4CFCA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 56
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cfcA00
1BIUA 1G15A 3L3VA 4ZHRA 3OYFA 1T05A 1LV5A 3V81A 3SZ2A 1HNIA 3IS9A 4LD0A 4KB0A 3NHGA 1RDDA 4EP4A 3G10A 4NYFA 4AHUA 4CJ3A 1U49A 2XO7A 3AA2A 3M8QA 5I42A 3PUFA 4CJTA 3KK3A 3TAEA 1VSHA 4FCYA 3OVNA 1S9EA 1BQMA 4CJFA 3QNNA 4KHYA 3VQEA 4Z4CA 2FBXA 3AVHA 4HVJA 3EY1A 4FJ9A 4OVLA 3I0SA 3G0ZA 5DK5A 4JRPA 3V9SA 3OY9A 3IG1A 3RMAA 1YTUA 4HHTA 4CHYA 1D9DA 1T7PA 4FM1A 4B9VA 4LY7A 4NCGA 4BDPA 4FVMA 1KSPA 3DLEA 1JLFA 4DTUA 1NK4A 4W5RA 4LH5A 4UQGA 4Z4FA 3MEGA 4O55A 4Z0UA 4BDZA 4L8RB 5C24A 3KLIA 4Z4IA 3D0PA 3WNEA 3NF6A 4R5PA 1JLGA 2HNZA 4C8LA 3ZT1A 3ZSVA 3THVA 4OGCA 3SPYA 1D5AA 2OYQA 3M8PA 1TL3A 3ZT4A 4RG8A 3LWLA 1EETA 4CF8A 3NGIA 3C95A 3AVMA 3HJFA 1RBVA 4DSJA 1TVRA 3V1RA 1NOZA 1I3AA 2HNDA 1S5JA 1S1WA 4CJEA 4JRQA 4NCBA 1A5WA 3AVKA 4E89A 4JS5A 4CGDA 4CJLA 1RDAA 3H08A 3NH2A 4CJSA 3AO1A 4IBNA 4H8KA 3AVGA 4I2PA 3MEDA 1VRUA 3QEXA 4CEFA 4FLTA 1C1BA 1XHXA 4M3RA 2ZQBA 3M8RA 5HP1A 1J5OA 3DOLA 5JS1A 5FDLA 4ELTA 4CE9A 1BHLA 1NJYA 1U4BA 4KREA 5D3GA 1Q9XA 4CIFA 1WSGA 4W5QA 1S6PA 4KHNA 4CFAA 3ULDA 1RTJA 1YTAA 4IDKA 1J53A 4DQSA 2GV9A 4DWIA 3HP9A 1HRHA 1BGXT 1HQUA 3KKSA 3SI6A 3ZSQA 4QAGA 3HP6A 3CFRA 5SZTA 1N5YA 3AO5A 3O4QA 4AHVA 3QIPA 3RMBA 4CJ4A 4E0DA 4GVMA 2B6AA 2X6NA 3ZSWA 4CHNA 3V9UA 2PZSA 4N41A 1RBTA 1REVA 1DTQA 1C0UA 3KK2A 1NJZA 5FROA 1IKVA 5KRTA 1BCOA 2HHSA 3NF8A 3HT3A 5FRNA 1RDBA 3MXJA 3HPOA 3K5NA 5CYQA 4OKKA 2YKNA 3TAPA 1J54A 4AHSA 1ZBLA 1JXEA 1XHZA 2OZSA 4NCAA 3AA4A 4M3XA 1J9AA 4LH4A 1S1TA 3OYEA 4FXDA 1S1VA 2G8KA 3VA3A 3CM6A 2IAJA 3L2UA 2IGIA 1T8EA 5DMRA 4FJJA 4FJXA 4QOZB 3NAEA 1LAVA 3SQ4A 3SCXA 1VK0A 4CHQA 3LANA 1NK7A 4HUFA 4KB1A 4O0IA 1QQCA 4LSLA 4CF2A 2NUBA 1S9GA 2KZMA 4KFBA 4CIGA 1X1PA 4CGHA 4GMJB 3U3GA 4N5SA 3KLEA 4DTNA 1HYZA 2D5RA 3HL8A 3LP3A 4DFKA 3K5MA 4FK2A 1WSHA 3CFOA 3I8DA 4B9UA 4DMNA 3A2FA 4CHZA 3VQ9A 1LW2A 3NF9A 1X9MA 2P1JA 2VG5A 3PO5A 2RPIA 3WNHA 1IH7A 4E7JA 2P5GA 3PX4A 4DTSA 2LSNA 4CJ5A 3E01A 4O4GA 2D0CA 1JKHA 3AVNA 3TANA 4OLBA 4F2SA 4DSFA 1R0AA 2I5JA 3LPUA 4CJQA 3T19A 3VQ8A 3RRHA 3DLGA 3QLHA 1GOAA 3ISNC 2BANA 2XY5A 1ZBFA 2DY4A 1HMVA 3TAFA 2AJQA 4ICLA 1WAFA 4LSNA 4CK1A 3VA0A 2QXFA 4M3YA 1EKEA 4FLYA 3IRXA 3NFAA 3CG7A 4DSKA 4FJHA 3RR7A 3P5JA 4H4MA 2VWJA 2OZMA 3AO3A 3KJVA 4FLXA 4FJKA 3D45A 3KTQA 4F4KA 4KPYA 4CGFA 3OS1A 4OPKA 2HB5A 4N47A 3TARA 3VQ6A 3KLFA 3OS0A 4CJUA 1K6YA 1TGOA 4N76A 1KVAA 4FJIA 3SUQA 2D0BA 4HCBA 3L2WA 1QSLA 3DRSA 1EXQA 3AVIA 3AVFA 3JSMA 4QCLA 3TAQA 4FJGA 4Y1CA 3C94A 1C1CA 3EYZA 2P51A 3VQBA 3IAYA 1HQEA 1S1XA 4FLZA 3O3FA 1JLAA 3TWHA 1IO2A 1RILA 4MFBA 4CCHA 4DTRA 4B9LA 3LZIA 3PX0A 3V9ZA 4DQQA 1CZBA 2BE2A 4BE0A 1FXXA 3AVCA 4OKJA 2KFZA 4CFCA 2OPPA 1LAWA 3VQPA 2E6MA 3WNGA 3MAQA 4BWMA 4W5NA 5HBMA 2B4JA 4FLUA 1VSMA 3KIOA 4DG1A 1RT3A 4FZXC 2RF2A 1UWBA 1NK9A 2HHUA 4FM0A 2IS3A 3B6OA 4OKEA 1C0TA 2E6LA 1TV6A 4CGGA 1BIZA 3QEWA 1ZBIA 1X9WA 4E7IA 4DS4A 3OYDA 1C1AA 3PV8A 2ETJA 2PYJA 4B3OA 2QKKA 2DFFA 3F9KA 4DSLA 1NK0A 4E3SA 5CYMA 4PY5A 2HW3A 1YT3A 4G1QA 1JL2A 5KGWA 1WSFA 4CJVA 4CESA 2WOMA 4XIUA 3QO9A 1JLEA 4FK0A 2P5OA 2Z1JA 3MXIA 3T1AA 4RW8A 3V9XA 3RTVA 4BE2A 2RN2A 4KTZA 4BE1A 4PA1A 1RT2A 3MEEA 2HHTA 1RBRA 1RT4A 3OS2A 1RT5A 2OA8A 1ASWA 3AVBA 4ELUA 1IKYA 1RT7A 1KLNA 3QESA 3DLKA 4KHSA 3CYMA 1RDCA 4DTMA 1NK5A 3L3UA 1KLMA 1HJRA 2D0AA 1WN7A 4CEOA 1TK0A 2G8FA 2BDPA 2OPSA 4FJNA 4DFPA 1I39A 1W0HA 4WE1A 1B92A 1QS4A 3VQ5A 3O3HA 4FK4A 2G8WA 3EZ5A 3VQQA 3DRPA 3DLHA 3AO4A 3QEIA 3LDSA 1TAUA 2X78A 3S3MA 4FZZA 3VQ7A 2WONA 4DQIA 4FJ7A 3MECA 1VSLA 1HNVA 5J1EA 3SQ2A 3OYIA 2Z1GA 3QEVA 1JLQA 3L2RA 2XY6A 1KVBA 3SQ0A 1SL0A 1MU2A 3NGYA 1KCFA 3SQ1A 3P83D 4CGJA 5CZ1A 1JXBA 4M41A 3V9WA 3ZSXA 4AILC 1IG9A 1QSSA 1TKDA 1VRTA 4E7HA 1SKWA 3SUPA 1KFSA 4IFYA 1YVUA 3ZT3A 1NK8A 3DI6A 3QIOA 3O3GA 1CXQA 2W42A 2YNGA 3QEPA 3AA3A 2YKMA 3NH0A 4AHRA 2FC0A 3HXMA 1XI1A 2E4LA 2B5JA 1BQNA 4DQRA 3DMJA 1C6VA 1ASUA 4FW1A 5KRSA 3UIQA 3OYMA 4KTWA 2A1RA 4J2EA 4KI4A 4KRFA 3RWUA 1WLJA 4HTUA 1SL1A 1SV5A 4GW6A 3VQAA 3RMCA 4DS5A 4DF8A 2O4GA 3F73A 2KQ2A 1VSKA 2KW4A 3WNFA 3ITHA 4EP5A 4DSEA 3K59A 4CHOA 3SJJA 4Z4HA 1BCMA 3P1GA 3TAMA 3DLBA 4J2AA 3LWMA 5HLFA 1LW0A 2KTQA 4CHPA 1RCHA 1CZ9A 3KD1E 4O5BA 3OYHA 1X9SA 1TK8A 3SUNA 4B08A 2YHBA 4Z4GA 4F2RA 3L2QA 3ZSOA 4DTXA 1Q9YA 3VQCA 4I7FA 3DOKA 2F8TA 2XY8A 4DFMA 2BGGA 3KK1A 1IKXA 1JLCA 4DSIA 3VN5A 3OJSA 3JYTA 1Q8IA 1NKBA 1ITGA 5C42A 3KKRA 3S9HA 1FKPA 5SWMA 3NH1A 1U45A 4M3ZA 4Z4EA 4W5TA 4E19A 4F3TA 4M42A 4HUGA 3MXMA 4KTQA 1BISA 5HRNA 1RTIA 4IG0A 4H4OA 1L3TA 3I0RA 4RW4A 2ATQA 3TABA 4FJLA 2PYLA 1RTDA 4FJ8A 2HVIA 2OPQA 4IFVA 4CEZA 4B9TA 1TL1A 2IDOA 3LAMA 3OYNA 4J2DA 2ZD1A 1B9DA 3OJUA 4B8CA 3HSTB 4CF0A 3BGRA 4B9SA 2HHXA 4M45A 1IKWA 1CXUA 3AVLA 3CFPA 3V6DA 1KRPA 4RW7A 4DU4A 3ZSYA 3QETA 1WSEA 2G8VA 3FFIA 3OYBA 1NOYA 5CZ2A 1WNSA 3RMDA 3S3NA 3V4IA 1WSJA 4DTPA 1U48A 2HVHA 3OYLA 1U47A 4CECA 4E7KA 4CEEA 1L3VA 1XWLA 1NK6A 2JGUA 3VQ4A 5K14A 1D9FA 3HPGA 3HK2A 1VSDA 2VWKA 4IG3A 2G8UA 4PWDA 4OJRA 2XHBA 4M3WA 3DM2A 4J2BA 2G8HA 4EZ9A 5E41A 4CK3A 4EZ6A 4ZTFA 4Y1DA 5J2NA 1QSYA 4CJKA 3AVJA 5C25A 1BI4A 3SNNA 5HRSA 2Q3SA 3NGZA 4FM2A 4JLHA 3CM5A 1ZBHA 4CGIA 1EX4A 1JL1A 4DFJA 2QK9A 3NCIA 4CF1A 5HROA 1DTTA 2QKBA 4MQ3A 3OYGA 4KV8A 4K8ZA 1A5VA 2DFEA 3C6TA 4O44A 5HRPA 4FLWA 2XY7A 4O0JA 1L3UA 4I9LA 2EHGA 4C8NA 3LP1A 3LALA 3U6FA 1VSIA 3T3FA 3ZCMA 1VSFA 4JS4A 4FW2A 3NBPA 5KGXA 5J2MA 4HCCA 4FJMA 4M3TA 1FKOA 3V1OA 1RNHA 5J2PA 4CF9A 4Q5VA 3QNOA 1HYVA 2YV0X 5KI6A 1NKCA 4HUEA 3KLGA 1UA1A 2Z1HA 1U04A 4KHQA 1RT1A 5CY4A 3VQDA 4CJWA 2YNIA 3ZSZA 3SV3A 3KLHA 1LWEA 3TAGA 4E1NA 1TKXA 4B8AB 4C8OA 2EX3A 1EP4A 1KTQA 3DLRA 4NYNA 3HVRA 1UA0A 1L3SA 3KD5E 2IOCA 3V1QA 3S3OA 1VSJA 1NKEA 1BL3A 4CFBA 3AVAA 4DQPA 4ZTJA 3DRRA 2YNHA 4CK2A 1S1UA 1BI4B 1GOCA 3B6PA 4RW9A 1ZYQA 1LWFA 1UOCA 2X6SA 4E1MA 5FRMA 2KZZA 4PQUA 4BDYA 3LAKA 1QTMA 3DYAA 1JLBA 2Y1JA 4DU3A 4CFDA 3L8BA 4E7LA 2PY5A 1Y97A 4DLGA 4IKFA 4ID1A 1Z26A 3NE6A 3LP2A 1TKZA 3CQ8A 5EU7A 4OLAA 2VG6A 1QE1A 3QINA 1NJWA 2DFHA 1ZBUA 2Y1IA 1D8YA 4KO0A 4Q0BA 1F21A 1RBUA 2DTUA 4KHUA 1KFDA 3K5LA 1HYSA 4KHWA 1KVCA 1TKTA 5HRRA 2XRIA 4ID5A 2KFNA 1FK9A 1WAJA 4N56A 3TR8A 1RT6A 1HPZA 4AHTA 2FBYA 3QERA 3PO4A 4YFUA 3OYCA 3HYFA 2HHWA 2JLEA 4C8KA 1T03A 3BDPA 4F8RA 4CIEA 3TI0A 3LPTA 4DTOA 4I2QA 3PY8A 5JS2A 5KTQA 1SL2A 1B9FA 3K57A 4AH9A 4KI6A 2F96A 3O4NA 2VG7A 2FBVA 4BWJA 2R7YA 4RW6A 3ZT2A 2F8SA 4FZYA 4CEDA 4KKOA 3AA5X 1RTHA 1QHTA 4CEBA 1VSEA 1NJXA 3SYZA 2IC3A 5T7BA 3NDKA 3RRGA 3RR8A 4BACA 1XC9A 4CEAA 3HVTA 1TK5A 1L5UA 1LWCA 5J2QA 4CJRA 3ASMA 4DF4A 2OPRA 4FJ5A 3AO2A 4FLVA 1ASVA 2YNFA 5I3UA 4OPJA 3PX6A 1SUQA 3SPZA 4B9MA 3ZT0A 1SKSA 2G8IA 2HHVA 3OYKA 4I9QA 4B9NA 3K5OA 2FBTA 4PUOA 3HO1A 2HHQA 4ELVA 3LP0A 4YNQA 1UAXA 3LZJA 4CEQA 1RBSA 1N6QA 3U3YA 4CERA 3OYAA 1TAQA 1C0MA 1WSIA 4FYDA 2GBZA 1Z25A 2ITGA 4C8MA 1W9HA 3ALYA 1O1WA 4F3OA 2ZE2A 4CJPA 4W5OA 1CLQA 3K58A 4AHCA 4M3UA 1A5XA 2X74A 1DLOA 3C6UA 3K2PA 4DLEA 4DU1A 2GUIA 1GOBA 4TSXA 2YHAA 1S6QA 2HNYA 2Z1IA 3HPHA 3NF7A 2HMIA 2RKIA 2A1SA 4DTJA 3M8SA 3SUOA 3SV4A 4OGEA 3OYJA 3AV9A 3HM9A 1SKRA 4KAZA 4K8XA 3L2VA 3ZSRA 2O4IA
chains in the Genus database with same CATH superfamily
1G15A 3L3VA 3OYFA 5BPMA 2CGJA 3SZ2A 2WBNA 1RDDA 2PAVA 3G10A 3J7AP 4H0OA 4DHYA 3TAEA 3QNNA 4Z4CA 3AVHA 4FJ9A 3G0ZA 3VETA 4V19S 2P9UB 5AQKA 1HX1A 3GBTA 4BDPA 4NCGA 3DLEA 4DTUA 4W5RA 4UQGA 4OO1J 5GIPA 4C1NI 4WF9L 4MLHA 2P9KB 3WXJA 4L8RB 1BUPA 3L4IA 3CPEA 3D7EO 3NF6A 4R5PA 2Q31A 4C8LA 3ZSVA 3THVA 2VQEK 3VEOA 5AQGA 2OYQA 3M8PA 3ZT4A 3HJFA 4CF8A 3NGIA 1DEJA 4DSJA 3K0SA 1I3AA 1S5JA 4JRQA 4NCBA 5FLXO 4CJLA 4H0VB 2IVPA 1BG3A 1BDGA 4IBNA 3ID6A 3AVGA 3VEWA 1U2VA 1FJGK 1XHXA 2ZQBA 4IZ9A 4ELTA 3I8BA 1NJYA 2KLAA 3WQTA 4JD2B 5BN9A 1Q9XA 1V4SA 4GKJK 1S6PA 1RTJA 3DAWA 1YTAA 3D2FA 4DQSA 4DWIA 1BGXT 1EO1A 4BG9A 4QAGA 3HP6A 1HNXK 3C0BA 1S3XA 3VF2A 3QIPA 2E8AA 4E0DA 4RCHA 2A41A 5CR4A 2PZSA 5BPLA 1IKVA 3K5NA 3EE8A 3TAPA 4M3XA 2F9WA 4MDBA 4FXDA 1S1VA 3O9QA 2IAJA 5DMRA 4QOZB 4BGBA 1LAVA 2FSJA 1Q81O 1S9GA 4PL7A 1QVFM 1X1PA 3KLEA 4DTNA 3WXMB 3D2FB 1HYZA 4FPBA 3AY9A 1WSHA 3CD6N 4B9UA 1ZBSA 3A2FA 4CHZA 5AQHA 2P1JA 1YI2N 1GLDG 2VG5A 3PO5A 2RPIA 3M1FA 1IH7A 4A2BA 1OH8A 3UB5A 3TANA 3HOTA 4EHTA 1R0AA 3LPUA 3UKRB 3LM9A 3DLGA 3QLHA 3ISNC 1ZBFA 2DY4A 1TUUA 4ICLA 1WAFA 4CK1A 4CZJA 4B1YB 3ZETA 3U9ZA 3KJVA 2Q0UA 2E2OA 4CGFA 3OS1A 1K6YA 3QFPA 1KVAA 4FJIA 3SUQA 3L2WA 3DRSA 5BRHA 1EXQA 3TAQA 4Y1CA 2O8DB 1CZAN 2IVOA 2O8CA 2DPNA 1RILA 4MFBA 4B9LA 2P9SB 3PX0A 1FXXA 3GOIA 3WNGA 3MAQA 4BWMA 3O1BA 2B4JA 2QWQA 1RT3A 4FZXC 5AQOA 3DXKA 4OKEA 5EVZA 1C0TA 2O8EA 1YF5L 2P9LA 5BR9A 4ISEA 4JI1K 3F9KA 2ASOA 4E3SA 3G6EN 3EKUA 4H5NA 5EXWA 3JAMO 3E66A 1RGIA 4CESA 4DR4K 3QO9A 5FPDA 5LJVA 1YJ9N 3MXIA 4RW8A 2HHTA 1RT4A 3OS2A 4JKAA 3CJ1A 1ASWA 1RT7A 1KLNA 1YITN 3DLKA 4Z94A 4KHSA 4JKGA 2G8FA 1KLMA 