DA 3PV8A 2YV0X 1TKTA 1S5JA 4E1NA 4FM2A 3HVTA 2Z1HA 1JLEA 2XY5A 4F2SA 2IGIA 4O0JA 1CXQA 1S6PA 2JLEA 1X1PA 3RR7A 3NBPA 3QLHA 4DTPA 1SUQA 4DQRA 1QSSA 4CIFA 2OPRA 2G8UA 3V6DA 4CGJA 2HHQA 1BQNA 1JL1A 2IOCA 3KLFA 3OYIA 3LP3A 3NF9A 1RTHA 3H08A 1J9AA 3QEPA 4I9LA 2QKBA 1C0MA 3F73A 1BI4B 3MEGA 2GUIA 4FLZA 3L2QA 4DSEA 3PX6A 1WSEA 1U48A 3DMJA 1VSJA 1S6QA 4J2AA 1C6VA 4H8KA 4OLBA 5HRSA 4LH5A 5J2NA 1C1BA 4NCAA 4FZZA 4W5OA 3V81A 4FJNA 3BDPA 1HQUA 3NF7A 2Y1JA 2P5OA 1NK5A 2X74A 3LALA 4OLAA 3IAYA 2WONA 1NOZA 4KHQA 3KLGA 1S1WA 1VSLA 4AHTA 3QEVA 4FJIA 3LANA 3QETA 4DTNA 2BANA 4MQ3A 3OYLA 3OYBA 3VQQA 4LD0A 1KLMA 3K5LA 5CYQA 3M8SA 2OZMA 3OYMA 4FJKA 2DTUA 4O55A 4R5PA 4CGDA 2BDPA 1BIZA 4BDPA 4QOZB 1S1TA 4CF2A 4CK3A 4FJMA 2Z1IA 4Z4HA 3QIOA 2HHTA 4CK2A 3U3YA 2OPQA 2KFZA 1ZBUA 4G1QA 1KVCA 3RTVA 1NK7A 2OPPA 4DQQA 4DF8A 1LAWA 3O4NA 4DMNA 2R7YA 4DTMA 3DRRA 2YHAA 4B8AB 3L2UA 3QINA 4FXDA 4BWMA 1EX4A 3CFRA 2PZSA 3VQBA 4F3TA 1JXBA 3SV4A 4HTUA 1JKHA 4ELVA 2XO7A 4FZYA 2XRIA 3DRPA 4OPKA 1KTQA 1I3AA 5J2PA 2KFNA 3RR8A 1LAVA 2HVIA 1VRUA 3AO1A 3L2VA 2RPIA 1NOYA 4Y1CA 1RBSA 3CM6A 4CJ3A 1T7PA 4DFPA 1TKXA 3QESA 4PY5A 1GOAA 1C0UA 1HRHA 4FW2A 4E7JA 1HNVA 4Z0UA 3VQ9A 4CJPA 4FJHA 2GBZA 1RT3A 4F2RA 4CIEA 4HUGA 1RTJA 3ZSZA 4DFJA 4ICLA 4FJ5A 1X9WA 1S9GA 3O3GA 4JLHA 3KJVA 1RDDA 2ATQA 2AJQA 3DI6A 4ZTJA 2XY6A 4CEBA 1HQEA 3KK3A 3TANA 3I0SA 4N41A 4OPJA 3ZT4A 3TR8A 3PX0A 3WNFA 3SQ2A 1TK0A 1BL3A 2E6LA 1YVUA 4W5RA 3SQ4A 1L3SA 4C8NA 4FLYA 1A5XA 3PX4A 3M8RA 4DS4A 3NCIA 3O3FA 3NAEA 3TAQA 3SUOA 4M3WA 4KHNA 2QXFA 2HHSA 4CJQA 4KKOA 3NH0A 3L8BA 2HHVA 4FJXA 1CXUA 2RKIA 1SKWA 4N47A 1ZBFA 4K8XA 4K8ZA 2KZMA 4M41A 4QCLA 4E7LA 3ZSRA 1GOBA 1HYZA 3S3MA 1VRTA 4DTRA 2D0BA 3NGZA 3V9XA 4DSFA 4KTQA 3VQAA 3O4QA 1CZBA 4CEZA 5SZTA 3ZT1A 4BDYA 2PYJA 1WNSA 4DSKA 1NK9A 4Z4EA 1RTDA 3C6UA 2OYQA 3KK1A 4KRFA 3TAFA 4F8RA 1W9HA 4CJWA 3C94A 1Q9XA 3M8QA 4I7FA 3KLIA 3MEEA 5KGXA 4YFUA 1RBTA 5J2MA 3OS2A 3U6FA 1KFDA 1RT5A 1R0AA 3AVMA 3JYTA 1HPZA 1RDCA 4KO0A 2EX3A 4W5QA 4EP4A 1RBUA 3OY9A 3NGIA 3UIQA 4PA1A 3NH1A 4BDZA 3S9HA 2LSNA 3KD1E 4GVMA 4HUFA 1KRPA 3QEWA 2DFFA 4CEQA 3C6TA 1WN7A 3G0ZA 4IBNA 3E01A 1JLAA 4RW8A 3QNNA 3RWUA 4CIGA 3PO4A 4FJ9A 3AA4A 4DTUA 4IG3A 3I0RA 1U04A 1NK0A 3HSTB 3RMDA 4AH9A 3EYZA 3HP6A 3B6PA 4O5BA 1HJRA 1HYVA 3ZSOA 1TK8A 1BISA 3K57A 4BE2A 1IKYA 4OGEA 4Q5VA 1SL1A 3SNNA 4FM1A 3SI6A 3NF8A 1NJYA 1ITGA 3ZT2A 4KTZA 5E41A 3KLHA 4CE9A 3KD5E 4FCYA 3HT3A 1RT1A 3DLKA 3LPUA 4CJFA 3AO4A 4EP5A 5HRNA 1JLCA 2X6NA 4KV8A 1RT2A 3LZJA 1LW2A 1JLFA 5FROA 1L3UA 2W42A 4NYFA 2FBXA 1SKRA 1J54A 4ID1A 4CGIA 2XY8A 2P51A 1RBVA 4E3SA 3OYEA 1QSYA 3LDSA 1XWLA 1KVBA 3FFIA 4IFYA 3DOLA 4DTXA 1IKWA 3S3OA 1KLNA 1LV5A 3T3FA 3LP1A 4OKJA 1KCFA 4RW7A 4F4KA 1JLGA 3VQEA 2YNGA 4E7HA 1QTMA 5D3GA 1FK9A 2IDOA 3AO3A 4AHCA 5J2QA 3SQ1A 1BCMA 1UA1A 1KSPA 2HHUA 4WE1A 4NCBA 3MEDA 3SUNA 2HB5A 3NE6A 4OVLA 1ZBHA 2YNFA 1CLQA 3TAEA 3ZCMA 2E6MA 1IKVA 4KREA 3T1AA 4KHWA 3ZSVA 5C25A 3O3HA 3OS0A 1RBRA 4O4GA 4PQUA 1XHXA 2P5GA 5EU7A 1D9DA 5KI6A 1A5VA 1B92A 4NCGA 3AVGA 1YT3A 4QAGA 1DTTA 1WSJA 4IFVA 1FKOA 5C42A 1B9DA 1EETA 1D8YA 4FK2A 1ASUA 3LAMA 1VSKA 3THVA 3WNEA 3B6OA 1RT6A 3KK2A 4E7KA 1T03A 1ASWA 3OYFA 1DLOA 1DTQA 4FJ8A 3AO5A 2VWKA 2YKNA 4FM0A 2F96A 1U49A 2BE2A 1VSEA 1T8EA 4M3YA 3MXJA 4CHZA 3QERA 4CFCA 3SCXA 4M3TA 4CJEA 1NJXA 3LZIA 1IH7A 1A5WA 1MU2A 1W0HA 3V1RA 4ZTFA 3VQ6A 3RRGA 1WSGA 2D0AA 3DLRA 1JXEA 3NDKA 4Z4FA 1QHTA 2VG6A 1S1XA 1BI4A 3K2PA 4IKFA 3SPYA 3QIPA 4DU1A 4CERA 4IDKA 4XIUA 4O0IA 3K58A 4DS5A 4DTOA 1IO2A 1VSIA 1L3TA 3ITHA 2X6SA 2B4JA 4B08A 3L2RA 3HVRA 1HNIA 4Z4GA 4B8CA 4AHSA 1BHLA 4IG0A 1G15A 2JGUA 1D9FA 1F21A 1UWBA 4LY7A 3K5MA 2HMIA 1BQMA 3HXMA 4M45A 5KGWA 2A1RA 4FW1A 2YHBA 3EY1A 4KAZA 3L2WA 3LP2A 1NK4A 3CG7A 4FYDA 2VG5A 1SV5A 2O4GA 1QQCA 1K6YA 1Z26A 3NF6A 4DU4A 1U47A 3C95A 4DFKA 4CF9A 1KVAA 2HHWA 4CGGA 1J5OA 1NK6A 4BE1A 4DF4A 4AILC 1RILA 1NJZA 2PYLA 3DOKA 4N5SA 1TAQA 3HPOA 4RG8A 3ASMA 3QO9A 4FLUA 4L8RB 3VQDA 1UAXA 3SV3A 3OVNA 1IG9A 3TABA 3HJFA 2G8KA 4CGFA 3U3GA 3AV9A 3ULDA 4B9TA 3HM9A 3NHGA 3DYAA 4KFBA 1NJWA 4W5TA 1REVA 4C8LA 1XHZA 1LW0A 2ETJA 4RW4A 2DFEA 3EZ5A 2NUBA 4CEEA 4O44A 3P83D 3TAMA 3ZSQA 5I3UA 4RW6A 1WSHA 5KRSA 1VSHA 4ZHRA 1Y97A 1RT7A 1Q9YA 4DSLA 3LPTA 3KTQA 1RCHA 5CZ2A 2Y1IA 4DSJA 4FK4A 4ID5A 4CK1A 5T7BA 1WAFA 3BGRA 3AVBA 4BWJA 4CFBA 4DU3A 4C8KA 4M3ZA 3CM5A 3VQ4A 1WSFA 3DLEA 3DM2A 3HYFA 3P5JA 3AVJA 4DFMA 4LSNA 2PY5A 2YKMA 4DSIA 4I9QA 4H4MA 4CEAA 1YTAA 4CJLA 5JS1A 3ZSYA 1LWEA 2WOMA 4RW9A 3IG1A 3DLBA 3OYGA 3AA2A 3NGYA 1TKZA 3A2FA 4FLWA 1ZYQA 3SUQA 2Q3SA 2FBVA 3HP9A 3VQ5A 3HL8A 5HLFA 3KKSA 1Z25A 3NFAA 3IRXA 3L3VA 2RN2A 1RT4A 4CF1A 1TVRA 5I42A 3AVLA 3OYNA 1B9FA 4FJGA 3ZSXA 4CHPA 4CHNA 1TAUA 4Z4CA 1UOCA 1HMVA 4NYNA 3T19A 4CHOA 4CJSA 2VWJA 4DTSA 2HNYA 3QEXA 3SQ0A 4C8OA 4KHYA 2G8IA 3VQ8A 1IKXA 4HHTA 1YTUA 1LWFA 4J2BA 4CJUA 3SYZA 4B9LA 1NKBA 3WNGA 1NKCA 4EZ9A 1N5YA 2D5RA 2GV9A 1WSIA 1U4BA 1T05A 2IAJA 1C1CA 3LP0A 4FLTA 1C0TA 1JLBA 3SUPA 4M3XA 3LAKA 1VSMA 3AVKA 3LWLA 4E7IA 4CECA 3AA3A 3LWMA 3ZT0A 4TSXA 4JS5A 5FRNA 3DLHA 2BGGA 3ZT3A 5CY4A 1S9EA 2B6AA 4CF0A 4Q0BA 4AHVA 4FLXA 4KI6A 4FJ7A 3OYCA 3QNOA 3HPGA 1VSFA 4OKEA 4JS4A 3SZ2A 3RMBA 1SKSA 3KIOA 4MFBA 3PY8A 3VA3A 4CEFA 1XI1A 3P1GA 4GMJB 1QS4A 1FKPA 1N6QA 4B9VA 2B5JA 4OJRA 3OYDA 4Z4IA
chains in the Genus database with same CATH superfamily
2O8EA 3CQYA 3QEIA 4CFAA 4O8KA 4N76A 4DTJA 3VGMA 3LL3A 3C7NA 5EOYA 3ZEUB 3AVFA 1QQMA 3WXLA 5CZ1A 1HJOA 2QI2A 4BR4A 5C2FA 3MXMA 3A8YA 3O4WA 2RE2A 3THWB 2A40A 4DLGA 4EZ6A 2YHXA 5AQOA 5BR9A 5HBMA 4FWKA 3CJ9A 1RDAA 2IS3A 4PUOA 4AHUA 1E4FT 4BG8A 3DRSA 4RTFD 1S1UA 2DFHA 2W6KA 5HRPA 4ELUA 5HROA 2YNHA 2OTLN 4ILJA 2YNIA 4JK7A 1O13A 5AQYA 4PL7A 1EP4A 1NK8A 4BVPA 4GKKK 4FVMA 4DG1A 3OJUA 4DV4K 1XMQK 1S72N 5AQSA 2FF3B 4LSLA 4IOAL 3HK2A 4JKFA 4DLEA 5C15A 2ZE2A 1KFSA 4BRAA 4DCHA 1I39A 3EEQA 1BCOA 1SZ2A 4CEDA 1VQ5N 4IEIA 5AQWA 2Z1JA 3CC4N 3K9JA 2AA4A 4ELTA 3T1HK 3HO1A 1CZ9A 2I5JA 5DK5A 3VA0A 2QA4N 1HYSA 4FWPA 3PO5A 2NZTA 4PWDA 4JKDA 1NGCA 2A1SA 4HCBA 3FGUA 3EL2A 1C1AA 3VQPA 1VQ6N 3CYMA 1O1WA 3SPZA 2VG7A 2OPSA 3TARA 5SWMA 4FJJA 4ILHA 4QS9A 5AQVA 5BRFA 3V9SA 2X78A 3ISNC 1OKJA 4FWOA 4FZXC 2RF2A 4E0DA 3PV8A 4WF9L 1SAZA 4YDUC 2Z1HA 2IGIA 4O0JA 1S6PA 4YDUA 3NBPA 1YIJN 4DTPA 3CMEN 3L4QA 2HHQA 2IOCA 3KLFA 3OYIA 3NF9A 1LOTB 3H08A 1VHXA 1Q81O 2UUBK 1J9AA 3QEPA 3T69A 3MN7A 3CPEA 1H1VA 1BI4B 3RSEB 3MEGA 4DSEA 4DR6K 3L2QA 3PX6A 1WSEA 4BGBA 1IBMK 3FR0A 5J2NA 4LH5A 3V81A 3BDPA 3NF7A 2Y1JA 3MDQA 2X74A 3IAYA 4JHDB 3F2KA 5M1QA 3KLGA 3QEVA 5BRDA 3LANA 4JKGA 5JICA 4PL8A 4DTNA 2BANA 3VQQA 4LD0A 2OZMA 5CYQA 3M8SA 2DTUA 3OYMA 4O55A 4CGDA 3LDPA 3DWLA 4BDPA 4YOWA 2Z1IA 3TSQA 1NGAA 4XH4A 2Q31A 2OPQA 2P9UA 4DTMA 2UU9K 3OA9A 2YHAA 3DXKB 4CD1A 4FO0A 3VQBA 1I94K 2YX6A 1W7AA 2P9PB 3G25A 2XRIA 1GLBG 3DRPA 4AF1A 1I3AA 4B3TK 2HVIA 3AO1A 1NOYA 3P39A 3SBGA 1C0UA 2J4RA 3EN9A 4BR5A 4E7JA 4FJHA 2D4WA 3EKSA 4V19S 2GBZA 4CIEA 3C6AA 3ZSZA 1X9WA 4JLHA 2AJQA 3CCJN 3UB5A 4FL9A 1P8ZA 1HQEA 3G4SN 3TANA 2GTDA 3PX0A 4NXNK 2FSKA 1EWRA 1BL3A 2E6LA 1YVUA 2YJFA 3H1VX 3SQ4A 1L3SA 4FLYA 3T7ZA 3NCIA 3E9PA 2NLXA 3D2EB 4JI2K 4BRLA 1J6ZA 3F9MA 2RKIA 4K8XA 1FW6A 2PFUA 3SBTA 4E7LA 3WQTA 1HYZA 1VRTA 3NGZA 4DSFA 3TPQA 5SZTA 4BDYA 4JI3K 1KQSM 1RTDA 4LF9K 2VGMA 3QFUA 5JVGL 4F8RA 4CJWA 4DB3A 1OH5A 3ID8A 3OS2A 1KFDA 1Q18A 1NNEA 3C7NB 1RDCA 4KO0A 3OY9A 1M1KO 2OANA 3ZEUA 3M6GA 4GV3A 2KHOA 4HUFA 5AQTA 4CEQA 2O8CA 3C6TA 1WN7A 1KAZA 5AFUA 4RW8A 1NK0A 3I0RA 3I33A 3EYZA 3HP6A 1HYVA 1TK8A 4BE2A 3SNNA 4DV3K 4FM1A 4H5NA 3ZT2A 3H3OB 4K43A 4H03B 4A62A 4EAHD 3BEXA 3AO4A 3MN5A 1JLCA 4YOVA 1LW2A 2QW9A 5AQXA 1L3UA 2W42A 2NRVA 2FSNA 4E3SA 1XWLA 1KVBA 3DOLA 4FPAA 1KLNA 3R8EA 3LP1A 4WQ5C 1JLGA 3VQEA 5D3GA 4OLAA 2IDOA 1S3XA 4CZFA 3CCSN 3A5NC 3TAEA 3AGRA 3OHRA 3ZCMA 4KREA 3ZSVA 4PQUA 1IG8A 1XHXA 4NCGA 5LL6Z 3AARA 3CC2N 2QXLA 4B1XB 3S41A 3LDLA 5C42A 1D8YA 2V7YA 1VSKA 4MO4A 3WNEA 3LM2A 1Q7YO 1NGIA 4FJ8A 1QQNA 4M3YA 4FM0A 2F96A 1VAZA 3QERA 4CFCA 4CJEA 4BREA 2ZJPL 1T3VA 1JXEA 5ELZA 3CC7N 4BRKA 2VG6A 1S1XA 2WC9A 1BI4A 3SPYA 4IDKA 4XIUA 4DS5A 1IO2A 3ITHA 1DT9A 2X6SA 3HVRA 1G15A 4CZGA 2HMIA 5KGWA 1ZXOA 3EY1A 1NK4A 1ATRA 1SV5A 1Z26A 3GG4A 4CGGA 1J5OA 4LFBK 4AILC 4OPHA 3VERA 3SLCA 5C12A 3DOKA 3QBXA 4L8RB 2HBKA 3SV3A 3HJFA 3CCRN 3TABA 4RCHA 4CGFA 3MN6A 2ZJQL 3FZKA 3EE8A 2WBNA 3OBWA 3HM9A 1HUXA 4KFBA 5CE3A 1U2VA 1HR0K 1REVA 1EQYA 1HKGA 3HTVA 2DFEA 4ISGA 3T1YK 2NUBA 3FZLA 3TAMA 3QICA 3ZSQA 3VEYA 3M1FA 5KRSA 1VSHA 1Q9YA 1RT7A 2W40A 2A42A 4FK4A 4ID5A 3SAGA 4H0YB 2UXDK 1WAFA 2YJEA 4BRGA 1Q82O 2V7ZA 1GLDG 3DM2A 3HYFA 4I9QA 3IMXA 4CEAA 3H45C 3DLBA 3NGYA 3KZBA 