4CFAA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 53
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cfaA00
1HMVA 4B9LA 4N76A 4IFYA 4DTMA 5C25A 5JS2A 3K57A 3EYZA 1SKSA 4KRFA 4ICLA 1HNIA 4CJ3A 2F8TA 2B6AA 1VSFA 3TR8A 4CECA 4CCHA 1UAXA 4IG0A 4E7LA 2OYQA 2OPPA 2HHWA 4H4OA 4KB1A 2IGIA 4E7KA 4PUOA 3NGYA 2PZSA 4W5TA 1REVA 4DTUA 3C6TA 4E3SA 3AVNA 3QESA 1LWEA 4CEBA 5KGXA 1LV5A 1BCOA 2BGGA 3D45A 1SKWA 4FJ7A 3NE6A 1D5AA 1U4BA 1Q9YA 1KSPA 2E6LA 4KI4A 4KTZA 1VSKA 3T19A 4RW8A 1L5UA 2X6NA 2G8VA 2KW4A 4F2RA 3A2FA 4KFBA 1CXUA 3LAMA 4FM2A 1Q9XA 3CFOA 1LAVA 4B08A 2A1RA 1NK0A 1Q8IA 3NHGA 5FDLA 4DFMA 3U3GA 5J1EA 3TI0A 4M3WA 3HYFA 3DRRA 4IDKA 4EP4A 3I0RA 4DTOA 2HHQA 1WLJA 4XIUA 3DLRA 1VK0A 4CHNA 4F3TA 1A5XA 5KRTA 4KAZA 4B9MA 3LZIA 3NF6A 3DLHA 1RNHA 1KCFA 1HQEA 1T7PA 3LZJA 2OPRA 3AO1A 5FROA 1BHLA 1VSMA 2ZQBA 3TAMA 3OYGA 3QETA 4ZHRA 4E1NA 3HPGA 4DTJA 3O3FA 4DSFA 2XY5A 1ZBIA 1D9FA 3B6OA 4Z4IA 3OYDA 2IC3A 4KHYA 3WNGA 2HHTA 4PA1A 4Q5VA 4DF8A 3S3MA 3CM5A 4Z4FA 1TKDA 4N47A 1EP4A 2O4GA 4RW9A 5HRRA 4O0IA 3L8BA 2X6SA 2DY4A 2VWKA 4Y1DA 2JLEA 1EETA 4FVMA 3M8SA 1JL2A 2RN2A 3HPHA 4C8MA 3MAQA 1RDCA 2VG5A 3VQ7A 1Z25A 2G8FA 2BDPA 1R0AA 3KTQA 4FZZA 1L3SA 1VSEA 2IAJA 3NGIA 1HYZA 3V4IA 1IH7A 1ASUA 2B4JA 2FBTA 4CJ5A 4M3YA 4F2SA 1WSJA 3G0ZA 1HJRA 3K2PA 3I8DA 4AHRA 3CFRA 1UOCA 4DSLA 3KK3A 3V9WA 4FW2A 4OGEA 1BCMA 5T7BA 1SL1A 1S9EA 4FK0A 3L2UA 4FJLA 1J53A 1GOCA 4TSXA 4DWIA 2IOCA 1QQCA 1RCHA 2DFHA 3WNEA 3OJSA 3L3UA 3V81A 2HHVA 4QOZB 4Z4CA 1X9MA 3AV9A 2EX3A 2G8UA 1U47A 3PY8A 4FJXA 1BIUA 2FC0A 3O4NA 3DRPA 2P5GA 1S1VA 3V1RA 3HT3A 1JLBA 1U49A 3ZT2A 4CGFA 2Y1IA 3VN5A 1WN7A 4FLTA 3L2WA 5HRPA 3K5LA 3OYNA 1T8EA 4HHTA 4N41A 2HW3A 3RMDA 4KREA 1SUQA 3KK1A 4EZ9A 4K8XA 3OYIA 1G15A 1LAWA 2GUIA 5FRMA 3OJUA 4DFKA 4J2DA 3HJFA 4B9VA 3LAKA 3SQ4A 3JYTA 3SUPA 2HNDA 4CJQA 1KVAA 4Z0UA 3LWLA 4HUFA 5KGWA 2G8IA 4J2BA 4Z4GA 4C8LA 4DLEA 1BI4B 1YT3A 3LALA 1D9DA 3AO4A 2DFEA 4CFBA 3RWUA 1JLEA 4DS5A 4HCBA 3WNFA 3ZSRA 3DLEA 2XO7A 1FXXA 1A5VA 4RW4A 3KKRA 3VQPA 3NCIA 5CYQA 3V9UA 2FBYA 3VQAA 3QEXA 1CZ9A 1KFDA 3VQCA 3TAPA 1TKZA 3AA2A 3SNNA 3OYLA 2O4IA 1QE1A 2VG7A 4AHUA 1N5YA 4KTQA 1JLQA 4NCAA 5CZ1A 4CESA 4PWDA 1TV6A 2X74A 3HSTB 4IBNA 2HNZA 4BWMA 3LANA 4BE0A 2ZD1A 4CJUA 1CZBA 3TAEA 1X9SA 3QEIA 1BQMA 4M41A 1JL1A 3MXMA 2LSNA 3V1OA 4BDYA 4E19A 4FCYA 1S9GA 3AO3A 3MXIA 1TKTA 2P1JA 4CEFA 2GV9A 3AVLA 1YVUA 1QSYA 4LD0A 4DSJA 4RW6A 3SUQA 1S1TA 4ELTA 3DMJA 5CY4A 3CFPA 4ELUA 1RDBA 1KFSA 1B9FA 2G8WA 4CF8A 4O5BA 4JLHA 3KK2A 3SJJA 4B8CA 1S6QA 2D5RA 3RMAA 4CGDA 3I0SA 1C1AA 2VWJA 5HP1A 1UA0A 1J9AA 3HL8A 5SZTA 3IG1A 1TGOA 4CF1A 1BIZA 4CIFA 4FLVA 3V6DA 3OS2A 1RT2A 1XHZA 2X78A 4FJJA 3PO4A 2XY8A 3KIOA 4KHWA 1RBUA 3DM2A 3RMCA 5I3UA 1FK9A 3O4QA 4OLAA 3VA3A 1WAJA 3L2QA 1NJWA 1TKXA 5J2MA 1NKBA 2OPQA 1RT3A 2Z1GA 4BE2A 3ALYA 4HVJA 1NK4A 3KD1E 3QEVA 3K59A 4E89A 1XI1A 4FJMA 1KTQA 4YFUA 3NH1A 4HTUA 4DF4A 1JKHA 3ZSQA 3ZSVA 2YV0X 1ZBLA 4K8ZA 5JS1A 3TAFA 1JXEA 1WSIA 4CGGA 3JSMA 4AHTA 4FLUA 3TABA 1WSEA 3LWMA 1QSLA 3NH2A 3HPOA 3L2VA 2QK9A 1C0MA 3ULDA 3AVBA 2OA8A 2VG6A 4MFBA 1IKVA 4FLYA 1J5OA 4C8OA 4DQIA 3NFAA 3O3HA 4G1QA 1RBVA 1Y97A 4DQSA 1XC9A 4CFDA 3T3FA 1BGXT 1LWCA 3AVJA 3M8QA 3M8PA 2XHBA 4KKOA 4OKEA 5CYMA 3O3GA 3PV8A 2G8KA 1ZYQA 1U48A 5D3GA 3CYMA 4LY7A 3OS0A 4M3TA 4ID1A 3T1AA 3PX6A 4FM1A 1KVBA 3KLFA 1VSIA 1FKPA 2KQ2A 4O55A 3AA3A 4ID5A 4QAGA 3THVA 4KTWA 4M45A 1RBTA 2WOMA 1KVCA 3LP2A 4DFPA 3HM9A 1L3VA 5HRSA 4PY5A 2KZZA 4DTRA 1NJXA 5C42A 1IKYA 5EU7A 1B9DA 2P51A 4HUEA 3QNOA 3SQ2A 4W5RA 5HROA 3QEPA 4FZYA 4FJ9A 3SQ0A 4FJ8A 2G8HA 4L8RB 3DRSA 1RT4A 3SUNA 1NKEA 3TWHA 4NCBA 3CG7A 3LPTA 3V1QA 1EX4A 4GW6A 1TAQA 3VQBA 1ASWA 3MEDA 3KKSA 1BISA 4QCLA 5J2PA 1BI4A 3LDSA 3QERA 4FW1A 4CF9A 4DFJA 1NJYA 1FKOA 1ASVA 2Z1IA 4FJGA 4OKKA 3AA4A 3DLKA 4CHQA 1HYSA 3NF7A 3MEGA 1EXQA 3V9SA 2BANA 1IG9A 4KHSA 4FLXA 1KLNA 4O4GA 3TANA 1NK6A 1RT1A 1RBSA 3ZSZA 1NK9A 4M42A 3OYMA 4I7FA 4F8RA 2DTUA 2Z1JA 4EZ6A 1C0TA 4OPJA 1B92A 1KLMA 4Y1CA 4DU4A 2OZSA 2AJQA 2RF2A 3OYFA 3IRXA 3PUFA 1RDDA 3KLEA 3QEWA 5KTQA 4CF0A 1S5JA 4I9QA 3MECA 2YHBA 3ZSXA 1DTTA 3LP3A 3QLHA 2NUBA 1ZBHA 4CJPA 3ZCMA 3HK2A 4I2PA 5C24A 4LSNA 1W0HA 2I5JA 2Q3SA 3DYAA 4CJSA 2XY7A 3SUOA 3BDPA 1UWBA 1BL3A 1RT7A 4DTPA 3BGRA 2JGUA 1WSHA 3DLGA 1LWFA 3RR8A 3PX0A 3F73A 3LP1A 4O44A 3ZT3A 1KRPA 5FRNA 4OPKA 2HNYA 3OYBA 4AILC 3S3OA 4W5NA 1X9WA 4FJ5A 4DTSA 1BQNA 4E1MA 4DLGA 3SQ1A 4FJHA 1WNSA 4FLWA 1D8YA 3HP9A 4C8KA 4CEAA 4B9NA 4DQRA 4CHOA 1TAUA 1F21A 4B8AB 3OS1A 4F3OA 3OYAA 1S1WA 3TAGA 4C8NA 4FK2A 3E01A 3K5MA 3DOKA 1GOBA 3ASMA 2D0CA 3HXMA 3SCXA 2YHAA 3V9ZA 1VRUA 2OZMA 1U04A 4OVLA 3C94A 4CEZA 2YKNA 3NDKA 3NF8A 3TAQA 3HO1A 3OY9A 4OKJA 4R5PA 1S1UA 3U3YA 4HCCA 4CFCA 4DU1A 4GMJB 4RG8A 3ZSOA 3QO9A 4ZTFA 3OYHA 2HHUA 3QINA 1JLFA 1RTHA 5CZ2A 3QNNA 4CJRA 5E41A 3AA5X 3ITHA 1NK7A 1QSSA 1EKEA 2XRIA 4CK2A 1QTMA 2KZMA 4CIGA 3ZT0A 2HVHA 4WE1A 4AH9A 4CF2A 3VQEA 4DQQA 1C1CA 3AVGA 4CJWA 3KJVA 1RT5A 4JRQA 3PO5A 3ZT1A 2Y1JA 4EP5A 2D0BA 1WSGA 3SI6A 4Z4EA 1RT6A 1VSJA 3IS9A 2YNFA 4CERA 4OGCA 1U45A 1QS4A 4NYNA 3VQDA 3OYJA 1SL0A 4M3ZA 2F8SA 1RDAA 2KFNA 1TVRA 3RRHA 1MU2A 3LPUA 4FM0A 4DSIA 4IKFA 2RPIA 4E7JA 2HHXA 4DS4A 4BDZA 4Q0BA 2KTQA 1O1WA 1IKWA 3AVMA 4CJFA 4JRPA 1C1BA 3K5OA 4DSEA 4B9SA 4M3RA 4GVMA 1HRHA 3SYZA 1UA1A 3VQ8A 3AO5A 3DLBA 1C0UA 4CJVA 4CIEA 4W5OA 4KO0A 3RMBA 1HNVA 1RILA 4KHNA 4CHZA 1NOZA 3RRGA 4CJLA 5J2NA 4B3OA 1I3AA 4O0JA 1L3TA 2QKKA 4AHCA 3ZSYA 3VA0A 3NBPA 1S1XA 3VQ6A 3QIOA 4UQGA 1LW2A 5J2QA 5HLFA 2HVIA 1W9HA 3RTVA 1LW0A 3NF9A 4FLZA 1SL2A 1RBRA 1TL3A 3S3NA 4ELVA 3KLGA 3ZT4A 1HQUA 1JLCA 3MEEA 1IO2A 1NKCA 3ZSWA 4CHYA 3AVKA 1IKXA 4BWJA 2F96A 3AVCA 1XHXA 3P5JA 4KHUA 2WONA 2YNHA 4J2AA 3LP0A 4BACA 2Z1HA 1WSFA 3L2RA 3CQ8A 1CLQA 1HYVA 1XWLA 3MXJA 3VQQA 4CJTA 3UIQA 4DG1A 4CK3A 1RTJA 4KPYA 4W5QA 1VRTA 1VSHA 1JXBA 3K5NA 2R7YA 2HMIA 4I9LA 4OJRA 3NAEA 3G10A 4Z4HA 3PX4A 3KLIA 5DK5A 1X1PA 3VQ5A 2ATQA 4DTXA 1T03A 3HP6A 5HBMA 2E4LA 5K14A 2HB5A 3SV3A 4IG3A 3V9XA 4FYDA 1I39A 1TK0A 4FXDA 1N6QA 2KFZA 4CEDA 1YTUA 4LSLA 3VQ4A 4DQPA 4CFAA 3ISNC 4H8KA 2ZE2A 3NGZA 2PY5A 4JS4A 4FJNA 2EHGA 2XY6A 2A1SA 3C95A 3OYCA 2W42A 1NK5A 4CGIA 3B6PA 3P83D 3D0PA 3CM6A 5KI6A 4B9TA 3FFIA 1QHTA 5HRNA 1NK8A 2FBXA 4CGHA 4N5SA 3KD5E 2B5JA 4YNQA 3DI6A 1WAFA 4CEEA 1L3UA 2D0AA 2DFFA 1VSLA 2RKIA 4OLBA 3SZ2A 1NOYA 4E0DA 2YKMA 2YNGA 4JS5A 1TK8A 4H4MA 4KV8A 4KI6A 4FK4A 2IS3A 2OPSA 2IDOA 3NH0A 5DMRA 1HPZA 2QKBA 4DMNA 2PYJA 4KB0A 4I2QA 4LH5A 1GOAA 1NJZA 1RTDA 1JLAA 4N56A 3U6FA 2PYLA 3OYKA 1C6VA 4DSKA 1RTIA 5SWMA 2QXFA 1TK5A 2E6MA 4NCGA 3S9HA 3DOLA 3AVIA 4RW7A 3SPZA 4B9UA 1ZBUA 4MQ3A 4E7IA 3AO2A 1SV5A 3TARA 4CGJA 4FJKA 4HUGA 1A5WA 4PQUA 4DU3A 4AHVA 5I42A 3AVHA 2ETJA 4CEQA 2HHSA 1K6YA 3AVAA 2FBVA 3C6UA 4CE9A 4FZXC 3RR7A 2GBZA 1JLGA 1S6PA 3KLHA 1VSDA 3P1GA 4KHQA 3OVNA 4BDPA 4CJKA 3EZ5A 2P5OA 4E7HA 4CK1A 4M3XA 3QIPA 3SV4A 1TL1A 4NYFA 3M8RA 1SKRA 3K58A 1ITGA 1Z26A 5KRSA 2BE2A 1YTAA 4M3UA 4CHPA 3WNHA 1T05A 1J54A 1ZBFA 3SPYA 3IAYA 3HVRA 1DLOA 1CXQA 4AHSA 4CJ4A 3VQ9A 4IFVA 4F4KA 4FJIA 2ITGA 3H08A 4DTNA 2YNIA 3L3VA 3OYEA 4LH4A 3AVFA 3EY1A 4ZTJA 3F9KA 4CEOA 3HVTA 4CJEA 1DTQA 4BE1A 4J2EA
chains in the Genus database with same CATH superfamily
4B9LA 4N76A 4U67L 4IFYA 4K43A 5TKYA 2P9PB 5KPRA 2HMPA 4KHPK 3O9SA 2QWPA 1JJ2M 1HNIA 4CJ3A 1VSFA 4BR5A 4CCHA 1UAXA 4CJ7A 4E7KA 3NGYA 4W5TA 1REVA 4DTUA 3E1YA 4IZ9A 1LV5A 2BGGA 3D45A 3A5LC 1D5AA 1U4BA 4KI4A 1VSKA 3T19A 4RW8A 3THXA 2G8VA 3LM9A 4DV0K 4H5WA 3A2FA 4KFBA 1CXUA 3CFOA 2A1RA 3NHGA 3U3GA 4M3WA 4IDKA 4DTOA 2A41A 3I0RA 1WLJA 4XIUA 3DLRA 2W6LA 4KAZA 2Q1NA 3AO1A 3QETA 1S72N 2XY5A 2QWLA 1VHXA 4JK8A 5AZIB 1D9FA 3OYDA 3WXJA 2IC3A 3D7EO 3WNGA 4Q5VA 4DF8A 1K8AO 2E2NA 1VQMN 3TSPA 2DY4A 3SBGA 2RN2A 5BN9A 3LDNA 5LJWA 1Z25A 2BDPA 3D2FA 3QFPA 2YCHA 1L3SA 4ISFA 1TYQB 4RTFD 1HJRA 1NMNA 5CR4A 1UOCA 3EE8A 3V9WA 4OGEA 1S9EA 4Y0WA 2IOCA 3VMFB 2GWJA 1RCHA 3WNEA 4FWQA 4FO0A 3CPWM 1U47A 3AAQA 1BIUA 4QS9A 3HT3A 1U49A 2BUPA 4JI2K 4CGFA 2ZF5O 3K5LA 3OYNA 2HW3A 3KK1A 1VQ9N 3VF6A 4K8XA 3A5OC 1Q82O 1G15A 2GUIA 1NLVA 4B9VA 3JYTA 2HNDA 4JN4A 4CJQA 3LWLA 3U8XA 4J2BA 4Z4GA 1LOTB 1BI4B 1V4SA 3EE9A 1YT3A 3LALA 3E66A 3WT0A 1D9DA 2DFEA 1JLEA 4YOTA 1W2BM 4DV3K 4RW4A 3CI5A 3CJ1A 3JAMO 3SBTA 2FBYA 3QEXA 1KFDA 1XNQK 3OHRA 3DWLA 3SNNA 1JLQA 4CESA 4BWMA 2ASOA 4FSVA 4EHUA 3HRGA 2LSNA 1QZ5A 4BGAA 4E19A 2P9LA 3AO3A 4C23A 2HF3A 1R59O 2GV9A 2HHVA 1QSYA 4CI6A 3SUQA 4FOEA 5CY4A 4ELUA 2HBKA 1B9FA 2V51B 5AQKA 2KHOA 1S6QA 2D5RA 3RMAA 2O8CB 2JWLA 1C1AA 1HX1A 4FWMA 2WC9A 3OS2A 3PO4A 3ZEUB 3RMCA 1QVFM 1QQNA 2CGJA 3VEVA 3WEEB 1TKXA 4MDAA 2Z1GA 1NK4A 3KD1E 1JCEA 4WQ5C 3K59A 4DUZK 4E89A 1BOTO 3A0IX 4H0XB 3L0QA 2GEMA 1YAGA 1ZBLA 1JXEA 1WSIA 4AHTA 3LWMA 3NH2A 3HPOA 4IFEA 1IKVA 4PKHA 4G1QA 5GAHP 1QZ6A 3PV8A 4PKIA 4WQ4C 3OS0A 1KVBA 3BP8A 4QAGA 1WUAA 1RBTA 3LP2A 3M6GA 4WFBL 2V7YA 4DFPA 1L3VA 