2D0AA 1WN7A 2NRZA 3J81O 2O8FA 1I39A 4WE1A 4FK4A 2NRRA 4HTLA 3AO4A 4XH5A 5AFUA 3LDSA 3SK3A 3CMAN 2NZTA 2WONA 4DQIA 3SBTA 3W3DA 5J1EA 1SQKA 1JLQA 3SQ0A 1MU2A 4NLCA 3VGLA 4BRMA 3A0IX 3SQ1A 4JAXA 5JMVA 3ZSXA 4XH1A 4BRQA 1VRTA 4IFYA 3ZT3A 3F9MA 3DI6A 1JCEA 3FGUA 3O3GA 2YNGA 3HXMA 2FC0A 2E4LA 1BQNA 3DMJA 4AF1A 1C6VA 3OYMA 2UXDK 3VQAA 3RMCA 1RDUA 5EY4A 2O4GA 3F73A 1VSKA 2KW4A 2OTLN 3WNFA 3SJJA 3VF6A 2F4VK 3P1GA 3DLBA 1LW0A 5BRDA 2KTQA 4CHPA 5C12A 5IT9O 3L2QA 3ZSOA 3VQCA 4PL8A 5HOOA 3DOKA 2BGGA 3KK7A 3OJSA 3JYTA 3KKRA 3S9HA 1U45A 4BY9C 4Z4EA 4W5TA 3D2EB 5AQPA 4AM6A 4IG0A 3I0RA 4RW4A 2ATQA 5AQUA 2HVIA 4FJ8A 5AQNA 3H45C 4F9OA 2AA4A 3THXA 3HSTB 4CF0A 2GUPA 5AQRA 1JCFA 3CFPA 4IOXA 1KRPA 3QETA 4CZEA 1NOYA 3S3NA 1WNSA 3V4IA 3CC7N 3O5BA 3N4PA 4CEEA 1N33K 4DV3K 2QWLA 2VQFK 3L0QA 3E1YA 3HPGA 3KWGA 1HUXA 2VWKA 4PWDA 4DV2K 3HZ6A 4J2BA 2G8HA 4EZ9A 5E41A 4BRKA 5AQFA 5J2NA 4GNIA 4CJKA 3G71N 3AVJA 5C25A 1VQMN 1N32K 4JLHA 4B1VA 3OW2M 3NCIA 4IWVA 4CF1A 5I9EB 1DTTA 2DFEA 3GE1A 4FLWA 2XY7A 1L3UA 3LP1A 3LALA 3BZCA 1HJOA 3LM2A 4JK8A 3T3FA 3ZCMA 1VSFA 3THXB 5BR8K 5KQDA 4DR1K 5KGXA 5J2MA 1RNHA 4CF9A 1IBMK 4I6MA 2YV0X 3QBXA 1UA1A 1U04A 2QWPA 5CY4A 2HHHK 4CJWA 2YNIA 1LWEA 5M1NA 3TAGA 1TKXA 2QXLA 4A62A 2CH6A 3KD5E 3V1QA 1JCGA 2WFBA 3P4IA 4FOIA 3ZX3A 1S1UA 3B6PA 1ZYQA 4M7YA 2VWBA 4E1MA 3FE1A 1QTMA 1JLBA 2QWNA 3ENOA 4IKFA 3TU5A 4C1NK 3LP2A 5EU7A 1QE1A 3QINA 4JKCA 2DFHA 1ZBUA 4BR4A 4DCHA 2DTUA 1HYSA 1KVCA 3OBWA 3QERA 1RT6A 1HPZA 3ZX2A 4AHTA 2HHWA 2JLEA 4F8RA 4JI4K 4B3SK 1X9JA 4AH9A 2VG7A 2FBVA 3CC2N 3R3LA 3G25A 3CETA 1QHTA 4CEBA 1VSEA 3FZKA 4IEIA 2IC3A 1XC9A 3HVTA 4WYBA 1IV0A 1LWCA 3MDQA 2OPRA 2W6KA 2OCEA 4IXCA 4JHDA 5ADXH 4BRAA 4BREA 3U8XA 3VEXA 2QEXN 4YNQA 3LZJA 3U3YA 4CERA 1Z25A 4C8MA 1W9HA 1O1WA 1XNRK 4CJPA 4W5OA 1CLQA 4M3UA 3WXIA 4LF9K 4DU1A 3CCLN 5EOYA 2YHAA 1EWRA 2ZF5O 4JKDA 3ZEUA 1H1VA 1NWKA 1SKRA 3AV9A 4GV6A 4BROA 4RWTA 4DV5K 1LV5A 3MMVA 3V81A 4KB0A 5LL6Z 3NHGA 4JI7K 1S72N 2VCPA 4X66K 3AA2A 3M8QA 4JHDB 3KK3A 4BC3A 1HPMA 1S9EA 1BQMA 1TYQB 3VQEA 1X3NA 3VEVA 3I0SA 5F1XA 5DK5A 4JRPA 4BG8A 3V9SA 3IG1A 3O1WA 4CHYA 4B9VA 3CXCM 4LY7A 5F2RA 1KSPA 3I55N 1SS6A 4Z0UA 4YOTA 3MN5A 2QW9A 3MK6A 2NRXA 1IBKK 4XEIA 4BQZA 4OGCA 4FO0A 1C0GA 1TL3A 2P9NB 4RG8A 1RBVA 1TVRA 1K8KA 3V1RA 2H3GX 2HNDA 3JS6A 4E89A 1VQ7N 3H08A 3NH2A 3AO1A 4JKHA 4H8KA 2HMPA 3CQXA 3MEDA 5AQZA 2E2NA 3FZLA 4CEFA 4FLTA 4M3RA 4A2AA 5HP1A 5FDLA 4CE9A 1U4BA 1XC3A 3J8AA 1KQSM 2YHXA 2GV9A 3IUCA 3AAQA 1ZXOA 4YHHK 3BF3A 3EE9A 3SI6A 5SZTA 3CERA 3O4QA 5GIOA 2QM1A 5GINA 4JI2K 3ZSWA 4CHNA 3KK2A 5FROA 4JKEA 5KRTA 2HHSA 3NF8A 3HPOA 5CYQA 4OKKA 3WEEA 1XHZA 4AHSA 2OZSA 4FPAA 1JXEA 1ZBLA 4MO4A 1YVNA 1OKJA 2E2QA 3VA3A 3A5MC 4BRNA 4O8UA 3SQ4A 1VK0A 3PLAA 4O0IA 1QQCA 4LSLA 4KFBA 3NVKA 4CIGA 3FZHA 4IO9L 2GWKA 3U3GA 4BGAA 4CBUA 3J7ZO 1GLCG 4YOVA 3K5MA 3CFOA 4EAHD 3SJHA 3CJAA 4ILHA 1XMQK 2P9UA 3WNHA 3VTHA 4JYAK 5FPMA 3S41A 2V7YA 3PX4A 2VGMA 2RHKA 2WTUA 3AVNA 4BC4A 4DSFA 4F2SA 2I5JA 5AQVA 2P9KA 4BR2A 3TAFA 1VQ5N 3VA0A 3NMUA 2UUBK 1EKEA 3BEXA 3M5RA 3IRXA 3QB0A 2JWLA 4FJHA 3RR7A 4KH6A 4LF7K 4H0XB 3P5JA 4FJKA 4F4KA 2HB5A 4N47A 3TARA 3H3OB 3OS0A 4CJUA 5AQJA 2NNWA 3ULEB 4KBOA 4FJGA 3VPZA 3IAYA 1HQEA 1S1XA 3EZWA 1NGBA 4CCHA 4DTRA 3CCVN 3V9ZA 4DQQA 1CZBA 4CFCA 4JD2A 4MO5A 4H5TA 2NRWA 4DG1A 4CZIA 4U67L 2HHUA 1BU6O 4CGGA 4GV3A 1BIZA 3QEWA 1KAYA 3O4WA 1Z05A 2GX9A 2ETJA 2NRVA 2PYJA 2BH1A 2QKKA 2DFFA 2HBKA 5M1OA 5C15A 1YT3A 4G1QA 4CD1A 4K43A 4FK0A 1E4FT 4G9ZA 2Z1JA 4K42A 1ILYA 3F2KA 4CZKA 3RTVA 4BE2A 1NMDA 1RT2A 1RBRA 3AVBA 3E9OA 3R1XA 3HI0A 4H03B 2FXUA 3CYMA 1NK5A 4DTMA 3L3UA 4CEOA 1TK0A 2OPSA 5AJ3K 3VQ5A 3O3HA 2CH5A 3A5LC 3FFKB 3QEIA 1OVYA 2X78A 3S3MA 4FZZA 4B1XB 4FJ7A 3MECA 1Y64A 3CJ7A 3SAHA 3TTDA 3NGYA 3UKRA 3M3ZA 3VGMA 3V9WA 5CZ1A 1IG9A 1TKDA 2VYPA 5KPZA 4ISGA 2KHOA 2KZMA 1T6DA 3NH0A 5KPTA 3A5NC 1OH5A 4FW1A 4IJNA 4KTWA 4KI4A 4NO7A 3RWUA 5KPRA 4CI6A 1T44A 3FLCO 4GW6A 5AZIA 2O8DA 5EX5A 3HOSA 3ITHA 4LF8K 3K59A 4BQLA 4CHOA 1MWMA 2E20A 2P9SA 1RCHA 1CZ9A 3OYHA 2YHBA 3THYB 4F2RA 2WC9A 3RSEB 2E1ZA 5H1SQ 2FSKA 4LC9B 1Q8IA 1ITGA 5LMUK 5C42A 3NH1A 1QQOA 3ENHA 4E19A 4F3TA 4KTQA 3ATUA 1Q82O 3CC4N 1L3TA 2PYLA 1RTDA 4IFVA 4CEZA 5KQ8A 4DV6K 3K9KA 4BVPA 3U9DA 5AZIB 4J2DA 2ZD1A 4B8CA 4B9SA 1NGIA 4M45A 4BRIA 5C0YA 4DU4A 1NGFA 2G8VA 4AM7A 1U48A 3CCQN 3OYLA 1U47A 5C10A 3R6MA 4E7KA 2GTDA 2JGUA 1NK6A 3VQ4A 2W6LA 2G8UA 1QHAA 1QQNA 4DUYK 3WXKA 5M1QA 1QZ6A 4ZTFA 3O08A 1QSYA 5BRFA 3TTFA 3E9PA 4FM2A 4CGIA 1JL1A 4DFJA 2QK9A 5HROA 2QKBA 3VEYA 3KWIA 4KV8A 4O44A 5GADP 4M3ZA 2UXBK 4C8NA 4LFCK 2I7PA 1NGHA 1BWFO 2UU9K 4KH5A 4FJMA 4M3TA 5J2PA 4Q5VA 1HYVA 3LL3A 3KLGA 3D6RA 1RT1A 4KHQA 2NRHA 3ENBA 5E26A 3ZSZA 2IIRA 4B8AB 4C8OA 2EX3A 1KTQA 2IOCA 1BL3A 4DQPA 3I33A 1KAXA 4ZTJA 3DRRA 2YNHA 4PQUA 3CCUN 3DYAA 3HTVA 2Y1JA 2PY5A 1Y97A 1BO5O 2BUPA 3HRGA 4ID1A 4JKFA 3ZYYX 3VGKA 3J7YP 3MN9A 2HOEA 4Q0BA 4KO0A 1F21A 1RBUA 4KHUA 4DV7K 2XRIA 2KFNA 1FK9A 1WAJA 3D2EA 4YFUA 3HYFA 4C8KA 3BDPA 4CIEA 4IOCL 4DTOA 5JS2A 5KTQA 3DXMA 3O4NA 3P38A 1BOTO 4BWJA 2R7YA 4K25A 2JWKA 4CEDA 4KKOA 5GAGP 5A2QO 4B1UB 3DJCA 1NJXA 1BA0A 1VQKN 3CCSN 3NDKA 3RR8A 2PBDA 2D0OA 4CJRA 3DLLL 4FJ5A 1FW6A 4FLVA 2YNFA 4FOEA 3PX6A 5DM6L 4B9MA 1EWQA 1Q86O 3ZT0A 2G8IA 2HHVA 3OYKA 4PUOA 2HHQA 3O6WA 3LP0A 1UAXA 3C7NB 4JI6K 4BRHA 4CEQA 3QBWA 1VHXA 1IJJA 1C0MA 1D4XA 1LCUA 3CIPA 3HBTA 4GKKK 4FWRA 1A5XA 2D1KA 2X74A 4DLEA 4H0YB 3DXMB 1GOBA 5E84A 2J4RA 2HMIA 3HPHA 3EO3A 2RKIA 3SUOA 3SV4A 4OGEA 3Q7BA 4C23A 1BIUA 4ZHRA 1I94K 3ID8A 1NGAA 1HNIA 2GELA 3IS9A 4LD0A 2E2PA 4EP4A 3GDQA 4NYFA 4CJ3A 5ELZA 2YJEA 4DR3K 2XO7A 3PUFA 4CJTA 3CCMN 3C6AA 4FCYA 4GY2B 1YJNN 4HVJA 1HKGA 4OVLA 4A61A 3PSIA 3OY9A 3RMAA 1GLAG 5M1FA 4FM1A 5F0XA 4FVMA 2GEMA 1NK4A 4LH5A 4Z4FA 3UKUA 1J5EK 4CZLA 5C24A 3KLIA 3SAGA 1NGDA 4E1JA 3FR0A 3ZT1A 4DR2K 3T1YK 3SAFA 3C95A 1HR0K 1GLFO 3BP8A 1S1WA 4CJEA 1A5WA 1ESVA 4M63C 4JS5A 1W7AA 1RDAA 2BTFA 1O13A 4CJSA 1NJIO 1NG9A 1C1BA 3M8RA 4L3QA 1J5OA 3DOLA 3GG4A 3G4SN 1QZ5A 2HBJA 5AZJB 5D3GA 4CIFA 3UKUB 4W5QA 3KKSA 1HQUA 3ZSQA 3CFRA 3EL2A 3AO5A 4AHVA 3RMBA 4CJ4A 2X6NA 4ISFA 1BA1A 1RBTA 1C0UA 5TKWA 3H46O 4Y0WA 3SLCA 1NGJA 4CZFA 4NCAA 1J54A 4K0KK 3THWB 2FF3B 1P8ZA 1J9AA 3H1VX 1S1TA 4LH4A 4FSVA 1OH7A 2G8KA 2Q36A 4FJJA 4FJXA 3L2UA 2IGIA 4JK9A 1T8EA 3NAEA 1GLBG 4CZGA 3SCXA 1RDWX 4CHQA 3LANA 4JI3K 3LDNA 4N5SA 2D5RA 3HL8A 2P9IB 3LP3A 5JLFA 4WCEL 1TYQA 4DMNA 1X9MA 3NF9A 3BY5A 2UXCK 3LDPA 2I7NA 3BZKA 4ILGB 2ZJRL 3RVCA 3KVGA 2LSNA 4CJ5A 1RFQA 4O4GA 1GLJO 2D0CA 1JKHA 4GVEA 4CJQA 3LDQA 1HKBA 2BANA 3QICA 1HMVA 2AJQA 1XUPO 4DSKA 1K8AO 3N4QA 2OZMA 2P9NA 3AO3A 3VQ6A 1TGOA 2D0BA 1WBBA 3AVFA 4LF6K 4QCLA 1NGCA 4EIAA 1C1CA 3EYZA 2P51A 4FLZA 2E88A 1JLAA 3O3FA 1SAZA 4DV0K 3LZIA 5B8HA 3AVCA 2AP1A 4OKJA 2KFZA 4W5NA 2E6MA 5HBMA 1VSMA 4YY3K 3KIOA 4X62K 1NK9A 2IS3A 3B6OA 2E6LA 1TV6A 1ZBIA 3CI5A 4E7IA 4MDAA 4DS4A 2YI1A 1VQ4N 2HSTA 4WFAL 4DSLA 1NK0A 3L6QA 2HW3A 1JL2A 4CJVA 3SMPA 4XIUA 4OX9K 1JLEA 2P5OA 4NXMK 3T1AA 2RN2A 4KTZA 5M1PA 2OA8A 5AFUH 4ELUA 4FWNA 3O9SA 4AQYK 3CJBA 3IMXA 2ZGYA 4B3OA 1HJRA 1YTUA 4FJNA 3OA9A 2BDPA 2FLOA 3UE5A 1B92A 1NMNA 1QS4A 5AR0A 4GV9A 2G8WA 3EZ5A 3DRPA 1K73O 1TAUA 3VQ7A 4CZMA 1HNVA 3SQ2A 3L2RA 4CVNE 2XY6A 1KCFA 3VEZA 5AQXA 3CQYA 4CBWA 1QVGM 3P83D 4LF5K 4WQ5C 4E7HA 3SUPA 1MWKA 2A40A 1YVUA 4BRCA 1NK8A 3CCRN 3QIOA 1XI1A 2O8BA 4DQRA 3UIQA 4J2EA 4IO8A 1U6ZA 1WLJA 3K9JA 2KKZA 3ULEA 2KQ2A 3OTOK 3AARA 4EP5A 2Q0RA 1ZC6A 1BCMA 1WUAA 4JEPA 3TAMA 4J2AA 3LWMA 5HLFA 1R59O 3IDHA 3KD1E 4O5BA 4MLEA 4Z4GA 1NNEA 3SUNA 4DTXA 1Q9YA 4I7FA 2GWJA 3AGKA 3KK1A 4DSIA 3VN5A 4LF4K 1VQ6N 1KXPA 3PIPL 2Q2RA 2O8BB 2RE2A 3MXMA 3IKMA 3WT0A 1RTIA 2QTDA 4H4OA 3CJCA 4DUZK 2OPQA 4JKBA 2HF4A 2WUSA 3OYNA 1B9DA 2ZWHA 3C6HA 2HHXA 4X64K 1CXUA 1WSEA 2OTJN 3OYBA 5CZ2A 2HVHA 4DTPA 4FWMA 5JLHA 3HK2A 4IG3A 1X3MA 4OJRA 3ZX0A 4M3WA 3DM2A 3O9RA 1BI4A 5HRSA 4X65K 2Q3SA 5JVGL 3OYGA 4K8ZA 1A5VA 1KAZA 5HRPA 4O0JA 4I9LA 3U6FA 1KC8O 2UUCK 3OBYA 1VQ8N 4FW2A 2F9TA 4JK7A 1S22A 4HCCA 1FKOA 4HUEA 2Z1HA 3VQDA 4DKWA 2OANA 4E1NA 4NYNA 3HVRA 4DQ8A 2P9PA 1L3SA 3AVAA 5AQMA 3TSUA 1C0FA 4CK2A 1K9MO 3LDOA 1BI4B 1GOCA 1Z6RA 4RW9A 3CMEN 1UOCA 3B8AX 5FRMA 1JJ2M 4BDYA 3LAKA 3THYA 3L8BA 4B1ZA 3AGRA 3Q7CA 3MWPA 3RSEA 5HL7L 4B9QA 3NE6A 1YJWN 4KHPK 1TKZA 1ATRA 4FWOA 3CQ8A 4OLAA 2VG6A 3KHYA 5AQSA 1NJWA 1LOTB 2FSNA 3A8YA 1KFDA 3K5LA 3CCJN 5AQYA 1KD1O 1TKTA 4LFAK 3SMSA 5C2DA 4N56A 3TR8A 3PO4A 3GL1A 4CZHA 3LPTA 1N8RO 1V4TA 4I2QA 2ZGZA 3PY8A 4NXNK 2P9PB 1NGEA 3HSCA 1W2BM 2QWRA 3VTIA 4FZYA 2NLXA 1RTHA 1M90O 1U2VB 5T7BA 3RRGA 4CEAA 1TK5A 3QDKA 3CF5L 2YJFA 3ASMA 2FF6A 4BRLA 4R79A 4DV4K 1ASVA 5I3UA 3C65A 4FWPA 4OPJA 4I9QA 2A5XA 2FBTA 4B3TK 4ELVA 4QS9A 1RBSA 1EQYA 1N6QA 5CE3A 1TAQA 2ASMA 4F3OA 5ADXA 4AHCA 4DR5K 1P90A 1DLOA 2GUIA 3P31A 3E9LA 1S6QA 3NF7A 4FWQA 1WBDA 2A1SA 3M8SA 4KAZA 4K8XA 1N36K 3L2VA 3ZSRA 2XHBA 