3ATVA 3CCUN 3HP9A 4JN4A 2RN2A 1TVRA 4CHPA 3EE9A 3KVGA 3VESA 4NYNA 4CHOA 4BRQA 4KH4A 3MX5A 3VQ8A 2NRHA 5GINA 3CD6N 1LWFA 4LF8K 3WNGA 1N5YA 3E9OA 4O8UA 1C0TA 1ESVA 3LAKA 1VSMA 3AVKA 4L3QA 4WFBL 4B1WB 3GBTA 3AA3A 3ZT0A 5FRNA 3GDQA 4AHVA 4FJ7A 3OYCA 1U2VB 3HPGA 1VSFA 4OKEA 3RMBA 5BPNA 2O8FB 3L6QA 2O8BA 4CEFA 3P1GA 4GMJB 1FKPA 2FF6A 3OYDA 1TK5A 4E89A 3I8DA 4B9SA 3L4IA 3OJSA 4CI6A 3AA5X 3W0LA 3ALYA 4B9NA 1QQOA 1LWCA 3GL1A 1X9SA 3D2EA 1RDBA 2GWKA 4YNQA 2G8HA 4W5NA 5FRMA 1D4XA 2XY7A 4JKHA 4CGHA 4EHUA 4KI4A 1KD1O 5ADXA 3THYB 1NKEA 3O08A 1Z6RA 4CZEA 2D0CA 4CBXA 3CI5A 1JL2A 4OKKA 1P90A 1D5AA 4CJKA 5GAHP 5AQFA 1VQMN 3G6EN 4JRQA 4KB1A 2RHKA 1UA0A 3MWTA 2HBLA 4BACA 4M3UA 2P9LA 2FC0A 4PKGA 3D0PA 1T44A 3R3LA 4LH4A 4BGAA 1Z05A 3TAGA 2QKBA 1CLQA 2P9PA 3NVMA 4JKBA 4H0XB 3K59A 3S3NA 1DKGD 1ZBIA 1TV6A 3U9DA 1JLQA 3CFPA 3TWHA 2ITGA 1WBDA 3C0BA 1EKEA 1N8RO 3CCEN 4DR5K 2NRZA 2O8DA 1XMOK 1TL1A 4B9MA 2DY4A 5FDLA 3CERA 3DLGA 4IO8A 2HNZA 2XHBA 3VQ7A 1VQ9N 1VQPN 2FBTA 1YXQA 4WFAL 3TAPA 5ADXH 4BE0A 3RMAA 3MXIA 1VQNN 4JKCA 1VQ8N 2ZWHA 4CJ5A 3RMCA 3VENA 1K73O 3CFOA 4CJ4A 4HUEA 4I2PA 2F9TA 3W3DA 3UKRB 2WTUA 2P9NA 3AO2A 1FXXA 4HCCA 3K5NA 3AVCA 1QSLA 4ILGB 4FK0A 4KTWA 1QHAA 2IVPA 4JI5K 2HHXA 1EXQA 4DR3K 3VF2A 2IC3A 2BH1A 1TKTA 4E1NA 1JLEA 2XY5A 3C65A 1FJGK 3RR7A 4CZIA 1YI2N 1SUQA 3E66A 3WXIA 2OPRA 2G8UA 3V6DA 4JEPA 3ENBA 1T6DA 3H1QA 3LP3A 3SK3A 2P9NB 4JKEA 1E4GT 3MN9A 1C0MA 2GUIA 5AZJB 4CJ7A 1U48A 5AQLA 3CCLN 1NGHA 2NRTA 1NK5A 3LALA 4J8FA 2PBDA 1NOZA 2EWSA 3O9TA 4LFAK 4KHQA 4JK9A 1VSLA 4AHTA 3Q7BA 4FSVA 4MQ3A 3K0SA 3VETA 3QDKA 5EX5A 3C6HA 5EXWA 3IDHA 1GLAG 4FJMA 3LM9A 2HHTA 3U3YA 3VGKA 2KFZA 3VEOA 3O4NA 4CBUA 4B8AB 3L2UA 4FXDA 4IJAA 1K8AO 1HNZK 4FZYA 4OPKA 4AQYK 5J2PA 2KFNA 3RR8A 3L2VA 5DM7L 1RBSA 3CM6A 1NGGA 5LMNK 3QESA 4JI7K 1GOAA 4CJPA 1K8KA 1RTJA 1X3NA 3H46O 2QTDA 4ICLA 3DAWA 5AQUA 4EFHA 1V4SA 2F4VK 4K42A 3WNFA 1R59O 4BRDA 4X62K 4YHHK 4C8NA 2VYPA 3PX4A 3M8RA 4DS4A 3NAEA 1GLJO 4M3WA 3SUOA 3JXUA 2QXFA 2P9KA 4WCEL 2FXUA 3L8BA 1CXUA 1TUYA 2P9SB 4N47A 4WQ4A 4DV0K 3S3MA 4DTRA 1TYQA 4KTQA 2HBJA 3O4QA 3ZT1A 1WNSA 4Z4EA 2OYQA 3TAFA 3HSCA 1Q9XA 3M8QA 3MEEA 1DGKN 5KGXA 4FWSA 1RBTA 3J7YP 5J2MA 1WUAA 4IDHA 3AVMA 3JYTA 4W5QA 1E3MA 4EP4A 1RBUA 1VQ4N 3S9HA 3QFPA 2LSNA 5JMVA 1KRPA 4A57A 2IVOA 3J7AP 2UXCK 4IOCL 4IBNA 3E01A 3QNNA 3RWUA 4IG3A 3JAMO 5AZIA 5EY4A 3SI6A 4G9ZA 1NJYA 3KD5E 1QZ6A 3HT3A 3M3ZA 3SAHA 2CH5A 4KV8A 3LZJA 5FROA 4BR2A 2GELA 4B3MK 4CGIA 1RBVA 3OYEA 3FFKB 3LDSA 1GLFO 1RGIA 3T3FA 4OKJA 4RW7A 5KPTA 5EVZA 1UA1A 3SQ1A 2HHUA 4HTLA 1NMNA 3CJ1A 3NE6A 3DLLL 4JV5K 1IKVA 4KHWA 3CF5L 5C25A 3OS0A 1RBRA 1OH7A 4O4GA 2Q36A 4MDBA 2P5GA 1D9DA 1NGDA 1TYQB 1HPMA 3HM8A 3BF3A 1N34K 1DTTA 1WSJA 2O8CB 1FKOA 4BC2A 3BP8A 3LAMA 4FPBA 3P31A 3KK2A 1ASWA 1DLOA 1DTQA 2VWKA 4K41A 1T8EA 3MXJA 4IEEA 4C1NK 1NJXA 4C1NI 1A5WA 1GLLO 1MU2A 1WOQA 3DLRA 3UKRA 2HSTA 5M1FA 4BC4A 4LC9B 3NDKA 4DUZK 4Z4FA 4B1YB 4BQLA 3CCQN 1QVFM 3QIPA 4FOEA 4PKIA 3R6MA 2B4JA 3HBTA 1D9FA 1UWBA 1JCGA 3HXMA 1XC3A 4A59A 1NGJA 3L2WA 5AQJA 4BQZA 1YJ9N 3I56N 1MWKA 2P9UB 3IKMA 4BE1A 4C23A 1NJZA 4N5SA 4CZKA 4JI1K 3ASMA 3QO9A 4FLUA 1YAGA 3VQDA 3KHYA 5AZJA 5IWAK 3NHGA 5JLHA 3VTHA 1NLVA 4W5TA 3CXCM 1QZ5A 1XHZA 1VQON 3AGKA 4KH6A 5AQQA 2V51B 3LPTA 2Y1IA 4JAXA 2GWJA 4M3ZA 3BGRA 4BWJA 4OO1J 1WSFA 3D2FB 4BRHA 4CD3A 3P5JA 4DFMA 1W2BM 2PY5A 4DSIA 3ZSYA 1LWEA 4OX9K 1K8KB 3VEZA 3OYGA 1HNWK 3A2FA 1ZYQA 3SUQA 2Q3SA 2FBVA 2GEMA 5HLFA 3KKSA 3IRXA 4K0KK 3OYNA 4CHNA 1TAUA 4Z4CA 1UOCA 1HMVA 2O8DB 3MCAB 3MX2A 2VWJA 4C8OA 2HNYA 2YHWA 3OBYA 2BTFA 3SYZA 3MWPA 1NKCA 5AQZA 1C1CA 4M3XA 1NM1A 2E88A 4CECA 3O1BA 2Q0UA 3DLHA 4CF0A 2VGNA 4UY8O 4FLXA 3SAFA 3QNOA 4MFBA 3PY8A 5FLXO 1N6QA 1QVGM 3MMVA 1ZBHA 4EIAA 2HOEA 4Z4IA 2CGJA 2OA8A 2YHYA 2KTQA 4B1UB 2OTJN 5AQKA 1NGBA 1RDWX 1IJJA 4OGCA 4NB4A 3AVIA 5AZIB 2CGLA 4LF4K 3R9PA 2EHGA 3QMLA 1U45A 4DQPA 2QWPA 4DWIA 4AHRA 2FBYA 3WEEA 4CJTA 5HP1A 5CYMA 3RVCA 3MCPA 1TKDA 3ULEB 1IV0A 1TGOA 4KHSA 4E1MA 3SJJA 5AQRA 4GW6A 3HOTA 4DQSA 1TL3A 2F7TA 2G8FA 3O9UA 5C24A 1SL0A 1WLJA 3OYAA 2ZD1A 4BY9C 4J2EA 2HW3A 5J1EA 1IBLK 4CF8A 1Q8IA 2KQ2A 5JS2A 1VSDA 2QK9A 4BROA 3M8PA 3UE5A 3VEWA 4E19A 3V9UA 2G8WA 3OYKA 4J2DA 3D45A 2VWBA 5GIOA 4FJLA 3V4IA 4U67L 3MAQA 1RNHA 4GKJK 1ZC6A 3FZFA 3V9ZA 3MECA 3TI0A 4C8MA 3E1YA 3WNHA 3E9LA 4M3RA 3VQCA 1NBWA 5HL7L 4FWQA 3I55N 3AVNA 4BG9A 1K9MO 4CCHA 4X65K 3NMUA 4B3OA 1ZBSA 5BN8A 3OYJA 4H4OA 1BIUA 4JI6K 5F1XA 2HVHA 4XEIA 3WUHA 4B9UA 1S22A 1L5UA 2F8SA 3AVHA 3F5TA 3HPHA 3G10A 4ISEA 3B8AX 5LJVA 2DPNA 1ZBLA 3J8AA 4M42A 4QS7A 4DQIA 5CHIA 4CEOA 3L0QA 4KH5A 2OZSA 5KPZA 4JRPA 2HNDA 4KHUA 1KXPA 5F0XA 1VQ7N 4JD2B 4FWLA 4M7XA 2JWLA 4KPYA 3I8BA 1S5JA 4FM2A 4FWMA 5AJ3K 1MWMA 1JCEA 3HVTA 4B1ZA 4DR2K 2JLEA 1X1PA 3QLHA 4CIFA 3R1XA 4CGJA 3HI0A 1BQNA 3SJHA 1RTHA 4H5WA 1WBBA 4I9LA 4DR7K 4DV7K 3F73A 5M1KA 3DMJA 1VSJA 1S6QA 4J2AA 2P9SA 4OLBA 2E1YA 4NCAA 4FZZA 4FWNA 1HQUA 5C0YA 3ATUA 5A2QO 5AQMA 3PIPL 1S1WA 4H0OA 3QETA 2HMPA 3OYLA 4LF5K 4JYAK 1YJNN 3K5LA 3DXKA 4R5PA 2BDPA 1S1TA 3JS6A 4CK3A 3LDOA 4Z4HA 5AR0A 4CK2A 2H3GX 1ZBUA 4G1QA 4FOIA 1NK7A 2R7YA 4DMNA 2ZGZA 1NWKA 1XNRK 5TKYA 3QINA 4H5RA 4BC3A 4PKHA 4F3TA 3FE1A 3CCMN 4HTUA 4DQ8A 4Y0WA 4ELVA 4BRIA 1KTQA 3ZYYX 3BZCA 2RPIA 3HOSA 1T7PA 4DFPA 1TKXA 1N33K 4FW2A 1HNVA 4Z0UA 2ITMA 2QWMA 4HUGA 3O3GA 1RDDA 2ATQA 3DI6A 4ZTJA 2XY6A 4CEBA 4DV1K 3I0SA 4N41A 4OPJA 1RFQA 1YUWA 3TR8A 4DV5K 3U4LA 1C0GA 4JI8K 2HF3A 3ID6A 1YVNA 4ISFA 3O3FA 3CIPA 4KHNA 5BRHA 4XH5A 3NH0A 4AM7A 2HHSA 4FJXA 2ASOA 3EO3A 1SKWA 4K8ZA 4M41A 4QCLA 2NRWA 4BR9A 1YJWN 3VQAA 4CEZA 3CHWA 2PYJA 2VQEK 2E5LK 4DSKA 1NK9A 3WEEB 5TKWA 3DXMA 3C6UA 3KK1A 4KRFA 2F9WA 4I7FA 3WXKA 4PHTX 3U6FA 1RT5A 1HKBA 3CJ7A 3UIQA 2EX3A 1VQKN 3SMPA 3NH1A 3KD1E 2DFFA 3FZMA 3G0ZA 3O5BA 3O9SA 1NMDA 1BA1A 1JLAA 4FJ9A 1GLCG 4CIGA 3PO4A 3AA4A 3D2FA 4DTUA 4BRPA 1U04A 4NO7A 1Q86O 4AH9A 3B6PA 1HJRA 3VEXA 3ZSOA 1JJ2M 1BISA 2Q0RA 1SL1A 1IKYA 4OGEA 3VEVA 5M1OA 4R79A 4Q5VA 4DV2K 3NF8A 3THWA 1ITGA 5E41A 4KTZA 3KLHA 4CE9A 2W41A 5JLFA 1RT1A 3DXMB 3LPUA 1OVQA 2VCPA 4CJFA 2W6LA 2QWRA 2ZJRL 3TU5A 2XY8A 2P51A 3PSIA 4CZJA 1QSYA 4IFYA 4XH1A 1IKWA 1BA0A 4DUYK 4F4KA 4CVNE 4E7HA 3J81O 1QTMA 1ATSA 4A5AA 4AHCA 5E26A 1BCMA 1KSPA 2UXBK 4WE1A 3J80O 3THXB 4NCBA 1NG9A 2HB5A 3P4IA 4OVLA 3ZX3A 2YNFA 3IUCA 5H1SQ 3T1AA 3O3HA 2ASMA 1HLUA 5KI6A 1A5VA 1B92A 1GLEG 4WQ5A 1T6CA 4IFVA 1B9DA 2A5XA 1ASUA 4RWTA 1YF5L 3RSEA 3THVA 3B6OA 1RT6A 4IXCA 1T03A 1U49A 3PSFA 1VSEA 4CHZA 5AQHA 3SCXA 1IBKK 4M3TA 4IFEA 3CJBA 1W0HA 3FZHA 4ZTFA 3VQ6A 5MLCQ 1WSGA 3UKUB 2D0AA 4M63C 1BDGA 3K2PA 3KWGA 4DU1A 3N4QA 4CERA 3QB0A 1BWFO 1VSIA 3L2RA 1RDUA 1HNIA 4AHSA 4CZMA 4IG0A 4YY3K 3D7EO 4LY7A 3K5MA 2P9KB 2YHBA 4KAZA 3LP2A 3CG7A 4FYDA 4DU4A 2O4GA 1QQCA 1K6YA 3NF6A 5E84A 3C95A 4CF9A 1KVAA 4KBOA 3HPOA 1TAQA 4RG8A 3DJCA 2ASPA 3A5OC 3SMSA 3AV9A 3ULDA 4B9TA 3ZETA 3DYAA 4MO5A 4H0VB 3QBWA 1LW0A 4E1JA 2FSJA 4B3SK 3Q7CA 2HF4A 1WSHA 4DSLA 4ZHRA 2P9IB 3KTQA 1RCHA 3AY9A 5CZ2A 1W97L 3VPZA 4DU3A 2Q2RA 3VQ4A 3CM5A 3BUZB 3A0IX 3AVJA 4B9QA 2YKMA 4H4MA 3FLCO 2WFBA 2WOMA 4RW9A 2QWQA 2UUAK 2HBMA 3CJCA 2CGKA 5GIPA 5F2RA 4IOXA 3VQ5A 1Z25A 3NFAA 2QWNA 5B8HA 1XQSC 1RT4A 4CF1A 3O8MA 3AVLA 5I42A 4FJGA 2QEXN 5JVHL 3T19A 3QEXA 4YORA 1IKXA 4HHTA 1OH6A 4CJUA 4B9LA 1NKBA 4EZ9A 1WSIA 2O8EB 1T05A 3UKUA 2O8FA 1BU6O 4X64K 4YOTA 3LWMA 1NU0A 4TSXA 4JS5A 2BGGA 2B6AA 3ZX0A 3U8XA 4KI6A 2ZF5O 4JS4A 1SKSA 3KIOA 1TUUA 4LF7K 3VA3A 1XI1A 3O6WA 3VF6A 3WXJA 4B9VA 2B5JA 3VGLA 5K14A 3ZSWA 4IO9L 1QE1A 4A61A 5KRTA 4UQGA 1XUPO 4WQ4C 5M1PA 3V1OA 1S1VA 5C10A 3KWIA 4CJRA 3ZX2A 4Y1DA 3CQ8A 3PUFA 2P1JA 4KB0A 4BR0A 3N4PA 3L3UA 4NXMK 3O80A 4K25A 3AVAA 3LDNA 3VN5A 4LF6K 2Z1GA 3OYHA 2QWOA 1EO1A 3D6RA 3NH2A 1X9MA 3A5MC 4H5TA 1DEJA 1M90O 3F9KA 4FLVA 3OTOK 4X66K 5KQDA 3BY5A 1OVYA 3V9WA 2E8AA 3PLAA 1ASVA 5FPNA 4CFDA 2KW4A 1WAJA 1Y64A 4CHYA 4HVJA 2D0PA 3K5OA 5BPMA 4N56A 3M5RA 3O9RA 5KTQA 1WB9A 3RRHA 3KK7A 4CJVA 2ZQBA 4GV9A 2QKKA 5DMRA 4Z94A 5HRRA 4BVOA 4CHQA 4JKAA 4WYBA 4GY2B 3OS1A 2E4LA 2GUPA 2I7NA 3V1QA 3PIOL 5FPEA 2NRRA 1GOCA 3CMAN 1BO5O 1L3VA 2YCHA 1LCUA 1J53A 3KLEA 5AFUH 3AAQA 4CESA 4I2QA 2E20A 2G8VA 3KKRA 3WQUA 5BN9A 3A5LC 3VTIA 1RTIA 4WFNL 1BGXT 2FLOA 2F8TA 3IS9A 2D1KA 2O4IA 4F3OA 4DR1K 1XC9A 1SL2A 4MLEA 1X9JA 3JSMA 2KZZA 1KAYA 1VK0A 2YV0X 4A2AA 3MK6A 5GAGP 4F2SA 3GOIA 1CXQA 4BRFA 2ZGYA 4DQRA 1QSSA 4KHPK 1JL1A 1OH8A 1BG3A 4FVUA 4IZ9A 5HOOA 2GX9A 4F9OA 1VQLN 4JNEA 4FLZA 3TSPA 2E2OA 3CCVN 5AQGA 1C6VA 4H8KA 5HRSA 1C1BA 1N36K 4O5FA 4W5OA 4FJNA 4HWIA 5BR8K 3HRGA 2P9IA 2WONA 2AP1A 4H0TB 4FJIA 3K9KA 4YOXA 3OYBA 5LY3A 4JK8A 1KLMA 4FJKA 1NGFA 3CQXA 4NLCA 