2KZZA 1NJXA 1IKYA 5EU7A 3SMPA 2QM1A 3EKSA 3CJ7A 3RSEB 5JMVA 4FZYA 3SQ0A 4FJ8A 4WQ5A 1RT4A 3CG7A 2P9KA 4M7YA 4ISEA 4JD2A 3KKSA 5J2PA 3LDSA 5ELZA 3VEYA 3E9OA 4DFJA 1ASVA 4K25A 1CZAN 3DLKA 3V9SA 5JICA 1KLNA 4BY9C 3RVCA 4DV6K 1RBSA 3ZSZA 3BF1A 2P9IA 3DXKA 5MLCQ 2DTUA 2UUBK 2Z1JA 1C0TA 3IRXA 2FF6A 3PUFA 3MWTA 3KLEA 4CF0A 1TUYA 3ZSXA 2NUBA 5C24A 1U6ZA 1OH7A 4CJSA 2QWQA 3BDPA 1UWBA 1RT7A 1T6CA 4E1JA 3DLGA 1LWFA 3SAFA 4DR5K 4OPKA 2HNYA 5AQSA 4AILC 4W5NA 1HKCA 3THWB 4H5NA 4LF5K 1Z6RA 5I9EB 4OX9K 3VGKA 1F21A 1S1WA 3WXKA 3K5MA 3DOKA 3U9DA 3SCXA 2OZMA 4CEZA 3O1WA 4X64K 1NGCA 3OY9A 3U3YA 3O9QA 5EVZA 4CFCA 3CCVN 3C7NB 3NVKA 5GAEP 3KK7A 3QINA 1RTHA 4CJRA 4A57A 1NK7A 4RWTA 3FZHA 3SK3A 4KH6A 2A6AA 2D0BA 1WSGA 5LJVA 2YNFA 4OGCA 1QS4A 2KFNA 2E20A 1MU2A 4FM0A 4DS4A 2KTQA 4FVUA 1O1WA 1IKWA 4CJFA 1E4FT 1N36K 3DLBA 1C0UA 4CIEA 4CJLA 5IWAK 3D2FB 4H0YB 5F2RA 3FR0A 2UXDK 2QKKA 3BY5A 4O8UA 1S1XA 4UQGA 3I55N 5HLFA 3IFRA 4FLZA 2D0OA 1ZBSA 4PL8A 1HQUA 1JLCA 1NKCA 4CHYA 1DT9A 4BWJA 4JKHA 5GIPA 2P9KB 3ZX3A 3ZYYX 4FWSA 3T7ZA 2YNHA 5GAGP 3CQ8A 3UIQA 4LF6K 3VQQA 4CK3A 5BPLA 4W5QA 3CMAN 1VRTA 3OTOK 3G6EN 5JLHA 3A8YA 2PBDA 2HOEA 5HBMA 4PL7A 2E4LA 4H0PA 5K14A 4CBUA 4IG3A 5LY3A 3HBTA 4FXDA 2V7ZA 4DQPA 4DR7K 3NGZA 4JS4A 4FJNA 4GV9A 2EHGA 3OYCA 2W42A 4CGIA 3P83D 3D0PA 4JI8K 4N5SA 3KD5E 3WXMB 3DI6A 1WAFA 3ULEA 1L3UA 2RKIA 1XMOK 4OLBA 2WBNA 4KI6A 3MN9A 2PFUA 3H1QA 2PYJA 4LH5A 1GOAA 1JLAA 3J81O 4LF9K 1NGIA 4WFNL 3OYKA 1IG8A 4JI3K 1GLLO 1RTIA 3IUCA 4MQ3A 3OW2M 3VEOA 3AVAA 2FBVA 3C6UA 5M1PA 4FZXC 3FZMA 3TU5A 4NB4A 4BQLA 3KLHA 1N8RO 3VTHA 4KHQA 3LL3A 3OVNA 4CJKA 3THYA 4CK1A 1VQLN 2ZJPL 4NYFA 3QFUA 1ITGA 3J7YP 5KRSA 2YHWA 3WNHA 5EY4A 1ZBFA 3HVRA 3GG4A 4CJ4A 3VQ9A 4IFVA 2ITGA 3EY1A 4ZTJA 4IOAL 4CJEA 4A5AA 3ATVA 2Q0RA 4J2EA 3H45C 2E2OA 5M1FA 4BRDA 5JS2A 3K57A 2OANA 3EYZA 4ICLA 1HR0K 3P39A 4KH4A 4CECA 1BA1A 4E7LA 2OPPA 2HHWA 1C0GA 4H4OA 2IGIA 3T69A 3C6TA 3HOTA 3QESA 5KGXA 4CEBA 1SKWA 2FLOA 1Q9YA 2E6LA 2KW4A 4JAXA 3ID8A 1Q9XA 1LAVA 3C7NA 2OTLN 5FDLA 2E8AA 1DKGD 3HYFA 4EP4A 4JNEA 1HUXA 4CHNA 3J8AA 2YHYA 5KRTA 4B9MA 3LZIA 3NF6A 1SS6A 1KCFA 3FZKA 4DQ8A 1BHLA 1VSMA 2ZQBA 3TAMA 3ZEUA 4ZHRA 3O3FA 4DSFA 4U7BA 4Z4IA 1MA9B 4KHYA 3AGKA 4PA1A 3S3MA 2A40A 3CM5A 1TKDA 2O4GA 4RW9A 2X6SA 2VWKA 5BR9A 3M8SA 4C8MA 3H1VX 1RDCA 3VQ7A 4K41A 4X62K 3NGIA 5FLXO 1HYZA 2ITMA 1ASUA 5AZIA 5BPMA 1VQKN 3G0ZA 3K2PA 3KZBA 4GKJK 4DSLA 3L6QA 3KK3A 4H0VB 4M63C 2NRRA 4JI1K 4FW2A 1SL1A 3L2UA 3CIPA 3TTCA 5AQJA 3WXIA 3OJSA 1VQNN 3L3UA 4XH1A 2HBMA 2EX3A 2FSKA 3PY8A 2FSJA 3WQUA 4BR4A 1S1VA 3V1RA 3L2WA 1IV0A 4HHTA 4BREA 3OA9A 5C0YA 4DFKA 3LM2A 4J2DA 3SQ4A 1KVAA 4Z0UA 3ZETB 4HUFA 2G8IA 4B1VA 1P8ZA 3LDOA 3RWUA 2IVPA 5FPNA 3DLEA 5M1QA 3DJCA 5JVGL 3KKRA 3VQPA 1KAYA 1VAZA 3VQAA 2Q2RA 2FF3B 1TKZA 4KTQA 4NCAA 1TV6A 4IBNA 4BE0A 2ZD1A 2QWNA 1X9SA 3QEIA 4BR0A 3V1OA 3MXIA 1VQ5N 1TKTA 2P1JA 3ZLJA 4DSJA 4M3UA 3DMJA 5GADP 3CFPA 3WQTA 4CF8A 4JLHA 3KK2A 3SJJA 4A61A 4B8CA 5IT9O 2VWJA 5HP1A 1NMDA 1IBLK 1TGOA 1GLDG 5BN8A 1M1KO 1IJJA 3CHWA 3AARA 4A2BA 2XY8A 3KIOA 3DM2A 1FK9A 4OLAA 3VA3A 3L2QA 4BC3A 5J2MA 3DXMA 1NKBA 2OPQA 3VTIA 1SZ2A 4DV4K 3ZSVA 2YV0X 4K8ZA 1WBBA 3MX5A 4CGGA 3JSMA 4LFCK 3TABA 3GBTA 3L2VA 5FPDA 2QK9A 2D1KA 4K42A 3ULDA 4JKGB 4JV5K 3AVBA 1KAZA 2OA8A 2VG6A 1S22A 3VF2A 3NFAA 1Y97A 3AVJA 2XHBA 4KKOA 4OKEA 5CYMA 2GTDA 3VETA 1OVQA 3CYMA 3F5TA 4F9OA 5KPZA 3PX6A 4FM1A 4BRPA 2ASPA 3KLFA 1VSIA 3P4IA 3EZWA 4M45A 4DQIA 3HM9A 3KWGA 1YI2N 4PKGA 5C42A 1B9DA 4HUEA 4JI7K 4W5RA 3QEPA 1VQ8N 3VEZA 2P9UB 2PAVA 4GW6A 1DGKN 3D2EB 1HNWK 3MEDA 2W6KA 1BISA 4QCLA 3C0BA 5BPNA 3O9TA 1NJYA 2KKZA 4EFHA 3R1XA 3E9PA 4DR1K 4IXCA 2VGNA 4BRAA 4CD3A 1EXQA 2FSNA 5AFUH 4KHSA 1T44A 4FLXA 2CGLA 1NK6A 3G71N 4J8FA 2QTDA 1XQSC 4A62A 4I6MB 4DV7K 4I7FA 3ATUA 4NO7A 4OPJA 4DU4A 4BC5A 3TSUA 4I9QA 1DTTA 1MWMA 4FL9A 1NNEA 3HK2A 4I2PA 4LSNA 1OH6A 2Q97A 1J6ZA 2XY7A 4JYAK 5ADXH 3BEXA 2JWKA 2JGUA 4CBWA 3LP1A 1X3NA 4DTSA 1WNSA 4FLWA 4FWRA 4AM6A 3MWPA 4C8KA 3L4IA 4DQRA 4B9NA 2NRHA 4B8AB 1GLFO 3OYAA 4MLHA 3CCSN 4GVEA 4BGBA 3HXMA 2YHAA 1U04A 3TAQA 2NRTA 4R5PA 4HCCA 1S3XA 3ZSOA 4C1NI 2HHUA 1BO5O 2O8FB 2HVHA 4WE1A 4CF2A 3VQEA 2O8EA 3KJVA 1RT5A 2A5XA 4CZFA 1BU6O 4BRCA 4EP5A 3M5RA 3GE1A 3KHYA 3QB0A 3IS9A 3OYJA 4M3ZA 5M1NA 1EO1A 3LPUA 4DSIA 3CQXA 4Q0BA 1GLEG 1C1BA 4EIAA 4DSEA 4M3RA 5AZJB 4B1XB 3SYZA 3AO5A 1HNZK 3CC2N 4CJVA 4W5OA 4CD1A 3RMBA 1YJ9N 5AQIA 5J2NA 1YF5L 4AHCA 3AY9A 2NZTA 2UUCK 4JD2B 4JKFA 2HVIA 1W9HA 4DV2K 3S3NA 2ZJRL 4ELVA 3KLGA 1OH5A 4DR2K 1IO2A 4O5FA 2D4WA 3AVCA 1HJOA 3LDQA 3VF4A 4KHUA 4LFAK 2GUPA 3EO3A 4BACA 3W0LA 1WSFA 3ZX2A 3L2RA 3P31A 1FW6A 1RTJA 1VSHA 1JXBA 2OTJN 4Z4HA 2NRXA 5DK5A 4NXNK 4DTXA 1T03A 3HP6A 4YDUC 2HB5A 3I8BA 3R9PA 1YTUA 4MO5A 1K8KB 1WOQA 3ISNC 4CZKA 3GL1A 5BRDA 4BROA 3QDKA 5C2DA 2XY6A 1XUPO 3EN9A 3J80O 1SQKA 1QHTA 4BRGA 1Y64A 3S41A 2B5JA 2P9NB 3M1FA 4V19S 1VSLA 3SZ2A 1NOYA 2YNGA 4KV8A 4FK4A 2IDOA 3H46O 3NH0A 1BWFO 1HPZA 3ID6A 4KB0A 3D2EA 1HNXK 1RTDA 4DR3K 3U6FA 4A2AA 4DV5K 1T6DA 3D6RA 3C65A 5SWMA 2QXFA 4AF1A 3TSQA 3S9HA 4NCGA 2O8CA 3AVIA 1ZBUA 5HL7L 3QBXA 4NXMK 2ETJA 2HHSA 1K6YA 3M3ZA 4I6MA 5AQOA 1JLGA 1S6PA 4B3SK 1VSDA 4BDPA 3QIPA 5FPMA 1TL1A 4CZHA 4NLCA 4RCHA 1YTAA 4CHPA 4LFBK 2A42A 3SPYA 3K9KA 3N4PA 3ENBA 1BG3A 3H08A 3O08A 4DTNA 2YNIA 4LH4A 3AVFA 4YOYA 3F9KA 3LDPA 1DTQA 2NNWA 1HMVA 3AGRA 4DTMA 2HHHK 4KRFA 1EQYA 5JVHL 1H1VA 2YI1A 4IG0A 3VEXA 2OYQA 3CCLN 4PUOA 4E3SA 3AVNA 1LWEA 1OVYA 4FJ7A 3PIPL 1KSPA 4KTZA 1L5UA 1XC3A 3GOIA 3UE5A 3MN5A 4DV1K 3MMVA 3FE1A 3QICA 3LAMA 4FM2A 5KQDA 4B08A 1IBKK 4IEIA 3CQYA 4FWNA 3TTDA 1VK0A 4F3TA 1A5XA 2O8FA 3DLHA 2QWRA 5LMNK 1RNHA 3I56N 3LZJA 2OPRA 2E1ZA 4KH5A 4FWOA 4E1NA 3HPGA 3H3OB 3CCRN 3B6OA 4BG8A 4BR7A 4YHHK 3WUHA 3R8EA 3A5MC 2P9PA 2HHTA 2RHKA 3UKUB 4BR9A 4CBXA 4ILJA 4N47A 3L8BA 4Y1DA 2JLEA 1JL2A 5AZJA 3MAQA 4C1NK 2G8FA 1R0AA 1VSEA 3HI0A 4FOIA 1V4TA 2B4JA 2FBTA 1WSJA 3I8DA 1ILYA 3G25A 3CFRA 4YOWA 4DCHA 3H3NO 2VYPA 1IBMK 5T7BA 1BCMA 1K9MO 1GOCA 1QQCA 2F9TA 4EAHD 2G8UA 4FJXA 1NGBA 1NBWA 1JLBA 4IDHA 1YITN 3VN5A 1WN7A 4FLTA 1T8EA 4N41A 3RMDA 4KREA 1BA0A 1LAWA 5FRMA 4ILHA 5C2FA 3HJFA 3LAKA 1W7AA 3SUPA 2ZM6K 5KGWA 5CHIA 4B3RK 4C8LA 4DB3A 4CFBA 1KC8O 4GY2B 4DS5A 4HCBA 2XO7A 4BVOA 5CYQA 2A3ZA 2O8BB 2HSTA 2P9SB 3VQCA 3MN7A 3TAPA 3CF5L 3OYLA 1EWRA 4B1WB 2O4IA 2VG7A 2UXCK 4BRQA 4CVNE 4BRFA 4PWDA 2X74A 3HSTB 2OCEA 2HNZA 1J5EK 3LANA 1CZBA 3J7ZO 1BQMA 4M41A 3MXMA 3MDQA 1S9GA 1U2VA 3F2KA 4CEFA 2IVOA 4RW6A 1Q81O 3DAWA 5F0XA 3O9UA 4IEEA 3IKMA 2G8WA 4O5BA 3VERA 1BDGA 5DM7L 1UA0A 1J9AA 4CZMA 3DLLL 2CH5A 4CF1A 1BIZA 1RT2A 2X78A 3BZKA 4DHYA 3QBWA 1RBUA 5I3UA 1NGDA 1NJWA 4CZEA 1HLUA 1NGAA 2P9SA 4HVJA 4WQ4A 4BE2A 3QEVA 1XI1A 4FJMA 1KTQA 4YFUA 3VEWA 4HTUA 4DF4A 2UUAK 1ZXOA 3ZSQA 2FXUA 3O1BA 3I33A 3TAFA 4FLUA 1QSLA 1WSEA 2E2QA 1X3MA 1C0MA 4MFBA 4FLYA 4C8OA 4AQYK 1P90A 1XC9A 4DQSA 1GLBG 4CFDA 3T3FA 1BGXT 2WUSA 3M8QA 3M8PA 3CCEN 3O3GA 1ZYQA 1JCFA 5D3GA 4JKDA 4IO9L 4ID1A 1HPMA 3T1AA 2KQ2A 4O55A 4ID5A 2QXLA 2E5LK 2GWKA 4KTWA 4JKGA 4PY5A 2IIRA 4DTRA 1KAXA 4BRKA 3QNOA 4JEPA 5HROA 3NMUA 3SQ2A 4PHTX 3CCMN 2G8HA 4L8RB 3DRSA 1NKEA 4NCBA 1ZC6A 3LPTA 1EX4A 1E4GT 1ASWA 2VWBA 4DR6K 4B1ZA 1NG9A 3CC4N 4FJGA 3O5BA 3IMXA 3NVMA 2BANA 1IG9A 4YDUA 1N33K 1TUUA 4O4GA 1QQMA 3CJAA 3J7AP 3OYMA 1MDUB 1I94K 2QW9A 2O8EB 2OZSA 1B92A 2AJQA 4H03B 4IJAA 1D4XA 1S5JA 2YHBA 5BRFA 3HM8A 3QLHA 4CJPA 3ZCMA 1N32K 2I5JA 5ADXA 2BH1A 3SUOA 4MDBA 2ZJQL 4OPHA 4ISGA 3VESA 4CZJA 3PX0A 5AQNA 4O44A 3F73A 5FRNA 3OYBA 4FJ5A 1BQNA 1YXQA 4BG9A 3SQ1A 4FJHA 3HP9A 4CZIA 2I7PA 4CEAA 3OS1A 5AQWA 3CCQN 3HZ6A 2E1YA 3FGUA 4FK2A 3E01A 4JI5K 1GOBA 4YOVA 2D0CA 3V9ZA 1VRUA 1ATNA 4OVLA 3NDKA 3C94A 1O13A 3HO1A 4YOUA 4GMJB 4RG8A 5JLFA 3OYHA 2O8DA 1JLFA 3QNNA 3AA5X 1XMQK 1MWKA 5AQMA 4CK2A 1QTMA 5AR0A 4CIGA 4DQQA 1C1CA 3AVGA 4CJWA 1QQOA 5EOYA 3PO5A 3ZT1A 4O8KA 1YHQN 3SI6A 1VSJA 1U45A 4BQZA 3VQDA 4NYNA 1SL0A 1OH8A 5AQZA 4E7JA 2HHXA 1KQSM 3AVMA 4Z94A 4JRPA 4B9SA 2WTUA 1UA1A 3VQ8A 3MX2A 1HNVA 1RILA 3TPQA 3RRGA 4O0JA 3ZSYA 3VA0A 3NBPA 2QI2A 1W97L 3UKRA 5J2QA 4FPBA 5AQPA 1NU0A 5AJ3K 3NF9A 5BRHA 4JK9A 3RTVA 1SL2A 3CC7N 3K0SA 2NRWA 2QWOA 3ZT4A 2H3GX 3AVKA 1IKXA 3BZCA 4G9ZA 3P5JA 1X9JA 5AQYA 3T1HK 3LP0A 2QWMA 1HYVA 1XWLA 5C15A 4CJTA 5C12A 3Q7BA 3ENOA 3K5NA 3ZX0A 2R7YA 4BRLA 4CZGA 3NAEA 3G10A 3PX4A 3KLIA 2NLXA 2YJFA 3MCAB 3V9XA 1I39A 1TK0A 1Q7YO 3PIOL 3UB5A 4LSLA 4LF7K 2Q0UA 4CFAA 4H8KA 2ZE2A 4MLEA 2PY5A 2I7NA 2A1SA 1NK5A 3B6PA 3O8MA 4B9TA 3FFIA 3T1YK 3PSFA 1KXPA 2Q36A 3CMEN 3JS6A 2DFFA 5AQLA 4A59A 5AFUA 2YKMA 4H5TA 4H4MA 1TK8A 4JI0K 4L3QA 3CJBA 1NJIO 5DMRA 4I2QA 5CE3A 1NJZA 4XEIA 2F9WA 4N56A 1C6VA 4DSKA 1TK5A 4B9UA 4LF4K 3DOLA 3SPZA 2KLAA 1VQPN 3CXCM 1SV5A 4CGJA 1ATSA 4JKAA 1A5WA 4DU3A 1RDWX 1N34K 4CE9A 5KPTA 4X66K 3DXKB 3RR7A 1BUPA 3P1GA 3DXMB 3EZ5A 3Q7CA 2P5OA 4M3XA 3WEEA 5GINA 1T3VA 3SMSA 1SKRA 5M1OA 