4CFDA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cfdA00
3S3NA 4LY7A 4CESA 2IC3A 1RTIA 1VSIA 1WSFA 1Z26A 3LP0A 3TAEA 4HUEA 5FRNA 3ITHA 3TABA 5KGWA 3I0RA 1N6QA 4M3TA 1UOCA 2QKBA 1KLNA 3OYLA 1T05A 1ITGA 4C8KA 2F8SA 4CEFA 4DSLA 4KRFA 2XY5A 3KLIA 5E41A 2X78A 1C6VA 1T03A 3RMDA 1KRPA 2BE2A 4ELVA 1LWFA 3T1AA 3VQPA 2EX3A 3NH0A 4B9LA 3HM9A 5K14A 2OA8A 3KTQA 2E6LA 2QXFA 4FLTA 4CJWA 2P51A 4DTJA 1IG9A 4N41A 4DF8A 3OYIA 3RMCA 1NK7A 3CG7A 4PWDA 1S1WA 1A5VA 3KKRA 3NH2A 3EZ5A 1NJZA 1B9FA 4N47A 3ZT3A 4B8CA 4E7KA 1TVRA 3M8PA 3RMBA 1WSGA 1XC9A 2F96A 4HUGA 1N5YA 2QKKA 3OYDA 1ZBIA 3BGRA 4DU1A 1Y97A 2OYQA 1RT7A 2O4IA 1S6QA 4AHUA 3V9SA 3OYFA 3RWUA 4FJJA 1TGOA 1JL2A 4CHZA 3ULDA 4RW8A 1RT2A 1HRHA 3C95A 4EP5A 3HSTB 4ICLA 4H8KA 3SUPA 1NK6A 2P5GA 3NFAA 4G1QA 3SUOA 1QTMA 2ZQBA 4DSKA 3PUFA 2PY5A 1RDCA 4B9VA 2ZD1A 3OYNA 3LDSA 1HJRA 4EZ9A 3TAFA 2XY6A 3HO1A 4E7HA 3CM5A 3ZCMA 3K5NA 4FLWA 1L3TA 2PYLA 3HJFA 4CERA 1W9HA 4JRPA 3LANA 3VQ5A 4CGDA 3O4NA 4PA1A 3V9XA 3WNFA 2X6NA 4ID1A 4GVMA 3HT3A 4DTOA 4Z0UA 2BANA 4B9UA 1REVA 5JS1A 1SKSA 3SQ2A 2ETJA 4OKEA 3OJUA 4OPKA 3AVGA 1QQCA 3PX4A 3A2FA 4NYNA 4M45A 1L3SA 4DQRA 4NCBA 4Q0BA 2KW4A 2Z1GA 3LP2A 4W5OA 4DF4A 3PO5A 4KHWA 2BGGA 3CFOA 2YHAA 1HMVA 4DS4A 1RDAA 1KVCA 2XY8A 3HVTA 2KFNA 1Q9XA 3HXMA 3L2QA 4H4MA 4AILC 2ZE2A 1JLBA 1TKZA 3JSMA 1VSFA 3AVHA 4OLAA 3NDKA 3QETA 3QEIA 3P5JA 1J54A 4CHOA 5C24A 3MXIA 2YHBA 3RMAA 3TAGA 5HRRA 2G8FA 3BDPA 1KSPA 1IH7A 3WNEA 5JS2A 1BIZA 1IO2A 1RT6A 3F9KA 1WSIA 5J1EA 3OYBA 1TK0A 3NGIA 1QSSA 3AVBA 1S6PA 4DQQA 4FLZA 1JL1A 3OY9A 3OJSA 3U3YA 4DFKA 3AO5A 3LPTA 3K5OA 4CIEA 4B9NA 4M3UA 2OPQA 5CYMA 2RF2A 4B8AB 1XHXA 2NUBA 2PZSA 3VQBA 4M3YA 1NK5A 1CXQA 3TWHA 3NF6A 1BISA 4O0JA 4M41A 1BI4A 3TANA 3MXJA 3DLBA 4DSEA 4O5BA 4I2PA 4CFBA 4CEEA 3EY1A 2FC0A 2G8VA 4M3ZA 4CHYA 1J5OA 4FJGA 3VQ7A 4LSNA 1RDBA 3WNGA 4CE9A 4DFMA 4HCBA 2HHQA 4CJFA 1B9DA 1TV6A 3ZSQA 4Q5VA 2HVHA 4AHCA 1NJWA 1GOBA 3OYMA 3SV3A 3EYZA 3F73A 1TK5A 1R0AA 3M8QA 4I9LA 1JLQA 3ASMA 3DLGA 3ZSZA 4KI6A 4DS5A 4O0IA 1FKPA 2HHUA 4IFYA 5HBMA 3VN5A 3SYZA 4FZYA 4YFUA 4KHSA 1HNIA 2P1JA 3ALYA 2DFHA 2KTQA 1D5AA 1HPZA 3U6FA 3D45A 4HCCA 3L2UA 1RILA 4I2QA 4C8MA 1NK8A 1BCOA 3FFIA 3H08A 3V1OA 4CIFA 5SWMA 3L3UA 1ZBHA 4C8LA 4K8XA 1GOCA 2KQ2A 4YNQA 5KRSA 4FJLA 4E89A 1TKXA 3DLHA 4QAGA 1KFSA 4CCHA 4OKKA 4CGGA 4FM1A 3AVMA 3AVKA 1Q9YA 1C1BA 4I9QA 3SPYA 4QCLA 4FCYA 1QHTA 1SV5A 4DSFA 3SNNA 2YV0X 3DI6A 3SQ4A 2R7YA 4HTUA 1K6YA 3OS0A 3DRRA 4OKJA 2YNFA 3P1GA 3VQEA 1DTQA 2F8TA 3SZ2A 3UIQA 4CJUA 4LH5A 4R5PA 3AA5X 3VA0A 4I7FA 4FZZA 1W0HA 4E19A 3LP3A 3B6PA 4CGIA 4WE1A 4CF8A 5KTQA 4TSXA 3AO1A 3LALA 4CGFA 4DSIA 3SI6A 4B9MA 2EHGA 3QNNA 4M3WA 3L3VA 3OYJA 4OGEA 1NK0A 1S1TA 3AVAA 4CEBA 3O3GA 4BDZA 3V6DA 1UA1A 2Y1JA 4E3SA 3G10A 1D9DA 4M42A 1JLCA 4DWIA 1BQMA 1U04A 2Z1JA 1KCFA 4CJVA 4DQIA 4M3XA 3NF9A 3I8DA 4B9TA 2B6AA 3L2VA 2Z1HA 3NCIA 1NJYA 1QSLA 1WSJA 2ITGA 4CK2A 4RW7A 3CM6A 4Y1DA 2B4JA 3LZIA 1KLMA 3IG1A 2YKNA 1FK9A 2IDOA 3C94A 3MEEA 3CFRA 1NOYA 4EZ6A 1WAJA 2OPRA 4FM0A 1UWBA 3KD1E 3V9UA 3NGZA 3TI0A 3WNHA 3S3MA 3O3HA 1X1PA 4DFPA 4CK1A 3MEDA 1XWLA 2VG5A 2RPIA 3L2WA 3MXMA 3V9ZA 2FBYA 2G8HA 4BDPA 3QERA 1RBUA 3AO2A 4ZTJA 2DFEA 4FJHA 4KHNA 1J53A 1VSKA 3HYFA 4E7JA 1CZ9A 4DTUA 2FBXA 1T7PA 4IKFA 1MU2A 1B92A 1RTJA 3T3FA 1ZBLA 4O4GA 1L5UA 3CQ8A 1EX4A 1G15A 3AO4A 4B08A 5CZ1A 5T7BA 3DOKA 1RNHA 1C0MA 3V1RA 4BE2A 1U49A 3K58A 4CJTA 3K5MA 1RBTA 1L3UA 3ISNC 2XY7A 4FLUA 3SJJA 3MECA 4FJ5A 4OJRA 2JGUA 2OPPA 3G0ZA 4CFCA 4JS5A 1U48A 3TAMA 2HHSA 4CJLA 4DTNA 3DLEA 2DFFA 3AO3A 3TAPA 1CZBA 1S1XA 5DK5A 3KLGA 4OLBA 3QIOA 2FBTA 2HHWA 1SUQA 4FJNA 4ZHRA 1XI1A 3SV4A 1S5JA 1CXUA 3KLHA 1JKHA 1RT4A 4F8RA 4Z4GA 4Z4IA 4CJ4A 4HHTA 1D8YA 4FJIA 3LAMA 4PY5A 4IBNA 3JYTA 3AVIA 1X9WA 2G8KA 1JXBA 3VQ9A 4FJ8A 1VSJA 3QESA 1NOZA 2LSNA 3QO9A 3QINA 4NYFA 4CEDA 3MAQA 1CLQA 3ZSYA 4UQGA 2G8UA 4IG0A 4CJSA 2P5OA 1U47A 4KTZA 1LW2A 1SL0A 4CF0A 3AVJA 3C6TA 2BDPA 4DU3A 1EP4A 3LP1A 3AA3A 5KI6A 2HHXA 1I39A 2IS3A 4F4KA 4KTQA 4KFBA 5HP1A 4KHYA 3NE6A 1TKTA 3PX0A 2YKMA 4DTSA 4ELUA 3S3OA 1QSYA 2OPSA 1SKRA 2WOMA 1DLOA 4Y1CA 3I0SA 3L2RA 4NCAA 5KGXA 3MEGA 3LWMA 1YT3A 1EKEA 4Z4HA 2D0BA 3QEWA 2A1RA 1D9FA 1BIUA 5CYQA 1SL1A 4FJXA 5J2MA 4KI4A 1RDDA 4CJPA 3VA3A 2DTUA 1NJXA 3RRGA 4J2EA 4CJQA 1J9AA 4AH9A 4JRQA 3B6OA 5HRNA 4BE1A 2FBVA 1NKEA 1DTTA 3KKSA 4CJKA 1L3VA 4CHNA 2OZMA 2X6SA 5FDLA 5HROA 1BI4B 2AJQA 4FLYA 1HNVA 1EETA 4DTXA 4FM2A 1BGXT 3PO4A 1JLFA 3ZT0A 1TAQA 1FXXA 3M8RA 4GMJB 4DTMA 2HW3A 4HUFA 4AHRA 1NKBA 1RTDA 2YNHA 4CJ5A 4J2DA 4DLGA 4C8NA 2XRIA 4E7LA 1C1CA 1VSDA 3SPZA 5I42A 1VSHA 2E6MA 3HP9A 1QS4A 2IGIA 1LAWA 5HRSA 3TAQA 2ATQA 4Z4CA 4CEOA 1RT5A 1O1WA 1JLEA 1ASUA 1VSMA 2O4GA 5HRPA 2HNDA 4CJRA 4DFJA 3THVA 3DRSA 4KB1A 2HB5A 4W5RA 3P83D 3OVNA 1BHLA 3AVLA 3OS1A 5D3GA 3HL8A 3M8SA 4FLXA 5I3UA 3OS2A 3QIPA 5KRTA 4OVLA 3V1QA 3V4IA 1A5XA 4FJ7A 4KHQA 1BL3A 3DMJA 3O3FA 3AVFA 4DSJA 4E1NA 1HYVA 4FXDA 1FKOA 3KK3A 4N56A 3ZSXA 4LSLA 4E7IA 2X74A 4CF2A 1BQNA 4BDYA 1T8EA 5J2QA 4CHQA 1EXQA 3OYCA 4FLVA 4CFDA 3RR8A 1VSEA 1WAFA 2IAJA 2VG6A 4RG8A 3S9HA 5CY4A 4LD0A 2Y1IA 4AHTA 3V81A 4J2BA 5C25A 1ASVA 3VQ8A 4FZXC 3DRPA 4CECA 4FJ9A 4HVJA 3D0PA 4DTPA 5C42A 4W5NA 4IG3A 3QEXA 1RT1A 3NAEA 3KIOA 4J2AA 1NK4A 4H4OA 1ZBUA 1SL2A 2HNZA 4NCGA 4FYDA 4CGHA 2B5JA 1BCMA 4CK3A 1HQUA 5SZTA 2IOCA 5HLFA 3L8BA 1JLAA 4JS4A 3QEPA 3HP6A 4BACA 4CJ3A 4O55A 3U3GA 4OPJA 3HPOA 3QEVA 2HHTA 2Z1IA 4FVMA 1WSEA 4O44A 1WN7A 3HVRA 1TK8A 2YNIA 4N5SA 4EP4A 1C1AA 1VRTA 3LAKA 4CF1A 1TAUA 3NHGA 1HYSA 3AA2A 4PUOA 3O4QA 1X9SA 3LZJA 3NGYA 4FK4A 4RW4A 2XO7A 2G8IA 1TL3A 5DMRA 3KLFA 1NK9A 4CEQA 5FROA 4W5QA 3IRXA 1KTQA 1RBRA 1IKWA 4KTWA 1ZYQA 4QOZB 4PQUA 4FJKA 2HMIA 1U4BA 3ZSVA 3OYKA 3PV8A 5FRMA 4DU4A 3KJVA 1QE1A 4BWMA 2KFZA 4RW9A 3VQQA 4CF9A 5J2PA 4CIGA 1RCHA 4F2RA 3VQAA 4DMNA 4N76A 4LH4A 2HNYA 1YTUA 4K8ZA 1F21A 3HPGA 2WONA 1C0UA 4FW2A 3ZT4A 3NF7A 4F2SA 4KV8A 1TKDA 2W42A 1VSLA 3RRHA 3PX6A 1I3AA 1RBVA 3K59A 2QK9A 1VK0A 3AVCA 3OYGA 4MFBA 4F3OA 3E01A 3DOLA 3AVNA 4DG1A 4CEZA 2A1SA 3KK1A 5EU7A 4B9SA 3K2PA 1X9MA 1XHZA 3OYHA 1WLJA 1VRUA 2RKIA 4FK2A 1RTHA 1A5WA 3TR8A 3OYAA 1SKWA 3TARA 2G8WA 4KAZA 1KVBA 4CFAA 4DLEA 1IKVA 4CHPA 4Z4FA 3SUNA 1NKCA 3RR7A 3SCXA 2VG7A 3AA4A 3KK2A 2D0CA 3T19A 2HVIA 3ZSOA 3ZT2A 1YVUA 2RN2A 1ZBFA 3QLHA 3K57A 2VWJA 3IAYA 2E4LA 2XHBA 1S1UA 1LV5A 4IDKA 3SUQA 3SQ0A 4KB0A 4F3TA 2DY4A 2VWKA 3DLKA 4FW1A 2GUIA 1Z25A 3IS9A 4RW6A 4DQSA 3DM2A 3ZSWA 2D0AA 3VQ6A 2KZZA 1HYZA 2Q3SA 3C6UA 1LW0A 1IKXA 1C0TA 4BWJA 1UAXA 3VQDA 1WNSA 3DLRA 4KPYA 2HHVA 1IKYA 4ZTFA 4DQPA 3NH1A 2OZSA 4KHUA 3LWLA 4Z4EA 4FJMA 1KVAA 4KKOA 1JLGA 3ZT1A 4BE0A 4CEAA 4IFVA 4E0DA 3NBPA 4MQ3A 3KD5E 1RT3A 4B3OA 3ZSRA 4FK0A 4ID5A 2I5JA 4AHSA 4AHVA 3PY8A 3NF8A 3HK2A 3KLEA 1S9GA 2PYJA 2GV9A 3RTVA 1U45A 1Q8IA 1GOAA 4L8RB 4M3RA 4E1MA 3QNOA 3LPUA 1UA0A 4DTRA 4JLHA 1KFDA 1HQEA 1TL1A 4KO0A 3OYEA 4C8OA 4CJEA 1S1VA 1S9EA 5CZ2A 2JLEA 1JXEA 3HPHA 4GW6A 1ASWA 3V9WA 1LWEA 2YNGA 3CYMA 4OGCA 1RBSA 3VQ4A 4XIUA 1YTAA 3K5LA 4W5TA 3CFPA 4CGJA 1WSHA 5J2NA 1LWCA 3VQCA 2KZMA 3AV9A 3SQ1A 3DYAA 4ELTA 4KREA 1LAVA 2GBZA 2D5RA
chains in the Genus database with same CATH superfamily
3S3NA 3LP0A 3FZHA 4HUEA 5FRNA 5KGWA 3D7EO 4DR1K 1UOCA 1Q7YO 2QKBA 2E1ZA 1ITGA 4KRFA 5AQRA 5E41A 2X78A 2BE2A 3HRGA 3T1AA 3CI5A 2HBMA 4A2AA 3HM9A 5K14A 2OA8A 2NRZA 4BQZA 2P51A 5E84A 1OVYA 3KKRA 1A5VA 3OBYA 4RTFD 4M3UA 4B8CA 2QKKA 1TVRA 4HUGA 3CC7N 1ZBIA 1Y97A 3BUZB 3I8BA 3L0QA 1QVGM 2O4IA 4DV1K 1TGOA 1RT2A 1HRHA 4ICLA 4BGBA 1MA9B 1N34K 2PY5A 4M7XA 4B9VA 4BR2A 5DM6L 4E7HA 4H5WA 1L3TA 3SK3A 3LANA 4CGDA 3O4NA 4BROA 2UXCK 3V9XA 3HT3A 4DTOA 4RCHA 2BANA 3FFKB 2ETJA 4OPKA 4NCBA 4DQRA 5M1KA 4JI7K 4YY3K 1NJIO 3KWGA 3J80O 2BGGA 3CFOA 2YHAA 2JWKA 4K41A 3A5NC 4AF1A 1V4SA 3T1YK 3E9OA 2ZE2A 2VGNA 1TKZA 3JSMA 4WQ4C 5GAHP 4CHOA 5C24A 3BDPA 2PAVA 1RT6A 4KTQA 1C0GA 3WEEB 3C0BA 5CYMA 3N4PA 4PKIA 3EEQA 1NK5A 1VQPN 1E3MA 1BISA 1HKGA 1BI4A 3TANA 4O5BA 4I2PA 2O8DA 4CEEA 3TSUA 3CXCM 2G8VA 5EX5A 4DFMA 5LJWA 1NGGA 3O9TA 4YOWA 2H3GX 3GBTA 2HVHA 1GOBA 2OCEA 3CJCA 3OYMA 2WFBA 5HL7L 4LFCK 4PL7A 3ZLJA 4KI6A 3DLLL 1FKPA 3VN5A 3SYZA 2KTQA 4YFUA 1KXPA 2DFHA 1D5AA 1KAXA 3L2UA 1HKBA 2GX9A 3K9JA 4LF7K 3NVKA 1ATRA 1VHXA 3L3UA 1ZBHA 4YNQA 1IBKK 2VYPA 3O1BA 1TKXA 4QAGA 1QHAA 4WQ4A 3HZ6A 4WFBL 3SPYA 4QCLA 3VMFB 1QHTA 1SV5A 4DSFA 3OS0A 2JWLA 3P1GA 3VQEA 1DTQA 3SZ2A 1T44A 3P31A 4DQ8A 4FZZA 1W0HA 3THXA 2A40A 3C65A 4CGIA 4WE1A 4CF8A 4WFNL 5KTQA 3AO1A 1BU6O 3SI6A 3QNNA 1NK0A 4CEBA 3O3GA 3H1VX 2P9UB 1JLCA 4JKGA 4DWIA 1KCFA 2B6AA 1M1KO 2Z1HA 1NJYA 2B4JA 5AQJA 2E8AA 5ADXA 2OPRA 1VAZA 3S3MA 3O3HA 1X1PA 1VQNN 4M63C 5B8HA 2G8HA 4JKGB 4BDPA 2CGLA 1YAGA 1J53A 4E7JA 1CZ9A 4DTUA 1T7PA 4FWSA 4IKFA 1MU2A 1B92A 3T3FA 1L5UA 3AO4A 1G15A 5CZ1A 1RNHA 1U49A 1L3UA 3ATVA 3ISNC 4YOUA 3T1HK 3IDHA 1NGEA 3H3OB 1GLDG 1KAZA 3CMEN 3TAMA 4IDHA 2Q36A 2O8EA 3SV4A 