4CFAA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cfaA00
1NJZA 4C8LA 3DM2A 3QEPA 3OYNA 1RBTA 1TAUA 3CM6A 1VSDA 4KB1A 1JLAA 3MXMA 2NUBA 3K5OA 3AVFA 5HRNA 1S1TA 2G8VA 4AHCA 3V9UA 4BE0A 4FJJA 4CHZA 1QTMA 4F3TA 3V1OA 3ITHA 1L3UA 3SYZA 4HVJA 2OPRA 3EY1A 2Z1HA 2P5GA 1ASWA 3OYFA 4FJXA 4CJFA 4DF8A 2HHTA 1WSIA 1LWEA 1Y97A 1S9GA 4CK1A 4FJHA 5HLFA 2OZMA 4M41A 1T05A 1I39A 1Q9XA 1TL3A 3D45A 2FBXA 2G8KA 1X1PA 3OYCA 1BCOA 3AVGA 3CFPA 4GW6A 4FZZA 3VQEA 4DS5A 1UAXA 3JYTA 4AHUA 4FJIA 3C94A 1S1XA 1HQEA 3AO2A 1BCMA 1DTTA 2B6AA 1NK8A 3KD5E 3QNOA 4N47A 1BIZA 5JS2A 4Q0BA 3S9HA 4M3WA 3VQ8A 2YNGA 3KLEA 4JRQA 3AVAA 4CJRA 1B9DA 2VG6A 4ICLA 1LAVA 4BWJA 4XIUA 3OS2A 4DFJA 4E7LA 4KHUA 2ATQA 1ZYQA 1L5UA 4B9MA 2RF2A 3OYEA 1VSIA 3NH2A 3VA3A 3OJSA 1C0TA 3PO4A 3C6UA 3HL8A 3B6OA 2I5JA 4MQ3A 4DWIA 1WSHA 2HVHA 3VQ5A 2RKIA 3TWHA 3I0SA 5I42A 3QIPA 4Q5VA 2OPPA 4J2DA 1VSKA 3AO3A 4BE2A 3TANA 3MXIA 2HVIA 2RN2A 5FRMA 4FM0A 4RW6A 4BE1A 1TAQA 4GVMA 4FM2A 4DQPA 4ID5A 1C1CA 1ZBUA 1FK9A 1S6PA 4E7IA 1XHZA 3DOKA 3NGZA 1NJXA 2IC3A 4UQGA 2BE2A 2D0BA 4FLXA 2O4IA 2DFFA 2OA8A 1KFSA 3HVTA 1JKHA 1WSEA 3TAQA 3K5NA 1KFDA 4FZYA 3ZT2A 4C8KA 4C8OA 3F73A 1RTDA 3RR7A 4DQSA 2XO7A 1NKCA 4ELTA 4KFBA 2LSNA 4DU1A 4DSEA 4Z4EA 2XY5A 1ITGA 3HVRA 4E1NA 4FJ7A 2E4LA 1HNVA 3ALYA 1EP4A 1HMVA 1RT5A 3NGYA 1S1VA 4HHTA 2FBVA 2QKBA 4BDPA 1WAFA 4B9SA 1NK6A 1JL2A 3AVLA 1CXUA 4CF8A 3TAEA 3KLFA 3KLIA 4O4GA 3WNEA 4FM1A 3HM9A 1SL2A 3RWUA 4CESA 4F8RA 3SV4A 5DMRA 4DTRA 2HNDA 1J9AA 4DF4A 2FBYA 4CEOA 2Y1JA 3H08A 3MEEA 3TR8A 4HTUA 4K8ZA 4AILC 3SZ2A 3NE6A 2HHUA 1TKTA 4Z0UA 1CZBA 3OS0A 1NOYA 3PO5A 1SL0A 4IFVA 1JLBA 4R5PA 2DTUA 4CJWA 4EZ6A 2KZZA 4CFCA 4E7HA 3DRSA 4N5SA 3VN5A 3L3VA 1EXQA 4CJSA 3AVHA 4PQUA 2FBTA 3AVKA 3DYAA 4KTZA 3M8SA 3L8BA 4FLYA 3SNNA 2KFNA 1J54A 4OKKA 3HJFA 2PZSA 4F4KA 4FJGA 1RBRA 3SV3A 4AHSA 2F8SA 3IG1A 4ID1A 4HCBA 3U3YA 3TAFA 3NFAA 2G8UA 3TAMA 3RRGA 2D5RA 4TSXA 3ISNC 2JGUA 3HP9A 4CEQA 4M3TA 3ZSYA 3RTVA 4OJRA 1S1WA 2IGIA 3KKSA 4AHVA 4RW7A 2YV0X 1CLQA 4FLVA 4ZTFA 1U45A 3PX0A 2XY7A 1J53A 1YTAA 4FW2A 4CJQA 3VQ7A 2VWJA 1TV6A 2JLEA 3LP0A 2YHAA 3VA0A 4BWMA 2IDOA 4KI4A 4F2SA 1BISA 4BACA 4ELVA 1QSSA 3VQDA 1JLCA 3HYFA 5J2MA 4FJNA 4DQRA 4FK4A 1L3TA 2X6NA 1S6QA 2R7YA 1ASVA 3LPUA 5HRPA 4FZXC 1CZ9A 3QINA 3AVCA 3V1RA 4DQIA 2EX3A 4CIEA 3AVBA 1D8YA 3PUFA 5CY4A 3LZIA 2ITGA 1JLQA 3O4NA 4B8CA 4F3OA 4Z4IA 2A1RA 3K5MA 2HHQA 3ZSWA 3DLRA 1S9EA 4M45A 1SKRA 4FJMA 2XY8A 1X9MA 1NK9A 3ZSRA 1QS4A 1G15A 1XC9A 1ZBLA 3KD1E 3L3UA 2GBZA 5FDLA 4M3ZA 4I9QA 3KIOA 3KLGA 3AVNA 1WNSA 1W9HA 4B9LA 3T19A 1HPZA 3O3HA 4CHNA 1LV5A 3DMJA 3C95A 4FLUA 1RTJA 4CGFA 2BDPA 4B9VA 3RR8A 2HHXA 4OLAA 3VQ9A 3QEIA 3CM5A 3CQ8A 2GV9A 3NDKA 5HBMA 1LWCA 3F9KA 5HP1A 4KHSA 2HMIA 4B9NA 3RMAA 3ZCMA 4CK3A 3L2UA 4CFDA 3L2VA 3IS9A 1RCHA 3E01A 2DFEA 4FLZA 5CYMA 3AA3A 3HPOA 1GOCA 5T7BA 4CHYA 1D5AA 1NKBA 1LW0A 4KHYA 3HO1A 1RDAA 2HB5A 4CJPA 3V9WA 4E7JA 4E0DA 3IRXA 4DSJA 3WNHA 3P83D 4RW9A 2OZSA 1VSJA 1B92A 2OPQA 1QQCA 1X9SA 1WLJA 1WSFA 3THVA 2PYLA 1VSFA 1TKXA 4N76A 5CZ2A 4H8KA 4JRPA 2IAJA 4FW1A 2D0CA 3M8QA 3PY8A 1QHTA 1W0HA 1F21A 4LSLA 4M3UA 3ASMA 1U49A 4CF0A 2KTQA 1C0UA 1C1AA 5CYQA 4EP4A 3V6DA 4E1MA 3O3GA 2BGGA 4B9UA 3DLEA 3LP3A 4CEEA 4N56A 2D0AA 4CJ3A 3SJJA 3LAMA 1GOAA 3S3OA 2Q3SA 1A5WA 3U3GA 4DU4A 1A5XA 1VRUA 2X6SA 4KAZA 4DTXA 5C25A 4EZ9A 2FC0A 3CG7A 3DLHA 3DLGA 4K8XA 4IFYA 3DI6A 4FYDA 1KVBA 4CGDA 2YKMA 3NBPA 2Z1IA 1T8EA 3MECA 3NF9A 4DTOA 4DSLA 4B9TA 5D3GA 3NF8A 4O0JA 1YTUA 1LAWA 2IS3A 4M3RA 5J2NA 3NGIA 4LH4A 3I8DA 1A5VA 2ZQBA 2YKNA 2DY4A 3MEDA 4FCYA 4F2RA 5HRRA 4DTSA 1KSPA 4H4MA 4CIFA 1UWBA 2P5OA 1WAJA 4KV8A 3AO1A 4QAGA 3K59A 3TARA 3KKRA 2XHBA 1GOBA 4FK0A 4O0IA 2F8TA 4KREA 3AVJA 4DTPA 3AO4A 4G1QA 4B08A 4CERA 4FVMA 1LW2A 4AHTA 1VK0A 4IBNA 4L8RB 3NH1A 3S3MA 3QNNA 4W5NA 3JSMA 4I2QA 4IDKA 4CJEA 1Q9YA 3MAQA 4KHQA 3QIOA 2HHSA 1BGXT 1RT3A 4OPJA 4PWDA 1NJWA 3UIQA 2GUIA 1JLEA 2XRIA 4OGEA 3VQAA 4KO0A 3SQ2A 3QEVA 3OY9A 3QERA 4OLBA 4EP5A 4FXDA 4CEZA 4DSKA 3MEGA 3P1GA 4KTQA 1U04A 3RRHA 3L2WA 3SCXA 3OVNA 1BL3A 4CE9A 4CJ5A 4DLEA 1ZBHA 4CEBA 2HHWA 2O4GA 3ZSVA 1EETA 4CEDA 1C6VA 4CJ4A 4CJUA 5KTQA 3TAPA 2G8WA 3DRPA 4Z4FA 5HROA 2VG7A 3OYAA 4O44A 3HPGA 5KI6A 1SKSA 4OKEA 2F96A 3CYMA 4IG3A 1J5OA 4I9LA 2VG5A 4KI6A 1HJRA 2B4JA 1RBUA 1DLOA 4LD0A 1QE1A 1TGOA 3CFOA 3B6PA 3P5JA 3T1AA 3HP6A 1U48A 4CFAA 4E3SA 3SUNA 3DLBA 4JS5A 3HK2A 3V9ZA 2A1SA 4DFPA 1NJYA 1D9FA 1RBSA 1VSLA 1SUQA 4DTMA 3SPYA 4CEFA 3QESA 3SQ1A 4CJKA 1T03A 5C24A 1VSMA 4HUEA 1UA0A 1TKZA 1RT6A 1I3AA 3G10A 4CHQA 5SZTA 4C8NA 3NAEA 4I7FA 1R0AA 4ELUA 4NCGA 1TK0A 4M3YA 3NHGA 3AA2A 3K5LA 1EX4A 4DU3A 1BQMA 3VQBA 2W42A 2ETJA 5E41A 4IG0A 3OS1A 1BHLA 1EKEA 3K58A 4AHRA 4DLGA 4RW8A 3TAGA 4FK2A 4IKFA 1UA1A 4DFKA 1IKWA 2YNFA 3L2QA 1RTHA 2X74A 4Z4HA 3OYBA 3M8PA 4CGJA 3LDSA 1NK4A 1N5YA 1FKPA 1C1BA 1WN7A 3LANA 4PA1A 4LH5A 1HYVA 4YNQA 3O3FA 3SUQA 4FJKA 2PYJA 5JS1A 2G8IA 4YFUA 4J2EA 3KJVA 3OYLA 3NF6A 1RBVA 3SI6A 2YHBA 3O4QA 1IG9A 4NCBA 4JLHA 1RT2A 1RT7A 3LZJA 5C42A 3VQQA 1SKWA 3DRRA 4RW4A 5HRSA 4RG8A 3DOLA 5J1EA 4LY7A 3QO9A 4DG1A 5J2PA 3VQ4A 5J2QA 4ZHRA 2QK9A 4Y1DA 4CF2A 2KQ2A 4NYNA 3V1QA 4KKOA 3BDPA 1HQUA 4CJTA 3EYZA 3KTQA 1YT3A 2B5JA 4DTNA 3QLHA 1RDBA 2VWKA 1JLGA 4CF9A 3D0PA 4Z4GA 1JXEA 1Z25A 3RMBA 1VSHA 1O1WA 2RPIA 3K2PA 1RILA 1XI1A 2WONA 4C8MA 1HYSA 3V9SA 4KB0A 4OVLA 3OYJA 1ZBFA 2IOCA 3ZSQA 1KTQA 4JS4A 4LSNA 3S3NA 3WNGA 1RNHA 1UOCA 4KHNA 1C0MA 1IKXA 4KTWA 3OJUA 2G8HA 4W5QA 5DK5A 3QETA 1KLNA 1IH7A 1KVAA 3TABA 2PY5A 3L2RA 3DLKA 4CEAA 2XY6A 1T7PA 3QEXA 4DMNA 5CZ1A 4ZTJA 4DTJA 1YVUA 3ZT0A 1NK7A 1DTQA 4CF1A 1B9FA 3HPHA 1TKDA 3M8RA 4BDYA 4PY5A 1KRPA 1RDCA 5SWMA 1JL1A 1KCFA 3PX6A 1NK0A 1RT1A 3PV8A 4Z4CA 2QKKA 2Z1JA 4Y1CA 3V81A 2ZD1A 4FJLA 4FJ9A 3G0ZA 4E19A 1U4BA 3KLHA 4DSIA 4FJ5A 1WSGA 3V4IA 5KRSA 1XWLA 2G8FA 4CJVA 2E6MA 3ZT3A 4CHPA 4CGGA 4J2BA 3U6FA 3NCIA 4AH9A 3SQ4A 1SV5A 1REVA 3BGRA 4WE1A 1SL1A 4N41A 3OYDA 1QSLA 2ZE2A 1NK5A 5KGXA 1BI4B 3LWMA 2X78A 3FFIA 3T3FA 1IKVA 2OPSA 3A2FA 3ZT4A 4DQQA 4NYFA 1BIUA 1QSYA 1L3VA 1S5JA 3RMCA 4B8AB 1TK8A 1N6QA 3LP2A 4HUGA 3OYKA 3AV9A 1VRTA 3ZT1A 1ASUA 3NF7A 4DSFA 3TI0A 1S1UA 1LWFA 4O5BA 2Z1GA 4OKJA 4GMJB 3K57A 4DS4A 3SUOA 1XHXA 4DFMA 3RMDA 4KPYA 1JLFA 4FJ8A 4B3OA 2HNYA 2KW4A 1L3SA 1FXXA 3IAYA 1RT4A 4CGHA 3AO5A 3C6TA 3OYMA 3QEWA 4M3XA 5FRNA 4QOZB 3LAKA 3KK1A 3OYIA 1NKEA 4M42A 3VQ6A 3AVIA 4W5RA 3EZ5A 1TK5A 2Y1IA 3PX4A 1NOZA 3OYHA 2EHGA 3I0RA 1Q8IA 4OGCA 3ZSZA 2YNIA 1VSEA 1Z26A 3VQPA 4DTUA 4I2PA 3SQ0A 1ZBIA 2OYQA 3NH0A 2QXFA 3V9XA 2HHVA 2WOMA 3HT3A 3ZSOA 3ULDA 2AJQA 1MU2A 4CGIA 3OYGA 1TL1A 4CECA 3AA4A 3LALA 4H4OA 3LP1A 4KHWA 4CHOA 3KK2A 1BQNA 1HNIA 1TVRA 1BI4A 2YNHA 2HW3A 4O55A 4HCCA 3SPZA 4J2AA 1KVCA 1FKOA 3HSTB 4CJLA 3MXJA 2KFZA 5FROA 1CXQA 5I3UA 1U47A 3LWLA 4QCLA 1IKYA 1RTIA 2P1JA 4HUFA 3SUPA 2HNZA 4PUOA 4W5OA 2DFHA 4W5TA 5K14A 4FLTA 1IO2A 1RDDA 4OPKA 2E6LA 1WSJA 2BANA 3KK3A 4CFBA 5EU7A 3HXMA 4MFBA 5KGWA 2KZMA 1KLMA 3WNFA 1X9WA 4NCAA 1JXBA 2P51A 3AVMA 5KRTA 3LPTA 4BDZA 4E89A 1HYZA 1K6YA 3CFRA 4CIGA 3VQCA 4CCHA 4FLWA 3ZSXA 1HRHA 3AA5X 1D9DA 4CK2A 4E7KA 4KRFA
chains in the Genus database with same CATH superfamily
3QEPA 2AA4A 1VSDA 1JLAA 3MXMA 2NUBA 3JXUA 5HRNA 2YI1A 4AHCA 4F3TA 3ITHA 5C2FA 1MA9B 2P9SB 4H0YB 3EY1A 2OPRA 4JHDB 1ASWA 3ULEB 3OYFA 4CJFA 3O80A 2HHTA 5AQLA 4ISEA 4E1JA 5HLFA 2QWOA 2OZMA 2G8KA 4BRFA 3OYCA 1BCOA 4FZZA 5AQYA 3AARA 4DS5A 4C1NK 1UAXA 1DGKN 4AHUA 3U9ZA 5DM6L 4FWSA 2NRXA 4N47A 3FZLA 4Q0BA 1YJNN 4M3WA 3C7NB 2VG6A 4DFJA 4KHPK 1ZYQA 4B9MA 1C0FA 1VSIA 2GELA 4DV3K 3OJSA 1C0TA 1NGFA 3B6OA 3PSIA 3CC7N 3DLLL 2RKIA 1QVFM 4Q5VA 3CQXA 3M1FA 3CCUN 4J2DA 3MXIA 4BE2A 5ADXH 4ID5A 1C1CA 4CD3A 3CCVN 4E7IA 4BG9A 1NJXA 2O4IA 2DFFA 1JKHA 2CGKA 1WSEA 2P9NA 3O1BA 1KFDA 3K5NA 4C8OA 3F73A 4LFCK 1I94K 2A6AA 3ZX0A 2XY5A 4B9QA 4GV3A 1W7AA 4BQLA 4FJ7A 3MCPA 4BDPA 3GE1A 1CXUA 3EL2A 4DTRA 4U67L 2FBYA 2IVPA 2P9LA 5AQZA 3A0IX 3NE6A 3SZ2A 4IEIA 4AILC 4GKJK 3PO5A 1J5EK 2DTUA 1JLBA 5EX5A 5M1OA 4H5NA 2YHXA 4E7HA 2E88A 2OTJN 3W0LA 3MDQA 4CJSA 1EXQA 2FBTA 3F9MA 3M8SA 3KHYA 3SNNA 4OKKA 4F4KA 4FWKA 2WC9A 2Q31A 4X66K 4FJGA 1RBRA 2F8SA 3TAMA 1NGCA 1VHXA 2W6KA 2V7YA 2JGUA 1T44A 3ENHA 4OJRA 4B1VA 3R6MA 1ATSA 2OTLN 1G99A 4FLVA 4CZKA 3PX0A 2HF3A 1VQMN 3VA0A 4BWMA 1GLFO 4KI4A 1OVYA 4F2SA 3EE8A 1BISA 3VQDA 1KAXA 4FK4A 3U8XA 1NGDA 1N33K 3V1RA 4DQIA 5BPNA 1K73O 4Z4IA 1VQ4N 2A1RA 3S41A 2E1ZA 1S9EA 4M45A 1VQ7N 4FJMA 1YITN 1NK9A 4NXMK 3SMSA 3ZSRA 1QS4A 5BR9A 3J81O 3L3UA 5AQQA 4Z94A 3KLGA 1BDGA 3CCQN 1HPZA 4CHNA 4KBOA 3G71N 3C95A 3HOTA 4H5TA 4JKGB 3QEIA 1ATNA 1BG3A 2FSJA 2GV9A 4CZJA 5JLHA 2NRRA 1IBMK 3ZETB 4B9NA 4IWVA 2HBMA 4B3SK 3IS9A 3WEEB 4FLZA 4V19S 5AQJA 1RDAA 2HB5A 3V9WA 2O8CA 1BUPA 1VSJA 2OPQA 1X9SA 2QWQA 4JKFA 2PYLA 2UUAK 2D0CA 4LF4K 1F21A 3OHRA 2KTQA 5AQWA 3TPQA 4B9UA 3BF1A 3LAMA 1GOAA 4IO9L 3S3OA 1HUXA 2PBDA 5HOOA 1A5XA 