3EKUA 1BIZA 4QOZB 4CF2A 3QIOA 1X3MA 4JD2A 1KVCA 3RTVA 4A5BA 2OPPA 4DQQA 4DF8A 1LAWA 3DRRA 4DV6K 5LMUK 4BWMA 1EX4A 3CFRA 2PZSA 1JXBA 3SV4A 1JKHA 2UUCK 2XO7A 4H5VA 1ILYA 5C2DA 3TSUA 2QWLA 2NRXA 1LAVA 1VRUA 3LDQA 4GNIA 4Y1CA 4CJ3A 1G99A 4PY5A 1HRHA 4OPAA 3VQ9A 1RT3A 4F2RA 3CETA 4DFJA 4FJ5A 1KAXA 4DR4K 1S9GA 4A2BA 3KJVA 1C0FA 3KK3A 3ZT4A 4QS8A 2Q1NA 3SQ2A 1TK0A 3AAPA 4W5RA 3GE1A 3ENHA 4DKWA 1A5XA 2E1ZA 2Q97A 3TTFA 3TAQA 5AQPA 2WUSA 4CJQA 4KKOA 2HHVA 2V52B 1YITN 1ZBFA 2KZMA 2A6AA 1GOBA 3ZSRA 4JI0K 2D0BA 1J5EK 3V9XA 4BR7A 1CZBA 4B3RK 3IFRA 3CPWM 1W9HA 4NLBA 3C94A 3KLIA 4YFUA 3CJAA 3WXMB 1R0AA 1HPZA 3G71N 3NGIA 1ATNA 4PA1A 5I9EB 4BDZA 1MA9B 4BRMA 4GVMA 3QEWA 2OCEA 4FWRA 1YHQN 3U9ZA 4LFCK 1HKCA 5IT9O 2IVNA 3HSTB 1NGEA 3RMDA 4O5BA 4BRCA 3K57A 3VF4A 2KLAA 5M1NA 5AQNA 2A41A 1HNXK 2I7PA 4FCYA 3H6EA 3DLKA 5DM6L 3P38A 4EP5A 5HRNA 2X6NA 3J7ZO 1RT2A 1JLFA 5GAEP 4H0PA 1V4TA 4NYFA 2FBXA 1SKRA 1J54A 4ID1A 3BF1A 1BUPA 4MLHA 3THXA 3ULEA 3FFIA 4DTXA 3S3OA 4CBWA 1LV5A 4JKGB 1KCFA 4I6MB 3WT0A 2YNGA 3NVKA 4JI4K 4JHDA 1FK9A 2ZM6K 3AO3A 5J2QA 5GADP 4BRNA 3MEDA 3SUNA 1EWQA 1MDUB 4CZLA 2E6MA 5KQ8A 4CW7B 5EU7A 3AVGA 4AM6A 1YT3A 3THYA 4QAGA 3ZLJA 3O1WA 1EETA 3EZWA 4FK2A 3TTCA 2D0OA 5CR4A 4E7KA 3OYFA 3AO5A 2YKNA 2A3ZA 2BE2A 4IJNA 2P9LB 5FPMA 3LZIA 1IH7A 4I6MA 2PAVA 4M7YA 5FPDA 3V1RA 5BPLA 3RRGA 2E2NA 1QHTA 2E2PA 1HX1A 3VOVA 2VQFK 4IKFA 4O0IA 3K58A 4DTOA 1L3TA 2G8KA 2P5OA 2E2QA 3H3NO 4B08A 4Z4GA 4B8CA 1BHLA 2JGUA 1F21A 2QM1A 1BQMA 5AQIA 4M45A 2A1RA 4FW1A 4U7BA 2BUPA 2VG5A 1U47A 4DFKA 5KPRA 2HHWA 3VMFB 1NK6A 4DF4A 1RILA 2PYLA 1CZAN 1UAXA 1IG9A 3OVNA 4GVEA 4BC5A 1SQKA 3U3GA 4CZHA 2NNWA 1NJWA 5BREA 4C8LA 2ETJA 2O8BB 4RW4A 1U6ZA 3EZ5A 4CEEA 1XNQK 4O44A 3P83D 5I3UA 4RW6A 1Y97A 4YOYA 1N32K 2CH6A 2UYTA 4DSJA 4CK1A 5T7BA 4CFBA 3AVBA 4C8KA 3DLEA 4IWVA 4LSNA 2KKZA 1YTAA 4CJLA 4EHTA 5JS1A 3IG1A 3AA2A 1KC8O 1TKZA 4FLWA 4YOUA 3O9QA 1NJIO 3HL8A 3ENOA 3L3VA 3OW2M 1B9FA 3ZETB 3ZSXA 4MDAA 2HHHK 4GV6A 2YI1A 4CJSA 4DTSA 3SQ0A 4KHYA 2G8IA 1YTUA 2IIRA 4DHYA 5LJWA 4J2BA 3HZ6A 2D5RA 2GV9A 1U4BA 2IAJA 4FLTA 3LP0A 3SUPA 1JLBA 3LWLA 4E7IA 2JWKA 4B1VA 3ZT3A 3BZKA 5CY4A 1S9EA 4Q0BA 1JCFA 3SZ2A 1SS6A 1QS4A 3TTDA 4OJRA 1BOTO
chains in the Genus database with same CATH topology
5K14A 1TK5A 4E89A 3ZSWA 3I8DA 1QE1A 3QEIA 4CFAA 5KRTA 4UQGA 4B9SA 2OA8A 3V1OA 1S1VA 4N76A 2KTQA 3OJSA 4DTJA 3AA5X 3ALYA 4B9NA 1LWCA 4CJRA 3AVFA 1X9SA 4OGCA 4Y1DA 5CZ1A 3AVIA 3CQ8A 1RDBA 3PUFA 4YNQA 2G8HA 4W5NA 5FRMA 2P1JA 4KB0A 2EHGA 3MXMA 2XY7A 1U45A 4DLGA 4DQPA 4CGHA 4EZ6A 4KI4A 4DWIA 3L3UA 4AHRA 2FBYA 4CJTA 5HBMA 5HP1A 5CYMA 1TKDA 1NKEA 3AVAA 1RDAA 1TGOA 4KHSA 2D0CA 3VN5A 2IS3A 4E1MA 3SJJA 1JL2A 4OKKA 2Z1GA 4GW6A 4PUOA 3OYHA 4DQSA 1D5AA 1TL3A 4AHUA 2G8FA 1SL0A 5C24A 3DRSA 3NH2A 1WLJA 1S1UA 2DFHA 5HRPA 2ZD1A 3OYAA 4CJKA 1X9MA 4J2EA 2HW3A 4ELUA 4JRQA 5HROA 4KB1A 2YNHA 5J1EA 4CF8A 1Q8IA 1UA0A 2YNIA 2KQ2A 4BACA 5JS2A 1VSDA 4M3UA 3D0PA 2FC0A 3F9KA 4FLVA 1EP4A 2QK9A 3M8PA 1NK8A 4LH4A 4E19A 3V9UA 3TAGA 4FVMA 4DG1A 3OYKA 3D45A 3OJUA 3V9WA 1ASVA 2G8WA 4CFDA 4FJLA 2KW4A 3V4IA 3K59A 3S3NA 3MAQA 1RNHA 1ZBIA 1TV6A 1WAJA 4LSLA 1JLQA 4CHYA 3HK2A 3CFPA 4HVJA 3MECA 3TWHA 3V9ZA 3TI0A 2ITGA 4C8MA 3WNHA 1EKEA 3K5OA 4DLEA 4M3RA 4N56A 2ZE2A 1KFSA 5KTQA 1TL1A 3VQCA 1I39A 4B9MA 3RRHA 1BCOA 2DY4A 4CEDA 4CJVA 2ZQBA 5FDLA 2QKKA 3DLGA 2Z1JA 3AVNA 5DMRA 2HNZA 4CCHA 5HRRA 4CHQA 2XHBA 3VQ7A 4B3OA 3OS1A 4ELTA 2FBTA 2E4LA 3V1QA 3OYJA 3TAPA 4H4OA 3HO1A 4BE0A 1CZ9A 2I5JA 5DK5A 3RMAA 1BIUA 3VA0A 3MXIA 1HYSA 2HVHA 1GOCA 3PO5A 4CJ5A 3RMCA 1L3VA 3CFOA 4PWDA 4CJ4A 4HUEA 2A1SA 4I2PA 4HCBA 1J53A 3KLEA 4B9UA 1L5UA 2F8SA 4CESA 3AVHA 1C1AA 4I2QA 3AO2A 3VQPA 3HPHA 1FXXA 4HCCA 2G8VA 3KKRA 4J2DA 3G10A 3K5NA 3AVCA 1QSLA 3CYMA 1RTIA 1O1WA 1ZBLA 3SPZA 1BGXT 2VG7A 4FK0A 2OPSA 4KTWA 3TARA 4DQIA 4M42A 4CEOA 2F8TA 5SWMA 3IS9A 2O4IA 2OZSA 4JRPA 4FJJA 4F3OA 1XC9A 2HNDA 3V9SA 1SL2A 4KHUA 2X78A 2HHXA 1EXQA 3JSMA 3ISNC 2IC3A 4KPYA 4FZXC 2KZZA 2RF2A 1VK0A 4E0DA 3PV8A 2YV0X 1TKTA 1S5JA 4E1NA 4FM2A 3HVTA 2Z1HA 1JLEA 2XY5A 4F2SA 2IGIA 4O0JA 1CXQA 1S6PA 2JLEA 1X1PA 3RR7A 3NBPA 3QLHA 4DTPA 1SUQA 4DQRA 1QSSA 4CIFA 2OPRA 2G8UA 3V6DA 4CGJA 2HHQA 1BQNA 1JL1A 2IOCA 3KLFA 3OYIA 3LP3A 3NF9A 1RTHA 3H08A 1J9AA 3QEPA 4I9LA 2QKBA 1C0MA 3F73A 1BI4B 3MEGA 2GUIA 4FLZA 3L2QA 4DSEA 3PX6A 1WSEA 1U48A 3DMJA 1VSJA 1S6QA 4J2AA 1C6VA 4H8KA 4OLBA 5HRSA 4LH5A 5J2NA 1C1BA 4NCAA 4FZZA 4W5OA 3V81A 4FJNA 3BDPA 1HQUA 3NF7A 2Y1JA 2P5OA 1NK5A 2X74A 3LALA 4OLAA 3IAYA 2WONA 1NOZA 4KHQA 3KLGA 1S1WA 1VSLA 4AHTA 3QEVA 4FJIA 3LANA 3QETA 4DTNA 2BANA 4MQ3A 3OYLA 3OYBA 3VQQA 4LD0A 1KLMA 3K5LA 5CYQA 3M8SA 2OZMA 3OYMA 4FJKA 2DTUA 4O55A 4R5PA 4CGDA 2BDPA 1BIZA 4BDPA 4QOZB 1S1TA 4CF2A 4CK3A 4FJMA 2Z1IA 4Z4HA 3QIOA 2HHTA 4CK2A 3U3YA 2OPQA 2KFZA 1ZBUA 4G1QA 1KVCA 3RTVA 1NK7A 2OPPA 4DQQA 4DF8A 1LAWA 3O4NA 4DMNA 2R7YA 4DTMA 3DRRA 2YHAA 4B8AB 3L2UA 3QINA 4FXDA 4BWMA 1EX4A 3CFRA 2PZSA 3VQBA 4F3TA 1JXBA 3SV4A 4HTUA 1JKHA 4ELVA 2XO7A 4FZYA 2XRIA 3DRPA 4OPKA 1KTQA 1I3AA 5J2PA 2KFNA 3RR8A 1LAVA 2HVIA 1VRUA 3AO1A 3L2VA 2RPIA 1NOYA 4Y1CA 1RBSA 3CM6A 4CJ3A 1T7PA 4DFPA 1TKXA 3QESA 4PY5A 1GOAA 1C0UA 1HRHA 4FW2A 4E7JA 1HNVA 4Z0UA 3VQ9A 4CJPA 4FJHA 2GBZA 1RT3A 4F2RA 4CIEA 4HUGA 1RTJA 3ZSZA 4DFJA 4ICLA 4FJ5A 1X9WA 1S9GA 3O3GA 4JLHA 3KJVA 1RDDA 2ATQA 2AJQA 3DI6A 4ZTJA 2XY6A 4CEBA 1HQEA 3KK3A 3TANA 3I0SA 4N41A 4OPJA 3ZT4A 3TR8A 3PX0A 3WNFA 3SQ2A 1TK0A 1BL3A 2E6LA 1YVUA 4W5RA 3SQ4A 1L3SA 4C8NA 4FLYA 1A5XA 3PX4A 3M8RA 4DS4A 3NCIA 3O3FA 3NAEA 3TAQA 3SUOA 4M3WA 4KHNA 2QXFA 2HHSA 4CJQA 4KKOA 3NH0A 3L8BA 2HHVA 4FJXA 1CXUA 2RKIA 1SKWA 4N47A 1ZBFA 4K8XA 4K8ZA 2KZMA 4M41A 4QCLA 4E7LA 3ZSRA 1GOBA 1HYZA 3S3MA 1VRTA 4DTRA 2D0BA 3NGZA 3V9XA 4DSFA 4KTQA 3VQAA 3O4QA 1CZBA 4CEZA 5SZTA 3ZT1A 4BDYA 2PYJA 1WNSA 4DSKA 1NK9A 4Z4EA 1RTDA 3C6UA 2OYQA 3KK1A 4KRFA 3TAFA 4F8RA 1W9HA 4CJWA 3C94A 1Q9XA 3M8QA 4I7FA 3KLIA 3MEEA 5KGXA 4YFUA 1RBTA 5J2MA 3OS2A 3U6FA 1KFDA 1RT5A 1R0AA 3AVMA 3JYTA 1HPZA 1RDCA 4KO0A 2EX3A 4W5QA 4EP4A 1RBUA 3OY9A 3NGIA 3UIQA 4PA1A 3NH1A 4BDZA 3S9HA 2LSNA 3KD1E 4GVMA 4HUFA 1KRPA 3QEWA 2DFFA 4CEQA 3C6TA 1WN7A 3G0ZA 4IBNA 3E01A 1JLAA 4RW8A 3QNNA 3RWUA 4CIGA 3PO4A 4FJ9A 3AA4A 4DTUA 4IG3A 3I0RA 1U04A 1NK0A 3HSTB 3RMDA 4AH9A 3EYZA 3HP6A 3B6PA 4O5BA 1HJRA 1HYVA 3ZSOA 1TK8A 1BISA 3K57A 4BE2A 1IKYA 4OGEA 4Q5VA 1SL1A 3SNNA 4FM1A 3SI6A 3NF8A 1NJYA 1ITGA 3ZT2A 4KTZA 5E41A 3KLHA 4CE9A 3KD5E 4FCYA 3HT3A 1RT1A 3DLKA 3LPUA 4CJFA 3AO4A 4EP5A 5HRNA 1JLCA 2X6NA 4KV8A 1RT2A 3LZJA 1LW2A 1JLFA 5FROA 1L3UA 2W42A 4NYFA 2FBXA 1SKRA 1J54A 4ID1A 4CGIA 2XY8A 2P51A 1RBVA 4E3SA 3OYEA 1QSYA 3LDSA 1XWLA 1KVBA 3FFIA 4IFYA 3DOLA 4DTXA 1IKWA 3S3OA 1KLNA 1LV5A 3T3FA 3LP1A 4OKJA 1KCFA 4RW7A 4F4KA 1JLGA 3VQEA 2YNGA 4E7HA 1QTMA 5D3GA 1FK9A 2IDOA 3AO3A 4AHCA 5J2QA 3SQ1A 1BCMA 1UA1A 1KSPA 2HHUA 4WE1A 4NCBA 3MEDA 3SUNA 2HB5A 3NE6A 4OVLA 1ZBHA 2YNFA 1CLQA 3TAEA 3ZCMA 2E6MA 1IKVA 4KREA 3T1AA 4KHWA 3ZSVA 5C25A 3O3HA 3OS0A 1RBRA 4O4GA 4PQUA 1XHXA 2P5GA 5EU7A 1D9DA 5KI6A 1A5VA 1B92A 4NCGA 3AVGA 1YT3A 4QAGA 1DTTA 1WSJA 4IFVA 1FKOA 5C42A 1B9DA 1EETA 1D8YA 4FK2A 1ASUA 3LAMA 1VSKA 3THVA 3WNEA 3B6OA 1RT6A 3KK2A 4E7KA 1T03A 1ASWA 3OYFA 1DLOA 1DTQA 4FJ8A 3AO5A 2VWKA 2YKNA 4FM0A 2F96A 1U49A 2BE2A 1VSEA 1T8EA 4M3YA 3MXJA 4CHZA 3QERA 4CFCA 3SCXA 4M3TA 4CJEA 1NJXA 3LZIA 1IH7A 1A5WA 1MU2A 1W0HA 3V1RA 4ZTFA 3VQ6A 3RRGA 1WSGA 2D0AA 3DLRA 1JXEA 3NDKA 4Z4FA 1QHTA 2VG6A 1S1XA 1BI4A 3K2PA 4IKFA 3SPYA 3QIPA 4DU1A 4CERA 4IDKA 4XIUA 4O0IA 3K58A 4DS5A 4DTOA 1IO2A 1VSIA 1L3TA 3ITHA 2X6SA 2B4JA 4B08A 3L2RA 3HVRA 1HNIA 4Z4GA 4B8CA 4AHSA 1BHLA 4IG0A 1G15A 2JGUA 1D9FA 1F21A 1UWBA 4LY7A 3K5MA 2HMIA 1BQMA 3HXMA 4M45A 5KGWA 2A1RA 4FW1A 2YHBA 3EY1A 4KAZA 3L2WA 3LP2A 1NK4A 3CG7A 4FYDA 2VG5A 1SV5A 2O4GA 1QQCA 1K6YA 1Z26A 3NF6A 4DU4A 1U47A 3C95A 4DFKA 4CF9A 1KVAA 2HHWA 4CGGA 1J5OA 1NK6A 4BE1A 4DF4A 4AILC 1RILA 1NJZA 2PYLA 3DOKA 4N5SA 1TAQA 3HPOA 4RG8A 3ASMA 3QO9A 4FLUA 4L8RB 3VQDA 1UAXA 3SV3A 3OVNA 1IG9A 3TABA 3HJFA 2G8KA 4CGFA 3U3GA 3AV9A 3ULDA 4B9TA 3HM9A 3NHGA 3DYAA 4KFBA 1NJWA 4W5TA 1REVA 4C8LA 1XHZA 1LW0A 2ETJA 4RW4A 2DFEA 3EZ5A 2NUBA 4CEEA 4O44A 3P83D 3TAMA 3ZSQA 5I3UA 4RW6A 1WSHA 5KRSA 1VSHA 4ZHRA 1Y97A 1RT7A 1Q9YA 4DSLA 3LPTA 3KTQA 1RCHA 5CZ2A 2Y1IA 4DSJA 4FK4A 4ID5A 4CK1A 5T7BA 1WAFA 3BGRA 3AVBA 4BWJA 4CFBA 4DU3A 4C8KA 4M3ZA 3CM5A 3VQ4A 1WSFA 3DLEA 3DM2A 3HYFA 3P5JA 3AVJA 4DFMA 4LSNA 2PY5A 2YKMA 4DSIA 4I9QA 4H4MA 4CEAA 1YTAA 4CJLA 5JS1A 3ZSYA 1LWEA 2WOMA 4RW9A 3IG1A 3DLBA 3OYGA 3AA2A 3NGYA 1TKZA 3A2FA 4FLWA 1ZYQA 3SUQA 2Q3SA 2FBVA 3HP9A 3VQ5A 3HL8A 5HLFA 3KKSA 1Z25A 3NFAA 