1K8KA 1X9WA 1VSJA 3QINA 3O9RA 2G8UA 4XH5A 2WUSA 2BDPA 1EP4A 3AA3A 2HHXA 2IS3A 3WXLA 3W3DA 2UUAK 3NE6A 3MN5A 4CW7B 4NLBA 4EHTA 3PX0A 2OPSA 2QEXN 3I0SA 1W7AA 3EE8A 3LWMA 1EKEA 5CYQA 3R3LA 3VA3A 1NJXA 3RRGA 3B6OA 1NKEA 4JKDA 4CJKA 1L3VA 1T6DA 3AAPA 1NWKA 4DTXA 1BGXT 1NGHA 3PO4A 4BR0A 3C6HA 5AQYA 1TUUA 4H0VB 4DTMA 1NGFA 3ZEUB 4HUFA 4AHRA 4IZ9A 4DLGA 4E7LA 1C1CA 1KQSM 2E6MA 3VGLA 5H1SQ 3RSEB 5HRSA 1VSMA 1JLEA 1IV0A 2F9WA 2HNDA 4CJRA 3THVA 5AQXA 4BVPA 4BC5A 1VQ7N 5D3GA 3SLCA 5KRTA 3CCRN 3E9PA 3V4IA 1A5XA 4KHQA 4JV5K 1BL3A 4FWNA 4DSJA 1HX1A 1FKOA 2VWBA 4A61A 3ZSXA 4FWKA 4E7IA 2X74A 1G99A 4O5FA 4CHQA 3OYCA 4FLVA 1R59O 5FPMA 4BGAA 1VQ5N 1VSEA 4RG8A 4LD0A 4J2BA 4FJ9A 1KAYA 4HVJA 5BPNA 5C42A 3D0PA 1J5EK 1HNWK 3CCUN 4J2AA 4H4OA 3QBXA 3QMLA 4NCGA 4CGHA 1HQUA 1JLAA 1JCGA 3T7ZA 4B1ZA 3U3GA 3BEXA 4H0OA 4PL8A 4O44A 1WN7A 3HVRA 2O8BB 4KHPK 4CF1A 3CCLN 4DR2K 3IFRA 4PUOA 3LZJA 2XO7A 1NGIA 3CJAA 4CEQA 4W5QA 1RFQA 1ZYQA 4QOZB 1GLEG 3A0IX 3FZFA 4G9ZA 2HMIA 2YX6A 4FO0A 3OYKA 3VEWA 3PV8A 5FRMA 2FXUA 3L4QA 1NG9A 3VQQA 2D4WA 2WONA 3ZT4A 4F2SA 5BRDA 3RRHA 1RBVA 1VK0A 4GVEA 3MWTA 4DV5K 2RKIA 2BH1A 3HTVA 1IKVA 4CHPA 1NKCA 2GEMA 2VG7A 3AA4A 3CQYA 2D0CA 3T19A 2HVIA 3ZSOA 3ZT2A 5LY3A 3IAYA 3DLKA 4FW1A 1Z25A 3IS9A 4DQSA 3DM2A 2P9SA 1HYZA 3C6UA 1YHQN 4C8OA 1C0TA 3AAQA 5M1OA 5FPEA 2NRVA 1VQON 4BRKA 3ZSRA 4IJNA 2GV9A 4E1MA 4E1JA 4O8UA 3LPUA 1UA0A 1KFDA 1TL1A 3Q7CA 3OYEA 2ZGYA 1S1VA 1S9EA 3HPHA 1LWEA 2YNGA 4BE0A 1RBSA 3C7NA 3K5LA 1YTAA 3NVMA 4W5TA 5AZIA 3SQ1A 2E1YA 3WXMB 4ELTA 1BOTO 1LAVA 1VSIA 1WSFA 5KQDA 3TABA 4A59A 3OYLA 4CEFA 5LJVA 4JKAA 3WXKA 3KLIA 4ELVA 1C6VA 3RMDA 1LWFA 3QICA 4A5AA 2E6LA 2QXFA 4GNIA 3TTFA 1WBBA 4BG8A 4N41A 1V4TA 1S1WA 3NH2A 3CCSN 4IFEA 4N47A 4E7KA 1N5YA 3BGRA 2OYQA 3V9SA 4FJJA 1SZ2A 1JL2A 4CHZA 3ULDA 4RW8A 1NK6A 3C95A 4EP5A 3NFAA 1QTMA 2ZQBA 2BTFA 3LDLA 1TYQA 2ZD1A 3LDSA 3TAFA 3C6AA 3HO1A 2P9NA 2PYLA 3A8YA 3JS6A 4CERA 4JRPA 3VQ5A 1ZXOA 1LCUA 1REVA 4FSVA 1SKSA 4B9UA 4OKEA 5MLCQ 2Z1GA 4WFAL 3PO5A 2P9KB 3OBWA 3L2QA 2YHWA 4H4MA 1NBWA 4J8FA 3BZCA 1U6ZA 4JYAK 3LDOA 1BUPA 1HUXA 2E20A 3WT0A 1C0FA 3GDQA 3RMAA 3ZX2A 4IO8A 2HHHK 5JS2A 4BRHA 1WSIA 1QSSA 1WBDA 1S6PA 4FLZA 1JL1A 3OJSA 3U3YA 5M1FA 4DFKA 3AO5A 3LPTA 4CIEA 2YI1A 4B9NA 5GAGP 4B8AB 1LOTB 2PZSA 3CMAN 4CD3A 1T3VA 3CCQN 4O0JA 2GELA 4DSEA 2HF4A 5I9EB 3SJHA 2FC0A 4CHYA 1J5OA 3VQ7A 4LSNA 1RDBA 3WNGA 4CE9A 4HCBA 2HHQA 4CJFA 1TV6A 4Q5VA 2HSTA 4BQLA 1NJWA 5A2QO 3LDNA 3VF4A 3O1WA 3SV3A 2QWPA 4I9LA 2GWJA 3ZSZA 2HHUA 4RWTA 4O0IA 4IFYA 3MDQA 1MWMA 1OH5A 4FZYA 1HNIA 2P1JA 5CE3A 4HCCA 5CHIA 4I2QA 4C8MA 1BCOA 3FFIA 3PLAA 3H08A 5SWMA 1GOCA 4K25A 5KRSA 2V52B 4X64K 4FJLA 3VERA 4I9QA 1C1BA 4ISGA 3CJ9A 4XEIA 2YNFA 1S3XA 4CJUA 4LH5A 4R5PA 1Q82O 3AA5X 3VA0A 4BRAA 3B6PA 4DR4K 3D2FB 2BUPA 3E66A 5EVZA 5AZJB 3V6DA 5AQUA 5M1PA 2E5LK 1Z6RA 4E3SA 5AQGA 2IIRA 4M3XA 3NF9A 1VQ6N 4CZHA 5AQNA 1WSJA 2VGMA 4A5BA 3LZIA 1KLMA 4LFAK 1FK9A 2IDOA 2FSJA 5E26A 4JKHA 4DV4K 2W6LA 4BC3A 4FM0A 1JJ2M 1UWBA 3V9UA 3NGZA 4CBXA 3TI0A 4DR3K 3H46O 3MEDA 1XWLA 2VG5A 3L2WA 3O9SA 1RBUA 4FJHA 1VSKA 3HYFA 4BREA 1RTJA 3EN9A 3N4QA 3OHRA 4Z94A 4O4GA 3CQ8A 3V1RA 4BC4A 4CJTA 4U67L 2XY7A 1ZBSA 3MECA 4FJ5A 4BRPA 4OJRA 2OPPA 4CFCA 4V19S 1U48A 3J7ZO 2ZJRL 3ENBA 2HHSA 2YCHA 4C23A 1CZBA 3T69A 5DK5A 3KLGA 2FBTA 2HHWA 1SUQA 1CXUA 3KLHA 1RT4A 4Z4IA 4HHTA 4ILJA 4IBNA 3VOVA 1I94K 3CJ1A 3VQ9A 1OKJA 1K9MO 5EXWA 5JICA 4CEDA 1O13A 1E4FT 2QA4N 4B1WB 4LF6K 3ZSYA 2QXLA 4BRCA 4CZGA 3FR0A 3C6TA 3PSIA 1XC3A 3VGKA 3U4LA 2WBNA 4KHYA 5LMUK 3DXKA 5JVHL 1TKTA 4DTSA 4BR7A 4ELUA 4Y1CA 3L2RA 3G71N 5KGXA 4NCAA 1EWRA 1YITN 1D9FA 1VQKN 1BIUA 5AQFA 1DT9A 1SL1A 3VESA 4CJPA 2DTUA 1XNQK 4AH9A 5HRNA 2FBVA 3EKUA 3OA9A 1DTTA 2OZMA 4CHNA 5FDLA 4B9QA 3H6EA 1BI4B 4GV9A 3A5LC 3H1QA 2O8DB 5BRFA 5AFUH 3ULEA 2UUBK 3ZT0A 1Q81O 1FXXA 3M8RA 4K0KK 2J4RA 3GG4A 4M7YA 3P4IA 3MMVA 4CJ5A 3A5OC 4L3QA 4C8NA 3SPZA 3PIPL 5I42A 3HP9A 4IEIA 2O8CA 1RGIA 2ASOA 2HBJA 5HRPA 4K43A 3K9KA 4DFJA 4DV3K 1HR0K 2E88A 4GV6A 1BHLA 3ULEB 3AVLA 1N8RO 4FLXA 5I3UA 3QIPA 3QFPA 4E1NA 4N56A 3A5MC 2HMPA 1T8EA 5J2QA 1EXQA 3MX2A 4DV0K 3O9QA 2KLAA 3RR8A 2IAJA 2VG6A 1WB9A 5CY4A 2Y1IA 4AHTA 3THXB 5IWAK 3DRPA 1MWKA 4IWVA 1JCFA 3NAEA 3CPWM 2FF6A 1BA1A 3R9PA 4FYDA 1KD1O 1BCMA 2CGKA 3CD6N 3L8BA 4NXMK 4NO7A 3ATUA 3FZMA 1QQOA 3AY9A 3CJBA 2DPNA 3QEVA 2Z1IA 4H0XB 4MDAA 2YNIA 1TAUA 1VRTA 1GLFO 3NHGA 4FWOA 4YOYA 3AARA 1TL3A 1NK9A 1SAZA 1QZ5A 2OTLN 1IBMK 1IKWA 4YORA 4JI3K 4PQUA 3UKRA 4JK9A 4UY8O 5GAEP 4DU4A 1QE1A 1Y64A 4BWMA 4RW9A 3TSQA 1RCHA 2YJEA 4CIGA 2YHXA 4DMNA 4LH4A 4K8ZA 3HPGA 3MN7A 3NF7A 3HBTA 1TKDA 4H5RA 1I3AA 4O8KA 3AVCA 3OYGA 4F3OA 4MFBA 4DG1A 3TTCA 2O8EB 4A62A 5FPDA 1SKWA 4CFAA 1K8KB 1SS6A 2VWJA 1NGJA 3OTOK 3SQ0A 4KB0A 3J8AA 4F3TA 2VWKA 3DWLA 5C2DA 3K0SA 3ZSWA 2D0AA 1W2BM 2QWLA 3UE5A 3VQDA 4KPYA 2HHVA 4CI6A 4ZTFA 4DQPA 5FPNA 4KHUA 1K8AO 4KKOA 5KQ8A 2NZTA 3I56N 4B1VA 2I5JA 3HK2A 3VF6A 3KLEA 1S9GA 4JI5K 1U45A 3MK6A 1GOAA 3QNOA 3TTDA 5C10A 3THWA 4FVUA 4I6MA 4CJEA 1EO1A 1JXEA 4LF9K 3R8EA 3SMPA 3WQTA 4XIUA 4OGCA 3S41A 4CZFA 5J2NA 2KZMA 3AV9A 1Q86O 1WUAA 2GBZA 2RE2A 4LY7A 4CESA 3CCVN 1RTIA 1SQKA 1QQMA 2HOEA 4M3TA 3THWB 1JCEA 4CBUA 1OH6A 1VQMN 3I33A 4DSLA 2UUCK 4DKWA 5KPTA 1T03A 1KRPA 1DKGD 5DM7L 3GE1A 2EX3A 3NH0A 3KTQA 3TSPA 3DXMA 5AR0A 4FLTA 4IOAL 2QI2A 4CJWA 3EKSA 4LF4K 4EHUA 3RMCA 3OYIA 3CG7A 1NJZA 3EZ5A 2D0OA 3M6GA 5AJ3K 1M90O 3M8PA 3RMBA 1XC9A 3CQXA 3KK7A 3UKUA 4YDUC 2WC9A 4GKJK 3LM9A 5M1NA 3D2EA 5BPMA 4AHUA 3RWUA 4CZKA 3OYFA 4PKHA 3SUPA 3HSTB 5FLXO 1NGCA 3SUOA 3CHWA 3PUFA 3DXMB 2W6KA 3OYNA 1HJRA 3FGUA 1RDWX 4FPBA 3CM5A 3ZCMA 4FLWA 4PA1A 5F2RA 2A41A 2X6NA 5JMVA 4GVMA 1KC8O 4QS8A 3FE1A 3VEYA 5EOYA 3SQ2A 1OH8A 1QQCA 4IXCA 3A2FA 4M45A 2KW4A 3LP2A 4JKEA 5AQVA 1HMVA 2XY8A 2KFNA 5IT9O 1XMQK 3CETA 2CH6A 3D6RA 2NRXA 1VSFA 3AVHA 4BRIA 3M5RA 3QETA 3QEIA 1J54A 4ISEA 2YJFA 3THYA 3O08A 3LL3A 2A3ZA 3TAGA 5HRRA 2G8FA 4XH4A 1KSPA 3FZKA 5J1EA 3F9KA 1TK0A 4DV2K 1QQNA 3R1XA 3NGIA 4BRGA 2ZM6K 4JK7A 4YDUA 3HOTA 1FJGK 3K5OA 2ITMA 4OO1J 4JKFA 2OPQA 3L4IA 2NUBA 3VQBA 4M3YA 1CXQA 3MCPA 4DCHA 3NF6A 4LF8K 2P9PA 2Q31A 3MXJA 3DLBA 3EY1A 1H1VA 4M3ZA 3VTIA 4A2BA 1B9DA 4QS9A 3U9DA 1EWQA 1TK5A 1R0AA 3M8QA 1JLQA 3ASMA 3BZKA 3DLGA 4DS5A 3ID6A 5HBMA 3U6FA 2P9SB 3D45A 5LMNK 5BR9A 4CIFA 3V1OA 1Q18A 4C8LA 4IEEA 4JKCA 2KQ2A 3DLHA 4OKKA 4CGGA 3AVKA 1GLAG 4FCYA 3SNNA 5EY4A 2YV0X 3DI6A 2R7YA 4HTUA 1K6YA 3J7YP 4JI6K 3DRRA 3HOSA 2A42A 4CZLA 3M3ZA 3JAMO 4E19A 3DJCA 4LC9B 4TSXA 3LALA 3C7NB 3FLCO 3ID8A 4CGFA 4B9MA 4DSIA 5GIOA 5AZIB 5TKWA 3OYJA 4OGEA 1S1TA 3AVAA 1UA1A 2GUPA 5ELZA 4M42A 2PFUA 4IJAA 4CJVA 2KHOA 4DQIA 3I8DA 1Z05A 1NNEA 3NCIA 4GKKK 2ITGA 2VQEK 2QM1A 3IG1A 2YKNA 3C94A 3MEEA 3CFRA 4X65K 3SAHA 4DFPA 4YOXA 4CK1A 2WTUA 2CGJA 1YXQA 2E2NA 2FBYA 1BG3A 2DFEA 4KHNA 3CIPA 4IO9L 5LL6Z 2ASPA 3SAFA 5C0YA 2ZGZA 3HSCA 1EX4A 4B08A 2GTDA 5AQTA 1C0MA 4BE2A 3K58A 3SJJA 1NGBA 1TYQB 2Q97A 3VEVA 2E2QA 2P9NB 4JI0K 4CJLA 4DTNA 2DFFA 3AO3A 1S1XA 4XH1A 3MWPA 4FJNA 1GLCG 4B1YB 1JKHA 1VQ8N 3CPEA 4FJIA 3VEXA 3LAMA 3JYTA 1OH7A 2G8KA 1JXBA 4FJ8A 3QESA 1NOZA 2LSNA 4BRLA 4NYFA 2NRRA 3MAQA 1P8ZA 1ZC6A 4UQGA 2PBDA 4CJSA 2P5OA 3VTHA 1U47A 1LW2A 1HNZK 4CF0A 3AVJA 4A57A 4DU3A 5KI6A 3LP1A 1I39A 5HP1A 1YF5L 1QVFM 4DR6K 3CC4N 3QB0A 1QSYA 5GINA 4EFHA 1ESVA 1SKRA 1DLOA 2NLXA 5ADXH 1YT3A 2D0BA 2A1RA 3B8AX 1IBLK 2P9LA 4HTLA 4FJXA 1RDDA 4U7BA 4MDBA 1ATSA 4CJQA 5GIPA 5AQHA 4JRQA 4BE1A 3O80A 2ZJQL 2AJQA 3ENHA 4FLYA 1HNVA 4FM2A 4JN4A 1TAQA 4GMJB 1WOQA 4F9OA 3CCJN 1NKBA 1RTDA 2YNHA 3I55N 2XRIA 4OPHA 1VSHA 3MCAB 1QS4A 3WUHA 2IGIA 4NB4A 3TAQA 2ATQA 5JLHA 1O1WA 1ASUA 1YJ9N 3WQUA 3DRSA 2HB5A 4W5RA 4FL9A 3SBTA 2Q0UA 3OS1A 4CD1A 3HL8A 3M8SA 1YJWN 3OS2A 4OVLA 3V1QA 2UU9K 4FJ7A 3O3FA 3AVFA 3KZBA 1HYVA 4FXDA 2NRTA 3O9UA 3KK3A 4LSLA 4WCEL 1BQNA 4H5VA 4EAHD 4DV7K 3EZWA 4YOTA 3ZYYX 5JVGL 3S9HA 5C25A 1ASVA 3VQ8A 4FZXC 4DTPA 4BG9A 4W5NA 4IG3A 3QEXA 4JKBA 1RT1A 3KIOA 1ZBUA 4FWRA 2KKZA 2B5JA 4CK3A 4GY2B 4WYBA 3O4WA 5HLFA 4JS4A 3EL2A 5C2FA 4BACA 3BF1A 4JD2A 4CJ3A 3HPOA 4NLCA 1YVNA 2HHTA 4GV3A 4FVMA 5F1XA 3F2KA 3M1FA 1TK8A 4AM7A 5C15A 4N5SA 4EP4A 2V7YA 3LAKA 4DV6K 1X9SA 1U2VA 3NGYA 4FK4A 4RW4A 2Q2RA 3KHYA 3KLFA 4BRFA 4X66K 1RBRA 5CR4A 4JD2B 3E1YA 5GADP 4JI8K 1U4BA 3ZSVA 5BN9A 3KJVA 2A5XA 1J6ZA 2KFZA 1N33K 4CF9A 4BR4A 5J2PA 3GOIA 4F2RA 4IOCL 3U8XA 4FPAA 1U2VB 4FWLA 2ZWHA 1IJJA 1W97L 2HNYA 1F21A 1IG8A 1C0UA 3KWIA 2F4VK 3WEEA 2W42A 1VSLA 3UB5A 2QK9A 3K59A 3E01A 3F5TA 4B9SA 2A1SA 1XHZA 3P39A 1GLLO 1WLJA 1VRUA 4FK2A 5BREA 3TR8A 3W0LA 4H5NA 4H5TA 2ASMA 3ZETA 3OYAA 2G8WA 3CCEN 1KVBA 4DLEA 4KAZA 4Z4FA 3SUNA 3RR7A 3SCXA 1HJOA 5HOOA 1YVUA 2RN2A 3CERA 3QLHA 3K57A 2E4LA 1LV5A 1S1UA 4EIAA 3SUQA 2W40A 3VEZA 1HKCA 2DY4A 4FWQA 4WF9L 2GUIA 4RW6A 3DXKB 5TKYA 1K73O 2Q3SA 3SAGA 4BWJA 1IKXA 3DLRA 1IKYA 3LWLA 4H03B 1KVAA 4H0PA 3ZETB 1JLGA 