4CFDA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cfdA00
1LWEA 1TGOA 1UWBA 4E7KA 2P5GA 4M3RA 3VQBA 3C6UA 3MEDA 3V9UA 4FVMA 3VQCA 1TK0A 2ETJA 3DM2A 3G10A 3CQ8A 1X9SA 2YHBA 3VQEA 3ZT0A 3NF9A 3MECA 3ASMA 3NDKA 4NYNA 1UOCA 2OPQA 1TKZA 4LH4A 3AVGA 3AA2A 4E0DA 2OPRA 4AHRA 4OKEA 4F3OA 4HHTA 2ATQA 3QEWA 4L8RB 3PY8A 3OYNA 3TAGA 4ZTFA 1LW2A 1HYVA 4DMNA 3O4NA 3DLGA 4IG0A 1EXQA 4YFUA 3DI6A 3B6PA 3TAMA 5HRSA 1VK0A 2XY8A 2D0AA 4DTOA 4CEQA 2IS3A 3DRPA 3O4QA 4N5SA 3PX6A 2DTUA 3HPHA 4IFYA 4M45A 5KI6A 1KFSA 4CK1A 1HQUA 4DTSA 3OS0A 4CF2A 2VG7A 3QNOA 3KKSA 4G1QA 3SQ0A 1SL0A 3LP1A 3WNEA 1K6YA 4O0IA 4DQIA 4M41A 3CYMA 2G8FA 4B08A 2G8HA 3IAYA 4F3TA 4H4MA 4RW7A 3VQ5A 1IG9A 1BI4A 3CFOA 2LSNA 4KHQA 4FJ5A 2F8SA 3EY1A 4W5OA 3F73A 2IGIA 4CHQA 1VSEA 2Z1GA 4AHCA 2BANA 1S1WA 3V9SA 1JLQA 4NCBA 4PY5A 2HHUA 2XY7A 4CFCA 3S9HA 4E7JA 4DWIA 4DTUA 3C6TA 4DSLA 1ZYQA 3OYKA 1KCFA 5HP1A 3RMCA 3SI6A 3T1AA 4KHWA 4CGFA 4EP5A 3ZSZA 2W42A 4N41A 4KTQA 2GUIA 3V4IA 3KD1E 2YKMA 1LAVA 3AVHA 2FBYA 1RTHA 4KTZA 4E19A 2RPIA 3AVJA 3NF7A 3V9WA 3HJFA 3D0PA 1UAXA 3HPOA 1WSJA 4W5TA 3V81A 4KKOA 3DLKA 4CGGA 5T7BA 4YNQA 1QTMA 5HRPA 3VN5A 3T3FA 2PY5A 4M3WA 4FJIA 3VQDA 3VQ8A 4RW8A 1N5YA 4CHPA 2QKBA 4CJPA 4E7HA 1NKBA 1ZBHA 3L3VA 4C8MA 1BHLA 3SUOA 2ZD1A 1L3TA 1RT1A 3NGIA 3LDSA 2XHBA 1LV5A 4GW6A 3TAFA 4FJLA 3ZT4A 4MFBA 4CEAA 3OYIA 1KRPA 4DS4A 4KHYA 1IKYA 4RW6A 3KJVA 1WN7A 4FM2A 1BQNA 1LWCA 4CGHA 4BACA 4Z4GA 3KLHA 3K2PA 4HVJA 2P5OA 3KD5E 4CF8A 1IKXA 1RCHA 2P51A 4CJQA 3KK1A 1EX4A 4FLTA 4B9NA 5HBMA 3AO5A 3PO4A 3LWMA 4AHTA 2HHSA 3BGRA 4DTXA 1YTAA 3SUPA 3RWUA 3RRGA 3AVKA 4JS4A 3WNFA 1TV6A 4KFBA 4FJHA 3EYZA 3SV4A 1SKRA 4B9VA 1J53A 4OGCA 3ZT2A 3AO1A 1TKXA 2G8UA 4CK3A 3DLRA 3L3UA 3LPUA 2HNDA 2FBTA 4FLXA 3AV9A 3IG1A 1NK6A 1QE1A 1U4BA 5HLFA 3NF8A 1TL3A 2YV0X 3LZIA 1J5OA 1I39A 4J2DA 1JLGA 4M3ZA 1NJWA 4FZXC 3OY9A 3BDPA 1S1VA 3AA4A 4W5QA 4B9MA 4FK0A 3AVIA 4Z4EA 3SQ2A 4CK2A 3ITHA 4DQSA 1WSFA 1TK8A 1T8EA 3V1OA 1RTJA 2QK9A 3O3FA 3AO4A 4I9LA 2NUBA 4O0JA 3QINA 4C8NA 4CJ4A 1RDBA 1RDDA 3LAKA 5CYMA 3ZT1A 3M8SA 3U6FA 4HUFA 5CZ1A 1QQCA 4DFJA 3S3NA 3VQAA 4ZHRA 3I0SA 3PV8A 4F4KA 4KI6A 4CF9A 2HB5A 3TI0A 1A5VA 4UQGA 1XHZA 3DMJA 5HRRA 2ZE2A 3ZSWA 1X9MA 1N6QA 4DTNA 1SKSA 3LPTA 2HHQA 1BCMA 3A2FA 2XO7A 4HUGA 3OVNA 2OPPA 4AILC 4K8XA 4Z0UA 3VQ7A 3ZSQA 3ZT3A 3KKRA 4OGEA 4M3TA 3ULDA 1VRUA 1LW0A 1XWLA 3OYDA 4FLUA 2PYJA 1QSYA 1YT3A 3AVFA 3VA3A 3ISNC 1W9HA 4FJXA 4FJ9A 1RBUA 1B9DA 1T7PA 3DLBA 2O4IA 2IC3A 1U48A 1VSKA 1JL2A 1JLEA 4EZ6A 2IOCA 4CEBA 4CGIA 1JXEA 3NH2A 1ZBIA 3C94A 1JLBA 1HJRA 1RT5A 2FBXA 4HTUA 1VSDA 1QS4A 3V1RA 3SUNA 3HO1A 3NAEA 2KFNA 3P83D 4LY7A 5FRNA 2RF2A 3AO2A 3L2RA 2G8IA 2AJQA 2Q3SA 1A5WA 4M3UA 2KTQA 4N56A 3B6OA 3I0RA 5FROA 1GOCA 3CFPA 1EKEA 2Z1JA 3TAQA 4O55A 5SZTA 3SNNA 3MXIA 1NK7A 4DSEA 4JS5A 2G8WA 5CZ2A 4TSXA 3THVA 1S1TA 4CJ5A 1Z25A 4KTWA 5J2PA 1WNSA 3K58A 2PYLA 4KHSA 3NH1A 4QAGA 1RBSA 3QEXA 4N76A 1NOYA 5E41A 4CJ3A 1KFDA 5D3GA 2VG5A 4MQ3A 4DU4A 3SCXA 1J54A 4DSKA 4FZYA 2YNFA 4FJ8A 2D0BA 1VRTA 3K5LA 1RBRA 4OVLA 1NOZA 4ID1A 4DTJA 1L3SA 3V6DA 3HP9A 3QETA 4J2AA 3SYZA 3DOLA 2KZZA 1WSHA 2X6SA 1TKDA 3TAPA 1ASVA 3KTQA 2BE2A 1CLQA 3DRSA 4CJFA 2BDPA 4PA1A 4FW2A 4CECA 5C42A 2RN2A 3AVCA 1NK8A 2XY5A 4FJGA 3ZSOA 1VSMA 2HHTA 3KLIA 4CEOA 4KPYA 4BDPA 4E1MA 3K59A 2YNIA 1NKCA 2O4GA 4I9QA 4CHNA 4KI4A 3AVLA 3OYGA 5KRSA 4CJRA 3NGZA 4B9LA 4DF4A 3OJUA 5EU7A 4AHUA 1JL1A 5I42A 1HYZA 1J9AA 4QOZB 2OYQA 5SWMA 2HHXA 5HRNA 4IG3A 3VQQA 1KVAA 4CFBA 1Q9XA 4HCCA 3HL8A 1JLAA 4OKKA 3TABA 2A1RA 3RMBA 1DTQA 2JLEA 2DFEA 4IBNA 3LP2A 2XY6A 1NK0A 4BE0A 3RRHA 3SV3A 1KLNA 1VSFA 3SQ1A 3HK2A 3HVTA 4M3YA 2DY4A 4XIUA 1T03A 5KRTA 3VQPA 1C0TA 1WLJA 2PZSA 3K57A 4DLEA 1HNIA 2KZMA 4E7LA 2EX3A 3ZCMA 3OJSA 3K5NA 4KB0A 4K8ZA 4Y1DA 4KO0A 3SQ4A 3SUQA 1C0MA 3P1GA 3OYCA 3LANA 4C8OA 3MXJA 4LSLA 3DLHA 1KVCA 4Z4FA 1ZBLA 1LAWA 1VSJA 1TVRA 4KAZA 5C24A 3WNHA 1L3UA 4KB1A 4FZZA 1WSIA 5JS1A 4CJEA 4CJKA 4O4GA 1RTDA 2WOMA 3H08A 4LH5A 4PWDA 3LAMA 4E89A 3AO3A 1D8YA 2XRIA 1U45A 1R0AA 4F8RA 2YNHA 1HPZA 4ELUA 4DTPA 1NJZA 4CFDA 1NK5A 3QEPA 4B9UA 4IKFA 4HCBA 3LP3A 2QXFA 4ELTA 4IFVA 5C25A 3NBPA 1SL2A 4O44A 2FBVA 3ZSRA 4CEDA 1VSLA 3V1QA 1A5XA 1C1CA 1KVBA 4CEFA 4W5NA 5K14A 1X1PA 3ZSVA 2G8KA 4HUEA 3TARA 3NH0A 4F2SA 2VWKA 3RTVA 1UA0A 1FXXA 2YKNA 2B5JA 1DLOA 3O3HA 3CFRA 4FCYA 2Y1IA 1Q9YA 1WSEA 1C0UA 3QIOA 5CY4A 3AVBA 4OLBA 5DK5A 1X9WA 4C8KA 1TAQA 4ICLA 3JSMA 3OYFA 4BWJA 2IDOA 3PX4A 1JLCA 2E6MA 4RW4A 4KHUA 1RTIA 2I5JA 3LALA 3T19A 3DLEA 4DF8A 2ZQBA 4CHZA 2D0CA 5CYQA 4WE1A 4DLGA 3L2QA 4E7IA 4OPKA 4DFMA 4FLZA 3PO5A 3OS2A 1TL1A 1RDAA 3CM6A 1ASUA 1WAFA 3MEEA 3U3YA 4CCHA 3KK2A 3QERA 1HYSA 2GV9A 3NFAA 1NK9A 4BE1A 1W0HA 3KLFA 3V9XA 4Z4IA 3M8RA 4FM0A 3HPGA 2YNGA 3QLHA 3QNNA 2EHGA 1L5UA 2IAJA 2BGGA 1QSLA 5KTQA 1XI1A 4FJMA 3ZSYA 4CE9A 1S5JA 1TAUA 4CFAA 4DSIA 3NCIA 3D45A 1Z26A 4CF0A 4FM1A 1Y97A 3OYLA 3OYEA 2F8TA 4FXDA 4CJTA 4CJLA 1IKWA 2HNYA 3FFIA 4NYFA 4ZTJA 4FJNA 2VG6A 3RMAA 3SJJA 1VSIA 3MEGA 3C95A 4CERA 4DQQA 4DFPA 1SKWA 4C8LA 1MU2A 2KQ2A 1REVA 5KGXA 3QESA 3OS1A 2HW3A 4AHSA 1CXQA 1RT2A 5HROA 3I8DA 1TK5A 1F21A 3TAEA 4FYDA 1S6QA 3HYFA 3G0ZA 4JLHA 1BQMA 2E4LA 1U49A 1WSGA 4B9TA 2RKIA 3JYTA 4RG8A 2OA8A 1HNVA 3P5JA 4OJRA 4EP4A 3HM9A 1RILA 2R7YA 3K5MA 1VSHA 3V9ZA 2X6NA 3L2WA 4FLYA 4B9SA 3NGYA 4Q5VA 2VWJA 4AHVA 3ALYA 1RT3A 1RBTA 4GMJB 3HXMA 1IKVA 3TR8A 3S3MA 1S9EA 4FJJA 4CGJA 1O1WA 3L2VA 1SV5A 2HHWA 1ZBFA 4CJSA 4CJVA 2HVHA 1C1BA 2ITGA 4Z4HA 1B9FA 1KTQA 1QSSA 4PUOA 3OYJA 1FK9A 4AH9A 5KGWA 2B4JA 4CF1A 4E1NA 3KLGA 4CIGA 4CHOA 4DFKA 2Z1HA 1XHXA 3O3GA 3K5OA 1NJYA 4QCLA 1ZBUA 3OYMA 3VQ4A 4FLVA 4PQUA 1ITGA 5J1EA 4FJKA 4JRPA 3NHGA 4BDZA 3QEVA 2OPSA 4DTMA 1JXBA 3S3OA 1NK4A 3NE6A 1ASWA 1RBVA 1UA1A 3VQ9A 3VA0A 1JLFA 3CG7A 2GBZA 1CZBA 4J2BA 1BIUA 1KSPA 4FJ7A 4FK2A 4FK4A 2E6LA 3WNGA 3AA3A 2F96A 1S1XA 3RR7A 3SPZA 3F9KA 4LD0A 1SL1A 4NCAA 4M3XA 4CIEA 1IH7A 1GOAA 3HVRA 2QKKA 3L8BA 1RDCA 5I3UA 4OKJA 3PUFA 4CJWA 3KLEA 1D9DA 3KK3A 4GVMA 3TWHA 3KIOA 2WONA 4I2PA 3DYAA 4BE2A 4CJUA 3ZSXA 4BWMA 1KLMA 1BL3A 1RNHA 1U04A 3NF6A 4B8AB 1TKTA 5J2MA 1WAJA 3VQ6A 4FLWA 3SPYA 4ID5A 4DTRA 1G15A 2HMIA 3AVMA 3OYHA 3HP6A 3LZJA 2G8VA 1YVUA 5JS2A 4DQPA 2KW4A 4KRFA 4KV8A 3L2UA 3DRRA 1BIZA 1EETA 4CEEA 4H8KA 4DS5A 4M42A 3U3GA 1SUQA 4CHYA 3OYAA 1QHTA 5J2QA 3AA5X 4BDYA 4ELVA 4N47A 1DTTA 3CM5A 2Z1IA 4W5RA 3TANA 4IDKA 1T05A 3M8QA 5J2NA 1LWFA 1JKHA 1GOBA 1HMVA 4FW1A 3UIQA 4EZ9A 2HVIA 1HQEA 2DFFA 3QEIA 4KREA 4RW9A 1S1UA 4DG1A 1I3AA 3EZ5A 4DSJA 1BISA 4Q0BA 1EP4A 1XC9A 3LWLA 1NJXA 1D9FA 2HNZA 2X74A 3SZ2A 4J2EA 4F2RA 4DU3A 1U47A 1C6VA 4LSNA 1FKOA 2X78A 2OZMA 2HHVA 4R5PA 4DQRA 4E3SA 3DOKA 4H4OA 3AVAA 4I7FA 1RT7A 1BGXT 4Y1CA 4JRQA 3HSTB 4DSFA 4NCGA 1BI4B 2DFHA 2B6AA 4CESA 3MAQA 1Q8IA 2FC0A 2Y1JA 1L3VA 3AVNA 4CIFA 4B3OA 1B92A 4KHNA 4DU1A 3OYBA 5FDLA 3PX0A 3MXMA 3E01A 1RT4A 2JGUA 3QIPA 1S6PA 4I2QA 4B8CA 3IRXA 1CXUA 5FRMA 4OLAA 1FKPA 1HRHA 4Z4CA 1CZ9A 1D5AA 3RMDA 5DMRA 1C1AA 4O5BA 2OZSA 1IO2A 2D5RA 2P1JA 3HT3A 1YTUA 3LP0A 3M8PA 4CEZA 2YHAA 4CGDA 2KFZA 2A1SA 4OPJA 1NKEA 1RT6A 3IS9A 3RR8A 1S9GA 1BCOA 3QO9A