4PKHA 2O4IA 1T05A 4M7XA 5BREA 4BR9A 4ILJA 4AHUA 1U49A 3MX5A 4YORA 5I42A 3PIOL 2ZM6K 1M1KO 1VSHA 3OVNA 4CJFA 4KHYA 3EY1A 2FBXA 4H0TB 4HHTA 4NLBA 1D9DA 1T7PA 4WFNL 2NRTA 3ZLJA 3MWTA 1JLFA 3T7ZA 3JXUA 5BN8A 4DV1K 3CHWA 3MEGA 3MX2A 4O55A 4HWIA 4BDZA 4Z4IA 4NB4A 3D0PA 3WNEA 1JLGA 2HNZA 2QWOA 3ZETB 3LDLA 4BC2A 2F7TA 3SPYA 1D5AA 2A6AA 3LWLA 1EETA 2PFUA 3AVMA 3WQUA 1NOZA 4JI0K 3EKSA 3O9TA 4BR7A 3AVKA 4CGDA 2O8CB 3PSFA 4I2PA 3OHRA 3TSQA 1VRUA 3QEXA 4JNEA 5JS1A 3VENA 1YUWA 1BHLA 4BRGA 4DB3A 4H0PA 4KREA 4EFHA 1WSGA 4CD3A 4KHNA 4CFAA 3FZFA 3ULDA 4IDKA 1J53A 3HP9A 1HRHA 3DXKB 1E3MA 1VAZA 4FWLA 4OPHA 1N5YA 1YHQN 2O8EB 3C7NA 2P9LB 4JV5K 1XMOK 4OPAA 3BF1A 3H3NO 4GVMA 2B6AA 3V9UA 1WB9A 2UUAK 4N41A 1REVA 1DTQA 1NJZA 1BCOA 2CGKA 5MLCQ 3HT3A 5FRNA 1RDBA 3MXJA 3A5OC 2YKNA 5M1KA 3AA4A 5GAEP 3OYEA 3R9PA 3CM6A 1N34K 1NK7A 4HUFA 4KB1A 4JKGB 4CF2A 2NUBA 4CGHA 4KH4A 4GMJB 2O8FB 4DFKA 4FK2A 2IVNA 4FWSA 3I8DA 3MN6A 4YOWA 3T69A 1LW2A 3VQ9A 1TUYA 3IFRA 4A57A 4E7JA 2P5GA 1Q18A 4DTSA 1YIJN 3R8EA 3E01A 4OLBA 3T19A 3VQ8A 3RRHA 2XY5A 1GOAA 4LSNA 4M3YA 2QXFA 4IDHA 5JVHL 4FLYA 4K41A 3NFAA 4H5WA 3CG7A 5AQTA 4BRDA 4LFBK 4BR0A 3EEQA 3QMLA 4H4MA 2VWJA 4FLXA 3D45A 3KTQA 4KPYA 4OPKA 3KLFA 4N76A 2V7ZA 4HCBA 1QSLA 2W41A 3AVIA 3J80O 3JSMA 3C94A 3T1HK 4YOUA 1HNWK 3VQBA 4BRFA 3TWHA 1IO2A 1Q7YO 2BE2A 4BE0A 3VERA 1IBLK 4YDUA 5AZJA 2OPPA 1LAWA 3VQPA 4FLUA 1VQNN 2RF2A 1UWBA 2ZJQL 4FM0A 3VESA 3CJ9A 3H1QA 1XQSC 3FZMA 1X9WA 2ZJPL 3OYDA 1C1AA 3PV8A 1QQMA 4BC5A 4PY5A 5CYMA 5KGWA 1WSFA 2WOMA 4CJ7A 2ITMA 1DT9A 4O5FA 4XH4A 3V9XA 3THWA 1HKCA 4O8KA 4BE1A 1DGKN 4PA1A 1MA9B 3MEEA 2Q97A 1RT5A 4IOAL 1IKYA 3MCPA 4IFEA 3QESA 4JI5K 1RDCA 3NVMA 1HLUA 4QS7A 4DFPA 4JN4A 2ASPA 1VQ9N 3EN9A 3I56N 1W0HA 2P9IA 5FPEA 3VQQA 3DLHA 2YHWA 1VSLA 4WQ4A 1MDUB 3OYIA 2Z1GA 3CCEN 3QEVA 1YAGA 2E5LK 4WQ5A 1KVBA 1VQLN 1SL0A 3U4LA 5LY3A 4CGJA 1JXBA 4M41A 4AILC 1QSSA 4PKIA 4FL9A 2V52B 1SKWA 1KFSA 5GAHP 1CXQA 2W42A 3QEPA 3AA3A 2YKMA 4AHRA 3TSPA 2B5JA 4I6MB 5BPNA 1ASUA 3BUZB 4JI8K 5KRSA 2D0PA 2W40A 1SZ2A 4CW7B 2A1RA 4KRFA 4H5VA 4HTUA 1SL1A 4UY8O 1SV5A 4DS5A 3VF4A 4DR6K 2HBLA 4DF8A 3AAPA 4DSEA 4FWKA 4PHTX 4Z4HA 1XNQK 3ATVA 1X9SA 1TK8A 4B08A 3KZBA 3M6GA 4B3MK 4WFBL 1DKGD 3DWLA 4H5RA 5LMNK 2HBMA 2F8TA 2XY8A 4DFMA 1VQON 1IKXA 1JLCA 1NKBA 1NM1A 5AQIA 1FKPA 5SWMA 1WOQA 4M42A 4HUGA 1ATSA 1BISA 5HRNA 1T6CA 2A3ZA 4FJLA 3TABA 1YXQA 4B9TA 1NLVA 1J6ZA 1TL1A 2IDOA 3LAMA 2YCHA 3CPWM 3OJUA 2CGLA 3BGRA 4J8FA 1GLLO 1IKWA 3AVLA 4B1WB 3V6DA 4RW7A 3ZSYA 3FFIA 2QWMA 1NU0A 3RMDA 1WSJA 1ATNA 2EWSA 4CECA 1OH6A 4FVUA 1L3VA 1XWLA 3F5TA 5K14A 1D9FA 2V51B 4PKGA 1VSDA 4YDUC 1W97L 2A42A 5IWAK 3W0LA 2E1YA 5CHIA 3L4QA 4CK3A 1VQPN 4EZ6A 4Y1DA 3SNNA 3NGZA 2YX6A 3HM8A 3CM5A 1ZBHA 1EX4A 1T3VA 4MQ3A 3C6TA 3O8MA 3HO1A 2EHGA 1VSIA 2YHYA 4JS4A 3NBPA 1IG8A 3ZEUB 3V1OA 4A5AA 3QNOA 5KI6A 1G99A 1NKCA 3TTCA 3SV3A 2QI2A 3KLHA 5C2FA 1EP4A 3DLRA 1UA0A 3S3OA 1VSJA 2UYTA 1NKEA 4CFBA 2HF3A 2VGNA 4IEEA 4EHUA 2D4WA 3VOVA 1LWFA 2X6SA 2KZZA 1OVQA 4DU3A 4CFDA 5LJWA 4E7LA 4DLGA 4WQ4C 1Z26A 4CBXA 1NBWA 1D8YA 2Y1IA 4A5BA 4U7BA 4KHWA 5HRRA 3TPQA 4ID5A 2FBYA 3OYCA 3QFUA 5DM7L 1T03A 5AQWA 3TI0A 3O80A 1K8KB 3WXLA 1SL2A 4RTFD 1B9FA 5TKYA 3K57A 4KI6A 2F96A 4IJAA 4RW6A 3ZT2A 3WUHA 2F8SA 3AA5X 1E4GT 5AQQA 3O9UA 4B3RK 3SYZA 5JICA 1NGGA 5AQLA 4BACA 4BRPA 1L5UA 5J2QA 4DF4A 3AO2A 4QS8A 4YOYA 2Q1NA 2QA4N 3MN7A 1SUQA 3SPZA 1SKSA 4B9NA 3K5OA 3P39A 3MCAB 3OYAA 1GLEG 1WSIA 4FYDA 5FPNA 2GBZA 2ITGA 4DR7K 3ALYA 2ZE2A 3K58A 3H6EA 3C6UA 1HNZK 3K2PA 4BR5A 4TSXA 2HNYA 2Z1IA 3WEEB 4BVOA 4A59A 4DTJA 3HM9A 4YOXA 3OYJA 3VMFB 3SBGA
chains in the Genus database with same CATH topology
1BIUA 1G15A 3L3VA 4ZHRA 3OYFA 1T05A 1LV5A 3V81A 3SZ2A 1HNIA 3IS9A 4LD0A 4KB0A 3NHGA 1RDDA 4EP4A 3G10A 4NYFA 4AHUA 4CJ3A 1U49A 2XO7A 3AA2A 3M8QA 5I42A 3PUFA 4CJTA 3KK3A 3TAEA 1VSHA 4FCYA 3OVNA 1S9EA 1BQMA 4CJFA 3QNNA 4KHYA 3VQEA 4Z4CA 2FBXA 3AVHA 4HVJA 3EY1A 4FJ9A 4OVLA 3I0SA 3G0ZA 5DK5A 4JRPA 3V9SA 3OY9A 3IG1A 3RMAA 1YTUA 4HHTA 4CHYA 1D9DA 1T7PA 4FM1A 4B9VA 4LY7A 4NCGA 4BDPA 4FVMA 1KSPA 3DLEA 1JLFA 4DTUA 1NK4A 4W5RA 4LH5A 4UQGA 4Z4FA 3MEGA 4O55A 4Z0UA 4BDZA 4L8RB 5C24A 3KLIA 4Z4IA 3D0PA 3WNEA 3NF6A 4R5PA 1JLGA 2HNZA 4C8LA 3ZT1A 3ZSVA 3THVA 4OGCA 3SPYA 1D5AA 2OYQA 3M8PA 1TL3A 3ZT4A 4RG8A 3LWLA 1EETA 4CF8A 3NGIA 3C95A 3AVMA 3HJFA 1RBVA 4DSJA 1TVRA 3V1RA 1NOZA 1I3AA 2HNDA 1S5JA 1S1WA 4CJEA 4JRQA 4NCBA 1A5WA 3AVKA 4E89A 4JS5A 4CGDA 4CJLA 1RDAA 3H08A 3NH2A 4CJSA 3AO1A 4IBNA 4H8KA 3AVGA 4I2PA 3MEDA 1VRUA 3QEXA 4CEFA 4FLTA 1C1BA 1XHXA 4M3RA 2ZQBA 3M8RA 5HP1A 1J5OA 3DOLA 5JS1A 5FDLA 4ELTA 4CE9A 1BHLA 1NJYA 1U4BA 4KREA 5D3GA 1Q9XA 4CIFA 1WSGA 4W5QA 1S6PA 4KHNA 4CFAA 3ULDA 1RTJA 1YTAA 4IDKA 1J53A 4DQSA 2GV9A 4DWIA 3HP9A 1HRHA 1BGXT 1HQUA 3KKSA 3SI6A 3ZSQA 4QAGA 3HP6A 3CFRA 5SZTA 1N5YA 3AO5A 3O4QA 4AHVA 3QIPA 3RMBA 4CJ4A 4E0DA 4GVMA 2B6AA 2X6NA 3ZSWA 4CHNA 3V9UA 2PZSA 4N41A 1RBTA 1REVA 1DTQA 1C0UA 3KK2A 1NJZA 5FROA 1IKVA 5KRTA 1BCOA 2HHSA 3NF8A 3HT3A 5FRNA 1RDBA 3MXJA 3HPOA 3K5NA 5CYQA 4OKKA 2YKNA 3TAPA 1J54A 4AHSA 1ZBLA 1JXEA 1XHZA 2OZSA 4NCAA 3AA4A 4M3XA 1J9AA 4LH4A 1S1TA 3OYEA 4FXDA 1S1VA 2G8KA 3VA3A 3CM6A 2IAJA 3L2UA 2IGIA 1T8EA 5DMRA 4FJJA 4FJXA 4QOZB 3NAEA 1LAVA 3SQ4A 3SCXA 1VK0A 4CHQA 3LANA 1NK7A 4HUFA 4KB1A 4O0IA 1QQCA 4LSLA 4CF2A 2NUBA 1S9GA 2KZMA 4KFBA 4CIGA 1X1PA 4CGHA 4GMJB 3U3GA 4N5SA 3KLEA 4DTNA 1HYZA 2D5RA 3HL8A 3LP3A 4DFKA 3K5MA 4FK2A 1WSHA 3CFOA 3I8DA 4B9UA 4DMNA 3A2FA 4CHZA 3VQ9A 1LW2A 3NF9A 1X9MA 2P1JA 2VG5A 3PO5A 2RPIA 3WNHA 1IH7A 4E7JA 2P5GA 3PX4A 4DTSA 2LSNA 4CJ5A 3E01A 4O4GA 2D0CA 1JKHA 3AVNA 3TANA 4OLBA 4F2SA 4DSFA 1R0AA 2I5JA 3LPUA 4CJQA 3T19A 3VQ8A 3RRHA 3DLGA 3QLHA 1GOAA 3ISNC 2BANA 2XY5A 1ZBFA 2DY4A 1HMVA 3TAFA 2AJQA 4ICLA 1WAFA 4LSNA 4CK1A 3VA0A 2QXFA 4M3YA 1EKEA 4FLYA 3IRXA 3NFAA 3CG7A 4DSKA 4FJHA 3RR7A 3P5JA 4H4MA 2VWJA 2OZMA 3AO3A 3KJVA 4FLXA 4FJKA 3D45A 3KTQA 4F4KA 4KPYA 4CGFA 3OS1A 4OPKA 2HB5A 4N47A 3TARA 3VQ6A 3KLFA 3OS0A 4CJUA 1K6YA 1TGOA 4N76A 1KVAA 4FJIA 3SUQA 2D0BA 4HCBA 3L2WA 1QSLA 3DRSA 1EXQA 3AVIA 3AVFA 3JSMA 4QCLA 3TAQA 4FJGA 4Y1CA 3C94A 1C1CA 3EYZA 2P51A 3VQBA 3IAYA 1HQEA 1S1XA 4FLZA 3O3FA 1JLAA 3TWHA 1IO2A 1RILA 4MFBA 4CCHA 4DTRA 4B9LA 3LZIA 3PX0A 3V9ZA 4DQQA 1CZBA 2BE2A 4BE0A 1FXXA 3AVCA 4OKJA 2KFZA 4CFCA 2OPPA 1LAWA 3VQPA 2E6MA 3WNGA 3MAQA 4BWMA 4W5NA 5HBMA 2B4JA 4FLUA 1VSMA 3KIOA 4DG1A 1RT3A 4FZXC 2RF2A 1UWBA 1NK9A 2HHUA 4FM0A 2IS3A 3B6OA 4OKEA 1C0TA 2E6LA 1TV6A 4CGGA 1BIZA 3QEWA 1ZBIA 1X9WA 4E7IA 4DS4A 3OYDA 1C1AA 3PV8A 2ETJA 2PYJA 4B3OA 2QKKA 2DFFA 3F9KA 4DSLA 1NK0A 4E3SA 5CYMA 4PY5A 2HW3A 1YT3A 4G1QA 1JL2A 5KGWA 1WSFA 4CJVA 4CESA 2WOMA 4XIUA 3QO9A 1JLEA 4FK0A 2P5OA 2Z1JA 3MXIA 3T1AA 4RW8A 3V9XA 3RTVA 4BE2A 2RN2A 4KTZA 4BE1A 4PA1A 1RT2A 3MEEA 2HHTA 1RBRA 1RT4A 3OS2A 1RT5A 2OA8A 1ASWA 3AVBA 4ELUA 1IKYA 1RT7A 1KLNA 3QESA 3DLKA 4KHSA 3CYMA 1RDCA 4DTMA 1NK5A 3L3UA 1KLMA 1HJRA 2D0AA 1WN7A 4CEOA 1TK0A 2G8FA 2BDPA 2OPSA 4FJNA 4DFPA 1I39A 1W0HA 4WE1A 1B92A 1QS4A 3VQ5A 3O3HA 4FK4A 2G8WA 3EZ5A 3VQQA 3DRPA 3DLHA 3AO4A 3QEIA 3LDSA 1TAUA 2X78A 3S3MA 4FZZA 3VQ7A 2WONA 4DQIA 4FJ7A 3MECA 1VSLA 1HNVA 5J1EA 3SQ2A 3OYIA 2Z1GA 3QEVA 1JLQA 3L2RA 2XY6A 1KVBA 3SQ0A 1SL0A 1MU2A 3NGYA 1KCFA 3SQ1A 3P83D 4CGJA 5CZ1A 1JXBA 4M41A 3V9WA 3ZSXA 4AILC 1IG9A 1QSSA 1TKDA 1VRTA 4E7HA 1SKWA 3SUPA 1KFSA 4IFYA 1YVUA 3ZT3A 1NK8A 3DI6A 3QIOA 3O3GA 1CXQA 2W42A 2YNGA 3QEPA 3AA3A 2YKMA 3NH0A 4AHRA 2FC0A 3HXMA 1XI1A 2E4LA 2B5JA 1BQNA 4DQRA 3DMJA 1C6VA 1ASUA 4FW1A 5KRSA 3UIQA 3OYMA 4KTWA 2A1RA 4J2EA 4KI4A 4KRFA 3RWUA 1WLJA 4HTUA 1SL1A 1SV5A 4GW6A 3VQAA 3RMCA 4DS5A 4DF8A 2O4GA 3F73A 2KQ2A 1VSKA 2KW4A 3WNFA 3ITHA 4EP5A 4DSEA 3K59A 4CHOA 3SJJA 4Z4HA 1BCMA 3P1GA 3TAMA 3DLBA 4J2AA 3LWMA 5HLFA 1LW0A 2KTQA 4CHPA 1RCHA 1CZ9A 3KD1E 4O5BA 3OYHA 1X9SA 1TK8A 3SUNA 4B08A 2YHBA 4Z4GA 4F2RA 3L2QA 3ZSOA 4DTXA 1Q9YA 3VQCA 4I7FA 3DOKA 2F8TA 2XY8A 4DFMA 2BGGA 3KK1A 1IKXA 1JLCA 4DSIA 3VN5A 3OJSA 3JYTA 1Q8IA 1NKBA 1ITGA 5C42A 3KKRA 3S9HA 1FKPA 5SWMA 3NH1A 1U45A 4M3ZA 4Z4EA 4W5TA 4E19A 4F3TA 4M42A 4HUGA 3MXMA 4KTQA 1BISA 5HRNA 1RTIA 4IG0A 4H4OA 1L3TA 3I0RA 4RW4A 2ATQA 3TABA 4FJLA 2PYLA 1RTDA 4FJ8A 2HVIA 2OPQA 4IFVA 4CEZA 4B9TA 1TL1A 2IDOA 3LAMA 3OYNA 4J2DA 2ZD1A 1B9DA 3OJUA 4B8CA 3HSTB 4CF0A 3BGRA 4B9SA 2HHXA 4M45A 1IKWA 1CXUA 3AVLA 3CFPA 3V6DA 1KRPA 4RW7A 4DU4A 3ZSYA 3QETA 1WSEA 2G8VA 3FFIA 3OYBA 1NOYA 5CZ2A 1WNSA 3RMDA 3S3NA 3V4IA 1WSJA 4DTPA 1U48A 2HVHA 3OYLA 1U47A 4CECA 4E7KA 4CEEA 1L3VA 1XWLA 1NK6A 2JGUA 3VQ4A 5K14A 1D9FA 3HPGA 3HK2A 1VSDA 2VWKA 4IG3A 2G8UA 4PWDA 4OJRA 2XHBA 4M3WA 3DM2A 4J2BA 2G8HA 4EZ9A 5E41A 4CK3A 4EZ6A 4ZTFA 4Y1DA 5J2NA 1QSYA 4CJKA 3AVJA 5C25A 1BI4A 3SNNA 5HRSA 2Q3SA 3NGZA 4FM2A 4JLHA 3CM5A 1ZBHA 4CGIA 1EX4A 1JL1A 4DFJA 2QK9A 3NCIA 4CF1A 5HROA 1DTTA 2QKBA 4MQ3A 3OYGA 4KV8A 4K8ZA 1A5VA 2DFEA 3C6TA 4O44A 5HRPA 