1RFQA 3K58A 3K9JA 3FLCO 1T05A 3C6HA 1J54A 3R3LA 2EWSA 1K8KA 4IWVA 2VQEK 3FZLA 3IAYA 1CXQA 4AHSA 4F4KA 3R6MA 4FJIA 2IVNA 3OYEA 4YORA 4CEOA 3EKUA 3HVTA 4QS7A 4H0OA 4DKWA 5KQ8A 4NLBA 2VQFK 3G4SN 1NWKA 5C25A 2W41A 1SKSA 2F8TA 2B6AA 3TR8A 4GV6A 2BTFA 4KB1A 3MK6A 2PZSA 1RGIA 2E88A 1BCOA 2HBLA 4FWLA 1YJWN 3NE6A 1U2VB 1SAZA 2X6NA 2UU9K 4F2RA 5BREA 1NGHA 1NK0A 1Q8IA 4B1YB 4DFMA 3TI0A 2O8DB 2ASMA 2VCPA 5J1EA 1XNRK 3DRRA 2HHQA 4GV3A 3ENHA 1ESVA 3BUZB 2DPNA 2ZWHA 1HQEA 4XH4A 1T7PA 5FROA 3OYGA 1ZBIA 4DTJA 5M1KA 1VQON 5EX5A 4FPAA 4Z4FA 1EP4A 4O0IA 5HRRA 2NRVA 1EETA 4FVMA 3HPHA 5C10A 1G99A 1QHAA 2VG5A 1LCUA 3L4QA 3KTQA 4FZZA 4JHDA 4BVPA 2IAJA 2GELA 3C6AA 3V4IA 1IH7A 4CJ5A 4M3YA 4F2SA 4AHRA 4QS8A 1NM1A 4FK0A 4B3MK 4WCEL 4FJLA 1J53A 4TSXA 4DWIA 3V81A 2DFHA 4QOZB 2WFBA 4Z4CA 3AV9A 3THXB 1X9MA 2FC0A 3O4NA 2YJEA 3DRPA 2P5GA 2CGKA 3ZT2A 4BRIA 3MCPA 2Y1IA 3CPEA 4WFAL 5HRPA 5AQQA 1NGEA 1SUQA 4EZ9A 3OYIA 5FPEA 3OJUA 3BF3A 4LF8K 5LL6Z 4XH5A 3TTFA 3CCJN 2AP1A 1RDUA 1Z05A 4DLEA 3SJHA 3AO4A 4OO1J 4JHDB 5AQFA 3WNFA 3EEQA 3ZSRA 1FXXA 3PSIA 1A5VA 3NCIA 3V9UA 1CZ9A 4MO4A 5EXWA 3AA2A 1QE1A 1N5YA 4AHUA 5CZ1A 3VGLA 1E3MA 3TAEA 4CJUA 1JL1A 4YOXA 4BDYA 4FCYA 4CW7B 3AVLA 4ELTA 1YVUA 4LD0A 4M7XA 1S1TA 2O8BA 1RDBA 3O9RA 5AQVA 1KFSA 3A5NC 4CGDA 3I0SA 2AA4A 3HL8A 5SZTA 3IG1A 4BC4A 3PLAA 4CIFA 4FLVA 3V6DA 1XHZA 3UKRB 4FJJA 1WBDA 4KHWA 4YY3K 3O4QA 2YHXA 1WAJA 3JXUA 3THYB 1RT3A 3UKUA 3ALYA 1WB9A 3HOSA 3NH1A 1JKHA 4BRNA 5JS1A 1Q86O 4BR2A 1J5OA 3O3HA 1RBVA 4WF9L 2J4RA 3F9MA 5GIOA 1LWCA 2G8KA 1U48A 4LY7A 3MN6A 4M3TA 1YUWA 4JK7A 5DM6L 1FKPA 3AA3A 3THVA 2WOMA 1KVCA 3HSCA 5HRSA 3VPZA 5E26A 2P51A 4FJ9A 3SAHA 3THWA 2P9NA 3VOVA 4DR4K 2HF4A 5F1XA 4IOCL 3SUNA 3TWHA 3VQBA 3V1QA 3P38A 1TAQA 1BI4A 1HKBA 3QERA 2GX9A 4IO8A 4FW1A 4CF9A 1FKOA 1Q18A 2Z1IA 4OKKA 3RSEA 3AA4A 4CHQA 1HYSA 3NF7A 3MEGA 2UXBK 3O6WA 3VENA 3ZETA 3TANA 4JI4K 1RT1A 1NGJA 1NK9A 4M42A 4F8RA 3SLCA 4WYBA 4KBOA 5E84A 4EZ6A 1KLMA 4Y1CA 2RF2A 3OYFA 1RDDA 3QEWA 5KTQA 3MECA 3LP3A 4BC2A 1ZBHA 1W0HA 2Q3SA 3DYAA 1NGFA 3U9ZA 1BL3A 4DTPA 4GKKK 2W40A 3BGRA 1WSHA 3RR8A 3CD6N 3ZT3A 1KRPA 3S3OA 2F7TA 1X9WA 4IOXA 4E1MA 1DEJA 1HKGA 3CETA 4DLGA 4HTLA 1D8YA 5B8HA 4BRMA 1TAUA 4CHOA 4F3OA 1NGGA 3ULEB 1VQ7N 3TAGA 4ILGB 1M90O 4C8NA 3ASMA 1ATRA 3VGMA 3LDLA 1EWQA 2YKNA 3NF8A 4A5BA 4OKJA 1S1UA 3FFKB 3GDQA 4DU1A 3KVGA 3OBWA 3QO9A 5AQUA 4ZTFA 1VQ4N 5CZ2A 4FWKA 5E41A 1QSSA 3ITHA 1EKEA 2XRIA 2KZMA 3WXLA 3ZT0A 3QMLA 2QA4N 4B1UB 4AH9A 1JCGA 5HOOA 3CCUN 4JRQA 1YJNN 2Y1JA 4DUYK 3H6EA 4JI6K 4Z4EA 2CH6A 1RT6A 4CERA 2F8SA 1RDAA 2P9LB 1TVRA 3RRHA 2V52B 4IKFA 3E9LA 2RPIA 4JKBA 3U4LA 4BDZA 4BRHA 3K5OA 4CZLA 4GVMA 1HRHA 3W3DA 1C0FA 4B3TK 4KO0A 3KWIA 4H5VA 4KHNA 1KD1O 5AQXA 4CHZA 1OKJA 4EHTA 1NOZA 4B3OA 1I3AA 3CERA 1L3TA 3CJCA 3VQ6A 4LC9B 3QIOA 1LW2A 4HWIA 1YIJN 2QEXN 1LW0A 2HBJA 1RBRA 1TL3A 3B8AX 2NRZA 3AAPA 3MEEA 3ZSWA 2P9UA 2F96A 3FZFA 1XHXA 5H1SQ 2F4VK 1YVNA 5LMUK 2WONA 2P9IB 3CJ9A 4J2AA 1FJGK 2Z1HA 1CLQA 3MXJA 4DG1A 4GNIA 4KPYA 2HMIA 4I9LA 4OJRA 2ZGZA 4H0TB 5TKWA 1X1PA 2UYTA 2ATQA 3VQ5A 3SV3A 4FWPA 4FYDA 1N6QA 2D0PA 2KFZA 2ZGYA 4CEDA 3VQ4A 1TYQA 5AQRA 3C95A 3CM6A 5KI6A 3IDHA 4H5RA 5HRNA 1NK8A 2FBXA 4CGHA 5A2QO 4YNQA 5BR8K 3O80A 4CEEA 2D0AA 1GLCG 4E0DA 4JS5A 3OBYA 2IS3A 2OPSA 3N4QA 2QKBA 4DMNA 4B9QA 3HTVA 2PYLA 2RE2A 4K0KK 1VQ6N 2E6MA 4RW7A 4JKEA 4E7IA 3AO2A 3TARA 4FJKA 4HUGA 4PQUA 4AHVA 5I42A 3AVHA 4CEQA 5AQGA 3O4WA 1GLJO 4X65K 2GBZA 2Q31A 5AQHA 4E7HA 5AQTA 3SAGA 3SV4A 3M8RA 1Z26A 1K73O 1GLAG 2BE2A 2YX6A 2VGMA 3EL2A 4JKCA 1DLOA 4R79A 4AM7A 1QVGM 4IJNA 3L3VA 4OPAA 4BE1A 4UY8O 2E2PA
chains in the Genus database with same CATH topology
1HMVA 4B9LA 4N76A 4IFYA 4DTMA 5C25A 5JS2A 3K57A 3EYZA 1SKSA 4KRFA 4ICLA 1HNIA 4CJ3A 2F8TA 2B6AA 1VSFA 3TR8A 4CECA 4CCHA 1UAXA 4IG0A 4E7LA 2OYQA 2OPPA 2HHWA 4H4OA 4KB1A 2IGIA 4E7KA 4PUOA 3NGYA 2PZSA 4W5TA 1REVA 4DTUA 3C6TA 4E3SA 3AVNA 3QESA 1LWEA 4CEBA 5KGXA 1LV5A 1BCOA 2BGGA 3D45A 1SKWA 4FJ7A 3NE6A 1D5AA 1U4BA 1Q9YA 1KSPA 2E6LA 4KI4A 4KTZA 1VSKA 3T19A 4RW8A 1L5UA 2X6NA 2G8VA 2KW4A 4F2RA 3A2FA 4KFBA 1CXUA 3LAMA 4FM2A 1Q9XA 3CFOA 1LAVA 4B08A 2A1RA 1NK0A 1Q8IA 3NHGA 5FDLA 4DFMA 3U3GA 5J1EA 3TI0A 4M3WA 3HYFA 3DRRA 4IDKA 4EP4A 3I0RA 4DTOA 2HHQA 1WLJA 4XIUA 3DLRA 1VK0A 4CHNA 4F3TA 1A5XA 5KRTA 4KAZA 4B9MA 3LZIA 3NF6A 3DLHA 1RNHA 1KCFA 1HQEA 1T7PA 3LZJA 2OPRA 3AO1A 5FROA 1BHLA 1VSMA 2ZQBA 3TAMA 3OYGA 3QETA 4ZHRA 4E1NA 3HPGA 4DTJA 3O3FA 4DSFA 2XY5A 1ZBIA 1D9FA 3B6OA 4Z4IA 3OYDA 2IC3A 4KHYA 3WNGA 2HHTA 4PA1A 4Q5VA 4DF8A 3S3MA 3CM5A 4Z4FA 1TKDA 4N47A 1EP4A 2O4GA 4RW9A 5HRRA 4O0IA 3L8BA 2X6SA 2DY4A 2VWKA 4Y1DA 2JLEA 1EETA 4FVMA 3M8SA 1JL2A 2RN2A 3HPHA 4C8MA 3MAQA 1RDCA 2VG5A 3VQ7A 1Z25A 2G8FA 2BDPA 1R0AA 3KTQA 4FZZA 1L3SA 1VSEA 2IAJA 3NGIA 1HYZA 3V4IA 1IH7A 1ASUA 2B4JA 2FBTA 4CJ5A 4M3YA 4F2SA 1WSJA 3G0ZA 1HJRA 3K2PA 3I8DA 4AHRA 3CFRA 1UOCA 4DSLA 3KK3A 3V9WA 4FW2A 4OGEA 1BCMA 5T7BA 1SL1A 1S9EA 4FK0A 3L2UA 4FJLA 1J53A 1GOCA 4TSXA 4DWIA 2IOCA 1QQCA 1RCHA 2DFHA 3WNEA 3OJSA 3L3UA 3V81A 2HHVA 4QOZB 4Z4CA 1X9MA 3AV9A 2EX3A 2G8UA 1U47A 3PY8A 4FJXA 1BIUA 2FC0A 3O4NA 3DRPA 2P5GA 1S1VA 3V1RA 3HT3A 1JLBA 1U49A 3ZT2A 4CGFA 2Y1IA 3VN5A 1WN7A 4FLTA 3L2WA 5HRPA 3K5LA 3OYNA 1T8EA 4HHTA 4N41A 2HW3A 3RMDA 4KREA 1SUQA 3KK1A 4EZ9A 4K8XA 3OYIA 1G15A 1LAWA 2GUIA 5FRMA 3OJUA 4DFKA 4J2DA 3HJFA 4B9VA 3LAKA 3SQ4A 3JYTA 3SUPA 2HNDA 4CJQA 1KVAA 4Z0UA 3LWLA 4HUFA 5KGWA 2G8IA 4J2BA 4Z4GA 4C8LA 4DLEA 1BI4B 1YT3A 3LALA 1D9DA 3AO4A 2DFEA 4CFBA 3RWUA 1JLEA 4DS5A 4HCBA 3WNFA 3ZSRA 3DLEA 2XO7A 1FXXA 1A5VA 4RW4A 3KKRA 3VQPA 3NCIA 5CYQA 3V9UA 2FBYA 3VQAA 3QEXA 1CZ9A 1KFDA 3VQCA 3TAPA 1TKZA 3AA2A 3SNNA 3OYLA 2O4IA 1QE1A 2VG7A 4AHUA 1N5YA 4KTQA 1JLQA 4NCAA 5CZ1A 4CESA 4PWDA 1TV6A 2X74A 3HSTB 4IBNA 2HNZA 4BWMA 3LANA 4BE0A 2ZD1A 4CJUA 1CZBA 3TAEA 1X9SA 3QEIA 1BQMA 4M41A 1JL1A 3MXMA 2LSNA 3V1OA 4BDYA 4E19A 4FCYA 1S9GA 3AO3A 3MXIA 1TKTA 2P1JA 4CEFA 2GV9A 3AVLA 1YVUA 1QSYA 4LD0A 4DSJA 4RW6A 3SUQA 1S1TA 4ELTA 3DMJA 5CY4A 3CFPA 4ELUA 1RDBA 1KFSA 1B9FA 2G8WA 4CF8A 4O5BA 4JLHA 3KK2A 3SJJA 4B8CA 1S6QA 2D5RA 3RMAA 4CGDA 3I0SA 1C1AA 2VWJA 5HP1A 1UA0A 1J9AA 3HL8A 5SZTA 3IG1A 1TGOA 4CF1A 1BIZA 4CIFA 4FLVA 3V6DA 3OS2A 1RT2A 1XHZA 2X78A 4FJJA 3PO4A 2XY8A 3KIOA 4KHWA 1RBUA 3DM2A 3RMCA 5I3UA 1FK9A 3O4QA 4OLAA 3VA3A 1WAJA 3L2QA 1NJWA 1TKXA 5J2MA 1NKBA 2OPQA 1RT3A 2Z1GA 4BE2A 3ALYA 4HVJA 1NK4A 3KD1E 3QEVA 3K59A 4E89A 1XI1A 4FJMA 1KTQA 4YFUA 3NH1A 4HTUA 4DF4A 1JKHA 3ZSQA 3ZSVA 2YV0X 1ZBLA 4K8ZA 5JS1A 3TAFA 1JXEA 1WSIA 4CGGA 3JSMA 4AHTA 4FLUA 3TABA 1WSEA 3LWMA 1QSLA 3NH2A 3HPOA 3L2VA 2QK9A 1C0MA 3ULDA 3AVBA 2OA8A 2VG6A 4MFBA 1IKVA 4FLYA 1J5OA 4C8OA 4DQIA 3NFAA 3O3HA 4G1QA 1RBVA 1Y97A 4DQSA 1XC9A 4CFDA 3T3FA 1BGXT 1LWCA 3AVJA 3M8QA 3M8PA 2XHBA 4KKOA 4OKEA 5CYMA 3O3GA 3PV8A 2G8KA 1ZYQA 1U48A 5D3GA 3CYMA 4LY7A 3OS0A 4M3TA 4ID1A 3T1AA 3PX6A 4FM1A 1KVBA 3KLFA 1VSIA 1FKPA 2KQ2A 4O55A 3AA3A 4ID5A 4QAGA 3THVA 4KTWA 4M45A 1RBTA 2WOMA 1KVCA 3LP2A 4DFPA 3HM9A 1L3VA 5HRSA 4PY5A 2KZZA 4DTRA 1NJXA 5C42A 1IKYA 5EU7A 1B9DA 2P51A 4HUEA 3QNOA 3SQ2A 4W5RA 5HROA 3QEPA 4FZYA 4FJ9A 3SQ0A 4FJ8A 2G8HA 4L8RB 3DRSA 1RT4A 3SUNA 1NKEA 3TWHA 4NCBA 3CG7A 3LPTA 3V1QA 1EX4A 4GW6A 1TAQA 3VQBA 1ASWA 3MEDA 3KKSA 1BISA 4QCLA 5J2PA 1BI4A 3LDSA 3QERA 4FW1A 4CF9A 4DFJA 1NJYA 1FKOA 1ASVA 2Z1IA 4FJGA 4OKKA 3AA4A 3DLKA 4CHQA 1HYSA 3NF7A 3MEGA 1EXQA 3V9SA 2BANA 1IG9A 4KHSA 4FLXA 1KLNA 4O4GA 3TANA 1NK6A 1RT1A 1RBSA 3ZSZA 1NK9A 4M42A 3OYMA 4I7FA 4F8RA 2DTUA 2Z1JA 4EZ6A 1C0TA 4OPJA 1B92A 1KLMA 4Y1CA 4DU4A 2OZSA 2AJQA 2RF2A 3OYFA 3IRXA 3PUFA 1RDDA 3KLEA 3QEWA 5KTQA 4CF0A 1S5JA 4I9QA 3MECA 2YHBA 3ZSXA 1DTTA 3LP3A 3QLHA 2NUBA 1ZBHA 4CJPA 3ZCMA 3HK2A 4I2PA 5C24A 4LSNA 1W0HA 2I5JA 2Q3SA 3DYAA 4CJSA 2XY7A 3SUOA 3BDPA 1UWBA 1BL3A 1RT7A 4DTPA 3BGRA 2JGUA 1WSHA 3DLGA 1LWFA 3RR8A 3PX0A 3F73A 3LP1A 4O44A 3ZT3A 1KRPA 5FRNA 4OPKA 2HNYA 3OYBA 4AILC 3S3OA 4W5NA 1X9WA 4FJ5A 4DTSA 1BQNA 4E1MA 4DLGA 3SQ1A 4FJHA 1WNSA 4FLWA 1D8YA 3HP9A 4C8KA 4CEAA 4B9NA 4DQRA 4CHOA 1TAUA 1F21A 4B8AB 3OS1A 4F3OA 3OYAA 1S1WA 3TAGA 4C8NA 4FK2A 3E01A 3K5MA 3DOKA 1GOBA 3ASMA 2D0CA 3HXMA 3SCXA 2YHAA 3V9ZA 1VRUA 2OZMA 1U04A 4OVLA 3C94A 4CEZA 2YKNA 3NDKA 3NF8A 3TAQA 3HO1A 3OY9A 4OKJA 4R5PA 1S1UA 3U3YA 4HCCA 4CFCA 4DU1A 4GMJB 4RG8A 3ZSOA 3QO9A 4ZTFA 3OYHA 2HHUA 3QINA 1JLFA 1RTHA 5CZ2A 3QNNA 4CJRA 5E41A 3AA5X 3ITHA 1NK7A 1QSSA 1EKEA 2XRIA 4CK2A 1QTMA 2KZMA 4CIGA 3ZT0A 2HVHA 4WE1A 4AH9A 4CF2A 3VQEA 4DQQA 1C1CA 3AVGA 4CJWA 3KJVA 1RT5A 4JRQA 3PO5A 3ZT1A 2Y1JA 4EP5A 2D0BA 1WSGA 3SI6A 4Z4EA 1RT6A 1VSJA 3IS9A 2YNFA 4CERA 4OGCA 1U45A 1QS4A 4NYNA 3VQDA 3OYJA 1SL0A 4M3ZA 2F8SA 1RDAA 2KFNA 1TVRA 3RRHA 1MU2A 3LPUA 4FM0A 4DSIA 4IKFA 2RPIA 4E7JA 2HHXA 4DS4A 4BDZA 4Q0BA 2KTQA 1O1WA 1IKWA 3AVMA 4CJFA 4JRPA 1C1BA 3K5OA 4DSEA 4B9SA 4M3RA 4GVMA 1HRHA 3SYZA 1UA1A 3VQ8A 3AO5A 3DLBA 1C0UA 