1VRUA 2X6SA 4KAZA 1OKJA 5C25A 2E2OA 3CG7A 4EHUA 4B1ZA 1KVBA 4DSLA 3NF8A 4MDBA 1LAWA 4LH4A 2ZQBA 3VF6A 3ATVA 2ZJQL 4B1WB 4WFNL 2P5OA 1GLAG 3K0SA 3AO1A 4QAGA 1YI2N 2XHBA 1GOBA 3C7NA 3T7ZA 5MLCQ 4DTPA 3AO4A 4G1QA 5C2DA 4CERA 1LW2A 2W41A 4B3TK 4NLBA 1KQSM 2Q97A 4KHQA 2HHSA 4ILGB 1RT3A 4OPJA 4PWDA 1VQ5N 2XRIA 3I55N 4DR6K 4KO0A 4JAXA 3OY9A 4EP5A 1NG9A 4FXDA 4CEZA 4A2AA 4DSKA 2Q2RA 4CZIA 3LM9A 4CZMA 3L4IA 4WYBA 3CD6N 4CJ5A 3MWPA 1ZBHA 3ZSVA 1EETA 4CJ4A 3QMLA 5AQOA 3DRPA 4Z4FA 1U2VB 1SKSA 2F96A 4BR5A 1Q81O 5AQRA 3HTVA 2GUPA 1RBUA 1DLOA 1QE1A 3CFOA 3B6PA 4YOTA 3ZEUB 3QICA 3V9ZA 2A1SA 1NJYA 3ATUA 1RBSA 4A61A 1SUQA 4DTMA 3SPYA 3WT0A 1OH6A 3QESA 3SQ1A 4A57A 1NGEA 1UA0A 1WUAA 3EO3A 3UB5A 3VF4A 1TK0A 4M3YA 3JAMO 1EX4A 3VQBA 2W42A 3BZKA 4YOUA 4BGAA 1RDWX 2O8FB 3HSCA 1BHLA 3CXCM 3A8YA 1JCFA 4IKFA 4BR9A 1IKWA 3BP8A 3OYBA 4Z4HA 4CGJA 1GLCG 4PA1A 4FJKA 4J2EA 3ID8A 4JLHA 1RT2A 1RT7A 5C42A 4IJAA 3H46O 4LFAK 4RW4A 3J7YP 4JK8A 4JKBA 3DOLA 5J1EA 5J2QA 3EZWA 4ZHRA 4JK7A 1BA1A 1GLJO 4XH1A 3BDPA 2QWNA 4DV7K 4CJTA 1YT3A 2B5JA 3QLHA 3DWLA 1RDBA 3D0PA 1Z25A 3RMBA 1O1WA 4A62A 1XI1A 3DXKB 2IIRA 2E8AA 2WONA 3O9SA 1HYSA 1NGAA 4JS4A 4LSNA 3SBTA 1IKXA 2VGMA 4W5QA 5AQGA 2CGJA 3TABA 3L2RA 4JKAA 3DLKA 4CEAA 3F2KA 1YVUA 3ZT0A 4YOXA 4JI2K 5BN9A 1DTQA 1B9FA 4BDYA 2KKZA 3THXB 1KRPA 2ASOA 3PX6A 3LL3A 1NLVA 4Z4CA 2QKKA 4FJ9A 3GG4A 4E19A 2RE2A 4JKGA 4FJ5A 3V4IA 4BC2A 1XWLA 3ZT3A 3ENBA 3NCIA 1NGHA 3BGRA 3HI0A 4WE1A 1BI4B 2QA4N 3FFIA 1IKVA 3QB0A 3CC4N 1L3VA 3H6EA 4HTLA 5H1SQ 3LP2A 3AV9A 3ZT1A 1S1UA 3K57A 3SUOA 1ESVA 3VEZA 2KW4A 1L3SA 1FXXA 3E9PA 5JMVA 1RT4A 3VPZA 3AO5A 4QOZB 2Q0RA 4FWOA 1NKEA 3VQ6A 4W5RA 3EZ5A 4I6MB 4ILHA 3ZLJA 3OYHA 2YNIA 3VQPA 1Z26A 3TTDA 1W97L 3SQ0A 2WOMA 2AJQA 3OYGA 4CECA 3LALA 2YNHA 3CJ9A 2F4VK 4FWNA 5I3UA 3LWLA 4QCLA 1RTIA 4HUFA 4BR4A 2DFHA 1TUYA 2V51B 2BANA 4WQ5A 5KPZA 3CIPA 1KLMA 3WNFA 4NCAA 1JXBA 2P51A 3AVMA 4BDZA 4E89A 1HYZA 4MO4A 3MX2A 3AA5X 1Y64A 3AY9A 1HPMA 4E7KA 1EWRA 3CETA 4C8LA 1MDUB 3OYNA 1RBTA 4KB1A 3DXMA 2V52B 1NMDA 4H0VB 4DV0K 1QTMA 4AM6A 4BQZA 3CCMN 4PKIA 3SYZA 3L4QA 3TSPA 3ZEUA 2W40A 2NLXA 1IJJA 3D2EA 1LWEA 3EN9A 4M41A 3O6WA 1T05A 2P9NB 1TL3A 2FBXA 3P31A 3G4SN 5BRDA 4GW6A 4CZGA 3VQEA 3C0BA 3JYTA 4F9OA 4FJIA 1S1XA 1BCMA 1DTTA 2B6AA 3AO2A 1NK8A 4H0OA 3KD5E 1YXQA 3VQ8A 3AVAA 4CJRA 1B9DA 4ICLA 4BWJA 4KHUA 1MWMA 2ATQA 1X9JA 2RF2A 3OYEA 1XNQK 3VMFB 4BRLA 5HL7L 2YX6A 2P9LB 3HL8A 2I5JA 4DWIA 3L0QA 1WSHA 2E2NA 4IOAL 4IEEA 3TWHA 2YHWA 3I0SA 4FO0A 5I42A 1VQNN 2OPPA 4X65K 4FM0A 4BE1A 4DQPA 1Z05A 1ZBUA 4FWQA 3DOKA 3GDQA 4EHTA 5LMUK 3TAQA 4PKGA 3RR7A 4KFBA 2LSNA 4DU1A 5IT9O 1ITGA 3HVRA 3C6HA 1HNVA 4HHTA 3ALYA 3NGYA 1RT5A 2FBVA 2O8BB 3VOVA 1NK6A 1NGIA 4DQ8A 1JL2A 3AVLA 4O4GA 4CESA 1Q18A 4F8RA 1HNZK 3WXKA 2HNDA 1J9AA 4DF4A 4HTUA 1TKTA 4FL9A 4IFEA 1SL0A 4IFVA 3CHWA 4EZ6A 3E66A 3DRSA 5C0YA 2GWKA 4PQUA 3DYAA 3VEXA 5JVGL 3HJFA 3IG1A 4ID1A 3TAFA 3RRGA 3ISNC 4CEQA 3ZSYA 3RTVA 4JKDA 3HRGA 2YJEA 1NMNA 4O8UA 3MN5A 3VQ7A 3R9PA 3CC2N 1TV6A 5AR0A 2O8CB 1ZC6A 4KH5A 3J7ZO 4ELVA 1QSSA 1JLCA 4DQRA 1BA0A 1L3TA 1VAZA 3GOIA 3LPUA 5AZJA 5HRPA 4FZXC 1CZ9A 4DB3A 5FPNA 1S3XA 2EX3A 1D8YA 3FZMA 3LZIA 2ITGA 3KK7A 1JLQA 4YHHK 2XY8A 1X9MA 2FF6A 4CBXA 4I9QA 3O9RA 2QWLA 1N34K 3O3HA 2BDPA 2HHXA 3CQ8A 5HBMA 1LWCA 5HP1A 5GADP 4JKHA 1RCHA 3MWTA 3AA3A 1TYQB 2VGNA 4CHYA 5T7BA 1NKBA 4KHYA 3IFRA 3IRXA 4DSJA 2OZSA 4RW9A 4O8KA 1VSFA 4C1NI 5FPMA 4MO5A 4H8KA 4JRPA 5FPEA 4PL7A 5AQKA 1NWKA 4LC9B 4LSLA 4M3UA 1U49A 1C0UA 4C23A 4E1MA 3O3GA 4GNIA 2BGGA 2E2PA 5JLFA 4CJ3A 1A5WA 4DTXA 4K8XA 4A5BA 1YHQN 3DI6A 2HF4A 2YKMA 3NF9A 4O0JA 2IS3A 3NGIA 1A5VA 4H5RA 4DTSA 1HX1A 1KSPA 1IBKK 1GLEG 3NVKA 3K9JA 3CJCA 3TARA 3KKRA 1H1VA 4WF9L 4O0IA 4JV5K 3SJHA 2CH6A 3D6RA 4FVMA 1VK0A 3BF3A 3JSMA 4I2QA 3N4QA 1Q9YA 4BGBA 5LL6Z 2VWBA 2JWLA 1WB9A 1M90O 1NJIO 1HLUA 5KPTA 4BRHA 2ZJRL 5JVHL 2GX9A 3CCRN 1S72N 1HKCA 1XNRK 4DR2K 3OVNA 1BL3A 4QS8A 4CE9A 1MWKA 1C6VA 2G8WA 3WXLA 1XQSC 2VG7A 3AGRA 5KI6A 4ISFA 2VG5A 4KI6A 2B4JA 4H5WA 2O8BA 1Q86O 4DV6K 4E3SA 3O08A 3SUNA 1D9FA 3DAWA 1VSLA 1ATRA 4CEFA 2QXLA 4CJKA 1T03A 3HOSA 1YAGA 4HUEA 4CZLA 1RGIA 1TKZA 3G10A 1R0AA 2ZM6K 3AA2A 3CCLN 1BQMA 1QHAA 3BUZB 2ETJA 4IG0A 3OS1A 1EKEA 4RW8A 5JICA 1K8AO 4NXNK 4R79A 2X74A 4CD1A 1VQON 1N5YA 1FKPA 2FSNA 4WFAL 4LH5A 3O3FA 5JS1A 2PYJA 2G8IA 3KJVA 3SI6A 1RBVA 4NCBA 4IJNA 5C15A 4LF9K 4IOCL 4CVNE 2NRTA 2NRVA 5EXWA 5IWAK 5AQIA 2KQ2A 5AQSA 3KTQA 1HQUA 4BR7A 1SS6A 2UXCK 4Z4GA 1JXEA 3A5MC 4WQ5C 3THWA 4C8MA 3V9SA 3OYJA 2IOCA 3WNGA 1RNHA 4KHNA 1OH7A 4KTWA 3QETA 1KVAA 4X64K 5LMNK 3U9DA 5AZIA 4DHYA 2XY6A 1FW6A 4LF5K 5CZ1A 3O8MA 2HBJA 3HPHA 4OX9K 4PY5A 5SWMA 3VENA 1RT1A 3QBWA 3PV8A 2I7PA 1KD1O 2DPNA 3VEVA 4BVOA 2E1YA 3V81A 2ZD1A 3IMXA 4BRGA 2Q0UA 1VQKN 4M7XA 4CHPA 3M6GA 4CGGA 3SAHA 4AH9A 2J4RA 1TYQA 3J7AP 5AQMA 1NK5A 2X78A 3C6AA 5GIOA 4DQQA 5BREA 2JWKA 3FE1A 4CBWA 4ILJA 3KWIA 4HUGA 1VRTA 5A2QO 3SBGA 3NF7A 4QS7A 4FJ8A 1VQ9N 2HNYA 3CJBA 4WCEL 3EKUA 4CGHA 2ZJPL 5AQPA 2NRZA 4H0TB 4M3XA 3LAKA 3KK1A 1K8KA 3AVIA 3CJ7A 3PX4A 1CZAN 1NOZA 4GKKK 3ZSZA 5AQFA 1Q8IA 4A59A 3DXMB 1HKGA 4BRMA 5GAGP 4DUYK 3HT3A 3ZSOA 3ULDA 3IDHA 1TL1A 3AA4A 4H4OA 3KK2A 3RSEA 1TVRA 1HNIA 4IOXA 4O55A 4FWMA 4MLEA 4J2AA 3D2EB 3H3OB 3CCJN 3MXJA 5FROA 1CXQA 2O8EA 4PUOA 4DUZK 3CMAN 3MCAB 4FLTA 1IO2A 4JD2B 4OPKA 2E6LA 1WOQA 3KK3A 5GINA 2D0OA 2KZMA 3H1VX 4H03B 5AQUA 3J8AA 3LPTA 4LF7K 2A5XA 1K6YA 1QQNA 4BREA 2QI2A 3ZSXA 3FFKB 4YOYA 4CK2A 4KRFA 4U7BA 3DM2A 2E2QA 1TAUA 2QM1A 2WFBA 3K5OA 3QBXA 5LJVA 1S1TA 2G8VA 3V9UA 4BE0A 4CHZA 2CGLA 2WTUA 4A5AA 4FJXA 4K0KK 2BUPA 1Y97A 4CK1A 3E9LA 3A5NC 2P9IB 1I39A 2V7ZA 2OANA 3D45A 3MMVA 1X1PA 3CFPA 3WXIA 2P9UA 3C94A 1HQEA 4DR4K 1E3MA 4PKHA 5FPDA 1BIZA 3S9HA 3KLEA 4JRQA 1LAVA 3R8EA 4XIUA 1JCEA 4KH4A 3SLCA 3UE5A 4MQ3A 3VQ5A 2D4WA 3TSQA 4BVPA 3QIPA 3AO3A 4BG8A 3TANA 2RN2A 1NBWA 5FRMA 4RW6A 3BY5A 4FM2A 4GVMA 1DEJA 1YVNA 1V4TA 3IKMA 2D0BA 4FLXA 3HVTA 4ISGA 3ZT2A 1RTDA 4DQSA 3CJAA 3B8AX 2KHOA 5TKWA 1XUPO 1EP4A 2E4LA 1HMVA 2QKBA 1WAFA 4CF8A 3WNEA 5I9EB 3O5BA 3AAPA 2VQEK 3HM8A 3SV4A 5DMRA 3HZ6A 5DM7L 4CW7B 2Y1JA 1SQKA 3MEEA 3TR8A 2HHUA 4Z0UA 3OS0A 2P9PB 5AZJB 3BEXA 1QZ6A 3M3ZA 3FLCO 2KZZA 4CFCA 3GL1A 4N5SA 3VN5A 3EEQA 2KFNA 3L8BA 4FLYA 4Y0WA 4DCHA 3FZHA 4HCBA 3U3YA 3NFAA 2D5RA 4TSXA 4JKCA 3FR0A 3J80O 4FPBA 3ZX3A 2IGIA 3KKSA 4BR0A 4AHVA 4RW7A 1FJGK 2YV0X 1CLQA 1U45A 4ZTFA 1QQOA 1C0GA 1YTAA 4FW2A 4RCHA 1V4SA 5E26A 2CH5A 2JLEA 3QFUA 2GTDA 2D0PA 3CPEA 3CPWM 4AM7A 5J2MA 2X6NA 2R7YA 4BR2A 1ASVA 4XH5A 2PAVA 3FGUA 5CY4A 2WUSA 2ZWHA 3K5MA 3ZSWA 2HSTA 3DLRA 1G15A 2KLAA 4M3ZA 2GBZA 4CI6A 3F5TA 1W9HA 4B9LA 4K41A 1LV5A 2A41A 4B9VA 4OLAA 1RFQA 4JD2A 3MK6A 3F9KA 2HMIA 4CK3A 3L2UA 1RDUA 3L2VA 2QWMA 3E01A 4OPHA 2DFEA 5CYMA 3JS6A 3HO1A 3VF2A 1D5AA 1LW0A 4CJPA 4E7JA 4E0DA 3P83D 3IUCA 1WLJA 1WSFA 3THVA 2IVOA 4N76A 1BU6O 5CZ2A 3DJCA 3WUHA 2F7TA 3M8QA 4DV2K 1HNWK 4CF0A 4EP4A 3SJJA 2D0AA 1T6DA 1YJWN 4JI1K 5C10A 2FXUA 3DLHA 3DLGA 5M1PA 1U6ZA 3THYA 2P9IA 5B8HA 4JI7K 3MECA 4B9TA 1T6CA 3FZKA 3NMUA 4B1XB 4YY3K 4DV4K 4DR1K 2YKNA 3MEDA 4FCYA 1N36K 5HRRA 3LDNA 2F9WA 1NNEA 4NB4A 4H4MA 4CIFA 1JJ2M 4KV8A 2ZF5O 4FK0A 5BR8K 2GEMA 3AVJA 3PLAA 4B08A 4K43A 4L8RB 3NH1A 4IDKA 3Q7CA 4CJEA 4FVUA 4O5FA 3MAQA 1BGXT 2W6LA 1NJWA 3UIQA 3W3DA 2GUIA 1JLEA 3VQAA 5BRFA 4DR5K 4FWRA 3SQ2A 3QEVA 3N4PA 3QERA 1X3NA 3P1GA 4JN4A 3RRHA 3O4WA 3SCXA 4YOWA 4DLEA 4FPAA 2VCPA 2O4GA 3LDQA 3T69A 1NGBA 3LDOA 5KTQA 3TAPA 1W2BM 2A3ZA 5HROA 4JNEA 3OYAA 4O44A 3HPGA 1DT9A 4IG3A 1J5OA 3TSUA 4J8FA 4JI8K 1VQLN 1VQ8N 4LD0A 4DV1K 3P5JA 3T1AA 3HP6A 3DLBA 3TTCA 4DFPA 3P4IA 1WBDA 1YUWA 2AP1A 3THWB 4YDUA 3VGLA 3CERA 1I3AA 3NAEA 5KQ8A 4C8NA 2P9PA 1EQYA 4I7FA 4NCGA 1SZ2A 3ZYYX 4DU3A 5E41A 5AZIB 4DLGA 4FK2A 4AHRA 3TAGA 3BZCA 1UA1A 2YNFA 1RTHA 3LDSA 3LANA 1C1BA 4GY2B 3SUQA 1HYVA 5M1NA 4YOVA 3TU5A 1BOTO 1IG9A 3VQQA 5AFUA 3OTOK 4DG1A 3QO9A 5KQDA 5J2PA 3VQ4A 3ID6A 3E1YA 3OA9A 1WBBA 3UKUB 2QK9A 2HBLA 3V1QA 3OW2M 4DTNA 1QQMA 3K2PA 3VGMA 2FF3B 5ELZA 4KB0A 4OVLA 3RVCA 1KTQA 1C0MA 2G8HA 1KLNA 3CMEN 3D2FB 1T7PA 3QEXA 4JI5K 4ZTJA 2ZGZA 4CZFA 4CF1A 5CHIA 1TKDA 1S22A 1K8KB 1RDCA 4K42A 1JL1A 1KCFA 4BRQA 1NK0A 2Z1JA 4RTFD 2RHKA 3L6QA 1M1KO 4RWTA 1U4BA 2UU9K 2EWSA 3CI5A 5KRSA 1X3MA 4CJVA 4J2BA 3U6FA 3SQ4A 1SV5A 3QDKA 1REVA 3RSEB 2ZE2A 4BRDA 4DKWA 5KGXA 3LWMA 1QSLA 3T3FA 2OPSA 4BRCA 3A2FA 3ZT4A 4NYFA 4FWLA 3RMCA 3PIOL 4B8AB 3KVGA 2O8EB 1N6QA 3OYKA 1OH5A 1ASUA 4DSFA 4O5BA 3D7EO 1XHXA 4DFMA 4KPYA 4FSVA 4M63C 3OYMA 4K25A 3OYIA 2I7NA 3Q7BA 1TK5A 3UKRB 2Y1IA 3VERA 3P38A 2EHGA 4OGCA 1ZBIA 1GLDG 2OYQA 3NH0A 3V9XA 2HHVA 1P8ZA 4OPAA 3FZFA 3ZX2A 4CGIA 4BRAA 5AQNA 4CHOA 2HW3A 1IBLK 1QVGM 4HCCA 3SPZA 1KVCA 4CJLA 2UUCK 1O13A 3H1QA 1IKYA 4JI6K 3SUPA 2HNZA 1BWFO 4W5OA 5K14A 1RDDA 4BY9C 5AQVA 4CFBA 5EU7A 2A40A 2P9UB 3HXMA 1VQ6N 2YCHA 4MFBA 5KGWA 4CZEA 4FOEA 4NLCA 4BRKA 