4FLWA 2XY7A 4O0JA 1L3UA 4I9LA 2EHGA 4C8NA 3LP1A 3LALA 3U6FA 1VSIA 3T3FA 3ZCMA 1VSFA 4JS4A 4FW2A 3NBPA 5KGXA 5J2MA 4HCCA 4FJMA 4M3TA 1FKOA 3V1OA 1RNHA 5J2PA 4CF9A 4Q5VA 3QNOA 1HYVA 2YV0X 5KI6A 1NKCA 4HUEA 3KLGA 1UA1A 2Z1HA 1U04A 4KHQA 1RT1A 5CY4A 3VQDA 4CJWA 2YNIA 3ZSZA 3SV3A 3KLHA 1LWEA 3TAGA 4E1NA 1TKXA 4B8AB 4C8OA 2EX3A 1EP4A 1KTQA 3DLRA 4NYNA 3HVRA 1UA0A 1L3SA 3KD5E 2IOCA 3V1QA 3S3OA 1VSJA 1NKEA 1BL3A 4CFBA 3AVAA 4DQPA 4ZTJA 3DRRA 2YNHA 4CK2A 1S1UA 1BI4B 1GOCA 3B6PA 4RW9A 1ZYQA 1LWFA 1UOCA 2X6SA 4E1MA 5FRMA 2KZZA 4PQUA 4BDYA 3LAKA 1QTMA 3DYAA 1JLBA 2Y1JA 4DU3A 4CFDA 3L8BA 4E7LA 2PY5A 1Y97A 4DLGA 4IKFA 4ID1A 1Z26A 3NE6A 3LP2A 1TKZA 3CQ8A 5EU7A 4OLAA 2VG6A 1QE1A 3QINA 1NJWA 2DFHA 1ZBUA 2Y1IA 1D8YA 4KO0A 4Q0BA 1F21A 1RBUA 2DTUA 4KHUA 1KFDA 3K5LA 1HYSA 4KHWA 1KVCA 1TKTA 5HRRA 2XRIA 4ID5A 2KFNA 1FK9A 1WAJA 4N56A 3TR8A 1RT6A 1HPZA 4AHTA 2FBYA 3QERA 3PO4A 4YFUA 3OYCA 3HYFA 2HHWA 2JLEA 4C8KA 1T03A 3BDPA 4F8RA 4CIEA 3TI0A 3LPTA 4DTOA 4I2QA 3PY8A 5JS2A 5KTQA 1SL2A 1B9FA 3K57A 4AH9A 4KI6A 2F96A 3O4NA 2VG7A 2FBVA 4BWJA 2R7YA 4RW6A 3ZT2A 2F8SA 4FZYA 4CEDA 4KKOA 3AA5X 1RTHA 1QHTA 4CEBA 1VSEA 1NJXA 3SYZA 2IC3A 5T7BA 3NDKA 3RRGA 3RR8A 4BACA 1XC9A 4CEAA 3HVTA 1TK5A 1L5UA 1LWCA 5J2QA 4CJRA 3ASMA 4DF4A 2OPRA 4FJ5A 3AO2A 4FLVA 1ASVA 2YNFA 5I3UA 4OPJA 3PX6A 1SUQA 3SPZA 4B9MA 3ZT0A 1SKSA 2G8IA 2HHVA 3OYKA 4I9QA 4B9NA 3K5OA 2FBTA 4PUOA 3HO1A 2HHQA 4ELVA 3LP0A 4YNQA 1UAXA 3LZJA 4CEQA 1RBSA 1N6QA 3U3YA 4CERA 3OYAA 1TAQA 1C0MA 1WSIA 4FYDA 2GBZA 1Z25A 2ITGA 4C8MA 1W9HA 3ALYA 1O1WA 4F3OA 2ZE2A 4CJPA 4W5OA 1CLQA 3K58A 4AHCA 4M3UA 1A5XA 2X74A 1DLOA 3C6UA 3K2PA 4DLEA 4DU1A 2GUIA 1GOBA 4TSXA 2YHAA 1S6QA 2HNYA 2Z1IA 3HPHA 3NF7A 2HMIA 2RKIA 2A1SA 4DTJA 3M8SA 3SUOA 3SV4A 4OGEA 3OYJA 3AV9A 3HM9A 1SKRA 4KAZA 4K8XA 3L2VA 3ZSRA 2O4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIU A;  1G15 A;  3L3V A;  4ZHR A;  3OYF A;  1T05 A;  1LV5 A;  3V81 A;  3SZ2 A;  1HNI A;  3IS9 A;  4LD0 A;  4KB0 A;  3NHG A;  1RDD A;  4EP4 A;  3G10 A;  4NYF A;  4AHU A;  4CJ3 A;  1U49 A;  2XO7 A;  3AA2 A;  3M8Q A;  5I42 A;  3PUF A;  4CJT A;  3KK3 A;  3TAE A;  1VSH A;  4FCY A;  3OVN A;  1S9E A;  1BQM A;  4CJF A;  3QNN A;  4KHY A;  3VQE A;  4Z4C A;  2FBX A;  3AVH A;  4HVJ A;  3EY1 A;  4FJ9 A;  4OVL A;  3I0S A;  3G0Z A;  5DK5 A;  4JRP A;  3V9S A;  3OY9 A;  3IG1 A;  3RMA A;  1YTU A;  4HHT A;  4CHY A;  1D9D A;  1T7P A;  4FM1 A;  4B9V A;  4LY7 A;  4NCG A;  4BDP A;  4FVM A;  1KSP A;  3DLE A;  1JLF A;  4DTU A;  1NK4 A;  4W5R A;  4LH5 A;  4UQG A;  4Z4F A;  3MEG A;  4O55 A;  4Z0U A;  4BDZ A;  4L8R B;  5C24 A;  3KLI A;  4Z4I A;  3D0P A;  3WNE A;  3NF6 A;  4R5P A;  1JLG A;  2HNZ A;  4C8L A;  3ZT1 A;  3ZSV A;  3THV A;  4OGC A;  3SPY A;  1D5A A;  2OYQ A;  3M8P A;  1TL3 A;  3ZT4 A;  4RG8 A;  3LWL A;  1EET A;  4CF8 A;  3NGI A;  3C95 A;  3AVM A;  3HJF A;  1RBV A;  4DSJ A;  1TVR A;  3V1R A;  1NOZ A;  1I3A A;  2HND A;  1S5J A;  1S1W A;  4CJE A;  4JRQ A;  4NCB A;  1A5W A;  3AVK A;  4E89 A;  4JS5 A;  4CGD A;  4CJL A;  1RDA A;  3H08 A;  3NH2 A;  4CJS A;  3AO1 A;  4IBN A;  4H8K A;  3AVG A;  4I2P A;  3MED A;  1VRU A;  3QEX A;  4CEF A;  4FLT A;  1C1B A;  1XHX A;  4M3R A;  2ZQB A;  3M8R A;  5HP1 A;  1J5O A;  3DOL A;  5JS1 A;  5FDL A;  4ELT A;  4CE9 A;  1BHL A;  1NJY A;  1U4B A;  4KRE A;  5D3G A;  1Q9X A;  4CIF A;  1WSG A;  4W5Q A;  1S6P A;  4KHN A;  4CFA A;  3ULD A;  1RTJ A;  1YTA A;  4IDK A;  1J53 A;  4DQS A;  2GV9 A;  4DWI A;  3HP9 A;  1HRH A;  1BGX T;  1HQU A;  3KKS A;  3SI6 A;  3ZSQ A;  4QAG A;  3HP6 A;  3CFR A;  5SZT A;  1N5Y A;  3AO5 A;  3O4Q A;  4AHV A;  3QIP A;  3RMB A;  4CJ4 A;  4E0D A;  4GVM A;  2B6A A;  2X6N A;  3ZSW A;  4CHN A;  3V9U A;  2PZS A;  4N41 A;  1RBT A;  1REV A;  1DTQ A;  1C0U A;  3KK2 A;  1NJZ A;  5FRO A;  1IKV A;  5KRT A;  1BCO A;  2HHS A;  3NF8 A;  3HT3 A;  5FRN A;  1RDB A;  3MXJ A;  3HPO A;  3K5N A;  5CYQ A;  4OKK A;  2YKN A;  3TAP A;  1J54 A;  4AHS A;  1ZBL A;  1JXE A;  1XHZ A;  2OZS A;  4NCA A;  3AA4 A;  4M3X A;  1J9A A;  4LH4 A;  1S1T A;  3OYE A;  4FXD A;  1S1V A;  2G8K A;  3VA3 A;  3CM6 A;  2IAJ A;  3L2U A;  2IGI A;  1T8E A;  5DMR A;  4FJJ A;  4FJX A;  4QOZ B;  3NAE A;  1LAV A;  3SQ4 A;  3SCX A;  1VK0 A;  4CHQ A;  3LAN A;  1NK7 A;  4HUF A;  4KB1 A;  4O0I A;  1QQC A;  4LSL A;  4CF2 A;  2NUB A;  1S9G A;  2KZM A;  4KFB A;  4CIG A;  1X1P A;  4CGH A;  4GMJ B;  3U3G A;  4N5S A;  3KLE A;  4DTN A;  1HYZ A;  2D5R A;  3HL8 A;  3LP3 A;  4DFK A;  3K5M A;  4FK2 A;  1WSH A;  3CFO A;  3I8D A;  4B9U A;  4DMN A;  3A2F A;  4CHZ A;  3VQ9 A;  1LW2 A;  3NF9 A;  1X9M A;  2P1J A;  2VG5 A;  3PO5 A;  2RPI A;  3WNH A;  1IH7 A;  4E7J A;  2P5G A;  3PX4 A;  4DTS A;  2LSN A;  4CJ5 A;  3E01 A;  4O4G A;  2D0C A;  1JKH A;  3AVN A;  3TAN A;  4OLB A;  4F2S A;  4DSF A;  1R0A A;  2I5J A;  3LPU A;  4CJQ A;  3T19 A;  3VQ8 A;  3RRH A;  3DLG A;  3QLH A;  1GOA A;  3ISN C;  2BAN A;  2XY5 A;  1ZBF A;  2DY4 A;  1HMV A;  3TAF A;  2AJQ A;  4ICL A;  1WAF A;  4LSN A;  4CK1 A;  3VA0 A;  2QXF A;  4M3Y A;  1EKE A;  4FLY A;  3IRX A;  3NFA A;  3CG7 A;  4DSK A;  4FJH A;  3RR7 A;  3P5J A;  4H4M A;  2VWJ A;  2OZM A;  3AO3 A;  3KJV A;  4FLX A;  4FJK A;  3D45 A;  3KTQ A;  4F4K A;  4KPY A;  4CGF A;  3OS1 A;  4OPK A;  2HB5 A;  4N47 A;  3TAR A;  3VQ6 A;  3KLF A;  3OS0 A;  4CJU A;  1K6Y A;  1TGO A;  4N76 A;  1KVA A;  4FJI A;  3SUQ A;  2D0B A;  4HCB A;  3L2W A;  1QSL A;  3DRS A;  1EXQ A;  3AVI A;  3AVF A;  3JSM A;  4QCL A;  3TAQ A;  4FJG A;  4Y1C A;  3C94 A;  1C1C A;  3EYZ A;  2P51 A;  3VQB A;  3IAY A;  1HQE A;  1S1X A;  4FLZ A;  3O3F A;  1JLA A;  3TWH A;  1IO2 A;  1RIL A;  4MFB A;  4CCH A;  4DTR A;  4B9L A;  3LZI A;  3PX0 A;  3V9Z A;  4DQQ A;  1CZB A;  2BE2 A;  4BE0 A;  1FXX A;  3AVC A;  4OKJ A;  2KFZ A;  4CFC A;  2OPP A;  1LAW A;  3VQP A;  2E6M A;  3WNG A;  3MAQ A;  4BWM A;  4W5N A;  5HBM A;  2B4J A;  4FLU A;  1VSM A;  3KIO A;  4DG1 A;  1RT3 A;  4FZX C;  2RF2 A;  1UWB A;  1NK9 A;  2HHU A;  4FM0 A;  2IS3 A;  3B6O A;  4OKE A;  1C0T A;  2E6L A;  1TV6 A;  4CGG A;  1BIZ A;  3QEW A;  1ZBI A;  1X9W A;  4E7I A;  4DS4 A;  3OYD A;  1C1A A;  3PV8 A;  2ETJ A;  2PYJ A;  4B3O A;  2QKK A;  2DFF A;  3F9K A;  4DSL A;  1NK0 A;  4E3S A;  5CYM A;  4PY5 A;  2HW3 A;  1YT3 A;  4G1Q A;  1JL2 A;  5KGW A;  1WSF A;  4CJV A;  4CES A;  2WOM A;  4XIU A;  3QO9 A;  1JLE A;  4FK0 A;  2P5O A;  2Z1J A;  3MXI A;  3T1A A;  4RW8 A;  3V9X A;  3RTV A;  4BE2 A;  2RN2 A;  4KTZ A;  4BE1 A;  4PA1 A;  1RT2 A;  3MEE A;  2HHT A;  1RBR A;  1RT4 A;  3OS2 A;  1RT5 A;  2OA8 A;  1ASW A;  3AVB A;  4ELU A;  1IKY A;  1RT7 A;  1KLN A;  3QES A;  3DLK A;  4KHS A;  3CYM A;  1RDC A;  4DTM A;  1NK5 A;  3L3U A;  1KLM A;  1HJR A;  2D0A A;  1WN7 A;  4CEO A;  1TK0 A;  2G8F A;  2BDP A;  2OPS A;  4FJN A;  4DFP A;  1I39 A;  1W0H A;  4WE1 A;  1B92 A;  1QS4 A;  3VQ5 A;  3O3H A;  4FK4 A;  2G8W A;  3EZ5 A;  3VQQ A;  3DRP A;  3DLH A;  3AO4 A;  3QEI A;  3LDS A;  1TAU A;  2X78 A;  3S3M A;  4FZZ A;  3VQ7 A;  2WON A;  4DQI A;  4FJ7 A;  3MEC A;  1VSL A;  1HNV A;  5J1E A;  3SQ2 A;  3OYI A;  2Z1G A;  3QEV A;  1JLQ A;  3L2R A;  2XY6 A;  1KVB A;  3SQ0 A;  1SL0 A;  1MU2 A;  3NGY A;  1KCF A;  3SQ1 A;  3P83 D;  4CGJ A;  5CZ1 A;  1JXB A;  4M41 A;  3V9W A;  3ZSX A;  4AIL C;  1IG9 A;  1QSS A;  1TKD A;  1VRT A;  4E7H A;  1SKW A;  3SUP A;  1KFS A;  4IFY A;  1YVU A;  3ZT3 A;  1NK8 A;  3DI6 A;  3QIO A;  3O3G A;  1CXQ A;  2W42 A;  2YNG A;  3QEP A;  3AA3 A;  2YKM A;  3NH0 A;  4AHR A;  2FC0 A;  3HXM A;  1XI1 A;  2E4L A;  2B5J A;  1BQN A;  4DQR A;  3DMJ A;  1C6V A;  1ASU A;  4FW1 A;  5KRS A;  3UIQ A;  3OYM A;  4KTW A;  2A1R A;  4J2E A;  4KI4 A;  4KRF A;  3RWU A;  1WLJ A;  4HTU A;  1SL1 A;  1SV5 A;  4GW6 A;  3VQA A;  3RMC A;  4DS5 A;  4DF8 A;  2O4G A;  3F73 A;  2KQ2 A;  1VSK A;  2KW4 A;  3WNF A;  3ITH A;  4EP5 A;  4DSE A;  3K59 A;  4CHO A;  3SJJ A;  4Z4H A;  1BCM A;  3P1G A;  3TAM A;  3DLB A;  4J2A A;  3LWM A;  5HLF A;  1LW0 A;  2KTQ A;  4CHP A;  1RCH A;  1CZ9 A;  3KD1 E;  4O5B A;  3OYH A;  1X9S A;  1TK8 A;  3SUN A;  4B08 A;  2YHB A;  4Z4G A;  4F2R A;  3L2Q A;  3ZSO A;  4DTX A;  1Q9Y A;  3VQC A;  4I7F A;  3DOK A;  2F8T A;  2XY8 A;  4DFM A;  2BGG A;  3KK1 A;  1IKX A;  1JLC A;  4DSI A;  3VN5 A;  3OJS A;  3JYT A;  1Q8I A;  1NKB A;  1ITG A;  5C42 A;  3KKR A;  3S9H A;  1FKP A;  5SWM A;  3NH1 A;  1U45 A;  4M3Z A;  4Z4E A;  4W5T A;  4E19 A;  4F3T A;  4M42 A;  4HUG A;  3MXM A;  4KTQ A;  1BIS A;  5HRN A;  1RTI A;  4IG0 A;  4H4O A;  1L3T A;  3I0R A;  4RW4 A;  2ATQ A;  3TAB A;  4FJL A;  2PYL A;  1RTD A;  4FJ8 A;  2HVI A;  2OPQ A;  4IFV A;  4CEZ A;  4B9T A;  1TL1 A;  2IDO A;  3LAM A;  3OYN A;  4J2D A;  2ZD1 A;  1B9D A;  3OJU A;  4B8C A;  3HST B;  4CF0 A;  3BGR A;  4B9S A;  2HHX A;  4M45 A;  1IKW A;  1CXU A;  3AVL A;  3CFP A;  