4CJVA 4CIEA 4W5OA 4KO0A 3RMBA 1HNVA 1RILA 4KHNA 4CHZA 1NOZA 3RRGA 4CJLA 5J2NA 4B3OA 1I3AA 4O0JA 1L3TA 2QKKA 4AHCA 3ZSYA 3VA0A 3NBPA 1S1XA 3VQ6A 3QIOA 4UQGA 1LW2A 5J2QA 5HLFA 2HVIA 1W9HA 3RTVA 1LW0A 3NF9A 4FLZA 1SL2A 1RBRA 1TL3A 3S3NA 4ELVA 3KLGA 3ZT4A 1HQUA 1JLCA 3MEEA 1IO2A 1NKCA 3ZSWA 4CHYA 3AVKA 1IKXA 4BWJA 2F96A 3AVCA 1XHXA 3P5JA 4KHUA 2WONA 2YNHA 4J2AA 3LP0A 4BACA 2Z1HA 1WSFA 3L2RA 3CQ8A 1CLQA 1HYVA 1XWLA 3MXJA 3VQQA 4CJTA 3UIQA 4DG1A 4CK3A 1RTJA 4KPYA 4W5QA 1VRTA 1VSHA 1JXBA 3K5NA 2R7YA 2HMIA 4I9LA 4OJRA 3NAEA 3G10A 4Z4HA 3PX4A 3KLIA 5DK5A 1X1PA 3VQ5A 2ATQA 4DTXA 1T03A 3HP6A 5HBMA 2E4LA 5K14A 2HB5A 3SV3A 4IG3A 3V9XA 4FYDA 1I39A 1TK0A 4FXDA 1N6QA 2KFZA 4CEDA 1YTUA 4LSLA 3VQ4A 4DQPA 4CFAA 3ISNC 4H8KA 2ZE2A 3NGZA 2PY5A 4JS4A 4FJNA 2EHGA 2XY6A 2A1SA 3C95A 3OYCA 2W42A 1NK5A 4CGIA 3B6PA 3P83D 3D0PA 3CM6A 5KI6A 4B9TA 3FFIA 1QHTA 5HRNA 1NK8A 2FBXA 4CGHA 4N5SA 3KD5E 2B5JA 4YNQA 3DI6A 1WAFA 4CEEA 1L3UA 2D0AA 2DFFA 1VSLA 2RKIA 4OLBA 3SZ2A 1NOYA 4E0DA 2YKMA 2YNGA 4JS5A 1TK8A 4H4MA 4KV8A 4KI6A 4FK4A 2IS3A 2OPSA 2IDOA 3NH0A 5DMRA 1HPZA 2QKBA 4DMNA 2PYJA 4KB0A 4I2QA 4LH5A 1GOAA 1NJZA 1RTDA 1JLAA 4N56A 3U6FA 2PYLA 3OYKA 1C6VA 4DSKA 1RTIA 5SWMA 2QXFA 1TK5A 2E6MA 4NCGA 3S9HA 3DOLA 3AVIA 4RW7A 3SPZA 4B9UA 1ZBUA 4MQ3A 4E7IA 3AO2A 1SV5A 3TARA 4CGJA 4FJKA 4HUGA 1A5WA 4PQUA 4DU3A 4AHVA 5I42A 3AVHA 2ETJA 4CEQA 2HHSA 1K6YA 3AVAA 2FBVA 3C6UA 4CE9A 4FZXC 3RR7A 2GBZA 1JLGA 1S6PA 3KLHA 1VSDA 3P1GA 4KHQA 3OVNA 4BDPA 4CJKA 3EZ5A 2P5OA 4E7HA 4CK1A 4M3XA 3QIPA 3SV4A 1TL1A 4NYFA 3M8RA 1SKRA 3K58A 1ITGA 1Z26A 5KRSA 2BE2A 1YTAA 4M3UA 4CHPA 3WNHA 1T05A 1J54A 1ZBFA 3SPYA 3IAYA 3HVRA 1DLOA 1CXQA 4AHSA 4CJ4A 3VQ9A 4IFVA 4F4KA 4FJIA 2ITGA 3H08A 4DTNA 2YNIA 3L3VA 3OYEA 4LH4A 3AVFA 3EY1A 4ZTJA 3F9KA 4CEOA 3HVTA 4CJEA 1DTQA 4BE1A 4J2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HMV A;  4B9L A;  4N76 A;  4IFY A;  4DTM A;  5C25 A;  5JS2 A;  3K57 A;  3EYZ A;  1SKS A;  4KRF A;  4ICL A;  1HNI A;  4CJ3 A;  2F8T A;  2B6A A;  1VSF A;  3TR8 A;  4CEC A;  4CCH A;  1UAX A;  4IG0 A;  4E7L A;  2OYQ A;  2OPP A;  2HHW A;  4H4O A;  4KB1 A;  2IGI A;  4E7K A;  4PUO A;  3NGY A;  2PZS A;  4W5T A;  1REV A;  4DTU A;  3C6T A;  4E3S A;  3AVN A;  3QES A;  1LWE A;  4CEB A;  5KGX A;  1LV5 A;  1BCO A;  2BGG A;  3D45 A;  1SKW A;  4FJ7 A;  3NE6 A;  1D5A A;  1U4B A;  1Q9Y A;  1KSP A;  2E6L A;  4KI4 A;  4KTZ A;  1VSK A;  3T19 A;  4RW8 A;  1L5U A;  2X6N A;  2G8V A;  2KW4 A;  4F2R A;  3A2F A;  4KFB A;  1CXU A;  3LAM A;  4FM2 A;  1Q9X A;  3CFO A;  1LAV A;  4B08 A;  2A1R A;  1NK0 A;  1Q8I A;  3NHG A;  5FDL A;  4DFM A;  3U3G A;  5J1E A;  3TI0 A;  4M3W A;  3HYF A;  3DRR A;  4IDK A;  4EP4 A;  3I0R A;  4DTO A;  2HHQ A;  1WLJ A;  4XIU A;  3DLR A;  1VK0 A;  4CHN A;  4F3T A;  1A5X A;  5KRT A;  4KAZ A;  4B9M A;  3LZI A;  3NF6 A;  3DLH A;  1RNH A;  1KCF A;  1HQE A;  1T7P A;  3LZJ A;  2OPR A;  3AO1 A;  5FRO A;  1BHL A;  1VSM A;  2ZQB A;  3TAM A;  3OYG A;  3QET A;  4ZHR A;  4E1N A;  3HPG A;  4DTJ A;  3O3F A;  4DSF A;  2XY5 A;  1ZBI A;  1D9F A;  3B6O A;  4Z4I A;  3OYD A;  2IC3 A;  4KHY A;  3WNG A;  2HHT A;  4PA1 A;  4Q5V A;  4DF8 A;  3S3M A;  3CM5 A;  4Z4F A;  1TKD A;  4N47 A;  1EP4 A;  2O4G A;  4RW9 A;  5HRR A;  4O0I A;  3L8B A;  2X6S A;  2DY4 A;  2VWK A;  4Y1D A;  2JLE A;  1EET A;  4FVM A;  3M8S A;  1JL2 A;  2RN2 A;  3HPH A;  4C8M A;  3MAQ A;  1RDC A;  2VG5 A;  3VQ7 A;  1Z25 A;  2G8F A;  2BDP A;  1R0A A;  3KTQ A;  4FZZ A;  1L3S A;  1VSE A;  2IAJ A;  3NGI A;  1HYZ A;  3V4I A;  1IH7 A;  1ASU A;  2B4J A;  2FBT A;  4CJ5 A;  4M3Y A;  4F2S A;  1WSJ A;  3G0Z A;  1HJR A;  3K2P A;  3I8D A;  4AHR A;  3CFR A;  1UOC A;  4DSL A;  3KK3 A;  3V9W A;  4FW2 A;  4OGE A;  1BCM A;  5T7B A;  1SL1 A;  1S9E A;  4FK0 A;  3L2U A;  4FJL A;  1J53 A;  1GOC A;  4TSX A;  4DWI A;  2IOC A;  1QQC A;  1RCH A;  2DFH A;  3WNE A;  3OJS A;  3L3U A;  3V81 A;  2HHV A;  4QOZ B;  4Z4C A;  1X9M A;  3AV9 A;  2EX3 A;  2G8U A;  1U47 A;  3PY8 A;  4FJX A;  1BIU A;  2FC0 A;  3O4N A;  3DRP A;  2P5G A;  1S1V A;  3V1R A;  3HT3 A;  1JLB A;  1U49 A;  3ZT2 A;  4CGF A;  2Y1I A;  3VN5 A;  1WN7 A;  4FLT A;  3L2W A;  5HRP A;  3K5L A;  3OYN A;  1T8E A;  4HHT A;  4N41 A;  2HW3 A;  3RMD A;  4KRE A;  1SUQ A;  3KK1 A;  4EZ9 A;  4K8X A;  3OYI A;  1G15 A;  1LAW A;  2GUI A;  5FRM A;  3OJU A;  4DFK A;  4J2D A;  3HJF A;  4B9V A;  3LAK A;  3SQ4 A;  3JYT A;  3SUP A;  2HND A;  4CJQ A;  1KVA A;  4Z0U A;  3LWL A;  4HUF A;  5KGW A;  2G8I A;  4J2B A;  4Z4G A;  4C8L A;  4DLE A;  1BI4 B;  1YT3 A;  3LAL A;  1D9D A;  3AO4 A;  2DFE A;  4CFB A;  3RWU A;  1JLE A;  4DS5 A;  4HCB A;  3WNF A;  3ZSR A;  3DLE A;  2XO7 A;  1FXX A;  1A5V A;  4RW4 A;  3KKR A;  3VQP A;  3NCI A;  5CYQ A;  3V9U A;  2FBY A;  3VQA A;  3QEX A;  1CZ9 A;  1KFD A;  3VQC A;  3TAP A;  1TKZ A;  3AA2 A;  3SNN A;  3OYL A;  2O4I A;  1QE1 A;  2VG7 A;  4AHU A;  1N5Y A;  4KTQ A;  1JLQ A;  4NCA A;  5CZ1 A;  4CES A;  4PWD A;  1TV6 A;  2X74 A;  3HST B;  4IBN A;  2HNZ A;  4BWM A;  3LAN A;  4BE0 A;  2ZD1 A;  4CJU A;  1CZB A;  3TAE A;  1X9S A;  3QEI A;  1BQM A;  4M41 A;  1JL1 A;  3MXM A;  2LSN A;  3V1O A;  4BDY A;  4E19 A;  4FCY A;  1S9G A;  3AO3 A;  3MXI A;  1TKT A;  2P1J A;  4CEF A;  2GV9 A;  3AVL A;  1YVU A;  1QSY A;  4LD0 A;  4DSJ A;  4RW6 A;  3SUQ A;  1S1T A;  4ELT A;  3DMJ A;  5CY4 A;  3CFP A;  4ELU A;  1RDB A;  1KFS A;  1B9F A;  2G8W A;  4CF8 A;  4O5B A;  4JLH A;  3KK2 A;  3SJJ A;  4B8C A;  1S6Q A;  2D5R A;  3RMA A;  4CGD A;  3I0S A;  1C1A A;  2VWJ A;  5HP1 A;  1UA0 A;  1J9A A;  3HL8 A;  5SZT A;  3IG1 A;  1TGO A;  4CF1 A;  1BIZ A;  4CIF A;  4FLV A;  3V6D A;  3OS2 A;  1RT2 A;  1XHZ A;  2X78 A;  4FJJ A;  3PO4 A;  2XY8 A;  3KIO A;  4KHW A;  1RBU A;  3DM2 A;  3RMC A;  5I3U A;  1FK9 A;  3O4Q A;  4OLA A;  3VA3 A;  1WAJ A;  3L2Q A;  1NJW A;  1TKX A;  5J2M A;  1NKB A;  2OPQ A;  1RT3 A;  2Z1G A;  4BE2 A;  3ALY A;  4HVJ A;  1NK4 A;  3KD1 E;  3QEV A;  3K59 A;  4E89 A;  1XI1 A;  4FJM A;  1KTQ A;  4YFU A;  3NH1 A;  4HTU A;  4DF4 A;  1JKH A;  3ZSQ A;  3ZSV A;  2YV0 X;  1ZBL A;  4K8Z A;  5JS1 A;  3TAF A;  1JXE A;  1WSI A;  4CGG A;  3JSM A;  4AHT A;  4FLU A;  3TAB A;  1WSE A;  3LWM A;  1QSL A;  3NH2 A;  3HPO A;  3L2V A;  2QK9 A;  1C0M A;  3ULD A;  3AVB A;  2OA8 A;  2VG6 A;  4MFB A;  1IKV A;  4FLY A;  1J5O A;  4C8O A;  4DQI A;  3NFA A;  3O3H A;  4G1Q A;  1RBV A;  1Y97 A;  4DQS A;  1XC9 A;  4CFD A;  3T3F A;  1BGX T;  1LWC A;  3AVJ A;  3M8Q A;  3M8P A;  2XHB A;  4KKO A;  4OKE A;  5CYM A;  3O3G A;  3PV8 A;  2G8K A;  1ZYQ A;  1U48 A;  5D3G A;  3CYM A;  4LY7 A;  3OS0 A;  4M3T A;  4ID1 A;  3T1A A;  3PX6 A;  4FM1 A;  1KVB A;  3KLF A;  1VSI A;  1FKP A;  2KQ2 A;  4O55 A;  3AA3 A;  4ID5 A;  4QAG A;  3THV A;  4KTW A;  4M45 A;  1RBT A;  2WOM A;  1KVC A;  3LP2 A;  4DFP A;  3HM9 A;  1L3V A;  5HRS A;  4PY5 A;  2KZZ A;  4DTR A;  1NJX A;  5C42 A;  1IKY A;  5EU7 A;  1B9D A;  2P51 A;  4HUE A;  3QNO A;  3SQ2 A;  4W5R A;  5HRO A;  3QEP A;  4FZY A;  4FJ9 A;  3SQ0 A;  4FJ8 A;  2G8H A;  4L8R B;  3DRS A;  1RT4 A;  3SUN A;  1NKE A;  3TWH A;  4NCB A;  3CG7 A;  3LPT A;  3V1Q A;  1EX4 A;  4GW6 A;  1TAQ A;  3VQB A;  1ASW A;  3MED A;  3KKS A;  1BIS A;  4QCL A;  5J2P A;  1BI4 A;  3LDS A;  3QER A;  4FW1 A;  4CF9 A;  4DFJ A;  1NJY A;  1FKO A;  1ASV A;  2Z1I A;  4FJG A;  4OKK A;  3AA4 A;  3DLK A;  4CHQ A;  1HYS A;  3NF7 A;  3MEG A;  1EXQ A;  3V9S A;  2BAN A;  1IG9 A;  4KHS A;  4FLX A;  1KLN A;  4O4G A;  3TAN A;  1NK6 A;  1RT1 A;  1RBS A;  3ZSZ A;  1NK9 A;  4M42 A;  3OYM A;  4I7F A;  4F8R A;  2DTU A;  2Z1J A;  4EZ6 A;  1C0T A;  4OPJ A;  1B92 A;  1KLM A;  4Y1C A;  4DU4 A;  2OZS A;  2AJQ A;  2RF2 A;  3OYF A;  3IRX A;  3PUF A;  1RDD A;  3KLE A;  3QEW A;  5KTQ A;  4CF0 A;  1S5J A;  4I9Q A;  3MEC A;  2YHB A;  3ZSX A;  1DTT A;  3LP3 A;  3QLH A;  2NUB A;  1ZBH A;  4CJP A;  3ZCM A;  3HK2 A;  4I2P A;  5C24 A;  4LSN A;  1W0H A;  2I5J A;  2Q3S A;  3DYA A;  4CJS A;  2XY7 A;  3SUO A;  3BDP A;  1UWB A;  1BL3 A;  1RT7 A;  4DTP A;  3BGR A;  2JGU A;  1WSH A;  3DLG A;  1LWF A;  3RR8 A;  3PX0 A;  3F73 A;  3LP1 A;  4O44 A;  3ZT3 A;  1KRP A;  5FRN A;  4OPK A;  2HNY A;  3OYB A;  4AIL C;  3S3O A;  4W5N A;  1X9W A;  4FJ5 A;  4DTS A;  1BQN A;  4E1M A;  4DLG A;  3SQ1 A;  4FJH A;  1WNS A;  4FLW A;  1D8Y A;  3HP9 A;  4C8K A;  4CEA A;  4B9N A;  4DQR A;  4CHO A;  1TAU A;  1F21 A;  4B8A B;  3OS1 A;  4F3O A;  3OYA A;  1S1W A;  3TAG A;  4C8N A;  4FK2 A;  3E01 A;  3K5M A;  3DOK A;  1GOB A;  3ASM A;  2D0C A;  3HXM A;  3SCX A;  2YHA A;  3V9Z A;  1VRU A;  2OZM A;  1U04 A;  4OVL A;  3C94 A;  4CEZ A;  2YKN A;  3NDK A;  3NF8 A;  3TAQ A;  3HO1 A;  3OY9 A;  4OKJ A;  4R5P A;  1S1U A;  3U3Y A;  4HCC A;  4CFC A;  4DU1 A;  4GMJ B;  4RG8 A;  3ZSO A;  3QO9 A;  4ZTF A;  3OYH A;  2HHU A;  3QIN A;  1JLF A;  