2AA4A 1XUPO 2QWOA 1XNRK 4E0DA 3NBPA 3KD5E 1RT3A 3NF8A 2UYTA 3HI0A 1OVQA 3CCMN 3RTVA 5AQLA 3G6EN 1HQEA 4KO0A 2YHYA 4IOXA 4AM6A 4YHHK 4GW6A 1ASWA 3V9WA 3VQ4A 2FLOA 3CYMA 3FZLA 1LWCA 3VQCA 4QS7A 1NGAA 2P9UA 2IC3A 3TAEA 3VENA 1Z26A 2QW9A 3ITHA 3I0RA 2O8CB 1X3MA 1N6QA 2NNWA 2Q1NA 5AQWA 3G25A 1KLNA 1T05A 4C8KA 2F8SA 2HBKA 1DGKN 3IMXA 2P9IA 3IUCA 2XY5A 3Q7BA 4BRNA 1NLVA 4KH6A 2F9TA 3VQPA 1YI2N 4B9LA 4BRMA 3LDPA 4DTJA 1IG9A 4DF8A 1NK7A 4PWDA 4DUYK 1B9FA 3ZT3A 4CZIA 1WSGA 2F96A 1P90A 3OYDA 2UXBK 2P9IB 4DU1A 1RT7A 1S6QA 4DUZK 5JLFA 2P5GA 4H8KA 3U9ZA 4DSKA 4G1QA 1RDCA 1ILYA 3AGRA 4YOVA 4EZ9A 4LFBK 3H45C 2XY6A 3ZX0A 3K5NA 3HJFA 3WXIA 1HLUA 1W9HA 1N32K 2QWRA 2IVPA 2I7PA 3WNFA 4ID1A 3H3NO 1ATNA 4MLHA 4Z0UA 2ZF5O 5JS1A 3OJUA 3AVGA 1L3SA 3PX4A 4Q0BA 4NYNA 4W5OA 4DF4A 4KHWA 5AQKA 3O5BA 1XMOK 4DS4A 1RDAA 1KVCA 3HVTA 1Q9XA 3HXMA 1NMNA 3MN9A 4AILC 1JLBA 3UKRB 4PKGA 4NXNK 4OLAA 4B3SK 3NDKA 3L6QA 3P5JA 1TUYA 5AQSA 1BWFO 3MXIA 2YHBA 1IH7A 3WNEA 1BIZA 1IO2A 3DAWA 3OYBA 3AVBA 4DQQA 1NU0A 3OY9A 4JAXA 2RF2A 2W41A 1XHXA 2F7TA 3TWHA 1BA0A 4M41A 5AQOA 4ILGB 4MO4A 4CFBA 4LF5K 4FJGA 3WXJA 3ZSQA 1YUWA 4AHCA 3ZEUA 2IVOA 1YJNN 4WQ5C 3EYZA 3F73A 3KVGA 1FW6A 4H0YB 3AGKA 3RSEA 4KHSA 4X62K 3ALYA 4JEPA 1HPZA 4CZEA 1RILA 3VF2A 1NK8A 4B3MK 1T6CA 4K8XA 4CJ7A 4KBOA 4E89A 1QZ6A 1KFSA 4CCHA 4FM1A 3AVMA 1Q9YA 2GWKA 1S72N 2VQFK 3SQ4A 3SBGA 4OKJA 2F8TA 4I6MB 3UIQA 4OPAA 4I7FA 3LP3A 3MN6A 5M1QA 2EHGA 3TU5A 4M3WA 3L3VA 4BDZA 1VQ4N 1DEJA 2Y1JA 1D9DA 3G10A 3ZX3A 1BQMA 1U04A 2Z1JA 4B9TA 3L2VA 2ZJPL 1HNXK 2NRWA 1QSLA 4CK2A 4RW7A 2O8BA 3CM6A 4Y1DA 2E2PA 4WQ5A 2OANA 1NOYA 4EZ6A 4DR7K 1WAJA 3KD1E 3R6MA 3WNHA 3BF3A 3LDQA 4FOEA 2RPIA 3MXMA 3V9ZA 3F9MA 1X9JA 3QERA 3VPZA 2RHKA 3AO2A 4ZTJA 3HM8A 3PSFA 1BO5O 2OTJN 4FOIA 2FBXA 3UKUB 1GLBG 3D2EB 2UXDK 4MLEA 1ZBLA 2QWNA 5T7BA 5AFUA 3DOKA 3K5MA 1RBTA 4B1UB 4CZJA 4R79A 4FLUA 2JGUA 3G0ZA 4JS5A 5BRHA 5BPLA 5AQIA 3DLEA 5KPZA 3JXUA 3TAPA 4OLBA 3E9LA 3QIOA 4BRDA 3J81O 4ZHRA 1XI1A 1S5JA 4F8RA 4Z4GA 4CJ4A 4Y0WA 1D8YA 4PY5A 3AVIA 5BR8K 2QWMA 1S22A 3QO9A 1CLQA 4IG0A 4KTZA 3EE9A 1SL0A 1N36K 4F4KA 4KFBA 2YKMA 3S3OA 3THYB 2WOMA 3BP8A 4K42A 3MEGA 4BVOA 4Z4HA 3QEWA 4JNEA 5J2MA 4KI4A 3QFUA 4J2EA 1J9AA 2FSNA 3KKSA 2X6SA 2P9PB 5HROA 3P38A 2QTDA 1EETA 1JLFA 3VETA 4CZMA 2HW3A 2O8FA 4H0TB 1HPMA 4J2DA 4KH5A 5BN8A 2CH5A 1VSDA 2HF3A 3RVCA 2D0PA 2AP1A 1LAWA 3QDKA 4Z4CA 4CEOA 1RT5A 2O4GA 1GLJO 5C12A 2FF3B 4KB1A 3P83D 3GL1A 3OVNA 2V51B 3CF5L 2NRHA 2O8FB 2QWQA 3MX5A 3DMJA 1RDUA 2A6AA 3SMSA 2I7NA 4CF2A 3CJ7A 4BRQA 4BDYA 4CFDA 5AQPA 1VQLN 1WAFA 4JK8A 3V81A 4CECA 3PIOL 1NK4A 3BY5A 1SL2A 2HNZA 2V7ZA 4KH4A 4BC2A 5SZTA 2IOCA 3QEPA 4JI4K 3HP6A 4O55A 4OPJA 3EO3A 4C1NK 1WSEA 3VEOA 2EWSA 5AQZA 3CC2N 4FWMA 1C1AA 1BDGA 1HYSA 3AA2A 3O4QA 3G4SN 2G8IA 2P9KA 5DMRA 1X3NA 5FROA 4B3TK 3IRXA 1KTQA 4KTWA 3IKMA 4FJKA 4HWIA 1E4GT 4DHYA 4PHTX 4FWPA 4CVNE 4B3RK 4DB3A 3ENOA 4BR9A 2Q0RA 3VQAA 1NGDA 4N76A 1YTUA 4OX9K 5F0XA 4FW2A 4ISFA 4B1XB 4KV8A 3PX6A 4CBWA 3DOLA 3AVNA 3KK1A 4CEZA 5EU7A 3K2PA 1X9MA 4BY9C 2D1KA 3OYHA 1RTHA 1A5WA 2HBLA 3TARA 1VQ9N 3J7AP 1MDUB 3VGMA 1D4XA 3KK2A 1XQSC 1ZBFA 4MO5A 3QBWA 4C1NI 2XHBA 4IDKA 2FSKA 1NM1A 2IVNA 1NMDA 1EQYA 3O6WA 3VQ6A 2KZZA 3O8MA 4DR5K 1LW0A 4JHDA 1UAXA 1WNSA 5AQQA 3NH1A 2OZSA 4Z4EA 3OW2M 4FJMA 3NMUA 5AQMA 3ZT1A 4JI2K 3LM2A 4CEAA 4IFVA 4MQ3A 2VCPA 4B3OA 4FK0A 4ID5A 4AHSA 4AHVA 3PY8A 4AQYK 5KPRA 2P9LB 2PYJA 1Q8IA 4L8RB 4M3RA 1CZAN 4DTRA 4JLHA 4ILHA 4JHDB 5CZ2A 2JLEA 4JI1K 2E2OA 3D2FA 3CFPA 4BR5A 1YIJN 4CGJA 1WSHA 5AZJA 3DYAA 4KREA 3TPQA 2D5RA
chains in the Genus database with same CATH topology
3S3NA 4LY7A 4CESA 2IC3A 1RTIA 1VSIA 1WSFA 1Z26A 3LP0A 3TAEA 4HUEA 5FRNA 3ITHA 3TABA 5KGWA 3I0RA 1N6QA 4M3TA 1UOCA 2QKBA 1KLNA 3OYLA 1T05A 1ITGA 4C8KA 2F8SA 4CEFA 4DSLA 4KRFA 2XY5A 3KLIA 5E41A 2X78A 1C6VA 1T03A 3RMDA 1KRPA 2BE2A 4ELVA 1LWFA 3T1AA 3VQPA 2EX3A 3NH0A 4B9LA 3HM9A 5K14A 2OA8A 3KTQA 2E6LA 2QXFA 4FLTA 4CJWA 2P51A 4DTJA 1IG9A 4N41A 4DF8A 3OYIA 3RMCA 1NK7A 3CG7A 4PWDA 1S1WA 1A5VA 3KKRA 3NH2A 3EZ5A 1NJZA 1B9FA 4N47A 3ZT3A 4B8CA 4E7KA 1TVRA 3M8PA 3RMBA 1WSGA 1XC9A 2F96A 4HUGA 1N5YA 2QKKA 3OYDA 1ZBIA 3BGRA 4DU1A 1Y97A 2OYQA 1RT7A 2O4IA 1S6QA 4AHUA 3V9SA 3OYFA 3RWUA 4FJJA 1TGOA 1JL2A 4CHZA 3ULDA 4RW8A 1RT2A 1HRHA 3C95A 4EP5A 3HSTB 4ICLA 4H8KA 3SUPA 1NK6A 2P5GA 3NFAA 4G1QA 3SUOA 1QTMA 2ZQBA 4DSKA 3PUFA 2PY5A 1RDCA 4B9VA 2ZD1A 3OYNA 3LDSA 1HJRA 4EZ9A 3TAFA 2XY6A 3HO1A 4E7HA 3CM5A 3ZCMA 3K5NA 4FLWA 1L3TA 2PYLA 3HJFA 4CERA 1W9HA 4JRPA 3LANA 3VQ5A 4CGDA 3O4NA 4PA1A 3V9XA 3WNFA 2X6NA 4ID1A 4GVMA 3HT3A 4DTOA 4Z0UA 2BANA 4B9UA 1REVA 5JS1A 1SKSA 3SQ2A 2ETJA 4OKEA 3OJUA 4OPKA 3AVGA 1QQCA 3PX4A 3A2FA 4NYNA 4M45A 1L3SA 4DQRA 4NCBA 4Q0BA 2KW4A 2Z1GA 3LP2A 4W5OA 4DF4A 3PO5A 4KHWA 2BGGA 3CFOA 2YHAA 1HMVA 4DS4A 1RDAA 1KVCA 2XY8A 3HVTA 2KFNA 1Q9XA 3HXMA 3L2QA 4H4MA 4AILC 2ZE2A 1JLBA 1TKZA 3JSMA 1VSFA 3AVHA 4OLAA 3NDKA 3QETA 3QEIA 3P5JA 1J54A 4CHOA 5C24A 3MXIA 2YHBA 3RMAA 3TAGA 5HRRA 2G8FA 3BDPA 1KSPA 1IH7A 3WNEA 5JS2A 1BIZA 1IO2A 1RT6A 3F9KA 1WSIA 5J1EA 3OYBA 1TK0A 3NGIA 1QSSA 3AVBA 1S6PA 4DQQA 4FLZA 1JL1A 3OY9A 3OJSA 3U3YA 4DFKA 3AO5A 3LPTA 3K5OA 4CIEA 4B9NA 4M3UA 2OPQA 5CYMA 2RF2A 4B8AB 1XHXA 2NUBA 2PZSA 3VQBA 4M3YA 1NK5A 1CXQA 3TWHA 3NF6A 1BISA 4O0JA 4M41A 1BI4A 3TANA 3MXJA 3DLBA 4DSEA 4O5BA 4I2PA 4CFBA 4CEEA 3EY1A 2FC0A 2G8VA 4M3ZA 4CHYA 1J5OA 4FJGA 3VQ7A 4LSNA 1RDBA 3WNGA 4CE9A 4DFMA 4HCBA 2HHQA 4CJFA 1B9DA 1TV6A 3ZSQA 4Q5VA 2HVHA 4AHCA 1NJWA 1GOBA 3OYMA 3SV3A 3EYZA 3F73A 1TK5A 1R0AA 3M8QA 4I9LA 1JLQA 3ASMA 3DLGA 3ZSZA 4KI6A 4DS5A 4O0IA 1FKPA 2HHUA 4IFYA 5HBMA 3VN5A 3SYZA 4FZYA 4YFUA 4KHSA 1HNIA 2P1JA 3ALYA 2DFHA 2KTQA 1D5AA 1HPZA 3U6FA 3D45A 4HCCA 3L2UA 1RILA 4I2QA 4C8MA 1NK8A 1BCOA 3FFIA 3H08A 3V1OA 4CIFA 5SWMA 3L3UA 1ZBHA 4C8LA 4K8XA 1GOCA 2KQ2A 4YNQA 5KRSA 4FJLA 4E89A 1TKXA 3DLHA 4QAGA 1KFSA 4CCHA 4OKKA 4CGGA 4FM1A 3AVMA 3AVKA 1Q9YA 1C1BA 4I9QA 3SPYA 4QCLA 4FCYA 1QHTA 1SV5A 4DSFA 3SNNA 2YV0X 3DI6A 3SQ4A 2R7YA 4HTUA 1K6YA 3OS0A 3DRRA 4OKJA 2YNFA 3P1GA 3VQEA 1DTQA 2F8TA 3SZ2A 3UIQA 4CJUA 4LH5A 4R5PA 3AA5X 3VA0A 4I7FA 4FZZA 1W0HA 4E19A 3LP3A 3B6PA 4CGIA 4WE1A 4CF8A 5KTQA 4TSXA 3AO1A 3LALA 4CGFA 4DSIA 3SI6A 4B9MA 2EHGA 3QNNA 4M3WA 3L3VA 3OYJA 4OGEA 1NK0A 1S1TA 3AVAA 4CEBA 3O3GA 4BDZA 3V6DA 1UA1A 2Y1JA 4E3SA 3G10A 1D9DA 4M42A 1JLCA 4DWIA 1BQMA 1U04A 2Z1JA 1KCFA 4CJVA 4DQIA 4M3XA 3NF9A 3I8DA 4B9TA 2B6AA 3L2VA 2Z1HA 3NCIA 1NJYA 1QSLA 1WSJA 2ITGA 4CK2A 4RW7A 3CM6A 4Y1DA 2B4JA 3LZIA 1KLMA 3IG1A 2YKNA 1FK9A 2IDOA 3C94A 3MEEA 3CFRA 1NOYA 4EZ6A 1WAJA 2OPRA 4FM0A 1UWBA 3KD1E 3V9UA 3NGZA 3TI0A 3WNHA 3S3MA 3O3HA 1X1PA 4DFPA 4CK1A 3MEDA 1XWLA 2VG5A 2RPIA 3L2WA 3MXMA 3V9ZA 2FBYA 2G8HA 4BDPA 3QERA 1RBUA 3AO2A 4ZTJA 2DFEA 4FJHA 4KHNA 1J53A 1VSKA 3HYFA 4E7JA 1CZ9A 4DTUA 2FBXA 1T7PA 4IKFA 1MU2A 1B92A 1RTJA 3T3FA 1ZBLA 4O4GA 1L5UA 3CQ8A 1EX4A 1G15A 3AO4A 4B08A 5CZ1A 5T7BA 3DOKA 1RNHA 1C0MA 3V1RA 4BE2A 1U49A 3K58A 4CJTA 3K5MA 1RBTA 1L3UA 3ISNC 2XY7A 4FLUA 3SJJA 3MECA 4FJ5A 4OJRA 2JGUA 2OPPA 3G0ZA 4CFCA 4JS5A 1U48A 3TAMA 2HHSA 4CJLA 4DTNA 3DLEA 2DFFA 3AO3A 3TAPA 1CZBA 1S1XA 5DK5A 3KLGA 4OLBA 3QIOA 2FBTA 2HHWA 1SUQA 4FJNA 4ZHRA 1XI1A 3SV4A 1S5JA 1CXUA 3KLHA 1JKHA 1RT4A 4F8RA 4Z4GA 4Z4IA 4CJ4A 4HHTA 1D8YA 4FJIA 3LAMA 4PY5A 4IBNA 3JYTA 3AVIA 1X9WA 2G8KA 1JXBA 3VQ9A 4FJ8A 1VSJA 3QESA 1NOZA 2LSNA 3QO9A 3QINA 4NYFA 4CEDA 3MAQA 1CLQA 3ZSYA 4UQGA 2G8UA 4IG0A 4CJSA 2P5OA 1U47A 4KTZA 1LW2A 1SL0A 4CF0A 3AVJA 3C6TA 2BDPA 4DU3A 1EP4A 3LP1A 3AA3A 5KI6A 2HHXA 1I39A 2IS3A 4F4KA 4KTQA 4KFBA 5HP1A 4KHYA 3NE6A 1TKTA 3PX0A 2YKMA 4DTSA 4ELUA 3S3OA 1QSYA 2OPSA 1SKRA 2WOMA 1DLOA 4Y1CA 3I0SA 3L2RA 4NCAA 5KGXA 3MEGA 3LWMA 1YT3A 1EKEA 4Z4HA 2D0BA 3QEWA 2A1RA 1D9FA 1BIUA 5CYQA 1SL1A 4FJXA 5J2MA 4KI4A 1RDDA 4CJPA 3VA3A 2DTUA 1NJXA 3RRGA 4J2EA 4CJQA 1J9AA 4AH9A 4JRQA 3B6OA 5HRNA 4BE1A 2FBVA 1NKEA 1DTTA 3KKSA 4CJKA 1L3VA 4CHNA 2OZMA 2X6SA 5FDLA 5HROA 1BI4B 2AJQA 4FLYA 1HNVA 1EETA 4DTXA 4FM2A 1BGXT 3PO4A 1JLFA 3ZT0A 1TAQA 1FXXA 3M8RA 4GMJB 4DTMA 2HW3A 4HUFA 4AHRA 1NKBA 1RTDA 2YNHA 4CJ5A 4J2DA 4DLGA 4C8NA 2XRIA 4E7LA 1C1CA 1VSDA 3SPZA 5I42A 1VSHA 2E6MA 3HP9A 1QS4A 2IGIA 1LAWA 5HRSA 3TAQA 2ATQA 4Z4CA 4CEOA 1RT5A 1O1WA 1JLEA 1ASUA 1VSMA 2O4GA 5HRPA 2HNDA 4CJRA 4DFJA 3THVA 3DRSA 4KB1A 2HB5A 4W5RA 3P83D 3OVNA 1BHLA 3AVLA 3OS1A 5D3GA 3HL8A 3M8SA 4FLXA 5I3UA 3OS2A 3QIPA 5KRTA 4OVLA 3V1QA 3V4IA 1A5XA 4FJ7A 4KHQA 1BL3A 3DMJA 3O3FA 3AVFA 4DSJA 4E1NA 1HYVA 4FXDA 1FKOA 3KK3A 4N56A 3ZSXA 4LSLA 4E7IA 2X74A 4CF2A 1BQNA 4BDYA 1T8EA 5J2QA 4CHQA 1EXQA 3OYCA 4FLVA 4CFDA 3RR8A 1VSEA 1WAFA 2IAJA 2VG6A 4RG8A 3S9HA 5CY4A 4LD0A 2Y1IA 4AHTA 3V81A 4J2BA 5C25A 1ASVA 3VQ8A 4FZXC 3DRPA 4CECA 4FJ9A 4HVJA 3D0PA 4DTPA 5C42A 4W5NA 4IG3A 3QEXA 1RT1A 3NAEA 3KIOA 4J2AA 1NK4A 4H4OA 1ZBUA 1SL2A 2HNZA 4NCGA 4FYDA 4CGHA 2B5JA 1BCMA 4CK3A 