3V6D A;  1KRP A;  4RW7 A;  4DU4 A;  3ZSY A;  3QET A;  1WSE A;  2G8V A;  3FFI A;  3OYB A;  1NOY A;  5CZ2 A;  1WNS A;  3RMD A;  3S3N A;  3V4I A;  1WSJ A;  4DTP A;  1U48 A;  2HVH A;  3OYL A;  1U47 A;  4CEC A;  4E7K A;  4CEE A;  1L3V A;  1XWL A;  1NK6 A;  2JGU A;  3VQ4 A;  5K14 A;  1D9F A;  3HPG A;  3HK2 A;  1VSD A;  2VWK A;  4IG3 A;  2G8U A;  4PWD A;  4OJR A;  2XHB A;  4M3W A;  3DM2 A;  4J2B A;  2G8H A;  4EZ9 A;  5E41 A;  4CK3 A;  4EZ6 A;  4ZTF A;  4Y1D A;  5J2N A;  1QSY A;  4CJK A;  3AVJ A;  5C25 A;  1BI4 A;  3SNN A;  5HRS A;  2Q3S A;  3NGZ A;  4FM2 A;  4JLH A;  3CM5 A;  1ZBH A;  4CGI A;  1EX4 A;  1JL1 A;  4DFJ A;  2QK9 A;  3NCI A;  4CF1 A;  5HRO A;  1DTT A;  2QKB A;  4MQ3 A;  3OYG A;  4KV8 A;  4K8Z A;  1A5V A;  2DFE A;  3C6T A;  4O44 A;  5HRP A;  4FLW A;  2XY7 A;  4O0J A;  1L3U A;  4I9L A;  2EHG A;  4C8N A;  3LP1 A;  3LAL A;  3U6F A;  1VSI A;  3T3F A;  3ZCM A;  1VSF A;  4JS4 A;  4FW2 A;  3NBP A;  5KGX A;  5J2M A;  4HCC A;  4FJM A;  4M3T A;  1FKO A;  3V1O A;  1RNH A;  5J2P A;  4CF9 A;  4Q5V A;  3QNO A;  1HYV A;  2YV0 X;  5KI6 A;  1NKC A;  4HUE A;  3KLG A;  1UA1 A;  2Z1H A;  1U04 A;  4KHQ A;  1RT1 A;  5CY4 A;  3VQD A;  4CJW A;  2YNI A;  3ZSZ A;  3SV3 A;  3KLH A;  1LWE A;  3TAG A;  4E1N A;  1TKX A;  4B8A B;  4C8O A;  2EX3 A;  1EP4 A;  1KTQ A;  3DLR A;  4NYN A;  3HVR A;  1UA0 A;  1L3S A;  3KD5 E;  2IOC A;  3V1Q A;  3S3O A;  1VSJ A;  1NKE A;  1BL3 A;  4CFB A;  3AVA A;  4DQP A;  4ZTJ A;  3DRR A;  2YNH A;  4CK2 A;  1S1U A;  1BI4 B;  1GOC A;  3B6P A;  4RW9 A;  1ZYQ A;  1LWF A;  1UOC A;  2X6S A;  4E1M A;  5FRM A;  2KZZ A;  4PQU A;  4BDY A;  3LAK A;  1QTM A;  3DYA A;  1JLB A;  2Y1J A;  4DU3 A;  4CFD A;  3L8B A;  4E7L A;  2PY5 A;  1Y97 A;  4DLG A;  4IKF A;  4ID1 A;  1Z26 A;  3NE6 A;  3LP2 A;  1TKZ A;  3CQ8 A;  5EU7 A;  4OLA A;  2VG6 A;  1QE1 A;  3QIN A;  1NJW A;  2DFH A;  1ZBU A;  2Y1I A;  1D8Y A;  4KO0 A;  4Q0B A;  1F21 A;  1RBU A;  2DTU A;  4KHU A;  1KFD A;  3K5L A;  1HYS A;  4KHW A;  1KVC A;  1TKT A;  5HRR A;  2XRI A;  4ID5 A;  2KFN A;  1FK9 A;  1WAJ A;  4N56 A;  3TR8 A;  1RT6 A;  1HPZ A;  4AHT A;  2FBY A;  3QER A;  3PO4 A;  4YFU A;  3OYC A;  3HYF A;  2HHW A;  2JLE A;  4C8K A;  1T03 A;  3BDP A;  4F8R A;  4CIE A;  3TI0 A;  3LPT A;  4DTO A;  4I2Q A;  3PY8 A;  5JS2 A;  5KTQ A;  1SL2 A;  1B9F A;  3K57 A;  4AH9 A;  4KI6 A;  2F96 A;  3O4N A;  2VG7 A;  2FBV A;  4BWJ A;  2R7Y A;  4RW6 A;  3ZT2 A;  2F8S A;  4FZY A;  4CED A;  4KKO A;  3AA5 X;  1RTH A;  1QHT A;  4CEB A;  1VSE A;  1NJX A;  3SYZ A;  2IC3 A;  5T7B A;  3NDK A;  3RRG A;  3RR8 A;  4BAC A;  1XC9 A;  4CEA A;  3HVT A;  1TK5 A;  1L5U A;  1LWC A;  5J2Q A;  4CJR A;  3ASM A;  4DF4 A;  2OPR A;  4FJ5 A;  3AO2 A;  4FLV A;  1ASV A;  2YNF A;  5I3U A;  4OPJ A;  3PX6 A;  1SUQ A;  3SPZ A;  4B9M A;  3ZT0 A;  1SKS A;  2G8I A;  2HHV A;  3OYK A;  4I9Q A;  4B9N A;  3K5O A;  2FBT A;  4PUO A;  3HO1 A;  2HHQ A;  4ELV A;  3LP0 A;  4YNQ A;  1UAX A;  3LZJ A;  4CEQ A;  1RBS A;  1N6Q A;  3U3Y A;  4CER A;  3OYA A;  1TAQ A;  1C0M A;  1WSI A;  4FYD A;  2GBZ A;  1Z25 A;  2ITG A;  4C8M A;  1W9H A;  3ALY A;  1O1W A;  4F3O A;  2ZE2 A;  4CJP A;  4W5O A;  1CLQ A;  3K58 A;  4AHC A;  4M3U A;  1A5X A;  2X74 A;  1DLO A;  3C6U A;  3K2P A;  4DLE A;  4DU1 A;  2GUI A;  1GOB A;  4TSX A;  2YHA A;  1S6Q A;  2HNY A;  2Z1I A;  3HPH A;  3NF7 A;  2HMI A;  2RKI A;  2A1S A;  4DTJ A;  3M8S A;  3SUO A;  3SV4 A;  4OGE A;  3OYJ A;  3AV9 A;  3HM9 A;  1SKR A;  4KAZ A;  4K8X A;  3L2V A;  3ZSR A;  2O4I A; 
#chains in the Genus database with same CATH topology
 1G15 A;  3L3V A;  3OYF A;  5BPM A;  2CGJ A;  3SZ2 A;  2WBN A;  1RDD A;  2PAV A;  3G10 A;  3J7A P;  4H0O A;  4DHY A;  3TAE A;  3QNN A;  4Z4C A;  3AVH A;  4FJ9 A;  3G0Z A;  3VET A;  4V19 S;  2P9U B;  5AQK A;  1HX1 A;  3GBT A;  4BDP A;  4NCG A;  3DLE A;  4DTU A;  4W5R A;  4UQG A;  4OO1 J;  5GIP A;  4C1N I;  4WF9 L;  4MLH A;  2P9K B;  3WXJ A;  4L8R B;  1BUP A;  3L4I A;  3CPE A;  3D7E O;  3NF6 A;  4R5P A;  2Q31 A;  4C8L A;  3ZSV A;  3THV A;  2VQE K;  3VEO A;  5AQG A;  2OYQ A;  3M8P A;  3ZT4 A;  3HJF A;  4CF8 A;  3NGI A;  1DEJ A;  4DSJ A;  3K0S A;  1I3A A;  1S5J A;  4JRQ A;  4NCB A;  5FLX O;  4CJL A;  4H0V B;  2IVP A;  1BG3 A;  1BDG A;  4IBN A;  3ID6 A;  3AVG A;  3VEW A;  1U2V A;  1FJG K;  1XHX A;  2ZQB A;  4IZ9 A;  4ELT A;  3I8B A;  1NJY A;  2KLA A;  3WQT A;  4JD2 B;  5BN9 A;  1Q9X A;  1V4S A;  4GKJ K;  1S6P A;  1RTJ A;  3DAW A;  1YTA A;  3D2F A;  4DQS A;  4DWI A;  1BGX T;  1EO1 A;  4BG9 A;  4QAG A;  3HP6 A;  1HNX K;  3C0B A;  1S3X A;  3VF2 A;  3QIP A;  2E8A A;  4E0D A;  4RCH A;  2A41 A;  5CR4 A;  2PZS A;  5BPL A;  1IKV A;  3K5N A;  3EE8 A;  3TAP A;  4M3X A;  2F9W A;  4MDB A;  4FXD A;  1S1V A;  3O9Q A;  2IAJ A;  5DMR A;  4QOZ B;  4BGB A;  1LAV A;  2FSJ A;  1Q81 O;  1S9G A;  4PL7 A;  1QVF M;  1X1P A;  3KLE A;  4DTN A;  3WXM B;  3D2F B;  1HYZ A;  4FPB A;  3AY9 A;  1WSH A;  3CD6 N;  4B9U A;  1ZBS A;  3A2F A;  4CHZ A;  5AQH A;  2P1J A;  1YI2 N;  1GLD G;  2VG5 A;  3PO5 A;  2RPI A;  3M1F A;  1IH7 A;  4A2B A;  1OH8 A;  3UB5 A;  3TAN A;  3HOT A;  4EHT A;  1R0A A;  3LPU A;  3UKR B;  3LM9 A;  3DLG A;  3QLH A;  3ISN C;  1ZBF A;  2DY4 A;  1TUU A;  4ICL A;  1WAF A;  4CK1 A;  4CZJ A;  4B1Y B;  3ZET A;  3U9Z A;  3KJV A;  2Q0U A;  2E2O A;  4CGF A;  3OS1 A;  1K6Y A;  3QFP A;  1KVA A;  4FJI A;  3SUQ A;  3L2W A;  3DRS A;  5BRH A;  1EXQ A;  3TAQ A;  4Y1C A;  2O8D B;  1CZA N;  2IVO A;  2O8C A;  2DPN A;  1RIL A;  4MFB A;  4B9L A;  2P9S B;  3PX0 A;  1FXX A;  3GOI A;  3WNG A;  3MAQ A;  4BWM A;  3O1B A;  2B4J A;  2QWQ A;  1RT3 A;  4FZX C;  5AQO A;  3DXK A;  4OKE A;  5EVZ A;  1C0T A;  2O8E A;  1YF5 L;  2P9L A;  5BR9 A;  4ISE A;  4JI1 K;  3F9K A;  2ASO A;  4E3S A;  3G6E N;  3EKU A;  4H5N A;  5EXW A;  3JAM O;  3E66 A;  1RGI A;  4CES A;  4DR4 K;  3QO9 A;  5FPD A;  5LJV A;  1YJ9 N;  3MXI A;  4RW8 A;  2HHT A;  1RT4 A;  3OS2 A;  4JKA A;  3CJ1 A;  1ASW A;  1RT7 A;  1KLN A;  1YIT N;  3DLK A;  4Z94 A;  4KHS A;  4JKG A;  2G8F A;  1KLM A;  2D0A A;  1WN7 A;  2NRZ A;  3J81 O;  2O8F A;  1I39 A;  4WE1 A;  4FK4 A;  2NRR A;  4HTL A;  3AO4 A;  4XH5 A;  5AFU A;  3LDS A;  3SK3 A;  3CMA N;  2NZT A;  2WON A;  4DQI A;  3SBT A;  3W3D A;  5J1E A;  1SQK A;  1JLQ A;  3SQ0 A;  1MU2 A;  4NLC A;  3VGL A;  4BRM A;  3A0I X;  3SQ1 A;  4JAX A;  5JMV A;  3ZSX A;  4XH1 A;  4BRQ A;  1VRT A;  4IFY A;  3ZT3 A;  3F9M A;  3DI6 A;  1JCE A;  3FGU A;  3O3G A;  2YNG A;  3HXM A;  2FC0 A;  2E4L A;  1BQN A;  3DMJ A;  4AF1 A;  1C6V A;  3OYM A;  2UXD K;  3VQA A;  3RMC A;  1RDU A;  5EY4 A;  2O4G A;  3F73 A;  1VSK A;  2KW4 A;  2OTL N;  3WNF A;  3SJJ A;  3VF6 A;  2F4V K;  3P1G A;  3DLB A;  1LW0 A;  5BRD A;  2KTQ A;  4CHP A;  5C12 A;  5IT9 O;  3L2Q A;  3ZSO A;  3VQC A;  4PL8 A;  5HOO A;  3DOK A;  2BGG A;  3KK7 A;  3OJS A;  3JYT A;  3KKR A;  3S9H A;  1U45 A;  4BY9 C;  4Z4E A;  4W5T A;  3D2E B;  5AQP A;  4AM6 A;  4IG0 A;  3I0R A;  4RW4 A;  2ATQ A;  5AQU A;  2HVI A;  4FJ8 A;  5AQN A;  3H45 C;  4F9O A;  2AA4 A;  3THX A;  3HST B;  4CF0 A;  2GUP A;  5AQR A;  1JCF A;  3CFP A;  4IOX A;  1KRP A;  3QET A;  4CZE A;  1NOY A;  3S3N A;  1WNS A;  3V4I A;  3CC7 N;  3O5B A;  3N4P A;  4CEE A;  1N33 K;  4DV3 K;  2QWL A;  2VQF K;  3L0Q A;  3E1Y A;  3HPG A;  3KWG A;  1HUX A;  2VWK A;  4PWD A;  4DV2 K;  3HZ6 A;  4J2B A;  2G8H A;  4EZ9 A;  5E41 A;  4BRK A;  5AQF A;  5J2N A;  4GNI A;  4CJK A;  3G71 N;  3AVJ A;  5C25 A;  1VQM N;  1N32 K;  4JLH A;  4B1V A;  3OW2 M;  3NCI A;  4IWV A;  4CF1 A;  5I9E B;  1DTT A;  2DFE A;  3GE1 A;  4FLW A;  2XY7 A;  1L3U A;  3LP1 A;  3LAL A;  3BZC A;  1HJO A;  3LM2 A;  4JK8 A;  3T3F A;  3ZCM A;  1VSF A;  3THX B;  5BR8 K;  5KQD A;  4DR1 K;  5KGX A;  5J2M A;  1RNH A;  4CF9 A;  1IBM K;  4I6M A;  2YV0 X;  3QBX A;  1UA1 A;  1U04 A;  2QWP A;  5CY4 A;  2HHH K;  4CJW A;  2YNI A;  1LWE A;  5M1N A;  3TAG A;  1TKX A;  2QXL A;  4A62 A;  2CH6 A;  3KD5 E;  3V1Q A;  1JCG A;  2WFB A;  3P4I A;  4FOI A;  3ZX3 A;  1S1U A;  3B6P A;  1ZYQ A;  4M7Y A;  2VWB A;  4E1M A;  3FE1 A;  1QTM A;  1JLB A;  2QWN A;  3ENO A;  4IKF A;  3TU5 A;  4C1N K;  3LP2 A;  5EU7 A;  1QE1 A;  3QIN A;  4JKC A;  2DFH A;  1ZBU A;  4BR4 A;  4DCH A;  2DTU A;  1HYS A;  1KVC A;  3OBW A;  3QER A;  1RT6 A;  1HPZ A;  3ZX2 A;  4AHT A;  2HHW A;  2JLE A;  4F8R A;  4JI4 K;  4B3S K;  1X9J A;  4AH9 A;  2VG7 A;  2FBV A;  3CC2 N;  3R3L A;  3G25 A;  3CET A;  1QHT A;  4CEB A;  1VSE A;  3FZK A;  4IEI A;  2IC3 A;  1XC9 A;  3HVT A;  4WYB A;  1IV0 A;  1LWC A;  3MDQ A;  2OPR A;  2W6K A;  2OCE A;  4IXC A;  4JHD A;  5ADX H;  4BRA A;  4BRE A;  3U8X A;  3VEX A;  2QEX N;  4YNQ A;  3LZJ A;  3U3Y A;  4CER A;  1Z25 A;  4C8M A;  1W9H A;  1O1W A;  1XNR K;  4CJP A;  4W5O A;  1CLQ A;  4M3U A;  3WXI A;  4LF9 K;  4DU1 A;  3CCL N;  5EOY