chains in the Genus database with same CATH superfamily
1TGOA 1UWBA 3E66A 4FVMA 1ZBSA 1Q86O 3G10A 4IEEA 5LY3A 1T44A 2QWOA 3ASMA 1UOCA 2OPQA 1GLFO 1TKZA 3AVGA 3AA2A 4KBOA 3O80A 4LH4A 5KQDA 1IV0A 4HHTA 2VQFK 3PY8A 3TAGA 2HMPA 5AQWA 1HYVA 3QBWA 3DLGA 4IG0A 1EXQA 1DT9A 5HRSA 1VK0A 2XY8A 2D0AA 2IS3A 2NRHA 1KFSA 4C8LA 3KKSA 4G1QA 3WNEA 1EWRA 3VERA 3QICA 4M41A 2G8HA 4F3TA 4H4MA 3VQ5A 3F73A 4AHCA 2P9IB 4CFCA 2WBNA 3ZETA 1TYQA 2V7ZA 3ULEA 3CCQN 1ZYQA 3OYKA 3T1AA 4KHWA 4KTQA 3V4IA 2YKMA 1KD1O 1LAVA 2VYPA 3OTOK 3V9WA 3MN9A 1DGKN 4JKAA 4YOTA 2GELA 4W5TA 4AQYK 4YNQA 3VN5A 1GLEG 3SK3A 2QKBA 1NKBA 1BHLA 3CCUN 3NGIA 1BUPA 2A5XA 1LV5A 4PHTX 4DS4A 1IKYA 4RW6A 3U9DA 3W3DA 1XMOK 1LWCA 4BACA 3OHRA 4CZEA 3VOVA 5LMNK 4HVJA 2P5OA 3VEYA 1N8RO 3KD5E 1IKXA 1HR0K 1EX4A 4FLTA 3AO5A 3LWMA 3BGRA 4JS4A 4FJHA 1K8KB 3FZMA 3EYZA 2WC9A 1X3MA 2G8UA 1ZXOA 2HNDA 3AV9A 1NK6A 1U4BA 4IOAL 3LZIA 4FZXC 3BDPA 5BPLA 5JVHL 3VTHA 5EVZA 5E26A 4LFAK 3AVIA 4Z4EA 1IJJA 4QS8A 1NG9A 1RTJA 3O3FA 4O0JA 4B9UA 4C8NA 1RDDA 3U6FA 4DFJA 1NMDA 3I0SA 3PV8A 2HB5A 3TI0A 1A5VA 1OKJA 1XHZA 2ZE2A 1X9MA 4LFCK 3OBYA 1SKSA 4X66K 3LPTA 1BCMA 3O9RA 3VEXA 2OPPA 4O8KA 4K8XA 4BRAA 3O4WA 4M3TA 1ATRA 1XWLA 3P38A 3DXKA 4Y0WA 1B9DA 3HOSA 3CCEN 2UXCK 3QBXA 4A5AA 4EZ6A 2O8EB 4CGIA 1JXEA 5E84A 3C94A 1WB9A 4JN4A 1JLBA 1HJRA 1KAYA 1HJOA 3MWPA 4LY7A 3AO2A 4K25A 4M3UA 4N56A 3CC2N 3TAQA 1EKEA 2Z1JA 3CI5A 3SNNA 4JS5A 2OCEA 1VQ6N 3THVA 3THXB 4CJ5A 1Z25A 1BDGA 4DR6K 5AZJB 4N76A 4BREA 1NOYA 5EY4A 2VG5A 4DU4A 3SCXA 1RBRA 2DPNA 3M3ZA 1TUUA 3R6MA 1BOTO 3DOLA 4BRCA 2GTDA 2X6SA 3THYB 2ZJQL 2BE2A 4GY2B 1U6ZA 2RE2A 4YY3K 2BDPA 4CECA 3ATUA 2F9TA 1XMQK 5C42A 2RN2A 1NK8A 1K8AO 3N4PA 2ZJPL 2O4GA 3LDOA 4CHNA 1VQ9N 5AQNA 3NGZA 1GLLO 4A61A 4YOUA 3OJUA 4QOZB 1JL1A 1HYZA 4DV4K 1BWFO 4IG3A 1LOTB 1KVAA 5LJWA 4CJ7A 1Q9XA 4HCCA 5DM7L 2JWLA 3A5NC 3OW2M 2A1RA 2GWKA 4ILJA 1KLNA 3HK2A 3SQ1A 1WBDA 3ENOA 3ZCMA 5AQSA 4GV9A 4K8ZA 4Y1DA 3VF6A 3THXA 1C0MA 4IOCL 3MXJA 4R79A 3ZX3A 3CERA 3IMXA 1BA0A 5JS1A 3THWB 1QVFM 3LAMA 1D8YA 4CVNE 4F8RA 5GINA 3QEPA 3LP3A 4ELTA 5C25A 3DAWA 3NBPA 1QHAA 1SL2A 4CEDA 4JKGB 3V1QA 5K14A 1X1PA 3ZSVA 3NVKA 2NRTA 2VWKA 4F2SA 3H46O 2QI2A 3O3HA 3CFRA 1Q82O 1WSEA 3AVBA 1TAQA 1GLBG 3BF1A 3T19A 3UKRB 4CHZA 2D0CA 4OO1J 1YHQN 5AQJA 3EZWA 3LDLA 4XEIA 3NFAA 2FLOA 2OTLN 1W0HA 3KLFA 2YCHA 3HPGA 2YNGA 3QNNA 5MLCQ 3CJ1A 1XI1A 4FJMA 3KWGA 5M1OA 4G9ZA 2J4RA 1TAUA 4DSIA 2WTUA 5IT9O 4JAXA 2F8TA 2H3GX 4FXDA 3FZFA 3C95A 3BZKA 5JLFA 1N36K 3VPZA 4EIAA 2IVNA 3OS1A 5HROA 4H0VB 4CD3A 1BA1A 3TAEA 3HYFA 1U49A 3G0ZA 4JKGA 3VENA 1W2BM 4FYDA 1WSGA 5FPDA 2UUAK 1YI2N 3P5JA 3H3NO 2R7YA 3BP8A 3M5RA 3V9ZA 4FLYA 4B9SA 1OVYA 5AQLA 3NGYA 4Q5VA 2QEXN 4QS7A 2CH5A 1RT3A 1RBTA 2ASOA 3D2EA 2CGLA 4H5VA 4FJJA 3L2VA 2HHWA 2E2NA 1C1BA 3FE1A 1KTQA 3CC4N 3T69A 1FK9A 2B4JA 1QZ6A 3O3GA 1ZBUA 3OYMA 4FLVA 4FJKA 4BDZA 4DTMA 1JXBA 4H0XB 5I9EB 1YF5L 3VQ9A 2O8BB 3VA0A 3CG7A 4J2BA 1CZBA 4FK2A 4NXMK 1T6DA 3RR7A 5JMVA 3F9KA 1IH7A 1GOAA 3O1BA 5I3UA 4OKJA 3PUFA 4CJWA 4LC9B 1D9DA 4GVMA 4MDBA 4BE2A 4CJUA 3UKUA 1S3XA 1TKTA 3SPYA 4ID5A 5M1PA 2G8VA 3LZJA 4KV8A 4BG9A 3DRRA 3J7ZO 1EETA 2O8FB 4H8KA 4A62A 3U3GA 1NGIA 3SAFA 1NBWA 1SUQA 3RVCA 2ZF5O 4CZMA 5J2QA 3AA5X 4ELVA 1DTTA 1N34K 4FWMA 4W5RA 4IDKA 4FWKA 4EZ9A 2HVIA 1JCGA 1HQEA 3AY9A 4GKKK 3U9ZA 4FWRA 5ADXA 4CZHA 1NJXA 2YHWA 1U47A 1JJ2M 2HHVA 4R5PA 4XH1A 4MO4A 4M63C 1Q9YA 2B6AA 1Q8IA 2FC0A 4K43A 4JI5K 1MA9B 3SBTA 3PX0A 3OYBA 4FOIA 1YITN 2Q97A 3I8BA 3PSIA 1HRHA 4Z4CA 1D5AA 3RMDA 5DMRA 2OZSA 1YTUA 4JKHA 4X64K 4IWVA 3T7ZA 1NKEA 1NU0A 1RT6A 5F1XA 3P39A 4KH4A 1S9GA 4IDHA 1BCOA 3QO9A 3ATVA 4M3RA 3V9UA 4NO7A 3C7NB 3VQEA 3ZLJA 3NF9A 4NXNK 3DLLL 2OPRA 4F3OA 4JKBA 5JICA 2ATQA 3CCVN 3DI6A 3TAMA 4I6MB 3PX6A 3DRPA 4N5SA 2QWNA 2YX6A 5KI6A 2OYQA 5BPNA 1HQUA 3QNOA 3OS0A 4CF2A 2VG7A 1SL0A 5BRHA 1SZ2A 3ID6A 4O0IA 4DUZK 4DR5K 2G8FA 4U7BA 3CFOA 4FWQA 2LSNA 4KHQA 4CHQA 1VSEA 1S72N 1Q18A 3V9SA 1JLQA 2O8CB 3DXMB 3S9HA 5ELZA 4E7JA 3C6TA 2E2QA 4DSLA 1KCFA 3SI6A 2GWJA 5AJ3K 2GUIA 3HJFA 3ENBA 3AVJA 3NF7A 4NB4A 2IVOA 3D0PA 5FPMA 3CJCA 5AR0A 5AQMA 3DLKA 2UU9K 5HRPA 3T3FA 2PY5A 4B3TK 4M3WA 4JEPA 3VQDA 3VQ8A 4CZIA 2UXBK 1N5YA 1HNWK 1RDWX 4CJPA 5HL7L 1ZBHA 3C7NA 2ZD1A 4JYAK 4FJLA 4CEAA 4MFBA 3OYIA 1BQNA 4CGHA 3KLHA 1NMNA 1YIJN 4LF9K 3K2PA 5EXWA 1RCHA 2FXUA 3EKSA 5HBMA 4I6MA 3RWUA 3RRGA 2F9WA 1NGAA 1TV6A 4B9VA 4LF4K 1J53A 3AO1A 4YOVA 1YUWA 4CK3A 1HKGA 3DLRA 4WF9L 1HNXK 4FLXA 3IG1A 1J5OA 1QE1A 2YV0X 1JLGA 2O8CA 3WQTA 1X9JA 3S41A 3OY9A 1OH6A 3AA4A 3O9QA 4B9MA 1FW6A 5CE3A 4FK0A 4WCEL 3SQ2A 4DQSA 4GKJK 1WSFA 3F2KA 2QK9A 5JLHA 4KHUA 3ZT1A 3M8SA 3S3NA 5CZ1A 3ZETB 1TYQB 4F4KA 4DR7K 5HRRA 1KC8O 3ZSWA 1N6QA 4DTNA 2P9PA 1X3NA 4HUGA 3OVNA 4BQZA 1K9MO 2Q1NA 4Z0UA 4O8UA 3FZLA 4FLUA 4FJXA 1YT3A 1XC3A 1W9HA 3ISNC 1QQNA 3DLBA 2O4IA 2I7NA 1U48A 5BR9A 1JL2A 4DR2K 1VQ5N 3AGKA 4IO8A 3CMAN 3RSEB 5F2RA 1VSDA 3V1RA 3SUNA 1C0FA 5FRNA 2RF2A 5H1SQ 3QDKA 4IFEA 5AFUH 1NJIO 3I0RA 5SZTA 4DSEA 3J7AP 4YHHK 2FF6A 5J2PA 1WNSA 3K58A 2PYLA 4QAGA 1RBSA 2VGNA 5AQGA 4CJ3A 4YDUA 3BZCA 1J54A 4FZYA 2YI1A 3J7YP 4OVLA 4ID1A 1L3SA 4J2AA 3QETA 2KZZA 1N33K 3PIOL 3DRSA 3AVCA 4BRPA 3CCSN 2HHTA 3IDHA 3LL3A 1NKCA 2W6KA 3AVLA 5HOOA 1Q81O 1C0GA 2QA4N 4AHUA 2D0PA 5SWMA 1HX1A 2VCPA 4PKIA 4BG8A 5HRNA 2P9UA 4BRFA 2ASPA 3RSEA 1LCUA 1EO1A 4FWSA 1JLAA 2QWQA 3DXKB 3R1XA 2HBKA 1DTQA 2E1ZA 1VQPN 4PKGA 2XY6A 3RRHA 3SV3A 4JV5K 2DY4A 3VMFB 3HSCA 2PZSA 3VQPA 1C0TA 3K57A 4DLEA 3O1WA 4E7LA 1GLCG 1GLJO 3T1HK 4DV0K 4KO0A 3SUQA 3G71N 3WT0A 3CD6N 2HF3A 1KVCA 3HZ6A 2Q36A 1ZBLA 3FZKA 1VSJA 1TVRA 4JI3K 3SMSA 4KAZA 1L3UA 1XNRK 4KB1A 1WSIA 2IVPA 4CJEA 4CJKA 1OH8A 3CCMN 1VQON 4LH5A 4E89A 1HKCA 4DV6K 1U45A 1J5EK 4JI6K 2A6AA 1NJZA 2FF3B 1NK5A 3GDQA 4HCBA 2QXFA 1P8ZA 3D2FA 4O44A 4H03B 5AQHA 3CF5L 4W5NA 4BRHA 1TUYA 3JAMO 3RTVA 2YKNA 2B5JA 1DLOA 3DJCA 5CY4A 4H0TB 3QFUA 2ITMA 1X9WA 4C8KA 5JVGL 3DWLA 2NRWA 1W7AA 3PX4A 2I7PA 4RW4A 3K9JA 4DF8A 2ZQBA 5KPTA 2BTFA 1EWQA 3WXLA 4DFMA 3FLCO 3OS2A 2P9KA 2FSNA 3CM6A 3U3YA 5GAEP 4BQLA 3SMPA 1D4XA 1NK9A 4BE1A 3G25A 4Z4IA 4CZKA 1KQSM 2CGKA 3QLHA 5KTQA 3SAGA 1S5JA 4CFAA 2Q2RA 4B3SK 3W0LA 4CF0A 3T1YK 4CJLA 1IKWA 2HNYA 4ZTJA 2VG6A 3SJJA 2HOEA 3VTIA 4CERA 3O5BA 4DQQA 4DFPA 3BY5A 4FWPA 1REVA 5KGXA 2HW3A 1Z6RA 3I8DA 1TK5A 1S6QA 1BQMA 2E4LA 4B9TA 4BR7A 1M1KO 3P31A 3JYTA 4RG8A 4EP4A 3HM9A 2QM1A 1RILA 1VSHA 2X6NA 2VWJA 3MX5A 4EFHA 3S3MA 1EQYA 1VAZA 3EE9A 5BR8K 1SV5A 1ZBFA 4CJSA 1B9FA 1MDUB 3CJ9A 3ZEUB 4PUOA 4CF1A 3KLGA 1CZAN 4CHOA 4EHUA 4DFKA 3UB5A 1NJYA 4BVPA 3LDNA 4WFNL 5KQ8A 3O08A 1ITGA 5J1EA 3NHGA 2BH1A 3S3OA 3C65A 3D7EO 1RBVA 3MCAB 2NLXA 4JHDB 4DHYA 4LFBK 3TTDA 4YOWA 2GBZA 2VQEK 1KSPA 3WNGA 1S1XA 4IZ9A 4UY8O 4LD0A 1SL1A 4NCAA 1NGEA 4M3XA 3N4QA 2QKKA 1KAZA 1RDCA 2P9NA 5DM6L 3TWHA 2WONA 5C15A 