3IRXA 3L3VA 2RN2A 1RT4A 4CF1A 1TVRA 5I42A 3AVLA 3OYNA 1B9FA 4FJGA 3ZSXA 4CHPA 4CHNA 1TAUA 4Z4CA 1UOCA 1HMVA 4NYNA 3T19A 4CHOA 4CJSA 2VWJA 4DTSA 2HNYA 3QEXA 3SQ0A 4C8OA 4KHYA 2G8IA 3VQ8A 1IKXA 4HHTA 1YTUA 1LWFA 4J2BA 4CJUA 3SYZA 4B9LA 1NKBA 3WNGA 1NKCA 4EZ9A 1N5YA 2D5RA 2GV9A 1WSIA 1U4BA 1T05A 2IAJA 1C1CA 3LP0A 4FLTA 1C0TA 1JLBA 3SUPA 4M3XA 3LAKA 1VSMA 3AVKA 3LWLA 4E7IA 4CECA 3AA3A 3LWMA 3ZT0A 4TSXA 4JS5A 5FRNA 3DLHA 2BGGA 3ZT3A 5CY4A 1S9EA 2B6AA 4CF0A 4Q0BA 4AHVA 4FLXA 4KI6A 4FJ7A 3OYCA 3QNOA 3HPGA 1VSFA 4OKEA 4JS4A 3SZ2A 3RMBA 1SKSA 3KIOA 4MFBA 3PY8A 3VA3A 4CEFA 1XI1A 3P1GA 4GMJB 1QS4A 1FKPA 1N6QA 4B9VA 2B5JA 4OJRA 3OYDA 4Z4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K14 A;  1TK5 A;  4E89 A;  3ZSW A;  3I8D A;  1QE1 A;  3QEI A;  4CFA A;  5KRT A;  4UQG A;  4B9S A;  2OA8 A;  3V1O A;  1S1V A;  4N76 A;  2KTQ A;  3OJS A;  4DTJ A;  3AA5 X;  3ALY A;  4B9N A;  1LWC A;  4CJR A;  3AVF A;  1X9S A;  4OGC A;  4Y1D A;  5CZ1 A;  3AVI A;  3CQ8 A;  1RDB A;  3PUF A;  4YNQ A;  2G8H A;  4W5N A;  5FRM A;  2P1J A;  4KB0 A;  2EHG A;  3MXM A;  2XY7 A;  1U45 A;  4DLG A;  4DQP A;  4CGH A;  4EZ6 A;  4KI4 A;  4DWI A;  3L3U A;  4AHR A;  2FBY A;  4CJT A;  5HBM A;  5HP1 A;  5CYM A;  1TKD A;  1NKE A;  3AVA A;  1RDA A;  1TGO A;  4KHS A;  2D0C A;  3VN5 A;  2IS3 A;  4E1M A;  3SJJ A;  1JL2 A;  4OKK A;  2Z1G A;  4GW6 A;  4PUO A;  3OYH A;  4DQS A;  1D5A A;  1TL3 A;  4AHU A;  2G8F A;  1SL0 A;  5C24 A;  3DRS A;  3NH2 A;  1WLJ A;  1S1U A;  2DFH A;  5HRP A;  2ZD1 A;  3OYA A;  4CJK A;  1X9M A;  4J2E A;  2HW3 A;  4ELU A;  4JRQ A;  5HRO A;  4KB1 A;  2YNH A;  5J1E A;  4CF8 A;  1Q8I A;  1UA0 A;  2YNI A;  2KQ2 A;  4BAC A;  5JS2 A;  1VSD A;  4M3U A;  3D0P A;  2FC0 A;  3F9K A;  4FLV A;  1EP4 A;  2QK9 A;  3M8P A;  1NK8 A;  4LH4 A;  4E19 A;  3V9U A;  3TAG A;  4FVM A;  4DG1 A;  3OYK A;  3D45 A;  3OJU A;  3V9W A;  1ASV A;  2G8W A;  4CFD A;  4FJL A;  2KW4 A;  3V4I A;  3K59 A;  3S3N A;  3MAQ A;  1RNH A;  1ZBI A;  1TV6 A;  1WAJ A;  4LSL A;  1JLQ A;  4CHY A;  3HK2 A;  3CFP A;  4HVJ A;  3MEC A;  3TWH A;  3V9Z A;  3TI0 A;  2ITG A;  4C8M A;  3WNH A;  1EKE A;  3K5O A;  4DLE A;  4M3R A;  4N56 A;  2ZE2 A;  1KFS A;  5KTQ A;  1TL1 A;  3VQC A;  1I39 A;  4B9M A;  3RRH A;  1BCO A;  2DY4 A;  4CED A;  4CJV A;  2ZQB A;  5FDL A;  2QKK A;  3DLG A;  2Z1J A;  3AVN A;  5DMR A;  2HNZ A;  4CCH A;  5HRR A;  4CHQ A;  2XHB A;  3VQ7 A;  4B3O A;  3OS1 A;  4ELT A;  2FBT A;  2E4L A;  3V1Q A;  3OYJ A;  3TAP A;  4H4O A;  3HO1 A;  4BE0 A;  1CZ9 A;  2I5J A;  5DK5 A;  3RMA A;  1BIU A;  3VA0 A;  3MXI A;  1HYS A;  2HVH A;  1GOC A;  3PO5 A;  4CJ5 A;  3RMC A;  1L3V A;  3CFO A;  4PWD A;  4CJ4 A;  4HUE A;  2A1S A;  4I2P A;  4HCB A;  1J53 A;  3KLE A;  4B9U A;  1L5U A;  2F8S A;  4CES A;  3AVH A;  1C1A A;  4I2Q A;  3AO2 A;  3VQP A;  3HPH A;  1FXX A;  4HCC A;  2G8V A;  3KKR A;  4J2D A;  3G10 A;  3K5N A;  3AVC A;  1QSL A;  3CYM A;  1RTI A;  1O1W A;  1ZBL A;  3SPZ A;  1BGX T;  2VG7 A;  4FK0 A;  2OPS A;  4KTW A;  3TAR A;  4DQI A;  4M42 A;  4CEO A;  2F8T A;  5SWM A;  3IS9 A;  2O4I A;  2OZS A;  4JRP A;  4FJJ A;  4F3O A;  1XC9 A;  2HND A;  3V9S A;  1SL2 A;  4KHU A;  2X78 A;  2HHX A;  1EXQ A;  3JSM A;  3ISN C;  2IC3 A;  4KPY A;  4FZX C;  2KZZ A;  2RF2 A;  1VK0 A;  4E0D A;  3PV8 A;  2YV0 X;  1TKT A;  1S5J A;  4E1N A;  4FM2 A;  3HVT A;  2Z1H A;  1JLE A;  2XY5 A;  4F2S A;  2IGI A;  4O0J A;  1CXQ A;  1S6P A;  2JLE A;  1X1P A;  3RR7 A;  3NBP A;  3QLH A;  4DTP A;  1SUQ A;  4DQR A;  1QSS A;  4CIF A;  2OPR A;  2G8U A;  3V6D A;  4CGJ A;  2HHQ A;  1BQN A;  1JL1 A;  2IOC A;  3KLF A;  3OYI A;  3LP3 A;  3NF9 A;  1RTH A;  3H08 A;  1J9A A;  3QEP A;  4I9L A;  2QKB A;  1C0M A;  3F73 A;  1BI4 B;  3MEG A;  2GUI A;  4FLZ A;  3L2Q A;  4DSE A;  3PX6 A;  1WSE A;  1U48 A;  3DMJ A;  1VSJ A;  1S6Q A;  4J2A A;  1C6V A;  4H8K A;  4OLB A;  5HRS A;  4LH5 A;  5J2N A;  1C1B A;  4NCA A;  4FZZ A;  4W5O A;  3V81 A;  4FJN A;  3BDP A;  1HQU A;  3NF7 A;  2Y1J A;  2P5O A;  1NK5 A;  2X74 A;  3LAL A;  4OLA A;  3IAY A;  2WON A;  1NOZ A;  4KHQ A;  3KLG A;  1S1W A;  1VSL A;  4AHT A;  3QEV A;  4FJI A;  3LAN A;  3QET A;  4DTN A;  2BAN A;  4MQ3 A;  3OYL A;  3OYB A;  3VQQ A;  4LD0 A;  1KLM A;  3K5L A;  5CYQ A;  3M8S A;  2OZM A;  3OYM A;  4FJK A;  2DTU A;  4O55 A;  4R5P A;  4CGD A;  2BDP A;  1BIZ A;  4BDP A;  4QOZ B;  1S1T A;  4CF2 A;  4CK3 A;  4FJM A;  2Z1I A;  4Z4H A;  3QIO A;  2HHT A;  4CK2 A;  3U3Y A;  2OPQ A;  2KFZ A;  1ZBU A;  4G1Q A;  1KVC A;  3RTV A;  1NK7 A;  2OPP A;  4DQQ A;  4DF8 A;  1LAW A;  3O4N A;  4DMN A;  2R7Y A;  4DTM A;  3DRR A;  2YHA A;  4B8A B;  3L2U A;  3QIN A;  4FXD A;  4BWM A;  1EX4 A;  3CFR A;  2PZS A;  3VQB A;  4F3T A;  1JXB A;  3SV4 A;  4HTU A;  1JKH A;  4ELV A;  2XO7 A;  4FZY A;  2XRI A;  3DRP A;  4OPK A;  1KTQ A;  1I3A A;  5J2P A;  2KFN A;  3RR8 A;  1LAV A;  2HVI A;  1VRU A;  3AO1 A;  3L2V A;  2RPI A;  1NOY A;  4Y1C A;  1RBS A;  3CM6 A;  4CJ3 A;  1T7P A;  4DFP A;  1TKX A;  3QES A;  4PY5 A;  1GOA A;  1C0U A;  1HRH A;  4FW2 A;  4E7J A;  1HNV A;  4Z0U A;  3VQ9 A;  4CJP A;  4FJH A;  2GBZ A;  1RT3 A;  4F2R A;  4CIE A;  4HUG A;  1RTJ A;  3ZSZ A;  4DFJ A;  4ICL A;  4FJ5 A;  1X9W A;  1S9G A;  3O3G A;  4JLH A;  3KJV A;  1RDD A;  2ATQ A;  2AJQ A;  3DI6 A;  4ZTJ A;  2XY6 A;  4CEB A;  1HQE A;  3KK3 A;  3TAN A;  3I0S A;  4N41 A;  4OPJ A;  3ZT4 A;  3TR8 A;  3PX0 A;  3WNF A;  3SQ2 A;  1TK0 A;  1BL3 A;  2E6L A;  1YVU A;  4W5R A;  3SQ4 A;  1L3S A;  4C8N A;  4FLY A;  1A5X A;  3PX4 A;  3M8R A;  4DS4 A;  3NCI A;  3O3F A;  3NAE A;  3TAQ A;  3SUO A;  4M3W A;  4KHN A;  2QXF A;  2HHS A;  4CJQ A;  4KKO A;  3NH0 A;  3L8B A;  2HHV A;  4FJX A;  1CXU A;  2RKI A;  1SKW A;  4N47 A;  1ZBF A;  4K8X A;  4K8Z A;  2KZM A;  4M41 A;  4QCL A;  4E7L A;  3ZSR A;  1GOB A;  1HYZ A;  3S3M A;  1VRT A;  4DTR A;  2D0B A;  3NGZ A;  3V9X A;  4DSF A;  4KTQ A;  3VQA A;  3O4Q A;  1CZB A;  4CEZ A;  5SZT A;  3ZT1 A;  4BDY A;  2PYJ A;  1WNS A;  4DSK A;  1NK9 A;  4Z4E A;  1RTD A;  3C6U A;  2OYQ A;  3KK1 A;  4KRF A;  3TAF A;  4F8R A;  1W9H A;  4CJW A;  3C94 A;  1Q9X A;  3M8Q A;  4I7F A;  3KLI A;  3MEE A;  5KGX A;  4YFU A;  1RBT A;  5J2M A;  3OS2 A;  3U6F A;  1KFD A;  1RT5 A;  1R0A A;  3AVM A;  3JYT A;  1HPZ A;  1RDC A;  4KO0 A;  2EX3 A;  4W5Q A;  4EP4 A;  1RBU A;  3OY9 A;  3NGI A;  3UIQ A;  4PA1 A;  3NH1 A;  4BDZ A;  3S9H A;  2LSN A;  3KD1 E;  4GVM A;  4HUF A;  1KRP A;  3QEW A;  2DFF A;  4CEQ A;  3C6T A;  1WN7 A;  3G0Z A;  4IBN A;  3E01 A;  1JLA A;  4RW8 A;  3QNN A;  3RWU A;  4CIG A;  3PO4 A;  4FJ9 A;  3AA4 A;  4DTU A;  4IG3 A;  3I0R A;  1U04 A;  1NK0 A;  3HST B;  3RMD A;  4AH9 A;  3EYZ A;  3HP6 A;  3B6P A;  4O5B A;  1HJR A;  1HYV A;  3ZSO A;  1TK8 A;  1BIS A;  3K57 A;  4BE2 A;  1IKY A;  4OGE A;  4Q5V A;  1SL1 A;  3SNN A;  4FM1 A;  3SI6 A;  3NF8 A;  1NJY A;  1ITG A;  3ZT2 A;  4KTZ A;  5E41 A;  3KLH A;  4CE9 A;  3KD5 E;  4FCY A;  3HT3 A;  1RT1 A;  3DLK A;  3LPU A;  4CJF A;  3AO4 A;  4EP5 A;  5HRN A;  1JLC A;  2X6N A;  4KV8 A;  1RT2 A;  3LZJ A;  1LW2 A;  1JLF A;  5FRO A;  1L3U A;  2W42 A;  4NYF A;  2FBX A;  1SKR A;  1J54 A;  4ID1 A;  4CGI A;  2XY8 A;  2P51 A;  1RBV A;  4E3S A;  3OYE A;  1QSY A;  3LDS A;  1XWL A;  1KVB A;  3FFI A;  4IFY A;  3DOL A;  4DTX A;  1IKW A;  3S3O A;  1KLN A;  1LV5 A;  3T3F A;  3LP1 A;  4OKJ A;  1KCF A;  4RW7 A;  4F4K A;  1JLG A;  3VQE A;  2YNG A;  4E7H A;  1QTM A;  5D3G A;  1FK9 A;  2IDO A;  3AO3 A;  4AHC A;  5J2Q A;  3SQ1 A;  1BCM A;  1UA1 A;  1KSP A;  2HHU A;  4WE1 A;  4NCB A;  3MED A;  3SUN A;  2HB5 A;  3NE6 A;  4OVL A;  1ZBH A;  2YNF A;  1CLQ A;  3TAE A;  3ZCM A;  2E6M A;  1IKV A;  4KRE A;  3T1A A;  4KHW A;  3ZSV A;  5C25 A;  3O3H A;  3OS0 A;  1RBR A;  4O4G A;  4PQU A;  1XHX A;  2P5G A;  5EU7 A;  1D9D A;  5KI6 A;  1A5V A;  1B92 A;  4NCG A;  3AVG A;  1YT3 A;  4QAG A;  1DTT A;  1WSJ A;  4IFV A;  1FKO A;  5C42 A;  1B9D A;  1EET A;  1D8Y A;  4FK2 A;  1ASU A;  3LAM A;  1VSK A;  3THV A;  3WNE A;  3B6O A;  1RT6 A;  3KK2 A;  4E7K A;  1T03 A;  1ASW A;  3OYF A;  1DLO A;  1DTQ A;  4FJ8 A;  3AO5 A;  2VWK A;  2YKN A;  4FM0 A;  2F96 A;  1U49 A;  2BE2 A;  1VSE A;  1T8E A;  4M3Y A;  3MXJ A;  4CHZ A;  3QER A;  4CFC A;  3SCX A;  4M3T A;  4CJE A;  1NJX A;  3LZI A;  1IH7 A;  1A5W A;  1MU2 A;  1W0H A;  3V1R A;  4ZTF A;  3VQ6 A;  3RRG A;  1WSG A;  2D0A A;  3DLR A;  1JXE A;  3NDK A;  4Z4F A;  1QHT A;  2VG6 A;  1S1X A;  1BI4 A;  3K2P A;  4IKF A;  3SPY A;  3QIP A;  4DU1 A;  4CER A;  4IDK A;  4XIU A;  4O0I A;  3K58 A;  4DS5 A;  4DTO A;  1IO2 A;  1VSI A;  1L3T A;  3ITH A;  2X6S A;  2B4J A;  4B08 A;  3L2R A;  3HVR A;  1HNI A;  4Z4G A;  4B8C A;  4AHS A;  1BHL A;  4IG0 A;  1G15 A;  2JGU A;  1D9F A;  1F21 A;  1UWB A;  4LY7 A;  3K5M A;  2HMI A;  1BQM A;  3HXM A;  4M45 A;  5KGW A;  2A1R A;  4FW1 A;  2YHB A;  3EY1 A;  4KAZ A;  3L2W A;  3LP2 A;  1NK4 A;  3CG7 A;  4FYD A;  2VG5 A;  1SV5 A;  2O4G A;  1QQC A;  1K6Y A;  1Z26 A;  3NF6 A;  4DU4 A;  1U47 A;  3C95 A;  4DFK A;  4CF9 A;  1KVA A;  2HHW A;  4CGG A;  1J5O A;  1NK6 A;  4BE1 A;  4DF4 A;  4AIL C;  1RIL A;  1NJZ A;  2PYL A;  3DOK A;  4N5S A;  1TAQ A;  3HPO A;  4RG8 A;  3ASM A;  3QO9 A;  4FLU A;  4L8R B;  3VQD A;  1UAX A;  3SV3 A;  3OVN A;  1IG9 A;  3TAB A;  3HJF A;  2G8K A;  4CGF A;  3U3G A;  3AV9 A;  3ULD A;  4B9T A;  3HM9 A;  3NHG A;  3DYA A;  4KFB A;  1NJW A;  4W5T A;  1REV A;  4C8L A;  1XHZ A;  1LW0 A;  2ETJ A;  4RW4 A;  2DFE A;  3EZ5 A;  2NUB A;  4CEE A;  4O44 A;  3P83 D;  3TAM A;  3ZSQ A;  5I3U A;  4RW6 A;  1WSH A;  5KRS A;  1VSH A;  4ZHR A;  1Y97 A;  1RT7 A;  1Q9Y A;  4DSL A;  3LPT A;  3KTQ A;  1RCH A;  5CZ2 A;  2Y1I A;  4DSJ A;  4FK4 A;  4ID5 A;  4CK1 A;  5T7B A;  1WAF A;  3BGR A;  3AVB A;  4BWJ A;  4CFB A;  4DU3 A;  4C8K A;  4M3Z A;  3CM5 A;  3VQ4 A;  1WSF A;  3DLE A;  3DM2 A;  3HYF A;  3P5J A;  3AVJ A;  4DFM A;  4LSN A;  2PY5 A;  2YKM A;  4DSI A;  4I9Q A;  4H4M A;  4CEA A;  1YTA A;  4CJL A;  5JS1 A;  3ZSY A;  1LWE A;  2WOM A;  4RW9 A;  3IG1 A;  3DLB A;  3OYG A;  3AA2 A;  3NGY A;  1TKZ A;  3A2F A;  4FLW A;  1ZYQ A;  3SUQ A;  2Q3S A;  2FBV A;  3HP9 A;  3VQ5 A;  3HL8 A;  5HLF A;  3KKS A;  1Z25 A;  3NFA A;  3IRX A;  3L3V A;  2RN2 A;  1RT4 A;  4CF1 A;  1TVR A;  5I42 A;  3AVL A;  3OYN A;  1B9F A;  4FJG A;  3ZSX A;  4CHP A;  4CHN A;  1TAU A;  4Z4C A;  1UOC A;  1HMV A;  4NYN A;  3T19 A;  4CHO A;  4CJS A;  2VWJ A;  4DTS A;  2HNY A;  3QEX A;  3SQ0 A;  4C8O A;  4KHY A;  2G8I A;  3VQ8 A;  1IKX A;  4HHT A;  1YTU A;  1LWF A;  4J2B A;  4CJU A;  3SYZ A;  4B9L A;  1NKB A;  3WNG A;  1NKC A;  4EZ9 A;  1N5Y A;  2D5R A;  2GV9 A;  1WSI A;  1U4B A;  1T05 A;  2IAJ A;  1C1C A;  3LP0 A;  4FLT A;  1C0T A;  1JLB A;  3SUP A;  4M3X A;  3LAK A;  1VSM A;  3AVK A;  3LWL A;  4E7I A;  4CEC A;  3AA3 A;  3LWM A;  3ZT0 A;  4TSX A;  4JS5 A;  5FRN A;  3DLH A;  2BGG A;  3ZT3 A;  5CY4 A;  1S9E A;  2B6A A;  4CF0 A;  4Q0B A;  4AHV A;  4FLX A;  4KI6 A;  4FJ7 A;  3OYC A;  3QNO A;  3HPG A;  1VSF A;  4OKE A;  4JS4 A;  3SZ2 A;  3RMB A;  1SKS A;  3KIO A;  4MFB A;  3PY8 A;  3VA3 A;  4CEF A;  1XI1 A;  3P1G A;  4GMJ B;  1QS4 A;  1FKP A;  1N6Q A;  4B9V A;  2B5J A;  4OJR A;  3OYD A;  4Z4I A; 
#chains in the Genus database with same CATH topology
 2O8E A;  3CQY A;  3QEI A;  4CFA A;  4O8K A;  4N76 A;  4DTJ A;  3VGM A;  3LL3 A;  3C7N A;  5EOY A;  3ZEU B;  3AVF A;  1QQM A;  3WXL A;  5CZ1 A;  1HJO A;  2QI2 A;  4BR4 A;  5C2F A;  3MXM A;  3A8Y A;  3O4W A;  2RE2 A;  3THW B;  2A40 A;  4DLG A;  4EZ6 A;  2YHX A;  5AQO A;  5BR9 A;  5HBM A;  4FWK A;  3CJ9 A;  1RDA A;  2IS3 A;  4PUO A;  4AHU A;  1E4F T;  4BG8 A;  3DRS A;  4RTF D;  1S1U A;  2DFH A;  2W6K A;  5HRP A;  4ELU A;  5HRO A;  2YNH A;  2OTL N;  4ILJ A;  2YNI A;  4JK7 A;  1O13 A;  5AQY A;  4PL7 A;  1EP4 A;  1NK8 A;  4BVP A;  4GKK K;  4FVM A;  4DG1 A;  3OJU A;  4DV4 K;  1XMQ K;  1S72 N;  5AQS A;  2FF3 B;  4LSL A;  4IOA L;  3HK2 A;  4JKF A;  4DLE A;  5C15 A;  2ZE2 A;  1KFS A;  4BRA A;  4DCH A;  1I39 A;  3EEQ A;  1BCO A;  1SZ2 A;  4CED A;  1VQ5 N;  4IEI A;  5AQW A;  2Z1J A;  3CC4 N;  3K9J A;  2AA4 A;  4ELT A;  3T1H K;  3HO1 A;  1CZ9 A;  2I5J A;  5DK5 A;  3VA0 A;  2QA4 N;  1HYS A;  4FWP A;  3PO5 A;  2NZT A;  4PWD A;  4JKD A;  1NGC A;  2A1S A;  4HCB A;  3FGU A;  3EL2 A;  1C1A A;  3VQP A;  1VQ6 N;  3CYM A;  1O1W A;  3SPZ A;  2VG7 A;  2OPS A;  3TAR A;  5SWM A;  4FJJ A;  4ILH A;  4QS9 A;  5AQV A;  5BRF A;  3V9S A;  2X78 A;  3ISN C;  1OKJ A;  4FWO A;  4FZX C;  2RF2 A;  4E0D A;  3PV8 A;  4WF9 L;  1SAZ A;  4YDU C;  2Z1H A;  2IGI A;  4O0J A;  1S6P A;  4YDU A;  3NBP A;  1YIJ N;  4DTP A;  3CME N;  3L4Q A;  2HHQ A;  2IOC A;  3KLF A;  3OYI A;  3NF9 A;  1LOT B;  3H08 A;  1VHX A;  1Q81 O;  2UUB K;  1J9A A;  3QEP A;  3T69 A;  3MN7 A;  3CPE A;  1H1V A;  1BI4 B;  3RSE B;  3MEG A;  4DSE A;  4DR6 K;  3L2Q A;  3PX6 A;  1WSE A;  4BGB A;  1IBM K;  3FR0 A;  5J2N A;  4LH5 A;  3V81 A;  3BDP A;  3NF7 A;  2Y1J A;  3MDQ A;  2X74 A;  3IAY A;  4JHD B;  3F2K A;  5M1Q A;  3KLG A;  3QEV A;  5BRD A;  3LAN A;  4JKG A;  5JIC A;  4PL8 A;  4DTN A;  2BAN A;  3VQQ A;  4LD0 A;  2OZM A;  5CYQ A;  3M8S A;  2DTU A;  3OYM A;  4O55 A;  4CGD A;  3LDP A;  3DWL A;  4BDP A;  4YOW A;  2Z1I A;  3TSQ A;  1NGA A;  4XH4 A;  2Q31 A;  2OPQ A;  2P9U A;  4DTM A;  2UU9 K;  3OA9 A;  2YHA A;  3DXK B;  4CD1 A;  4FO0 A;  3VQB A;  1I94 K;  2YX6 A;  1W7A A;  2P9P B;  3G25 A;  2XRI A;  1GLB G;  3DRP A;  4AF1 A;  1I3A A;  4B3T K;  2HVI A;  3AO1 A;  1NOY A;  3P39 A;  3SBG A;  1C0U A;  2J4R A;  3EN9 A;  4BR5 A;  4E7J A;  4FJH A;  2D4W A;  3EKS A;  4V19 S;  2GBZ A;  4CIE A;  3C6A A;  3ZSZ A;  1X9W A;  4JLH A;  2AJQ A;  3CCJ N;  3UB5 A;  4FL9 A;  1P8Z A;  1HQE A;  3G4S N;  3TAN A;  2GTD A;  3PX0 A;  4NXN K;  2FSK A;  1EWR A;  1BL3 A;  2E6L A;  1YVU A;  2YJF A;  3H1V X;  3SQ4 A;  1L3S A;  4FLY A;  3T7Z A;  3NCI A;  3E9P A;  2NLX A;  3D2E B;  4JI2 K;  4BRL A;  1J6Z A;  3F9M A;  2RKI A;  4K8X A;  1FW6 A;  2PFU A;  3SBT A;  4E7L A;  3WQT A;  1HYZ A;  1VRT A;  3NGZ A;  4DSF A;  3TPQ A;  5SZT A;  4BDY A;  4JI3 K;  1KQS M;  1RTD A;  4LF9 K;  2VGM A;  3QFU A;  5JVG L;  4F8R A;  4CJW A;  4DB3 A;  1OH5 A;  3ID8 A;  3OS2 A;  1KFD A;  1Q18 A;  1NNE A;  3C7N B;  1RDC A;  4KO0 A;  3OY9 A;  1M1K O;  2OAN A;  3ZEU A;  3M6G A;  4GV3 A;  2KHO A;  4HUF A;  5AQT A;  4CEQ A;  2O8C A;  3C6T A;  1WN7 A;  1KAZ A;  5AFU A;  4RW8 A;  1NK0 A;  3I0R A;  3I33 A;  3EYZ A;  3HP6 A;  1HYV A;  1TK8 A;  4BE2 A;  3SNN A;  4DV3 K;  4FM1 A;  4H5N A;  3ZT2 A;  3H3O B;  4K43 A;  4H03 B;  4A62 A;  4EAH D;  3BEX A;  3AO4 A;  3MN5 A;  1JLC A;  4YOV A;  1LW2 A;  2QW9 A;  5AQX A;  1L3U A;  2W42 A;  2NRV A;  2FSN A;  4E3S A;  1XWL A;  1KVB A;  3DOL A;  4FPA A;  1KLN A;  3R8E A;  3LP1 A;  4WQ5 C;  1JLG A;  3VQE A;  5D3G A;  4OLA A;  2IDO A;  1S3X A;  4CZF A;  3CCS N;  3A5N C;  3TAE A;  3AGR A;  3OHR A;  3ZCM A;  4KRE A;  3ZSV A;  4PQU A;  1IG8 A;  1XHX A;  4NCG A;  5LL6 Z;  3AAR A;  3CC2 N;  2QXL A;  4B1X B;  3S41 A;  3LDL A;  5C42 A;  1D8Y A;  2V7Y A;  1VSK A;  4MO4 A;  3WNE A;  3LM2 A;  1Q7Y O;  1NGI A;  4FJ8 A;  1QQN A;  4M3Y A;  4FM0 A;  2F96 A;  1VAZ A;  3QER A;  4CFC A;  4CJE A;  4BRE A;  2ZJP L;  1T3V A;  1JXE A;  5ELZ A;  3CC7 N;  4BRK A;  2VG6 A;  1S1X A;  2WC9 A;  1BI4 A;  3SPY A;  4IDK A;  4XIU A;  4DS5 A;  1IO2 A;  3ITH A;  1DT9 A;  2X6S A;  3HVR A;  1G15 A;  4CZG A;  2HMI A;  5KGW A;  1ZXO A;  3EY1 A;  1NK4 A;  1ATR A;  1SV5 A;  1Z26 A;  3GG4 A;  4CGG A;  1J5O A;  4LFB K;  4AIL C;  4OPH A;  3VER A;  3SLC A;  5C12 A;  3DOK A;  3QBX A;  4L8R B;  2HBK A;  3SV3 A;  3HJF A;  3CCR N;  3TAB A;  4RCH A;  4CGF A;  3MN6 A;  2ZJQ L;  3FZK A;  3EE8 A;  2WBN A;  3OBW A;  3HM9 A;  1HUX A;  4KFB A;  5CE3 A;  1U2V A;  1HR0 K;  1REV A;  1EQY A;  1HKG A;  3HTV A;  2DFE A;  4ISG A;  3T1Y K;  2NUB A;  3FZL A;  3TAM A;  3QIC A;  3ZSQ A;  3VEY A;  3M1F A;  5KRS A;  1VSH A;  1Q9Y A;  1RT7 A;  2W40 A;  2A42 A;  4FK4 A;  4ID5 A;  3SAG A;  4H0Y B;  2UXD K;  1WAF A;  2YJE A;  4BRG A;  1Q82 O;  2V7Z A;  1GLD G;  3DM2 A;  3HYF A;  4I9Q A;  3IMX A;  4CEA A;  3H45 C;  3DLB A;  3NGY A;  3KZB A;  3ATV A;  3CCU N;  3HP9 A;  4JN4 A;  2RN2 A;  1TVR A;  4CHP A;  3EE9 A;  3KVG A;  3VES A;  4NYN A;  4CHO A;  4BRQ A;  4KH4 A;  3MX5 A;  3VQ8 A;  2NRH A;  5GIN A;  3CD6 N;  1LWF A;  4LF8 K;  3WNG A;  1N5Y A;  3E9O A;  4O8U A;  1C0T A;  1ESV A;  3LAK A;  1VSM A;  3AVK A;  4L3Q A;  4WFB L;  4B1W B;  3GBT A;  3AA3 A;  3ZT0 A;  5FRN A;  3GDQ A;  4AHV A;  4FJ7 A;  3OYC A;  1U2V B;  3HPG A;  1VSF A;  4OKE A;  3RMB A;  5BPN A;  2O8F B;  3L6Q A;  2O8B A;  4CEF A;  3P1G A;  4GMJ B;  1FKP A;  2FF6 A;  3OYD A;  1TK5 A;  4E89 A;  3I8D A;  4B9S A;  3L4I A;  3OJS A;  4CI6 A;  3AA5 X;  3W0L A;  3ALY A;  4B9N A;  1QQO A;  1LWC A;  3GL1 A;  1X9S A;  3D2E A;  1RDB A;  2GWK A;  4YNQ A;  2G8H A;  4W5N A;  5FRM A;  1D4X A;  2XY7 A;  4JKH A;  4CGH A;  4EHU A;  4KI4 A;  1KD1 O;  5ADX A;  3THY B;  1NKE A;  3O08 A;  1Z6R A;  4CZE A;  2D0C A;  4CBX A;  3CI5 A;  1JL2 A;  4OKK A;  1P90 A;  1D5A A;  4CJK A;  5GAH P;  5AQF A;  1VQM N;  3G6E N;  4JRQ A;  4KB1 A;  2RHK A;  1UA0 A;  3MWT A;  2HBL