1RTH A;  5CZ2 A;  3QNN A;  4CJR A;  5E41 A;  3AA5 X;  3ITH A;  1NK7 A;  1QSS A;  1EKE A;  2XRI A;  4CK2 A;  1QTM A;  2KZM A;  4CIG A;  3ZT0 A;  2HVH A;  4WE1 A;  4AH9 A;  4CF2 A;  3VQE A;  4DQQ A;  1C1C A;  3AVG A;  4CJW A;  3KJV A;  1RT5 A;  4JRQ A;  3PO5 A;  3ZT1 A;  2Y1J A;  4EP5 A;  2D0B A;  1WSG A;  3SI6 A;  4Z4E A;  1RT6 A;  1VSJ A;  3IS9 A;  2YNF A;  4CER A;  4OGC A;  1U45 A;  1QS4 A;  4NYN A;  3VQD A;  3OYJ A;  1SL0 A;  4M3Z A;  2F8S A;  1RDA A;  2KFN A;  1TVR A;  3RRH A;  1MU2 A;  3LPU A;  4FM0 A;  4DSI A;  4IKF A;  2RPI A;  4E7J A;  2HHX A;  4DS4 A;  4BDZ A;  4Q0B A;  2KTQ A;  1O1W A;  1IKW A;  3AVM A;  4CJF A;  4JRP A;  1C1B A;  3K5O A;  4DSE A;  4B9S A;  4M3R A;  4GVM A;  1HRH A;  3SYZ A;  1UA1 A;  3VQ8 A;  3AO5 A;  3DLB A;  1C0U A;  4CJV A;  4CIE A;  4W5O A;  4KO0 A;  3RMB A;  1HNV A;  1RIL A;  4KHN A;  4CHZ A;  1NOZ A;  3RRG A;  4CJL A;  5J2N A;  4B3O A;  1I3A A;  4O0J A;  1L3T A;  2QKK A;  4AHC A;  3ZSY A;  3VA0 A;  3NBP A;  1S1X A;  3VQ6 A;  3QIO A;  4UQG A;  1LW2 A;  5J2Q A;  5HLF A;  2HVI A;  1W9H A;  3RTV A;  1LW0 A;  3NF9 A;  4FLZ A;  1SL2 A;  1RBR A;  1TL3 A;  3S3N A;  4ELV A;  3KLG A;  3ZT4 A;  1HQU A;  1JLC A;  3MEE A;  1IO2 A;  1NKC A;  3ZSW A;  4CHY A;  3AVK A;  1IKX A;  4BWJ A;  2F96 A;  3AVC A;  1XHX A;  3P5J A;  4KHU A;  2WON A;  2YNH A;  4J2A A;  3LP0 A;  4BAC A;  2Z1H A;  1WSF A;  3L2R A;  3CQ8 A;  1CLQ A;  1HYV A;  1XWL A;  3MXJ A;  3VQQ A;  4CJT A;  3UIQ A;  4DG1 A;  4CK3 A;  1RTJ A;  4KPY A;  4W5Q A;  1VRT A;  1VSH A;  1JXB A;  3K5N A;  2R7Y A;  2HMI A;  4I9L A;  4OJR A;  3NAE A;  3G10 A;  4Z4H A;  3PX4 A;  3KLI A;  5DK5 A;  1X1P A;  3VQ5 A;  2ATQ A;  4DTX A;  1T03 A;  3HP6 A;  5HBM A;  2E4L A;  5K14 A;  2HB5 A;  3SV3 A;  4IG3 A;  3V9X A;  4FYD A;  1I39 A;  1TK0 A;  4FXD A;  1N6Q A;  2KFZ A;  4CED A;  1YTU A;  4LSL A;  3VQ4 A;  4DQP A;  4CFA A;  3ISN C;  4H8K A;  2ZE2 A;  3NGZ A;  2PY5 A;  4JS4 A;  4FJN A;  2EHG A;  2XY6 A;  2A1S A;  3C95 A;  3OYC A;  2W42 A;  1NK5 A;  4CGI A;  3B6P A;  3P83 D;  3D0P A;  3CM6 A;  5KI6 A;  4B9T A;  3FFI A;  1QHT A;  5HRN A;  1NK8 A;  2FBX A;  4CGH A;  4N5S A;  3KD5 E;  2B5J A;  4YNQ A;  3DI6 A;  1WAF A;  4CEE A;  1L3U A;  2D0A A;  2DFF A;  1VSL A;  2RKI A;  4OLB A;  3SZ2 A;  1NOY A;  4E0D A;  2YKM A;  2YNG A;  4JS5 A;  1TK8 A;  4H4M A;  4KV8 A;  4KI6 A;  4FK4 A;  2IS3 A;  2OPS A;  2IDO A;  3NH0 A;  5DMR A;  1HPZ A;  2QKB A;  4DMN A;  2PYJ A;  4KB0 A;  4I2Q A;  4LH5 A;  1GOA A;  1NJZ A;  1RTD A;  1JLA A;  4N56 A;  3U6F A;  2PYL A;  3OYK A;  1C6V A;  4DSK A;  1RTI A;  5SWM A;  2QXF A;  1TK5 A;  2E6M A;  4NCG A;  3S9H A;  3DOL A;  3AVI A;  4RW7 A;  3SPZ A;  4B9U A;  1ZBU A;  4MQ3 A;  4E7I A;  3AO2 A;  1SV5 A;  3TAR A;  4CGJ A;  4FJK A;  4HUG A;  1A5W A;  4PQU A;  4DU3 A;  4AHV A;  5I42 A;  3AVH A;  2ETJ A;  4CEQ A;  2HHS A;  1K6Y A;  3AVA A;  2FBV A;  3C6U A;  4CE9 A;  4FZX C;  3RR7 A;  2GBZ A;  1JLG A;  1S6P A;  3KLH A;  1VSD A;  3P1G A;  4KHQ A;  3OVN A;  4BDP A;  4CJK A;  3EZ5 A;  2P5O A;  4E7H A;  4CK1 A;  4M3X A;  3QIP A;  3SV4 A;  1TL1 A;  4NYF A;  3M8R A;  1SKR A;  3K58 A;  1ITG A;  1Z26 A;  5KRS A;  2BE2 A;  1YTA A;  4M3U A;  4CHP A;  3WNH A;  1T05 A;  1J54 A;  1ZBF A;  3SPY A;  3IAY A;  3HVR A;  1DLO A;  1CXQ A;  4AHS A;  4CJ4 A;  3VQ9 A;  4IFV A;  4F4K A;  4FJI A;  2ITG A;  3H08 A;  4DTN A;  2YNI A;  3L3V A;  3OYE A;  4LH4 A;  3AVF A;  3EY1 A;  4ZTJ A;  3F9K A;  4CEO A;  3HVT A;  4CJE A;  1DTQ A;  4BE1 A;  4J2E A; 
#chains in the Genus database with same CATH topology
 4B9L A;  4N76 A;  4U67 L;  4IFY A;  4K43 A;  5TKY A;  2P9P B;  5KPR A;  2HMP A;  4KHP K;  3O9S A;  2QWP A;  1JJ2 M;  1HNI A;  4CJ3 A;  1VSF A;  4BR5 A;  4CCH A;  1UAX A;  4CJ7 A;  4E7K A;  3NGY A;  4W5T A;  1REV A;  4DTU A;  3E1Y A;  4IZ9 A;  1LV5 A;  2BGG A;  3D45 A;  3A5L C;  1D5A A;  1U4B A;  4KI4 A;  1VSK A;  3T19 A;  4RW8 A;  3THX A;  2G8V A;  3LM9 A;  4DV0 K;  4H5W A;  3A2F A;  4KFB A;  1CXU A;  3CFO A;  2A1R A;  3NHG A;  3U3G A;  4M3W A;  4IDK A;  4DTO A;  2A41 A;  3I0R A;  1WLJ A;  4XIU A;  3DLR A;  2W6L A;  4KAZ A;  2Q1N A;  3AO1 A;  3QET A;  1S72 N;  2XY5 A;  2QWL A;  1VHX A;  4JK8 A;  5AZI B;  1D9F A;  3OYD A;  3WXJ A;  2IC3 A;  3D7E O;  3WNG A;  4Q5V A;  4DF8 A;  1K8A O;  2E2N A;  1VQM N;  3TSP A;  2DY4 A;  3SBG A;  2RN2 A;  5BN9 A;  3LDN A;  5LJW A;  1Z25 A;  2BDP A;  3D2F A;  3QFP A;  2YCH A;  1L3S A;  4ISF A;  1TYQ B;  4RTF D;  1HJR A;  1NMN A;  5CR4 A;  1UOC A;  3EE8 A;  3V9W A;  4OGE A;  1S9E A;  4Y0W A;  2IOC A;  3VMF B;  2GWJ A;  1RCH A;  3WNE A;  4FWQ A;  4FO0 A;  3CPW M;  1U47 A;  3AAQ A;  1BIU A;  4QS9 A;  3HT3 A;  1U49 A;  2BUP A;  4JI2 K;  4CGF A;  2ZF5 O;  3K5L A;  3OYN A;  2HW3 A;  3KK1 A;  1VQ9 N;  3VF6 A;  4K8X A;  3A5O C;  1Q82 O;  1G15 A;  2GUI A;  1NLV A;  4B9V A;  3JYT A;  2HND A;  4JN4 A;  4CJQ A;  3LWL A;  3U8X A;  4J2B A;  4Z4G A;  1LOT B;  1BI4 B;  1V4S A;  3EE9 A;  1YT3 A;  3LAL A;  3E66 A;  3WT0 A;  1D9D A;  2DFE A;  1JLE A;  4YOT A;  1W2B M;  4DV3 K;  4RW4 A;  3CI5 A;  3CJ1 A;  3JAM O;  3SBT A;  2FBY A;  3QEX A;  1KFD A;  1XNQ K;  3OHR A;  3DWL A;  3SNN A;  1JLQ A;  4CES A;  4BWM A;  2ASO A;  4FSV A;  4EHU A;  3HRG A;  2LSN A;  1QZ5 A;  4BGA A;  4E19 A;  2P9L A;  3AO3 A;  4C23 A;  2HF3 A;  1R59 O;  2GV9 A;  2HHV A;  1QSY A;  4CI6 A;  3SUQ A;  4FOE A;  5CY4 A;  4ELU A;  2HBK A;  1B9F A;  2V51 B;  5AQK A;  2KHO A;  1S6Q A;  2D5R A;  3RMA A;  2O8C B;  2JWL A;  1C1A A;  1HX1 A;  4FWM A;  2WC9 A;  3OS2 A;  3PO4 A;  3ZEU B;  3RMC A;  1QVF M;  1QQN A;  2CGJ A;  3VEV A;  3WEE B;  1TKX A;  4MDA A;  2Z1G A;  1NK4 A;  3KD1 E;  1JCE A;  4WQ5 C;  3K59 A;  4DUZ K;  4E89 A;  1BOT O;  3A0I X;  4H0X B;  3L0Q A;  2GEM A;  1YAG A;  1ZBL A;  1JXE A;  1WSI A;  4AHT A;  3LWM A;  3NH2 A;  3HPO A;  4IFE A;  1IKV A;  4PKH A;  4G1Q A;  5GAH P;  1QZ6 A;  3PV8 A;  4PKI A;  4WQ4 C;  3OS0 A;  1KVB A;  3BP8 A;  4QAG A;  1WUA A;  1RBT A;  3LP2 A;  3M6G A;  4WFB L;  2V7Y A;  4DFP A;  1L3V A;  2KZZ A;  1NJX A;  1IKY A;  5EU7 A;  3SMP A;  2QM1 A;  3EKS A;  3CJ7 A;  3RSE B;  5JMV A;  4FZY A;  3SQ0 A;  4FJ8 A;  4WQ5 A;  1RT4 A;  3CG7 A;  2P9K A;  4M7Y A;  4ISE A;  4JD2 A;  3KKS A;  5J2P A;  3LDS A;  5ELZ A;  3VEY A;  3E9O A;  4DFJ A;  1ASV A;  4K25 A;  1CZA N;  3DLK A;  3V9S A;  5JIC A;  1KLN A;  4BY9 C;  3RVC A;  4DV6 K;  1RBS A;  3ZSZ A;  3BF1 A;  2P9I A;  3DXK A;  5MLC Q;  2DTU A;  2UUB K;  2Z1J A;  1C0T A;  3IRX A;  2FF6 A;  3PUF A;  3MWT A;  3KLE A;  4CF0 A;  1TUY A;  3ZSX A;  2NUB A;  5C24 A;  1U6Z A;  1OH7 A;  4CJS A;  2QWQ A;  3BDP A;  1UWB A;  1RT7 A;  1T6C A;  4E1J A;  3DLG A;  1LWF A;  3SAF A;  4DR5 K;  4OPK A;  2HNY A;  5AQS A;  4AIL C;  4W5N A;  1HKC A;  3THW B;  4H5N A;  4LF5 K;  1Z6R A;  5I9E B;  4OX9 K;  3VGK A;  1F21 A;  1S1W A;  3WXK A;  3K5M A;  3DOK A;  3U9D A;  3SCX A;  2OZM A;  4CEZ A;  3O1W A;  4X64 K;  1NGC A;  3OY9 A;  3U3Y A;  3O9Q A;  5EVZ A;  4CFC A;  3CCV N;  3C7N B;  3NVK A;  5GAE P;  3KK7 A;  3QIN A;  1RTH A;  4CJR A;  4A57 A;  1NK7 A;  4RWT A;  3FZH A;  3SK3 A;  4KH6 A;  2A6A A;  2D0B A;  1WSG A;  5LJV A;  2YNF A;  4OGC A;  1QS4 A;  2KFN A;  2E20 A;  1MU2 A;  4FM0 A;  4DS4 A;  2KTQ A;  4FVU A;  1O1W A;  1IKW A;  4CJF A;  1E4F T;  1N36 K;  3DLB A;  1C0U A;  4CIE A;  4CJL A;  5IWA K;  3D2F B;  4H0Y B;  5F2R A;  3FR0 A;  2UXD K;  2QKK A;  3BY5 A;  4O8U A;  1S1X A;  4UQG A;  3I55 N;  5HLF A;  3IFR A;  4FLZ A;  2D0O A;  1ZBS A;  4PL8 A;  1HQU A;  1JLC A;  1NKC A;  4CHY A;  1DT9 A;  4BWJ A;  4JKH A;  5GIP A;  2P9K B;  3ZX3 A;  3ZYY X;  4FWS A;  3T7Z A;  2YNH A;  5GAG P;  3CQ8 A;  3UIQ A;  4LF6 K;  3VQQ A;  4CK3 A;  5BPL A;  4W5Q A;  3CMA N;  1VRT A;  3OTO K;  3G6E N;  5JLH A;  3A8Y A;  2PBD A;  2HOE A;  5HBM A;  4PL7 A;  2E4L A;  4H0P A;  5K14 A;  4CBU A;  4IG3 A;  5LY3 A;  3HBT A;  4FXD A;  2V7Z A;  4DQP A;  4DR7 K;  3NGZ A;  4JS4 A;  4FJN A;  4GV9 A;  2EHG A;  3OYC A;  2W42 A;  4CGI A;  3P83 D;  3D0P A;  4JI8 K;  4N5S A;  3KD5 E;  3WXM B;  3DI6 A;  1WAF A;  3ULE A;  1L3U A;  2RKI A;  1XMO K;  4OLB A;  2WBN A;  4KI6 A;  3MN9 A;  2PFU A;  3H1Q A;  2PYJ A;  4LH5 A;  1GOA A;  1JLA A;  3J81 O;  4LF9 K;  1NGI A;  4WFN L;  3OYK A;  1IG8 A;  4JI3 K;  1GLL O;  1RTI A;  3IUC A;  4MQ3 A;  3OW2 M;  3VEO A;  3AVA A;  2FBV A;  3C6U A;  5M1P A;  4FZX C;  3FZM A;  3TU5 A;  4NB4 A;  4BQL A;  3KLH A;  1N8R O;  3VTH A;  4KHQ A;  3LL3 A;  3OVN A;  4CJK A;  3THY A;  4CK1 A;  1VQL N;  2ZJP L;  4NYF A;  3QFU A;  1ITG A;  3J7Y P;  5KRS A;  2YHW A;  3WNH A;  5EY4 A;  1ZBF A;  3HVR A;  3GG4 A;  4CJ4 A;  3VQ9 A;  4IFV A;  2ITG A;  3EY1 A;  4ZTJ A;  4IOA L;  4CJE A;  4A5A A;  3ATV A;  2Q0R A;  4J2E A;  3H45 C;  2E2O A;  5M1F A;  4BRD A;  5JS2 A;  3K57 A;  2OAN A;  3EYZ A;  4ICL A;  1HR0 K;  3P39 A;  4KH4 A;  4CEC A;  1BA1 A;  4E7L A;  2OPP A;  2HHW A;  1C0G A;  4H4O A;  2IGI A;  3T69 A;  3C6T A;  3HOT A;  3QES A;  5KGX A;  4CEB A;  1SKW A;  2FLO A;  1Q9Y A;  2E6L A;  2KW4 A;  4JAX A;  3ID8 A;  1Q9X A;  1LAV A;  3C7N A;  2OTL N;  5FDL A;  2E8A A;  1DKG D;  3HYF A;  4EP4 A;  4JNE A;  1HUX A;  4CHN A;  3J8A A;  2YHY A;  5KRT A;  4B9M A;  3LZI A;  3NF6 A;  1SS6 A;  1KCF A;  3FZK A;  4DQ8 A;  1BHL A;  1VSM A;  2ZQB A;  3TAM A;  3ZEU A;  4ZHR A;  3O3F A;  4DSF A;  4U7B A;  4Z4I A;  1MA9 B;  4KHY A;  3AGK A;  4PA1 A;  3S3M A;  2A40 A;  3CM5 A;  1TKD A;  2O4G A;  4RW9 A;  2X6S A;  2VWK A;  5BR9 A;  3M8S A;  4C8M A;  3H1V X;  1RDC A;  3VQ7 A;  4K41 A;  4X62 K;  3NGI A;  5FLX O;  1HYZ A;  2ITM A;  1ASU A;  5AZI A;  5BPM A;  1VQK N;  3G0Z A;  3K2P A;  3KZB A;  4GKJ K;  4DSL A;  3L6Q A;  3KK3 A;  4H0V B;  4M63 C;  2NRR A;  4JI1 K;  4FW2 A;  1SL1 A;  3L2U A;  3CIP A;  3TTC A;  5AQJ A;  3WXI A;  3OJS A;  1VQN N;  3L3U A;  4XH1 A;  2HBM A;  2EX3 A;  2FSK A;  3PY8 A;  2FSJ A;  3WQU A;  4BR4 A;  1S1V A;  3V1R A;  3L2W A;  1IV0 A;  4HHT A;  4BRE A;  3OA9 A;  5C0Y A;  4DFK A;  3LM2 A;  4J2D A;  3SQ4 A;  1KVA A;  4Z0U A;  3ZET B;  4HUF A;  2G8I A;  4B1V A;  1P8Z A;  3LDO A;  3RWU A;  2IVP A;  5FPN A;  3DLE A;  5M1Q A;  3DJC A;  5JVG L;  3KKR A;  3VQP A;  1KAY A;  1VAZ A;  3VQA A;  2Q2R A;  2FF3 B;  1TKZ A;  4KTQ A;  4NCA A;  1TV6 A;  4IBN A;  4BE0 A;  2ZD1 A;  2QWN A;  1X9S A;  3QEI A;  4BR0 A;  3V1O A;  3MXI A;  1VQ5 N;  1TKT A;  2P1J A;  3ZLJ A;  4DSJ A;  4M3U A;  3DMJ A;  5GAD P;  3CFP A;  3WQT A;  4CF8 A;  4JLH A;  3KK2 A;  3SJJ A;  4A61 A;  4B8C A;  5IT9 O;  2VWJ A;  5HP1 A;  1NMD A;  1IBL K;  1TGO A;  1GLD G;  5BN8 A;  1M1K O;  1IJJ A;  3CHW A;  3AAR A;  4A2B A;  2XY8 A;  3KIO A;  3DM2 A;  1FK9 A;  4OLA A;  3VA3 A;  3L2Q A;  4BC3 A;  5J2M A;  3DXM A;  1NKB A;  2OPQ A;  3VTI A;  1SZ2 A;  4DV4 K;  3ZSV A;  2YV0 X;  4K8Z A;  1WBB A;  3MX5 A;  4CGG A;  3JSM A;  4LFC K;  3TAB A;  3GBT A;  3L2V A;  5FPD A;  2QK9 A;  2D1K A;  4K42 A;  3ULD A;  4JKG B;  4JV5 K;  3AVB A;  1KAZ A;  2OA8 A;  2VG6 A;  1S22 A;  3VF2 A;  3NFA A;  1Y97 A;  3AVJ A;  2XHB A;  4KKO A;  4OKE A;  5CYM A;  2GTD A;  3VET A;  1OVQ A;  3CYM A;  3F5T A;  4F9O A;  5KPZ A;  3PX6 A;  4FM1 A;  4BRP A;  2ASP A;  3KLF A;  1VSI A;  3P4I A;  3EZW A;  4M45 A;  4DQI A;  3HM9 A;  3KWG A;  1YI2 N;  4PKG A;  5C42 A;  1B9D A;  4HUE A;  4JI7 K;  4W5R A;  3QEP A;  1VQ8 N;  3VEZ A;  2P9U B;  2PAV A;  4GW6 A;  1DGK N;  3D2E B;  1HNW K;  3MED A;  2W6K A;  1BIS A;  4QCL A;  3C0B A;  5BPN A;  3O9T A;  1NJY A;  2KKZ A;  4EFH A;  3R1X A;  3E9P A;  4DR1 K;  4IXC A;  2VGN A;  4BRA A;  4CD3 A;  1EXQ A;  2FSN A;  5AFU H;  4KHS A;  1T44 A;  4FLX A;  2CGL A;  1NK6 A;  3G71 N;  4J8F A;  2QTD A;  1XQS C;  4A62 A;  4I6M B;  4DV7 K;  4I7F A;  3ATU A;  4NO7 A;  4OPJ A;  4DU4 A;  4BC5 A;  3TSU A;  4I9Q A;  1DTT A;  1MWM A;  4FL9 A;  1NNE A;  3HK2 A;  4I2P A;  4LSN A;  1OH6 A;  2Q97 A;  1J6Z A;  2XY7 A;  4JYA K;  5ADX H;  3BEX A;  2JWK A;  2JGU A;  4CBW A;  3LP1 A;  1X3N A;  4DTS A;  1WNS A;  4FLW A;  4FWR A;  4AM6 A;  3MWP A;  4C8K A;  3L4I A;  4DQR A;  4B9N A;  2NRH A;  4B8A B;  1GLF O;  3OYA A;  4MLH A;  3CCS N;  4GVE A;  4BGB A;  3HXM A;  2YHA A;  1U04 A;  3TAQ A;  2NRT A;  4R5P A;  4HCC A;  1S3X A;  3ZSO A;  4C1N I;  2HHU A;  1BO5 O;  2O8F B;  2HVH A;  4WE1 A;  4CF2 A;  3VQE A;  2O8E A;  3KJV A;  1RT5 A;  2A5X A;  4CZF A;  1BU6 O;  4BRC A;  4EP5 A;  3M5R A;  3GE1 A;  3KHY A;  3QB0 A;  3IS9 A;  3OYJ A;  4M3Z A;  5M1N A;  1EO1 A;  3LPU A;  4DSI A;  3CQX A;  4Q0B A;  1GLE G;  1C1B A;  4EIA A;  4DSE A;  4M3R A;  5AZJ B;  4B1X B;  3SYZ A;  3AO5 A;  1HNZ K;  3CC2 N;  4CJV A;  4W5O A;  4CD1 A;  3RMB A;  1YJ9 N;  5AQI A;  5J2N A;  1YF5 L;  4AHC A;  3AY9 A;  2NZT A;  2UUC K;  4JD2 B;  4JKF A;  2HVI A;  1W9H A;  4DV2 K;  3S3N A;  2ZJR L;  4ELV A;  3KLG A;  1OH5 A;  4DR2 K;  1IO2 A;  4O5F A;  2D4W A;  3AVC A;  1HJO A;  3LDQ A;  3VF4 A;  4KHU A;  4LFA K;  2GUP A;  3EO3 A;  4BAC A;  3W0L A;  1WSF A;  3ZX2 A;  3L2R A;  3P31 A;  1FW6 A;  1RTJ A;  1VSH A;  1JXB A;  2OTJ N;  4Z4H A;  2NRX A;  5DK5 A;  4NXN K;  4DTX A;  1T03 A;  3HP6 A;  4YDU C;  2HB5 A;  3I8B A;  3R9P A;  1YTU A;  4MO5 A;  1K8K B;  1WOQ A;  3ISN C;  4CZK A;  3GL1 A;  5BRD A;  4BRO A;  3QDK A;  5C2D A;  2XY6 A;  1XUP O;  3EN9 A;  3J80 O;  1SQK A;  1QHT A;  4BRG A;  1Y64 A;  3S41 A;  2B5J A;  2P9N B;  3M1F A;  4V19 S;  1VSL A;  3SZ2 A;  1NOY A;  2YNG A;  4KV8 A;  4FK4 A;  2IDO A;  3H46 O;  3NH0 A;  1BWF O;  1HPZ A;  3ID6 A;  4KB0 A;  3D2E A;  1HNX K;  1RTD A;  4DR3 K;  3U6F A;  4A2A A;  4DV5 K;  1T6D A;  3D6R A;  3C65 A;  5SWM A;  2QXF A;  4AF1 A;  3TSQ A;  3S9H A;  4NCG A;  2O8C A;  3AVI A;  1ZBU A;  5HL7 L;  3QBX A;  4NXM K;  2ETJ A;  2HHS A;  1K6Y A;  3M3Z A;  4I6M A;  5AQO A;  1JLG A;  1S6P A;  4B3S K;  1VSD A;  4BDP A;  3QIP A;  5FPM A;  1TL1 A;  4CZH A;  4NLC A;  4RCH A;  1YTA A;  4CHP A;  4LFB K;  2A42 A;  3SPY A;  3K9K A;  3N4P A;  3ENB A;  1BG3 A;  3H08 A;  3O08 A;  4DTN A;  2YNI A;  4LH4 A;  3AVF A;  4YOY A;  3F9K A;  3LDP A;  1DTQ A;  2NNW A;  1HMV A;  3AGR A;  4DTM A;  2HHH K;  4KRF A;  1EQY A;  5JVH L;  1H1V A;  2YI1 A;  4IG0 A;  3VEX A;  2OYQ A;  3CCL N;  4PUO A;  4E3S A;  3AVN A;  1LWE A;  1OVY A;  4FJ7 A;  3PIP L;  1KSP A;  4KTZ A;  1L5U A;  1XC3 A;  3GOI A;  3UE5 A;  3MN5 A;  4DV1 K;  3MMV A;  3FE1 A;  3QIC A;  3LAM A;  4FM2 A;  5KQD A;  4B08 A;  1IBK K;  4IEI A;  3CQY A;  4FWN A;  3TTD A;  1VK0 A;  4F3T A;  1A5X A;  2O8F A;  3DLH A;  2QWR A;  5LMN K;  1RNH A;  3I56 N;  3LZJ A;  2OPR A;  2E1Z A;  4KH5 A;  4FWO A;  4E1N A;  3HPG A;  3H3O B;  3CCR N;  3B6O A;  4BG8 A;  4BR7 A;  4YHH K;  3WUH A;  3R8E A;  3A5M C;  2P9P A;  2HHT A;  2RHK A;  3UKU B;  4BR9 A;  4CBX A;  4ILJ A;  4N47 A;  3L8B A;  4Y1D A;  2JLE A;  1JL2 A;  5AZJ A;  3MAQ A;  4C1N K;  2G8F A;  1R0A A;  1VSE A;  3HI0 A;  4FOI A;  1V4T A;  2B4J A;  2FBT A;  1WSJ A;  3I8D A;  1ILY A;  3G25 A;  3CFR A;  4YOW A;  4DCH A;  3H3N O;  2VYP A;  1IBM K;  5T7B A;  1BCM A;  1K9M O;  1GOC A;  1QQC A;  2F9T A;  4EAH D;  2G8U A;  4FJX A;  1NGB A;  1NBW A;  1JLB A;  4IDH A;  1YIT N;  3VN5 A;  1WN7 A;  4FLT A;  1T8E A;  4N41 A;  3RMD A;  4KRE A;  1BA0 A;  1LAW A;  5FRM A;  4ILH A;  5C2F A;  3HJF A;  3LAK A;  1W7A A;  3SUP A;  2ZM6 K;  5KGW A;  5CHI A;  4B3R K;  4C8L A;  4DB3 A;  4CFB A;  1KC8 O;  4GY2 B;  4DS5 A;  4HCB A;  2XO7 A;  4BVO A;  5CYQ A;  2A3Z A;  2O8B B;  2HST A;  2P9S B;  3VQC A;  3MN7 A;  3TAP A;  3CF5 L;  3OYL A;  1EWR A;  4B1W B;  2O4I A;  2VG7 A;  2UXC K;  4BRQ A;  4CVN E;  4BRF A;  4PWD A;  2X74 A;  3HST B;  2OCE A;  2HNZ A;  1J5E K;  3LAN A;  1CZB A;  3J7Z O;  1BQM A;  4M41 A;  3MXM A;  3MDQ A;  1S9G A;  1U2V A;  3F2K A;  4CEF A;  2IVO A;  4RW6 A;  1Q81 O;  3DAW A;  5F0X A;  3O9U A;  4IEE A;  3IKM A;  2G8W A;  4O5B A;  3VER A;  1BDG A;  5DM7 L;  1UA0 A;  1J9A A;  4CZM A;  3DLL L;  2CH5 A;  4CF1 A;  1BIZ A;  1RT2 A;  2X78 A;  3BZK A;  4DHY A;  3QBW A;  1RBU A;  5I3U A;  1NGD A;  1NJW A;  4CZE A;  1HLU A;  1NGA A;  2P9S A;  4HVJ A;  4WQ4 A;  4BE2 A;  3QEV A;  1XI1 A;  4FJM A;  1KTQ A;  4YFU A;  3VEW A;  4HTU A;  4DF4 A;  2UUA K;  1ZXO A;  3ZSQ A;  2FXU A;  3O1B A;  3I33 A;  3TAF A;  4FLU A;  1QSL A;  1WSE A;  2E2Q A;  1X3M A;  1C0M A;  4MFB A;  4FLY A;  4C8O A;  4AQY K;  1P90 A;  1XC9 A;  4DQS A;  1GLB G;  4CFD A;  3T3F A;  1BGX T;  2WUS A;  3M8Q A;  3M8P A;  3CCE N;  3O3G A;  1ZYQ A;  1JCF A;  5D3G A;  4JKD A;  4IO9 L;  4ID1 A;  1HPM A;  3T1A A;  2KQ2 A;  4O55 A;  4ID5 A;  2QXL A;  2E5L K;  2GWK A;  4KTW A;  4JKG A;  4PY5 A;  2IIR A;  4DTR A;  1KAX A;  4BRK A;  3QNO A;  4JEP A;  5HRO A;  3NMU A;  3SQ2 A;  4PHT X;  3CCM N;  2G8H A;  4L8R B;  3DRS A;  1NKE A;  4NCB A;  1ZC6 A;  3LPT A;  1EX4 A;  1E4G T;  1ASW A;  2VWB A;  4DR6 K;  4B1Z A;  1NG9 A;  3CC4 N;  4FJG A;  3O5B A;  3IMX A;  3NVM A;  2BAN A;  1IG9 A;  4YDU A;  1N33 K;  1TUU A;  4O4G A;  1QQM A;  3CJA A;  3J7A P;  3OYM A;  1MDU B;  1I94 K;  2QW9 A;  2O8E B;  2OZS A;  1B92 A;  2AJQ A;  4H03 B;  4IJA A;  1D4X A;  1S5J A;  2YHB A;  5BRF A;  3HM8 A;  3QLH A;  4CJP A;  3ZCM A;  1N32 K;  2I5J A;  5ADX A;  2BH1 A;  3SUO A;  4MDB A;  2ZJQ L;  4OPH A;  4ISG A;  3VES A;  4CZJ A;  3PX0 A;  5AQN A;  4O44 A;  3F73 A;  5FRN A;  3OYB A;  4FJ5 A;  1BQN A;  1YXQ A;  4BG9 A;  3SQ1 A;  4FJH A;  3HP9 A;  4CZI A;  2I7P A;  4CEA A;  3OS1 A;  5AQW A;  3CCQ N;  3HZ6 A;  2E1Y A;  3FGU A;  4FK2 A;  3E01 A;  4JI5 K;  1GOB A;  4YOV A;  2D0C A;  3V9Z A;  1VRU A;  1ATN A;  4OVL A;  3NDK A;  3C94 A;  1O13 A;  3HO1 A;  4YOU A;  4GMJ B;  4RG8 A;  5JLF A;  3OYH A;  2O8D A;  1JLF A;  3QNN A;  3AA5 X;  1XMQ K;  1MWK A;  5AQM A;  4CK2 A;  1QTM A;  5AR0 A;  4CIG A;  4DQQ A;  1C1C A;  3AVG A;  4CJW A;  1QQO A;  5EOY A;  3PO5 A;  3ZT1 A;  4O8K A;  1YHQ N;  3SI6 A;  1VSJ A;  1U45 A;  4BQZ A;  3VQD A;  4NYN A;  1SL0 A;  1OH8 A;  5AQZ A;  4E7J A;  2HHX A;  1KQS M;  3AVM A;  4Z94 A;  4JRP A;  4B9S A;  2WTU A;  1UA1 A;  3VQ8 A;  3MX2 A;  1HNV A;  1RIL A;  3TPQ A;  3RRG A;  4O0J A;  3ZSY A;  3VA0 A;  3NBP A;  2QI2 A;  1W97 L;  3UKR A;  5J2Q A;  4FPB A;  5AQP A;  1NU0 A;  5AJ3 K;  3NF9 A;  5BRH A;  4JK9 A;  3RTV A;  1SL2 A;  3CC7 N;  3K0S A;  2NRW A;  2QWO A;  3ZT4 A;  2H3G X;  3AVK A;  1IKX A;  3BZC A;  4G9Z A;  3P5J A;  1X9J A;  5AQY A;  3T1H K;  3LP0 A;  2QWM A;  1HYV A;  1XWL A;  5C15 A;  4CJT A;  5C12 A;  3Q7B A;  3ENO A;  3K5N A;  3ZX0 A;  2R7Y A;  4BRL A;  4CZG A;  3NAE A;  3G10 A;  3PX4 A;  3KLI A;  2NLX A;  2YJF A;  3MCA B;  3V9X A;  1I39 A;  1TK0 A;  1Q7Y O;  3PIO L;  3UB5 A;  4LSL A;  4LF7 K;  2Q0U A;  4CFA A;  4H8K A;  2ZE2 A;  4MLE A;  2PY5 A;  2I7N A;  2A1S A;  1NK5 A;  3B6P A;  3O8M A;  4B9T A;  3FFI A;  3T1Y K;  3PSF A;  1KXP A;  2Q36 A;  3CME N;  3JS6 A;  2DFF A;  5AQL A;  4A59 A;  5AFU A;  2YKM A;  4H5T A;  4H4M A;  1TK8 A;  4JI0 K;  4L3Q A;  3CJB A;  1NJI O;  5DMR A;  4I2Q A;  5CE3 A;  1NJZ A;  4XEI A;  2F9W A;  4N56 A;  1C6V A;  4DSK A;  1TK5 A;  4B9U A;  4LF4 K;  3DOL A;  3SPZ A;  2KLA A;  1VQP N;  3CXC M;  1SV5 A;  4CGJ A;  1ATS A;  4JKA A;  1A5W A;  4DU3 A;  1RDW X;  1N34 K;  4CE9 A;  5KPT A;  4X66 K;  3DXK B;  3RR7 A;  1BUP A;  3P1G A;  3DXM B;  3EZ5 A;  3Q7C A;  2P5O A;  4M3X A;  3WEE A;  5GIN A;  1T3V A;  3SMS A;  1SKR A;  5M1O A;  1RFQ A;  3K58 A;  3K9J A;  3FLC O;  1T05 A;  3C6H A;  1J54 A;  3R3L A;  2EWS A;  1K8K A;  4IWV A;  2VQE K;  3FZL A;  3IAY A;  1CXQ A;  4AHS A;  4F4K A;  3R6M A;  4FJI A;  2IVN A;  3OYE A;  4YOR A;  4CEO A;  3EKU A;  3HVT A;  4QS7 A;  4H0O A;  4DKW A;  5KQ8 A;  4NLB A;  2VQF K;  3G4S N;  1NWK A;  5C25 A;  2W41 A;  1SKS A;  2F8T A;  2B6A A;  3TR8 A;  4GV6 A;  2BTF A;  4KB1 A;  3MK6 A;  2PZS A;  1RGI A;  2E88 A;  1BCO A;  2HBL A;  4FWL A;  1YJW N;  3NE6 A;  1U2V B;  1SAZ A;  2X6N A;  2UU9 K;  4F2R A;  5BRE A;  1NGH A;  1NK0 A;  1Q8I A;  4B1Y B;  4DFM A;  3TI0 A;  2O8D B;  2ASM A;  2VCP A;  5J1E A;  1XNR K;  3DRR A;  2HHQ A;  4GV3 A;  3ENH A;  1ESV A;  3BUZ B;  2DPN A;  2ZWH A;  1HQE A;  4XH4 A;  1T7P A;  5FRO A;  3OYG A;  1ZBI A;  4DTJ A;  5M1K A;  1VQO N;  5EX5 A;  4FPA A;  4Z4F A;  1EP4 A;  4O0I A;  5HRR A;  2NRV A;  1EET A;  4FVM A;  3HPH A;  5C10 A;  1G99 A;  1QHA A;  2VG5 A;  1LCU A;  3L4Q A;  3KTQ A;  4FZZ A;  4JHD A;  4BVP A;  2IAJ A;  2GEL A;  3C6A A;  3V4I A;  1IH7 A;  4CJ5 A;  4M3Y A;  4F2S A;  4AHR A;  4QS8 A;  1NM1 A;  4FK0 A;  4B3M K;  4WCE L;  4FJL A;  1J53 A;  4TSX A;  4DWI A;  3V81 A;  2DFH A;  4QOZ B;  2WFB A;  4Z4C A;  3AV9 A;  3THX B;  1X9M A;  2FC0 A;  3O4N A;  2YJE A;  3DRP A;  2P5G A;  2CGK A;  3ZT2 A;  4BRI A;  3MCP A;  2Y1I A;  3CPE A;  4WFA L;  5HRP A;  5AQQ A;  1NGE A;  1SUQ A;  4EZ9 A;  3OYI A;  5FPE A;  3OJU A;  3BF3 A;  4LF8 K;  5LL6 Z;  4XH5 A;  3TTF A;  3CCJ N;  2AP1 A;  1RDU A;  1Z05 A;  4DLE A;  3SJH A;  3AO4 A;  4OO1 J;  4JHD B;  5AQF A;  3WNF A;  3EEQ A;  3ZSR A;  1FXX A;  3PSI A;  1A5V A;  3NCI A;  3V9U A;  1CZ9 A;  4MO4 A;  5EXW A;  3AA2 A;  1QE1 A;  1N5Y A;  4AHU A;  5CZ1 A;  3VGL A;  1E3M A;  3TAE A;  4CJU A;  1JL1 A;  4YOX A;  4BDY A;  4FCY A;  4CW7 B;  3AVL A;  4ELT A;  1YVU A;  4LD0 A;  4M7X A;  1S1T A;  2O8B A;  1RDB A;  3O9R A;  5AQV A;  1KFS A;  3A5N C;  4CGD A;  3I0S A;  2AA4 A;  3HL8 A;  5SZT A;  3IG1 A;  4BC4 A;  3PLA A;  4CIF A;  4FLV A;  3V6D A;  1XHZ A;  3UKR B;  4FJJ A;  1WBD A;  4KHW A;  4YY3 K;  3O4Q A;  2YHX A;  1WAJ A;  3JXU A;  3THY B;  1RT3 A;  3UKU A;  3ALY A;  1WB9 A;  3HOS A;  3NH1 A;  1JKH A;  4BRN A;  5JS1 A;  1Q86 O;  4BR2 A;  1J5O A;  3O3H A;  1RBV A;  4WF9 L;  2J4R A;  3F9M A;  5GIO A;  1LWC A;  2G8K A;  1U48 A;  4LY7 A;  3MN6 A;  4M3T A;  1YUW A;  4JK7 A;  5DM6 L;  1FKP A;  3AA3 A;  3THV A;  2WOM A;  1KVC A;  3HSC A;  5HRS A;  3VPZ A;  5E26 A;  2P51 A;  4FJ9 A;  3SAH A;  3THW A;  2P9N A;  3VOV A;  4DR4 K;  2HF4 A;  5F1X A;  4IOC L;  3SUN A;  3TWH A;  3VQB A;  3V1Q A;  3P38 A;  1TAQ A;  1BI4 A;  1HKB A;  3QER A;  2GX9 A;  4IO8 A;  4FW1 A;  4CF9 A;  1FKO A;  1Q18 A;  2Z1I A;  4OKK A;  3RSE A;  3AA4 A;  4CHQ A;  1HYS A;  3NF7 A;  3MEG A;  2UXB K;  3O6W A;  3VEN A;  3ZET A;  3TAN A;  4JI4 K;  1RT1 A;  1NGJ A;  1NK9 A;  4M42 A;  4F8R A;  3SLC A;  4WYB A;  4KBO A;  5E84 A;  4EZ6 A;  1KLM A;  4Y1C A;  2RF2 A;  3OYF A;  1RDD A;  3QEW A;  5KTQ A;  3MEC A;  3LP3 A;  4BC2 A;  1ZBH A;  1W0H A;  2Q3S A;  3DYA A;  1NGF A;  3U9Z A;  1BL3 A;  4DTP A;  4GKK K;  2W40 A;  3BGR A;  1WSH A;  3RR8 A;  3CD6 N;  3ZT3 A;  1KRP A;  3S3O A;  2F7T A;  1X9W A;  4IOX A;  4E1M A;  1DEJ A;  1HKG A;  3CET A;  4DLG A;  4HTL A;  1D8Y A;  5B8H A;  4BRM A;  1TAU A;  4CHO A;  4F3O A;  1NGG A;  3ULE B;  1VQ7 N;  3TAG A;  4ILG B;  1M90 O;  4C8N A;  3ASM A;  1ATR A;  3VGM A;  3LDL A;  1EWQ A;  2YKN A;  3NF8 A;  4A5B A;  4OKJ A;  1S1U A;  3FFK B;  3GDQ A;  4DU1 A;  3KVG A;  3OBW A;  3QO9 A;  5AQU A;  4ZTF A;  1VQ4 N;  5CZ2 A;  4FWK A;  5E41 A;  1QSS A;  3ITH A;  1EKE A;  2XRI A;  2KZM A;  3WXL A;  3ZT0 A;  3QML A;  2QA4 N;  4B1U B;  4AH9 A;  1JCG A;  5HOO A;  3CCU N;  4JRQ A;  1YJN N;  2Y1J A;  4DUY K;  3H6E A;  4JI6 K;  4Z4E A;  2CH6 A;  1RT6 A;  4CER A;  2F8S A;  1RDA A;  2P9L B;  1TVR A;  3RRH A;  2V52 B;  4IKF A;  3E9L A;  2RPI A;  4JKB A;  3U4L A;  4BDZ A;  4BRH A;  3K5O A;  4CZL A;  4GVM A;  1HRH A;  3W3D A;  1C0F A;  4B3T K;  4KO0 A;  3KWI A;  4H5V A;  4KHN A;  1KD1 O;  5AQX A;  4CHZ A;  1OKJ A;  4EHT A;  1NOZ A;  4B3O A;  1I3A A;  3CER A;  1L3T A;  3CJC A;  3VQ6 A;  4LC9 B;  3QIO A;  1LW2 A;  4HWI A;  1YIJ N;  2QEX N;  1LW0 A;  2HBJ A;  1RBR A;  1TL3 A;  3B8A X;  2NRZ A;  3AAP A;  3MEE A;  3ZSW A;  2P9U A;  2F96 A;  3FZF A;  1XHX A;  5H1S Q;  2F4V K;  1YVN A;  5LMU K;  2WON A;  2P9I B;  3CJ9 A;  4J2A A;  1FJG K;  2Z1H A;  1CLQ A;  3MXJ A;  4DG1 A;  4GNI A;  4KPY A;  2HMI A;  4I9L A;  4OJR A;  2ZGZ A;  4H0T B;  5TKW A;  1X1P A;  2UYT A;  2ATQ A;  3VQ5 A;  3SV3 A;  4FWP A;  4FYD A;  1N6Q A;  2D0P A;  2KFZ A;  2ZGY A;  4CED A;  3VQ4 A;  1TYQ A;  5AQR A;  3C95 A;  3CM6 A;  5KI6 A;  3IDH A;  4H5R A;  5HRN A;  1NK8 A;  2FBX A;  4CGH A;  5A2Q O;  4YNQ A;  5BR8 K;  3O80 A;  4CEE A;  2D0A A;  1GLC G;  4E0D A;  4JS5 A;  3OBY A;  2IS3 A;  2OPS A;  3N4Q A;  2QKB A;  4DMN A;  4B9Q A;  3HTV A;  2PYL A;  2RE2 A;  4K0K K;  1VQ6 N;  2E6M A;  4RW7 A;  4JKE A;  4E7I A;  3AO2 A;  3TAR A;  4FJK A;  4HUG A;  4PQU A;  4AHV A;  5I42 A;  3AVH A;  4CEQ A;  5AQG A;  3O4W A;  1GLJ O;  4X65 K;  2GBZ A;  2Q31 A;  5AQH A;  4E7H A;  5AQT A;  3SAG A;  3SV4 A;  3M8R A;  1Z26 A;  1K73 O;  1GLA G;  2BE2 A;  2YX6 A;  2VGM A;  3EL2 A;  4JKC A;  1DLO A;  4R79 A;  4AM7 A;  1QVG M;  4IJN A;  3L3V A;  4OPA A;  4BE1 A;  4UY8 O;  2E2P A; 
#chains in the Genus database with same CATH homology
 1HMV A;  4B9L A;  4N76 A;  4IFY A;  4DTM A;  5C25 A;  5JS2 A;  3K57 A;  3EYZ A;  1SKS A;  4KRF A;  4ICL A;  1HNI A;  4CJ3 A;  2F8T A;  2B6A A;  1VSF A;  3TR8 A;  4CEC A;  4CCH A;  1UAX A;  4IG0 A;  4E7L A;  2OYQ A;  2OPP A;  2HHW A;  4H4O A;  4KB1 A;  2IGI A;  4E7K A;  4PUO A;  3NGY A;  2PZS A;  4W5T A;  1REV A;  4DTU A;  3C6T A;  4E3S A;  3AVN A;  3QES A;  1LWE A;  4CEB A;  5KGX A;  1LV5 A;  1BCO A;  2BGG A;  3D45 A;  1SKW A;  4FJ7 A;  3NE6 A;  1D5A A;  1U4B A;  1Q9Y A;  1KSP A;  2E6L A;  4KI4 A;  4KTZ A;  1VSK A;  3T19 A;  4RW8 A;  1L5U A;  2X6N A;  2G8V A;  2KW4 A;  4F2R A;  3A2F A;  4KFB A;  1CXU A;  3LAM A;  4FM2 A;  1Q9X A;  3CFO A;  1LAV A;  4B08 A;  2A1R A;  1NK0 A;  1Q8I A;  3NHG A;  5FDL A;  4DFM A;  3U3G A;  5J1E A;  3TI0 A;  4M3W A;  3HYF A;  3DRR A;  4IDK A;  4EP4 A;  3I0R A;  4DTO A;  2HHQ A;  1WLJ A;  4XIU A;  3DLR A;  1VK0 A;  4CHN A;  4F3T A;  1A5X A;  5KRT A;  4KAZ A;  4B9M A;  3LZI A;  3NF6 A;  3DLH A;  1RNH A;  1KCF A;  1HQE A;  1T7P A;  3LZJ A;  2OPR A;  3AO1 A;  5FRO A;  1BHL A;  1VSM A;  2ZQB A;  3TAM A;  3OYG A;  3QET A;  4ZHR A;  4E1N A;  3HPG A;  4DTJ A;  3O3F A;  4DSF A;  2XY5 A;  1ZBI A;  1D9F A;  3B6O A;  4Z4I A;  3OYD A;  2IC3 A;  4KHY A;  3WNG A;  2HHT A;  4PA1 A;  4Q5V A;  4DF8 A;  3S3M A;  3CM5 A;  4Z4F A;  1TKD A;  4N47 A;  1EP4 A;  2O4G A;  4RW9 A;  5HRR A;  4O0I A;  3L8B A;  2X6S A;  2DY4 A;  2VWK A;  4Y1D A;  2JLE A;  1EET A;  4FVM A;  3M8S A;  1JL2 A;  2RN2 A;  3HPH A;  4C8M A;  3MAQ A;  1RDC A;  2VG5 A;  3VQ7 A;  1Z25 A;  2G8F A;  2BDP A;  1R0A A;  3KTQ A;  4FZZ A;  1L3S A;  1VSE A;  2IAJ A;  3NGI A;  1HYZ A;  3V4I A;  1IH7 A;  1ASU A;  2B4J A;  2FBT A;  