4BWMA 4FWLA 1KLMA 1BL3A 1RNHA 4B8AB 1QQOA 2NZTA 4DTRA 1G15A 3K0SA 3HP6A 1YVUA 4KRFA 1Q7YO 4M42A 4DS5A 4IOXA 4CHYA 3OYAA 4BDYA 4N47A 4X65K 2NNWA 4JK8A 1NM1A 3OBWA 4DV1K 2DFFA 4KREA 4H0YB 4RW9A 3EZ5A 3J8AA 4DSJA 1XC9A 2X74A 3ZEUA 4F2RA 1FKOA 1NGBA 3D2EB 3LDQA 2OZMA 4DQRA 3DOKA 1SAZA 4H4OA 4AM6A 4DSFA 3L4QA 3MAQA 4DV5K 3AVNA 4CZGA 4B3OA 3GBTA 4JHDA 4DU1A 3E01A 4I2QA 3IRXA 1CXUA 4BRKA 1OH5A 1ATSA 3TTFA 5FRMA 1YJWN 3A5LC 3LP0A 3M8PA 4CEZA 4HWIA 1V4TA 4PL8A 5GAHP 3IS9A 1H1VA 3VGMA 1LWEA 5AQXA 3C6UA 3MEDA 2OTJN 1V4SA 3VQCA 2ETJA 3DM2A 4RWTA 3CQ8A 4CD1A 1X9SA 2YHBA 5BPMA 2Q0RA 3KHYA 4JK9A 4DR4K 3UKUB 4H5RA 3NDKA 3WQUA 4E0DA 4OKEA 4YDUC 3QEWA 4L8RB 3OYNA 3FFKB 4ZTFA 2OANA 1VQKN 3O4NA 1J6ZA 5C10A 2CGJA 4CEQA 2DTUA 3O4QA 3HPHA 2GX9A 3TSQA 4CK1A 3SQ0A 5C2DA 1S22A 2HVHA 4H0PA 3LP1A 4H5TA 4JKFA 1XUPO 3IAYA 4RW7A 2IGIA 1S1WA 1I94K 4PY5A 2XY7A 3WXKA 4DR3K 2VGMA 5BRFA 1YJ9N 4DB3A 3LDPA 5HP1A 3TSUA 3ZSZA 4ILGB 2EWSA 4N41A 2FBYA 3H45C 4KTZA 4BR0A 2RPIA 1NGCA 2A3ZA 3QFPA 3VGKA 3HPOA 3V81A 4CGGA 4JI0K 5T7BA 4FJIA 3NVMA 4GNIA 4RW8A 3G4SN 4E7HA 3L3VA 4C8MA 1L3TA 4JKCA 3LDSA 2XHBA 1P90A 1KRPA 3ZYYX 5AQVA 3KJVA 1WN7A 3MX2A 4LF5K 2HBLA 4J8FA 4CF8A 4H5WA 4CBWA 4B9NA 3BEXA 3SUPA 4B1YB 3AVKA 3WNFA 3CCLN 3SV4A 4OGCA 3ZT2A 3VEOA 3VF2A 3CMEN 3L3UA 1QZ5A 1RFQA 4A59A 5GIPA 1SKRA 3H3OB 5HLFA 1TL3A 1I39A 4J2DA 2A40A 1YXQA 3TSPA 1S1VA 3FGUA 4W5QA 3O8MA 3AARA 3A8YA 5C12A 4AM7A 4CK2A 5BRDA 3OA9A 4YORA 3TU5A 2NUBA 4CJ4A 3QINA 1RDBA 5CYMA 4PL7A 3MCPA 3VF4A 4HUFA 3CC7N 3CPWM 2ZM6K 5BREA 4CF9A 4E1JA 4UQGA 1N32K 2QXLA 3DMJA 4L3QA 5GAGP 4GVEA 3EL2A 2HHQA 2XO7A 4Z4GA 3ZSQA 3VQ7A 3ZT3A 3FR0A 1YAGA 3KKRA 4RTFD 5TKWA 3KWIA 4FJ9A 4O5FA 1T7PA 2IC3A 5AQPA 4WFAL 4MLHA 2IOCA 4CEBA 1ZBIA 4DCHA 2FBXA 4K42A 1NGHA 1QS4A 4B3RK 4BRLA 2KFNA 4BRIA 3P83D 3L2RA 2G8IA 2AJQA 1RGIA 4KH5A 2V51B 2A42A 4EHTA 2KTQA 4K0KK 1MWKA 3B6OA 5FROA 1GOCA 3CFPA 4O55A 3MXIA 4TSXA 4BC3A 5AQIA 4KTWA 2Q31A 5E41A 2UYTA 5D3GA 4MQ3A 4PKHA 5KPZA 4DSKA 1OH7A 2YNFA 3O9SA 2D0BA 4BRNA 4DTJA 3V6DA 4OPHA 3SYZA 1WSHA 3IFRA 1TKDA 3TAPA 3KTQA 5KPRA 1CLQA 3CHWA 3R9PA 4CJFA 4FW2A 2XY5A 3ZSOA 3U8XA 1VSMA 4F9OA 3KLIA 3VEZA 4M7YA 4CEOA 4BDPA 3Q7BA 3K59A 4OX9K 2QWRA 3EN9A 4BC5A 4WQ4A 4B9LA 4BR9A 2P9PB 3M6GA 2NRZA 4Z94A 3HM8A 2HHXA 2WUSA 3VQQA 5AZIB 1IBMK 4OKKA 5AQFA 3TABA 3RMBA 3UE5A 2JLEA 2PBDA 4IBNA 1VSFA 3HVTA 4M3YA 4XIUA 2UUCK 1T03A 1HNIA 3HRGA 4DUYK 2EX3A 3OJSA 3K5NA 4KB0A 3L4IA 3AAPA 3SQ4A 2D4WA 1QVGM 3P1GA 3A0IX 3LANA 1NGGA 1NGJA 2E2PA 1LAWA 3H6EA 5C24A 3WNHA 4FZZA 4O4GA 5CR4A 3MMVA 2WOMA 3CQYA 3H08A 3WEEB 4K41A 2XRIA 2AA4A 1HPZA 4ELUA 4DTPA 4CFDA 4IKFA 1FJGK 3LM9A 2FBVA 3ZSRA 1VSLA 2W41A 1KVBA 4CEFA 2G8KA 4HUEA 3TARA 4FWOA 2Y1IA 4HTLA 5M1QA 1C0UA 3QIOA 4OLBA 4ICLA 2QWLA 3JSMA 3CCRN 2IDOA 1JLCA 5AZIA 1RTIA 2I5JA 3HBTA 3LALA 5C0YA 4CBXA 5CYQA 4WE1A 4E7IA 3L2QA 4OPKA 4XH5A 3I55N 1DKGD 1ASUA 1WAFA 4CCHA 2P9UB 4NLCA 3QERA 2GV9A 1HYSA 3WXJA 3M8RA 5LMUK 2HSTA 1VQLN 3I33A 3CIPA 4WFBL 1L5UA 3ZSYA 2F4VK 2O8DA 3NCIA 3D45A 4BROA 2BUPA 1Z26A 1Y97A 4JKDA 3VEVA 3FFIA 4NYFA 3SJHA 3RMAA 2YJFA 3WEEA 3SBGA 3CJBA 3O6WA 1HUXA 1MU2A 3QESA 1F21A 3A5MC 4JLHA 1T6CA 4M7XA 2RKIA 2OA8A 1HNVA 4BC4A 4IJNA 3SLCA 3K5MA 3L2WA 1WOQA 3D2FB 3ALYA 4GMJB 1ATNA 1IKVA 3TR8A 4IJAA 3WXMB 2F7TA 1HLUA 4CJVA 2ITGA 4Z4HA 4DQ8A 3ZX2A 1QSSA 3OYJA 4AH9A 3EE8A 1GLDG 4CZFA 1G99A 2Z1HA 1XHXA 5M1FA 3J80O 2ZJRL 3EKUA 3G6EN 5AQZA 4JRPA 3QEVA 3E9PA 1NK4A 2OPSA 1E4FT 1ASWA 1UA1A 4FK4A 4FJ7A 2P9KB 4WQ5C 2E6LA 2QWPA 1NLVA 3AA3A 2F96A 3HI0A 4B9QA 3SPZA 4JK7A 4CIEA 1BU6O 3HVRA 4FVUA 2FSKA 2FSJA 4A5BA 3AAQA 4B1UB 4I2PA 3BF3A 5F0XA 3ZSXA 1U04A 2GUPA 3M1FA 3NF6A 4BGAA 5J2MA 1WAJA 3VQ6A 3AVMA 4DQPA 2KW4A 3L2UA 1BIZA 2YJEA 3TPQA 1QHTA 4V19S 3CM5A 2Z1IA 4DV7K 5J2NA 1JKHA 1HMVA 4FW1A 4BRMA 3UIQA 4RCHA 4C23A 5BN8A 2AP1A 3SZ2A 4DU3A 4LSNA 2P9IA 2X78A 4B1ZA 5FPEA 2E88A 4I7FA 2NRXA 4BR4A 1RT7A 1BGXT 4JRQA 3ID8A 3O9TA 4NCGA 1BI4B 2DFHA 4CI6A 5GIOA 2GEMA 1L3VA 2HHHK 4CIFA 4CW7B 5C2FA 4BVOA 2UUBK 4KHNA 3MXMA 5FDLA 4BRGA 3IKMA 3QIPA 2QWMA 4B8CA 1OVQA 4O5BA 1IO2A 3HT3A 2PAVA 2YHAA 4CGDA 2KFZA 4A2AA 4QS9A 4OPJA 1VQMN 5AFUA 5FPNA 2Q0UA 1J9AA 3ZX0A 4E7KA 2P5GA 2QTDA 3O9UA 3VQBA 4FOEA 3CCJN 1TK0A 2P9NB 1VQ8N 3E9OA 3ZT0A 3MECA 1SS6A 3C6HA 4NYNA 3MN5A 3E1YA 1K8KA 4OPAA 4AHRA 2NRRA 1VHXA 1LW2A 4DMNA 4YFUA 4A2BA 2D0OA 3B6PA 1U2VB 2G8WA 4DTOA 1NWKA 4M45A 4IFYA 4DTSA 4BRQA 3LM2A 5FLXO 5M1NA 1K6YA 4DQIA 4DV3K 3CYMA 4B08A 1BG3A 5CHIA 1IG9A 1BI4A 4FJ5A 2F8SA 3EY1A 4W5OA 2Z1GA 2BANA 2V7YA 4NCBA 2HHUA 1RDUA 4DWIA 4DTUA 2V52B 4WQ4C 4BGBA 3EO3A 3RMCA 4CGFA 4EP5A 2W42A 3KD1E 4JI1K 3AVHA 1RTHA 4E19A 2W6LA 1UAXA 2QW9A 1WSJA 1HNZK 4KKOA 1Z05A 1QTMA 3E9LA 2E2OA 2O8EA 4CHPA 4AF1A 5AQOA 3SUOA 1RT1A 4GW6A 3TAFA 4MO5A 3ZT4A 4A57A 3JS6A 4KHYA 1KXPA 4FM2A 4FWNA 1GLAG 4CJQA 2P51A 3U4LA 3KK1A 3GL1A 1U2VA 3PO4A 4AHTA 2HHSA 5BN9A 1YTAA 3R3LA 4XH4A 4DTXA 3H1VX 4KFBA 5AZJA 4EAHD 2E5LK 1TKXA 4KHPK 3LPUA 4YOYA 1M90O 4GV3A 2FBTA 3NF8A 2KHOA 5M1KA 4H5NA 4M3ZA 1NJWA 4ISFA 3THYA 3WXIA 3KZBA 2IIRA 3ITHA 1DEJA 1TK8A 1T8EA 3V1OA 3AO4A 4I9LA 2E1YA 3LAKA 4IXCA 1QQCA 3VQAA 3AGRA 4ZHRA 5ADXH 4JI2K 4KI6A 3TTCA 3A2FA 4AILC 4FPAA 4OGEA 3ULDA 1VRUA 1LW0A 3OYDA 2PYJA 1QSYA 3VA3A 3AVFA 1RBUA 3J81O 3GG4A 1VSKA 3MK6A 1JLEA 3NH2A 5EOYA 4JNEA 4B1XB 3CJAA 1RT5A 3VETA 4HTUA 3EEQA 3L6QA 3HO1A 3NAEA 1VQ4N 2PFUA 2Q3SA 3CQXA 5B8HA 5AQKA 1A5WA 2HBMA 3CETA 1NK7A 4FSVA 5CZ2A 4BC2A 1S1TA 3THWA 1O13A 3CXCM 1MWMA 4KHSA 3NH1A 3QEXA 1QQMA 2E20A 1KFDA 5TKYA 3C0BA 2KLAA 4FJ8A 1VRTA 5LL6Z 1HKBA 3K5LA 1NOZA 3MN6A 3HP9A 4BY9C 3Q7CA 1ASVA 2NRVA 1JCEA 1WUAA 5GADP 4B1VA 4PA1A 3MN7A 4FJGA 4KPYA 4E1MA 2YNIA 3UKRA 4ISEA 4I9QA 4KI4A 3OYGA 5KRSA 4CJRA 3IUCA 4DF4A 5EU7A 5I42A 3F5TA 3PSFA 3KVGA 4LF6K 4JKEA 2P9LB 1E3MA 2YHXA 4CFBA 3HL8A 2P9SB 4WQ5A 4B3MK 2DFEA 4ILHA 3D6RA 3LP2A 1NK0A 4BE0A 3GE1A 3GOIA 2W40A 3BUZB 5KRTA 1WLJA 2KZMA 1E4GT 4BRDA 3JXUA 1ESVA 5EX5A 3OYCA 4X62K 2ZGYA 4C8OA 4LSLA 3DLHA 4DKWA 4Z4FA 5AQUA 1BO5O 4FPBA 1RTDA 4PWDA 3AO3A 1R59O 1R0AA 2YNHA 4IFVA 1VQNN 1ZC6A 1A5XA 4JD2B 1C1CA 4B1WB 1VQ7N 4KH6A 3NH0A 3ENHA 1UA0A 1FXXA 4FCYA 4BR5A 5DK5A 4FL9A 3HOTA 3OYFA 4BWJA 2P9LA 2E6MA 3PLAA 2E8AA 3DLEA 2P9SA 3A5OC 4DLGA 4YOXA 1XNQK 3CPEA 1T3VA 2O8BA 4FLZA 3PO5A 3QB0A 1TL1A 1RDAA 3MEEA 3KK2A 3VGLA 5IWAK 1Y64A 3V9XA 4FM0A 3P4IA 2EHGA 2IAJA 2BGGA 1QSLA 4U67L 4CE9A 1SQKA 1YVNA 5LJVA 4JI4K 4FM1A 3R8EA 3OYLA 3B8AX 3OYEA 4CJTA 4FJNA 3H1QA 3VEWA 1KAXA 2O8FA 1VSIA 3MEGA 5AQYA 1WBBA 1SKWA 2KQ2A 3CJ7A 2HF4A 4AHSA 1RT2A 1CXQA 4LF8K 3FZHA 4JD2A 1IG8A 1YJNN 1ILYA 4OJRA 2VWBA 2D1KA 3SAHA 4AHVA 3HXMA 3NMUA 1S9EA 4CZLA 4CGJA 1O1WA 3QMLA 4JI8K 5KGWA 4E1NA 4CIGA 4NLBA 1JCFA 3VESA 3K5OA 4BR2A 4QCLA 3I56N 3VQ4A 1HPMA 4PQUA 3MDQA 3NE6A 2ZWHA 1XQSC 1IBLK 1JLFA 4ISGA 1BIUA 4JI7K 2ASMA 4DV2K 4MLEA 1NNEA 2A41A 5AQRA 3C6AA 3L8BA 2CH6A 3KK7A 3KLEA 5AQQA 3KK3A 3PIPL 3KIOA 3DYAA 2O8DB 3L0QA 3HTVA 4FLWA 2HMIA 3OYHA 2UXDK 5JS2A 4CEEA 3TANA 1NGDA 2JWKA 3M8QA 1T05A 1LWFA 1GOBA 2RHKA 2KKZA 3QEIA 1S1UA 4DG1A 1I3AA 3MWTA 1BISA 4Q0BA 1EP4A 4H0OA 3WUHA 3LWLA 1D9FA 4C1NI 2HNZA 3F9MA 1NGFA 4J2EA 1C6VA 4IO9L 4WYBA 4CBUA 3DXMA 5AQTA 4E3SA 5A2QO 4C1NK 3AVAA 4Y1CA 3HSTB 2Y1JA 4CESA 4MDAA 2HBJA 1B92A 2WFBA 1RT4A 2JGUA 1S6PA 1W97L 4IEIA 3ULEB 4OLAA 1FKPA 1CZ9A 3K9KA 4DR1K 1C1AA 2YHYA 2D5RA 2P1JA 4CZJA 4LF7K 2ZGZA 2A1SA 1IBKK 1K73O 3RR8A 4FO0A 4GV6A