1HQUA 5SZTA 2IOCA 5HLFA 3L8BA 1JLAA 4JS4A 3QEPA 3HP6A 4BACA 4CJ3A 4O55A 3U3GA 4OPJA 3HPOA 3QEVA 2HHTA 2Z1IA 4FVMA 1WSEA 4O44A 1WN7A 3HVRA 1TK8A 2YNIA 4N5SA 4EP4A 1C1AA 1VRTA 3LAKA 4CF1A 1TAUA 3NHGA 1HYSA 3AA2A 4PUOA 3O4QA 1X9SA 3LZJA 3NGYA 4FK4A 4RW4A 2XO7A 2G8IA 1TL3A 5DMRA 3KLFA 1NK9A 4CEQA 5FROA 4W5QA 3IRXA 1KTQA 1RBRA 1IKWA 4KTWA 1ZYQA 4QOZB 4PQUA 4FJKA 2HMIA 1U4BA 3ZSVA 3OYKA 3PV8A 5FRMA 4DU4A 3KJVA 1QE1A 4BWMA 2KFZA 4RW9A 3VQQA 4CF9A 5J2PA 4CIGA 1RCHA 4F2RA 3VQAA 4DMNA 4N76A 4LH4A 2HNYA 1YTUA 4K8ZA 1F21A 3HPGA 2WONA 1C0UA 4FW2A 3ZT4A 3NF7A 4F2SA 4KV8A 1TKDA 2W42A 1VSLA 3RRHA 3PX6A 1I3AA 1RBVA 3K59A 2QK9A 1VK0A 3AVCA 3OYGA 4MFBA 4F3OA 3E01A 3DOLA 3AVNA 4DG1A 4CEZA 2A1SA 3KK1A 5EU7A 4B9SA 3K2PA 1X9MA 1XHZA 3OYHA 1WLJA 1VRUA 2RKIA 4FK2A 1RTHA 1A5WA 3TR8A 3OYAA 1SKWA 3TARA 2G8WA 4KAZA 1KVBA 4CFAA 4DLEA 1IKVA 4CHPA 4Z4FA 3SUNA 1NKCA 3RR7A 3SCXA 2VG7A 3AA4A 3KK2A 2D0CA 3T19A 2HVIA 3ZSOA 3ZT2A 1YVUA 2RN2A 1ZBFA 3QLHA 3K57A 2VWJA 3IAYA 2E4LA 2XHBA 1S1UA 1LV5A 4IDKA 3SUQA 3SQ0A 4KB0A 4F3TA 2DY4A 2VWKA 3DLKA 4FW1A 2GUIA 1Z25A 3IS9A 4RW6A 4DQSA 3DM2A 3ZSWA 2D0AA 3VQ6A 2KZZA 1HYZA 2Q3SA 3C6UA 1LW0A 1IKXA 1C0TA 4BWJA 1UAXA 3VQDA 1WNSA 3DLRA 4KPYA 2HHVA 1IKYA 4ZTFA 4DQPA 3NH1A 2OZSA 4KHUA 3LWLA 4Z4EA 4FJMA 1KVAA 4KKOA 1JLGA 3ZT1A 4BE0A 4CEAA 4IFVA 4E0DA 3NBPA 4MQ3A 3KD5E 1RT3A 4B3OA 3ZSRA 4FK0A 4ID5A 2I5JA 4AHSA 4AHVA 3PY8A 3NF8A 3HK2A 3KLEA 1S9GA 2PYJA 2GV9A 3RTVA 1U45A 1Q8IA 1GOAA 4L8RB 4M3RA 4E1MA 3QNOA 3LPUA 1UA0A 4DTRA 4JLHA 1KFDA 1HQEA 1TL1A 4KO0A 3OYEA 4C8OA 4CJEA 1S1VA 1S9EA 5CZ2A 2JLEA 1JXEA 3HPHA 4GW6A 1ASWA 3V9WA 1LWEA 2YNGA 3CYMA 4OGCA 1RBSA 3VQ4A 4XIUA 1YTAA 3K5LA 4W5TA 3CFPA 4CGJA 1WSHA 5J2NA 1LWCA 3VQCA 2KZMA 3AV9A 3SQ1A 3DYAA 4ELTA 4KREA 1LAVA 2GBZA 2D5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S3N A;  4LY7 A;  4CES A;  2IC3 A;  1RTI A;  1VSI A;  1WSF A;  1Z26 A;  3LP0 A;  3TAE A;  4HUE A;  5FRN A;  3ITH A;  3TAB A;  5KGW A;  3I0R A;  1N6Q A;  4M3T A;  1UOC A;  2QKB A;  1KLN A;  3OYL A;  1T05 A;  1ITG A;  4C8K A;  2F8S A;  4CEF A;  4DSL A;  4KRF A;  2XY5 A;  3KLI A;  5E41 A;  2X78 A;  1C6V A;  1T03 A;  3RMD A;  1KRP A;  2BE2 A;  4ELV A;  1LWF A;  3T1A A;  3VQP A;  2EX3 A;  3NH0 A;  4B9L A;  3HM9 A;  5K14 A;  2OA8 A;  3KTQ A;  2E6L A;  2QXF A;  4FLT A;  4CJW A;  2P51 A;  4DTJ A;  1IG9 A;  4N41 A;  4DF8 A;  3OYI A;  3RMC A;  1NK7 A;  3CG7 A;  4PWD A;  1S1W A;  1A5V A;  3KKR A;  3NH2 A;  3EZ5 A;  1NJZ A;  1B9F A;  4N47 A;  3ZT3 A;  4B8C A;  4E7K A;  1TVR A;  3M8P A;  3RMB A;  1WSG A;  1XC9 A;  2F96 A;  4HUG A;  1N5Y A;  2QKK A;  3OYD A;  1ZBI A;  3BGR A;  4DU1 A;  1Y97 A;  2OYQ A;  1RT7 A;  2O4I A;  1S6Q A;  4AHU A;  3V9S A;  3OYF A;  3RWU A;  4FJJ A;  1TGO A;  1JL2 A;  4CHZ A;  3ULD A;  4RW8 A;  1RT2 A;  1HRH A;  3C95 A;  4EP5 A;  3HST B;  4ICL A;  4H8K A;  3SUP A;  1NK6 A;  2P5G A;  3NFA A;  4G1Q A;  3SUO A;  1QTM A;  2ZQB A;  4DSK A;  3PUF A;  2PY5 A;  1RDC A;  4B9V A;  2ZD1 A;  3OYN A;  3LDS A;  1HJR A;  4EZ9 A;  3TAF A;  2XY6 A;  3HO1 A;  4E7H A;  3CM5 A;  3ZCM A;  3K5N A;  4FLW A;  1L3T A;  2PYL A;  3HJF A;  4CER A;  1W9H A;  4JRP A;  3LAN A;  3VQ5 A;  4CGD A;  3O4N A;  4PA1 A;  3V9X A;  3WNF A;  2X6N A;  4ID1 A;  4GVM A;  3HT3 A;  4DTO A;  4Z0U A;  2BAN A;  4B9U A;  1REV A;  5JS1 A;  1SKS A;  3SQ2 A;  2ETJ A;  4OKE A;  3OJU A;  4OPK A;  3AVG A;  1QQC A;  3PX4 A;  3A2F A;  4NYN A;  4M45 A;  1L3S A;  4DQR A;  4NCB A;  4Q0B A;  2KW4 A;  2Z1G A;  3LP2 A;  4W5O A;  4DF4 A;  3PO5 A;  4KHW A;  2BGG A;  3CFO A;  2YHA A;  1HMV A;  4DS4 A;  1RDA A;  1KVC A;  2XY8 A;  3HVT A;  2KFN A;  1Q9X A;  3HXM A;  3L2Q A;  4H4M A;  4AIL C;  2ZE2 A;  1JLB A;  1TKZ A;  3JSM A;  1VSF A;  3AVH A;  4OLA A;  3NDK A;  3QET A;  3QEI A;  3P5J A;  1J54 A;  4CHO A;  5C24 A;  3MXI A;  2YHB A;  3RMA A;  3TAG A;  5HRR A;  2G8F A;  3BDP A;  1KSP A;  1IH7 A;  3WNE A;  5JS2 A;  1BIZ A;  1IO2 A;  1RT6 A;  3F9K A;  1WSI A;  5J1E A;  3OYB A;  1TK0 A;  3NGI A;  1QSS A;  3AVB A;  1S6P A;  4DQQ A;  4FLZ A;  1JL1 A;  3OY9 A;  3OJS A;  3U3Y A;  4DFK A;  3AO5 A;  3LPT A;  3K5O A;  4CIE A;  4B9N A;  4M3U A;  2OPQ A;  5CYM A;  2RF2 A;  4B8A B;  1XHX A;  2NUB A;  2PZS A;  3VQB A;  4M3Y A;  1NK5 A;  1CXQ A;  3TWH A;  3NF6 A;  1BIS A;  4O0J A;  4M41 A;  1BI4 A;  3TAN A;  3MXJ A;  3DLB A;  4DSE A;  4O5B A;  4I2P A;  4CFB A;  4CEE A;  3EY1 A;  2FC0 A;  2G8V A;  4M3Z A;  4CHY A;  1J5O A;  4FJG A;  3VQ7 A;  4LSN A;  1RDB A;  3WNG A;  4CE9 A;  4DFM A;  4HCB A;  2HHQ A;  4CJF A;  1B9D A;  1TV6 A;  3ZSQ A;  4Q5V A;  2HVH A;  4AHC A;  1NJW A;  1GOB A;  3OYM A;  3SV3 A;  3EYZ A;  3F73 A;  1TK5 A;  1R0A A;  3M8Q A;  4I9L A;  1JLQ A;  3ASM A;  3DLG A;  3ZSZ A;  4KI6 A;  4DS5 A;  4O0I A;  1FKP A;  2HHU A;  4IFY A;  5HBM A;  3VN5 A;  3SYZ A;  4FZY A;  4YFU A;  4KHS A;  1HNI A;  2P1J A;  3ALY A;  2DFH A;  2KTQ A;  1D5A A;  1HPZ A;  3U6F A;  3D45 A;  4HCC A;  3L2U A;  1RIL A;  4I2Q A;  4C8M A;  1NK8 A;  1BCO A;  3FFI A;  3H08 A;  3V1O A;  4CIF A;  5SWM A;  3L3U A;  1ZBH A;  4C8L A;  4K8X A;  1GOC A;  2KQ2 A;  4YNQ A;  5KRS A;  4FJL A;  4E89 A;  1TKX A;  3DLH A;  4QAG A;  1KFS A;  4CCH A;  4OKK A;  4CGG A;  4FM1 A;  3AVM A;  3AVK A;  1Q9Y A;  1C1B A;  4I9Q A;  3SPY A;  4QCL A;  4FCY A;  1QHT A;  1SV5 A;  4DSF A;  3SNN A;  2YV0 X;  3DI6 A;  3SQ4 A;  2R7Y A;  4HTU A;  1K6Y A;  3OS0 A;  3DRR A;  4OKJ A;  2YNF A;  3P1G A;  3VQE A;  1DTQ A;  2F8T A;  3SZ2 A;  3UIQ A;  4CJU A;  4LH5 A;  4R5P A;  3AA5 X;  3VA0 A;  4I7F A;  4FZZ A;  1W0H A;  4E19 A;  3LP3 A;  3B6P A;  4CGI A;  4WE1 A;  4CF8 A;  5KTQ A;  4TSX A;  3AO1 A;  3LAL A;  4CGF A;  4DSI A;  3SI6 A;  4B9M A;  2EHG A;  3QNN A;  4M3W A;  3L3V A;  3OYJ A;  4OGE A;  1NK0 A;  1S1T A;  3AVA A;  4CEB A;  3O3G A;  4BDZ A;  3V6D A;  1UA1 A;  2Y1J A;  4E3S A;  3G10 A;  1D9D A;  4M42 A;  1JLC A;  4DWI A;  1BQM A;  1U04 A;  2Z1J A;  1KCF A;  4CJV A;  4DQI A;  4M3X A;  3NF9 A;  3I8D A;  4B9T A;  2B6A A;  3L2V A;  2Z1H A;  3NCI A;  1NJY A;  1QSL A;  1WSJ A;  2ITG A;  4CK2 A;  4RW7 A;  3CM6 A;  4Y1D A;  2B4J A;  3LZI A;  1KLM A;  3IG1 A;  2YKN A;  1FK9 A;  2IDO A;  3C94 A;  3MEE A;  3CFR A;  1NOY A;  4EZ6 A;  1WAJ A;  2OPR A;  4FM0 A;  1UWB A;  3KD1 E;  3V9U A;  3NGZ A;  3TI0 A;  3WNH A;  3S3M A;  3O3H A;  1X1P A;  4DFP A;  4CK1 A;  3MED A;  1XWL A;  2VG5 A;  2RPI A;  3L2W A;  3MXM A;  3V9Z A;  2FBY A;  2G8H A;  4BDP A;  3QER A;  1RBU A;  3AO2 A;  4ZTJ A;  2DFE A;  4FJH A;  4KHN A;  1J53 A;  1VSK A;  3HYF A;  4E7J A;  1CZ9 A;  4DTU A;  2FBX A;  1T7P A;  4IKF A;  1MU2 A;  1B92 A;  1RTJ A;  3T3F A;  1ZBL A;  4O4G A;  1L5U A;  3CQ8 A;  1EX4 A;  1G15 A;  3AO4 A;  4B08 A;  5CZ1 A;  5T7B A;  3DOK A;  1RNH A;  1C0M A;  3V1R A;  4BE2 A;  1U49 A;  3K58 A;  4CJT A;  3K5M A;  1RBT A;  1L3U A;  3ISN C;  2XY7 A;  4FLU A;  3SJJ A;  3MEC A;  4FJ5 A;  4OJR A;  2JGU A;  2OPP A;  3G0Z A;  4CFC A;  4JS5 A;  1U48 A;  3TAM A;  2HHS A;  4CJL A;  4DTN A;  3DLE A;  2DFF A;  3AO3 A;  3TAP A;  1CZB A;  1S1X A;  5DK5 A;  3KLG A;  4OLB A;  3QIO A;  2FBT A;  2HHW A;  1SUQ A;  4FJN A;  4ZHR A;  1XI1 A;  3SV4 A;  1S5J A;  1CXU A;  3KLH A;  1JKH A;  1RT4 A;  4F8R A;  4Z4G A;  4Z4I A;  4CJ4 A;  4HHT A;  1D8Y A;  4FJI A;  3LAM A;  4PY5 A;  4IBN A;  3JYT A;  3AVI A;  1X9W A;  2G8K A;  1JXB A;  3VQ9 A;  4FJ8 A;  1VSJ A;  3QES A;  1NOZ A;  2LSN A;  3QO9 A;  3QIN A;  4NYF A;  4CED A;  3MAQ A;  1CLQ A;  3ZSY A;  4UQG A;  2G8U A;  4IG0 A;  4CJS A;  2P5O A;  1U47 A;  4KTZ A;  1LW2 A;  1SL0 A;  4CF0 A;  3AVJ A;  3C6T A;  2BDP A;  4DU3 A;  1EP4 A;  3LP1 A;  3AA3 A;  5KI6 A;  2HHX A;  1I39 A;  2IS3 A;  4F4K A;  4KTQ A;  4KFB A;  5HP1 A;  4KHY A;  3NE6 A;  1TKT A;  3PX0 A;  2YKM A;  4DTS A;  4ELU A;  3S3O A;  1QSY A;  2OPS A;  1SKR A;  2WOM A;  1DLO A;  4Y1C A;  3I0S A;  3L2R A;  4NCA A;  5KGX A;  3MEG A;  3LWM A;  1YT3 A;  1EKE A;  4Z4H A;  2D0B A;  3QEW A;  2A1R A;  1D9F A;  1BIU A;  5CYQ A;  1SL1 A;  4FJX A;  5J2M A;  4KI4 A;  1RDD A;  4CJP A;  3VA3 A;  2DTU A;  1NJX A;  3RRG A;  4J2E A;  4CJQ A;  1J9A A;  4AH9 A;  4JRQ A;  3B6O A;  5HRN A;  4BE1 A;  2FBV A;  1NKE A;  1DTT A;  3KKS A;  4CJK A;  1L3V A;  4CHN A;  2OZM A;  2X6S A;  5FDL A;  5HRO A;  1BI4 B;  2AJQ A;  4FLY A;  1HNV A;  1EET A;  4DTX A;  4FM2 A;  1BGX T;  3PO4 A;  1JLF A;  3ZT0 A;  1TAQ A;  1FXX A;  3M8R A;  4GMJ B;  4DTM A;  2HW3 A;  4HUF A;  4AHR A;  1NKB A;  1RTD A;  2YNH A;  4CJ5 A;  4J2D A;  4DLG A;  4C8N A;  2XRI A;  4E7L A;  1C1C A;  1VSD A;  3SPZ A;  5I42 A;  1VSH A;  2E6M A;  3HP9 A;  1QS4 A;  2IGI A;  1LAW A;  5HRS A;  3TAQ A;  2ATQ A;  4Z4C A;  4CEO A;  1RT5 A;  1O1W A;  1JLE A;  1ASU A;  1VSM A;  2O4G A;  5HRP A;  2HND A;  4CJR A;  4DFJ A;  3THV A;  3DRS A;  4KB1 A;  2HB5 A;  