A;  2YHA A;  1EWR A;  2ZF5 O;  4JKD A;  3ZEU A;  1H1V A;  1NWK A;  1SKR A;  3AV9 A;  4GV6 A;  4BRO A;  4RWT A;  4DV5 K;  1LV5 A;  3MMV A;  3V81 A;  4KB0 A;  5LL6 Z;  3NHG A;  4JI7 K;  1S72 N;  2VCP A;  4X66 K;  3AA2 A;  3M8Q A;  4JHD B;  3KK3 A;  4BC3 A;  1HPM A;  1S9E A;  1BQM A;  1TYQ B;  3VQE A;  1X3N A;  3VEV A;  3I0S A;  5F1X A;  5DK5 A;  4JRP A;  4BG8 A;  3V9S A;  3IG1 A;  3O1W A;  4CHY A;  4B9V A;  3CXC M;  4LY7 A;  5F2R A;  1KSP A;  3I55 N;  1SS6 A;  4Z0U A;  4YOT A;  3MN5 A;  2QW9 A;  3MK6 A;  2NRX A;  1IBK K;  4XEI A;  4BQZ A;  4OGC A;  4FO0 A;  1C0G A;  1TL3 A;  2P9N B;  4RG8 A;  1RBV A;  1TVR A;  1K8K A;  3V1R A;  2H3G X;  2HND A;  3JS6 A;  4E89 A;  1VQ7 N;  3H08 A;  3NH2 A;  3AO1 A;  4JKH A;  4H8K A;  2HMP A;  3CQX A;  3MED A;  5AQZ A;  2E2N A;  3FZL A;  4CEF A;  4FLT A;  4M3R A;  4A2A A;  5HP1 A;  5FDL A;  4CE9 A;  1U4B A;  1XC3 A;  3J8A A;  1KQS M;  2YHX A;  2GV9 A;  3IUC A;  3AAQ A;  1ZXO A;  4YHH K;  3BF3 A;  3EE9 A;  3SI6 A;  5SZT A;  3CER A;  3O4Q A;  5GIO A;  2QM1 A;  5GIN A;  4JI2 K;  3ZSW A;  4CHN A;  3KK2 A;  5FRO A;  4JKE A;  5KRT A;  2HHS A;  3NF8 A;  3HPO A;  5CYQ A;  4OKK A;  3WEE A;  1XHZ A;  4AHS A;  2OZS A;  4FPA A;  1JXE A;  1ZBL A;  4MO4 A;  1YVN A;  1OKJ A;  2E2Q A;  3VA3 A;  3A5M C;  4BRN A;  4O8U A;  3SQ4 A;  1VK0 A;  3PLA A;  4O0I A;  1QQC A;  4LSL A;  4KFB A;  3NVK A;  4CIG A;  3FZH A;  4IO9 L;  2GWK A;  3U3G A;  4BGA A;  4CBU A;  3J7Z O;  1GLC G;  4YOV A;  3K5M A;  3CFO A;  4EAH D;  3SJH A;  3CJA A;  4ILH A;  1XMQ K;  2P9U A;  3WNH A;  3VTH A;  4JYA K;  5FPM A;  3S41 A;  2V7Y A;  3PX4 A;  2VGM A;  2RHK A;  2WTU A;  3AVN A;  4BC4 A;  4DSF A;  4F2S A;  2I5J A;  5AQV A;  2P9K A;  4BR2 A;  3TAF A;  1VQ5 N;  3VA0 A;  3NMU A;  2UUB K;  1EKE A;  3BEX A;  3M5R A;  3IRX A;  3QB0 A;  2JWL A;  4FJH A;  3RR7 A;  4KH6 A;  4LF7 K;  4H0X B;  3P5J A;  4FJK A;  4F4K A;  2HB5 A;  4N47 A;  3TAR A;  3H3O B;  3OS0 A;  4CJU A;  5AQJ A;  2NNW A;  3ULE B;  4KBO A;  4FJG A;  3VPZ A;  3IAY A;  1HQE A;  1S1X A;  3EZW A;  1NGB A;  4CCH A;  4DTR A;  3CCV N;  3V9Z A;  4DQQ A;  1CZB A;  4CFC A;  4JD2 A;  4MO5 A;  4H5T A;  2NRW A;  4DG1 A;  4CZI A;  4U67 L;  2HHU A;  1BU6 O;  4CGG A;  4GV3 A;  1BIZ A;  3QEW A;  1KAY A;  3O4W A;  1Z05 A;  2GX9 A;  2ETJ A;  2NRV A;  2PYJ A;  2BH1 A;  2QKK A;  2DFF A;  2HBK A;  5M1O A;  5C15 A;  1YT3 A;  4G1Q A;  4CD1 A;  4K43 A;  4FK0 A;  1E4F T;  4G9Z A;  2Z1J A;  4K42 A;  1ILY A;  3F2K A;  4CZK A;  3RTV A;  4BE2 A;  1NMD A;  1RT2 A;  1RBR A;  3AVB A;  3E9O A;  3R1X A;  3HI0 A;  4H03 B;  2FXU A;  3CYM A;  1NK5 A;  4DTM A;  3L3U A;  4CEO A;  1TK0 A;  2OPS A;  5AJ3 K;  3VQ5 A;  3O3H A;  2CH5 A;  3A5L C;  3FFK B;  3QEI A;  1OVY A;  2X78 A;  3S3M A;  4FZZ A;  4B1X B;  4FJ7 A;  3MEC A;  1Y64 A;  3CJ7 A;  3SAH A;  3TTD A;  3NGY A;  3UKR A;  3M3Z A;  3VGM A;  3V9W A;  5CZ1 A;  1IG9 A;  1TKD A;  2VYP A;  5KPZ A;  4ISG A;  2KHO A;  2KZM A;  1T6D A;  3NH0 A;  5KPT A;  3A5N C;  1OH5 A;  4FW1 A;  4IJN A;  4KTW A;  4KI4 A;  4NO7 A;  3RWU A;  5KPR A;  4CI6 A;  1T44 A;  3FLC O;  4GW6 A;  5AZI A;  2O8D A;  5EX5 A;  3HOS A;  3ITH A;  4LF8 K;  3K59 A;  4BQL A;  4CHO A;  1MWM A;  2E20 A;  2P9S A;  1RCH A;  1CZ9 A;  3OYH A;  2YHB A;  3THY B;  4F2R A;  2WC9 A;  3RSE B;  2E1Z A;  5H1S Q;  2FSK A;  4LC9 B;  1Q8I A;  1ITG A;  5LMU K;  5C42 A;  3NH1 A;  1QQO A;  3ENH A;  4E19 A;  4F3T A;  4KTQ A;  3ATU A;  1Q82 O;  3CC4 N;  1L3T A;  2PYL A;  1RTD A;  4IFV A;  4CEZ A;  5KQ8 A;  4DV6 K;  3K9K A;  4BVP A;  3U9D A;  5AZI B;  4J2D A;  2ZD1 A;  4B8C A;  4B9S A;  1NGI A;  4M45 A;  4BRI A;  5C0Y A;  4DU4 A;  1NGF A;  2G8V A;  4AM7 A;  1U48 A;  3CCQ N;  3OYL A;  1U47 A;  5C10 A;  3R6M A;  4E7K A;  2GTD A;  2JGU A;  1NK6 A;  3VQ4 A;  2W6L A;  2G8U A;  1QHA A;  1QQN A;  4DUY K;  3WXK A;  5M1Q A;  1QZ6 A;  4ZTF A;  3O08 A;  1QSY A;  5BRF A;  3TTF A;  3E9P A;  4FM2 A;  4CGI A;  1JL1 A;  4DFJ A;  2QK9 A;  5HRO A;  2QKB A;  3VEY A;  3KWI A;  4KV8 A;  4O44 A;  5GAD P;  4M3Z A;  2UXB K;  4C8N A;  4LFC K;  2I7P A;  1NGH A;  1BWF O;  2UU9 K;  4KH5 A;  4FJM A;  4M3T A;  5J2P A;  4Q5V A;  1HYV A;  3LL3 A;  3KLG A;  3D6R A;  1RT1 A;  4KHQ A;  2NRH A;  3ENB A;  5E26 A;  3ZSZ A;  2IIR A;  4B8A B;  4C8O A;  2EX3 A;  1KTQ A;  2IOC A;  1BL3 A;  4DQP A;  3I33 A;  1KAX A;  4ZTJ A;  3DRR A;  2YNH A;  4PQU A;  3CCU N;  3DYA A;  3HTV A;  2Y1J A;  2PY5 A;  1Y97 A;  1BO5 O;  2BUP A;  3HRG A;  4ID1 A;  4JKF A;  3ZYY X;  3VGK A;  3J7Y P;  3MN9 A;  2HOE A;  4Q0B A;  4KO0 A;  1F21 A;  1RBU A;  4KHU A;  4DV7 K;  2XRI A;  2KFN A;  1FK9 A;  1WAJ A;  3D2E A;  4YFU A;  3HYF A;  4C8K A;  3BDP A;  4CIE A;  4IOC L;  4DTO A;  5JS2 A;  5KTQ A;  3DXM A;  3O4N A;  3P38 A;  1BOT O;  4BWJ A;  2R7Y A;  4K25 A;  2JWK A;  4CED A;  4KKO A;  5GAG P;  5A2Q O;  4B1U B;  3DJC A;  1NJX A;  1BA0 A;  1VQK N;  3CCS N;  3NDK A;  3RR8 A;  2PBD A;  2D0O A;  4CJR A;  3DLL L;  4FJ5 A;  1FW6 A;  4FLV A;  2YNF A;  4FOE A;  3PX6 A;  5DM6 L;  4B9M A;  1EWQ A;  1Q86 O;  3ZT0 A;  2G8I A;  2HHV A;  3OYK A;  4PUO A;  2HHQ A;  3O6W A;  3LP0 A;  1UAX A;  3C7N B;  4JI6 K;  4BRH A;  4CEQ A;  3QBW A;  1VHX A;  1IJJ A;  1C0M A;  1D4X A;  1LCU A;  3CIP A;  3HBT A;  4GKK K;  4FWR A;  1A5X A;  2D1K A;  2X74 A;  4DLE A;  4H0Y B;  3DXM B;  1GOB A;  5E84 A;  2J4R A;  2HMI A;  3HPH A;  3EO3 A;  2RKI A;  3SUO A;  3SV4 A;  4OGE A;  3Q7B A;  4C23 A;  1BIU A;  4ZHR A;  1I94 K;  3ID8 A;  1NGA A;  1HNI A;  2GEL A;  3IS9 A;  4LD0 A;  2E2P A;  4EP4 A;  3GDQ A;  4NYF A;  4CJ3 A;  5ELZ A;  2YJE A;  4DR3 K;  2XO7 A;  3PUF A;  4CJT A;  3CCM N;  3C6A A;  4FCY A;  4GY2 B;  1YJN N;  4HVJ A;  1HKG A;  4OVL A;  4A61 A;  3PSI A;  3OY9 A;  3RMA A;  1GLA G;  5M1F A;  4FM1 A;  5F0X A;  4FVM A;  2GEM A;  1NK4 A;  4LH5 A;  4Z4F A;  3UKU A;  1J5E K;  4CZL A;  5C24 A;  3KLI A;  3SAG A;  1NGD A;  4E1J A;  3FR0 A;  3ZT1 A;  4DR2 K;  3T1Y K;  3SAF A;  3C95 A;  1HR0 K;  1GLF O;  3BP8 A;  1S1W A;  4CJE A;  1A5W A;  1ESV A;  4M63 C;  4JS5 A;  1W7A A;  1RDA A;  2BTF A;  1O13 A;  4CJS A;  1NJI O;  1NG9 A;  1C1B A;  3M8R A;  4L3Q A;  1J5O A;  3DOL A;  3GG4 A;  3G4S N;  1QZ5 A;  2HBJ A;  5AZJ B;  5D3G A;  4CIF A;  3UKU B;  4W5Q A;  3KKS A;  1HQU A;  3ZSQ A;  3CFR A;  3EL2 A;  3AO5 A;  4AHV A;  3RMB A;  4CJ4 A;  2X6N A;  4ISF A;  1BA1 A;  1RBT A;  1C0U A;  5TKW A;  3H46 O;  4Y0W A;  3SLC A;  1NGJ A;  4CZF A;  4NCA A;  1J54 A;  4K0K K;  3THW B;  2FF3 B;  1P8Z A;  1J9A A;  3H1V X;  1S1T A;  4LH4 A;  4FSV A;  1OH7 A;  2G8K A;  2Q36 A;  4FJJ A;  4FJX A;  3L2U A;  2IGI A;  4JK9 A;  1T8E A;  3NAE A;  1GLB G;  4CZG A;  3SCX A;  1RDW X;  4CHQ A;  3LAN A;  4JI3 K;  3LDN A;  4N5S A;  2D5R A;  3HL8 A;  2P9I B;  3LP3 A;  5JLF A;  4WCE L;  1TYQ A;  4DMN A;  1X9M A;  3NF9 A;  3BY5 A;  2UXC K;  3LDP A;  2I7N A;  3BZK A;  4ILG B;  2ZJR L;  3RVC A;  3KVG A;  2LSN A;  4CJ5 A;  1RFQ A;  4O4G A;  1GLJ O;  2D0C A;  1JKH A;  4GVE A;  4CJQ A;  3LDQ A;  1HKB A;  2BAN A;  3QIC A;  1HMV A;  2AJQ A;  1XUP O;  4DSK A;  1K8A O;  3N4Q A;  2OZM A;  2P9N A;  3AO3 A;  3VQ6 A;  1TGO A;  2D0B A;  1WBB A;  3AVF A;  4LF6 K;  4QCL A;  1NGC A;  4EIA A;  1C1C A;  3EYZ A;  2P51 A;  4FLZ A;  2E88 A;  1JLA A;  3O3F A;  1SAZ A;  4DV0 K;  3LZI A;  5B8H A;  3AVC A;  2AP1 A;  4OKJ A;  2KFZ A;  4W5N A;  2E6M A;  5HBM A;  1VSM A;  4YY3 K;  3KIO A;  4X62 K;  1NK9 A;  2IS3 A;  3B6O A;  2E6L A;  1TV6 A;  1ZBI A;  3CI5 A;  4E7I A;  4MDA A;  4DS4 A;  2YI1 A;  1VQ4 N;  2HST A;  4WFA L;  4DSL A;  1NK0 A;  3L6Q A;  2HW3 A;  1JL2 A;  4CJV A;  3SMP A;  4XIU A;  4OX9 K;  1JLE A;  2P5O A;  4NXM K;  3T1A A;  2RN2 A;  4KTZ A;  5M1P A;  2OA8 A;  5AFU H;  4ELU A;  4FWN A;  3O9S A;  4AQY K;  3CJB A;  3IMX A;  2ZGY A;  4B3O A;  1HJR A;  1YTU A;  4FJN A;  3OA9 A;  2BDP A;  2FLO A;  3UE5 A;  1B92 A;  1NMN A;  1QS4 A;  5AR0 A;  4GV9 A;  2G8W A;  3EZ5 A;  3DRP A;  1K73 O;  1TAU A;  3VQ7 A;  4CZM A;  1HNV A;  3SQ2 A;  3L2R A;  4CVN E;  2XY6 A;  1KCF A;  3VEZ A;  5AQX A;  3CQY A;  4CBW A;  1QVG M;  3P83 D;  4LF5 K;  4WQ5 C;  4E7H A;  3SUP A;  1MWK A;  2A40 A;  1YVU A;  4BRC A;  1NK8 A;  3CCR N;  3QIO A;  1XI1 A;  2O8B A;  4DQR A;  3UIQ A;  4J2E A;  4IO8 A;  1U6Z A;  1WLJ A;  3K9J A;  2KKZ A;  3ULE A;  2KQ2 A;  3OTO K;  3AAR A;  4EP5 A;  2Q0R A;  1ZC6 A;  1BCM A;  1WUA A;  4JEP A;  3TAM A;  4J2A A;  3LWM A;  5HLF A;  1R59 O;  3IDH A;  3KD1 E;  4O5B A;  4MLE A;  4Z4G A;  1NNE A;  3SUN A;  4DTX A;  1Q9Y A;  4I7F A;  2GWJ A;  3AGK A;  3KK1 A;  4DSI A;  3VN5 A;  4LF4 K;  1VQ6 N;  1KXP A;  3PIP L;  2Q2R A;  2O8B B;  2RE2 A;  3MXM A;  3IKM A;  3WT0 A;  1RTI A;  2QTD A;  4H4O A;  3CJC A;  4DUZ K;  2OPQ A;  4JKB A;  2HF4 A;  2WUS A;  3OYN A;  1B9D A;  2ZWH A;  3C6H A;  2HHX A;  4X64 K;  1CXU A;  