chains in the Genus database with same CATH topology
1LWEA 1TGOA 1UWBA 4E7KA 2P5GA 4M3RA 3VQBA 3C6UA 3MEDA 3V9UA 4FVMA 3VQCA 1TK0A 2ETJA 3DM2A 3G10A 3CQ8A 1X9SA 2YHBA 3VQEA 3ZT0A 3NF9A 3MECA 3ASMA 3NDKA 4NYNA 1UOCA 2OPQA 1TKZA 4LH4A 3AVGA 3AA2A 4E0DA 2OPRA 4AHRA 4OKEA 4F3OA 4HHTA 2ATQA 3QEWA 4L8RB 3PY8A 3OYNA 3TAGA 4ZTFA 1LW2A 1HYVA 4DMNA 3O4NA 3DLGA 4IG0A 1EXQA 4YFUA 3DI6A 3B6PA 3TAMA 5HRSA 1VK0A 2XY8A 2D0AA 4DTOA 4CEQA 2IS3A 3DRPA 3O4QA 4N5SA 3PX6A 2DTUA 3HPHA 4IFYA 4M45A 5KI6A 1KFSA 4CK1A 1HQUA 4DTSA 3OS0A 4CF2A 2VG7A 3QNOA 3KKSA 4G1QA 3SQ0A 1SL0A 3LP1A 3WNEA 1K6YA 4O0IA 4DQIA 4M41A 3CYMA 2G8FA 4B08A 2G8HA 3IAYA 4F3TA 4H4MA 4RW7A 3VQ5A 1IG9A 1BI4A 3CFOA 2LSNA 4KHQA 4FJ5A 2F8SA 3EY1A 4W5OA 3F73A 2IGIA 4CHQA 1VSEA 2Z1GA 4AHCA 2BANA 1S1WA 3V9SA 1JLQA 4NCBA 4PY5A 2HHUA 2XY7A 4CFCA 3S9HA 4E7JA 4DWIA 4DTUA 3C6TA 4DSLA 1ZYQA 3OYKA 1KCFA 5HP1A 3RMCA 3SI6A 3T1AA 4KHWA 4CGFA 4EP5A 3ZSZA 2W42A 4N41A 4KTQA 2GUIA 3V4IA 3KD1E 2YKMA 1LAVA 3AVHA 2FBYA 1RTHA 4KTZA 4E19A 2RPIA 3AVJA 3NF7A 3V9WA 3HJFA 3D0PA 1UAXA 3HPOA 1WSJA 4W5TA 3V81A 4KKOA 3DLKA 4CGGA 5T7BA 4YNQA 1QTMA 5HRPA 3VN5A 3T3FA 2PY5A 4M3WA 4FJIA 3VQDA 3VQ8A 4RW8A 1N5YA 4CHPA 2QKBA 4CJPA 4E7HA 1NKBA 1ZBHA 3L3VA 4C8MA 1BHLA 3SUOA 2ZD1A 1L3TA 1RT1A 3NGIA 3LDSA 2XHBA 1LV5A 4GW6A 3TAFA 4FJLA 3ZT4A 4MFBA 4CEAA 3OYIA 1KRPA 4DS4A 4KHYA 1IKYA 4RW6A 3KJVA 1WN7A 4FM2A 1BQNA 1LWCA 4CGHA 4BACA 4Z4GA 3KLHA 3K2PA 4HVJA 2P5OA 3KD5E 4CF8A 1IKXA 1RCHA 2P51A 4CJQA 3KK1A 1EX4A 4FLTA 4B9NA 5HBMA 3AO5A 3PO4A 3LWMA 4AHTA 2HHSA 3BGRA 4DTXA 1YTAA 3SUPA 3RWUA 3RRGA 3AVKA 4JS4A 3WNFA 1TV6A 4KFBA 4FJHA 3EYZA 3SV4A 1SKRA 4B9VA 1J53A 4OGCA 3ZT2A 3AO1A 1TKXA 2G8UA 4CK3A 3DLRA 3L3UA 3LPUA 2HNDA 2FBTA 4FLXA 3AV9A 3IG1A 1NK6A 1QE1A 1U4BA 5HLFA 3NF8A 1TL3A 2YV0X 3LZIA 1J5OA 1I39A 4J2DA 1JLGA 4M3ZA 1NJWA 4FZXC 3OY9A 3BDPA 1S1VA 3AA4A 4W5QA 4B9MA 4FK0A 3AVIA 4Z4EA 3SQ2A 4CK2A 3ITHA 4DQSA 1WSFA 1TK8A 1T8EA 3V1OA 1RTJA 2QK9A 3O3FA 3AO4A 4I9LA 2NUBA 4O0JA 3QINA 4C8NA 4CJ4A 1RDBA 1RDDA 3LAKA 5CYMA 3ZT1A 3M8SA 3U6FA 4HUFA 5CZ1A 1QQCA 4DFJA 3S3NA 3VQAA 4ZHRA 3I0SA 3PV8A 4F4KA 4KI6A 4CF9A 2HB5A 3TI0A 1A5VA 4UQGA 1XHZA 3DMJA 5HRRA 2ZE2A 3ZSWA 1X9MA 1N6QA 4DTNA 1SKSA 3LPTA 2HHQA 1BCMA 3A2FA 2XO7A 4HUGA 3OVNA 2OPPA 4AILC 4K8XA 4Z0UA 3VQ7A 3ZSQA 3ZT3A 3KKRA 4OGEA 4M3TA 3ULDA 1VRUA 1LW0A 1XWLA 3OYDA 4FLUA 2PYJA 1QSYA 1YT3A 3AVFA 3VA3A 3ISNC 1W9HA 4FJXA 4FJ9A 1RBUA 1B9DA 1T7PA 3DLBA 2O4IA 2IC3A 1U48A 1VSKA 1JL2A 1JLEA 4EZ6A 2IOCA 4CEBA 4CGIA 1JXEA 3NH2A 1ZBIA 3C94A 1JLBA 1HJRA 1RT5A 2FBXA 4HTUA 1VSDA 1QS4A 3V1RA 3SUNA 3HO1A 3NAEA 2KFNA 3P83D 4LY7A 5FRNA 2RF2A 3AO2A 3L2RA 2G8IA 2AJQA 2Q3SA 1A5WA 4M3UA 2KTQA 4N56A 3B6OA 3I0RA 5FROA 1GOCA 3CFPA 1EKEA 2Z1JA 3TAQA 4O55A 5SZTA 3SNNA 3MXIA 1NK7A 4DSEA 4JS5A 2G8WA 5CZ2A 4TSXA 3THVA 1S1TA 4CJ5A 1Z25A 4KTWA 5J2PA 1WNSA 3K58A 2PYLA 4KHSA 3NH1A 4QAGA 1RBSA 3QEXA 4N76A 1NOYA 5E41A 4CJ3A 1KFDA 5D3GA 2VG5A 4MQ3A 4DU4A 3SCXA 1J54A 4DSKA 4FZYA 2YNFA 4FJ8A 2D0BA 1VRTA 3K5LA 1RBRA 4OVLA 1NOZA 4ID1A 4DTJA 1L3SA 3V6DA 3HP9A 3QETA 4J2AA 3SYZA 3DOLA 2KZZA 1WSHA 2X6SA 1TKDA 3TAPA 1ASVA 3KTQA 2BE2A 1CLQA 3DRSA 4CJFA 2BDPA 4PA1A 4FW2A 4CECA 5C42A 2RN2A 3AVCA 1NK8A 2XY5A 4FJGA 3ZSOA 1VSMA 2HHTA 3KLIA 4CEOA 4KPYA 4BDPA 4E1MA 3K59A 2YNIA 1NKCA 2O4GA 4I9QA 4CHNA 4KI4A 3AVLA 3OYGA 5KRSA 4CJRA 3NGZA 4B9LA 4DF4A 3OJUA 5EU7A 4AHUA 1JL1A 5I42A 1HYZA 1J9AA 4QOZB 2OYQA 5SWMA 2HHXA 5HRNA 4IG3A 3VQQA 1KVAA 4CFBA 1Q9XA 4HCCA 3HL8A 1JLAA 4OKKA 3TABA 2A1RA 3RMBA 1DTQA 2JLEA 2DFEA 4IBNA 3LP2A 2XY6A 1NK0A 4BE0A 3RRHA 3SV3A 1KLNA 1VSFA 3SQ1A 3HK2A 3HVTA 4M3YA 2DY4A 4XIUA 1T03A 5KRTA 3VQPA 1C0TA 1WLJA 2PZSA 3K57A 4DLEA 1HNIA 2KZMA 4E7LA 2EX3A 3ZCMA 3OJSA 3K5NA 4KB0A 4K8ZA 4Y1DA 4KO0A 3SQ4A 3SUQA 1C0MA 3P1GA 3OYCA 3LANA 4C8OA 3MXJA 4LSLA 3DLHA 1KVCA 4Z4FA 1ZBLA 1LAWA 1VSJA 1TVRA 4KAZA 5C24A 3WNHA 1L3UA 4KB1A 4FZZA 1WSIA 5JS1A 4CJEA 4CJKA 4O4GA 1RTDA 2WOMA 3H08A 4LH5A 4PWDA 3LAMA 4E89A 3AO3A 1D8YA 2XRIA 1U45A 1R0AA 4F8RA 2YNHA 1HPZA 4ELUA 4DTPA 1NJZA 4CFDA 1NK5A 3QEPA 4B9UA 4IKFA 4HCBA 3LP3A 2QXFA 4ELTA 4IFVA 5C25A 3NBPA 1SL2A 4O44A 2FBVA 3ZSRA 4CEDA 1VSLA 3V1QA 1A5XA 1C1CA 1KVBA 4CEFA 4W5NA 5K14A 1X1PA 3ZSVA 2G8KA 4HUEA 3TARA 3NH0A 4F2SA 2VWKA 3RTVA 1UA0A 1FXXA 2YKNA 2B5JA 1DLOA 3O3HA 3CFRA 4FCYA 2Y1IA 1Q9YA 1WSEA 1C0UA 3QIOA 5CY4A 3AVBA 4OLBA 5DK5A 1X9WA 4C8KA 1TAQA 4ICLA 3JSMA 3OYFA 4BWJA 2IDOA 3PX4A 1JLCA 2E6MA 4RW4A 4KHUA 1RTIA 2I5JA 3LALA 3T19A 3DLEA 4DF8A 2ZQBA 4CHZA 2D0CA 5CYQA 4WE1A 4DLGA 3L2QA 4E7IA 4OPKA 4DFMA 4FLZA 3PO5A 3OS2A 1TL1A 1RDAA 3CM6A 1ASUA 1WAFA 3MEEA 3U3YA 4CCHA 3KK2A 3QERA 1HYSA 2GV9A 3NFAA 1NK9A 4BE1A 1W0HA 3KLFA 3V9XA 4Z4IA 3M8RA 4FM0A 3HPGA 2YNGA 3QLHA 3QNNA 2EHGA 1L5UA 2IAJA 2BGGA 1QSLA 5KTQA 1XI1A 4FJMA 3ZSYA 4CE9A 1S5JA 1TAUA 4CFAA 4DSIA 3NCIA 3D45A 1Z26A 4CF0A 4FM1A 1Y97A 3OYLA 3OYEA 2F8TA 4FXDA 4CJTA 4CJLA 1IKWA 2HNYA 3FFIA 4NYFA 4ZTJA 4FJNA 2VG6A 3RMAA 3SJJA 1VSIA 3MEGA 3C95A 4CERA 4DQQA 4DFPA 1SKWA 4C8LA 1MU2A 2KQ2A 1REVA 5KGXA 3QESA 3OS1A 2HW3A 4AHSA 1CXQA 1RT2A 5HROA 3I8DA 1TK5A 1F21A 3TAEA 4FYDA 1S6QA 3HYFA 3G0ZA 4JLHA 1BQMA 2E4LA 1U49A 1WSGA 4B9TA 2RKIA 3JYTA 4RG8A 2OA8A 1HNVA 3P5JA 4OJRA 4EP4A 3HM9A 1RILA 2R7YA 3K5MA 1VSHA 3V9ZA 2X6NA 3L2WA 4FLYA 4B9SA 3NGYA 4Q5VA 2VWJA 4AHVA 3ALYA 1RT3A 1RBTA 4GMJB 3HXMA 1IKVA 3TR8A 3S3MA 1S9EA 4FJJA 4CGJA 1O1WA 3L2VA 1SV5A 2HHWA 1ZBFA 4CJSA 4CJVA 2HVHA 1C1BA 2ITGA 4Z4HA 1B9FA 1KTQA 1QSSA 4PUOA 3OYJA 1FK9A 4AH9A 5KGWA 2B4JA 4CF1A 4E1NA 3KLGA 4CIGA 4CHOA 4DFKA 2Z1HA 1XHXA 3O3GA 3K5OA 1NJYA 4QCLA 1ZBUA 3OYMA 3VQ4A 4FLVA 4PQUA 1ITGA 5J1EA 4FJKA 4JRPA 3NHGA 4BDZA 3QEVA 2OPSA 4DTMA 1JXBA 3S3OA 1NK4A 3NE6A 1ASWA 1RBVA 1UA1A 3VQ9A 3VA0A 1JLFA 3CG7A 2GBZA 1CZBA 4J2BA 1BIUA 1KSPA 4FJ7A 4FK2A 4FK4A 2E6LA 3WNGA 3AA3A 2F96A 1S1XA 3RR7A 3SPZA 3F9KA 4LD0A 1SL1A 4NCAA 4M3XA 4CIEA 1IH7A 1GOAA 3HVRA 2QKKA 3L8BA 1RDCA 5I3UA 4OKJA 3PUFA 4CJWA 3KLEA 1D9DA 3KK3A 4GVMA 3TWHA 3KIOA 2WONA 4I2PA 3DYAA 4BE2A 4CJUA 3ZSXA 4BWMA 1KLMA 1BL3A 1RNHA 1U04A 3NF6A 4B8AB 1TKTA 5J2MA 1WAJA 3VQ6A 4FLWA 3SPYA 4ID5A 4DTRA 1G15A 2HMIA 3AVMA 3OYHA 3HP6A 3LZJA 2G8VA 1YVUA 5JS2A 4DQPA 2KW4A 4KRFA 4KV8A 3L2UA 3DRRA 1BIZA 1EETA 4CEEA 4H8KA 4DS5A 4M42A 3U3GA 1SUQA 4CHYA 3OYAA 1QHTA 5J2QA 3AA5X 4BDYA 4ELVA 4N47A 1DTTA 3CM5A 2Z1IA 4W5RA 3TANA 4IDKA 1T05A 3M8QA 5J2NA 1LWFA 1JKHA 1GOBA 1HMVA 4FW1A 3UIQA 4EZ9A 2HVIA 1HQEA 2DFFA 3QEIA 4KREA 4RW9A 1S1UA 4DG1A 1I3AA 3EZ5A 4DSJA 1BISA 