4W5R A;  3P83 D;  3OVN A;  1BHL A;  3AVL A;  3OS1 A;  5D3G A;  3HL8 A;  3M8S A;  4FLX A;  5I3U A;  3OS2 A;  3QIP A;  5KRT A;  4OVL A;  3V1Q A;  3V4I A;  1A5X A;  4FJ7 A;  4KHQ A;  1BL3 A;  3DMJ A;  3O3F A;  3AVF A;  4DSJ A;  4E1N A;  1HYV A;  4FXD A;  1FKO A;  3KK3 A;  4N56 A;  3ZSX A;  4LSL A;  4E7I A;  2X74 A;  4CF2 A;  1BQN A;  4BDY A;  1T8E A;  5J2Q A;  4CHQ A;  1EXQ A;  3OYC A;  4FLV A;  4CFD A;  3RR8 A;  1VSE A;  1WAF A;  2IAJ A;  2VG6 A;  4RG8 A;  3S9H A;  5CY4 A;  4LD0 A;  2Y1I A;  4AHT A;  3V81 A;  4J2B A;  5C25 A;  1ASV A;  3VQ8 A;  4FZX C;  3DRP A;  4CEC A;  4FJ9 A;  4HVJ A;  3D0P A;  4DTP A;  5C42 A;  4W5N A;  4IG3 A;  3QEX A;  1RT1 A;  3NAE A;  3KIO A;  4J2A A;  1NK4 A;  4H4O A;  1ZBU A;  1SL2 A;  2HNZ A;  4NCG A;  4FYD A;  4CGH A;  2B5J A;  1BCM A;  4CK3 A;  1HQU A;  5SZT A;  2IOC A;  5HLF A;  3L8B A;  1JLA A;  4JS4 A;  3QEP A;  3HP6 A;  4BAC A;  4CJ3 A;  4O55 A;  3U3G A;  4OPJ A;  3HPO A;  3QEV A;  2HHT A;  2Z1I A;  4FVM A;  1WSE A;  4O44 A;  1WN7 A;  3HVR A;  1TK8 A;  2YNI A;  4N5S A;  4EP4 A;  1C1A A;  1VRT A;  3LAK A;  4CF1 A;  1TAU A;  3NHG A;  1HYS A;  3AA2 A;  4PUO A;  3O4Q A;  1X9S A;  3LZJ A;  3NGY A;  4FK4 A;  4RW4 A;  2XO7 A;  2G8I A;  1TL3 A;  5DMR A;  3KLF A;  1NK9 A;  4CEQ A;  5FRO A;  4W5Q A;  3IRX A;  1KTQ A;  1RBR A;  1IKW A;  4KTW A;  1ZYQ A;  4QOZ B;  4PQU A;  4FJK A;  2HMI A;  1U4B A;  3ZSV A;  3OYK A;  3PV8 A;  5FRM A;  4DU4 A;  3KJV A;  1QE1 A;  4BWM A;  2KFZ A;  4RW9 A;  3VQQ A;  4CF9 A;  5J2P A;  4CIG A;  1RCH A;  4F2R A;  3VQA A;  4DMN A;  4N76 A;  4LH4 A;  2HNY A;  1YTU A;  4K8Z A;  1F21 A;  3HPG A;  2WON A;  1C0U A;  4FW2 A;  3ZT4 A;  3NF7 A;  4F2S A;  4KV8 A;  1TKD A;  2W42 A;  1VSL A;  3RRH A;  3PX6 A;  1I3A A;  1RBV A;  3K59 A;  2QK9 A;  1VK0 A;  3AVC A;  3OYG A;  4MFB A;  4F3O A;  3E01 A;  3DOL A;  3AVN A;  4DG1 A;  4CEZ A;  2A1S A;  3KK1 A;  5EU7 A;  4B9S A;  3K2P A;  1X9M A;  1XHZ A;  3OYH A;  1WLJ A;  1VRU A;  2RKI A;  4FK2 A;  1RTH A;  1A5W A;  3TR8 A;  3OYA A;  1SKW A;  3TAR A;  2G8W A;  4KAZ A;  1KVB A;  4CFA A;  4DLE A;  1IKV A;  4CHP A;  4Z4F A;  3SUN A;  1NKC A;  3RR7 A;  3SCX A;  2VG7 A;  3AA4 A;  3KK2 A;  2D0C A;  3T19 A;  2HVI A;  3ZSO A;  3ZT2 A;  1YVU A;  2RN2 A;  1ZBF A;  3QLH A;  3K57 A;  2VWJ A;  3IAY A;  2E4L A;  2XHB A;  1S1U A;  1LV5 A;  4IDK A;  3SUQ A;  3SQ0 A;  4KB0 A;  4F3T A;  2DY4 A;  2VWK A;  3DLK A;  4FW1 A;  2GUI A;  1Z25 A;  3IS9 A;  4RW6 A;  4DQS A;  3DM2 A;  3ZSW A;  2D0A A;  3VQ6 A;  2KZZ A;  1HYZ A;  2Q3S A;  3C6U A;  1LW0 A;  1IKX A;  1C0T A;  4BWJ A;  1UAX A;  3VQD A;  1WNS A;  3DLR A;  4KPY A;  2HHV A;  1IKY A;  4ZTF A;  4DQP A;  3NH1 A;  2OZS A;  4KHU A;  3LWL A;  4Z4E A;  4FJM A;  1KVA A;  4KKO A;  1JLG A;  3ZT1 A;  4BE0 A;  4CEA A;  4IFV A;  4E0D A;  3NBP A;  4MQ3 A;  3KD5 E;  1RT3 A;  4B3O A;  3ZSR A;  4FK0 A;  4ID5 A;  2I5J A;  4AHS A;  4AHV A;  3PY8 A;  3NF8 A;  3HK2 A;  3KLE A;  1S9G A;  2PYJ A;  2GV9 A;  3RTV A;  1U45 A;  1Q8I A;  1GOA A;  4L8R B;  4M3R A;  4E1M A;  3QNO A;  3LPU A;  1UA0 A;  4DTR A;  4JLH A;  1KFD A;  1HQE A;  1TL1 A;  4KO0 A;  3OYE A;  4C8O A;  4CJE A;  1S1V A;  1S9E A;  5CZ2 A;  2JLE A;  1JXE A;  3HPH A;  4GW6 A;  1ASW A;  3V9W A;  1LWE A;  2YNG A;  3CYM A;  4OGC A;  1RBS A;  3VQ4 A;  4XIU A;  1YTA A;  3K5L A;  4W5T A;  3CFP A;  4CGJ A;  1WSH A;  5J2N A;  1LWC A;  3VQC A;  2KZM A;  3AV9 A;  3SQ1 A;  3DYA A;  4ELT A;  4KRE A;  1LAV A;  2GBZ A;  2D5R A; 
#chains in the Genus database with same CATH topology
 3S3N A;  3LP0 A;  3FZH A;  4HUE A;  5FRN A;  5KGW A;  3D7E O;  4DR1 K;  1UOC A;  1Q7Y O;  2QKB A;  2E1Z A;  1ITG A;  4KRF A;  5AQR A;  5E41 A;  2X78 A;  2BE2 A;  3HRG A;  3T1A A;  3CI5 A;  2HBM A;  4A2A A;  3HM9 A;  5K14 A;  2OA8 A;  2NRZ A;  4BQZ A;  2P51 A;  5E84 A;  1OVY A;  3KKR A;  1A5V A;  3OBY A;  4RTF D;  4M3U A;  4B8C A;  2QKK A;  1TVR A;  4HUG A;  3CC7 N;  1ZBI A;  1Y97 A;  3BUZ B;  3I8B A;  3L0Q A;  1QVG M;  2O4I A;  4DV1 K;  1TGO A;  1RT2 A;  1HRH A;  4ICL A;  4BGB A;  1MA9 B;  1N34 K;  2PY5 A;  4M7X A;  4B9V A;  4BR2 A;  5DM6 L;  4E7H A;  4H5W A;  1L3T A;  3SK3 A;  3LAN A;  4CGD A;  3O4N A;  4BRO A;  2UXC K;  3V9X A;  3HT3 A;  4DTO A;  4RCH A;  2BAN A;  3FFK B;  2ETJ A;  4OPK A;  4NCB A;  4DQR A;  5M1K A;  4JI7 K;  4YY3 K;  1NJI O;  3KWG A;  3J80 O;  2BGG A;  3CFO A;  2YHA A;  2JWK A;  4K41 A;  3A5N C;  4AF1 A;  1V4S A;  3T1Y K;  3E9O A;  2ZE2 A;  2VGN A;  1TKZ A;  3JSM A;  4WQ4 C;  5GAH P;  4CHO A;  5C24 A;  3BDP A;  2PAV A;  1RT6 A;  4KTQ A;  1C0G A;  3WEE B;  3C0B A;  5CYM A;  3N4P A;  4PKI A;  3EEQ A;  1NK5 A;  1VQP N;  1E3M A;  1BIS A;  1HKG A;  1BI4 A;  3TAN A;  4O5B A;  4I2P A;  2O8D A;  4CEE A;  3TSU A;  3CXC M;  2G8V A;  5EX5 A;  4DFM A;  5LJW A;  1NGG A;  3O9T A;  4YOW A;  2H3G X;  3GBT A;  2HVH A;  1GOB A;  2OCE A;  3CJC A;  3OYM A;  2WFB A;  5HL7 L;  4LFC K;  4PL7 A;  3ZLJ A;  4KI6 A;  3DLL L;  1FKP A;  3VN5 A;  3SYZ A;  2KTQ A;  4YFU A;  1KXP A;  2DFH A;  1D5A A;  1KAX A;  3L2U A;  1HKB A;  2GX9 A;  3K9J A;  4LF7 K;  3NVK A;  1ATR A;  1VHX A;  3L3U A;  1ZBH A;  4YNQ A;  1IBK K;  2VYP A;  3O1B A;  1TKX A;  4QAG A;  1QHA A;  4WQ4 A;  3HZ6 A;  4WFB L;  3SPY A;  4QCL A;  3VMF B;  1QHT A;  1SV5 A;  4DSF A;  3OS0 A;  2JWL A;  3P1G A;  3VQE A;  1DTQ A;  3SZ2 A;  1T44 A;  3P31 A;  4DQ8 A;  4FZZ A;  1W0H A;  3THX A;  2A40 A;  3C65 A;  4CGI A;  4WE1 A;  4CF8 A;  4WFN L;  5KTQ A;  3AO1 A;  1BU6 O;  3SI6 A;  3QNN A;  1NK0 A;  4CEB A;  3O3G A;  3H1V X;  2P9U B;  1JLC A;  4JKG A;  4DWI A;  1KCF A;  2B6A A;  1M1K O;  2Z1H A;  1NJY A;  2B4J A;  5AQJ A;  2E8A A;  5ADX A;  2OPR A;  1VAZ A;  3S3M A;  3O3H A;  1X1P A;  1VQN N;  4M63 C;  5B8H A;  2G8H A;  4JKG B;  4BDP A;  2CGL A;  1YAG A;  1J53 A;  4E7J A;  1CZ9 A;  4DTU A;  1T7P A;  4FWS A;  4IKF A;  1MU2 A;  1B92 A;  3T3F A;  1L5U A;  3AO4 A;  1G15 A;  5CZ1 A;  1RNH A;  1U49 A;  1L3U A;  3ATV A;  3ISN C;  4YOU A;  3T1H K;  3IDH A;  1NGE A;  3H3O B;  1GLD G;  1KAZ A;  3CME N;  3TAM A;  4IDH A;  2Q36 A;  2O8E A;  3SV4 A;  1K8K A;  1X9W A;  1VSJ A;  3QIN A;  3O9R A;  2G8U A;  4XH5 A;  2WUS A;  2BDP A;  1EP4 A;  3AA3 A;  2HHX A;  2IS3 A;  3WXL A;  3W3D A;  2UUA K;  3NE6 A;  3MN5 A;  4CW7 B;  4NLB A;  4EHT A;  3PX0 A;  2OPS A;  2QEX N;  3I0S A;  1W7A A;  3EE8 A;  3LWM A;  1EKE A;  5CYQ A;  3R3L A;  3VA3 A;  1NJX A;  3RRG A;  3B6O A;  1NKE A;  4JKD A;  4CJK A;  1L3V A;  1T6D A;  3AAP A;  1NWK A;  4DTX A;  1BGX T;  1NGH A;  3PO4 A;  4BR0 A;  3C6H A;  5AQY A;  1TUU A;  4H0V B;  4DTM A;  1NGF A;  3ZEU B;  4HUF A;  4AHR A;  4IZ9 A;  4DLG A;  4E7L A;  1C1C A;  1KQS M;  2E6M A;  3VGL A;  5H1S Q;  3RSE B;  5HRS A;  1VSM A;  1JLE A;  1IV0 A;  2F9W A;  2HND A;  4CJR A;  3THV A;  5AQX A;  4BVP A;  4BC5 A;  1VQ7 N;  5D3G A;  3SLC A;  5KRT A;  3CCR N;  3E9P A;  3V4I A;  1A5X A;  4KHQ A;  4JV5 K;  1BL3 A;  4FWN A;  4DSJ A;  1HX1 A;  1FKO A;  2VWB A;  4A61 A;  3ZSX A;  4FWK A;  4E7I A;  2X74 A;  1G99 A;  4O5F A;  4CHQ A;  3OYC A;  4FLV A;  1R59 O;  5FPM A;  4BGA A;  1VQ5 N;  1VSE A;  4RG8 A;  4LD0 A;  4J2B A;  4FJ9 A;  1KAY A;  4HVJ A;  5BPN A;  5C42 A;  3D0P A;  1J5E K;  1HNW K;  3CCU N;  4J2A A;  4H4O A;  3QBX A;  3QML A;  4NCG A;  4CGH A;  1HQU A;  1JLA A;  1JCG A;  3T7Z A;  4B1Z A;  3U3G A;  3BEX A;  4H0O A;  4PL8 A;  4O44 A;  1WN7 A;  3HVR A;  2O8B B;  4KHP K;  4CF1 A;  3CCL N;  4DR2 K;  3IFR A;  4PUO A;  3LZJ A;  2XO7 A;  1NGI A;  3CJA A;  4CEQ A;  4W5Q A;  1RFQ A;  1ZYQ A;  4QOZ B;  1GLE G;  3A0I X;  3FZF A;  4G9Z A;  2HMI A;  2YX6 A;  4FO0 A;  3OYK A;  3VEW A;  3PV8 A;  5FRM A;  2FXU A;  3L4Q A;  1NG9 A;  3VQQ A;  2D4W A;  2WON A;  3ZT4 A;  4F2S A;  5BRD A;  3RRH A;  1RBV A;  1VK0 A;  4GVE A;  3MWT A;  4DV5 K;  2RKI A;  2BH1 A;  3HTV A;  1IKV A;  4CHP A;  1NKC A;  2GEM A;  2VG7 A;  3AA4 A;  3CQY A;  2D0C A;  3T19 A;  2HVI A;  3ZSO A;  3ZT2 A;  5LY3 A;  3IAY A;  3DLK A;  4FW1 A;  1Z25 A;  3IS9 A;  4DQS A;  3DM2 A;  2P9S A;  1HYZ A;  3C6U A;  1YHQ N;  4C8O A;  1C0T A;  3AAQ A;  5M1O A;  5FPE A;  2NRV A;  1VQO N;  4BRK A;  3ZSR A;  4IJN A;  2GV9 A;  4E1M A;  4E1J A;  4O8U A;  3LPU A;  1UA0 A;  1KFD A;  1TL1 A;  3Q7C A;  3OYE A;  2ZGY A;  1S1V A;  1S9E A;  3HPH A;  1LWE A;  2YNG A;  4BE0 A;  1RBS A;  3C7N A;  3K5L A;  1YTA A;  3NVM A;  4W5T A;  5AZI A;  3SQ1 A;  2E1Y A;  3WXM B;  4ELT A;  1BOT O;  1LAV A;  1VSI A;  1WSF A;  5KQD A;  3TAB A;  4A59 A;  3OYL A;  4CEF A;  5LJV A;  4JKA A;  3WXK A;  3KLI A;  4ELV A;  1C6V A;  3RMD A;  1LWF A;  3QIC A;  4A5A A;  2E6L A;  2QXF A;  4GNI A;  3TTF A;  1WBB A;  4BG8 A;  4N41 A;  1V4T A;  1S1W A;  3NH2 A;  3CCS N;  4IFE A;  4N47 A;  4E7K A;  1N5Y A;  3BGR A;  2OYQ A;  3V9S A;  4FJJ A;  1SZ2 A;  1JL2 A;  4CHZ A;  3ULD A;  4RW8 A;  1NK6 A;  3C95 A;  4EP5 A;  3NFA A;  1QTM A;  2ZQB A;  2BTF A;  3LDL A;  1TYQ A;  2ZD1 A;  3LDS A;  3TAF A;  3C6A A;  3HO1 A;  2P9N A;  2PYL A;  3A8Y A;  3JS6 A;  4CER A;  4JRP A;  3VQ5 A;  1ZXO A;  1LCU A;  1REV A;  4FSV A;  1SKS A;  4B9U A;  4OKE A;  5MLC Q;  2Z1G A;  4WFA L;  3PO5 A;  2P9K B;  3OBW A;  3L2Q A;  2YHW A;  4H4M A;  1NBW A;  4J8F A;  3BZC A;  1U6Z A;  4JYA K;  3LDO A;  1BUP A;  1HUX A;  2E20 A;  3WT0 A;  1C0F A;  3GDQ A;  3RMA A;  3ZX2 A;  4IO8 A;  2HHH K;  5JS2 A;  4BRH A;  1WSI A;  1QSS A;  1WBD A;  1S6P A;  4FLZ A;  1JL1 A;  3OJS A;  3U3Y A;  5M1F A;  4DFK A;  3AO5 A;  3LPT A;  4CIE A;  2YI1 A;  4B9N A;  5GAG P;  4B8A B;  1LOT B;  2PZS A;  3CMA N;  4CD3 A;  1T3V A;  3CCQ N;  4O0J A;  2GEL A;  4DSE A;  2HF4 A;  5I9E B;  3SJH A;  2FC0 A;  4CHY A;  1J5O A;  3VQ7 A;  4LSN A;  1RDB A;  3WNG A;  4CE9 A;  4HCB A;  2HHQ A;  4CJF A;  1TV6 A;  4Q5V A;  2HST A;  4BQL A;  1NJW A;  5A2Q O;  3LDN A;  3VF4 A;  3O1W A;  3SV3 A;  2QWP A;  4I9L A;  2GWJ A;  3ZSZ A;  2HHU A;  4RWT A;  4O0I A;  4IFY A;  3MDQ A;  1MWM A;  1OH5 A;  4FZY A;  1HNI A;  2P1J A;  5CE3 A;  4HCC A;  5CHI A;  4I2Q A;  4C8M A;  1BCO A;  3FFI A;  3PLA A;  3H08 A;  5SWM A;  1GOC A;  4K25 A;  5KRS A;  2V52 B;  4X64 K;  4FJL A;  3VER A;  4I9Q A;  1C1B A;  4ISG A;  3CJ9 A;  4XEI A;  2YNF A;  1S3X A;  4CJU A;  4LH5 A;  4R5P A;  1Q82 O;  3AA5 X;  3VA0 A;  4BRA A;  3B6P A;  4DR4 K;  3D2F B;  2BUP A;  3E66 A;  5EVZ A;  5AZJ B;  3V6D A;  5AQU A;  5M1P A;  2E5L K;  1Z6R A;  4E3S A;  5AQG A;  2IIR A;  4M3X A;  3NF9 A;  1VQ6 N;  4CZH A;  5AQN A;  1WSJ A;  2VGM A;  4A5B A;  3LZI A;  1KLM A;  4LFA K;  1FK9 A;  2IDO A;  2FSJ A;  5E26 A;  4JKH A;  4DV4 K;  2W6L A;  4BC3 A;  4FM0 A;  1JJ2 M;  1UWB A;  3V9U A;  3NGZ A;  4CBX A;  3TI0 A;  4DR3 K;  3H46 O;  3MED A;  1XWL A;  2VG5 A;  3L2W A;  3O9S A;  1RBU A;  4FJH A;  1VSK A;  3HYF A;  4BRE A;  1RTJ A;  3EN9 A;  3N4Q A;  3OHR A;  4Z94 A;  4O4G A;  3CQ8 A;  3V1R A;  4BC4 A;  4CJT A;  4U67 L;  2XY7 A;  1ZBS A;  3MEC A;  4FJ5 A;  4BRP A;  4OJR A;  2OPP A;  4CFC A;  4V19 S;  1U48 A;  3J7Z O;  2ZJR L;  3ENB A;  2HHS A;  2YCH A;  4C23 A;  1CZB A;  3T69 A;  5DK5 A;  3KLG A;  2FBT A;  2HHW A;  1SUQ A;  1CXU A;  3KLH A;  1RT4 A;  4Z4I A;  4HHT A;  4ILJ A;  4IBN A;  3VOV A;  1I94 K;  3CJ1 A;  3VQ9 A;  1OKJ A;  1K9M O;  5EXW A;  5JIC A;  4CED A;  1O13 A;  1E4F T;  2QA4 N;  4B1W B;  4LF6 K;  3ZSY A;  2QXL A;  4BRC A;  4CZG A;  3FR0 A;  3C6T A;  3PSI A;  1XC3 A;  3VGK A;  3U4L A;  2WBN A;  4KHY A;  5LMU K;  3DXK A;  5JVH L;  1TKT A;  4DTS A;  4BR7 A;  4ELU A;  4Y1C A;  3L2R A;  3G71 N;  5KGX A;  4NCA A;  1EWR A;  1YIT N;  1D9F A;  1VQK N;  1BIU A;  5AQF A;  1DT9 A;  1SL1 A;  3VES A;  4CJP A;  2DTU A;  1XNQ K;  4AH9 A;  5HRN A;  2FBV A;  3EKU A;  3OA9 A;  1DTT A;  2OZM A;  4CHN A;  5FDL A;  4B9Q A;  3H6E A;  1BI4 B;  4GV9 A;  3A5L C;  3H1Q A;  2O8D B;  5BRF A;  5AFU H;  3ULE A;  2UUB K;  3ZT0 A;  1Q81 O;  1FXX A;  3M8R A;  4K0K K;  2J4R A;  3GG4 A;  4M7Y A;  3P4I A;  3MMV A;  4CJ5 A;  3A5O C;  4L3Q A;  4C8N A;  3SPZ A;  3PIP L;  5I42 A;  3HP9 A;  4IEI A;  2O8C A;  1RGI A;  2ASO A;  2HBJ A;  5HRP A;  4K43 A;  3K9K A;  4DFJ A;  4DV3 K;  1HR0 K;  2E88 A;  4GV6 A;  1BHL A;  3ULE B;  3AVL A;  1N8R O;  4FLX A;  5I3U A;  3QIP A;  3QFP A;  4E1N A;  4N56 A;  3A5M C;  2HMP A;  1T8E A;  5J2Q A;  1EXQ A;  3MX2 A;  4DV0 K;  3O9Q A;  2KLA A;  3RR8 A;  2IAJ A;  2VG6 A;  1WB9 A;  5CY4 A;  2Y1I A;  4AHT A;  3THX B;  5IWA K;  3DRP A;  1MWK A;  4IWV A;  1JCF A;  3NAE A;  3CPW M;  2FF6 A;  1BA1 A;  3R9P A;  4FYD A;  1KD1 O;  1BCM A;  2CGK A;  3CD6 N;  3L8B A;  4NXM K;  4NO7 A;  3ATU A;  3FZM A;  1QQO A;  3AY9 A;  3CJB A;  2DPN A;  3QEV A;  2Z1I A;  4H0X B;  4MDA A;  2YNI A;  1TAU A;  1VRT A;  1GLF O;  3NHG A;  4FWO A;  4YOY A;  3AAR A;  1TL3 A;  1NK9 A;  1SAZ A;  1QZ5 A;  2OTL N;  1IBM K;  1IKW A;  4YOR A;  4JI3 K;  4PQU A;  3UKR A;  4JK9 A;  4UY8 O;  5GAE P;  4DU4 A;  1QE1 A;  1Y64 A;  4BWM A;  4RW9 A;  3TSQ A;  1RCH A;  2YJE A;  4CIG A;  2YHX A;  4DMN A;  4LH4 A;  4K8Z A;  3HPG A;  3MN7 A;  3NF7 A;  3HBT A;  1TKD A;  4H5R A;  1I3A A;  4O8K A;  3AVC A;  3OYG A;  4F3O A;  4MFB A;  4DG1 A;  3TTC A;  2O8E B;  4A62 A;  5FPD A;  1SKW A;  4CFA A;  1K8K B;  1SS6 A;  2VWJ A;  1NGJ A;  3OTO K;  3SQ0 A;  4KB0 A;  3J8A A;  4F3T A;  2VWK A;  3DWL A;  5C2D A;  3K0S A;  3ZSW A;  2D0A A;  1W2B M;  2QWL A;  3UE5 A;  3VQD A;  4KPY A;  2HHV A;  4CI6 A;  4ZTF A;  4DQP A;  5FPN A;  4KHU A;  1K8A O;  4KKO A;  5KQ8 A;  2NZT A;  3I56 N;  4B1V A;  2I5J A;  3HK2 A;  3VF6 A;  3KLE A;  1S9G A;  4JI5 K;  1U45 A;  3MK6 A;  1GOA A;  3QNO A;  3TTD A;  5C10 A;  3THW A;  4FVU A;  4I6M A;  4CJE A;  1EO1 A;  1JXE A;  4LF9 K;  3R8E A;  3SMP A;  3WQT A;  4XIU A;  4OGC A;  3S41 A;  4CZF A;  5J2N A;  2KZM A;  3AV9 A;  1Q86 O;  1WUA A;  2GBZ A;  2RE2 A;  4LY7 A;  4CES A;  3CCV N;  1RTI A;  1SQK A;  1QQM A;  2HOE A;  4M3T A;  3THW B;  1JCE A;  4CBU A;  1OH6 A;  1VQM N;  3I33 A;  4DSL A;  2UUC K;  4DKW A;  5KPT A;  1T03 A;  1KRP A;  1DKG D;  5DM7 L;  3GE1 A;  2EX3 A;  3NH0 A;  3KTQ A;  3TSP A;  3DXM A;  5AR0 A;  4FLT A;  4IOA L;  2QI2 A;  4CJW A;  3EKS A;  4LF4 K;  4EHU A;  3RMC A;  3OYI A;  3CG7 A;  1NJZ A;  3EZ5 A;  2D0O A;  3M6G A;  5AJ3 K;  1M90 O;  3M8P A;  3RMB A;  1XC9 A;  3CQX A;  3KK7 A;  3UKU A;  4YDU C;  2WC9 A;  4GKJ K;  3LM9 A;  5M1N A;  3D2E A;  5BPM A;  4AHU A;  3RWU A;  4CZK A;  3OYF A;  4PKH A;  3SUP A;  3HST B;  5FLX O;  1NGC A;  3SUO A;  3CHW A;  3PUF A;  3DXM B;  2W6K A;  3OYN A;  1HJR A;  3FGU A;  1RDW X;  4FPB A;  3CM5 A;  3ZCM A;  4FLW A;  4PA1 A;  5F2R A;  2A41 A;  2X6N A;  5JMV A;  4GVM A;  1KC8 O;  4QS8 A;  3FE1 A;  3VEY A;  5EOY A;  3SQ2 A;  1OH8 A;  1QQC A;  4IXC A;  3A2F A;  4M45 A;  2KW4 A;  3LP2 A;  4JKE A;  5AQV A;  1HMV A;  2XY8 A;  2KFN A;  5IT9 O;  1XMQ K;  3CET A;  2CH6 A;  3D6R A;  2NRX A;  1VSF A;  3AVH A;  4BRI A;  3M5R A;  3QET A;  3QEI A;  1J54 A;  4ISE A;  2YJF A;  3THY A;  3O08 A;  3LL3 A;  2A3Z A;  3TAG A;  5HRR A;  2G8F A;  4XH4 A;  1KSP A;  3FZK A;  5J1E A;  3F9K A;  1TK0 A;  4DV2 K;  1QQN A;  3R1X A;  3NGI A;  4BRG A;  2ZM6 K;  4JK7 A;  4YDU A;  3HOT A;  1FJG K;  3K5O A;  2ITM A;  4OO1 J;  4JKF A;  2OPQ A;  3L4I A;  2NUB A;  3VQB A;  4M3Y A;  1CXQ A;  3MCP A;  4DCH A;  3NF6 A;  4LF8 K;  2P9P A;  2Q31 A;  3MXJ A;  3DLB A;  3EY1 A;  1H1V A;  4M3Z A;  3VTI A;  4A2B A;  1B9D A;  4QS9 A;  3U9D A;  1EWQ A;  1TK5 A;  1R0A A;  3M8Q A;  1JLQ A;  3ASM A;  3BZK A;  3DLG A;  4DS5 A;  3ID6 A;  5HBM A;  3U6F A;  2P9S B;  3D45 A;  5LMN K;  5BR9 A;  4CIF A;  3V1O A;  1Q18 A;  4C8L A;  4IEE A;  4JKC A;  2KQ2 A;  3DLH A;  4OKK A;  4CGG A;  3AVK A;  1GLA G;  4FCY A;  3SNN A;  5EY4 A;  2YV0 X;  3DI6 A;  2R7Y A;  4HTU A;  1K6Y A;  3J7Y P;  4JI6 K;  3DRR A;  3HOS A;  2A42 A;  4CZL A;  3M3Z A;  3JAM O;  4E19 A;  3DJC A;  4LC9 B;  4TSX A;  3LAL A;  3C7N B;  3FLC O;  3ID8 A;  4CGF A;  4B9M A;  4DSI A;  5GIO A;  5AZI B;  5TKW A;  3OYJ A;  4OGE A;  1S1T A;  3AVA A;  1UA1 A;  2GUP A;  5ELZ A;  4M42 A;  2PFU A;  4IJA A;  4CJV A;  2KHO A;  4DQI A;  3I8D A;  1Z05 A;  1NNE A;  3NCI A;  4GKK K;  2ITG A;  2VQE K;  2QM1 A;  3IG1 A;  2YKN A;  3C94 A;  3MEE A;  3CFR A;  4X65 K;  3SAH A;  4DFP A;  4YOX A;  4CK1 A;  2WTU A;  2CGJ A;  1YXQ A;  2E2N A;  2FBY A;  1BG3 A;  2DFE A;  4KHN A;  3CIP A;  4IO9 L;  5LL6 Z;  2ASP A;  3SAF A;  5C0Y A;  2ZGZ A;  3HSC A;  1EX4 A;  4B08 A;  2GTD A;  5AQT A;  1C0M A;  4BE2 A;  3K58 A;  3SJJ A;  1NGB A;  1TYQ B;  2Q97 A;  3VEV A;  2E2Q A;  2P9N B;  4JI0 K;  4CJL A;  4DTN A;  2DFF A;  3AO3 A;  1S1X A;  4XH1 A;  3MWP A;  4FJN A;  1GLC G;  4B1Y B;  1JKH A;  1VQ8 N;  3CPE A;  4FJI A;  3VEX A;  3LAM A;  3JYT A;  1OH7 A;  2G8K A;  1JXB A;  4FJ8 A;  3QES A;  1NOZ A;  2LSN A;  4BRL A;  4NYF A;  2NRR A;  3MAQ A;  1P8Z A;  1ZC6 A;  4UQG A;  2PBD A;  4CJS A;  2P5O A;  3VTH A;  1U47 A;  1LW2 A;  1HNZ K;  4CF0 A;  3AVJ A;  4A57 A;  4DU3 A;  5KI6 A;  3LP1 A;  1I39 A;  5HP1 A;  1YF5 L;  1QVF M;  4DR6 K;  3CC4 N;  3QB0 A;  1QSY A;  5GIN A;  4EFH A;  1ESV A;  1SKR A;  1DLO A;  2NLX A;  5ADX H;  1YT3 A;  2D0B A;  2A1R A;  3B8A X;  1IBL K;  2P9L A;  4HTL A;  4FJX A;  1RDD A;  4U7B A;  4MDB A;  1ATS A;  4CJQ A;  5GIP A;  5AQH A;  4JRQ A;  4BE1 A;  3O80 A;  2ZJQ L;  2AJQ A;  3ENH A;  4FLY A;  1HNV A;  4FM2 A;  4JN4 A;  1TAQ A;  4GMJ B;  1WOQ A;  4F9O A;  3CCJ N;  1NKB A;  1RTD A;  2YNH A;  3I55 N;  2XRI A;  4OPH A;  1VSH A;  3MCA B;  1QS4 A;  3WUH A;  2IGI A;  4NB4 A;  3TAQ A;  2ATQ A;  5JLH A;  1O1W A;  1ASU A;  1YJ9 N;  3WQU A;  3DRS A;  2HB5 A;  4W5R A;  4FL9 A;  3SBT A;  2Q0U A;  3OS1 A;  4CD1 A;  3HL8 A;  3M8S A;  1YJW N;  3OS2 