A;  4BAC A;  4M3U A;  2P9L A;  2FC0 A;  4PKG A;  3D0P A;  1T44 A;  3R3L A;  4LH4 A;  4BGA A;  1Z05 A;  3TAG A;  2QKB A;  1CLQ A;  2P9P A;  3NVM A;  4JKB A;  4H0X B;  3K59 A;  3S3N A;  1DKG D;  1ZBI A;  1TV6 A;  3U9D A;  1JLQ A;  3CFP A;  3TWH A;  2ITG A;  1WBD A;  3C0B A;  1EKE A;  1N8R O;  3CCE N;  4DR5 K;  2NRZ A;  2O8D A;  1XMO K;  1TL1 A;  4B9M A;  2DY4 A;  5FDL A;  3CER A;  3DLG A;  4IO8 A;  2HNZ A;  2XHB A;  3VQ7 A;  1VQ9 N;  1VQP N;  2FBT A;  1YXQ A;  4WFA L;  3TAP A;  5ADX H;  4BE0 A;  3RMA A;  3MXI A;  1VQN N;  4JKC A;  1VQ8 N;  2ZWH A;  4CJ5 A;  3RMC A;  3VEN A;  1K73 O;  3CFO A;  4CJ4 A;  4HUE A;  4I2P A;  2F9T A;  3W3D A;  3UKR B;  2WTU A;  2P9N A;  3AO2 A;  1FXX A;  4HCC A;  3K5N A;  3AVC A;  1QSL A;  4ILG B;  4FK0 A;  4KTW A;  1QHA A;  2IVP A;  4JI5 K;  2HHX A;  1EXQ A;  4DR3 K;  3VF2 A;  2IC3 A;  2BH1 A;  1TKT A;  4E1N A;  1JLE A;  2XY5 A;  3C65 A;  1FJG K;  3RR7 A;  4CZI A;  1YI2 N;  1SUQ A;  3E66 A;  3WXI A;  2OPR A;  2G8U A;  3V6D A;  4JEP A;  3ENB A;  1T6D A;  3H1Q A;  3LP3 A;  3SK3 A;  2P9N B;  4JKE A;  1E4G T;  3MN9 A;  1C0M A;  2GUI A;  5AZJ B;  4CJ7 A;  1U48 A;  5AQL A;  3CCL N;  1NGH A;  2NRT A;  1NK5 A;  3LAL A;  4J8F A;  2PBD A;  1NOZ A;  2EWS A;  3O9T A;  4LFA K;  4KHQ A;  4JK9 A;  1VSL A;  4AHT A;  3Q7B A;  4FSV A;  4MQ3 A;  3K0S A;  3VET A;  3QDK A;  5EX5 A;  3C6H A;  5EXW A;  3IDH A;  1GLA G;  4FJM A;  3LM9 A;  2HHT A;  3U3Y A;  3VGK A;  2KFZ A;  3VEO A;  3O4N A;  4CBU A;  4B8A B;  3L2U A;  4FXD A;  4IJA A;  1K8A O;  1HNZ K;  4FZY A;  4OPK A;  4AQY K;  5J2P A;  2KFN A;  3RR8 A;  3L2V A;  5DM7 L;  1RBS A;  3CM6 A;  1NGG A;  5LMN K;  3QES A;  4JI7 K;  1GOA A;  4CJP A;  1K8K A;  1RTJ A;  1X3N A;  3H46 O;  2QTD A;  4ICL A;  3DAW A;  5AQU A;  4EFH A;  1V4S A;  2F4V K;  4K42 A;  3WNF A;  1R59 O;  4BRD A;  4X62 K;  4YHH K;  4C8N A;  2VYP A;  3PX4 A;  3M8R A;  4DS4 A;  3NAE A;  1GLJ O;  4M3W A;  3SUO A;  3JXU A;  2QXF A;  2P9K A;  4WCE L;  2FXU A;  3L8B A;  1CXU A;  1TUY A;  2P9S B;  4N47 A;  4WQ4 A;  4DV0 K;  3S3M A;  4DTR A;  1TYQ A;  4KTQ A;  2HBJ A;  3O4Q A;  3ZT1 A;  1WNS A;  4Z4E A;  2OYQ A;  3TAF A;  3HSC A;  1Q9X A;  3M8Q A;  3MEE A;  1DGK N;  5KGX A;  4FWS A;  1RBT A;  3J7Y P;  5J2M A;  1WUA A;  4IDH A;  3AVM A;  3JYT A;  4W5Q A;  1E3M A;  4EP4 A;  1RBU A;  1VQ4 N;  3S9H A;  3QFP A;  2LSN A;  5JMV A;  1KRP A;  4A57 A;  2IVO A;  3J7A P;  2UXC K;  4IOC L;  4IBN A;  3E01 A;  3QNN A;  3RWU A;  4IG3 A;  3JAM O;  5AZI A;  5EY4 A;  3SI6 A;  4G9Z A;  1NJY A;  3KD5 E;  1QZ6 A;  3HT3 A;  3M3Z A;  3SAH A;  2CH5 A;  4KV8 A;  3LZJ A;  5FRO A;  4BR2 A;  2GEL A;  4B3M K;  4CGI A;  1RBV A;  3OYE A;  3FFK B;  3LDS A;  1GLF O;  1RGI A;  3T3F A;  4OKJ A;  4RW7 A;  5KPT A;  5EVZ A;  1UA1 A;  3SQ1 A;  2HHU A;  4HTL A;  1NMN A;  3CJ1 A;  3NE6 A;  3DLL L;  4JV5 K;  1IKV A;  4KHW A;  3CF5 L;  5C25 A;  3OS0 A;  1RBR A;  1OH7 A;  4O4G A;  2Q36 A;  4MDB A;  2P5G A;  1D9D A;  1NGD A;  1TYQ B;  1HPM A;  3HM8 A;  3BF3 A;  1N34 K;  1DTT A;  1WSJ A;  2O8C B;  1FKO A;  4BC2 A;  3BP8 A;  3LAM A;  4FPB A;  3P31 A;  3KK2 A;  1ASW A;  1DLO A;  1DTQ A;  2VWK A;  4K41 A;  1T8E A;  3MXJ A;  4IEE A;  4C1N K;  1NJX A;  4C1N I;  1A5W A;  1GLL O;  1MU2 A;  1WOQ A;  3DLR A;  3UKR A;  2HST A;  5M1F A;  4BC4 A;  4LC9 B;  3NDK A;  4DUZ K;  4Z4F A;  4B1Y B;  4BQL A;  3CCQ N;  1QVF M;  3QIP A;  4FOE A;  4PKI A;  3R6M A;  2B4J A;  3HBT A;  1D9F A;  1UWB A;  1JCG A;  3HXM A;  1XC3 A;  4A59 A;  1NGJ A;  3L2W A;  5AQJ A;  4BQZ A;  1YJ9 N;  3I56 N;  1MWK A;  2P9U B;  3IKM A;  4BE1 A;  4C23 A;  1NJZ A;  4N5S A;  4CZK A;  4JI1 K;  3ASM A;  3QO9 A;  4FLU A;  1YAG A;  3VQD A;  3KHY A;  5AZJ A;  5IWA K;  3NHG A;  5JLH A;  3VTH A;  1NLV A;  4W5T A;  3CXC M;  1QZ5 A;  1XHZ A;  1VQO N;  3AGK A;  4KH6 A;  5AQQ A;  2V51 B;  3LPT A;  2Y1I A;  4JAX A;  2GWJ A;  4M3Z A;  3BGR A;  4BWJ A;  4OO1 J;  1WSF A;  3D2F B;  4BRH A;  4CD3 A;  3P5J A;  4DFM A;  1W2B M;  2PY5 A;  4DSI A;  3ZSY A;  1LWE A;  4OX9 K;  1K8K B;  3VEZ A;  3OYG A;  1HNW K;  3A2F A;  1ZYQ A;  3SUQ A;  2Q3S A;  2FBV A;  2GEM A;  5HLF A;  3KKS A;  3IRX A;  4K0K K;  3OYN A;  4CHN A;  1TAU A;  4Z4C A;  1UOC A;  1HMV A;  2O8D B;  3MCA B;  3MX2 A;  2VWJ A;  4C8O A;  2HNY A;  2YHW A;  3OBY A;  2BTF A;  3SYZ A;  3MWP A;  1NKC A;  5AQZ A;  1C1C A;  4M3X A;  1NM1 A;  2E88 A;  4CEC A;  3O1B A;  2Q0U A;  3DLH A;  4CF0 A;  2VGN A;  4UY8 O;  4FLX A;  3SAF A;  3QNO A;  4MFB A;  3PY8 A;  5FLX O;  1N6Q A;  1QVG M;  3MMV A;  1ZBH A;  4EIA A;  2HOE A;  4Z4I A;  2CGJ A;  2OA8 A;  2YHY A;  2KTQ A;  4B1U B;  2OTJ N;  5AQK A;  1NGB A;  1RDW X;  1IJJ A;  4OGC A;  4NB4 A;  3AVI A;  5AZI B;  2CGL A;  4LF4 K;  3R9P A;  2EHG A;  3QML A;  1U45 A;  4DQP A;  2QWP A;  4DWI A;  4AHR A;  2FBY A;  3WEE A;  4CJT A;  5HP1 A;  5CYM A;  3RVC A;  3MCP A;  1TKD A;  3ULE B;  1IV0 A;  1TGO A;  4KHS A;  4E1M A;  3SJJ A;  5AQR A;  4GW6 A;  3HOT A;  4DQS A;  1TL3 A;  2F7T A;  2G8F A;  3O9U A;  5C24 A;  1SL0 A;  1WLJ A;  3OYA A;  2ZD1 A;  4BY9 C;  4J2E A;  2HW3 A;  5J1E A;  1IBL K;  4CF8 A;  1Q8I A;  2KQ2 A;  5JS2 A;  1VSD A;  2QK9 A;  4BRO A;  3M8P A;  3UE5 A;  3VEW A;  4E19 A;  3V9U A;  2G8W A;  3OYK A;  4J2D A;  3D45 A;  2VWB A;  5GIO A;  4FJL A;  3V4I A;  4U67 L;  3MAQ A;  1RNH A;  4GKJ K;  1ZC6 A;  3FZF A;  3V9Z A;  3MEC A;  3TI0 A;  4C8M A;  3E1Y A;  3WNH A;  3E9L A;  4M3R A;  3VQC A;  1NBW A;  5HL7 L;  4FWQ A;  3I55 N;  3AVN A;  4BG9 A;  1K9M O;  4CCH A;  4X65 K;  3NMU A;  4B3O A;  1ZBS A;  5BN8 A;  3OYJ A;  4H4O A;  1BIU A;  4JI6 K;  5F1X A;  2HVH A;  4XEI A;  3WUH A;  4B9U A;  1S22 A;  1L5U A;  2F8S A;  3AVH A;  3F5T A;  3HPH A;  3G10 A;  4ISE A;  3B8A X;  5LJV A;  2DPN A;  1ZBL A;  3J8A A;  4M42 A;  4QS7 A;  4DQI A;  5CHI A;  4CEO A;  3L0Q A;  4KH5 A;  2OZS A;  5KPZ A;  4JRP A;  2HND A;  4KHU A;  1KXP A;  5F0X A;  1VQ7 N;  4JD2 B;  4FWL A;  4M7X A;  2JWL A;  4KPY A;  3I8B A;  1S5J A;  4FM2 A;  4FWM A;  5AJ3 K;  1MWM A;  1JCE A;  3HVT A;  4B1Z A;  4DR2 K;  2JLE A;  1X1P A;  3QLH A;  4CIF A;  3R1X A;  4CGJ A;  3HI0 A;  1BQN A;  3SJH A;  1RTH A;  4H5W A;  1WBB A;  4I9L A;  4DR7 K;  4DV7 K;  3F73 A;  5M1K A;  3DMJ A;  1VSJ A;  1S6Q A;  4J2A A;  2P9S A;  4OLB A;  2E1Y A;  4NCA A;  4FZZ A;  4FWN A;  1HQU A;  5C0Y A;  3ATU A;  5A2Q O;  5AQM A;  3PIP L;  1S1W A;  4H0O A;  3QET A;  2HMP A;  3OYL A;  4LF5 K;  4JYA K;  1YJN N;  3K5L A;  3DXK A;  4R5P A;  2BDP A;  1S1T A;  3JS6 A;  4CK3 A;  3LDO A;  4Z4H A;  5AR0 A;  4CK2 A;  2H3G X;  1ZBU A;  4G1Q A;  4FOI A;  1NK7 A;  2R7Y A;  4DMN A;  2ZGZ A;  1NWK A;  1XNR K;  5TKY A;  3QIN A;  4H5R A;  4BC3 A;  4PKH A;  4F3T A;  3FE1 A;  3CCM N;  4HTU A;  4DQ8 A;  4Y0W A;  4ELV A;  4BRI A;  1KTQ A;  3ZYY X;  3BZC A;  2RPI A;  3HOS A;  1T7P A;  4DFP A;  1TKX A;  1N33 K;  4FW2 A;  1HNV A;  4Z0U A;  2ITM A;  2QWM A;  4HUG A;  3O3G A;  1RDD A;  2ATQ A;  3DI6 A;  4ZTJ A;  2XY6 A;  4CEB A;  4DV1 K;  3I0S A;  4N41 A;  4OPJ A;  1RFQ A;  1YUW A;  3TR8 A;  4DV5 K;  3U4L A;  1C0G A;  4JI8 K;  2HF3 A;  3ID6 A;  1YVN A;  4ISF A;  3O3F A;  3CIP A;  4KHN A;  5BRH A;  4XH5 A;  3NH0 A;  4AM7 A;  2HHS A;  4FJX A;  2ASO A;  3EO3 A;  1SKW A;  4K8Z A;  4M41 A;  4QCL A;  2NRW A;  4BR9 A;  1YJW N;  3VQA A;  4CEZ A;  3CHW A;  2PYJ A;  2VQE K;  2E5L K;  4DSK A;  1NK9 A;  3WEE B;  5TKW A;  3DXM A;  3C6U A;  3KK1 A;  4KRF A;  2F9W A;  4I7F A;  3WXK A;  4PHT X;  3U6F A;  1RT5 A;  1HKB A;  3CJ7 A;  3UIQ A;  2EX3 A;  1VQK N;  3SMP A;  3NH1 A;  3KD1 E;  2DFF A;  3FZM A;  3G0Z A;  3O5B A;  3O9S A;  1NMD A;  1BA1 A;  1JLA A;  4FJ9 A;  1GLC G;  4CIG A;  3PO4 A;  3AA4 A;  3D2F A;  4DTU A;  4BRP A;  1U04 A;  4NO7 A;  1Q86 O;  4AH9 A;  3B6P A;  1HJR A;  3VEX A;  3ZSO A;  1JJ2 M;  1BIS A;  2Q0R A;  1SL1 A;  1IKY A;  4OGE A;  3VEV A;  5M1O A;  4R79 A;  4Q5V A;  4DV2 K;  3NF8 A;  3THW A;  1ITG A;  5E41 A;  4KTZ A;  3KLH A;  4CE9 A;  2W41 A;  5JLF A;  1RT1 A;  3DXM B;  3LPU A;  1OVQ A;  2VCP A;  4CJF A;  2W6L A;  2QWR A;  2ZJR L;  3TU5 A;  2XY8 A;  2P51 A;  3PSI A;  4CZJ A;  1QSY A;  4IFY A;  4XH1 A;  1IKW A;  1BA0 A;  4DUY K;  4F4K A;  4CVN E;  4E7H A;  3J81 O;  1QTM A;  1ATS A;  4A5A A;  4AHC A;  5E26 A;  1BCM A;  1KSP A;  2UXB K;  4WE1 A;  3J80 O;  3THX B;  4NCB A;  1NG9 A;  2HB5 A;  3P4I A;  4OVL A;  3ZX3 A;  2YNF A;  3IUC A;  5H1S Q;  3T1A A;  3O3H A;  2ASM A;  1HLU A;  5KI6 A;  1A5V A;  1B92 A;  1GLE G;  4WQ5 A;  1T6C A;  4IFV A;  1B9D A;  2A5X A;  1ASU A;  4RWT A;  1YF5 L;  3RSE A;  3THV A;  3B6O A;  1RT6 