4Q0BA 1EP4A 1XC9A 3LWLA 1NJXA 1D9FA 2HNZA 2X74A 3SZ2A 4J2EA 4F2RA 4DU3A 1U47A 1C6VA 4LSNA 1FKOA 2X78A 2OZMA 2HHVA 4R5PA 4DQRA 4E3SA 3DOKA 4H4OA 3AVAA 4I7FA 1RT7A 1BGXT 4Y1CA 4JRQA 3HSTB 4DSFA 4NCGA 1BI4B 2DFHA 2B6AA 4CESA 3MAQA 1Q8IA 2FC0A 2Y1JA 1L3VA 3AVNA 4CIFA 4B3OA 1B92A 4KHNA 4DU1A 3OYBA 5FDLA 3PX0A 3MXMA 3E01A 1RT4A 2JGUA 3QIPA 1S6PA 4I2QA 4B8CA 3IRXA 1CXUA 5FRMA 4OLAA 1FKPA 1HRHA 4Z4CA 1CZ9A 1D5AA 3RMDA 5DMRA 1C1AA 4O5BA 2OZSA 1IO2A 2D5RA 2P1JA 3HT3A 1YTUA 3LP0A 3M8PA 4CEZA 2YHAA 4CGDA 2KFZA 2A1SA 4OPJA 1NKEA 1RT6A 3IS9A 3RR8A 1S9GA 1BCOA 3QO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWE A;  1TGO A;  1UWB A;  4E7K A;  2P5G A;  4M3R A;  3VQB A;  3C6U A;  3MED A;  3V9U A;  4FVM A;  3VQC A;  1TK0 A;  2ETJ A;  3DM2 A;  3G10 A;  3CQ8 A;  1X9S A;  2YHB A;  3VQE A;  3ZT0 A;  3NF9 A;  3MEC A;  3ASM A;  3NDK A;  4NYN A;  1UOC A;  2OPQ A;  1TKZ A;  4LH4 A;  3AVG A;  3AA2 A;  4E0D A;  2OPR A;  4AHR A;  4OKE A;  4F3O A;  4HHT A;  2ATQ A;  3QEW A;  4L8R B;  3PY8 A;  3OYN A;  3TAG A;  4ZTF A;  1LW2 A;  1HYV A;  4DMN A;  3O4N A;  3DLG A;  4IG0 A;  1EXQ A;  4YFU A;  3DI6 A;  3B6P A;  3TAM A;  5HRS A;  1VK0 A;  2XY8 A;  2D0A A;  4DTO A;  4CEQ A;  2IS3 A;  3DRP A;  3O4Q A;  4N5S A;  3PX6 A;  2DTU A;  3HPH A;  4IFY A;  4M45 A;  5KI6 A;  1KFS A;  4CK1 A;  1HQU A;  4DTS A;  3OS0 A;  4CF2 A;  2VG7 A;  3QNO A;  3KKS A;  4G1Q A;  3SQ0 A;  1SL0 A;  3LP1 A;  3WNE A;  1K6Y A;  4O0I A;  4DQI A;  4M41 A;  3CYM A;  2G8F A;  4B08 A;  2G8H A;  3IAY A;  4F3T A;  4H4M A;  4RW7 A;  3VQ5 A;  1IG9 A;  1BI4 A;  3CFO A;  2LSN A;  4KHQ A;  4FJ5 A;  2F8S A;  3EY1 A;  4W5O A;  3F73 A;  2IGI A;  4CHQ A;  1VSE A;  2Z1G A;  4AHC A;  2BAN A;  1S1W A;  3V9S A;  1JLQ A;  4NCB A;  4PY5 A;  2HHU A;  2XY7 A;  4CFC A;  3S9H A;  4E7J A;  4DWI A;  4DTU A;  3C6T A;  4DSL A;  1ZYQ A;  3OYK A;  1KCF A;  5HP1 A;  3RMC A;  3SI6 A;  3T1A A;  4KHW A;  4CGF A;  4EP5 A;  3ZSZ A;  2W42 A;  4N41 A;  4KTQ A;  2GUI A;  3V4I A;  3KD1 E;  2YKM A;  1LAV A;  3AVH A;  2FBY A;  1RTH A;  4KTZ A;  4E19 A;  2RPI A;  3AVJ A;  3NF7 A;  3V9W A;  3HJF A;  3D0P A;  1UAX A;  3HPO A;  1WSJ A;  4W5T A;  3V81 A;  4KKO A;  3DLK A;  4CGG A;  5T7B A;  4YNQ A;  1QTM A;  5HRP A;  3VN5 A;  3T3F A;  2PY5 A;  4M3W A;  4FJI A;  3VQD A;  3VQ8 A;  4RW8 A;  1N5Y A;  4CHP A;  2QKB A;  4CJP A;  4E7H A;  1NKB A;  1ZBH A;  3L3V A;  4C8M A;  1BHL A;  3SUO A;  2ZD1 A;  1L3T A;  1RT1 A;  3NGI A;  3LDS A;  2XHB A;  1LV5 A;  4GW6 A;  3TAF A;  4FJL A;  3ZT4 A;  4MFB A;  4CEA A;  3OYI A;  1KRP A;  4DS4 A;  4KHY A;  1IKY A;  4RW6 A;  3KJV A;  1WN7 A;  4FM2 A;  1BQN A;  1LWC A;  4CGH A;  4BAC A;  4Z4G A;  3KLH A;  3K2P A;  4HVJ A;  2P5O A;  3KD5 E;  4CF8 A;  1IKX A;  1RCH A;  2P51 A;  4CJQ A;  3KK1 A;  1EX4 A;  4FLT A;  4B9N A;  5HBM A;  3AO5 A;  3PO4 A;  3LWM A;  4AHT A;  2HHS A;  3BGR A;  4DTX A;  1YTA A;  3SUP A;  3RWU A;  3RRG A;  3AVK A;  4JS4 A;  3WNF A;  1TV6 A;  4KFB A;  4FJH A;  3EYZ A;  3SV4 A;  1SKR A;  4B9V A;  1J53 A;  4OGC A;  3ZT2 A;  3AO1 A;  1TKX A;  2G8U A;  4CK3 A;  3DLR A;  3L3U A;  3LPU A;  2HND A;  2FBT A;  4FLX A;  3AV9 A;  3IG1 A;  1NK6 A;  1QE1 A;  1U4B A;  5HLF A;  3NF8 A;  1TL3 A;  2YV0 X;  3LZI A;  1J5O A;  1I39 A;  4J2D A;  1JLG A;  4M3Z A;  1NJW A;  4FZX C;  3OY9 A;  3BDP A;  1S1V A;  3AA4 A;  4W5Q A;  4B9M A;  4FK0 A;  3AVI A;  4Z4E A;  3SQ2 A;  4CK2 A;  3ITH A;  4DQS A;  1WSF A;  1TK8 A;  1T8E A;  3V1O A;  1RTJ A;  2QK9 A;  3O3F A;  3AO4 A;  4I9L A;  2NUB A;  4O0J A;  3QIN A;  4C8N A;  4CJ4 A;  1RDB A;  1RDD A;  3LAK A;  5CYM A;  3ZT1 A;  3M8S A;  3U6F A;  4HUF A;  5CZ1 A;  1QQC A;  4DFJ A;  3S3N A;  3VQA A;  4ZHR A;  3I0S A;  3PV8 A;  4F4K A;  4KI6 A;  4CF9 A;  2HB5 A;  3TI0 A;  1A5V A;  4UQG A;  1XHZ A;  3DMJ A;  5HRR A;  2ZE2 A;  3ZSW A;  1X9M A;  1N6Q A;  4DTN A;  1SKS A;  3LPT A;  2HHQ A;  1BCM A;  3A2F A;  2XO7 A;  4HUG A;  3OVN A;  2OPP A;  4AIL C;  4K8X A;  4Z0U A;  3VQ7 A;  3ZSQ A;  3ZT3 A;  3KKR A;  4OGE A;  4M3T A;  3ULD A;  1VRU A;  1LW0 A;  1XWL A;  3OYD A;  4FLU A;  2PYJ A;  1QSY A;  1YT3 A;  3AVF A;  3VA3 A;  3ISN C;  1W9H A;  4FJX A;  4FJ9 A;  1RBU A;  1B9D A;  1T7P A;  3DLB A;  2O4I A;  2IC3 A;  1U48 A;  1VSK A;  1JL2 A;  1JLE A;  4EZ6 A;  2IOC A;  4CEB A;  4CGI A;  1JXE A;  3NH2 A;  1ZBI A;  3C94 A;  1JLB A;  1HJR A;  1RT5 A;  2FBX A;  4HTU A;  1VSD A;  1QS4 A;  3V1R A;  3SUN A;  3HO1 A;  3NAE A;  2KFN A;  3P83 D;  4LY7 A;  5FRN A;  2RF2 A;  3AO2 A;  3L2R A;  2G8I A;  2AJQ A;  2Q3S A;  1A5W A;  4M3U A;  2KTQ A;  4N56 A;  3B6O A;  3I0R A;  5FRO A;  1GOC A;  3CFP A;  1EKE A;  2Z1J A;  3TAQ A;  4O55 A;  5SZT A;  3SNN A;  3MXI A;  1NK7 A;  4DSE A;  4JS5 A;  2G8W A;  5CZ2 A;  4TSX A;  3THV A;  1S1T A;  4CJ5 A;  1Z25 A;  4KTW A;  5J2P A;  1WNS A;  3K58 A;  2PYL A;  4KHS A;  3NH1 A;  4QAG A;  1RBS A;  3QEX A;  4N76 A;  1NOY A;  5E41 A;  4CJ3 A;  1KFD A;  5D3G A;  2VG5 A;  4MQ3 A;  4DU4 A;  3SCX A;  1J54 A;  4DSK A;  4FZY A;  2YNF A;  4FJ8 A;  2D0B A;  1VRT A;  3K5L A;  1RBR A;  4OVL A;  1NOZ A;  4ID1 A;  4DTJ A;  1L3S A;  3V6D A;  3HP9 A;  3QET A;  4J2A A;  3SYZ A;  3DOL A;  2KZZ A;  1WSH A;  2X6S A;  1TKD A;  3TAP A;  1ASV A;  3KTQ A;  2BE2 A;  1CLQ A;  3DRS A;  4CJF A;  2BDP A;  4PA1 A;  4FW2 A;  4CEC A;  5C42 A;  2RN2 A;  3AVC A;  1NK8 A;  2XY5 A;  4FJG A;  3ZSO A;  1VSM A;  2HHT A;  3KLI A;  4CEO A;  4KPY A;  4BDP A;  4E1M A;  3K59 A;  2YNI A;  1NKC A;  2O4G A;  4I9Q A;  4CHN A;  4KI4 A;  3AVL A;  3OYG A;  5KRS A;  4CJR A;  3NGZ A;  4B9L A;  4DF4 A;  3OJU A;  5EU7 A;  4AHU A;  1JL1 A;  5I42 A;  1HYZ A;  1J9A A;  4QOZ B;  2OYQ A;  5SWM A;  2HHX A;  5HRN A;  4IG3 A;  3VQQ A;  1KVA A;  4CFB A;  1Q9X A;  4HCC A;  3HL8 A;  1JLA A;  4OKK A;  3TAB A;  2A1R A;  3RMB A;  1DTQ A;  2JLE A;  2DFE A;  4IBN A;  3LP2 A;  2XY6 A;  1NK0 A;  4BE0 A;  3RRH A;  3SV3 A;  1KLN A;  1VSF A;  3SQ1 A;  3HK2 A;  3HVT A;  4M3Y A;  2DY4 A;  4XIU A;  1T03 A;  5KRT A;  3VQP A;  1C0T A;  1WLJ A;  2PZS A;  3K57 A;  4DLE A;  1HNI A;  2KZM A;  4E7L A;  2EX3 A;  3ZCM A;  3OJS A;  3K5N A;  4KB0 A;  4K8Z A;  4Y1D A;  4KO0 A;  3SQ4 A;  3SUQ A;  1C0M A;  3P1G A;  3OYC A;  3LAN A;  4C8O A;  3MXJ A;  4LSL A;  3DLH A;  1KVC A;  4Z4F A;  1ZBL A;  1LAW A;  1VSJ A;  1TVR A;  4KAZ A;  5C24 A;  3WNH A;  1L3U A;  4KB1 A;  4FZZ A;  1WSI A;  5JS1 A;  4CJE A;  4CJK A;  4O4G A;  1RTD A;  2WOM A;  3H08 A;  4LH5 A;  4PWD A;  3LAM A;  4E89 A;  3AO3 A;  1D8Y A;  2XRI A;  1U45 A;  1R0A A;  4F8R A;  2YNH A;  1HPZ A;  4ELU A;  4DTP A;  1NJZ A;  4CFD A;  1NK5 A;  3QEP A;  4B9U A;  4IKF A;  4HCB A;  3LP3 A;  2QXF A;  4ELT A;  4IFV A;  5C25 A;  3NBP A;  1SL2 A;  4O44 A;  2FBV A;  3ZSR A;  4CED A;  1VSL A;  3V1Q A;  1A5X A;  1C1C A;  1KVB A;  4CEF A;  4W5N A;  5K14 A;  1X1P A;  3ZSV A;  2G8K A;  4HUE A;  3TAR A;  3NH0 A;  4F2S A;  2VWK A;  3RTV A;  1UA0 A;  1FXX A;  2YKN A;  2B5J A;  1DLO A;  3O3H A;  3CFR A;  4FCY A;  2Y1I A;  1Q9Y A;  1WSE A;  1C0U A;  3QIO A;  5CY4 A;  3AVB A;  4OLB A;  5DK5 A;  1X9W A;  4C8K A;  1TAQ A;  4ICL A;  3JSM A;  3OYF A;  4BWJ A;  2IDO A;  3PX4 A;  1JLC A;  2E6M A;  4RW4 A;  4KHU A;  1RTI A;  2I5J A;  3LAL A;  3T19 A;  3DLE A;  4DF8 A;  2ZQB A;  4CHZ A;  2D0C A;  5CYQ A;  4WE1 A;  4DLG A;  3L2Q A;  4E7I A;  4OPK A;  4DFM A;  4FLZ A;  3PO5 A;  3OS2 A;  1TL1 A;  1RDA A;  3CM6 A;  1ASU A;  1WAF A;  3MEE A;  3U3Y A;  4CCH A;  3KK2 A;  3QER A;  1HYS A;  2GV9 A;  3NFA A;  1NK9 A;  4BE1 A;  1W0H A;  3KLF A;  3V9X A;  4Z4I A;  3M8R A;  4FM0 A;  3HPG A;  2YNG A;  3QLH A;  3QNN A;  2EHG A;  1L5U A;  2IAJ A;  2BGG A;  1QSL A;  5KTQ A;  1XI1 A;  4FJM A;  3ZSY A;  4CE9 A;  1S5J A;  1TAU A;  4CFA A;  4DSI A;  3NCI A;  3D45 A;  1Z26 A;  4CF0 A;  4FM1 A;  1Y97 A;  3OYL A;  3OYE A;  2F8T A;  4FXD A;  4CJT A;  4CJL A;  1IKW A;  2HNY A;  3FFI A;  4NYF A;  4ZTJ A;  4FJN A;  2VG6 A;  3RMA A;  3SJJ A;  1VSI A;  3MEG A;  3C95 A;  4CER A;  4DQQ A;  4DFP A;  1SKW A;  4C8L A;  1MU2 A;  2KQ2 A;  1REV A;  5KGX A;  3QES A;  3OS1 A;  2HW3 A;  4AHS A;  1CXQ A;  1RT2 A;  5HRO A;  3I8D A;  1TK5 A;  1F21 A;  3TAE A;  4FYD A;  1S6Q A;  3HYF A;  3G0Z A;  4JLH A;  1BQM A;  2E4L A;  1U49 A;  1WSG A;  4B9T A;  2RKI A;  3JYT A;  4RG8 A;  2OA8 A;  1HNV A;  3P5J A;  4OJR A;  4EP4 A;  3HM9 A;  1RIL A;  2R7Y A;  3K5M A;  1VSH A;  3V9Z A;  2X6N A;  3L2W A;  4FLY A;  4B9S A;  3NGY A;  4Q5V A;  2VWJ A;  4AHV A;  3ALY A;  1RT3 A;  1RBT A;  4GMJ B;  3HXM A;  1IKV A;  3TR8 A;  3S3M A;  1S9E A;  4FJJ A;  4CGJ A;  1O1W A;  3L2V A;  1SV5 A;  2HHW A;  1ZBF A;  4CJS A;  4CJV A;  2HVH A;  1C1B A;  2ITG A;  4Z4H A;  1B9F A;  1KTQ A;  1QSS A;  4PUO A;  3OYJ A;  1FK9 A;  4AH9 A;  5KGW A;  2B4J A;  4CF1 A;  4E1N A;  3KLG A;  4CIG A;  4CHO A;  4DFK A;  2Z1H A;  1XHX A;  3O3G A;  3K5O A;  1NJY A;  4QCL A;  1ZBU A;  3OYM A;  3VQ4 A;  4FLV A;  4PQU A;  1ITG A;  5J1E A;  4FJK A;  4JRP A;  3NHG A;  4BDZ A;  3QEV A;  2OPS A;  4DTM A;  1JXB A;  3S3O A;  1NK4 A;  3NE6 A;  1ASW A;  1RBV A;  1UA1 A;  3VQ9 A;  3VA0 A;  1JLF A;  3CG7 A;  2GBZ A;  1CZB A;  4J2B A;  1BIU A;  1KSP A;  4FJ7 A;  4FK2 A;  4FK4 A;  2E6L A;  3WNG A;  3AA3 A;  2F96 A;  1S1X A;  3RR7 A;  3SPZ A;  3F9K A;  4LD0 A;  1SL1 A;  4NCA A;  4M3X A;  4CIE A;  1IH7 A;  1GOA A;  3HVR A;  2QKK A;  3L8B A;  1RDC A;  5I3U A;  4OKJ A;  3PUF A;  4CJW A;  3KLE A;  1D9D A;  3KK3 A;  4GVM A;  3TWH A;  3KIO A;  2WON A;  4I2P A;  3DYA A;  4BE2 A;  4CJU A;  3ZSX A;  4BWM A;  1KLM A;  1BL3 A;  1RNH A;  1U04 A;  3NF6 A;  4B8A B;  1TKT A;  5J2M A;  1WAJ A;  3VQ6 A;  4FLW A;  3SPY A;  4ID5 A;  4DTR A;  1G15 A;  2HMI A;  3AVM A;  3OYH A;  3HP6 A;  3LZJ A;  2G8V A;  1YVU A;  5JS2 A;  4DQP A;  2KW4 A;  4KRF A;  4KV8 A;  3L2U A;  3DRR A;  1BIZ A;  1EET A;  4CEE A;  4H8K A;  4DS5 A;  4M42 A;  3U3G A;  1SUQ A;  4CHY A;  3OYA A;  1QHT A;  5J2Q A;  3AA5 X;  4BDY A;  4ELV A;  4N47 A;  1DTT A;  3CM5 A;  2Z1I A;  4W5R A;  3TAN A;  4IDK A;  1T05 A;  3M8Q A;  5J2N A;  1LWF A;  1JKH A;  1GOB A;  1HMV A;  4FW1 A;  3UIQ A;  4EZ9 A;  2HVI A;  1HQE A;  2DFF A;  3QEI A;  4KRE A;  4RW9 A;  1S1U A;  4DG1 A;  1I3A A;  3EZ5 A;  4DSJ A;  1BIS A;  4Q0B A;  1EP4 A;  1XC9 A;  3LWL A;  1NJX A;  1D9F A;  2HNZ A;  2X74 A;  3SZ2 A;  4J2E A;  4F2R A;  4DU3 A;  1U47 A;  1C6V A;  4LSN A;  1FKO A;  2X78 A;  2OZM A;  2HHV A;  4R5P A;  4DQR A;  4E3S A;  3DOK A;  4H4O A;  3AVA A;  4I7F A;  1RT7 A;  1BGX T;  4Y1C A;  4JRQ A;  3HST B;  4DSF A;  4NCG A;  1BI4 B;  2DFH A;  2B6A A;  4CES A;  3MAQ A;  1Q8I A;  2FC0 A;  2Y1J A;  1L3V A;  3AVN A;  4CIF A;  4B3O A;  1B92 A;  4KHN A;  4DU1 A;  3OYB A;  5FDL A;  3PX0 A;  3MXM A;  3E01 A;  1RT4 A;  2JGU A;  3QIP A;  1S6P A;  4I2Q A;  4B8C A;  3IRX A;  1CXU A;  5FRM A;  4OLA A;  1FKP A;  1HRH A;  4Z4C A;  1CZ9 A;  1D5A A;  3RMD A;  5DMR A;  1C1A A;  4O5B A;  2OZS A;  1IO2 A;  2D5R A;  2P1J A;  3HT3 A;  1YTU A;  3LP0 A;  3M8P A;  4CEZ A;  2YHA A;  4CGD A;  2KFZ A;  2A1S A;  4OPJ A;  1NKE A;  1RT6 A;  3IS9 A;  3RR8 A;  1S9G A;  1BCO A;  3QO9 A; 
#chains in the Genus database with same CATH topology
 1TGO A;  1UWB A;  3E66 A;  4FVM A;  1ZBS A;  1Q86 O;  3G10 A;  4IEE A;  5LY3 A;  1T44 A;  2QWO A;  3ASM A;  1UOC A;  2OPQ A;  1GLF O;  1TKZ A;  3AVG A;  3AA2 A;  4KBO A;  3O80 A;  4LH4 A;  5KQD A;  1IV0 A;  4HHT A;  2VQF K;  3PY8 A;  3TAG A;  2HMP A;  5AQW A;  1HYV A;  3QBW A;  3DLG A;  4IG0 A;  1EXQ A;  1DT9 A;  5HRS A;  1VK0 A;  2XY8 A;  2D0A A;  2IS3 A;  2NRH A;  1KFS A;  4C8L A;  3KKS A;  4G1Q A;  3WNE A;  1EWR A;  3VER A;  3QIC A;  4M41 A;  2G8H A;  4F3T A;  4H4M A;  3VQ5 A;  3F73 A;  4AHC A;  2P9I B;  4CFC A;  2WBN A;  3ZET A;  1TYQ A;  2V7Z A;  3ULE A;  3CCQ N;  1ZYQ A;  3OYK A;  3T1A A;  4KHW A;  4KTQ A;  3V4I A;  2YKM A;  1KD1 O;  1LAV A;  2VYP A;  3OTO K;  3V9W A;  3MN9 A;  1DGK N;  4JKA A;  4YOT A;  2GEL A;  4W5T A;  4AQY K;  4YNQ A;  3VN5 A;  1GLE G;  3SK3 A;  2QKB A;  1NKB A;  1BHL A;  3CCU N;  3NGI A;  1BUP A;  2A5X A;  1LV5 A;  4PHT X;  4DS4 A;  1IKY A;  4RW6 A;  3U9D A;  3W3D A;  1XMO K;  1LWC A;  4BAC A;  3OHR A;  4CZE A;  3VOV A;  5LMN K;  4HVJ A;  2P5O A;  3VEY A;  1N8R O;  3KD5 E;  1IKX A;  1HR0 K;  1EX4 A;  4FLT A;  3AO5 A;  3LWM A;  3BGR A;  4JS4 A;  4FJH A;  1K8K B;  3FZM A;  3EYZ A;  2WC9 A;  1X3M A;  2G8U A;  1ZXO A;  2HND A;  3AV9 A;  1NK6 A;  1U4B A;  4IOA L;  3LZI A;  4FZX C;  3BDP A;  5BPL A;  5JVH L;  3VTH A;  5EVZ A;  5E26 A;  4LFA K;  3AVI A;  4Z4E A;  1IJJ A;  4QS8 A;  1NG9 A;  1RTJ A;  3O3F A;  4O0J A;  4B9U A;  4C8N A;  1RDD A;  3U6F A;  4DFJ A;  1NMD A;  3I0S A;  3PV8 A;  2HB5 A;  3TI0 A;  1A5V A;  1OKJ A;  1XHZ A;  2ZE2 A;  1X9M A;  4LFC K;  3OBY A;  1SKS A;  4X66 K;  3LPT A;  1BCM A;  3O9R A;  3VEX A;  2OPP A;  4O8K A;  4K8X A;  4BRA A;  3O4W A;  4M3T A;  1ATR A;  1XWL A;  3P38 A;  3DXK A;  4Y0W A;  1B9D A;  3HOS A;  3CCE N;  2UXC K;  3QBX A;  4A5A A;  4EZ6 A;  2O8E B;  4CGI A;  1JXE A;  5E84 A;  3C94 A;  1WB9 A;  4JN4 A;  1JLB A;  1HJR A;  1KAY A;  1HJO A;  3MWP A;  4LY7 A;  3AO2 A;  4K25 A;  4M3U A;  4N56 A;  3CC2 N;  3TAQ A;  1EKE A;  2Z1J A;  3CI5 A;  3SNN A;  4JS5 A;  2OCE A;  1VQ6 N;  3THV A;  3THX B;  4CJ5 A;  1Z25 A;  1BDG A;  4DR6 K;  5AZJ B;  4N76 A;  4BRE A;  1NOY A;  5EY4 A;  2VG5 A;  4DU4 A;  3SCX A;  1RBR A;  2DPN A;  3M3Z A;  1TUU A;  3R6M A;  1BOT O;  3DOL A;  4BRC A;  2GTD A;  2X6S A;  3THY B;  2ZJQ L;  2BE2 A;  4GY2 B;  1U6Z A;  2RE2 A;  4YY3 K;  2BDP A;  4CEC A;  3ATU A;  2F9T A;  1XMQ K;  5C42 A;  2RN2 A;  1NK8 A;  1K8A O;  3N4P A;  2ZJP L;  2O4G A;  3LDO A;  4CHN A;  1VQ9 N;  5AQN A;  3NGZ A;  1GLL O;  4A61 A;  4YOU A;  3OJU A;  4QOZ B;  1JL1 A;  1HYZ A;  4DV4 K;  1BWF O;  4IG3 A;  1LOT B;  1KVA A;  5LJW A;  