A;  4OVL A;  3V1Q A;  2UU9 K;  4FJ7 A;  3O3F A;  3AVF A;  3KZB A;  1HYV A;  4FXD A;  2NRT A;  3O9U A;  3KK3 A;  4LSL A;  4WCE L;  1BQN A;  4H5V A;  4EAH D;  4DV7 K;  3EZW A;  4YOT A;  3ZYY X;  5JVG L;  3S9H A;  5C25 A;  1ASV A;  3VQ8 A;  4FZX C;  4DTP A;  4BG9 A;  4W5N A;  4IG3 A;  3QEX A;  4JKB A;  1RT1 A;  3KIO A;  1ZBU A;  4FWR A;  2KKZ A;  2B5J A;  4CK3 A;  4GY2 B;  4WYB A;  3O4W A;  5HLF A;  4JS4 A;  3EL2 A;  5C2F A;  4BAC A;  3BF1 A;  4JD2 A;  4CJ3 A;  3HPO A;  4NLC A;  1YVN A;  2HHT A;  4GV3 A;  4FVM A;  5F1X A;  3F2K A;  3M1F A;  1TK8 A;  4AM7 A;  5C15 A;  4N5S A;  4EP4 A;  2V7Y A;  3LAK A;  4DV6 K;  1X9S A;  1U2V A;  3NGY A;  4FK4 A;  4RW4 A;  2Q2R A;  3KHY A;  3KLF A;  4BRF A;  4X66 K;  1RBR A;  5CR4 A;  4JD2 B;  3E1Y A;  5GAD P;  4JI8 K;  1U4B A;  3ZSV A;  5BN9 A;  3KJV A;  2A5X A;  1J6Z A;  2KFZ A;  1N33 K;  4CF9 A;  4BR4 A;  5J2P A;  3GOI A;  4F2R A;  4IOC L;  3U8X A;  4FPA A;  1U2V B;  4FWL A;  2ZWH A;  1IJJ A;  1W97 L;  2HNY A;  1F21 A;  1IG8 A;  1C0U A;  3KWI A;  2F4V K;  3WEE A;  2W42 A;  1VSL A;  3UB5 A;  2QK9 A;  3K59 A;  3E01 A;  3F5T A;  4B9S A;  2A1S A;  1XHZ A;  3P39 A;  1GLL O;  1WLJ A;  1VRU A;  4FK2 A;  5BRE A;  3TR8 A;  3W0L A;  4H5N A;  4H5T A;  2ASM A;  3ZET A;  3OYA A;  2G8W A;  3CCE N;  1KVB A;  4DLE A;  4KAZ A;  4Z4F A;  3SUN A;  3RR7 A;  3SCX A;  1HJO A;  5HOO A;  1YVU A;  2RN2 A;  3CER A;  3QLH A;  3K57 A;  2E4L A;  1LV5 A;  1S1U A;  4EIA A;  3SUQ A;  2W40 A;  3VEZ A;  1HKC A;  2DY4 A;  4FWQ A;  4WF9 L;  2GUI A;  4RW6 A;  3DXK B;  5TKY A;  1K73 O;  2Q3S A;  3SAG A;  4BWJ A;  1IKX A;  3DLR A;  1IKY A;  3LWL A;  4H03 B;  1KVA A;  4H0P A;  3ZET B;  1JLG A;  2AA4 A;  1XUP O;  2QWO A;  1XNR K;  4E0D A;  3NBP A;  3KD5 E;  1RT3 A;  3NF8 A;  2UYT A;  3HI0 A;  1OVQ A;  3CCM N;  3RTV A;  5AQL A;  3G6E N;  1HQE A;  4KO0 A;  2YHY A;  4IOX A;  4AM6 A;  4YHH K;  4GW6 A;  1ASW A;  3V9W A;  3VQ4 A;  2FLO A;  3CYM A;  3FZL A;  1LWC A;  3VQC A;  4QS7 A;  1NGA A;  2P9U A;  2IC3 A;  3TAE A;  3VEN A;  1Z26 A;  2QW9 A;  3ITH A;  3I0R A;  2O8C B;  1X3M A;  1N6Q A;  2NNW A;  2Q1N A;  5AQW A;  3G25 A;  1KLN A;  1T05 A;  4C8K A;  2F8S A;  2HBK A;  1DGK N;  3IMX A;  2P9I A;  3IUC A;  2XY5 A;  3Q7B A;  4BRN A;  1NLV A;  4KH6 A;  2F9T A;  3VQP A;  1YI2 N;  4B9L A;  4BRM A;  3LDP A;  4DTJ A;  1IG9 A;  4DF8 A;  1NK7 A;  4PWD A;  4DUY K;  1B9F A;  3ZT3 A;  4CZI A;  1WSG A;  2F96 A;  1P90 A;  3OYD A;  2UXB K;  2P9I B;  4DU1 A;  1RT7 A;  1S6Q A;  4DUZ K;  5JLF A;  2P5G A;  4H8K A;  3U9Z A;  4DSK A;  4G1Q A;  1RDC A;  1ILY A;  3AGR A;  4YOV A;  4EZ9 A;  4LFB K;  3H45 C;  2XY6 A;  3ZX0 A;  3K5N A;  3HJF A;  3WXI A;  1HLU A;  1W9H A;  1N32 K;  2QWR A;  2IVP A;  2I7P A;  3WNF A;  4ID1 A;  3H3N O;  1ATN A;  4MLH A;  4Z0U A;  2ZF5 O;  5JS1 A;  3OJU A;  3AVG A;  1L3S A;  3PX4 A;  4Q0B A;  4NYN A;  4W5O A;  4DF4 A;  4KHW A;  5AQK A;  3O5B A;  1XMO K;  4DS4 A;  1RDA A;  1KVC A;  3HVT A;  1Q9X A;  3HXM A;  1NMN A;  3MN9 A;  4AIL C;  1JLB A;  3UKR B;  4PKG A;  4NXN K;  4OLA A;  4B3S K;  3NDK A;  3L6Q A;  3P5J A;  1TUY A;  5AQS A;  1BWF O;  3MXI A;  2YHB A;  1IH7 A;  3WNE A;  1BIZ A;  1IO2 A;  3DAW A;  3OYB A;  3AVB A;  4DQQ A;  1NU0 A;  3OY9 A;  4JAX A;  2RF2 A;  2W41 A;  1XHX A;  2F7T A;  3TWH A;  1BA0 A;  4M41 A;  5AQO A;  4ILG B;  4MO4 A;  4CFB A;  4LF5 K;  4FJG A;  3WXJ A;  3ZSQ A;  1YUW A;  4AHC A;  3ZEU A;  2IVO A;  1YJN N;  4WQ5 C;  3EYZ A;  3F73 A;  3KVG A;  1FW6 A;  4H0Y B;  3AGK A;  3RSE A;  4KHS A;  4X62 K;  3ALY A;  4JEP A;  1HPZ A;  4CZE A;  1RIL A;  3VF2 A;  1NK8 A;  4B3M K;  1T6C A;  4K8X A;  4CJ7 A;  4KBO A;  4E89 A;  1QZ6 A;  1KFS A;  4CCH A;  4FM1 A;  3AVM A;  1Q9Y A;  2GWK A;  1S72 N;  2VQF K;  3SQ4 A;  3SBG A;  4OKJ A;  2F8T A;  4I6M B;  3UIQ A;  4OPA A;  4I7F A;  3LP3 A;  3MN6 A;  5M1Q A;  2EHG A;  3TU5 A;  4M3W A;  3L3V A;  4BDZ A;  1VQ4 N;  1DEJ A;  2Y1J A;  1D9D A;  3G10 A;  3ZX3 A;  1BQM A;  1U04 A;  2Z1J A;  4B9T A;  3L2V A;  2ZJP L;  1HNX K;  2NRW A;  1QSL A;  4CK2 A;  4RW7 A;  2O8B A;  3CM6 A;  4Y1D A;  2E2P A;  4WQ5 A;  2OAN A;  1NOY A;  4EZ6 A;  4DR7 K;  1WAJ A;  3KD1 E;  3R6M A;  3WNH A;  3BF3 A;  3LDQ A;  4FOE A;  2RPI A;  3MXM A;  3V9Z A;  3F9M A;  1X9J A;  3QER A;  3VPZ A;  2RHK A;  3AO2 A;  4ZTJ A;  3HM8 A;  3PSF A;  1BO5 O;  2OTJ N;  4FOI A;  2FBX A;  3UKU B;  1GLB G;  3D2E B;  2UXD K;  4MLE A;  1ZBL A;  2QWN A;  5T7B A;  5AFU A;  3DOK A;  3K5M A;  1RBT A;  4B1U B;  4CZJ A;  4R79 A;  4FLU A;  2JGU A;  3G0Z A;  4JS5 A;  5BRH A;  5BPL A;  5AQI A;  3DLE A;  5KPZ A;  3JXU A;  3TAP A;  4OLB A;  3E9L A;  3QIO A;  4BRD A;  3J81 O;  4ZHR A;  1XI1 A;  1S5J A;  4F8R A;  4Z4G A;  4CJ4 A;  4Y0W A;  1D8Y A;  4PY5 A;  3AVI A;  5BR8 K;  2QWM A;  1S22 A;  3QO9 A;  1CLQ A;  4IG0 A;  4KTZ A;  3EE9 A;  1SL0 A;  1N36 K;  4F4K A;  4KFB A;  2YKM A;  3S3O A;  3THY B;  2WOM A;  3BP8 A;  4K42 A;  3MEG A;  4BVO A;  4Z4H A;  3QEW A;  4JNE A;  5J2M A;  4KI4 A;  3QFU A;  4J2E A;  1J9A A;  2FSN A;  3KKS A;  2X6S A;  2P9P B;  5HRO A;  3P38 A;  2QTD A;  1EET A;  1JLF A;  3VET A;  4CZM A;  2HW3 A;  2O8F A;  4H0T B;  1HPM A;  4J2D A;  4KH5 A;  5BN8 A;  2CH5 A;  1VSD A;  2HF3 A;  3RVC A;  2D0P A;  2AP1 A;  1LAW A;  3QDK A;  4Z4C A;  4CEO A;  1RT5 A;  2O4G A;  1GLJ O;  5C12 A;  2FF3 B;  4KB1 A;  3P83 D;  3GL1 A;  3OVN A;  2V51 B;  3CF5 L;  2NRH A;  2O8F B;  2QWQ A;  3MX5 A;  3DMJ A;  1RDU A;  2A6A A;  3SMS A;  2I7N A;  4CF2 A;  3CJ7 A;  4BRQ A;  4BDY A;  4CFD A;  5AQP A;  1VQL N;  1WAF A;  4JK8 A;  3V81 A;  4CEC A;  3PIO L;  1NK4 A;  3BY5 A;  1SL2 A;  2HNZ A;  2V7Z A;  4KH4 A;  4BC2 A;  5SZT A;  2IOC A;  3QEP A;  4JI4 K;  3HP6 A;  4O55 A;  4OPJ A;  3EO3 A;  4C1N K;  1WSE A;  3VEO A;  2EWS A;  5AQZ A;  3CC2 N;  4FWM A;  1C1A A;  1BDG A;  1HYS A;  3AA2 A;  3O4Q A;  3G4S N;  2G8I A;  2P9K A;  5DMR A;  1X3N A;  5FRO A;  4B3T K;  3IRX A;  1KTQ A;  4KTW A;  3IKM A;  4FJK A;  4HWI A;  1E4G T;  4DHY A;  4PHT X;  4FWP A;  4CVN E;  4B3R K;  4DB3 A;  3ENO A;  4BR9 A;  2Q0R A;  3VQA A;  1NGD A;  4N76 A;  1YTU A;  4OX9 K;  5F0X A;  4FW2 A;  4ISF A;  4B1X B;  4KV8 A;  3PX6 A;  4CBW A;  3DOL A;  3AVN A;  3KK1 A;  4CEZ A;  5EU7 A;  3K2P A;  1X9M A;  4BY9 C;  2D1K A;  3OYH A;  1RTH A;  1A5W A;  2HBL A;  3TAR A;  1VQ9 N;  3J7A P;  1MDU B;  3VGM A;  1D4X A;  3KK2 A;  1XQS C;  1ZBF A;  4MO5 A;  3QBW A;  4C1N I;  2XHB A;  4IDK A;  2FSK A;  1NM1 A;  2IVN A;  1NMD A;  1EQY A;  3O6W A;  3VQ6 A;  2KZZ A;  3O8M A;  4DR5 K;  1LW0 A;  4JHD A;  1UAX A;  1WNS A;  5AQQ A;  3NH1 A;  2OZS A;  4Z4E A;  3OW2 M;  4FJM A;  3NMU A;  5AQM A;  3ZT1 A;  4JI2 K;  3LM2 A;  4CEA A;  4IFV A;  4MQ3 A;  2VCP A;  4B3O A;  4FK0 A;  4ID5 A;  4AHS A;  4AHV A;  3PY8 A;  4AQY K;  5KPR A;  2P9L B;  2PYJ A;  1Q8I A;  4L8R B;  4M3R A;  1CZA N;  4DTR A;  4JLH A;  4ILH A;  4JHD B;  5CZ2 A;  2JLE A;  4JI1 K;  2E2O A;  3D2F A;  3CFP A;  4BR5 A;  1YIJ N;  4CGJ A;  1WSH A;  5AZJ A;  3DYA A;  4KRE A;  3TPQ A;  2D5R A; 
#chains in the Genus database with same CATH homology
 3S3N A;  4LY7 A;  4CES A;  2IC3 A;  1RTI A;  1VSI A;  1WSF A;  1Z26 A;  3LP0 A;  3TAE A;  4HUE A;  5FRN A;  3ITH A;  3TAB A;  5KGW A;  3I0R A;  1N6Q A;  4M3T A;  1UOC A;  2QKB A;  1KLN A;  3OYL A;  1T05 A;  1ITG A;  4C8K A;  2F8S A;  4CEF A;  4DSL A;  4KRF A;  2XY5 A;  3KLI A;  5E41 A;  2X78 A;  1C6V A;  1T03 A;  3RMD A;  1KRP A;  2BE2 A;  4ELV A;  1LWF A;  3T1A A;  3VQP A;  2EX3 A;  3NH0 A;  4B9L A;  3HM9 A;  5K14 A;  2OA8 A;  3KTQ A;  2E6L A;  2QXF A;  4FLT A;  4CJW A;  2P51 A;  4DTJ A;  1IG9 A;  4N41 A;  4DF8 A;  3OYI A;  3RMC A;  1NK7 A;  3CG7 A;  4PWD A;  1S1W A;  1A5V A;  3KKR A;  3NH2 A;  3EZ5 A;  1NJZ A;  1B9F A;  4N47 A;  3ZT3 A;  4B8C A;  4E7K A;  1TVR A;  3M8P A;  3RMB A;  1WSG A;  1XC9 A;  2F96 A;  4HUG A;  1N5Y A;  2QKK A;  3OYD A;  1ZBI A;  3BGR A;  4DU1 A;  1Y97 A;  2OYQ A;  1RT7 A;  2O4I A;  1S6Q A;  4AHU A;  3V9S A;  3OYF A;  3RWU A;  4FJJ A;  1TGO A;  1JL2 A;  4CHZ A;  3ULD A;  4RW8 A;  1RT2 A;  1HRH A;  3C95 A;  4EP5 A;  3HST B;  4ICL A;  4H8K A;  3SUP A;  1NK6 A;  2P5G A;  3NFA A;  4G1Q A;  3SUO A;  1QTM A;  2ZQB A;  4DSK A;  3PUF A;  2PY5 A;  1RDC A;  4B9V A;  2ZD1 A;  3OYN A;  3LDS A;  1HJR A;  4EZ9 A;  3TAF A;  2XY6 A;  3HO1 A;  4E7H A;  3CM5 A;  3ZCM A;  3K5N A;  4FLW A;  1L3T A;  2PYL A;  3HJF A;  4CER A;  1W9H A;  4JRP A;  3LAN A;  3VQ5 A;  4CGD A;  3O4N A;  4PA1 A;  3V9X A;  3WNF A;  2X6N A;  4ID1 A;  4GVM A;  3HT3 A;  4DTO A;  4Z0U A;  2BAN A;  4B9U A;  1REV A;  5JS1 A;  1SKS A;  3SQ2 A;  2ETJ A;  4OKE A;  3OJU A;  4OPK A;  3AVG A;  1QQC A;  3PX4 A;  3A2F A;  4NYN A;  4M45 A;  1L3S A;  4DQR A;  4NCB A;  4Q0B A;  2KW4 A;  2Z1G A;  3LP2 A;  4W5O A;  4DF4 A;  3PO5 A;  4KHW A;  