1WSE A;  2OTJ N;  3OYB A;  5CZ2 A;  2HVH A;  4DTP A;  4FWM A;  5JLH A;  3HK2 A;  4IG3 A;  1X3M A;  4OJR A;  3ZX0 A;  4M3W A;  3DM2 A;  3O9R A;  1BI4 A;  5HRS A;  4X65 K;  2Q3S A;  5JVG L;  3OYG A;  4K8Z A;  1A5V A;  1KAZ A;  5HRP A;  4O0J A;  4I9L A;  3U6F A;  1KC8 O;  2UUC K;  3OBY A;  1VQ8 N;  4FW2 A;  2F9T A;  4JK7 A;  1S22 A;  4HCC A;  1FKO A;  4HUE A;  2Z1H A;  3VQD A;  4DKW A;  2OAN A;  4E1N A;  4NYN A;  3HVR A;  4DQ8 A;  2P9P A;  1L3S A;  3AVA A;  5AQM A;  3TSU A;  1C0F A;  4CK2 A;  1K9M O;  3LDO A;  1BI4 B;  1GOC A;  1Z6R A;  4RW9 A;  3CME N;  1UOC A;  3B8A X;  5FRM A;  1JJ2 M;  4BDY A;  3LAK A;  3THY A;  3L8B A;  4B1Z A;  3AGR A;  3Q7C A;  3MWP A;  3RSE A;  5HL7 L;  4B9Q A;  3NE6 A;  1YJW N;  4KHP K;  1TKZ A;  1ATR A;  4FWO A;  3CQ8 A;  4OLA A;  2VG6 A;  3KHY A;  5AQS A;  1NJW A;  1LOT B;  2FSN A;  3A8Y A;  1KFD A;  3K5L A;  3CCJ N;  5AQY A;  1KD1 O;  1TKT A;  4LFA K;  3SMS A;  5C2D A;  4N56 A;  3TR8 A;  3PO4 A;  3GL1 A;  4CZH A;  3LPT A;  1N8R O;  1V4T A;  4I2Q A;  2ZGZ A;  3PY8 A;  4NXN K;  2P9P B;  1NGE A;  3HSC A;  1W2B M;  2QWR A;  3VTI A;  4FZY A;  2NLX A;  1RTH A;  1M90 O;  1U2V B;  5T7B A;  3RRG A;  4CEA A;  1TK5 A;  3QDK A;  3CF5 L;  2YJF A;  3ASM A;  2FF6 A;  4BRL A;  4R79 A;  4DV4 K;  1ASV A;  5I3U A;  3C65 A;  4FWP A;  4OPJ A;  4I9Q A;  2A5X A;  2FBT A;  4B3T K;  4ELV A;  4QS9 A;  1RBS A;  1EQY A;  1N6Q A;  5CE3 A;  1TAQ A;  2ASM A;  4F3O A;  5ADX A;  4AHC A;  4DR5 K;  1P90 A;  1DLO A;  2GUI A;  3P31 A;  3E9L A;  1S6Q A;  3NF7 A;  4FWQ A;  1WBD A;  2A1S A;  3M8S A;  4KAZ A;  4K8X A;  1N36 K;  3L2V A;  3ZSR A;  2XHB A;  4PKH A;  2O4I A;  1T05 A;  4M7X A;  5BRE A;  4BR9 A;  4ILJ A;  4AHU A;  1U49 A;  3MX5 A;  4YOR A;  5I42 A;  3PIO L;  2ZM6 K;  1M1K O;  1VSH A;  3OVN A;  4CJF A;  4KHY A;  3EY1 A;  2FBX A;  4H0T B;  4HHT A;  4NLB A;  1D9D A;  1T7P A;  4WFN L;  2NRT A;  3ZLJ A;  3MWT A;  1JLF A;  3T7Z A;  3JXU A;  5BN8 A;  4DV1 K;  3CHW A;  3MEG A;  3MX2 A;  4O55 A;  4HWI A;  4BDZ A;  4Z4I A;  4NB4 A;  3D0P A;  3WNE A;  1JLG A;  2HNZ A;  2QWO A;  3ZET B;  3LDL A;  4BC2 A;  2F7T A;  3SPY A;  1D5A A;  2A6A A;  3LWL A;  1EET A;  2PFU A;  3AVM A;  3WQU A;  1NOZ A;  4JI0 K;  3EKS A;  3O9T A;  4BR7 A;  3AVK A;  4CGD A;  2O8C B;  3PSF A;  4I2P A;  3OHR A;  3TSQ A;  1VRU A;  3QEX A;  4JNE A;  5JS1 A;  3VEN A;  1YUW A;  1BHL A;  4BRG A;  4DB3 A;  4H0P A;  4KRE A;  4EFH A;  1WSG A;  4CD3 A;  4KHN A;  4CFA A;  3FZF A;  3ULD A;  4IDK A;  1J53 A;  3HP9 A;  1HRH A;  3DXK B;  1E3M A;  1VAZ A;  4FWL A;  4OPH A;  1N5Y A;  1YHQ N;  2O8E B;  3C7N A;  2P9L B;  4JV5 K;  1XMO K;  4OPA A;  3BF1 A;  3H3N O;  4GVM A;  2B6A A;  3V9U A;  1WB9 A;  2UUA K;  4N41 A;  1REV A;  1DTQ A;  1NJZ A;  1BCO A;  2CGK A;  5MLC Q;  3HT3 A;  5FRN A;  1RDB A;  3MXJ A;  3A5O C;  2YKN A;  5M1K A;  3AA4 A;  5GAE P;  3OYE A;  3R9P A;  3CM6 A;  1N34 K;  1NK7 A;  4HUF A;  4KB1 A;  4JKG B;  4CF2 A;  2NUB A;  4CGH A;  4KH4 A;  4GMJ B;  2O8F B;  4DFK A;  4FK2 A;  2IVN A;  4FWS A;  3I8D A;  3MN6 A;  4YOW A;  3T69 A;  1LW2 A;  3VQ9 A;  1TUY A;  3IFR A;  4A57 A;  4E7J A;  2P5G A;  1Q18 A;  4DTS A;  1YIJ N;  3R8E A;  3E01 A;  4OLB A;  3T19 A;  3VQ8 A;  3RRH A;  2XY5 A;  1GOA A;  4LSN A;  4M3Y A;  2QXF A;  4IDH A;  5JVH L;  4FLY A;  4K41 A;  3NFA A;  4H5W A;  3CG7 A;  5AQT A;  4BRD A;  4LFB K;  4BR0 A;  3EEQ A;  3QML A;  4H4M A;  2VWJ A;  4FLX A;  3D45 A;  3KTQ A;  4KPY A;  4OPK A;  3KLF A;  4N76 A;  2V7Z A;  4HCB A;  1QSL A;  2W41 A;  3AVI A;  3J80 O;  3JSM A;  3C94 A;  3T1H K;  4YOU A;  1HNW K;  3VQB A;  4BRF A;  3TWH A;  1IO2 A;  1Q7Y O;  2BE2 A;  4BE0 A;  3VER A;  1IBL K;  4YDU A;  5AZJ A;  2OPP A;  1LAW A;  3VQP A;  4FLU A;  1VQN N;  2RF2 A;  1UWB A;  2ZJQ L;  4FM0 A;  3VES A;  3CJ9 A;  3H1Q A;  1XQS C;  3FZM A;  1X9W A;  2ZJP L;  3OYD A;  1C1A A;  3PV8 A;  1QQM A;  4BC5 A;  4PY5 A;  5CYM A;  5KGW A;  1WSF A;  2WOM A;  4CJ7 A;  2ITM A;  1DT9 A;  4O5F A;  4XH4 A;  3V9X A;  3THW A;  1HKC A;  4O8K A;  4BE1 A;  1DGK N;  4PA1 A;  1MA9 B;  3MEE A;  2Q97 A;  1RT5 A;  4IOA L;  1IKY A;  3MCP A;  4IFE A;  3QES A;  4JI5 K;  1RDC A;  3NVM A;  1HLU A;  4QS7 A;  4DFP A;  4JN4 A;  2ASP A;  1VQ9 N;  3EN9 A;  3I56 N;  1W0H A;  2P9I A;  5FPE A;  3VQQ A;  3DLH A;  2YHW A;  1VSL A;  4WQ4 A;  1MDU B;  3OYI A;  2Z1G A;  3CCE N;  3QEV A;  1YAG A;  2E5L K;  4WQ5 A;  1KVB A;  1VQL N;  1SL0 A;  3U4L A;  5LY3 A;  4CGJ A;  1JXB A;  4M41 A;  4AIL C;  1QSS A;  4PKI A;  4FL9 A;  2V52 B;  1SKW A;  1KFS A;  5GAH P;  1CXQ A;  2W42 A;  3QEP A;  3AA3 A;  2YKM A;  4AHR A;  3TSP A;  2B5J A;  4I6M B;  5BPN A;  1ASU A;  3BUZ B;  4JI8 K;  5KRS A;  2D0P A;  2W40 A;  1SZ2 A;  4CW7 B;  2A1R A;  4KRF A;  4H5V A;  4HTU A;  1SL1 A;  4UY8 O;  1SV5 A;  4DS5 A;  3VF4 A;  4DR6 K;  2HBL A;  4DF8 A;  3AAP A;  4DSE A;  4FWK A;  4PHT X;  4Z4H A;  1XNQ K;  3ATV A;  1X9S A;  1TK8 A;  4B08 A;  3KZB A;  3M6G A;  4B3M K;  4WFB L;  1DKG D;  3DWL A;  4H5R A;  5LMN K;  2HBM A;  2F8T A;  2XY8 A;  4DFM A;  1VQO N;  1IKX A;  1JLC A;  1NKB A;  1NM1 A;  5AQI A;  1FKP A;  5SWM A;  1WOQ A;  4M42 A;  4HUG A;  1ATS A;  1BIS A;  5HRN A;  1T6C A;  2A3Z A;  4FJL A;  3TAB A;  1YXQ A;  4B9T A;  1NLV A;  1J6Z A;  1TL1 A;  2IDO A;  3LAM A;  2YCH A;  3CPW M;  3OJU A;  2CGL A;  3BGR A;  4J8F A;  1GLL O;  1IKW A;  3AVL A;  4B1W B;  3V6D A;  4RW7 A;  3ZSY A;  3FFI A;  2QWM A;  1NU0 A;  3RMD A;  1WSJ A;  1ATN A;  2EWS A;  4CEC A;  1OH6 A;  4FVU A;  1L3V A;  1XWL A;  3F5T A;  5K14 A;  1D9F A;  2V51 B;  4PKG A;  1VSD A;  4YDU C;  1W97 L;  2A42 A;  5IWA K;  3W0L A;  2E1Y A;  5CHI A;  3L4Q A;  4CK3 A;  1VQP N;  4EZ6 A;  4Y1D A;  3SNN A;  3NGZ A;  2YX6 A;  3HM8 A;  3CM5 A;  1ZBH A;  1EX4 A;  1T3V A;  4MQ3 A;  3C6T A;  3O8M A;  3HO1 A;  2EHG A;  1VSI A;  2YHY A;  4JS4 A;  3NBP A;  1IG8 A;  3ZEU B;  3V1O A;  4A5A A;  3QNO A;  5KI6 A;  1G99 A;  1NKC A;  3TTC A;  3SV3 A;  2QI2 A;  3KLH A;  5C2F A;  1EP4 A;  3DLR A;  1UA0 A;  3S3O A;  1VSJ A;  2UYT A;  1NKE A;  4CFB A;  2HF3 A;  2VGN A;  4IEE A;  4EHU A;  2D4W A;  3VOV A;  1LWF A;  2X6S A;  2KZZ A;  1OVQ A;  4DU3 A;  4CFD A;  5LJW A;  4E7L A;  4DLG A;  4WQ4 C;  1Z26 A;  4CBX A;  1NBW A;  1D8Y A;  2Y1I A;  4A5B A;  4U7B A;  4KHW A;  5HRR A;  3TPQ A;  4ID5 A;  2FBY A;  3OYC A;  3QFU A;  5DM7 L;  1T03 A;  5AQW A;  3TI0 A;  3O80 A;  1K8K B;  3WXL A;  1SL2 A;  4RTF D;  1B9F A;  5TKY A;  3K57 A;  4KI6 A;  2F96 A;  4IJA A;  4RW6 A;  3ZT2 A;  3WUH A;  2F8S A;  3AA5 X;  1E4G T;  5AQQ A;  3O9U A;  4B3R K;  3SYZ A;  5JIC A;  1NGG A;  5AQL A;  4BAC A;  4BRP A;  1L5U A;  5J2Q A;  4DF4 A;  3AO2 A;  4QS8 A;  4YOY A;  2Q1N A;  2QA4 N;  3MN7 A;  1SUQ A;  3SPZ A;  1SKS A;  4B9N A;  3K5O A;  3P39 A;  3MCA B;  3OYA A;  1GLE G;  1WSI A;  4FYD A;  5FPN A;  2GBZ A;  2ITG A;  4DR7 K;  3ALY A;  2ZE2 A;  3K58 A;  3H6E A;  3C6U A;  1HNZ K;  3K2P A;  4BR5 A;  4TSX A;  2HNY A;  2Z1I A;  3WEE B;  4BVO A;  4A59 A;  4DTJ A;  3HM9 A;  4YOX A;  3OYJ A;  3VMF B;  3SBG A; 
#chains in the Genus database with same CATH homology
 1BIU A;  1G15 A;  3L3V A;  4ZHR A;  3OYF A;  1T05 A;  1LV5 A;  3V81 A;  3SZ2 A;  1HNI A;  3IS9 A;  4LD0 A;  4KB0 A;  3NHG A;  1RDD A;  4EP4 A;  3G10 A;  4NYF A;  4AHU A;  4CJ3 A;  1U49 A;  2XO7 A;  3AA2 A;  3M8Q A;  5I42 A;  3PUF A;  4CJT A;  3KK3 A;  3TAE A;  1VSH A;  4FCY A;  3OVN A;  1S9E A;  1BQM A;  4CJF A;  3QNN A;  4KHY A;  3VQE A;  4Z4C A;  2FBX A;  3AVH A;  4HVJ A;  3EY1 A;  4FJ9 A;  4OVL A;  3I0S A;  3G0Z A;  5DK5 A;  4JRP A;  3V9S A;  3OY9 A;  3IG1 A;  3RMA A;  1YTU A;  4HHT A;  4CHY A;  1D9D A;  1T7P A;  4FM1 A;  4B9V A;  4LY7 A;  4NCG A;  4BDP A;  4FVM A;  1KSP A;  3DLE A;  1JLF A;  4DTU A;  1NK4 A;  4W5R A;  4LH5 A;  4UQG A;  4Z4F A;  3MEG A;  4O55 A;  4Z0U A;  4BDZ A;  4L8R B;  5C24 A;  3KLI A;  4Z4I A;  3D0P A;  3WNE A;  3NF6 A;  4R5P A;  1JLG A;  2HNZ A;  4C8L A;  3ZT1 A;  3ZSV A;  3THV A;  4OGC A;  3SPY A;  1D5A A;  2OYQ A;  3M8P A;  1TL3 A;  3ZT4 A;  4RG8 A;  3LWL A;  1EET A;  4CF8 A;  3NGI A;  3C95 A;  3AVM A;  3HJF A;  1RBV A;  4DSJ A;  1TVR A;  3V1R A;  1NOZ A;  1I3A A;  2HND A;  1S5J A;  1S1W A;  4CJE A;  4JRQ A;  4NCB A;  1A5W A;  3AVK A;  4E89 A;  4JS5 A;  4CGD A;  4CJL A;  1RDA A;  3H08 A;  3NH2 A;  4CJS A;  3AO1 A;  4IBN A;  4H8K A;  3AVG A;  4I2P A;  3MED A;  1VRU A;  3QEX A;  4CEF A;  4FLT A;  1C1B A;  1XHX A;  4M3R A;  2ZQB A;  3M8R A;  5HP1 A;  1J5O A;  3DOL A;  5JS1 A;  5FDL A;  4ELT A;  4CE9 A;  1BHL A;  1NJY A;  1U4B A;  4KRE A;  5D3G A;  1Q9X A;  4CIF A;  1WSG A;  4W5Q A;  1S6P A;  4KHN A;  4CFA A;  3ULD A;  1RTJ A;  1YTA A;  4IDK A;  1J53 A;  4DQS A;  2GV9 A;  4DWI A;  3HP9 A;  1HRH A;  1BGX T;  1HQU A;  3KKS A;  3SI6 A;  3ZSQ A;  4QAG A;  3HP6 A;  3CFR A;  