4CJ7 A;  1Q9X A;  4HCC A;  5DM7 L;  2JWL A;  3A5N C;  3OW2 M;  2A1R A;  2GWK A;  4ILJ A;  1KLN A;  3HK2 A;  3SQ1 A;  1WBD A;  3ENO A;  3ZCM A;  5AQS A;  4GV9 A;  4K8Z A;  4Y1D A;  3VF6 A;  3THX A;  1C0M A;  4IOC L;  3MXJ A;  4R79 A;  3ZX3 A;  3CER A;  3IMX A;  1BA0 A;  5JS1 A;  3THW B;  1QVF M;  3LAM A;  1D8Y A;  4CVN E;  4F8R A;  5GIN A;  3QEP A;  3LP3 A;  4ELT A;  5C25 A;  3DAW A;  3NBP A;  1QHA A;  1SL2 A;  4CED A;  4JKG B;  3V1Q A;  5K14 A;  1X1P A;  3ZSV A;  3NVK A;  2NRT A;  2VWK A;  4F2S A;  3H46 O;  2QI2 A;  3O3H A;  3CFR A;  1Q82 O;  1WSE A;  3AVB A;  1TAQ A;  1GLB G;  3BF1 A;  3T19 A;  3UKR B;  4CHZ A;  2D0C A;  4OO1 J;  1YHQ N;  5AQJ A;  3EZW A;  3LDL A;  4XEI A;  3NFA A;  2FLO A;  2OTL N;  1W0H A;  3KLF A;  2YCH A;  3HPG A;  2YNG A;  3QNN A;  5MLC Q;  3CJ1 A;  1XI1 A;  4FJM A;  3KWG A;  5M1O A;  4G9Z A;  2J4R A;  1TAU A;  4DSI A;  2WTU A;  5IT9 O;  4JAX A;  2F8T A;  2H3G X;  4FXD A;  3FZF A;  3C95 A;  3BZK A;  5JLF A;  1N36 K;  3VPZ A;  4EIA A;  2IVN A;  3OS1 A;  5HRO A;  4H0V B;  4CD3 A;  1BA1 A;  3TAE A;  3HYF A;  1U49 A;  3G0Z A;  4JKG A;  3VEN A;  1W2B M;  4FYD A;  1WSG A;  5FPD A;  2UUA K;  1YI2 N;  3P5J A;  3H3N O;  2R7Y A;  3BP8 A;  3M5R A;  3V9Z A;  4FLY A;  4B9S A;  1OVY A;  5AQL A;  3NGY A;  4Q5V A;  2QEX N;  4QS7 A;  2CH5 A;  1RT3 A;  1RBT A;  2ASO A;  3D2E A;  2CGL A;  4H5V A;  4FJJ A;  3L2V A;  2HHW A;  2E2N A;  1C1B A;  3FE1 A;  1KTQ A;  3CC4 N;  3T69 A;  1FK9 A;  2B4J A;  1QZ6 A;  3O3G A;  1ZBU A;  3OYM A;  4FLV A;  4FJK A;  4BDZ A;  4DTM A;  1JXB A;  4H0X B;  5I9E B;  1YF5 L;  3VQ9 A;  2O8B B;  3VA0 A;  3CG7 A;  4J2B A;  1CZB A;  4FK2 A;  4NXM K;  1T6D A;  3RR7 A;  5JMV A;  3F9K A;  1IH7 A;  1GOA A;  3O1B A;  5I3U A;  4OKJ A;  3PUF A;  4CJW A;  4LC9 B;  1D9D A;  4GVM A;  4MDB A;  4BE2 A;  4CJU A;  3UKU A;  1S3X A;  1TKT A;  3SPY A;  4ID5 A;  5M1P A;  2G8V A;  3LZJ A;  4KV8 A;  4BG9 A;  3DRR A;  3J7Z O;  1EET A;  2O8F B;  4H8K A;  4A62 A;  3U3G A;  1NGI A;  3SAF A;  1NBW A;  1SUQ A;  3RVC A;  2ZF5 O;  4CZM A;  5J2Q A;  3AA5 X;  4ELV A;  1DTT A;  1N34 K;  4FWM A;  4W5R A;  4IDK A;  4FWK A;  4EZ9 A;  2HVI A;  1JCG A;  1HQE A;  3AY9 A;  4GKK K;  3U9Z A;  4FWR A;  5ADX A;  4CZH A;  1NJX A;  2YHW A;  1U47 A;  1JJ2 M;  2HHV A;  4R5P A;  4XH1 A;  4MO4 A;  4M63 C;  1Q9Y A;  2B6A A;  1Q8I A;  2FC0 A;  4K43 A;  4JI5 K;  1MA9 B;  3SBT A;  3PX0 A;  3OYB A;  4FOI A;  1YIT N;  2Q97 A;  3I8B A;  3PSI A;  1HRH A;  4Z4C A;  1D5A A;  3RMD A;  5DMR A;  2OZS A;  1YTU A;  4JKH A;  4X64 K;  4IWV A;  3T7Z A;  1NKE A;  1NU0 A;  1RT6 A;  5F1X A;  3P39 A;  4KH4 A;  1S9G A;  4IDH A;  1BCO A;  3QO9 A;  3ATV A;  4M3R A;  3V9U A;  4NO7 A;  3C7N B;  3VQE A;  3ZLJ A;  3NF9 A;  4NXN K;  3DLL L;  2OPR A;  4F3O A;  4JKB A;  5JIC A;  2ATQ A;  3CCV N;  3DI6 A;  3TAM A;  4I6M B;  3PX6 A;  3DRP A;  4N5S A;  2QWN A;  2YX6 A;  5KI6 A;  2OYQ A;  5BPN A;  1HQU A;  3QNO A;  3OS0 A;  4CF2 A;  2VG7 A;  1SL0 A;  5BRH A;  1SZ2 A;  3ID6 A;  4O0I A;  4DUZ K;  4DR5 K;  2G8F A;  4U7B A;  3CFO A;  4FWQ A;  2LSN A;  4KHQ A;  4CHQ A;  1VSE A;  1S72 N;  1Q18 A;  3V9S A;  1JLQ A;  2O8C B;  3DXM B;  3S9H A;  5ELZ A;  4E7J A;  3C6T A;  2E2Q A;  4DSL A;  1KCF A;  3SI6 A;  2GWJ A;  5AJ3 K;  2GUI A;  3HJF A;  3ENB A;  3AVJ A;  3NF7 A;  4NB4 A;  2IVO A;  3D0P A;  5FPM A;  3CJC A;  5AR0 A;  5AQM A;  3DLK A;  2UU9 K;  5HRP A;  3T3F A;  2PY5 A;  4B3T K;  4M3W A;  4JEP A;  3VQD A;  3VQ8 A;  4CZI A;  2UXB K;  1N5Y A;  1HNW K;  1RDW X;  4CJP A;  5HL7 L;  1ZBH A;  3C7N A;  2ZD1 A;  4JYA K;  4FJL A;  4CEA A;  4MFB A;  3OYI A;  1BQN A;  4CGH A;  3KLH A;  1NMN A;  1YIJ N;  4LF9 K;  3K2P A;  5EXW A;  1RCH A;  2FXU A;  3EKS A;  5HBM A;  4I6M A;  3RWU A;  3RRG A;  2F9W A;  1NGA A;  1TV6 A;  4B9V A;  4LF4 K;  1J53 A;  3AO1 A;  4YOV A;  1YUW A;  4CK3 A;  1HKG A;  3DLR A;  4WF9 L;  1HNX K;  4FLX A;  3IG1 A;  1J5O A;  1QE1 A;  2YV0 X;  1JLG A;  2O8C A;  3WQT A;  1X9J A;  3S41 A;  3OY9 A;  1OH6 A;  3AA4 A;  3O9Q A;  4B9M A;  1FW6 A;  5CE3 A;  4FK0 A;  4WCE L;  3SQ2 A;  4DQS A;  4GKJ K;  1WSF A;  3F2K A;  2QK9 A;  5JLH A;  4KHU A;  3ZT1 A;  3M8S A;  3S3N A;  5CZ1 A;  3ZET B;  1TYQ B;  4F4K A;  4DR7 K;  5HRR A;  1KC8 O;  3ZSW A;  1N6Q A;  4DTN A;  2P9P A;  1X3N A;  4HUG A;  3OVN A;  4BQZ A;  1K9M O;  2Q1N A;  4Z0U A;  4O8U A;  3FZL A;  4FLU A;  4FJX A;  1YT3 A;  1XC3 A;  1W9H A;  3ISN C;  1QQN A;  3DLB A;  2O4I A;  2I7N A;  1U48 A;  5BR9 A;  1JL2 A;  4DR2 K;  1VQ5 N;  3AGK A;  4IO8 A;  3CMA N;  3RSE B;  5F2R A;  1VSD A;  3V1R A;  3SUN A;  1C0F A;  5FRN A;  2RF2 A;  5H1S Q;  3QDK A;  4IFE A;  5AFU H;  1NJI O;  3I0R A;  5SZT A;  4DSE A;  3J7A P;  4YHH K;  2FF6 A;  5J2P A;  1WNS A;  3K58 A;  2PYL A;  4QAG A;  1RBS A;  2VGN A;  5AQG A;  4CJ3 A;  4YDU A;  3BZC A;  1J54 A;  4FZY A;  2YI1 A;  3J7Y P;  4OVL A;  4ID1 A;  1L3S A;  4J2A A;  3QET A;  2KZZ A;  1N33 K;  3PIO L;  3DRS A;  3AVC A;  4BRP A;  3CCS N;  2HHT A;  3IDH A;  3LL3 A;  1NKC A;  2W6K A;  3AVL A;  5HOO A;  1Q81 O;  1C0G A;  2QA4 N;  4AHU A;  2D0P A;  5SWM A;  1HX1 A;  2VCP A;  4PKI A;  4BG8 A;  5HRN A;  2P9U A;  4BRF A;  2ASP A;  3RSE A;  1LCU A;  1EO1 A;  4FWS A;  1JLA A;  2QWQ A;  3DXK B;  3R1X A;  2HBK A;  1DTQ A;  2E1Z A;  1VQP N;  4PKG A;  2XY6 A;  3RRH A;  3SV3 A;  4JV5 K;  2DY4 A;  3VMF B;  3HSC A;  2PZS A;  3VQP A;  1C0T A;  3K57 A;  4DLE A;  3O1W A;  4E7L A;  1GLC G;  1GLJ O;  3T1H K;  4DV0 K;  4KO0 A;  3SUQ A;  3G71 N;  3WT0 A;  3CD6 N;  2HF3 A;  1KVC A;  3HZ6 A;  2Q36 A;  1ZBL A;  3FZK A;  1VSJ A;  1TVR A;  4JI3 K;  3SMS A;  4KAZ A;  1L3U A;  1XNR K;  4KB1 A;  1WSI A;  2IVP A;  4CJE A;  4CJK A;  1OH8 A;  3CCM N;  1VQO N;  4LH5 A;  4E89 A;  1HKC A;  4DV6 K;  1U45 A;  1J5E K;  4JI6 K;  2A6A A;  1NJZ A;  2FF3 B;  1NK5 A;  3GDQ A;  4HCB A;  2QXF A;  1P8Z A;  3D2F A;  4O44 A;  4H03 B;  5AQH A;  3CF5 L;  4W5N A;  4BRH A;  1TUY A;  3JAM O;  3RTV A;  2YKN A;  2B5J A;  1DLO A;  3DJC A;  5CY4 A;  4H0T B;  3QFU A;  2ITM A;  1X9W A;  4C8K A;  5JVG L;  3DWL A;  2NRW A;  1W7A A;  3PX4 A;  2I7P A;  4RW4 A;  3K9J A;  4DF8 A;  2ZQB A;  5KPT A;  2BTF A;  1EWQ A;  3WXL A;  4DFM A;  3FLC O;  3OS2 A;  2P9K A;  2FSN A;  3CM6 A;  3U3Y A;  5GAE P;  4BQL A;  3SMP A;  1D4X A;  1NK9 A;  4BE1 A;  3G25 A;  4Z4I A;  4CZK A;  1KQS M;  2CGK A;  3QLH A;  5KTQ A;  3SAG A;  1S5J A;  4CFA A;  2Q2R A;  4B3S K;  3W0L A;  4CF0 A;  3T1Y K;  4CJL A;  1IKW A;  2HNY A;  4ZTJ A;  2VG6 A;  3SJJ A;  2HOE A;  3VTI A;  4CER A;  3O5B A;  4DQQ A;  4DFP A;  3BY5 A;  4FWP A;  1REV A;  5KGX A;  2HW3 A;  1Z6R A;  3I8D A;  1TK5 A;  1S6Q A;  1BQM A;  2E4L A;  4B9T A;  4BR7 A;  1M1K O;  3P31 A;  3JYT A;  4RG8 A;  4EP4 A;  3HM9 A;  2QM1 A;  1RIL A;  1VSH A;  2X6N A;  2VWJ A;  3MX5 A;  4EFH A;  3S3M A;  1EQY A;  1VAZ A;  3EE9 A;  5BR8 K;  1SV5 A;  1ZBF A;  4CJS A;  1B9F A;  