2BGG A;  3CFO A;  2YHA A;  1HMV A;  4DS4 A;  1RDA A;  1KVC A;  2XY8 A;  3HVT A;  2KFN A;  1Q9X A;  3HXM A;  3L2Q A;  4H4M A;  4AIL C;  2ZE2 A;  1JLB A;  1TKZ A;  3JSM A;  1VSF A;  3AVH A;  4OLA A;  3NDK A;  3QET A;  3QEI A;  3P5J A;  1J54 A;  4CHO A;  5C24 A;  3MXI A;  2YHB A;  3RMA A;  3TAG A;  5HRR A;  2G8F A;  3BDP A;  1KSP A;  1IH7 A;  3WNE A;  5JS2 A;  1BIZ A;  1IO2 A;  1RT6 A;  3F9K A;  1WSI A;  5J1E A;  3OYB A;  1TK0 A;  3NGI A;  1QSS A;  3AVB A;  1S6P A;  4DQQ A;  4FLZ A;  1JL1 A;  3OY9 A;  3OJS A;  3U3Y A;  4DFK A;  3AO5 A;  3LPT A;  3K5O A;  4CIE A;  4B9N A;  4M3U A;  2OPQ A;  5CYM A;  2RF2 A;  4B8A B;  1XHX A;  2NUB A;  2PZS A;  3VQB A;  4M3Y A;  1NK5 A;  1CXQ A;  3TWH A;  3NF6 A;  1BIS A;  4O0J A;  4M41 A;  1BI4 A;  3TAN A;  3MXJ A;  3DLB A;  4DSE A;  4O5B A;  4I2P A;  4CFB A;  4CEE A;  3EY1 A;  2FC0 A;  2G8V A;  4M3Z A;  4CHY A;  1J5O A;  4FJG A;  3VQ7 A;  4LSN A;  1RDB A;  3WNG A;  4CE9 A;  4DFM A;  4HCB A;  2HHQ A;  4CJF A;  1B9D A;  1TV6 A;  3ZSQ A;  4Q5V A;  2HVH A;  4AHC A;  1NJW A;  1GOB A;  3OYM A;  3SV3 A;  3EYZ A;  3F73 A;  1TK5 A;  1R0A A;  3M8Q A;  4I9L A;  1JLQ A;  3ASM A;  3DLG A;  3ZSZ A;  4KI6 A;  4DS5 A;  4O0I A;  1FKP A;  2HHU A;  4IFY A;  5HBM A;  3VN5 A;  3SYZ A;  4FZY A;  4YFU A;  4KHS A;  1HNI A;  2P1J A;  3ALY A;  2DFH A;  2KTQ A;  1D5A A;  1HPZ A;  3U6F A;  3D45 A;  4HCC A;  3L2U A;  1RIL A;  4I2Q A;  4C8M A;  1NK8 A;  1BCO A;  3FFI A;  3H08 A;  3V1O A;  4CIF A;  5SWM A;  3L3U A;  1ZBH A;  4C8L A;  4K8X A;  1GOC A;  2KQ2 A;  4YNQ A;  5KRS A;  4FJL A;  4E89 A;  1TKX A;  3DLH A;  4QAG A;  1KFS A;  4CCH A;  4OKK A;  4CGG A;  4FM1 A;  3AVM A;  3AVK A;  1Q9Y A;  1C1B A;  4I9Q A;  3SPY A;  4QCL A;  4FCY A;  1QHT A;  1SV5 A;  4DSF A;  3SNN A;  2YV0 X;  3DI6 A;  3SQ4 A;  2R7Y A;  4HTU A;  1K6Y A;  3OS0 A;  3DRR A;  4OKJ A;  2YNF A;  3P1G A;  3VQE A;  1DTQ A;  2F8T A;  3SZ2 A;  3UIQ A;  4CJU A;  4LH5 A;  4R5P A;  3AA5 X;  3VA0 A;  4I7F A;  4FZZ A;  1W0H A;  4E19 A;  3LP3 A;  3B6P A;  4CGI A;  4WE1 A;  4CF8 A;  5KTQ A;  4TSX A;  3AO1 A;  3LAL A;  4CGF A;  4DSI A;  3SI6 A;  4B9M A;  2EHG A;  3QNN A;  4M3W A;  3L3V A;  3OYJ A;  4OGE A;  1NK0 A;  1S1T A;  3AVA A;  4CEB A;  3O3G A;  4BDZ A;  3V6D A;  1UA1 A;  2Y1J A;  4E3S A;  3G10 A;  1D9D A;  4M42 A;  1JLC A;  4DWI A;  1BQM A;  1U04 A;  2Z1J A;  1KCF A;  4CJV A;  4DQI A;  4M3X A;  3NF9 A;  3I8D A;  4B9T A;  2B6A A;  3L2V A;  2Z1H A;  3NCI A;  1NJY A;  1QSL A;  1WSJ A;  2ITG A;  4CK2 A;  4RW7 A;  3CM6 A;  4Y1D A;  2B4J A;  3LZI A;  1KLM A;  3IG1 A;  2YKN A;  1FK9 A;  2IDO A;  3C94 A;  3MEE A;  3CFR A;  1NOY A;  4EZ6 A;  1WAJ A;  2OPR A;  4FM0 A;  1UWB A;  3KD1 E;  3V9U A;  3NGZ A;  3TI0 A;  3WNH A;  3S3M A;  3O3H A;  1X1P A;  4DFP A;  4CK1 A;  3MED A;  1XWL A;  2VG5 A;  2RPI A;  3L2W A;  3MXM A;  3V9Z A;  2FBY A;  2G8H A;  4BDP A;  3QER A;  1RBU A;  3AO2 A;  4ZTJ A;  2DFE A;  4FJH A;  4KHN A;  1J53 A;  1VSK A;  3HYF A;  4E7J A;  1CZ9 A;  4DTU A;  2FBX A;  1T7P A;  4IKF A;  1MU2 A;  1B92 A;  1RTJ A;  3T3F A;  1ZBL A;  4O4G A;  1L5U A;  3CQ8 A;  1EX4 A;  1G15 A;  3AO4 A;  4B08 A;  5CZ1 A;  5T7B A;  3DOK A;  1RNH A;  1C0M A;  3V1R A;  4BE2 A;  1U49 A;  3K58 A;  4CJT A;  3K5M A;  1RBT A;  1L3U A;  3ISN C;  2XY7 A;  4FLU A;  3SJJ A;  3MEC A;  4FJ5 A;  4OJR A;  2JGU A;  2OPP A;  3G0Z A;  4CFC A;  4JS5 A;  1U48 A;  3TAM A;  2HHS A;  4CJL A;  4DTN A;  3DLE A;  2DFF A;  3AO3 A;  3TAP A;  1CZB A;  1S1X A;  5DK5 A;  3KLG A;  4OLB A;  3QIO A;  2FBT A;  2HHW A;  1SUQ A;  4FJN A;  4ZHR A;  1XI1 A;  3SV4 A;  1S5J A;  1CXU A;  3KLH A;  1JKH A;  1RT4 A;  4F8R A;  4Z4G A;  4Z4I A;  4CJ4 A;  4HHT A;  1D8Y A;  4FJI A;  3LAM A;  4PY5 A;  4IBN A;  3JYT A;  3AVI A;  1X9W A;  2G8K A;  1JXB A;  3VQ9 A;  4FJ8 A;  1VSJ A;  3QES A;  1NOZ A;  2LSN A;  3QO9 A;  3QIN A;  4NYF A;  4CED A;  3MAQ A;  1CLQ A;  3ZSY A;  4UQG A;  2G8U A;  4IG0 A;  4CJS A;  2P5O A;  1U47 A;  4KTZ A;  1LW2 A;  1SL0 A;  4CF0 A;  3AVJ A;  3C6T A;  2BDP A;  4DU3 A;  1EP4 A;  3LP1 A;  3AA3 A;  5KI6 A;  2HHX A;  1I39 A;  2IS3 A;  4F4K A;  4KTQ A;  4KFB A;  5HP1 A;  4KHY A;  3NE6 A;  1TKT A;  3PX0 A;  2YKM A;  4DTS A;  4ELU A;  3S3O A;  1QSY A;  2OPS A;  1SKR A;  2WOM A;  1DLO A;  4Y1C A;  3I0S A;  3L2R A;  4NCA A;  5KGX A;  3MEG A;  3LWM A;  1YT3 A;  1EKE A;  4Z4H A;  2D0B A;  3QEW A;  2A1R A;  1D9F A;  1BIU A;  5CYQ A;  1SL1 A;  4FJX A;  5J2M A;  4KI4 A;  1RDD A;  4CJP A;  3VA3 A;  2DTU A;  1NJX A;  3RRG A;  4J2E A;  4CJQ A;  1J9A A;  4AH9 A;  4JRQ A;  3B6O A;  5HRN A;  4BE1 A;  2FBV A;  1NKE A;  1DTT A;  3KKS A;  4CJK A;  1L3V A;  4CHN A;  2OZM A;  2X6S A;  5FDL A;  5HRO A;  1BI4 B;  2AJQ A;  4FLY A;  1HNV A;  1EET A;  4DTX A;  4FM2 A;  1BGX T;  3PO4 A;  1JLF A;  3ZT0 A;  1TAQ A;  1FXX A;  3M8R A;  4GMJ B;  4DTM A;  2HW3 A;  4HUF A;  4AHR A;  1NKB A;  1RTD A;  2YNH A;  4CJ5 A;  4J2D A;  4DLG A;  4C8N A;  2XRI A;  4E7L A;  1C1C A;  1VSD A;  3SPZ A;  5I42 A;  1VSH A;  2E6M A;  3HP9 A;  1QS4 A;  2IGI A;  1LAW A;  5HRS A;  3TAQ A;  2ATQ A;  4Z4C A;  4CEO A;  1RT5 A;  1O1W A;  1JLE A;  1ASU A;  1VSM A;  2O4G A;  5HRP A;  2HND A;  4CJR A;  4DFJ A;  3THV A;  3DRS A;  4KB1 A;  2HB5 A;  4W5R A;  3P83 D;  3OVN A;  1BHL A;  3AVL A;  3OS1 A;  5D3G A;  3HL8 A;  3M8S A;  4FLX A;  5I3U A;  3OS2 A;  3QIP A;  5KRT A;  4OVL A;  3V1Q A;  3V4I A;  1A5X A;  4FJ7 A;  4KHQ A;  1BL3 A;  3DMJ A;  3O3F A;  3AVF A;  4DSJ A;  4E1N A;  1HYV A;  4FXD A;  1FKO A;  3KK3 A;  4N56 A;  3ZSX A;  4LSL A;  4E7I A;  2X74 A;  4CF2 A;  1BQN A;  4BDY A;  1T8E A;  5J2Q A;  4CHQ A;  1EXQ A;  3OYC A;  4FLV A;  4CFD A;  3RR8 A;  1VSE A;  1WAF A;  2IAJ A;  2VG6 A;  4RG8 A;  3S9H A;  5CY4 A;  4LD0 A;  2Y1I A;  4AHT A;  3V81 A;  4J2B A;  5C25 A;  1ASV A;  3VQ8 A;  4FZX C;  3DRP A;  4CEC A;  4FJ9 A;  4HVJ A;  3D0P A;  4DTP A;  5C42 A;  4W5N A;  4IG3 A;  3QEX A;  1RT1 A;  3NAE A;  3KIO A;  4J2A A;  1NK4 A;  4H4O A;  1ZBU A;  1SL2 A;  2HNZ A;  4NCG A;  4FYD A;  4CGH A;  2B5J A;  1BCM A;  4CK3 A;  1HQU A;  5SZT A;  2IOC A;  5HLF A;  3L8B A;  1JLA A;  4JS4 A;  3QEP A;  3HP6 A;  4BAC A;  4CJ3 A;  4O55 A;  3U3G A;  4OPJ A;  3HPO A;  3QEV A;  2HHT A;  2Z1I A;  4FVM A;  1WSE A;  4O44 A;  1WN7 A;  3HVR A;  1TK8 A;  2YNI A;  4N5S A;  4EP4 A;  1C1A A;  1VRT A;  3LAK A;  4CF1 A;  1TAU A;  3NHG A;  1HYS A;  3AA2 A;  4PUO A;  3O4Q A;  1X9S A;  3LZJ A;  3NGY A;  4FK4 A;  4RW4 A;  2XO7 A;  2G8I A;  1TL3 A;  5DMR A;  3KLF A;  1NK9 A;  4CEQ A;  5FRO A;  4W5Q A;  3IRX A;  1KTQ A;  1RBR A;  1IKW A;  4KTW A;  1ZYQ A;  4QOZ B;  4PQU A;  4FJK A;  2HMI A;  1U4B A;  3ZSV A;  3OYK A;  3PV8 A;  5FRM A;  4DU4 A;  3KJV A;  1QE1 A;  4BWM A;  2KFZ A;  4RW9 A;  3VQQ A;  4CF9 A;  5J2P A;  4CIG A;  1RCH A;  4F2R A;  3VQA A;  4DMN A;  4N76 A;  4LH4 A;  2HNY A;  1YTU A;  4K8Z A;  1F21 A;  3HPG A;  2WON A;  1C0U A;  4FW2 A;  3ZT4 A;  3NF7 A;  4F2S A;  4KV8 A;  1TKD A;  2W42 A;  1VSL A;  3RRH A;  3PX6 A;  1I3A A;  1RBV A;  3K59 A;  2QK9 A;  1VK0 A;  3AVC A;  3OYG A;  4MFB A;  4F3O A;  3E01 A;  3DOL A;  3AVN A;  4DG1 A;  4CEZ A;  2A1S A;  3KK1 A;  5EU7 A;  4B9S A;  3K2P A;  1X9M A;  1XHZ A;  3OYH A;  1WLJ A;  1VRU A;  2RKI A;  4FK2 A;  1RTH A;  1A5W A;  3TR8 A;  3OYA A;  1SKW A;  3TAR A;  2G8W A;  4KAZ A;  1KVB A;  4CFA A;  4DLE A;  1IKV A;  4CHP A;  4Z4F A;  3SUN A;  1NKC A;  3RR7 A;  3SCX A;  2VG7 A;  3AA4 A;  3KK2 A;  2D0C A;  3T19 A;  2HVI A;  3ZSO A;  3ZT2 A;  1YVU A;  2RN2 A;  1ZBF A;  3QLH A;  3K57 A;  2VWJ A;  3IAY A;  2E4L A;  2XHB A;  1S1U A;  1LV5 A;  4IDK A;  3SUQ A;  3SQ0 A;  4KB0 A;  4F3T A;  2DY4 A;  2VWK A;  3DLK A;  4FW1 A;  2GUI A;  1Z25 A;  3IS9 A;  4RW6 A;  4DQS A;  3DM2 A;  3ZSW A;  2D0A A;  3VQ6 A;  2KZZ A;  1HYZ A;  2Q3S A;  3C6U A;  1LW0 A;  1IKX A;  1C0T A;  4BWJ A;  1UAX A;  3VQD A;  1WNS A;  3DLR A;  4KPY A;  2HHV A;  1IKY A;  4ZTF A;  4DQP A;  3NH1 A;  2OZS A;  4KHU A;  3LWL A;  4Z4E A;  4FJM A;  1KVA A;  4KKO A;  1JLG A;  3ZT1 A;  4BE0 A;  4CEA A;  4IFV A;  4E0D A;  3NBP A;  4MQ3 A;  3KD5 E;  1RT3 A;  4B3O A;  3ZSR A;  4FK0 A;  4ID5 A;  2I5J A;  4AHS A;  4AHV A;  3PY8 A;  3NF8 A;  3HK2 A;  3KLE A;  1S9G A;  2PYJ A;  2GV9 A;  3RTV A;  1U45 A;  1Q8I A;  1GOA A;  4L8R B;  4M3R A;  4E1M A;  3QNO A;  3LPU A;  1UA0 A;  4DTR A;  4JLH A;  1KFD A;  1HQE A;  1TL1 A;  4KO0 A;  3OYE A;  4C8O A;  4CJE A;  1S1V A;  1S9E A;  5CZ2 A;  2JLE A;  1JXE A;  3HPH A;  4GW6 A;  1ASW A;  3V9W A;  1LWE A;  2YNG A;  3CYM A;  4OGC A;  1RBS A;  3VQ4 A;  4XIU A;  1YTA A;  3K5L A;  4W5T A;  3CFP A;  4CGJ A;  1WSH A;  5J2N A;  1LWC A;  3VQC A;  2KZM A;  3AV9 A;  3SQ1 A;  3DYA A;  4ELT A;  4KRE A;  1LAV A;  2GBZ A;  2D5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...