5SZT A;  1N5Y A;  3AO5 A;  3O4Q A;  4AHV A;  3QIP A;  3RMB A;  4CJ4 A;  4E0D A;  4GVM A;  2B6A A;  2X6N A;  3ZSW A;  4CHN A;  3V9U A;  2PZS A;  4N41 A;  1RBT A;  1REV A;  1DTQ A;  1C0U A;  3KK2 A;  1NJZ A;  5FRO A;  1IKV A;  5KRT A;  1BCO A;  2HHS A;  3NF8 A;  3HT3 A;  5FRN A;  1RDB A;  3MXJ A;  3HPO A;  3K5N A;  5CYQ A;  4OKK A;  2YKN A;  3TAP A;  1J54 A;  4AHS A;  1ZBL A;  1JXE A;  1XHZ A;  2OZS A;  4NCA A;  3AA4 A;  4M3X A;  1J9A A;  4LH4 A;  1S1T A;  3OYE A;  4FXD A;  1S1V A;  2G8K A;  3VA3 A;  3CM6 A;  2IAJ A;  3L2U A;  2IGI A;  1T8E A;  5DMR A;  4FJJ A;  4FJX A;  4QOZ B;  3NAE A;  1LAV A;  3SQ4 A;  3SCX A;  1VK0 A;  4CHQ A;  3LAN A;  1NK7 A;  4HUF A;  4KB1 A;  4O0I A;  1QQC A;  4LSL A;  4CF2 A;  2NUB A;  1S9G A;  2KZM A;  4KFB A;  4CIG A;  1X1P A;  4CGH A;  4GMJ B;  3U3G A;  4N5S A;  3KLE A;  4DTN A;  1HYZ A;  2D5R A;  3HL8 A;  3LP3 A;  4DFK A;  3K5M A;  4FK2 A;  1WSH A;  3CFO A;  3I8D A;  4B9U A;  4DMN A;  3A2F A;  4CHZ A;  3VQ9 A;  1LW2 A;  3NF9 A;  1X9M A;  2P1J A;  2VG5 A;  3PO5 A;  2RPI A;  3WNH A;  1IH7 A;  4E7J A;  2P5G A;  3PX4 A;  4DTS A;  2LSN A;  4CJ5 A;  3E01 A;  4O4G A;  2D0C A;  1JKH A;  3AVN A;  3TAN A;  4OLB A;  4F2S A;  4DSF A;  1R0A A;  2I5J A;  3LPU A;  4CJQ A;  3T19 A;  3VQ8 A;  3RRH A;  3DLG A;  3QLH A;  1GOA A;  3ISN C;  2BAN A;  2XY5 A;  1ZBF A;  2DY4 A;  1HMV A;  3TAF A;  2AJQ A;  4ICL A;  1WAF A;  4LSN A;  4CK1 A;  3VA0 A;  2QXF A;  4M3Y A;  1EKE A;  4FLY A;  3IRX A;  3NFA A;  3CG7 A;  4DSK A;  4FJH A;  3RR7 A;  3P5J A;  4H4M A;  2VWJ A;  2OZM A;  3AO3 A;  3KJV A;  4FLX A;  4FJK A;  3D45 A;  3KTQ A;  4F4K A;  4KPY A;  4CGF A;  3OS1 A;  4OPK A;  2HB5 A;  4N47 A;  3TAR A;  3VQ6 A;  3KLF A;  3OS0 A;  4CJU A;  1K6Y A;  1TGO A;  4N76 A;  1KVA A;  4FJI A;  3SUQ A;  2D0B A;  4HCB A;  3L2W A;  1QSL A;  3DRS A;  1EXQ A;  3AVI A;  3AVF A;  3JSM A;  4QCL A;  3TAQ A;  4FJG A;  4Y1C A;  3C94 A;  1C1C A;  3EYZ A;  2P51 A;  3VQB A;  3IAY A;  1HQE A;  1S1X A;  4FLZ A;  3O3F A;  1JLA A;  3TWH A;  1IO2 A;  1RIL A;  4MFB A;  4CCH A;  4DTR A;  4B9L A;  3LZI A;  3PX0 A;  3V9Z A;  4DQQ A;  1CZB A;  2BE2 A;  4BE0 A;  1FXX A;  3AVC A;  4OKJ A;  2KFZ A;  4CFC A;  2OPP A;  1LAW A;  3VQP A;  2E6M A;  3WNG A;  3MAQ A;  4BWM A;  4W5N A;  5HBM A;  2B4J A;  4FLU A;  1VSM A;  3KIO A;  4DG1 A;  1RT3 A;  4FZX C;  2RF2 A;  1UWB A;  1NK9 A;  2HHU A;  4FM0 A;  2IS3 A;  3B6O A;  4OKE A;  1C0T A;  2E6L A;  1TV6 A;  4CGG A;  1BIZ A;  3QEW A;  1ZBI A;  1X9W A;  4E7I A;  4DS4 A;  3OYD A;  1C1A A;  3PV8 A;  2ETJ A;  2PYJ A;  4B3O A;  2QKK A;  2DFF A;  3F9K A;  4DSL A;  1NK0 A;  4E3S A;  5CYM A;  4PY5 A;  2HW3 A;  1YT3 A;  4G1Q A;  1JL2 A;  5KGW A;  1WSF A;  4CJV A;  4CES A;  2WOM A;  4XIU A;  3QO9 A;  1JLE A;  4FK0 A;  2P5O A;  2Z1J A;  3MXI A;  3T1A A;  4RW8 A;  3V9X A;  3RTV A;  4BE2 A;  2RN2 A;  4KTZ A;  4BE1 A;  4PA1 A;  1RT2 A;  3MEE A;  2HHT A;  1RBR A;  1RT4 A;  3OS2 A;  1RT5 A;  2OA8 A;  1ASW A;  3AVB A;  4ELU A;  1IKY A;  1RT7 A;  1KLN A;  3QES A;  3DLK A;  4KHS A;  3CYM A;  1RDC A;  4DTM A;  1NK5 A;  3L3U A;  1KLM A;  1HJR A;  2D0A A;  1WN7 A;  4CEO A;  1TK0 A;  2G8F A;  2BDP A;  2OPS A;  4FJN A;  4DFP A;  1I39 A;  1W0H A;  4WE1 A;  1B92 A;  1QS4 A;  3VQ5 A;  3O3H A;  4FK4 A;  2G8W A;  3EZ5 A;  3VQQ A;  3DRP A;  3DLH A;  3AO4 A;  3QEI A;  3LDS A;  1TAU A;  2X78 A;  3S3M A;  4FZZ A;  3VQ7 A;  2WON A;  4DQI A;  4FJ7 A;  3MEC A;  1VSL A;  1HNV A;  5J1E A;  3SQ2 A;  3OYI A;  2Z1G A;  3QEV A;  1JLQ A;  3L2R A;  2XY6 A;  1KVB A;  3SQ0 A;  1SL0 A;  1MU2 A;  3NGY A;  1KCF A;  3SQ1 A;  3P83 D;  4CGJ A;  5CZ1 A;  1JXB A;  4M41 A;  3V9W A;  3ZSX A;  4AIL C;  1IG9 A;  1QSS A;  1TKD A;  1VRT A;  4E7H A;  1SKW A;  3SUP A;  1KFS A;  4IFY A;  1YVU A;  3ZT3 A;  1NK8 A;  3DI6 A;  3QIO A;  3O3G A;  1CXQ A;  2W42 A;  2YNG A;  3QEP A;  3AA3 A;  2YKM A;  3NH0 A;  4AHR A;  2FC0 A;  3HXM A;  1XI1 A;  2E4L A;  2B5J A;  1BQN A;  4DQR A;  3DMJ A;  1C6V A;  1ASU A;  4FW1 A;  5KRS A;  3UIQ A;  3OYM A;  4KTW A;  2A1R A;  4J2E A;  4KI4 A;  4KRF A;  3RWU A;  1WLJ A;  4HTU A;  1SL1 A;  1SV5 A;  4GW6 A;  3VQA A;  3RMC A;  4DS5 A;  4DF8 A;  2O4G A;  3F73 A;  2KQ2 A;  1VSK A;  2KW4 A;  3WNF A;  3ITH A;  4EP5 A;  4DSE A;  3K59 A;  4CHO A;  3SJJ A;  4Z4H A;  1BCM A;  3P1G A;  3TAM A;  3DLB A;  4J2A A;  3LWM A;  5HLF A;  1LW0 A;  2KTQ A;  4CHP A;  1RCH A;  1CZ9 A;  3KD1 E;  4O5B A;  3OYH A;  1X9S A;  1TK8 A;  3SUN A;  4B08 A;  2YHB A;  4Z4G A;  4F2R A;  3L2Q A;  3ZSO A;  4DTX A;  1Q9Y A;  3VQC A;  4I7F A;  3DOK A;  2F8T A;  2XY8 A;  4DFM A;  2BGG A;  3KK1 A;  1IKX A;  1JLC A;  4DSI A;  3VN5 A;  3OJS A;  3JYT A;  1Q8I A;  1NKB A;  1ITG A;  5C42 A;  3KKR A;  3S9H A;  1FKP A;  5SWM A;  3NH1 A;  1U45 A;  4M3Z A;  4Z4E A;  4W5T A;  4E19 A;  4F3T A;  4M42 A;  4HUG A;  3MXM A;  4KTQ A;  1BIS A;  5HRN A;  1RTI A;  4IG0 A;  4H4O A;  1L3T A;  3I0R A;  4RW4 A;  2ATQ A;  3TAB A;  4FJL A;  2PYL A;  1RTD A;  4FJ8 A;  2HVI A;  2OPQ A;  4IFV A;  4CEZ A;  4B9T A;  1TL1 A;  2IDO A;  3LAM A;  3OYN A;  4J2D A;  2ZD1 A;  1B9D A;  3OJU A;  4B8C A;  3HST B;  4CF0 A;  3BGR A;  4B9S A;  2HHX A;  4M45 A;  1IKW A;  1CXU A;  3AVL A;  3CFP A;  3V6D A;  1KRP A;  4RW7 A;  4DU4 A;  3ZSY A;  3QET A;  1WSE A;  2G8V A;  3FFI A;  3OYB A;  1NOY A;  5CZ2 A;  1WNS A;  3RMD A;  3S3N A;  3V4I A;  1WSJ A;  4DTP A;  1U48 A;  2HVH A;  3OYL A;  1U47 A;  4CEC A;  4E7K A;  4CEE A;  1L3V A;  1XWL A;  1NK6 A;  2JGU A;  3VQ4 A;  5K14 A;  1D9F A;  3HPG A;  3HK2 A;  1VSD A;  2VWK A;  4IG3 A;  2G8U A;  4PWD A;  4OJR A;  2XHB A;  4M3W A;  3DM2 A;  4J2B A;  2G8H A;  4EZ9 A;  5E41 A;  4CK3 A;  4EZ6 A;  4ZTF A;  4Y1D A;  5J2N A;  1QSY A;  4CJK A;  3AVJ A;  5C25 A;  1BI4 A;  3SNN A;  5HRS A;  2Q3S A;  3NGZ A;  4FM2 A;  4JLH A;  3CM5 A;  1ZBH A;  4CGI A;  1EX4 A;  1JL1 A;  4DFJ A;  2QK9 A;  3NCI A;  4CF1 A;  5HRO A;  1DTT A;  2QKB A;  4MQ3 A;  3OYG A;  4KV8 A;  4K8Z A;  1A5V A;  2DFE A;  3C6T A;  4O44 A;  5HRP A;  4FLW A;  2XY7 A;  4O0J A;  1L3U A;  4I9L A;  2EHG A;  4C8N A;  3LP1 A;  3LAL A;  3U6F A;  1VSI A;  3T3F A;  3ZCM A;  1VSF A;  4JS4 A;  4FW2 A;  3NBP A;  5KGX A;  5J2M A;  4HCC A;  4FJM A;  4M3T A;  1FKO A;  3V1O A;  1RNH A;  5J2P A;  4CF9 A;  4Q5V A;  3QNO A;  1HYV A;  2YV0 X;  5KI6 A;  1NKC A;  4HUE A;  3KLG A;  1UA1 A;  2Z1H A;  1U04 A;  4KHQ A;  1RT1 A;  5CY4 A;  3VQD A;  4CJW A;  2YNI A;  3ZSZ A;  3SV3 A;  3KLH A;  1LWE A;  3TAG A;  4E1N A;  1TKX A;  4B8A B;  4C8O A;  2EX3 A;  1EP4 A;  1KTQ A;  3DLR A;  4NYN A;  3HVR A;  1UA0 A;  1L3S A;  3KD5 E;  2IOC A;  3V1Q A;  3S3O A;  1VSJ A;  1NKE A;  1BL3 A;  4CFB A;  3AVA A;  4DQP A;  4ZTJ A;  3DRR A;  2YNH A;  4CK2 A;  1S1U A;  1BI4 B;  1GOC A;  3B6P A;  4RW9 A;  1ZYQ A;  1LWF A;  1UOC A;  2X6S A;  4E1M A;  5FRM A;  2KZZ A;  4PQU A;  4BDY A;  3LAK A;  1QTM A;  3DYA A;  1JLB A;  2Y1J A;  4DU3 A;  4CFD A;  3L8B A;  4E7L A;  2PY5 A;  1Y97 A;  4DLG A;  4IKF A;  4ID1 A;  1Z26 A;  3NE6 A;  3LP2 A;  1TKZ A;  3CQ8 A;  5EU7 A;  4OLA A;  2VG6 A;  1QE1 A;  3QIN A;  1NJW A;  2DFH A;  1ZBU A;  2Y1I A;  1D8Y A;  4KO0 A;  4Q0B A;  1F21 A;  1RBU A;  2DTU A;  4KHU A;  1KFD A;  3K5L A;  1HYS A;  4KHW A;  1KVC A;  1TKT A;  5HRR A;  2XRI A;  4ID5 A;  2KFN A;  1FK9 A;  1WAJ A;  4N56 A;  3TR8 A;  1RT6 A;  1HPZ A;  4AHT A;  2FBY A;  3QER A;  3PO4 A;  4YFU A;  3OYC A;  3HYF A;  2HHW A;  2JLE A;  4C8K A;  1T03 A;  3BDP A;  4F8R A;  4CIE A;  3TI0 A;  3LPT A;  4DTO A;  4I2Q A;  3PY8 A;  5JS2 A;  5KTQ A;  1SL2 A;  1B9F A;  3K57 A;  4AH9 A;  4KI6 A;  2F96 A;  3O4N A;  2VG7 A;  2FBV A;  4BWJ A;  2R7Y A;  4RW6 A;  3ZT2 A;  2F8S A;  4FZY A;  4CED A;  4KKO A;  3AA5 X;  1RTH A;  1QHT A;  4CEB A;  1VSE A;  1NJX A;  3SYZ A;  2IC3 A;  5T7B A;  3NDK A;  3RRG A;  3RR8 A;  4BAC A;  1XC9 A;  4CEA A;  3HVT A;  1TK5 A;  1L5U A;  1LWC A;  5J2Q A;  4CJR A;  3ASM A;  4DF4 A;  2OPR A;  4FJ5 A;  3AO2 A;  4FLV A;  1ASV A;  2YNF A;  5I3U A;  4OPJ A;  3PX6 A;  1SUQ A;  3SPZ A;  4B9M A;  3ZT0 A;  1SKS A;  2G8I A;  2HHV A;  3OYK A;  4I9Q A;  4B9N A;  3K5O A;  2FBT A;  4PUO A;  3HO1 A;  2HHQ A;  4ELV A;  3LP0 A;  4YNQ A;  1UAX A;  3LZJ A;  4CEQ A;  1RBS A;  1N6Q A;  3U3Y A;  4CER A;  3OYA A;  1TAQ A;  1C0M A;  1WSI A;  4FYD A;  2GBZ A;  1Z25 A;  2ITG A;  4C8M A;  1W9H A;  3ALY A;  1O1W A;  4F3O A;  2ZE2 A;  4CJP A;  4W5O A;  1CLQ A;  3K58 A;  4AHC A;  4M3U A;  1A5X A;  2X74 A;  1DLO A;  3C6U A;  3K2P A;  4DLE A;  4DU1 A;  2GUI A;  1GOB A;  4TSX A;  2YHA A;  1S6Q A;  2HNY A;  2Z1I A;  3HPH A;  3NF7 A;  2HMI A;  2RKI A;  2A1S A;  4DTJ A;  3M8S A;  3SUO A;  3SV4 A;  4OGE A;  3OYJ A;  3AV9 A;  3HM9 A;  1SKR A;  4KAZ A;  4K8X A;  3L2V A;  3ZSR A;  2O4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...