1X9WA 5AJ3K 4M7YA 4PHTX 3EE9A 2QEXN 4CCHA 3VQCA 1HRHA 5CE3A 1D9DA 2P9KA 4WQ4A 1NJZA 3E9OA 3CM6A 3G25A 3R3LA 2BTFA 3VEWA 3AVFA 3CCEN 3VESA 1LCUA 4FJJA 3V1OA 1L3UA 1KXPA 3A5LC 4HVJA 1XMQK 1XC3A 2Z1HA 2P5GA 2F9TA 3O9QA 4DF8A 1WSIA 4FJHA 1S9GA 1Q9XA 1YF5L 4AQYK 3AVGA 4BRIA 4G9ZA 4H0PA 2QW9A 4LF8K 2ASMA 3QNOA 5CR4A 1N32K 5JS2A 2FLOA 4HWIA 4CZHA 2YNGA 4DFKA 5AQTA 3OS2A 4BC4A 4BRPA 4E7LA 2O8DB 5F0XA 1L5UA 3VA3A 3NH2A 3PO4A 3C6UA 2HVHA 1E4GT 4GVEA 2QWPA 3UKUA 1ZBSA 1VSKA 2HVIA 2P9SA 4JHDA 5TKYA 1TAQA 3ULEA 1FK9A 1S6PA 4BC5A 3T1HK 3MN7A 1XHZA 3NGZA 2IC3A 3QFPA 2BE2A 4UQGA 2OA8A 1KFSA 4FZYA 4C8KA 3ENOA 1NKCA 2XO7A 4ELTA 5AQXA 4DSEA 4Z4EA 3D2FA 4E1NA 2YJFA 5AQHA 1HKBA 1S1VA 2BH1A 4B9SA 5EOYA 3TAEA 3KLFA 3KLIA 2NRWA 3HM9A 4FM1A 1SL2A 3RWUA 4X62K 4JEPA 4CEOA 5E84A 3H08A 4K8ZA 4DR3K 1CZBA 1NOYA 3WXJA 2UYTA 4R5PA 4BC3A 4CJWA 1E4FT 1KAZA 3KWGA 5BPMA 2Q1NA 5M1FA 3GBTA 3L3VA 1K9MO 3AVHA 3AVKA 4NO7A 4KTZA 2WBNA 1J54A 4B3RK 1EWQA 2PZSA 3SV3A 4AHSA 2G8UA 1GLLO 3O9TA 3HP9A 4M3TA 1S1WA 1QZ5A 5ADXA 3AGKA 1J53A 2XY7A 4CJQA 3G6EN 2VWJA 2HOEA 3C65A 3LP0A 2YHAA 2IDOA 2ZGYA 3I8BA 1HR0K 3A5OC 2VQFK 4BACA 5GAEP 4GV6A 3HYFA 3UKRA 4EAHD 3EKSA 4FJNA 1NU0A 1S6QA 3VGKA 3QINA 3AVCA 4CIEA 3AVBA 3LM2A 3PUFA 3O4NA 4B8CA 4F3OA 1XMOK 3CF5L 2HHQA 1SKRA 4EFHA 5EY4A 1XC9A 3KD1E 1ZBLA 5GAHP 1Q7YO 5FDLA 2D1KA 3KIOA 3AVNA 1WNSA 3TTFA 3THYB 3T19A 3DMJA 4FLUA 1RTJA 4CGFA 2NNWA 3RR8A 1HJOA 3VQ9A 3CM5A 3NDKA 2GWJA 4MDAA 4KHSA 3SAFA 3RMAA 3ZCMA 4MLHA 4YDUC 4CFDA 3HPOA 1GOCA 3LDPA 4EIAA 5LJWA 1T3VA 3WNHA 1B92A 1QQCA 4IZ9A 1TKXA 4DV5K 4H0XB 2IAJA 4FW1A 3PY8A 1QHTA 1W0HA 3O1WA 3ASMA 1OVQA 3U4LA 4JI3K 1C1AA 5CYQA 3V6DA 3DLEA 3LP3A 4CEEA 4N56A 1HNXK 1P90A 2Q3SA 3HBTA 3U3GA 4DU4A 1YJ9N 4EZ9A 2FC0A 2FSKA 4IFYA 1Z6RA 4FYDA 3WXMB 4CGDA 3NBPA 1Q82O 2Z1IA 4JI4K 1T8EA 4DTOA 2ASPA 5D3GA 1YTUA 4FWPA 5J2NA 4M3RA 1EO1A 3I8DA 3MN6A 1LOTB 2DY4A 4F2RA 3ZETA 1UWBA 3WEEA 4BROA 1WAJA 1NGJA 3K59A 4XH4A 2F8TA 4KREA 1KC8O 2HHHK 2O8DA 3AAQA 3NVMA 5C12A 2PFUA 3SK3A 4AHTA 4IBNA 5M1KA 3PIPL 3S3MA 5BRHA 3QNNA 2H3GX 4W5NA 3VEOA 3I33A 3H45C 1JCGA 3QIOA 2HBKA 4KH6A 5AFUH 4OGEA 4PL8A 3CQYA 4OLBA 4XEIA 3MEGA 4KTQA 1U04A 2HMPA 2ITMA 2NRHA 3L2WA 2E20A 4CEBA 2HHWA 1DKGD 2VYPA 4CEDA 4CJUA 5F2RA 5F1XA 1R59O 4OKEA 3CYMA 4I9LA 2A42A 1HJRA 1TGOA 1U48A 4CFAA 3HK2A 4JS5A 1GLBG 5C24A 5BN8A 1VSMA 4YORA 4OO1J 3WQUA 4AF1A 1RT6A 2OCEA 1YIJN 4CHQA 5SZTA 4ELUA 3K9KA 3P39A 3NHGA 3K5LA 3VTIA 1KAYA 2YHYA 1BO5O 3I56N 2UXDK 3SMPA 1VQPN 4B1UB 3K58A 4B3MK 3L2QA 1NK4A 3M8PA 3CCSN 1WN7A 3VETA 4IO8A 4YNQA 3M5RA 4YFUA 4DR7K 3OYLA 3NF6A 2YHBA 3O4QA 4QS9A 3LZJA 1SKWA 3DRRA 1U2VA 5HRSA 5M1QA 4RG8A 4LY7A 3MX5A 4FOIA 3T1YK 3VEYA 2QWRA 3KZBA 4Y1DA 4CF2A 3WQTA 4NYNA 4KKOA 3EYZA 4WFBL 4A2BA 4BRNA 1D4XA 2VWKA 1JLGA 4CF9A 1NGGA 1VSHA 2RPIA 1RILA 1N8RO 1IG8A 3O9UA 1ZBFA 1SAZA 3ZSQA 5GIPA 3S3NA 1UOCA 3OJUA 5DK5A 2Q36A 1IV0A 1IH7A 2PY5A 4LF6K 2O8FA 4DMNA 4WQ4C 4DTJA 4JK9A 4CBUA 4JI0K 1NK7A 4L3QA 3M8RA 5FLXO 4IXCA 1TUUA 4Y1CA 4FJLA 3PSFA 1OH8A 3G0ZA 2UXBK 5KPRA 3KLHA 4DSIA 1WSGA 4LFBK 2G8FA 2E6MA 4JYAK 5EVZA 3R1XA 1SL1A 4N41A 3OYDA 1ZXOA 3CJ1A 3LDLA 3DXKA 1BIUA 1QSYA 1S5JA 2UUBK 1TK8A 3VTHA 3OBWA 3TI0A 1LWFA 2Z1GA 4OKJA 4GMJB 4DS4A 3RMDA 2NZTA 1JLFA 4B3OA 3OBYA 3IAYA 4UY8O 3SAGA 3QEWA 3C6TA 5FRNA 3THXA 4M42A 4B1YB 2P9KB 2QTDA 3I0RA 4DTUA 2IVNA 1J6ZA 1VSEA 4CJ7A 4I2PA 4H5VA 4GV9A 2QXFA 1ILYA 1MU2A 3LP1A 4KHWA 1BQNA 1BI4A 1FKOA 3HSTB 2KFZA 5BPLA 4IDHA 1U47A 2P1JA 5LY3A 4W5TA 1WSJA 1NM1A 4JKEA 5KRTA 3CFRA 2E5LK 4CIGA 4FLWA 4I6MA 3H3NO 3MN9A
chains in the Genus database with same CATH topology
1NJZA 4C8LA 3DM2A 3QEPA 3OYNA 1RBTA 1TAUA 3CM6A 1VSDA 4KB1A 1JLAA 3MXMA 2NUBA 3K5OA 3AVFA 5HRNA 1S1TA 2G8VA 4AHCA 3V9UA 4BE0A 4FJJA 4CHZA 1QTMA 4F3TA 3V1OA 3ITHA 1L3UA 3SYZA 4HVJA 2OPRA 3EY1A 2Z1HA 2P5GA 1ASWA 3OYFA 4FJXA 4CJFA 4DF8A 2HHTA 1WSIA 1LWEA 1Y97A 1S9GA 4CK1A 4FJHA 5HLFA 2OZMA 4M41A 1T05A 1I39A 1Q9XA 1TL3A 3D45A 2FBXA 2G8KA 1X1PA 3OYCA 1BCOA 3AVGA 3CFPA 4GW6A 4FZZA 3VQEA 4DS5A 1UAXA 3JYTA 4AHUA 4FJIA 3C94A 1S1XA 1HQEA 3AO2A 1BCMA 1DTTA 2B6AA 1NK8A 3KD5E 3QNOA 4N47A 1BIZA 5JS2A 4Q0BA 3S9HA 4M3WA 3VQ8A 2YNGA 3KLEA 4JRQA 3AVAA 4CJRA 1B9DA 2VG6A 4ICLA 1LAVA 4BWJA 4XIUA 3OS2A 4DFJA 4E7LA 4KHUA 2ATQA 1ZYQA 1L5UA 4B9MA 2RF2A 3OYEA 1VSIA 3NH2A 3VA3A 3OJSA 1C0TA 3PO4A 3C6UA 3HL8A 3B6OA 2I5JA 4MQ3A 4DWIA 1WSHA 2HVHA 3VQ5A 2RKIA 3TWHA 3I0SA 5I42A 3QIPA 4Q5VA 2OPPA 4J2DA 1VSKA 3AO3A 4BE2A 3TANA 3MXIA 2HVIA 2RN2A 5FRMA 4FM0A 4RW6A 4BE1A 1TAQA 4GVMA 4FM2A 4DQPA 4ID5A 1C1CA 1ZBUA 1FK9A 1S6PA 4E7IA 1XHZA 3DOKA 3NGZA 1NJXA 2IC3A 4UQGA 2BE2A 2D0BA 4FLXA 2O4IA 2DFFA 2OA8A 1KFSA 3HVTA 1JKHA 1WSEA 3TAQA 3K5NA 1KFDA 4FZYA 3ZT2A 4C8KA 4C8OA 3F73A 1RTDA 3RR7A 4DQSA 2XO7A 1NKCA 4ELTA 4KFBA 2LSNA 4DU1A 4DSEA 4Z4EA 2XY5A 1ITGA 3HVRA 4E1NA 4FJ7A 2E4LA 1HNVA 3ALYA 1EP4A 1HMVA 1RT5A 3NGYA 1S1VA 4HHTA 2FBVA 2QKBA 4BDPA 1WAFA 4B9SA 1NK6A 1JL2A 3AVLA 1CXUA 4CF8A 3TAEA 3KLFA 3KLIA 4O4GA 3WNEA 4FM1A 3HM9A 1SL2A 3RWUA 4CESA 4F8RA 3SV4A 5DMRA 4DTRA 2HNDA 1J9AA 4DF4A 2FBYA 4CEOA 2Y1JA 3H08A 3MEEA 3TR8A 4HTUA 4K8ZA 4AILC 3SZ2A 3NE6A 2HHUA 1TKTA 4Z0UA 1CZBA 3OS0A 1NOYA 3PO5A 1SL0A 4IFVA 1JLBA 4R5PA 2DTUA 4CJWA 4EZ6A 2KZZA 4CFCA 4E7HA 3DRSA 4N5SA 3VN5A 3L3VA 1EXQA 4CJSA 3AVHA 4PQUA 2FBTA 3AVKA 3DYAA 4KTZA 3M8SA 3L8BA 4FLYA 3SNNA 2KFNA 1J54A 4OKKA 3HJFA 2PZSA 4F4KA 4FJGA 1RBRA 3SV3A 4AHSA 2F8SA 3IG1A 4ID1A 4HCBA 3U3YA 3TAFA 3NFAA 2G8UA 3TAMA 3RRGA 2D5RA 4TSXA 3ISNC 2JGUA 3HP9A 4CEQA 4M3TA 3ZSYA 3RTVA 4OJRA 1S1WA 2IGIA 3KKSA 4AHVA 4RW7A 2YV0X 1CLQA 4FLVA 4ZTFA 1U45A 3PX0A 2XY7A 1J53A 1YTAA 4FW2A 4CJQA 3VQ7A 2VWJA 1TV6A 2JLEA 3LP0A 2YHAA 3VA0A 4BWMA 2IDOA 4KI4A 4F2SA 1BISA 4BACA 4ELVA 1QSSA 3VQDA 1JLCA 3HYFA 5J2MA 4FJNA 4DQRA 4FK4A 1L3TA 2X6NA 1S6QA 2R7YA 1ASVA 3LPUA 5HRPA 4FZXC 1CZ9A 3QINA 3AVCA 3V1RA 4DQIA 2EX3A 4CIEA 3AVBA 1D8YA 3PUFA 5CY4A 3LZIA 2ITGA 1JLQA 3O4NA 4B8CA 4F3OA 4Z4IA 2A1RA 3K5MA 2HHQA 3ZSWA 3DLRA 1S9EA 4M45A 1SKRA 4FJMA 2XY8A 1X9MA 1NK9A 3ZSRA 1QS4A 1G15A 1XC9A 1ZBLA 3KD1E 3L3UA 2GBZA 5FDLA 4M3ZA 4I9QA 3KIOA 3KLGA 3AVNA 1WNSA 1W9HA 4B9LA 3T19A 1HPZA 3O3HA 4CHNA 1LV5A 3DMJA 3C95A 4FLUA 1RTJA 4CGFA 2BDPA 4B9VA 3RR8A 2HHXA 4OLAA 3VQ9A 3QEIA 3CM5A 3CQ8A 2GV9A 3NDKA 5HBMA 1LWCA 3F9KA 5HP1A 4KHSA 2HMIA 4B9NA 3RMAA 3ZCMA 4CK3A 3L2UA 4CFDA 3L2VA 3IS9A 1RCHA 3E01A 2DFEA 4FLZA 5CYMA 3AA3A 3HPOA 1GOCA 5T7BA 4CHYA 1D5AA 1NKBA 1LW0A 4KHYA 3HO1A 1RDAA 2HB5A 4CJPA 3V9WA 4E7JA 4E0DA 3IRXA 4DSJA 3WNHA 3P83D 4RW9A 2OZSA 1VSJA 1B92A 2OPQA 1QQCA 1X9SA 1WLJA 1WSFA 3THVA 2PYLA 1VSFA 1TKXA 4N76A 5CZ2A 4H8KA 4JRPA 2IAJA 4FW1A 2D0CA 3M8QA 3PY8A 1QHTA 1W0HA 1F21A 4LSLA 4M3UA 3ASMA 1U49A 4CF0A 2KTQA 1C0UA 1C1AA 5CYQA 4EP4A 3V6DA 4E1MA 3O3GA 2BGGA 4B9UA 3DLEA 3LP3A 4CEEA 4N56A 2D0AA 4CJ3A 3SJJA 3LAMA 1GOAA 3S3OA 2Q3SA 1A5WA 3U3GA 4DU4A 1A5XA 1VRUA 2X6SA 4KAZA 4DTXA 5C25A 4EZ9A 2FC0A 3CG7A 3DLHA 3DLGA 4K8XA 4IFYA 3DI6A 4FYDA 1KVBA 4CGDA 2YKMA 3NBPA 2Z1IA 1T8EA 3MECA 3NF9A 4DTOA 4DSLA 4B9TA 5D3GA 3NF8A 4O0JA 1YTUA 1LAWA 2IS3A 4M3RA 5J2NA 3NGIA 4LH4A 3I8DA 1A5VA 2ZQBA 2YKNA 2DY4A 3MEDA 4FCYA 4F2RA 5HRRA 4DTSA 1KSPA 4H4MA 4CIFA 1UWBA 2P5OA 1WAJA 4KV8A 3AO1A 4QAGA 3K59A 3TARA 3KKRA 2XHBA 1GOBA 4FK0A 4O0IA 2F8TA 4KREA 3AVJA 4DTPA 3AO4A 4G1QA 4B08A 4CERA 4FVMA 1LW2A 4AHTA 1VK0A 4IBNA 4L8RB 3NH1A 3S3MA 3QNNA 4W5NA 3JSMA 4I2QA 4IDKA 4CJEA 1Q9YA 3MAQA 4KHQA 3QIOA 2HHSA 1BGXT 1RT3A 4OPJA 4PWDA 1NJWA 3UIQA 2GUIA 1JLEA 2XRIA 4OGEA 3VQAA 4KO0A 3SQ2A 3QEVA 3OY9A 3QERA 4OLBA 4EP5A 4FXDA 4CEZA 4DSKA 3MEGA 3P1GA 4KTQA 1U04A 3RRHA 3L2WA 3SCXA 3OVNA 1BL3A 4CE9A 4CJ5A 4DLEA 1ZBHA 4CEBA 2HHWA 2O4GA 3ZSVA 1EETA 4CEDA 1C6VA 4CJ4A 4CJUA 5KTQA 3TAPA 2G8WA 3DRPA 4Z4FA 5HROA 2VG7A 3OYAA 4O44A 3HPGA 5KI6A 1SKSA 4OKEA 2F96A 3CYMA 4IG3A 1J5OA 4I9LA 2VG5A 4KI6A 1HJRA 2B4JA 1RBUA 1DLOA 4LD0A 1QE1A 1TGOA 3CFOA 3B6PA 3P5JA 3T1AA 3HP6A 1U48A 4CFAA 4E3SA 3SUNA 3DLBA 4JS5A 3HK2A 3V9ZA 2A1SA 4DFPA 1NJYA 1D9FA 1RBSA 1VSLA 1SUQA 4DTMA 3SPYA 4CEFA 3QESA 3SQ1A 4CJKA 1T03A 5C24A 1VSMA 4HUEA 1UA0A 1TKZA 1RT6A 1I3AA 3G10A 4CHQA 5SZTA 4C8NA 3NAEA 4I7FA 1R0AA 4ELUA 4NCGA 1TK0A 4M3YA 3NHGA 3AA2A 3K5LA 1EX4A 4DU3A 1BQMA 3VQBA 2W42A 2ETJA 5E41A 4IG0A 3OS1A 1BHLA 1EKEA 3K58A 4AHRA 4DLGA 4RW8A 3TAGA 4FK2A 4IKFA 1UA1A 4DFKA 1IKWA 2YNFA 3L2QA 1RTHA 2X74A 4Z4HA 3OYBA 3M8PA 4CGJA 3LDSA 1NK4A 1N5YA 1FKPA 1C1BA 1WN7A 3LANA 4PA1A 4LH5A 1HYVA 4YNQA 3O3FA 3SUQA 4FJKA 2PYJA 5JS1A 2G8IA 4YFUA 4J2EA 3KJVA 3OYLA 3NF6A 1RBVA 3SI6A 2YHBA 3O4QA 1IG9A 4NCBA 4JLHA 1RT2A 1RT7A 3LZJA 5C42A 3VQQA 1SKWA 3DRRA 4RW4A 5HRSA 4RG8A 3DOLA 5J1EA 4LY7A 3QO9A 4DG1A 5J2PA 3VQ4A 5J2QA 4ZHRA 2QK9A 4Y1DA 4CF2A 2KQ2A 4NYNA 3V1QA 4KKOA 3BDPA 1HQUA 4CJTA 3EYZA 3KTQA 1YT3A 2B5JA 4DTNA 3QLHA 1RDBA 2VWKA 1JLGA 4CF9A 3D0PA 4Z4GA 1JXEA 1Z25A 3RMBA 1VSHA 1O1WA 2RPIA 3K2PA 1RILA 