A;  4IXC A;  1T03 A;  1U49 A;  3PSF A;  1VSE A;  4CHZ A;  5AQH A;  3SCX A;  1IBK K;  4M3T A;  4IFE A;  3CJB A;  1W0H A;  3FZH A;  4ZTF A;  3VQ6 A;  5MLC Q;  1WSG A;  3UKU B;  2D0A A;  4M63 C;  1BDG A;  3K2P A;  3KWG A;  4DU1 A;  3N4Q A;  4CER A;  3QB0 A;  1BWF O;  1VSI A;  3L2R A;  1RDU A;  1HNI A;  4AHS A;  4CZM A;  4IG0 A;  4YY3 K;  3D7E O;  4LY7 A;  3K5M A;  2P9K B;  2YHB A;  4KAZ A;  3LP2 A;  3CG7 A;  4FYD A;  4DU4 A;  2O4G A;  1QQC A;  1K6Y A;  3NF6 A;  5E84 A;  3C95 A;  4CF9 A;  1KVA A;  4KBO A;  3HPO A;  1TAQ A;  4RG8 A;  3DJC A;  2ASP A;  3A5O C;  3SMS A;  3AV9 A;  3ULD A;  4B9T A;  3ZET A;  3DYA A;  4MO5 A;  4H0V B;  3QBW A;  1LW0 A;  4E1J A;  2FSJ A;  4B3S K;  3Q7C A;  2HF4 A;  1WSH A;  4DSL A;  4ZHR A;  2P9I B;  3KTQ A;  1RCH A;  3AY9 A;  5CZ2 A;  1W97 L;  3VPZ A;  4DU3 A;  2Q2R A;  3VQ4 A;  3CM5 A;  3BUZ B;  3A0I X;  3AVJ A;  4B9Q A;  2YKM A;  4H4M A;  3FLC O;  2WFB A;  2WOM A;  4RW9 A;  2QWQ A;  2UUA K;  2HBM A;  3CJC A;  2CGK A;  5GIP A;  5F2R A;  4IOX A;  3VQ5 A;  1Z25 A;  3NFA A;  2QWN A;  5B8H A;  1XQS C;  1RT4 A;  4CF1 A;  3O8M A;  3AVL A;  5I42 A;  4FJG A;  2QEX N;  5JVH L;  3T19 A;  3QEX A;  4YOR A;  1IKX A;  4HHT A;  1OH6 A;  4CJU A;  4B9L A;  1NKB A;  4EZ9 A;  1WSI A;  2O8E B;  1T05 A;  3UKU A;  2O8F A;  1BU6 O;  4X64 K;  4YOT A;  3LWM A;  1NU0 A;  4TSX A;  4JS5 A;  2BGG A;  2B6A A;  3ZX0 A;  3U8X A;  4KI6 A;  2ZF5 O;  4JS4 A;  1SKS A;  3KIO A;  1TUU A;  4LF7 K;  3VA3 A;  1XI1 A;  3O6W A;  3VF6 A;  3WXJ A;  4B9V A;  2B5J A;  3VGL A;  5K14 A;  3ZSW A;  4IO9 L;  1QE1 A;  4A61 A;  5KRT A;  4UQG A;  1XUP O;  4WQ4 C;  5M1P A;  3V1O A;  1S1V A;  5C10 A;  3KWI A;  4CJR A;  3ZX2 A;  4Y1D A;  3CQ8 A;  3PUF A;  2P1J A;  4KB0 A;  4BR0 A;  3N4P A;  3L3U A;  4NXM K;  3O80 A;  4K25 A;  3AVA A;  3LDN A;  3VN5 A;  4LF6 K;  2Z1G A;  3OYH A;  2QWO A;  1EO1 A;  3D6R A;  3NH2 A;  1X9M A;  3A5M C;  4H5T A;  1DEJ A;  1M90 O;  3F9K A;  4FLV A;  3OTO K;  4X66 K;  5KQD A;  3BY5 A;  1OVY A;  3V9W A;  2E8A A;  3PLA A;  1ASV A;  5FPN A;  4CFD A;  2KW4 A;  1WAJ A;  1Y64 A;  4CHY A;  4HVJ A;  2D0P A;  3K5O A;  5BPM A;  4N56 A;  3M5R A;  3O9R A;  5KTQ A;  1WB9 A;  3RRH A;  3KK7 A;  4CJV A;  2ZQB A;  4GV9 A;  2QKK A;  5DMR A;  4Z94 A;  5HRR A;  4BVO A;  4CHQ A;  4JKA A;  4WYB A;  4GY2 B;  3OS1 A;  2E4L A;  2GUP A;  2I7N A;  3V1Q A;  3PIO L;  5FPE A;  2NRR A;  1GOC A;  3CMA N;  1BO5 O;  1L3V A;  2YCH A;  1LCU A;  1J53 A;  3KLE A;  5AFU H;  3AAQ A;  4CES A;  4I2Q A;  2E20 A;  2G8V A;  3KKR A;  3WQU A;  5BN9 A;  3A5L C;  3VTI A;  1RTI A;  4WFN L;  1BGX T;  2FLO A;  2F8T A;  3IS9 A;  2D1K A;  2O4I A;  4F3O A;  4DR1 K;  1XC9 A;  1SL2 A;  4MLE A;  1X9J A;  3JSM A;  2KZZ A;  1KAY A;  1VK0 A;  2YV0 X;  4A2A A;  3MK6 A;  5GAG P;  4F2S A;  3GOI A;  1CXQ A;  4BRF A;  2ZGY A;  4DQR A;  1QSS A;  4KHP K;  1JL1 A;  1OH8 A;  1BG3 A;  4FVU A;  4IZ9 A;  5HOO A;  2GX9 A;  4F9O A;  1VQL N;  4JNE A;  4FLZ A;  3TSP A;  2E2O A;  3CCV N;  5AQG A;  1C6V A;  4H8K A;  5HRS A;  1C1B A;  1N36 K;  4O5F A;  4W5O A;  4FJN A;  4HWI A;  5BR8 K;  3HRG A;  2P9I A;  2WON A;  2AP1 A;  4H0T B;  4FJI A;  3K9K A;  4YOX A;  3OYB A;  5LY3 A;  4JK8 A;  1KLM A;  4FJK A;  1NGF A;  3CQX A;  4NLC A;  3EKU A;  1BIZ A;  4QOZ B;  4CF2 A;  3QIO A;  1X3M A;  4JD2 A;  1KVC A;  3RTV A;  4A5B A;  2OPP A;  4DQQ A;  4DF8 A;  1LAW A;  3DRR A;  4DV6 K;  5LMU K;  4BWM A;  1EX4 A;  3CFR A;  2PZS A;  1JXB A;  3SV4 A;  1JKH A;  2UUC K;  2XO7 A;  4H5V A;  1ILY A;  5C2D A;  3TSU A;  2QWL A;  2NRX A;  1LAV A;  1VRU A;  3LDQ A;  4GNI A;  4Y1C A;  4CJ3 A;  1G99 A;  4PY5 A;  1HRH A;  4OPA A;  3VQ9 A;  1RT3 A;  4F2R A;  3CET A;  4DFJ A;  4FJ5 A;  1KAX A;  4DR4 K;  1S9G A;  4A2B A;  3KJV A;  1C0F A;  3KK3 A;  3ZT4 A;  4QS8 A;  2Q1N A;  3SQ2 A;  1TK0 A;  3AAP A;  4W5R A;  3GE1 A;  3ENH A;  4DKW A;  1A5X A;  2E1Z A;  2Q97 A;  3TTF A;  3TAQ A;  5AQP A;  2WUS A;  4CJQ A;  4KKO A;  2HHV A;  2V52 B;  1YIT N;  1ZBF A;  2KZM A;  2A6A A;  1GOB A;  3ZSR A;  4JI0 K;  2D0B A;  1J5E K;  3V9X A;  4BR7 A;  1CZB A;  4B3R K;  3IFR A;  3CPW M;  1W9H A;  4NLB A;  3C94 A;  3KLI A;  4YFU A;  3CJA A;  3WXM B;  1R0A A;  1HPZ A;  3G71 N;  3NGI A;  1ATN A;  4PA1 A;  5I9E B;  4BDZ A;  1MA9 B;  4BRM A;  4GVM A;  3QEW A;  2OCE A;  4FWR A;  1YHQ N;  3U9Z A;  4LFC K;  1HKC A;  5IT9 O;  2IVN A;  3HST B;  1NGE A;  3RMD A;  4O5B A;  4BRC A;  3K57 A;  3VF4 A;  2KLA A;  5M1N A;  5AQN A;  2A41 A;  1HNX K;  2I7P A;  4FCY A;  3H6E A;  3DLK A;  5DM6 L;  3P38 A;  4EP5 A;  5HRN A;  2X6N A;  3J7Z O;  1RT2 A;  1JLF A;  5GAE P;  4H0P A;  1V4T A;  4NYF A;  2FBX A;  1SKR A;  1J54 A;  4ID1 A;  3BF1 A;  1BUP A;  4MLH A;  3THX A;  3ULE A;  3FFI A;  4DTX A;  3S3O A;  4CBW A;  1LV5 A;  4JKG B;  1KCF A;  4I6M B;  3WT0 A;  2YNG A;  3NVK A;  4JI4 K;  4JHD A;  1FK9 A;  2ZM6 K;  3AO3 A;  5J2Q A;  5GAD P;  4BRN A;  3MED A;  3SUN A;  1EWQ A;  1MDU B;  4CZL A;  2E6M A;  5KQ8 A;  4CW7 B;  5EU7 A;  3AVG A;  4AM6 A;  1YT3 A;  3THY A;  4QAG A;  3ZLJ A;  3O1W A;  1EET A;  3EZW A;  4FK2 A;  3TTC A;  2D0O A;  5CR4 A;  4E7K A;  3OYF A;  3AO5 A;  2YKN A;  2A3Z A;  2BE2 A;  4IJN A;  2P9L B;  5FPM A;  3LZI A;  1IH7 A;  4I6M A;  2PAV A;  4M7Y A;  5FPD A;  3V1R A;  5BPL A;  3RRG A;  2E2N A;  1QHT A;  2E2P A;  1HX1 A;  3VOV A;  2VQF K;  4IKF A;  4O0I A;  3K58 A;  4DTO A;  1L3T A;  2G8K A;  2P5O A;  2E2Q A;  3H3N O;  4B08 A;  4Z4G A;  4B8C A;  1BHL A;  2JGU A;  1F21 A;  2QM1 A;  1BQM A;  5AQI A;  4M45 A;  2A1R A;  4FW1 A;  4U7B A;  2BUP A;  2VG5 A;  1U47 A;  4DFK A;  5KPR A;  2HHW A;  3VMF B;  1NK6 A;  4DF4 A;  1RIL A;  2PYL A;  1CZA N;  1UAX A;  1IG9 A;  3OVN A;  4GVE A;  4BC5 A;  1SQK A;  3U3G A;  4CZH A;  2NNW A;  1NJW A;  5BRE A;  4C8L A;  2ETJ A;  2O8B B;  4RW4 A;  1U6Z A;  3EZ5 A;  4CEE A;  1XNQ K;  4O44 A;  3P83 D;  5I3U A;  4RW6 A;  1Y97 A;  4YOY A;  1N32 K;  2CH6 A;  2UYT A;  4DSJ A;  4CK1 A;  5T7B A;  4CFB A;  3AVB A;  4C8K A;  3DLE A;  4IWV A;  4LSN A;  2KKZ A;  1YTA A;  4CJL A;  4EHT A;  5JS1 A;  3IG1 A;  3AA2 A;  1KC8 O;  1TKZ A;  4FLW A;  4YOU A;  3O9Q A;  1NJI O;  3HL8 A;  3ENO A;  3L3V A;  3OW2 M;  1B9F A;  3ZET B;  3ZSX A;  4MDA A;  2HHH K;  4GV6 A;  2YI1 A;  4CJS A;  4DTS A;  3SQ0 A;  4KHY A;  2G8I A;  1YTU A;  2IIR A;  4DHY A;  5LJW A;  4J2B A;  3HZ6 A;  2D5R A;  2GV9 A;  1U4B A;  2IAJ A;  4FLT A;  3LP0 A;  3SUP A;  1JLB A;  3LWL A;  4E7I A;  2JWK A;  4B1V A;  3ZT3 A;  3BZK A;  5CY4 A;  1S9E A;  4Q0B A;  1JCF A;  3SZ2 A;  1SS6 A;  1QS4 A;  3TTD A;  4OJR A;  1BOT O; 
#chains in the Genus database with same CATH homology
 5K14 A;  1TK5 A;  4E89 A;  3ZSW A;  3I8D A;  1QE1 A;  3QEI A;  4CFA A;  5KRT A;  4UQG A;  4B9S A;  2OA8 A;  3V1O A;  1S1V A;  4N76 A;  2KTQ A;  3OJS A;  4DTJ A;  3AA5 X;  3ALY A;  4B9N A;  1LWC A;  4CJR A;  3AVF A;  1X9S A;  4OGC A;  4Y1D A;  5CZ1 A;  3AVI A;  3CQ8 A;  1RDB A;  3PUF A;  4YNQ A;  2G8H A;  4W5N A;  5FRM A;  2P1J A;  4KB0 A;  2EHG A;  3MXM A;  2XY7 A;  1U45 A;  4DLG A;  4DQP A;  4CGH A;  4EZ6 A;  4KI4 A;  4DWI A;  3L3U A;  4AHR A;  2FBY A;  4CJT A;  5HBM A;  5HP1 A;  5CYM A;  1TKD A;  1NKE A;  3AVA A;  1RDA A;  1TGO A;  4KHS A;  2D0C A;  3VN5 A;  2IS3 A;  4E1M A;  3SJJ A;  1JL2 A;  4OKK A;  2Z1G A;  4GW6 A;  4PUO A;  3OYH A;  4DQS A;  1D5A A;  1TL3 A;  4AHU A;  2G8F A;  1SL0 A;  5C24 A;  3DRS A;  3NH2 A;  1WLJ A;  1S1U A;  2DFH A;  5HRP A;  2ZD1 A;  3OYA A;  4CJK A;  1X9M A;  4J2E A;  2HW3 A;  4ELU A;  4JRQ A;  5HRO A;  4KB1 A;  2YNH A;  5J1E A;  4CF8 A;  1Q8I A;  1UA0 A;  2YNI A;  2KQ2 A;  4BAC A;  5JS2 A;  1VSD A;  4M3U A;  3D0P A;  2FC0 A;  3F9K A;  4FLV A;  1EP4 A;  2QK9 A;  3M8P A;  1NK8 A;  4LH4 A;  4E19 A;  3V9U A;  3TAG A;  4FVM A;  4DG1 A;  3OYK A;  3D45 A;  3OJU A;  3V9W A;  1ASV A;  2G8W A;  4CFD A;  4FJL A;  2KW4 A;  3V4I A;  3K59 A;  3S3N A;  3MAQ A;  1RNH A;  1ZBI A;  1TV6 A;  1WAJ A;  4LSL A;  1JLQ A;  4CHY A;  3HK2 A;  3CFP A;  4HVJ A;  3MEC A;  3TWH A;  3V9Z A;  3TI0 A;  2ITG A;  4C8M A;  3WNH A;  1EKE A;  3K5O A;  4DLE A;  4M3R A;  4N56 A;  2ZE2 A;  1KFS A;  5KTQ A;  1TL1 A;  3VQC A;  1I39 A;  4B9M A;  3RRH A;  1BCO A;  2DY4 A;  4CED A;  4CJV A;  2ZQB A;  5FDL A;  2QKK A;  3DLG A;  2Z1J A;  3AVN A;  5DMR A;  2HNZ A;  4CCH A;  5HRR A;  4CHQ A;  2XHB A;  3VQ7 A;  4B3O A;  3OS1 A;  4ELT A;  2FBT A;  2E4L A;  3V1Q A;  3OYJ A;  3TAP A;  4H4O A;  3HO1 A;  4BE0 A;  1CZ9 A;  2I5J A;  5DK5 A;  3RMA A;  1BIU A;  3VA0 A;  3MXI A;  1HYS A;  2HVH A;  1GOC A;  3PO5 A;  4CJ5 A;  3RMC A;  1L3V