4CJ5 A;  4M3Y A;  4F2S A;  1WSJ A;  3G0Z A;  1HJR A;  3K2P A;  3I8D A;  4AHR A;  3CFR A;  1UOC A;  4DSL A;  3KK3 A;  3V9W A;  4FW2 A;  4OGE A;  1BCM A;  5T7B A;  1SL1 A;  1S9E A;  4FK0 A;  3L2U A;  4FJL A;  1J53 A;  1GOC A;  4TSX A;  4DWI A;  2IOC A;  1QQC A;  1RCH A;  2DFH A;  3WNE A;  3OJS A;  3L3U A;  3V81 A;  2HHV A;  4QOZ B;  4Z4C A;  1X9M A;  3AV9 A;  2EX3 A;  2G8U A;  1U47 A;  3PY8 A;  4FJX A;  1BIU A;  2FC0 A;  3O4N A;  3DRP A;  2P5G A;  1S1V A;  3V1R A;  3HT3 A;  1JLB A;  1U49 A;  3ZT2 A;  4CGF A;  2Y1I A;  3VN5 A;  1WN7 A;  4FLT A;  3L2W A;  5HRP A;  3K5L A;  3OYN A;  1T8E A;  4HHT A;  4N41 A;  2HW3 A;  3RMD A;  4KRE A;  1SUQ A;  3KK1 A;  4EZ9 A;  4K8X A;  3OYI A;  1G15 A;  1LAW A;  2GUI A;  5FRM A;  3OJU A;  4DFK A;  4J2D A;  3HJF A;  4B9V A;  3LAK A;  3SQ4 A;  3JYT A;  3SUP A;  2HND A;  4CJQ A;  1KVA A;  4Z0U A;  3LWL A;  4HUF A;  5KGW A;  2G8I A;  4J2B A;  4Z4G A;  4C8L A;  4DLE A;  1BI4 B;  1YT3 A;  3LAL A;  1D9D A;  3AO4 A;  2DFE A;  4CFB A;  3RWU A;  1JLE A;  4DS5 A;  4HCB A;  3WNF A;  3ZSR A;  3DLE A;  2XO7 A;  1FXX A;  1A5V A;  4RW4 A;  3KKR A;  3VQP A;  3NCI A;  5CYQ A;  3V9U A;  2FBY A;  3VQA A;  3QEX A;  1CZ9 A;  1KFD A;  3VQC A;  3TAP A;  1TKZ A;  3AA2 A;  3SNN A;  3OYL A;  2O4I A;  1QE1 A;  2VG7 A;  4AHU A;  1N5Y A;  4KTQ A;  1JLQ A;  4NCA A;  5CZ1 A;  4CES A;  4PWD A;  1TV6 A;  2X74 A;  3HST B;  4IBN A;  2HNZ A;  4BWM A;  3LAN A;  4BE0 A;  2ZD1 A;  4CJU A;  1CZB A;  3TAE A;  1X9S A;  3QEI A;  1BQM A;  4M41 A;  1JL1 A;  3MXM A;  2LSN A;  3V1O A;  4BDY A;  4E19 A;  4FCY A;  1S9G A;  3AO3 A;  3MXI A;  1TKT A;  2P1J A;  4CEF A;  2GV9 A;  3AVL A;  1YVU A;  1QSY A;  4LD0 A;  4DSJ A;  4RW6 A;  3SUQ A;  1S1T A;  4ELT A;  3DMJ A;  5CY4 A;  3CFP A;  4ELU A;  1RDB A;  1KFS A;  1B9F A;  2G8W A;  4CF8 A;  4O5B A;  4JLH A;  3KK2 A;  3SJJ A;  4B8C A;  1S6Q A;  2D5R A;  3RMA A;  4CGD A;  3I0S A;  1C1A A;  2VWJ A;  5HP1 A;  1UA0 A;  1J9A A;  3HL8 A;  5SZT A;  3IG1 A;  1TGO A;  4CF1 A;  1BIZ A;  4CIF A;  4FLV A;  3V6D A;  3OS2 A;  1RT2 A;  1XHZ A;  2X78 A;  4FJJ A;  3PO4 A;  2XY8 A;  3KIO A;  4KHW A;  1RBU A;  3DM2 A;  3RMC A;  5I3U A;  1FK9 A;  3O4Q A;  4OLA A;  3VA3 A;  1WAJ A;  3L2Q A;  1NJW A;  1TKX A;  5J2M A;  1NKB A;  2OPQ A;  1RT3 A;  2Z1G A;  4BE2 A;  3ALY A;  4HVJ A;  1NK4 A;  3KD1 E;  3QEV A;  3K59 A;  4E89 A;  1XI1 A;  4FJM A;  1KTQ A;  4YFU A;  3NH1 A;  4HTU A;  4DF4 A;  1JKH A;  3ZSQ A;  3ZSV A;  2YV0 X;  1ZBL A;  4K8Z A;  5JS1 A;  3TAF A;  1JXE A;  1WSI A;  4CGG A;  3JSM A;  4AHT A;  4FLU A;  3TAB A;  1WSE A;  3LWM A;  1QSL A;  3NH2 A;  3HPO A;  3L2V A;  2QK9 A;  1C0M A;  3ULD A;  3AVB A;  2OA8 A;  2VG6 A;  4MFB A;  1IKV A;  4FLY A;  1J5O A;  4C8O A;  4DQI A;  3NFA A;  3O3H A;  4G1Q A;  1RBV A;  1Y97 A;  4DQS A;  1XC9 A;  4CFD A;  3T3F A;  1BGX T;  1LWC A;  3AVJ A;  3M8Q A;  3M8P A;  2XHB A;  4KKO A;  4OKE A;  5CYM A;  3O3G A;  3PV8 A;  2G8K A;  1ZYQ A;  1U48 A;  5D3G A;  3CYM A;  4LY7 A;  3OS0 A;  4M3T A;  4ID1 A;  3T1A A;  3PX6 A;  4FM1 A;  1KVB A;  3KLF A;  1VSI A;  1FKP A;  2KQ2 A;  4O55 A;  3AA3 A;  4ID5 A;  4QAG A;  3THV A;  4KTW A;  4M45 A;  1RBT A;  2WOM A;  1KVC A;  3LP2 A;  4DFP A;  3HM9 A;  1L3V A;  5HRS A;  4PY5 A;  2KZZ A;  4DTR A;  1NJX A;  5C42 A;  1IKY A;  5EU7 A;  1B9D A;  2P51 A;  4HUE A;  3QNO A;  3SQ2 A;  4W5R A;  5HRO A;  3QEP A;  4FZY A;  4FJ9 A;  3SQ0 A;  4FJ8 A;  2G8H A;  4L8R B;  3DRS A;  1RT4 A;  3SUN A;  1NKE A;  3TWH A;  4NCB A;  3CG7 A;  3LPT A;  3V1Q A;  1EX4 A;  4GW6 A;  1TAQ A;  3VQB A;  1ASW A;  3MED A;  3KKS A;  1BIS A;  4QCL A;  5J2P A;  1BI4 A;  3LDS A;  3QER A;  4FW1 A;  4CF9 A;  4DFJ A;  1NJY A;  1FKO A;  1ASV A;  2Z1I A;  4FJG A;  4OKK A;  3AA4 A;  3DLK A;  4CHQ A;  1HYS A;  3NF7 A;  3MEG A;  1EXQ A;  3V9S A;  2BAN A;  1IG9 A;  4KHS A;  4FLX A;  1KLN A;  4O4G A;  3TAN A;  1NK6 A;  1RT1 A;  1RBS A;  3ZSZ A;  1NK9 A;  4M42 A;  3OYM A;  4I7F A;  4F8R A;  2DTU A;  2Z1J A;  4EZ6 A;  1C0T A;  4OPJ A;  1B92 A;  1KLM A;  4Y1C A;  4DU4 A;  2OZS A;  2AJQ A;  2RF2 A;  3OYF A;  3IRX A;  3PUF A;  1RDD A;  3KLE A;  3QEW A;  5KTQ A;  4CF0 A;  1S5J A;  4I9Q A;  3MEC A;  2YHB A;  3ZSX A;  1DTT A;  3LP3 A;  3QLH A;  2NUB A;  1ZBH A;  4CJP A;  3ZCM A;  3HK2 A;  4I2P A;  5C24 A;  4LSN A;  1W0H A;  2I5J A;  2Q3S A;  3DYA A;  4CJS A;  2XY7 A;  3SUO A;  3BDP A;  1UWB A;  1BL3 A;  1RT7 A;  4DTP A;  3BGR A;  2JGU A;  1WSH A;  3DLG A;  1LWF A;  3RR8 A;  3PX0 A;  3F73 A;  3LP1 A;  4O44 A;  3ZT3 A;  1KRP A;  5FRN A;  4OPK A;  2HNY A;  3OYB A;  4AIL C;  3S3O A;  4W5N A;  1X9W A;  4FJ5 A;  4DTS A;  1BQN A;  4E1M A;  4DLG A;  3SQ1 A;  4FJH A;  1WNS A;  4FLW A;  1D8Y A;  3HP9 A;  4C8K A;  4CEA A;  4B9N A;  4DQR A;  4CHO A;  1TAU A;  1F21 A;  4B8A B;  3OS1 A;  4F3O A;  3OYA A;  1S1W A;  3TAG A;  4C8N A;  4FK2 A;  3E01 A;  3K5M A;  3DOK A;  1GOB A;  3ASM A;  2D0C A;  3HXM A;  3SCX A;  2YHA A;  3V9Z A;  1VRU A;  2OZM A;  1U04 A;  4OVL A;  3C94 A;  4CEZ A;  2YKN A;  3NDK A;  3NF8 A;  3TAQ A;  3HO1 A;  3OY9 A;  4OKJ A;  4R5P A;  1S1U A;  3U3Y A;  4HCC A;  4CFC A;  4DU1 A;  4GMJ B;  4RG8 A;  3ZSO A;  3QO9 A;  4ZTF A;  3OYH A;  2HHU A;  3QIN A;  1JLF A;  1RTH A;  5CZ2 A;  3QNN A;  4CJR A;  5E41 A;  3AA5 X;  3ITH A;  1NK7 A;  1QSS A;  1EKE A;  2XRI A;  4CK2 A;  1QTM A;  2KZM A;  4CIG A;  3ZT0 A;  2HVH A;  4WE1 A;  4AH9 A;  4CF2 A;  3VQE A;  4DQQ A;  1C1C A;  3AVG A;  4CJW A;  3KJV A;  1RT5 A;  4JRQ A;  3PO5 A;  3ZT1 A;  2Y1J A;  4EP5 A;  2D0B A;  1WSG A;  3SI6 A;  4Z4E A;  1RT6 A;  1VSJ A;  3IS9 A;  2YNF A;  4CER A;  4OGC A;  1U45 A;  1QS4 A;  4NYN A;  3VQD A;  3OYJ A;  1SL0 A;  4M3Z A;  2F8S A;  1RDA A;  2KFN A;  1TVR A;  3RRH A;  1MU2 A;  3LPU A;  4FM0 A;  4DSI A;  4IKF A;  2RPI A;  4E7J A;  2HHX A;  4DS4 A;  4BDZ A;  4Q0B A;  2KTQ A;  1O1W A;  1IKW A;  3AVM A;  4CJF A;  4JRP A;  1C1B A;  3K5O A;  4DSE A;  4B9S A;  4M3R A;  4GVM A;  1HRH A;  3SYZ A;  1UA1 A;  3VQ8 A;  3AO5 A;  3DLB A;  1C0U A;  4CJV A;  4CIE A;  4W5O A;  4KO0 A;  3RMB A;  1HNV A;  1RIL A;  4KHN A;  4CHZ A;  1NOZ A;  3RRG A;  4CJL A;  5J2N A;  4B3O A;  1I3A A;  4O0J A;  1L3T A;  2QKK A;  4AHC A;  3ZSY A;  3VA0 A;  3NBP A;  1S1X A;  3VQ6 A;  3QIO A;  4UQG A;  1LW2 A;  5J2Q A;  5HLF A;  2HVI A;  1W9H A;  3RTV A;  1LW0 A;  3NF9 A;  4FLZ A;  1SL2 A;  1RBR A;  1TL3 A;  3S3N A;  4ELV A;  3KLG A;  3ZT4 A;  1HQU A;  1JLC A;  3MEE A;  1IO2 A;  1NKC A;  3ZSW A;  4CHY A;  3AVK A;  1IKX A;  4BWJ A;  2F96 A;  3AVC A;  1XHX A;  3P5J A;  4KHU A;  2WON A;  2YNH A;  4J2A A;  3LP0 A;  4BAC A;  2Z1H A;  1WSF A;  3L2R A;  3CQ8 A;  1CLQ A;  1HYV A;  1XWL A;  3MXJ A;  3VQQ A;  4CJT A;  3UIQ A;  4DG1 A;  4CK3 A;  1RTJ A;  4KPY A;  4W5Q A;  1VRT A;  1VSH A;  1JXB A;  3K5N A;  2R7Y A;  2HMI A;  4I9L A;  4OJR A;  3NAE A;  3G10 A;  4Z4H A;  3PX4 A;  3KLI A;  5DK5 A;  1X1P A;  3VQ5 A;  2ATQ A;  4DTX A;  1T03 A;  3HP6 A;  5HBM A;  2E4L A;  5K14 A;  2HB5 A;  3SV3 A;  4IG3 A;  3V9X A;  4FYD A;  1I39 A;  1TK0 A;  4FXD A;  1N6Q A;  2KFZ A;  4CED A;  1YTU A;  4LSL A;  3VQ4 A;  4DQP A;  4CFA A;  3ISN C;  4H8K A;  2ZE2 A;  3NGZ A;  2PY5 A;  4JS4 A;  4FJN A;  2EHG A;  2XY6 A;  2A1S A;  3C95 A;  3OYC A;  2W42 A;  1NK5 A;  4CGI A;  3B6P A;  3P83 D;  3D0P A;  3CM6 A;  5KI6 A;  4B9T A;  3FFI A;  1QHT A;  5HRN A;  1NK8 A;  2FBX A;  4CGH A;  4N5S A;  3KD5 E;  2B5J A;  4YNQ A;  3DI6 A;  1WAF A;  4CEE A;  1L3U A;  2D0A A;  2DFF A;  1VSL A;  2RKI A;  4OLB A;  3SZ2 A;  1NOY A;  4E0D A;  2YKM A;  2YNG A;  4JS5 A;  1TK8 A;  4H4M A;  4KV8 A;  4KI6 A;  4FK4 A;  2IS3 A;  2OPS A;  2IDO A;  3NH0 A;  5DMR A;  1HPZ A;  2QKB A;  4DMN A;  2PYJ A;  4KB0 A;  4I2Q A;  4LH5 A;  1GOA A;  1NJZ A;  1RTD A;  1JLA A;  4N56 A;  3U6F A;  2PYL A;  3OYK A;  1C6V A;  4DSK A;  1RTI A;  5SWM A;  2QXF A;  1TK5 A;  2E6M A;  4NCG A;  3S9H A;  3DOL A;  3AVI A;  4RW7 A;  3SPZ A;  4B9U A;  1ZBU A;  4MQ3 A;  4E7I A;  3AO2 A;  1SV5 A;  3TAR A;  4CGJ A;  4FJK A;  4HUG A;  1A5W A;  4PQU A;  4DU3 A;  4AHV A;  5I42 A;  3AVH A;  2ETJ A;  4CEQ A;  2HHS A;  1K6Y A;  3AVA A;  2FBV A;  3C6U A;  4CE9 A;  4FZX C;  3RR7 A;  2GBZ A;  1JLG A;  1S6P A;  3KLH A;  1VSD A;  3P1G A;  4KHQ A;  3OVN A;  4BDP A;  4CJK A;  3EZ5 A;  2P5O A;  4E7H A;  4CK1 A;  4M3X A;  3QIP A;  3SV4 A;  1TL1 A;  4NYF A;  3M8R A;  1SKR A;  3K58 A;  1ITG A;  1Z26 A;  5KRS A;  2BE2 A;  1YTA A;  4M3U A;  4CHP A;  3WNH A;  1T05 A;  1J54 A;  1ZBF A;  3SPY A;  3IAY A;  3HVR A;  1DLO A;  1CXQ A;  4AHS A;  4CJ4 A;  3VQ9 A;  4IFV A;  4F4K A;  4FJI A;  2ITG A;  3H08 A;  4DTN A;  2YNI A;  3L3V A;  3OYE A;  4LH4 A;  3AVF A;  3EY1 A;  4ZTJ A;  3F9K A;  4CEO A;  3HVT A;  4CJE A;  1DTQ A;  4BE1 A;  4J2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...