1XI1A 2WONA 4C8MA 1HYSA 3V9SA 4KB0A 4OVLA 3OYJA 1ZBFA 2IOCA 3ZSQA 1KTQA 4JS4A 4LSNA 3S3NA 3WNGA 1RNHA 1UOCA 4KHNA 1C0MA 1IKXA 4KTWA 3OJUA 2G8HA 4W5QA 5DK5A 3QETA 1KLNA 1IH7A 1KVAA 3TABA 2PY5A 3L2RA 3DLKA 4CEAA 2XY6A 1T7PA 3QEXA 4DMNA 5CZ1A 4ZTJA 4DTJA 1YVUA 3ZT0A 1NK7A 1DTQA 4CF1A 1B9FA 3HPHA 1TKDA 3M8RA 4BDYA 4PY5A 1KRPA 1RDCA 5SWMA 1JL1A 1KCFA 3PX6A 1NK0A 1RT1A 3PV8A 4Z4CA 2QKKA 2Z1JA 4Y1CA 3V81A 2ZD1A 4FJLA 4FJ9A 3G0ZA 4E19A 1U4BA 3KLHA 4DSIA 4FJ5A 1WSGA 3V4IA 5KRSA 1XWLA 2G8FA 4CJVA 2E6MA 3ZT3A 4CHPA 4CGGA 4J2BA 3U6FA 3NCIA 4AH9A 3SQ4A 1SV5A 1REVA 3BGRA 4WE1A 1SL1A 4N41A 3OYDA 1QSLA 2ZE2A 1NK5A 5KGXA 1BI4B 3LWMA 2X78A 3FFIA 3T3FA 1IKVA 2OPSA 3A2FA 3ZT4A 4DQQA 4NYFA 1BIUA 1QSYA 1L3VA 1S5JA 3RMCA 4B8AB 1TK8A 1N6QA 3LP2A 4HUGA 3OYKA 3AV9A 1VRTA 3ZT1A 1ASUA 3NF7A 4DSFA 3TI0A 1S1UA 1LWFA 4O5BA 2Z1GA 4OKJA 4GMJB 3K57A 4DS4A 3SUOA 1XHXA 4DFMA 3RMDA 4KPYA 1JLFA 4FJ8A 4B3OA 2HNYA 2KW4A 1L3SA 1FXXA 3IAYA 1RT4A 4CGHA 3AO5A 3C6TA 3OYMA 3QEWA 4M3XA 5FRNA 4QOZB 3LAKA 3KK1A 3OYIA 1NKEA 4M42A 3VQ6A 3AVIA 4W5RA 3EZ5A 1TK5A 2Y1IA 3PX4A 1NOZA 3OYHA 2EHGA 3I0RA 1Q8IA 4OGCA 3ZSZA 2YNIA 1VSEA 1Z26A 3VQPA 4DTUA 4I2PA 3SQ0A 1ZBIA 2OYQA 3NH0A 2QXFA 3V9XA 2HHVA 2WOMA 3HT3A 3ZSOA 3ULDA 2AJQA 1MU2A 4CGIA 3OYGA 1TL1A 4CECA 3AA4A 3LALA 4H4OA 3LP1A 4KHWA 4CHOA 3KK2A 1BQNA 1HNIA 1TVRA 1BI4A 2YNHA 2HW3A 4O55A 4HCCA 3SPZA 4J2AA 1KVCA 1FKOA 3HSTB 4CJLA 3MXJA 2KFZA 5FROA 1CXQA 5I3UA 1U47A 3LWLA 4QCLA 1IKYA 1RTIA 2P1JA 4HUFA 3SUPA 2HNZA 4PUOA 4W5OA 2DFHA 4W5TA 5K14A 4FLTA 1IO2A 1RDDA 4OPKA 2E6LA 1WSJA 2BANA 3KK3A 4CFBA 5EU7A 3HXMA 4MFBA 5KGWA 2KZMA 1KLMA 3WNFA 1X9WA 4NCAA 1JXBA 2P51A 3AVMA 5KRTA 3LPTA 4BDZA 4E89A 1HYZA 1K6YA 3CFRA 4CIGA 3VQCA 4CCHA 4FLWA 3ZSXA 1HRHA 3AA5X 1D9DA 4CK2A 4E7KA 4KRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJZ A;  4C8L A;  3DM2 A;  3QEP A;  3OYN A;  1RBT A;  1TAU A;  3CM6 A;  1VSD A;  4KB1 A;  1JLA A;  3MXM A;  2NUB A;  3K5O A;  3AVF A;  5HRN A;  1S1T A;  2G8V A;  4AHC A;  3V9U A;  4BE0 A;  4FJJ A;  4CHZ A;  1QTM A;  4F3T A;  3V1O A;  3ITH A;  1L3U A;  3SYZ A;  4HVJ A;  2OPR A;  3EY1 A;  2Z1H A;  2P5G A;  1ASW A;  3OYF A;  4FJX A;  4CJF A;  4DF8 A;  2HHT A;  1WSI A;  1LWE A;  1Y97 A;  1S9G A;  4CK1 A;  4FJH A;  5HLF A;  2OZM A;  4M41 A;  1T05 A;  1I39 A;  1Q9X A;  1TL3 A;  3D45 A;  2FBX A;  2G8K A;  1X1P A;  3OYC A;  1BCO A;  3AVG A;  3CFP A;  4GW6 A;  4FZZ A;  3VQE A;  4DS5 A;  1UAX A;  3JYT A;  4AHU A;  4FJI A;  3C94 A;  1S1X A;  1HQE A;  3AO2 A;  1BCM A;  1DTT A;  2B6A A;  1NK8 A;  3KD5 E;  3QNO A;  4N47 A;  1BIZ A;  5JS2 A;  4Q0B A;  3S9H A;  4M3W A;  3VQ8 A;  2YNG A;  3KLE A;  4JRQ A;  3AVA A;  4CJR A;  1B9D A;  2VG6 A;  4ICL A;  1LAV A;  4BWJ A;  4XIU A;  3OS2 A;  4DFJ A;  4E7L A;  4KHU A;  2ATQ A;  1ZYQ A;  1L5U A;  4B9M A;  2RF2 A;  3OYE A;  1VSI A;  3NH2 A;  3VA3 A;  3OJS A;  1C0T A;  3PO4 A;  3C6U A;  3HL8 A;  3B6O A;  2I5J A;  4MQ3 A;  4DWI A;  1WSH A;  2HVH A;  3VQ5 A;  2RKI A;  3TWH A;  3I0S A;  5I42 A;  3QIP A;  4Q5V A;  2OPP A;  4J2D A;  1VSK A;  3AO3 A;  4BE2 A;  3TAN A;  3MXI A;  2HVI A;  2RN2 A;  5FRM A;  4FM0 A;  4RW6 A;  4BE1 A;  1TAQ A;  4GVM A;  4FM2 A;  4DQP A;  4ID5 A;  1C1C A;  1ZBU A;  1FK9 A;  1S6P A;  4E7I A;  1XHZ A;  3DOK A;  3NGZ A;  1NJX A;  2IC3 A;  4UQG A;  2BE2 A;  2D0B A;  4FLX A;  2O4I A;  2DFF A;  2OA8 A;  1KFS A;  3HVT A;  1JKH A;  1WSE A;  3TAQ A;  3K5N A;  1KFD A;  4FZY A;  3ZT2 A;  4C8K A;  4C8O A;  3F73 A;  1RTD A;  3RR7 A;  4DQS A;  2XO7 A;  1NKC A;  4ELT A;  4KFB A;  2LSN A;  4DU1 A;  4DSE A;  4Z4E A;  2XY5 A;  1ITG A;  3HVR A;  4E1N A;  4FJ7 A;  2E4L A;  1HNV A;  3ALY A;  1EP4 A;  1HMV A;  1RT5 A;  3NGY A;  1S1V A;  4HHT A;  2FBV A;  2QKB A;  4BDP A;  1WAF A;  4B9S A;  1NK6 A;  1JL2 A;  3AVL A;  1CXU A;  4CF8 A;  3TAE A;  3KLF A;  3KLI A;  4O4G A;  3WNE A;  4FM1 A;  3HM9 A;  1SL2 A;  3RWU A;  4CES A;  4F8R A;  3SV4 A;  5DMR A;  4DTR A;  2HND A;  1J9A A;  4DF4 A;  2FBY A;  4CEO A;  2Y1J A;  3H08 A;  3MEE A;  3TR8 A;  4HTU A;  4K8Z A;  4AIL C;  3SZ2 A;  3NE6 A;  2HHU A;  1TKT A;  4Z0U A;  1CZB A;  3OS0 A;  1NOY A;  3PO5 A;  1SL0 A;  4IFV A;  1JLB A;  4R5P A;  2DTU A;  4CJW A;  4EZ6 A;  2KZZ A;  4CFC A;  4E7H A;  3DRS A;  4N5S A;  3VN5 A;  3L3V A;  1EXQ A;  4CJS A;  3AVH A;  4PQU A;  2FBT A;  3AVK A;  3DYA A;  4KTZ A;  3M8S A;  3L8B A;  4FLY A;  3SNN A;  2KFN A;  1J54 A;  4OKK A;  3HJF A;  2PZS A;  4F4K A;  4FJG A;  1RBR A;  3SV3 A;  4AHS A;  2F8S A;  3IG1 A;  4ID1 A;  4HCB A;  3U3Y A;  3TAF A;  3NFA A;  2G8U A;  3TAM A;  3RRG A;  2D5R A;  4TSX A;  3ISN C;  2JGU A;  3HP9 A;  4CEQ A;  4M3T A;  3ZSY A;  3RTV A;  4OJR A;  1S1W A;  2IGI A;  3KKS A;  4AHV A;  4RW7 A;  2YV0 X;  1CLQ A;  4FLV A;  4ZTF A;  1U45 A;  3PX0 A;  2XY7 A;  1J53 A;  1YTA A;  4FW2 A;  4CJQ A;  3VQ7 A;  2VWJ A;  1TV6 A;  2JLE A;  3LP0 A;  2YHA A;  3VA0 A;  4BWM A;  2IDO A;  4KI4 A;  4F2S A;  1BIS A;  4BAC A;  4ELV A;  1QSS A;  3VQD A;  1JLC A;  3HYF A;  5J2M A;  4FJN A;  4DQR A;  4FK4 A;  1L3T A;  2X6N A;  1S6Q A;  2R7Y A;  1ASV A;  3LPU A;  5HRP A;  4FZX C;  1CZ9 A;  3QIN A;  3AVC A;  3V1R A;  4DQI A;  2EX3 A;  4CIE A;  3AVB A;  1D8Y A;  3PUF A;  5CY4 A;  3LZI A;  2ITG A;  1JLQ A;  3O4N A;  4B8C A;  4F3O A;  4Z4I A;  2A1R A;  3K5M A;  2HHQ A;  3ZSW A;  3DLR A;  1S9E A;  4M45 A;  1SKR A;  4FJM A;  2XY8 A;  1X9M A;  1NK9 A;  3ZSR A;  1QS4 A;  1G15 A;  1XC9 A;  1ZBL A;  3KD1 E;  3L3U A;  2GBZ A;  5FDL A;  4M3Z A;  4I9Q A;  3KIO A;  3KLG A;  3AVN A;  1WNS A;  1W9H A;  4B9L A;  3T19 A;  1HPZ A;  3O3H A;  4CHN A;  1LV5 A;  3DMJ A;  3C95 A;  4FLU A;  1RTJ A;  4CGF A;  2BDP A;  4B9V A;  3RR8 A;  2HHX A;  4OLA A;  3VQ9 A;  3QEI A;  3CM5 A;  3CQ8 A;  2GV9 A;  3NDK A;  5HBM A;  1LWC A;  3F9K A;  5HP1 A;  4KHS A;  2HMI A;  4B9N A;  3RMA A;  3ZCM A;  4CK3 A;  3L2U A;  4CFD A;  3L2V A;  3IS9 A;  1RCH A;  3E01 A;  2DFE A;  4FLZ A;  5CYM A;  3AA3 A;  3HPO A;  1GOC A;  5T7B A;  4CHY A;  1D5A A;  1NKB A;  1LW0 A;  4KHY A;  3HO1 A;  1RDA A;  2HB5 A;  4CJP A;  3V9W A;  4E7J A;  4E0D A;  3IRX A;  4DSJ A;  3WNH A;  3P83 D;  4RW9 A;  2OZS A;  1VSJ A;  1B92 A;  2OPQ A;  1QQC A;  1X9S A;  1WLJ A;  1WSF A;  3THV A;  2PYL A;  1VSF A;  1TKX A;  4N76 A;  5CZ2 A;  4H8K A;  4JRP A;  2IAJ A;  4FW1 A;  2D0C A;  3M8Q A;  3PY8 A;  1QHT A;  1W0H A;  1F21 A;  4LSL A;  4M3U A;  3ASM A;  1U49 A;  4CF0 A;  2KTQ A;  1C0U A;  1C1A A;  5CYQ A;  4EP4 A;  3V6D A;  4E1M A;  3O3G A;  2BGG A;  4B9U A;  3DLE A;  3LP3 A;  4CEE A;  4N56 A;  2D0A A;  4CJ3 A;  3SJJ A;  3LAM A;  1GOA A;  3S3O A;  2Q3S A;  1A5W A;  3U3G A;  4DU4 A;  1A5X A;  1VRU A;  2X6S A;  4KAZ A;  4DTX A;  5C25 A;  4EZ9 A;  2FC0 A;  3CG7 A;  3DLH A;  3DLG A;  4K8X A;  4IFY A;  3DI6 A;  4FYD A;  1KVB A;  4CGD A;  2YKM A;  3NBP A;  2Z1I A;  1T8E A;  3MEC A;  3NF9 A;  4DTO A;  4DSL A;  4B9T A;  5D3G A;  3NF8 A;  4O0J A;  1YTU A;  1LAW A;  2IS3 A;  4M3R A;  5J2N A;  3NGI A;  4LH4 A;  3I8D A;  1A5V A;  2ZQB A;  2YKN A;  2DY4 A;  3MED A;  4FCY A;  4F2R A;  5HRR A;  4DTS A;  1KSP A;  4H4M A;  4CIF A;  1UWB A;  2P5O A;  1WAJ A;  4KV8 A;  3AO1 A;  4QAG A;  3K59 A;  3TAR A;  3KKR A;  2XHB A;  1GOB A;  4FK0 A;  4O0I A;  2F8T A;  4KRE A;  3AVJ A;  4DTP A;  3AO4 A;  4G1Q A;  4B08 A;  4CER A;  4FVM A;  1LW2 A;  4AHT A;  1VK0 A;  4IBN A;  4L8R B;  3NH1 A;  3S3M A;  3QNN A;  4W5N A;  3JSM A;  4I2Q A;  4IDK A;  4CJE A;  1Q9Y A;  3MAQ A;  4KHQ A;  3QIO A;  2HHS A;  1BGX T;  1RT3 A;  4OPJ A;  4PWD A;  1NJW A;  3UIQ A;  2GUI A;  1JLE A;  2XRI A;  4OGE A;  3VQA A;  4KO0 A;  3SQ2 A;  3QEV A;  3OY9 A;  3QER A;  4OLB A;  4EP5 A;  4FXD A;  4CEZ A;  4DSK A;  3MEG A;  3P1G A;  4KTQ A;  1U04 A;  3RRH A;  3L2W A;  3SCX A;  3OVN A;  1BL3 A;  4CE9 A;  4CJ5 A;  4DLE A;  1ZBH A;  4CEB A;  2HHW A;  2O4G A;  3ZSV A;  1EET A;  4CED A;  1C6V A;  4CJ4 A;  4CJU A;  5KTQ A;  3TAP A;  2G8W A;  3DRP A;  4Z4F A;  5HRO A;  2VG7 A;  3OYA A;  4O44 A;  3HPG A;  5KI6 A;  1SKS A;  4OKE A;  2F96 A;  3CYM A;  4IG3 A;  1J5O A;  4I9L A;  2VG5 A;  4KI6 A;  1HJR A;  2B4J A;  1RBU A;  1DLO A;  4LD0 A;  1QE1 A;  1TGO A;  3CFO A;  3B6P A;  3P5J A;  3T1A A;  3HP6 A;  1U48 A;  4CFA A;  4E3S A;  3SUN A;  3DLB A;  4JS5 A;  3HK2 A;  3V9Z A;  2A1S A;  4DFP A;  1NJY A;  1D9F A;  1RBS A;  1VSL A;  1SUQ A;  4DTM A;  3SPY A;  4CEF A;  3QES A;  3SQ1 A;  4CJK A;  1T03 A;  5C24 A;  1VSM A;  4HUE A;  1UA0 A;  1TKZ A;  1RT6 A;  1I3A A;  3G10 A;  4CHQ A;  5SZT A;  4C8N A;  3NAE A;  4I7F A;  1R0A A;  4ELU A;  4NCG A;  1TK0 A;  4M3Y A;  3NHG A;  3AA2 A;  3K5L A;  1EX4 A;  4DU3 A;  1BQM A;  3VQB A;  2W42 A;  2ETJ A;  5E41 A;  4IG0 A;  3OS1 A;  1BHL A;  1EKE A;  3K58 A;  4AHR A;  4DLG A;  4RW8 A;  3TAG A;  4FK2 A;  4IKF A;  1UA1 A;  4DFK A;  