A;  3CFO A;  4PWD A;  4CJ4 A;  4HUE A;  2A1S A;  4I2P A;  4HCB A;  1J53 A;  3KLE A;  4B9U A;  1L5U A;  2F8S A;  4CES A;  3AVH A;  1C1A A;  4I2Q A;  3AO2 A;  3VQP A;  3HPH A;  1FXX A;  4HCC A;  2G8V A;  3KKR A;  4J2D A;  3G10 A;  3K5N A;  3AVC A;  1QSL A;  3CYM A;  1RTI A;  1O1W A;  1ZBL A;  3SPZ A;  1BGX T;  2VG7 A;  4FK0 A;  2OPS A;  4KTW A;  3TAR A;  4DQI A;  4M42 A;  4CEO A;  2F8T A;  5SWM A;  3IS9 A;  2O4I A;  2OZS A;  4JRP A;  4FJJ A;  4F3O A;  1XC9 A;  2HND A;  3V9S A;  1SL2 A;  4KHU A;  2X78 A;  2HHX A;  1EXQ A;  3JSM A;  3ISN C;  2IC3 A;  4KPY A;  4FZX C;  2KZZ A;  2RF2 A;  1VK0 A;  4E0D A;  3PV8 A;  2YV0 X;  1TKT A;  1S5J A;  4E1N A;  4FM2 A;  3HVT A;  2Z1H A;  1JLE A;  2XY5 A;  4F2S A;  2IGI A;  4O0J A;  1CXQ A;  1S6P A;  2JLE A;  1X1P A;  3RR7 A;  3NBP A;  3QLH A;  4DTP A;  1SUQ A;  4DQR A;  1QSS A;  4CIF A;  2OPR A;  2G8U A;  3V6D A;  4CGJ A;  2HHQ A;  1BQN A;  1JL1 A;  2IOC A;  3KLF A;  3OYI A;  3LP3 A;  3NF9 A;  1RTH A;  3H08 A;  1J9A A;  3QEP A;  4I9L A;  2QKB A;  1C0M A;  3F73 A;  1BI4 B;  3MEG A;  2GUI A;  4FLZ A;  3L2Q A;  4DSE A;  3PX6 A;  1WSE A;  1U48 A;  3DMJ A;  1VSJ A;  1S6Q A;  4J2A A;  1C6V A;  4H8K A;  4OLB A;  5HRS A;  4LH5 A;  5J2N A;  1C1B A;  4NCA A;  4FZZ A;  4W5O A;  3V81 A;  4FJN A;  3BDP A;  1HQU A;  3NF7 A;  2Y1J A;  2P5O A;  1NK5 A;  2X74 A;  3LAL A;  4OLA A;  3IAY A;  2WON A;  1NOZ A;  4KHQ A;  3KLG A;  1S1W A;  1VSL A;  4AHT A;  3QEV A;  4FJI A;  3LAN A;  3QET A;  4DTN A;  2BAN A;  4MQ3 A;  3OYL A;  3OYB A;  3VQQ A;  4LD0 A;  1KLM A;  3K5L A;  5CYQ A;  3M8S A;  2OZM A;  3OYM A;  4FJK A;  2DTU A;  4O55 A;  4R5P A;  4CGD A;  2BDP A;  1BIZ A;  4BDP A;  4QOZ B;  1S1T A;  4CF2 A;  4CK3 A;  4FJM A;  2Z1I A;  4Z4H A;  3QIO A;  2HHT A;  4CK2 A;  3U3Y A;  2OPQ A;  2KFZ A;  1ZBU A;  4G1Q A;  1KVC A;  3RTV A;  1NK7 A;  2OPP A;  4DQQ A;  4DF8 A;  1LAW A;  3O4N A;  4DMN A;  2R7Y A;  4DTM A;  3DRR A;  2YHA A;  4B8A B;  3L2U A;  3QIN A;  4FXD A;  4BWM A;  1EX4 A;  3CFR A;  2PZS A;  3VQB A;  4F3T A;  1JXB A;  3SV4 A;  4HTU A;  1JKH A;  4ELV A;  2XO7 A;  4FZY A;  2XRI A;  3DRP A;  4OPK A;  1KTQ A;  1I3A A;  5J2P A;  2KFN A;  3RR8 A;  1LAV A;  2HVI A;  1VRU A;  3AO1 A;  3L2V A;  2RPI A;  1NOY A;  4Y1C A;  1RBS A;  3CM6 A;  4CJ3 A;  1T7P A;  4DFP A;  1TKX A;  3QES A;  4PY5 A;  1GOA A;  1C0U A;  1HRH A;  4FW2 A;  4E7J A;  1HNV A;  4Z0U A;  3VQ9 A;  4CJP A;  4FJH A;  2GBZ A;  1RT3 A;  4F2R A;  4CIE A;  4HUG A;  1RTJ A;  3ZSZ A;  4DFJ A;  4ICL A;  4FJ5 A;  1X9W A;  1S9G A;  3O3G A;  4JLH A;  3KJV A;  1RDD A;  2ATQ A;  2AJQ A;  3DI6 A;  4ZTJ A;  2XY6 A;  4CEB A;  1HQE A;  3KK3 A;  3TAN A;  3I0S A;  4N41 A;  4OPJ A;  3ZT4 A;  3TR8 A;  3PX0 A;  3WNF A;  3SQ2 A;  1TK0 A;  1BL3 A;  2E6L A;  1YVU A;  4W5R A;  3SQ4 A;  1L3S A;  4C8N A;  4FLY A;  1A5X A;  3PX4 A;  3M8R A;  4DS4 A;  3NCI A;  3O3F A;  3NAE A;  3TAQ A;  3SUO A;  4M3W A;  4KHN A;  2QXF A;  2HHS A;  4CJQ A;  4KKO A;  3NH0 A;  3L8B A;  2HHV A;  4FJX A;  1CXU A;  2RKI A;  1SKW A;  4N47 A;  1ZBF A;  4K8X A;  4K8Z A;  2KZM A;  4M41 A;  4QCL A;  4E7L A;  3ZSR A;  1GOB A;  1HYZ A;  3S3M A;  1VRT A;  4DTR A;  2D0B A;  3NGZ A;  3V9X A;  4DSF A;  4KTQ A;  3VQA A;  3O4Q A;  1CZB A;  4CEZ A;  5SZT A;  3ZT1 A;  4BDY A;  2PYJ A;  1WNS A;  4DSK A;  1NK9 A;  4Z4E A;  1RTD A;  3C6U A;  2OYQ A;  3KK1 A;  4KRF A;  3TAF A;  4F8R A;  1W9H A;  4CJW A;  3C94 A;  1Q9X A;  3M8Q A;  4I7F A;  3KLI A;  3MEE A;  5KGX A;  4YFU A;  1RBT A;  5J2M A;  3OS2 A;  3U6F A;  1KFD A;  1RT5 A;  1R0A A;  3AVM A;  3JYT A;  1HPZ A;  1RDC A;  4KO0 A;  2EX3 A;  4W5Q A;  4EP4 A;  1RBU A;  3OY9 A;  3NGI A;  3UIQ A;  4PA1 A;  3NH1 A;  4BDZ A;  3S9H A;  2LSN A;  3KD1 E;  4GVM A;  4HUF A;  1KRP A;  3QEW A;  2DFF A;  4CEQ A;  3C6T A;  1WN7 A;  3G0Z A;  4IBN A;  3E01 A;  1JLA A;  4RW8 A;  3QNN A;  3RWU A;  4CIG A;  3PO4 A;  4FJ9 A;  3AA4 A;  4DTU A;  4IG3 A;  3I0R A;  1U04 A;  1NK0 A;  3HST B;  3RMD A;  4AH9 A;  3EYZ A;  3HP6 A;  3B6P A;  4O5B A;  1HJR A;  1HYV A;  3ZSO A;  1TK8 A;  1BIS A;  3K57 A;  4BE2 A;  1IKY A;  4OGE A;  4Q5V A;  1SL1 A;  3SNN A;  4FM1 A;  3SI6 A;  3NF8 A;  1NJY A;  1ITG A;  3ZT2 A;  4KTZ A;  5E41 A;  3KLH A;  4CE9 A;  3KD5 E;  4FCY A;  3HT3 A;  1RT1 A;  3DLK A;  3LPU A;  4CJF A;  3AO4 A;  4EP5 A;  5HRN A;  1JLC A;  2X6N A;  4KV8 A;  1RT2 A;  3LZJ A;  1LW2 A;  1JLF A;  5FRO A;  1L3U A;  2W42 A;  4NYF A;  2FBX A;  1SKR A;  1J54 A;  4ID1 A;  4CGI A;  2XY8 A;  2P51 A;  1RBV A;  4E3S A;  3OYE A;  1QSY A;  3LDS A;  1XWL A;  1KVB A;  3FFI A;  4IFY A;  3DOL A;  4DTX A;  1IKW A;  3S3O A;  1KLN A;  1LV5 A;  3T3F A;  3LP1 A;  4OKJ A;  1KCF A;  4RW7 A;  4F4K A;  1JLG A;  3VQE A;  2YNG A;  4E7H A;  1QTM A;  5D3G A;  1FK9 A;  2IDO A;  3AO3 A;  4AHC A;  5J2Q A;  3SQ1 A;  1BCM A;  1UA1 A;  1KSP A;  2HHU A;  4WE1 A;  4NCB A;  3MED A;  3SUN A;  2HB5 A;  3NE6 A;  4OVL A;  1ZBH A;  2YNF A;  1CLQ A;  3TAE A;  3ZCM A;  2E6M A;  1IKV A;  4KRE A;  3T1A A;  4KHW A;  3ZSV A;  5C25 A;  3O3H A;  3OS0 A;  1RBR A;  4O4G A;  4PQU A;  1XHX A;  2P5G A;  5EU7 A;  1D9D A;  5KI6 A;  1A5V A;  1B92 A;  4NCG A;  3AVG A;  1YT3 A;  4QAG A;  1DTT A;  1WSJ A;  4IFV A;  1FKO A;  5C42 A;  1B9D A;  1EET A;  1D8Y A;  4FK2 A;  1ASU A;  3LAM A;  1VSK A;  3THV A;  3WNE A;  3B6O A;  1RT6 A;  3KK2 A;  4E7K A;  1T03 A;  1ASW A;  3OYF A;  1DLO A;  1DTQ A;  4FJ8 A;  3AO5 A;  2VWK A;  2YKN A;  4FM0 A;  2F96 A;  1U49 A;  2BE2 A;  1VSE A;  1T8E A;  4M3Y A;  3MXJ A;  4CHZ A;  3QER A;  4CFC A;  3SCX A;  4M3T A;  4CJE A;  1NJX A;  3LZI A;  1IH7 A;  1A5W A;  1MU2 A;  1W0H A;  3V1R A;  4ZTF A;  3VQ6 A;  3RRG A;  1WSG A;  2D0A A;  3DLR A;  1JXE A;  3NDK A;  4Z4F A;  1QHT A;  2VG6 A;  1S1X A;  1BI4 A;  3K2P A;  4IKF A;  3SPY A;  3QIP A;  4DU1 A;  4CER A;  4IDK A;  4XIU A;  4O0I A;  3K58 A;  4DS5 A;  4DTO A;  1IO2 A;  1VSI A;  1L3T A;  3ITH A;  2X6S A;  2B4J A;  4B08 A;  3L2R A;  3HVR A;  1HNI A;  4Z4G A;  4B8C A;  4AHS A;  1BHL A;  4IG0 A;  1G15 A;  2JGU A;  1D9F A;  1F21 A;  1UWB A;  4LY7 A;  3K5M A;  2HMI A;  1BQM A;  3HXM A;  4M45 A;  5KGW A;  2A1R A;  4FW1 A;  2YHB A;  3EY1 A;  4KAZ A;  3L2W A;  3LP2 A;  1NK4 A;  3CG7 A;  4FYD A;  2VG5 A;  1SV5 A;  2O4G A;  1QQC A;  1K6Y A;  1Z26 A;  3NF6 A;  4DU4 A;  1U47 A;  3C95 A;  4DFK A;  4CF9 A;  1KVA A;  2HHW A;  4CGG A;  1J5O A;  1NK6 A;  4BE1 A;  4DF4 A;  4AIL C;  1RIL A;  1NJZ A;  2PYL A;  3DOK A;  4N5S A;  1TAQ A;  3HPO A;  4RG8 A;  3ASM A;  3QO9 A;  4FLU A;  4L8R B;  3VQD A;  1UAX A;  3SV3 A;  3OVN A;  1IG9 A;  3TAB A;  3HJF A;  2G8K A;  4CGF A;  3U3G A;  3AV9 A;  3ULD A;  4B9T A;  3HM9 A;  3NHG A;  3DYA A;  4KFB A;  1NJW A;  4W5T A;  1REV A;  4C8L A;  1XHZ A;  1LW0 A;  2ETJ A;  4RW4 A;  2DFE A;  3EZ5 A;  2NUB A;  4CEE A;  4O44 A;  3P83 D;  3TAM A;  3ZSQ A;  5I3U A;  4RW6 A;  1WSH A;  5KRS A;  1VSH A;  4ZHR A;  1Y97 A;  1RT7 A;  1Q9Y A;  4DSL A;  3LPT A;  3KTQ A;  1RCH A;  5CZ2 A;  2Y1I A;  4DSJ A;  4FK4 A;  4ID5 A;  4CK1 A;  5T7B A;  1WAF A;  3BGR A;  3AVB A;  4BWJ A;  4CFB A;  4DU3 A;  4C8K A;  4M3Z A;  3CM5 A;  3VQ4 A;  1WSF A;  3DLE A;  3DM2 A;  3HYF A;  3P5J A;  3AVJ A;  4DFM A;  4LSN A;  2PY5 A;  2YKM A;  4DSI A;  4I9Q A;  4H4M A;  4CEA A;  1YTA A;  4CJL A;  5JS1 A;  3ZSY A;  1LWE A;  2WOM A;  4RW9 A;  3IG1 A;  3DLB A;  3OYG A;  3AA2 A;  3NGY A;  1TKZ A;  3A2F A;  4FLW A;  1ZYQ A;  3SUQ A;  2Q3S A;  2FBV A;  3HP9 A;  3VQ5 A;  3HL8 A;  5HLF A;  3KKS A;  1Z25 A;  3NFA A;  3IRX A;  3L3V A;  2RN2 A;  1RT4 A;  4CF1 A;  1TVR A;  5I42 A;  3AVL A;  3OYN A;  1B9F A;  4FJG A;  3ZSX A;  4CHP A;  4CHN A;  1TAU A;  4Z4C A;  1UOC A;  1HMV A;  4NYN A;  3T19 A;  4CHO A;  4CJS A;  2VWJ A;  4DTS A;  2HNY A;  3QEX A;  3SQ0 A;  4C8O A;  4KHY A;  2G8I A;  3VQ8 A;  1IKX A;  4HHT A;  1YTU A;  1LWF A;  4J2B A;  4CJU A;  3SYZ A;  4B9L A;  1NKB A;  3WNG A;  1NKC A;  4EZ9 A;  1N5Y A;  2D5R A;  2GV9 A;  1WSI A;  1U4B A;  1T05 A;  2IAJ A;  1C1C A;  3LP0 A;  4FLT A;  1C0T A;  1JLB A;  3SUP A;  4M3X A;  3LAK A;  1VSM A;  3AVK A;  3LWL A;  4E7I A;  4CEC A;  3AA3 A;  3LWM A;  3ZT0 A;  4TSX A;  4JS5 A;  5FRN A;  3DLH A;  2BGG A;  3ZT3 A;  5CY4 A;  1S9E A;  2B6A A;  4CF0 A;  4Q0B A;  4AHV A;  4FLX A;  4KI6 A;  4FJ7 A;  3OYC A;  3QNO A;  3HPG A;  1VSF A;  4OKE A;  4JS4 A;  3SZ2 A;  3RMB A;  1SKS A;  3KIO A;  4MFB A;  3PY8 A;  3VA3 A;  4CEF A;  1XI1 A;  3P1G A;  4GMJ B;  1QS4 A;  1FKP A;  1N6Q A;  4B9V A;  2B5J A;  4OJR A;  3OYD A;  4Z4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...