1IKW A;  2YNF A;  3L2Q A;  1RTH A;  2X74 A;  4Z4H A;  3OYB A;  3M8P A;  4CGJ A;  3LDS A;  1NK4 A;  1N5Y A;  1FKP A;  1C1B A;  1WN7 A;  3LAN A;  4PA1 A;  4LH5 A;  1HYV A;  4YNQ A;  3O3F A;  3SUQ A;  4FJK A;  2PYJ A;  5JS1 A;  2G8I A;  4YFU A;  4J2E A;  3KJV A;  3OYL A;  3NF6 A;  1RBV A;  3SI6 A;  2YHB A;  3O4Q A;  1IG9 A;  4NCB A;  4JLH A;  1RT2 A;  1RT7 A;  3LZJ A;  5C42 A;  3VQQ A;  1SKW A;  3DRR A;  4RW4 A;  5HRS A;  4RG8 A;  3DOL A;  5J1E A;  4LY7 A;  3QO9 A;  4DG1 A;  5J2P A;  3VQ4 A;  5J2Q A;  4ZHR A;  2QK9 A;  4Y1D A;  4CF2 A;  2KQ2 A;  4NYN A;  3V1Q A;  4KKO A;  3BDP A;  1HQU A;  4CJT A;  3EYZ A;  3KTQ A;  1YT3 A;  2B5J A;  4DTN A;  3QLH A;  1RDB A;  2VWK A;  1JLG A;  4CF9 A;  3D0P A;  4Z4G A;  1JXE A;  1Z25 A;  3RMB A;  1VSH A;  1O1W A;  2RPI A;  3K2P A;  1RIL A;  1XI1 A;  2WON A;  4C8M A;  1HYS A;  3V9S A;  4KB0 A;  4OVL A;  3OYJ A;  1ZBF A;  2IOC A;  3ZSQ A;  1KTQ A;  4JS4 A;  4LSN A;  3S3N A;  3WNG A;  1RNH A;  1UOC A;  4KHN A;  1C0M A;  1IKX A;  4KTW A;  3OJU A;  2G8H A;  4W5Q A;  5DK5 A;  3QET A;  1KLN A;  1IH7 A;  1KVA A;  3TAB A;  2PY5 A;  3L2R A;  3DLK A;  4CEA A;  2XY6 A;  1T7P A;  3QEX A;  4DMN A;  5CZ1 A;  4ZTJ A;  4DTJ A;  1YVU A;  3ZT0 A;  1NK7 A;  1DTQ A;  4CF1 A;  1B9F A;  3HPH A;  1TKD A;  3M8R A;  4BDY A;  4PY5 A;  1KRP A;  1RDC A;  5SWM A;  1JL1 A;  1KCF A;  3PX6 A;  1NK0 A;  1RT1 A;  3PV8 A;  4Z4C A;  2QKK A;  2Z1J A;  4Y1C A;  3V81 A;  2ZD1 A;  4FJL A;  4FJ9 A;  3G0Z A;  4E19 A;  1U4B A;  3KLH A;  4DSI A;  4FJ5 A;  1WSG A;  3V4I A;  5KRS A;  1XWL A;  2G8F A;  4CJV A;  2E6M A;  3ZT3 A;  4CHP A;  4CGG A;  4J2B A;  3U6F A;  3NCI A;  4AH9 A;  3SQ4 A;  1SV5 A;  1REV A;  3BGR A;  4WE1 A;  1SL1 A;  4N41 A;  3OYD A;  1QSL A;  2ZE2 A;  1NK5 A;  5KGX A;  1BI4 B;  3LWM A;  2X78 A;  3FFI A;  3T3F A;  1IKV A;  2OPS A;  3A2F A;  3ZT4 A;  4DQQ A;  4NYF A;  1BIU A;  1QSY A;  1L3V A;  1S5J A;  3RMC A;  4B8A B;  1TK8 A;  1N6Q A;  3LP2 A;  4HUG A;  3OYK A;  3AV9 A;  1VRT A;  3ZT1 A;  1ASU A;  3NF7 A;  4DSF A;  3TI0 A;  1S1U A;  1LWF A;  4O5B A;  2Z1G A;  4OKJ A;  4GMJ B;  3K57 A;  4DS4 A;  3SUO A;  1XHX A;  4DFM A;  3RMD A;  4KPY A;  1JLF A;  4FJ8 A;  4B3O A;  2HNY A;  2KW4 A;  1L3S A;  1FXX A;  3IAY A;  1RT4 A;  4CGH A;  3AO5 A;  3C6T A;  3OYM A;  3QEW A;  4M3X A;  5FRN A;  4QOZ B;  3LAK A;  3KK1 A;  3OYI A;  1NKE A;  4M42 A;  3VQ6 A;  3AVI A;  4W5R A;  3EZ5 A;  1TK5 A;  2Y1I A;  3PX4 A;  1NOZ A;  3OYH A;  2EHG A;  3I0R A;  1Q8I A;  4OGC A;  3ZSZ A;  2YNI A;  1VSE A;  1Z26 A;  3VQP A;  4DTU A;  4I2P A;  3SQ0 A;  1ZBI A;  2OYQ A;  3NH0 A;  2QXF A;  3V9X A;  2HHV A;  2WOM A;  3HT3 A;  3ZSO A;  3ULD A;  2AJQ A;  1MU2 A;  4CGI A;  3OYG A;  1TL1 A;  4CEC A;  3AA4 A;  3LAL A;  4H4O A;  3LP1 A;  4KHW A;  4CHO A;  3KK2 A;  1BQN A;  1HNI A;  1TVR A;  1BI4 A;  2YNH A;  2HW3 A;  4O55 A;  4HCC A;  3SPZ A;  4J2A A;  1KVC A;  1FKO A;  3HST B;  4CJL A;  3MXJ A;  2KFZ A;  5FRO A;  1CXQ A;  5I3U A;  1U47 A;  3LWL A;  4QCL A;  1IKY A;  1RTI A;  2P1J A;  4HUF A;  3SUP A;  2HNZ A;  4PUO A;  4W5O A;  2DFH A;  4W5T A;  5K14 A;  4FLT A;  1IO2 A;  1RDD A;  4OPK A;  2E6L A;  1WSJ A;  2BAN A;  3KK3 A;  4CFB A;  5EU7 A;  3HXM A;  4MFB A;  5KGW A;  2KZM A;  1KLM A;  3WNF A;  1X9W A;  4NCA A;  1JXB A;  2P51 A;  3AVM A;  5KRT A;  3LPT A;  4BDZ A;  4E89 A;  1HYZ A;  1K6Y A;  3CFR A;  4CIG A;  3VQC A;  4CCH A;  4FLW A;  3ZSX A;  1HRH A;  3AA5 X;  1D9D A;  4CK2 A;  4E7K A;  4KRF A; 
#chains in the Genus database with same CATH topology
 3QEP A;  2AA4 A;  1VSD A;  1JLA A;  3MXM A;  2NUB A;  3JXU A;  5HRN A;  2YI1 A;  4AHC A;  4F3T A;  3ITH A;  5C2F A;  1MA9 B;  2P9S B;  4H0Y B;  3EY1 A;  2OPR A;  4JHD B;  1ASW A;  3ULE B;  3OYF A;  4CJF A;  3O80 A;  2HHT A;  5AQL A;  4ISE A;  4E1J A;  5HLF A;  2QWO A;  2OZM A;  2G8K A;  4BRF A;  3OYC A;  1BCO A;  4FZZ A;  5AQY A;  3AAR A;  4DS5 A;  4C1N K;  1UAX A;  1DGK N;  4AHU A;  3U9Z A;  5DM6 L;  4FWS A;  2NRX A;  4N47 A;  3FZL A;  4Q0B A;  1YJN N;  4M3W A;  3C7N B;  2VG6 A;  4DFJ A;  4KHP K;  1ZYQ A;  4B9M A;  1C0F A;  1VSI A;  2GEL A;  4DV3 K;  3OJS A;  1C0T A;  1NGF A;  3B6O A;  3PSI A;  3CC7 N;  3DLL L;  2RKI A;  1QVF M;  4Q5V A;  3CQX A;  3M1F A;  3CCU N;  4J2D A;  3MXI A;  4BE2 A;  5ADX H;  4ID5 A;  1C1C A;  4CD3 A;  3CCV N;  4E7I A;  4BG9 A;  1NJX A;  2O4I A;  2DFF A;  1JKH A;  2CGK A;  1WSE A;  2P9N A;  3O1B A;  1KFD A;  3K5N A;  4C8O A;  3F73 A;  4LFC K;  1I94 K;  2A6A A;  3ZX0 A;  2XY5 A;  4B9Q A;  4GV3 A;  1W7A A;  4BQL A;  4FJ7 A;  3MCP A;  4BDP A;  3GE1 A;  1CXU A;  3EL2 A;  4DTR A;  4U67 L;  2FBY A;  2IVP A;  2P9L A;  5AQZ A;  3A0I X;  3NE6 A;  3SZ2 A;  4IEI A;  4AIL C;  4GKJ K;  3PO5 A;  1J5E K;  2DTU A;  1JLB A;  5EX5 A;  5M1O A;  4H5N A;  2YHX A;  4E7H A;  2E88 A;  2OTJ N;  3W0L A;  3MDQ A;  4CJS A;  1EXQ A;  2FBT A;  3F9M A;  3M8S A;  3KHY A;  3SNN A;  4OKK A;  4F4K A;  4FWK A;  2WC9 A;  2Q31 A;  4X66 K;  4FJG A;  1RBR A;  2F8S A;  3TAM A;  1NGC A;  1VHX A;  2W6K A;  2V7Y A;  2JGU A;  1T44 A;  3ENH A;  4OJR A;  4B1V A;  3R6M A;  1ATS A;  2OTL N;  1G99 A;  4FLV A;  4CZK A;  3PX0 A;  2HF3 A;  1VQM N;  3VA0 A;  4BWM A;  1GLF O;  4KI4 A;  1OVY A;  4F2S A;  3EE8 A;  1BIS A;  3VQD A;  1KAX A;  4FK4 A;  3U8X A;  1NGD A;  1N33 K;  3V1R A;  4DQI A;  5BPN A;  1K73 O;  4Z4I A;  1VQ4 N;  2A1R A;  3S41 A;  2E1Z A;  1S9E A;  4M45 A;  1VQ7 N;  4FJM A;  1YIT N;  1NK9 A;  4NXM K;  3SMS A;  3ZSR A;  1QS4 A;  5BR9 A;  3J81 O;  3L3U A;  5AQQ A;  4Z94 A;  3KLG A;  1BDG A;  3CCQ N;  1HPZ A;  4CHN A;  4KBO A;  3G71 N;  3C95 A;  3HOT A;  4H5T A;  4JKG B;  3QEI A;  1ATN A;  1BG3 A;  2FSJ A;  2GV9 A;  4CZJ A;  5JLH A;  2NRR A;  1IBM K;  3ZET B;  4B9N A;  4IWV A;  2HBM A;  4B3S K;  3IS9 A;  3WEE B;  4FLZ A;  4V19 S;  5AQJ A;  1RDA A;  2HB5 A;  3V9W A;  2O8C A;  1BUP A;  1VSJ A;  2OPQ A;  1X9S A;  2QWQ A;  4JKF A;  2PYL A;  2UUA K;  2D0C A;  4LF4 K;  1F21 A;  3OHR A;  2KTQ A;  5AQW A;  3TPQ A;  4B9U A;  3BF1 A;  3LAM A;  1GOA A;  4IO9 L;  3S3O A;  1HUX A;  2PBD A;  5HOO A;  1A5X A;  1VRU A;  2X6S A;  4KAZ A;  1OKJ A;  5C25 A;  2E2O A;  3CG7 A;  4EHU A;  4B1Z A;  1KVB A;  4DSL A;  3NF8 A;  4MDB A;  1LAW A;  4LH4 A;  2ZQB A;  3VF6 A;  3ATV A;  2ZJQ L;  4B1W B;  4WFN L;  2P5O A;  1GLA G;  3K0S A;  3AO1 A;  4QAG A;  1YI2 N;  2XHB A;  1GOB A;  3C7N A;  3T7Z A;  5MLC Q;  4DTP A;  3AO4 A;  4G1Q A;  5C2D A;  4CER A;  1LW2 A;  2W41 A;  4B3T K;  4NLB A;  1KQS M;  2Q97 A;  4KHQ A;  2HHS A;  4ILG B;  1RT3 A;  4OPJ A;  4PWD A;  1VQ5 N;  2XRI A;  3I55 N;  4DR6 K;  4KO0 A;  4JAX A;  3OY9 A;  4EP5 A;  1NG9 A;  4FXD A;  4CEZ A;  4A2A A;  4DSK A;  2Q2R A;  4CZI A;  3LM9 A;  4CZM A;  3L4I A;  4WYB A;  3CD6 N;  4CJ5 A;  3MWP A;  1ZBH A;  3ZSV A;  1EET A;  4CJ4 A;  3QML A;  5AQO A;  3DRP A;  4Z4F A;  1U2V B;  1SKS A;  2F96 A;  4BR5 A;  1Q81 O;  5AQR A;  3HTV A;  2GUP A;  1RBU A;  1DLO A;  1QE1 A;  3CFO A;  3B6P A;  4YOT A;  3ZEU B;  3QIC A;  3V9Z A;  2A1S A;  1NJY A;  3ATU A;  1RBS A;  4A61 A;  1SUQ A;  4DTM A;  3SPY A;  3WT0 A;  1OH6 A;  3QES A;  3SQ1 A;  4A57 A;  1NGE A;  1UA0 A;  1WUA A;  3EO3 A;  3UB5 A;  3VF4 A;  1TK0 A;  4M3Y A;  3JAM O;  1EX4 A;  3VQB A;  2W42 A;  3BZK A;  4YOU A;  4BGA A;  1RDW X;  2O8F B;  3HSC A;  1BHL A;  3CXC M;  3A8Y A;  1JCF A;  4IKF A;  4BR9 A;  1IKW A;  3BP8 A;  3OYB A;  4Z4H A;  4CGJ A;  1GLC G;  4PA1 A;  4FJK A;  4J2E A;  3ID8 A;  4JLH A;  1RT2 A;  1RT7 A;  5C42 A;  4IJA A;  3H46 O;  4LFA K;  4RW4 A;  3J7Y P;  4JK8 A;  4JKB A;  3DOL A;  5J1E A;  5J2Q A;  3EZW A;  4ZHR A;  4JK7 A;  1BA1 A;  1GLJ O;  4XH1 A;  3BDP A;  2QWN A;  4DV7 K;  4CJT A;  1YT3 A;  2B5J A;  3QLH A;  3DWL A;  1RDB A;  3D0P A;  1Z25 A;  3RMB A;  1O1W A;  4A62 A;  1XI1 A;  3DXK B;  2IIR A;  2E8A A;  2WON A;  3O9S A;  1HYS A;  1NGA A;  4JS4 A;  4LSN A;  3SBT A;  1IKX A;  2VGM A;  4W5Q A;  5AQG A;  2CGJ A;  3TAB A;  3L2R A;  4JKA A;  3DLK A;  4CEA A;  3F2K A;  1YVU A;  3ZT0 A;  4YOX A;  4JI2 K;  5BN9 A;  1DTQ A;  1B9F A;  4BDY A;  2KKZ A;  3THX B;  1KRP A;  2ASO A;  3PX6 A;  3LL3 A;  1NLV A;  4Z4C A;  2QKK A;  4FJ9 A;  3GG4 A;  4E19 A;  2RE2 A;  4JKG A;  4FJ5 A;  3V4I A;  4BC2 A;  1XWL A;  3ZT3 A;  3ENB A;  3NCI A;  1NGH A;  3BGR A;  3HI0 A;  4WE1 A;  1BI4 B;  2QA4 N;  3FFI A;  1IKV A;  3QB0 A;  3CC4 N;  1L3V A;  3H6E A;  4HTL A;  5H1S Q;  3LP2 A;  3AV9 A;  3ZT1 A;  1S1U A;  3K57 A;  3SUO A;  1ESV A;  3VEZ A;  2KW4 A;  1L3S A;  1FXX A;  3E9P A;  5JMV A;  1RT4 A;  3VPZ A;  3AO5 A;  4QOZ B;  2Q0R A;  4FWO A;  1NKE A;  3VQ6 A;  4W5R A;  3EZ5 A;  4I6M B;  4ILH A;  3ZLJ A;  3OYH A;  2YNI A;  3VQP A;  1Z26 A;  3TTD A;  1W97 L;  3SQ0 A;  2WOM A;  2AJQ A;  3OYG A;  4CEC A;  3LAL A;  2YNH A;  3CJ9 A;  2F4V K;  4FWN A;  5I3U A;  3LWL A;  4QCL A;  1RTI A;  4HUF A;  4BR4 A;  2DFH A;  1TUY A;  2V51 B;  2BAN A;  4WQ5 A;  5KPZ A;  3CIP A;  1KLM A;  3WNF A;  4NCA A;  1JXB A;  2P51 A;  3AVM A;  4BDZ A;  4E89 A;  1HYZ A;  4MO4 A;  3MX2 A;  3AA5 X;  1Y64 A;  3AY9 A;  1HPM A;  4E7K A;  1EWR A;  3CET A;  4C8L A;  1MDU B;  3OYN A;  1RBT A;  4KB1 A;  3DXM A;  2V52 B;  1NMD A;  4H0V B;  4DV0 K;  1QTM A;  4AM6 A;  4BQZ A;  3CCM N;  4PKI A;  3SYZ A;  3L4Q A;  3TSP A;  3ZEU A;  2W40 A;  2NLX A;  1IJJ A;  3D2E A;  1LWE A;  3EN9 A;  4M41 A;  3O6W A;  1T05 A;  2P9N B;  1TL3 A;  2FBX A;  3P31 A;  3G4S N;  5BRD A;  4GW6 A;  4CZG A;  3VQE A;  3C0B A;  3JYT A;  4F9O A;  4FJI A;  1S1X A;  1BCM A;  1DTT A;  2B6A A;  3AO2 A;  1NK8 A;  4H0O A;  3KD5 E;  1YXQ A;  3VQ8 A;  3AVA A;  4CJR A;  1B9D A;  4ICL A;  4BWJ A;  4KHU A;  1MWM A;  2ATQ A;  1X9J A;  2RF2 A;  3OYE A;  1XNQ K;  3VMF B;  4BRL A;  5HL7 L;  2YX6 A;  2P9L B;  3HL8 A;  2I5J A;  4DWI A;  3L0Q A;  1WSH A;  2E2N A;  4IOA L;  4IEE A;  3TWH A;  2YHW A;  3I0S A;  4FO0 A;  5I42 A;  1VQN N;  2OPP A;  4X65 K;  4FM0 A;  4BE1 A;  4DQP A;  1Z05 A;  1ZBU A;  4FWQ A;  3DOK A;  3GDQ A;  4EHT A;  5LMU K;  3TAQ A;  4PKG A;  3RR7 A;  4KFB A;  2LSN A;  4DU1 A;  5IT9 O;  1ITG A;  3HVR A;  3C6H A;  1HNV A;  4HHT A;  3ALY A;  3NGY A;  1RT5 A;  2FBV A;  2O8B B;  3VOV A;  1NK6 A;  1NGI A;  4DQ8 A;  1JL2 A;  3AVL A;  4O4G A;  4CES A;  1Q18 A;  4F8R A;  1HNZ K;  3WXK A;  2HND A;  1J9A A;  4DF4 A;  4HTU A;  1TKT A;  4FL9 A;  4IFE A;  1SL0 A;  4IFV A;  3CHW A;  4EZ6 A;  3E66 A;  3DRS A;  5C0Y A;  2GWK A;  4PQU A;  3DYA A;  3VEX A;  5JVG L;  3HJF A;  3IG1 A;  4ID1 A;  3TAF A;  3RRG A;  3ISN C;  4CEQ A;  3ZSY A;  3RTV A;  4JKD A;  3HRG A;  2YJE A;  1NMN A;  4O8U A;  3MN5 A;  3VQ7 A;  3R9P A;  3CC2 N;  1TV6 A;  5AR0 A;  2O8C B;  1ZC6 A;  4KH5 A;  3J7Z O;  4ELV A;  1QSS A;  1JLC A;  4DQR A;  1BA0 A;  1L3T A;  1VAZ A;  3GOI A;  3LPU A;  5AZJ A;  5HRP A;  4FZX C;  1CZ9 A;  4DB3 A;  5FPN A;  1S3X A;  2EX3 A;  1D8Y A;  3FZM A;  3LZI A;  2ITG A;  3KK7 A;  1JLQ A;  4YHH K;  2XY8 A;  1X9M A;  2FF6 A;  4CBX A;  4I9Q A;  3O9R A;  2QWL A;  1N34 K;  3O3H A;  2BDP A;  2HHX A;  3CQ8 A;  5HBM A;  1LWC A;  5HP1 A;  5GAD P;  4JKH A;  1RCH A;  3MWT A;  3AA3 A;  1TYQ B;  2VGN A;  4CHY A;  5T7B A;  1NKB A;  4KHY A;  3IFR A;  3IRX A;  4DSJ A;  2OZS A;  4RW9 A;  4O8K A;  1VSF A;  4C1N I;  5FPM A;  4MO5 A;  4H8K A;  4JRP A;  5FPE A;  4PL7 A;  5AQK A;  1NWK A;  4LC9 B;  4LSL A;  4M3U A;  1U49 A;  1C0U A;  4C23 A;  4E1M A;  3O3G A;  4GNI A;  2BGG A;  2E2P A;  5JLF A;  4CJ3 A;  1A5W A;  4DTX A;  4K8X A;  4A5B A;  1YHQ N;  3DI6 A;  2HF4 A;  2YKM A;  3NF9 A;  4O0J A;  2IS3 A;  3NGI A;  1A5V A;  4H5R A;  4DTS A;  1HX1 A;  1KSP A;  1IBK K;  1GLE G;  3NVK A;  3K9J A;  3CJC A;  3TAR A;  3KKR A;  1H1V A;  4WF9 L;  4O0I A;  4JV5 K;  3SJH A;  2CH6 A;  3D6R A;  4FVM A;  1VK0 A;  3BF3 A;  3JSM A;  4I2Q A;  3N4Q A;  1Q9Y A;  4BGB A;  5LL6 Z;  2VWB A;  2JWL A;  1WB9 A;  1M90 O;  1NJI O;  1HLU A;  5KPT A;  4BRH A;  2ZJR L;  5JVH L;  2GX9 A;  3CCR N;  1S72 N;  1HKC A;  1XNR K;  4DR2 K;  3OVN A;  1BL3 A;  4QS8 A;  4CE9 A;  1MWK A;  1C6V A;  2G8W A;  3WXL A;  1XQS C;  2VG7 A;  3AGR A;  5KI6 A;  4ISF A;  2VG5 A;  4KI6 A;  2B4J A;  4H5W A;  2O8B A;  1Q86 O;  4DV6 K;  4E3S A;  3O08 A;  3SUN A;  1D9F A;  3DAW A;  1VSL A;  1ATR A;  4CEF A;  2QXL A;  4CJK A;  1T03 A;  3HOS A;  1YAG A;  4HUE A;  4CZL A;  1RGI A;  1TKZ A;  3G10 A;  1R0A A;  2ZM6 K;  3AA2 A;  3CCL N;  1BQM A;  1QHA A;  3BUZ B;  2ETJ A;  4IG0 A;  3OS1 A;  1EKE A;  4RW8 A;  5JIC A;  1K8A O;  4NXN K;  4R79 A;  2X74 A;  4CD1 A;  1VQO N;  1N5Y A;  1FKP A;  2FSN A;  4WFA L;  4LH5 A;  3O3F A;  5JS1 A;  2PYJ A;  2G8I A;  3KJV A;  3SI6 A;  1RBV A;  4NCB A;  4IJN A;  5C15 A;  4LF9 K;  4IOC L;  4CVN E;  2NRT A;  2NRV A;  5EXW A;  5IWA K;  5AQI A;  2KQ2 A;  5AQS A;  3KTQ A;  1HQU A;  4BR7 A;  1SS6 A;  2UXC K;  4Z4G A;  1JXE A;  3A5M C;  4WQ5 C;  3THW A;  4C8M A;  3V9S A;  3OYJ A;  2IOC A;  3WNG A;  1RNH A;  4KHN A;  1OH7 A;  4KTW A;  3QET A;  1KVA A;  4X64 K;  5LMN K;  3U9D A;  5AZI A;  4DHY A;  2XY6 A;  1FW6 A;  4LF5 K;  5CZ1 A;  3O8M A;  2HBJ A;  3HPH A;  4OX9 K;  4PY5 A;  5SWM A;  3VEN A;  1RT1 A;  3QBW A;  3PV8 A;  2I7P A;  1KD1 O;  2DPN A;  3VEV A;  4BVO A;  2E1Y A;  3V81 A;  2ZD1 A;  3IMX A;  4BRG A;  2Q0U A;  1VQK N;  4M7X A;  4CHP A;  3M6G A;  4CGG A;  3SAH A;  4AH9 A;  2J4R A;  1TYQ A;  3J7A P;  5AQM A;  1NK5 A;  2X78 A;  3C6A A;  5GIO A;  4DQQ A;  5BRE A;  2JWK A;  3FE1 A;  4CBW A;  4ILJ A;  3KWI A;  4HUG A;  1VRT A;  5A2Q O;  3SBG A;  3NF7 A;  4QS7 A;  4FJ8 A;  1VQ9 N;  2HNY A;  3CJB A;  4WCE L;  3EKU A;  4CGH A;  2ZJP L;  5AQP A;  2NRZ A;  4H0T B;  4M3X A;  3LAK A;  3KK1 A;  1K8K A;  3AVI A;  3CJ7 A;  3PX4 A;  1CZA N;  1NOZ A;  4GKK K;  3ZSZ A;  5AQF A;  1Q8I A;  4A59 A;  3DXM B;  1HKG A;  4BRM A;  5GAG P;  4DUY K;  3HT3 A;  3ZSO A;  3ULD A;  3IDH A;  1TL1 A;  3AA4 A;  4H4O A;  3KK2 A;  3RSE A;  1TVR A;  1HNI A;  4IOX A;  4O55 A;  4FWM A;  4MLE A;  4J2A A;  3D2E B;  3H3O B;  3CCJ N;  3MXJ A;  5FRO A;  1CXQ A;  2O8E A;  4PUO A;  4DUZ K;  3CMA N;  3MCA B;  4FLT A;  1IO2 A;  4JD2 B;  4OPK A;  2E6L A;  1WOQ A;  3KK3 A;  5GIN A;  2D0O A;  2KZM A;  3H1V X;  4H03 B;  5AQU A;  3J8A A;  3LPT A;  4LF7 K;  2A5X A;  1K6Y A;  1QQN A;  4BRE A;  2QI2 A;  3ZSX A;  3FFK B;  4YOY A;  4CK2 A;  4KRF A;  4U7B A;  3DM2 A;  2E2Q A;  1TAU A;  2QM1 A;  2WFB A;  3K5O A;  3QBX A;  5LJV A;  1S1T A;  2G8V A;  3V9U A;  4BE0 A;  4CHZ A;  2CGL A;  2WTU A;  4A5A A;  4FJX A;  4K0K K;  2BUP A;  1Y97 A;  4CK1 A;  3E9L A;  3A5N C;  2P9I B;  1I39 A;  2V7Z A;  2OAN A;  3D45 A;  3MMV A;  1X1P A;  3CFP A;  3WXI A;  2P9U A;  3C94 A;  1HQE A;  4DR4 K;  1E3M A;  4PKH A;  5FPD A;  1BIZ A;  3S9H A;  3KLE A;  4JRQ A;  1LAV A;  3R8E A;  4XIU A;  1JCE A;  4KH4 A;  3SLC A;  3UE5 A;  4MQ3 A;  3VQ5 A;  2D4W A;  3TSQ A;  4BVP A;  3QIP A;  3AO3 A;  4BG8 A;  3TAN A;  2RN2 A;  1NBW A;  5FRM A;  4RW6 A;  3BY5 A;  4FM2 A;  4GVM A;  1DEJ A;  1YVN A;  1V4T A;  3IKM A;  2D0B A;  4FLX A;  3HVT A;  4ISG A;  3ZT2 A;  1RTD A;  4DQS A;  3CJA A;  3B8A X;  2KHO A;  5TKW A;  1XUP O;  1EP4 A;  2E4L A;  1HMV A;  2QKB A;  1WAF A;  4CF8 A;  3WNE A;  5I9E B;  3O5B A;  3AAP A;  2VQE K;  3HM8 A;  3SV4 A;  5DMR A;  3HZ6 A;  5DM7 L;  4CW7 B;  2Y1J A;  1SQK A;  3MEE A;  3TR8 A;  2HHU A;  4Z0U A;  3OS0 A;  2P9P B;  5AZJ B;  3BEX A;  1QZ6 A;  3M3Z A;  3FLC O;  2KZZ A;  4CFC A;  3GL1 A;  4N5S A;  3VN5 A;  3EEQ A;  2KFN A;  3L8B A;  4FLY A;  4Y0W A;  4DCH A;  3FZH A;  4HCB A;  3U3Y A;  3NFA A;  2D5R A;  4TSX A;  4JKC A;  3FR0 A;  3J80 O;  4FPB A;  3ZX3 A;  2IGI A;  3KKS A;  4BR0 A;  4AHV A;  4RW7 A;  1FJG K;  2YV0 X;  1CLQ A;  1U45 A;  4ZTF A;  1QQO A;  1C0G A;  1YTA A;  4FW2 A;  4RCH A;  1V4S A;  5E26 A;  2CH5 A;  2JLE A;  3QFU A;  2GTD A;  2D0P A;  3CPE A;  3CPW M;  4AM7 A;  5J2M A;  2X6N A;  2R7Y A;  4BR2 A;  1ASV A;  4XH5 A;  2PAV A;  3FGU A;  5CY4 A;  2WUS A;  2ZWH A;  3K5M A;  3ZSW A;  2HST A;  3DLR A;  1G15 A;  2KLA A;  4M3Z A;  2GBZ A;  4CI6 A;  3F5T A;  1W9H A;  4B9L A;  4K41 A;  1LV5 A;  2A41 A;  4B9V A;  4OLA A;  1RFQ A;  4JD2 A;  3MK6 A;  3F9K A;  2HMI A;  4CK3 A;  3L2U A;  1RDU A;  3L2V A;  2QWM A;  3E01 A;  4OPH A;  2DFE A;  5CYM A;  3JS6 A;  3HO1 A;  3VF2 A;  1D5A A;  1LW0 A;  4CJP A;  4E7J A;  4E0D A;  3P83 D;  3IUC A;  1WLJ A;  1WSF A;  3THV A;  2IVO A;  4N76 A;  1BU6 O;  5CZ2 A;  3DJC A;  3WUH A;  2F7T A;  3M8Q A;  4DV2 K;  1HNW K;  4CF0 A;  4EP4 A;  3SJJ A;  2D0A A;  1T6D A;  1YJW N;  4JI1 K;  5C10 A;  2FXU A;  3DLH A;  3DLG A;  5M1P A;  1U6Z A;  3THY A;  2P9I A;  5B8H A;  4JI7 K;  3MEC A;  4B9T A;  1T6C A;  3FZK A;  3NMU A;  4B1X B;  4YY3 K;  4DV4 K;  4DR1 K;  2YKN A;  3MED A;  4FCY A;  1N36 K;  5HRR A;  3LDN A;  2F9W A;  1NNE A;  4NB4 A;  4H4M A;  4CIF A;  1JJ2 M;  4KV8 A;  2ZF5 O;  4FK0 A;  5BR8 K;  2GEM A;  3AVJ A;  3PLA A;  4B08 A;  4K43 A;  4L8R B;  3NH1 A;  4IDK A;  3Q7C A;  4CJE A;  4FVU A;  4O5F A;  3MAQ A;  1BGX T;  2W6L A;  1NJW A;  3UIQ A;  3W3D A;  2GUI A;  1JLE A;  3VQA A;  5BRF A;  4DR5 K;  4FWR A;  3SQ2 A;  3QEV A;  3N4P A;  3QER A;  1X3N A;  3P1G A;  4JN4 A;  3RRH A;  3O4W A;  3SCX A;  4YOW A;  4DLE A;  4FPA A;  2VCP A;  2O4G A;  3LDQ A;  3T69 A;  1NGB A;  3LDO A;  5KTQ A;  3TAP A;  1W2B M;  2A3Z A;  5HRO A;  4JNE A;  3OYA A;  4O44 A;  3HPG A;  1DT9 A;  4IG3 A;  1J5O A;  3TSU A;  4J8F A;  4JI8 K;  1VQL N;  1VQ8 N;  4LD0 A;  4DV1 K;  3P5J A;  3T1A A;  3HP6 A;  3DLB A;  3TTC A;  4DFP A;  3P4I A;  1WBD A;  1YUW A;  2AP1 A;  3THW B;  4YDU A;  3VGL A;  3CER A;  1I3A A;  3NAE A;  5KQ8 A;  4C8N A;  2P9P A;  1EQY A;  4I7F A;  4NCG A;  1SZ2 A;  3ZYY X;  4DU3 A;  5E41 A;  5AZI B;  4DLG A;  4FK2 A;  4AHR A;  3TAG A;  3BZC A;  1UA1 A;  2YNF A;  1RTH A;  3LDS A;  3LAN A;  1C1B A;  4GY2 B;  3SUQ A;  1HYV A;  5M1N A;  4YOV A;  3TU5 A;  1BOT O;  1IG9 A;  3VQQ A;  5AFU A;  3OTO K;  4DG1 A;  3QO9 A;  5KQD A;  5J2P A;  3VQ4 A;  3ID6 A;  3E1Y A;  3OA9 A;  1WBB A;  3UKU B;  2QK9 A;  2HBL A;  3V1Q A;  3OW2 M;  4DTN A;  1QQM A;  3K2P A;  3VGM A;  2FF3 B;  5ELZ A;  4KB0 A;  4OVL A;  3RVC A;  1KTQ A;  1C0M A;  2G8H A;  1KLN A;  3CME N;  3D2F B;  1T7P A;  3QEX A;  4JI5 K;  4ZTJ A;  2ZGZ A;  4CZF A;  4CF1 A;  5CHI A;  1TKD A;  1S22 A;  1K8K B;  1RDC A;  4K42 A;  1JL1 A;  1KCF A;  4BRQ A;  1NK0 A;  2Z1J A;  4RTF D;  2RHK A;  3L6Q A;  1M1K O;  4RWT A;  1U4B A;  2UU9 K;  2EWS A;  3CI5 A;  5KRS A;  1X3M A;  4CJV A;  4J2B A;  3U6F A;  3SQ4 A;  1SV5 A;  3QDK A;  1REV A;  3RSE B;  2ZE2 A;  4BRD A;  4DKW A;  5KGX A;  3LWM A;  1QSL A;  3T3F A;  2OPS A;  4BRC A;  3A2F A;  3ZT4 A;  4NYF A;  4FWL A;  3RMC A;  3PIO L;  4B8A B;  3KVG A;  2O8E B;  1N6Q A;  3OYK A;  1OH5 A;  1ASU A;  4DSF A;  4O5B A;  3D7E O;  1XHX A;  4DFM A;  4KPY A;  4FSV A;  4M63 C;  3OYM A;  4K25 A;  3OYI A;  2I7N A;  3Q7B A;  1TK5 A;  3UKR B;  2Y1I A;  3VER A;  3P38 A;  2EHG A;  4OGC A;  1ZBI A;  1GLD G;  2OYQ A;  3NH0 A;  3V9X A;  2HHV A;  1P8Z A;  4OPA A;  3FZF A;  3ZX2 A;  4CGI A;  4BRA A;  5AQN A;  4CHO A;  2HW3 A;  1IBL K;  1QVG M;  4HCC A;  3SPZ A;  1KVC A;  4CJL A;  2UUC K;  1O13 A;  3H1Q A;  1IKY A;  4JI6 K;  3SUP A;  2HNZ A;  1BWF O;  4W5O A;  5K14 A;  1RDD A;  4BY9 C;  5AQV A;  4CFB A;  5EU7 A;  2A40 A;  2P9U B;  3HXM A;  1VQ6 N;  2YCH A;  4MFB A;  5KGW A;  4CZE A;  4FOE A;  4NLC A;  4BRK A;  1X9W A;  5AJ3 K;  4M7Y A;  4PHT X;  3EE9 A;  2QEX N;  4CCH A;  3VQC A;  1HRH A;  5CE3 A;  1D9D A;  2P9K A;  4WQ4 A;  1NJZ A;  3E9O A;  3CM6 A;  3G25 A;  3R3L A;  2BTF A;  3VEW A;  3AVF A;  3CCE N;  3VES A;  1LCU A;  4FJJ A;  3V1O A;  1L3U A;  1KXP A;  3A5L C;  4HVJ A;  1XMQ K;  1XC3 A;  2Z1H A;  2P5G A;  2F9T A;  3O9Q A;  4DF8 A;  1WSI A;  4FJH A;  1S9G A;  1Q9X A;  1YF5 L;  4AQY K;  3AVG A;  4BRI A;  4G9Z A;  4H0P A;  2QW9 A;  4LF8 K;  2ASM A;  3QNO A;  5CR4 A;  1N32 K;  5JS2 A;  2FLO A;  4HWI A;  4CZH A;  2YNG A;  4DFK A;  5AQT A;  3OS2 A;  4BC4 A;  4BRP A;  4E7L A;  2O8D B;  5F0X A;  1L5U A;  3VA3 A;  3NH2 A;  3PO4 A;  3C6U A;  2HVH A;  1E4G T;  4GVE A;  2QWP A;  3UKU A;  1ZBS A;  1VSK A;  2HVI A;  2P9S A;  4JHD A;  5TKY A;  1TAQ A;  3ULE A;  1FK9 A;  1S6P A;  4BC5 A;  3T1H K;  3MN7 A;  1XHZ A;  3NGZ A;  2IC3 A;  3QFP A;  2BE2 A;  4UQG A;  2OA8 A;  1KFS A;  4FZY A;  4C8K A;  3ENO A;  1NKC A;  2XO7 A;  4ELT A;  5AQX A;  4DSE A;  4Z4E A;  3D2F A;  4E1N A;  2YJF A;  5AQH A;  1HKB A;  1S1V A;  2BH1 A;  4B9S A;  5EOY A;  3TAE A;  3KLF A;  3KLI A;  2NRW A;  3HM9 A;  4FM1 A;  1SL2 A;  3RWU A;  4X62 K;  4JEP A;  4CEO A;  5E84 A;  3H08 A;  4K8Z A;  4DR3 K;  1CZB A;  1NOY A;  3WXJ A;  2UYT A;  4R5P A;  4BC3 A;  4CJW A;  1E4F T;  1KAZ A;  3KWG A;  5BPM A;  2Q1N A;  5M1F A;  3GBT A;  3L3V A;  1K9M O;  3AVH A;  3AVK A;  4NO7 A;  4KTZ A;  2WBN A;  1J54 A;  4B3R K;  1EWQ A;  2PZS A;  3SV3 A;  4AHS A;  2G8U A;  1GLL O;  3O9T A;  3HP9 A;  4M3T A;  1S1W A;  1QZ5 A;  5ADX A;  3AGK A;  1J53 A;  2XY7 A;  4CJQ A;  3G6E N;  2VWJ A;  2HOE A;  3C65 A;  3LP0 A;  2YHA A;  2IDO A;  2ZGY A;  3I8B A;  1HR0 K;  3A5O C;  2VQF K;  4BAC A;  5GAE P;  4GV6 A;  3HYF A;  3UKR A;  4EAH D;  3EKS A;  4FJN A;  1NU0 A;  1S6Q A;  3VGK A;  3QIN A;  3AVC A;  4CIE A;  3AVB A;  3LM2 A;  3PUF A;  3O4N A;  4B8C A;  4F3O A;  1XMO K;  3CF5 L;  2HHQ A;  1SKR A;  4EFH A;  5EY4 A;  1XC9 A;  3KD1 E;  1ZBL A;  5GAH P;  1Q7Y O;  5FDL A;  2D1K A;  3KIO A;  3AVN A;  1WNS A;  3TTF A;  3THY B;  3T19 A;  3DMJ A;  4FLU A;  1RTJ A;  4CGF A;  2NNW A;  3RR8 A;  1HJO A;  3VQ9 A;  3CM5 A;  3NDK A;  2GWJ A;  4MDA A;  4KHS A;  3SAF A;  3RMA A;  3ZCM A;  4MLH A;  4YDU C;  4CFD A;  3HPO A;  1GOC A;  3LDP A;  4EIA A;  5LJW A;  1T3V A;  3WNH A;  1B92 A;  1QQC A;  4IZ9 A;  1TKX A;  4DV5 K;  4H0X B;  2IAJ A;  4FW1 A;  3PY8 A;  1QHT A;  1W0H A;  3O1W A;  3ASM A;  1OVQ A;  3U4L A;  4JI3 K;  1C1A A;  5CYQ A;  3V6D A;  3DLE A;  3LP3 A;  4CEE A;  4N56 A;  1HNX K;  1P90 A;  2Q3S A;  3HBT A;  3U3G A;  4DU4 A;  1YJ9 N;  4EZ9 A;  2FC0 A;  2FSK A;  4IFY A;  1Z6R A;  4FYD A;  3WXM B;  4CGD A;  3NBP A;  1Q82 O;  2Z1I A;  4JI4 K;  1T8E A;  4DTO A;  2ASP A;  5D3G A;  1YTU A;  4FWP A;  5J2N A;  4M3R A;  1EO1 A;  3I8D A;  3MN6 A;  1LOT B;  2DY4 A;  4F2R A;  3ZET A;  1UWB A;  3WEE A;  4BRO A;  1WAJ A;  1NGJ A;  3K59 A;  4XH4 A;  2F8T A;  4KRE A;  1KC8 O;  2HHH K;  2O8D A;  3AAQ A;  3NVM A;  5C12 A;  2PFU A;  3SK3 A;  4AHT A;  4IBN A;  5M1K A;  3PIP L;  3S3M A;  5BRH A;  3QNN A;  2H3G X;  4W5N A;  3VEO A;  3I33 A;  3H45 C;  1JCG A;  3QIO A;  2HBK A;  4KH6 A;  5AFU H;  4OGE A;  4PL8 A;  3CQY A;  4OLB A;  4XEI A;  3MEG A;  4KTQ A;  1U04 A;  2HMP A;  2ITM A;  2NRH A;  3L2W A;  2E20 A;  4CEB A;  2HHW A;  1DKG D;  2VYP A;  4CED A;  4CJU A;  5F2R A;  5F1X A;  1R59 O;  4OKE A;  3CYM A;  4I9L A;  2A42 A;  1HJR A;  1TGO A;  1U48 A;  4CFA A;  3HK2 A;  4JS5 A;  1GLB G;  5C24 A;  5BN8 A;  1VSM A;  4YOR A;  4OO1 J;  3WQU A;  4AF1 A;  1RT6 A;  2OCE A;  1YIJ N;  4CHQ A;  5SZT A;  4ELU A;  3K9K A;  3P39 A;  3NHG A;  3K5L A;  3VTI A;  1KAY A;  2YHY A;  1BO5 O;  3I56 N;  2UXD K;  3SMP A;  1VQP N;  4B1U B;  3K58 A;  4B3M K;  3L2Q A;  1NK4 A;  3M8P A;  3CCS N;  1WN7 A;  3VET A;  4IO8 A;  4YNQ A;  3M5R A;  4YFU A;  4DR7 K;  3OYL A;  3NF6 A;  2YHB A;  3O4Q A;  4QS9 A;  3LZJ A;  1SKW A;  3DRR A;  1U2V A;  5HRS A;  5M1Q A;  4RG8 A;  4LY7 A;  3MX5 A;  4FOI A;  3T1Y K;  3VEY A;  2QWR A;  3KZB A;  4Y1D A;  4CF2 A;  3WQT A;  4NYN A;  4KKO A;  3EYZ A;  4WFB L;  4A2B A;  4BRN A;  1D4X A;  2VWK A;  1JLG A;  4CF9 A;  1NGG A;  1VSH A;  2RPI A;  1RIL A;  1N8R O;  1IG8 A;  3O9U A;  1ZBF A;  1SAZ A;  3ZSQ A;  5GIP A;  3S3N A;  1UOC A;  3OJU A;  5DK5 A;  2Q36 A;  1IV0 A;  1IH7 A;  2PY5 A;  4LF6 K;  2O8F A;  4DMN A;  4WQ4 C;  4DTJ A;  4JK9 A;  4CBU A;  4JI0 K;  1NK7 A;  4L3Q A;  3M8R A;  5FLX O;  4IXC A;  1TUU A;  4Y1C A;  4FJL A;  3PSF A;  1OH8 A;  3G0Z A;  2UXB K;  5KPR A;  3KLH A;  4DSI A;  1WSG A;  4LFB K;  2G8F A;  2E6M A;  4JYA K;  5EVZ A;  3R1X A;  1SL1 A;  4N41 A;  3OYD A;  1ZXO A;  3CJ1 A;  3LDL A;  3DXK A;  1BIU A;  1QSY A;  1S5J A;  2UUB K;  1TK8 A;  3VTH A;  3OBW A;  3TI0 A;  1LWF A;  2Z1G A;  4OKJ A;  4GMJ B;  4DS4 A;  3RMD A;  2NZT A;  1JLF A;  4B3O A;  3OBY A;  3IAY A;  4UY8 O;  3SAG A;  3QEW A;  3C6T A;  5FRN A;  3THX A;  4M42 A;  4B1Y B;  2P9K B;  2QTD A;  3I0R A;  4DTU A;  2IVN A;  1J6Z A;  1VSE A;  4CJ7 A;  4I2P A;  4H5V A;  4GV9 A;  2QXF A;  1ILY A;  1MU2 A;  3LP1 A;  4KHW A;  1BQN A;  1BI4 A;  1FKO A;  3HST B;  2KFZ A;  5BPL A;  4IDH A;  1U47 A;  2P1J A;  5LY3 A;  4W5T A;  1WSJ A;  1NM1 A;  4JKE A;  5KRT A;  3CFR A;  2E5L K;  4CIG A;  4FLW A;  4I6M A;  3H3N O;  3MN9 A; 
#chains in the Genus database with same CATH homology
 1NJZ A;  4C8L A;  3DM2 A;  3QEP A;  3OYN A;  1RBT A;  1TAU A;  3CM6 A;  1VSD A;  4KB1 A;  1JLA A;  3MXM A;  2NUB A;  3K5O A;  3AVF A;  5HRN A;  1S1T A;  2G8V A;  4AHC A;  3V9U A;  4BE0 A;  4FJJ A;  4CHZ A;  1QTM A;  4F3T A;  3V1O A;  3ITH A;  1L3U A;  3SYZ A;  4HVJ A;  2OPR A;  3EY1 A;  2Z1H A;  2P5G A;  1ASW A;  3OYF A;  4FJX A;  4CJF A;  4DF8 A;  2HHT A;  1WSI A;  1LWE A;  1Y97 A;  1S9G A;  4CK1 A;  4FJH A;  5HLF A;  2OZM A;  4M41 A;  1T05 A;  1I39 A;  1Q9X A;  1TL3 A;  3D45 A;  2FBX A;  2G8K A;  1X1P A;  3OYC A;  1BCO A;  3AVG A;  3CFP A;  4GW6 A;  4FZZ A;  3VQE A;  4DS5 A;  1UAX A;  3JYT A;  4AHU A;  4FJI A;  3C94 A;  1S1X A;  1HQE A;  3AO2 A;  1BCM A;  1DTT A;  2B6A A;  1NK8 A;  3KD5 E;  3QNO A;  4N47 A;  1BIZ A;  5JS2 A;  4Q0B A;  3S9H A;  4M3W A;  3VQ8 A;  2YNG A;  3KLE A;  4JRQ A;  3AVA A;  4CJR A;  1B9D A;  2VG6 A;  4ICL A;  1LAV A;  4BWJ A;  4XIU A;  3OS2 A;  4DFJ A;  4E7L A;  4KHU A;  2ATQ A;  1ZYQ A;  1L5U A;  4B9M A;  2RF2 A;  3OYE A;  1VSI A;  3NH2 A;  3VA3 A;  3OJS A;  1C0T A;  3PO4 A;  3C6U A;  3HL8 A;  3B6O A;  2I5J A;  4MQ3 A;  4DWI A;  1WSH A;  2HVH A;  3VQ5 A;  2RKI A;  3TWH A;  3I0S A;  5I42 A;  3QIP A;  4Q5V A;  2OPP A;  4J2D A;  1VSK A;  3AO3 A;  4BE2 A;  3TAN A;  3MXI A;  2HVI A;  2RN2 A;  5FRM A;  4FM0 A;  4RW6 A;  4BE1 A;  1TAQ A;  4GVM A;  4FM2 A;  4DQP A;  4ID5 A;  1C1C A;  1ZBU A;  1FK9 A;  1S6P A;  4E7I A;  1XHZ A;  3DOK A;  3NGZ A;  1NJX A;  2IC3 A;  4UQG A;  2BE2 A;  2D0B A;  4FLX A;  2O4I A;  2DFF A;  2OA8 A;  1KFS A;  3HVT A;  1JKH A;  1WSE A;  3TAQ A;  3K5N A;  1KFD A;  4FZY A;  3ZT2 A;  4C8K A;  4C8O A;  3F73 A;  1RTD A;  3RR7 A;  4DQS A;  2XO7 A;  1NKC A;  4ELT A;  4KFB A;  2LSN A;  4DU1 A;  4DSE A;  4Z4E A;  2XY5 A;  1ITG A;  3HVR A;  4E1N A;  4FJ7 A;  2E4L A;  1HNV A;  3ALY A;  1EP4 A;  1HMV A;  1RT5 A;  3NGY A;  1S1V A;  4HHT A;  2FBV A;  2QKB A;  4BDP A;  1WAF A;  4B9S A;  1NK6 A;  1JL2 A;  3AVL A;  1CXU A;  4CF8 A;  3TAE A;  3KLF A;  3KLI A;  4O4G A;  3WNE A;  4FM1 A;  3HM9 A;  1SL2 A;  3RWU A;  4CES A;  4F8R A;  3SV4 A;  5DMR A;  4DTR A;  2HND A;  1J9A A;  4DF4 A;  2FBY A;  4CEO A;  2Y1J A;  3H08 A;  3MEE A;  3TR8 A;  4HTU A;  4K8Z A;  4AIL C;  3SZ2 A;  3NE6 A;  2HHU A;  1TKT A;  4Z0U A;  1CZB A;  3OS0 A;  1NOY A;  3PO5 A;  1SL0 A;  4IFV A;  1JLB A;  4R5P A;  2DTU A;  4CJW A;  4EZ6 A;  2KZZ A;  4CFC A;  4E7H A;  3DRS A;  4N5S A;  3VN5 A;  3L3V A;  1EXQ A;  4CJS A;  3AVH A;  4PQU A;  2FBT A;  3AVK A;  3DYA A;  4KTZ A;  3M8S A;  3L8B A;  4FLY A;  3SNN A;  2KFN A;  1J54 A;  4OKK A;  3HJF A;  2PZS A;  4F4K A;  4FJG A;  1RBR A;  3SV3 A;  4AHS A;  2F8S A;  3IG1 A;  4ID1 A;  4HCB A;  3U3Y A;  3TAF A;  3NFA A;  2G8U A;  3TAM A;  3RRG A;  2D5R A;  4TSX A;  3ISN C;  2JGU A;  3HP9 A;  4CEQ A;  4M3T A;  3ZSY A;  3RTV A;  4OJR A;  1S1W A;  2IGI A;  3KKS A;  4AHV A;  4RW7 A;  2YV0 X;  1CLQ A;  4FLV A;  4ZTF A;  1U45 A;  3PX0 A;  2XY7 A;  1J53 A;  1YTA A;  4FW2 A;  4CJQ A;  3VQ7 A;  2VWJ A;  1TV6 A;  2JLE A;  3LP0 A;  2YHA A;  3VA0 A;  4BWM A;  2IDO A;  4KI4 A;  4F2S A;  1BIS A;  4BAC A;  4ELV A;  1QSS A;  3VQD A;  1JLC A;  3HYF A;  5J2M A;  4FJN A;  4DQR A;  4FK4 A;  1L3T A;  2X6N A;  1S6Q A;  2R7Y A;  1ASV A;  3LPU A;  5HRP A;  4FZX C;  1CZ9 A;  3QIN A;  3AVC A;  3V1R A;  4DQI A;  2EX3 A;  4CIE A;  3AVB A;  1D8Y A;  3PUF A;  5CY4 A;  3LZI A;  2ITG A;  1JLQ A;  3O4N A;  4B8C A;  4F3O A;  4Z4I A;  2A1R A;  3K5M A;  2HHQ A;  3ZSW A;  3DLR A;  1S9E A;  4M45 A;  1SKR A;  4FJM A;  2XY8 A;  1X9M A;  1NK9 A;  3ZSR A;  1QS4 A;  1G15 A;  1XC9 A;  1ZBL A;  3KD1 E;  3L3U A;  2GBZ A;  5FDL A;  4M3Z A;  4I9Q A;  3KIO A;  3KLG A;  3AVN A;  1WNS A;  1W9H A;  4B9L A;  3T19 A;  1HPZ A;  3O3H A;  4CHN A;  1LV5 A;  3DMJ A;  3C95 A;  4FLU A;  1RTJ A;  4CGF A;  2BDP A;  4B9V A;  3RR8 A;  2HHX A;  4OLA A;  3VQ9 A;  3QEI A;  3CM5 A;  3CQ8 A;  2GV9 A;  3NDK A;  5HBM A;  1LWC A;  3F9K A;  5HP1 A;  4KHS A;  2HMI A;  4B9N A;  3RMA A;  3ZCM A;  4CK3 A;  3L2U A;  4CFD A;  3L2V A;  3IS9 A;  1RCH A;  3E01 A;  2DFE A;  4FLZ A;  5CYM A;  3AA3 A;  3HPO A;  1GOC A;  5T7B A;  4CHY A;  1D5A A;  1NKB A;  1LW0 A;  4KHY A;  3HO1 A;  1RDA A;  2HB5 A;  4CJP A;  3V9W A;  4E7J A;  4E0D A;  3IRX A;  4DSJ A;  3WNH A;  3P83 D;  4RW9 A;  2OZS A;  1VSJ A;  1B92 A;  2OPQ A;  1QQC A;  1X9S A;  1WLJ A;  1WSF A;  3THV A;  2PYL A;  1VSF A;  1TKX A;  4N76 A;  5CZ2 A;  4H8K A;  4JRP A;  2IAJ A;  4FW1 A;  2D0C A;  3M8Q A;  3PY8 A;  1QHT A;  1W0H A;  1F21 A;  4LSL A;  4M3U A;  3ASM A;  1U49 A;  4CF0 A;  2KTQ A;  1C0U A;  1C1A A;  5CYQ A;  4EP4 A;  3V6D A;  4E1M A;  3O3G A;  2BGG A;  4B9U A;  3DLE A;  3LP3 A;  4CEE A;  4N56 A;  2D0A A;  4CJ3 A;  3SJJ A;  3LAM A;  1GOA A;  3S3O A;  2Q3S A;  1A5W A;  3U3G A;  4DU4 A;  1A5X A;  1VRU A;  2X6S A;  4KAZ A;  4DTX A;  5C25 A;  4EZ9 A;  2FC0 A;  3CG7 A;  3DLH A;  3DLG A;  4K8X A;  4IFY A;  3DI6 A;  4FYD A;  1KVB A;  4CGD A;  2YKM A;  3NBP A;  2Z1I A;  1T8E A;  3MEC A;  3NF9 A;  4DTO A;  4DSL A;  4B9T A;  5D3G A;  3NF8 A;  4O0J A;  1YTU A;  1LAW A;  2IS3 A;  4M3R A;  5J2N A;  3NGI A;  4LH4 A;  3I8D A;  1A5V A;  2ZQB A;  2YKN A;  2DY4 A;  3MED A;  4FCY A;  4F2R A;  5HRR A;  4DTS A;  1KSP A;  4H4M A;  4CIF A;  1UWB A;  2P5O A;  1WAJ A;  4KV8 A;  3AO1 A;  4QAG A;  3K59 A;  3TAR A;  3KKR A;  2XHB A;  1GOB A;  4FK0 A;  4O0I A;  2F8T A;  4KRE A;  3AVJ A;  4DTP A;  3AO4 A;  4G1Q A;  4B08 A;  4CER A;  4FVM A;  1LW2 A;  4AHT A;  1VK0 A;  4IBN A;  4L8R B;  3NH1 A;  3S3M A;  3QNN A;  4W5N A;  3JSM A;  4I2Q A;  4IDK A;  4CJE A;  1Q9Y A;  3MAQ A;  4KHQ A;  3QIO A;  2HHS A;  1BGX T;  1RT3 A;  4OPJ A;  4PWD A;  1NJW A;  3UIQ A;  2GUI A;  1JLE A;  2XRI A;  4OGE A;  3VQA A;  4KO0 A;  3SQ2 A;  3QEV A;  3OY9 A;  3QER A;  4OLB A;  4EP5 A;  4FXD A;  4CEZ A;  4DSK A;  3MEG A;  3P1G A;  4KTQ A;  1U04 A;  3RRH A;  3L2W A;  3SCX A;  3OVN A;  1BL3 A;  4CE9 A;  4CJ5 A;  4DLE A;  1ZBH A;  4CEB A;  2HHW A;  2O4G A;  3ZSV A;  1EET A;  4CED A;  1C6V A;  4CJ4 A;  4CJU A;  5KTQ A;  3TAP A;  2G8W A;  3DRP A;  4Z4F A;  5HRO A;  2VG7 A;  3OYA A;  4O44 A;  3HPG A;  5KI6 A;  1SKS A;  4OKE A;  2F96 A;  3CYM A;  4IG3 A;  1J5O A;  4I9L A;  2VG5 A;  4KI6 A;  1HJR A;  2B4J A;  1RBU A;  1DLO A;  4LD0 A;  1QE1 A;  1TGO A;  3CFO A;  3B6P A;  3P5J A;  3T1A A;  3HP6 A;  1U48 A;  4CFA A;  4E3S A;  3SUN A;  3DLB A;  4JS5 A;  3HK2 A;  3V9Z A;  2A1S A;  4DFP A;  1NJY A;  1D9F A;  1RBS A;  1VSL A;  1SUQ A;  4DTM A;  3SPY A;  4CEF A;  3QES A;  3SQ1 A;  4CJK A;  1T03 A;  5C24 A;  1VSM A;  4HUE A;  1UA0 A;  1TKZ A;  1RT6 A;  1I3A A;  3G10 A;  4CHQ A;  5SZT A;  4C8N A;  3NAE A;  4I7F A;  1R0A A;  4ELU A;  4NCG A;  1TK0 A;  4M3Y A;  3NHG A;  3AA2 A;  3K5L A;  1EX4 A;  4DU3 A;  1BQM A;  3VQB A;  2W42 A;  2ETJ A;  5E41 A;  4IG0 A;  3OS1 A;  1BHL A;  1EKE A;  3K58 A;  4AHR A;  4DLG A;  4RW8 A;  3TAG A;  4FK2 A;  4IKF A;  1UA1 A;  4DFK A;  1IKW A;  2YNF A;  3L2Q A;  1RTH A;  2X74 A;  4Z4H A;  3OYB A;  3M8P A;  4CGJ A;  3LDS A;  1NK4 A;  1N5Y A;  1FKP A;  1C1B A;  1WN7 A;  3LAN A;  4PA1 A;  4LH5 A;  1HYV A;  4YNQ A;  3O3F A;  3SUQ A;  4FJK A;  2PYJ A;  5JS1 A;  2G8I A;  4YFU A;  4J2E A;  3KJV A;  3OYL A;  3NF6 A;  1RBV A;  3SI6 A;  2YHB A;  3O4Q A;  1IG9 A;  4NCB A;  4JLH A;  1RT2 A;  1RT7 A;  3LZJ A;  5C42 A;  3VQQ A;  1SKW A;  3DRR A;  4RW4 A;  5HRS A;  4RG8 A;  3DOL A;  5J1E A;  4LY7 A;  3QO9 A;  4DG1 A;  5J2P A;  3VQ4 A;  5J2Q A;  4ZHR A;  2QK9 A;  4Y1D A;  4CF2 A;  2KQ2 A;  4NYN A;  3V1Q A;  4KKO A;  3BDP A;  1HQU A;  4CJT A;  3EYZ A;  3KTQ A;  1YT3 A;  2B5J A;  4DTN A;  3QLH A;  1RDB A;  2VWK A;  1JLG A;  4CF9 A;  3D0P A;  4Z4G A;  1JXE A;  1Z25 A;  3RMB A;  1VSH A;  1O1W A;  2RPI A;  3K2P A;  1RIL A;  1XI1 A;  2WON A;  4C8M A;  1HYS A;  3V9S A;  4KB0 A;  4OVL A;  3OYJ A;  1ZBF A;  2IOC A;  3ZSQ A;  1KTQ A;  4JS4 A;  4LSN A;  3S3N A;  3WNG A;  1RNH A;  1UOC A;  4KHN A;  1C0M A;  1IKX A;  4KTW A;  3OJU A;  2G8H A;  4W5Q A;  5DK5 A;  3QET A;  1KLN A;  1IH7 A;  1KVA A;  3TAB A;  2PY5 A;  3L2R A;  3DLK A;  4CEA A;  2XY6 A;  1T7P A;  3QEX A;  4DMN A;  5CZ1 A;  4ZTJ A;  4DTJ A;  1YVU A;  3ZT0 A;  1NK7 A;  1DTQ A;  4CF1 A;  1B9F A;  3HPH A;  1TKD A;  3M8R A;  4BDY A;  4PY5 A;  1KRP A;  1RDC A;  5SWM A;  1JL1 A;  1KCF A;  3PX6 A;  1NK0 A;  1RT1 A;  3PV8 A;  4Z4C A;  2QKK A;  2Z1J A;  4Y1C A;  3V81 A;  2ZD1 A;  4FJL A;  4FJ9 A;  3G0Z A;  4E19 A;  1U4B A;  3KLH A;  4DSI A;  4FJ5 A;  1WSG A;  3V4I A;  5KRS A;  1XWL A;  2G8F A;  4CJV A;  2E6M A;  3ZT3 A;  4CHP A;  4CGG A;  4J2B A;  3U6F A;  3NCI A;  4AH9 A;  3SQ4 A;  1SV5 A;  1REV A;  3BGR A;  4WE1 A;  1SL1 A;  4N41 A;  3OYD A;  1QSL A;  2ZE2 A;  1NK5 A;  5KGX A;  1BI4 B;  3LWM A;  2X78 A;  3FFI A;  3T3F A;  1IKV A;  2OPS A;  3A2F A;  3ZT4 A;  4DQQ A;  4NYF A;  1BIU A;  1QSY A;  1L3V A;  1S5J A;  3RMC A;  4B8A B;  1TK8 A;  1N6Q A;  3LP2 A;  4HUG A;  3OYK A;  3AV9 A;  1VRT A;  3ZT1 A;  1ASU A;  3NF7 A;  4DSF A;  3TI0 A;  1S1U A;  1LWF A;  4O5B A;  2Z1G A;  4OKJ A;  4GMJ B;  3K57 A;  4DS4 A;  3SUO A;  1XHX A;  4DFM A;  3RMD A;  4KPY A;  1JLF A;  4FJ8 A;  4B3O A;  2HNY A;  2KW4 A;  1L3S A;  1FXX A;  3IAY A;  1RT4 A;  4CGH A;  3AO5 A;  3C6T A;  3OYM A;  3QEW A;  4M3X A;  5FRN A;  4QOZ B;  3LAK A;  3KK1 A;  3OYI A;  1NKE A;  4M42 A;  3VQ6 A;  3AVI A;  4W5R A;  3EZ5 A;  1TK5 A;  2Y1I A;  3PX4 A;  1NOZ A;  3OYH A;  2EHG A;  3I0R A;  1Q8I A;  4OGC A;  3ZSZ A;  2YNI A;  1VSE A;  1Z26 A;  3VQP A;  4DTU A;  4I2P A;  3SQ0 A;  1ZBI A;  2OYQ A;  3NH0 A;  2QXF A;  3V9X A;  2HHV A;  2WOM A;  3HT3 A;  3ZSO A;  3ULD A;  2AJQ A;  1MU2 A;  4CGI A;  3OYG A;  1TL1 A;  4CEC A;  3AA4 A;  3LAL A;  4H4O A;  3LP1 A;  4KHW A;  4CHO A;  3KK2 A;  1BQN A;  1HNI A;  1TVR A;  1BI4 A;  2YNH A;  2HW3 A;  4O55 A;  4HCC A;  3SPZ A;  4J2A A;  1KVC A;  1FKO A;  3HST B;  4CJL A;  3MXJ A;  2KFZ A;  5FRO A;  1CXQ A;  5I3U A;  1U47 A;  3LWL A;  4QCL A;  1IKY A;  1RTI A;  2P1J A;  4HUF A;  3SUP A;  2HNZ A;  4PUO A;  4W5O A;  2DFH A;  4W5T A;  5K14 A;  4FLT A;  1IO2 A;  1RDD A;  4OPK A;  2E6L A;  1WSJ A;  2BAN A;  3KK3 A;  4CFB A;  5EU7 A;  3HXM A;  4MFB A;  5KGW A;  2KZM A;  1KLM A;  3WNF A;  1X9W A;  4NCA A;  1JXB A;  2P51 A;  3AVM A;  5KRT A;  3LPT A;  4BDZ A;  4E89 A;  1HYZ A;  1K6Y A;  3CFR A;  4CIG A;  3VQC A;  4CCH A;  4FLW A;  3ZSX A;  1HRH A;  3AA5 X;  1D9D A;  4CK2 A;  4E7K A;  4KRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...