1MDU B;  3CJ9 A;  3ZEU B;  4PUO A;  4CF1 A;  3KLG A;  1CZA N;  4CHO A;  4EHU A;  4DFK A;  3UB5 A;  1NJY A;  4BVP A;  3LDN A;  4WFN L;  5KQ8 A;  3O08 A;  1ITG A;  5J1E A;  3NHG A;  2BH1 A;  3S3O A;  3C65 A;  3D7E O;  1RBV A;  3MCA B;  2NLX A;  4JHD B;  4DHY A;  4LFB K;  3TTD A;  4YOW A;  2GBZ A;  2VQE K;  1KSP A;  3WNG A;  1S1X A;  4IZ9 A;  4UY8 O;  4LD0 A;  1SL1 A;  4NCA A;  1NGE A;  4M3X A;  3N4Q A;  2QKK A;  1KAZ A;  1RDC A;  2P9N A;  5DM6 L;  3TWH A;  2WON A;  5C15 A;  4BWM A;  4FWL A;  1KLM A;  1BL3 A;  1RNH A;  4B8A B;  1QQO A;  2NZT A;  4DTR A;  1G15 A;  3K0S A;  3HP6 A;  1YVU A;  4KRF A;  1Q7Y O;  4M42 A;  4DS5 A;  4IOX A;  4CHY A;  3OYA A;  4BDY A;  4N47 A;  4X65 K;  2NNW A;  4JK8 A;  1NM1 A;  3OBW A;  4DV1 K;  2DFF A;  4KRE A;  4H0Y B;  4RW9 A;  3EZ5 A;  3J8A A;  4DSJ A;  1XC9 A;  2X74 A;  3ZEU A;  4F2R A;  1FKO A;  1NGB A;  3D2E B;  3LDQ A;  2OZM A;  4DQR A;  3DOK A;  1SAZ A;  4H4O A;  4AM6 A;  4DSF A;  3L4Q A;  3MAQ A;  4DV5 K;  3AVN A;  4CZG A;  4B3O A;  3GBT A;  4JHD A;  4DU1 A;  3E01 A;  4I2Q A;  3IRX A;  1CXU A;  4BRK A;  1OH5 A;  1ATS A;  3TTF A;  5FRM A;  1YJW N;  3A5L C;  3LP0 A;  3M8P A;  4CEZ A;  4HWI A;  1V4T A;  4PL8 A;  5GAH P;  3IS9 A;  1H1V A;  3VGM A;  1LWE A;  5AQX A;  3C6U A;  3MED A;  2OTJ N;  1V4S A;  3VQC A;  2ETJ A;  3DM2 A;  4RWT A;  3CQ8 A;  4CD1 A;  1X9S A;  2YHB A;  5BPM A;  2Q0R A;  3KHY A;  4JK9 A;  4DR4 K;  3UKU B;  4H5R A;  3NDK A;  3WQU A;  4E0D A;  4OKE A;  4YDU C;  3QEW A;  4L8R B;  3OYN A;  3FFK B;  4ZTF A;  2OAN A;  1VQK N;  3O4N A;  1J6Z A;  5C10 A;  2CGJ A;  4CEQ A;  2DTU A;  3O4Q A;  3HPH A;  2GX9 A;  3TSQ A;  4CK1 A;  3SQ0 A;  5C2D A;  1S22 A;  2HVH A;  4H0P A;  3LP1 A;  4H5T A;  4JKF A;  1XUP O;  3IAY A;  4RW7 A;  2IGI A;  1S1W A;  1I94 K;  4PY5 A;  2XY7 A;  3WXK A;  4DR3 K;  2VGM A;  5BRF A;  1YJ9 N;  4DB3 A;  3LDP A;  5HP1 A;  3TSU A;  3ZSZ A;  4ILG B;  2EWS A;  4N41 A;  2FBY A;  3H45 C;  4KTZ A;  4BR0 A;  2RPI A;  1NGC A;  2A3Z A;  3QFP A;  3VGK A;  3HPO A;  3V81 A;  4CGG A;  4JI0 K;  5T7B A;  4FJI A;  3NVM A;  4GNI A;  4RW8 A;  3G4S N;  4E7H A;  3L3V A;  4C8M A;  1L3T A;  4JKC A;  3LDS A;  2XHB A;  1P90 A;  1KRP A;  3ZYY X;  5AQV A;  3KJV A;  1WN7 A;  3MX2 A;  4LF5 K;  2HBL A;  4J8F A;  4CF8 A;  4H5W A;  4CBW A;  4B9N A;  3BEX A;  3SUP A;  4B1Y B;  3AVK A;  3WNF A;  3CCL N;  3SV4 A;  4OGC A;  3ZT2 A;  3VEO A;  3VF2 A;  3CME N;  3L3U A;  1QZ5 A;  1RFQ A;  4A59 A;  5GIP A;  1SKR A;  3H3O B;  5HLF A;  1TL3 A;  1I39 A;  4J2D A;  2A40 A;  1YXQ A;  3TSP A;  1S1V A;  3FGU A;  4W5Q A;  3O8M A;  3AAR A;  3A8Y A;  5C12 A;  4AM7 A;  4CK2 A;  5BRD A;  3OA9 A;  4YOR A;  3TU5 A;  2NUB A;  4CJ4 A;  3QIN A;  1RDB A;  5CYM A;  4PL7 A;  3MCP A;  3VF4 A;  4HUF A;  3CC7 N;  3CPW M;  2ZM6 K;  5BRE A;  4CF9 A;  4E1J A;  4UQG A;  1N32 K;  2QXL A;  3DMJ A;  4L3Q A;  5GAG P;  4GVE A;  3EL2 A;  2HHQ A;  2XO7 A;  4Z4G A;  3ZSQ A;  3VQ7 A;  3ZT3 A;  3FR0 A;  1YAG A;  3KKR A;  4RTF D;  5TKW A;  3KWI A;  4FJ9 A;  4O5F A;  1T7P A;  2IC3 A;  5AQP A;  4WFA L;  4MLH A;  2IOC A;  4CEB A;  1ZBI A;  4DCH A;  2FBX A;  4K42 A;  1NGH A;  1QS4 A;  4B3R K;  4BRL A;  2KFN A;  4BRI A;  3P83 D;  3L2R A;  2G8I A;  2AJQ A;  1RGI A;  4KH5 A;  2V51 B;  2A42 A;  4EHT A;  2KTQ A;  4K0K K;  1MWK A;  3B6O A;  5FRO A;  1GOC A;  3CFP A;  4O55 A;  3MXI A;  4TSX A;  4BC3 A;  5AQI A;  4KTW A;  2Q31 A;  5E41 A;  2UYT A;  5D3G A;  4MQ3 A;  4PKH A;  5KPZ A;  4DSK A;  1OH7 A;  2YNF A;  3O9S A;  2D0B A;  4BRN A;  4DTJ A;  3V6D A;  4OPH A;  3SYZ A;  1WSH A;  3IFR A;  1TKD A;  3TAP A;  3KTQ A;  5KPR A;  1CLQ A;  3CHW A;  3R9P A;  4CJF A;  4FW2 A;  2XY5 A;  3ZSO A;  3U8X A;  1VSM A;  4F9O A;  3KLI A;  3VEZ A;  4M7Y A;  4CEO A;  4BDP A;  3Q7B A;  3K59 A;  4OX9 K;  2QWR A;  3EN9 A;  4BC5 A;  4WQ4 A;  4B9L A;  4BR9 A;  2P9P B;  3M6G A;  2NRZ A;  4Z94 A;  3HM8 A;  2HHX A;  2WUS A;  3VQQ A;  5AZI B;  1IBM K;  4OKK A;  5AQF A;  3TAB A;  3RMB A;  3UE5 A;  2JLE A;  2PBD A;  4IBN A;  1VSF A;  3HVT A;  4M3Y A;  4XIU A;  2UUC K;  1T03 A;  1HNI A;  3HRG A;  4DUY K;  2EX3 A;  3OJS A;  3K5N A;  4KB0 A;  3L4I A;  3AAP A;  3SQ4 A;  2D4W A;  1QVG M;  3P1G A;  3A0I X;  3LAN A;  1NGG A;  1NGJ A;  2E2P A;  1LAW A;  3H6E A;  5C24 A;  3WNH A;  4FZZ A;  4O4G A;  5CR4 A;  3MMV A;  2WOM A;  3CQY A;  3H08 A;  3WEE B;  4K41 A;  2XRI A;  2AA4 A;  1HPZ A;  4ELU A;  4DTP A;  4CFD A;  4IKF A;  1FJG K;  3LM9 A;  2FBV A;  3ZSR A;  1VSL A;  2W41 A;  1KVB A;  4CEF A;  2G8K A;  4HUE A;  3TAR A;  4FWO A;  2Y1I A;  4HTL A;  5M1Q A;  1C0U A;  3QIO A;  4OLB A;  4ICL A;  2QWL A;  3JSM A;  3CCR N;  2IDO A;  1JLC A;  5AZI A;  1RTI A;  2I5J A;  3HBT A;  3LAL A;  5C0Y A;  4CBX A;  5CYQ A;  4WE1 A;  4E7I A;  3L2Q A;  4OPK A;  4XH5 A;  3I55 N;  1DKG D;  1ASU A;  1WAF A;  4CCH A;  2P9U B;  4NLC A;  3QER A;  2GV9 A;  1HYS A;  3WXJ A;  3M8R A;  5LMU K;  2HST A;  1VQL N;  3I33 A;  3CIP A;  4WFB L;  1L5U A;  3ZSY A;  2F4V K;  2O8D A;  3NCI A;  3D45 A;  4BRO A;  2BUP A;  1Z26 A;  1Y97 A;  4JKD A;  3VEV A;  3FFI A;  4NYF A;  3SJH A;  3RMA A;  2YJF A;  3WEE A;  3SBG A;  3CJB A;  3O6W A;  1HUX A;  1MU2 A;  3QES A;  1F21 A;  3A5M C;  4JLH A;  1T6C A;  4M7X A;  2RKI A;  2OA8 A;  1HNV A;  4BC4 A;  4IJN A;  3SLC A;  3K5M A;  3L2W A;  1WOQ A;  3D2F B;  3ALY A;  4GMJ B;  1ATN A;  1IKV A;  3TR8 A;  4IJA A;  3WXM B;  2F7T A;  1HLU A;  4CJV A;  2ITG A;  4Z4H A;  4DQ8 A;  3ZX2 A;  1QSS A;  3OYJ A;  4AH9 A;  3EE8 A;  1GLD G;  4CZF A;  1G99 A;  2Z1H A;  1XHX A;  5M1F A;  3J80 O;  2ZJR L;  3EKU A;  3G6E N;  5AQZ A;  4JRP A;  3QEV A;  3E9P A;  1NK4 A;  2OPS A;  1E4F T;  1ASW A;  1UA1 A;  4FK4 A;  4FJ7 A;  2P9K B;  4WQ5 C;  2E6L A;  2QWP A;  1NLV A;  3AA3 A;  2F96 A;  3HI0 A;  4B9Q A;  3SPZ A;  4JK7 A;  4CIE A;  1BU6 O;  3HVR A;  4FVU A;  2FSK A;  2FSJ A;  4A5B A;  3AAQ A;  4B1U B;  4I2P A;  3BF3 A;  5F0X A;  3ZSX A;  1U04 A;  2GUP A;  3M1F A;  3NF6 A;  4BGA A;  5J2M A;  1WAJ A;  3VQ6 A;  3AVM A;  4DQP A;  2KW4 A;  3L2U A;  1BIZ A;  2YJE A;  3TPQ A;  1QHT A;  4V19 S;  3CM5 A;  2Z1I A;  4DV7 K;  5J2N A;  1JKH A;  1HMV A;  4FW1 A;  4BRM A;  3UIQ A;  4RCH A;  4C23 A;  5BN8 A;  2AP1 A;  3SZ2 A;  4DU3 A;  4LSN A;  2P9I A;  2X78 A;  4B1Z A;  5FPE A;  2E88 A;  4I7F A;  2NRX A;  4BR4 A;  1RT7 A;  1BGX T;  4JRQ A;  3ID8 A;  3O9T A;  4NCG A;  1BI4 B;  2DFH A;  4CI6 A;  5GIO A;  2GEM A;  1L3V A;  2HHH K;  4CIF A;  4CW7 B;  5C2F A;  4BVO A;  2UUB K;  4KHN A;  3MXM A;  5FDL A;  4BRG A;  3IKM A;  3QIP A;  2QWM A;  4B8C A;  1OVQ A;  4O5B A;  1IO2 A;  3HT3 A;  2PAV A;  2YHA A;  4CGD A;  2KFZ A;  4A2A A;  4QS9 A;  4OPJ A;  1VQM N;  5AFU A;  5FPN A;  2Q0U A;  1J9A A;  3ZX0 A;  4E7K A;  2P5G A;  2QTD A;  3O9U A;  3VQB A;  4FOE A;  3CCJ N;  1TK0 A;  2P9N B;  1VQ8 N;  3E9O A;  3ZT0 A;  3MEC A;  1SS6 A;  3C6H A;  4NYN A;  3MN5 A;  3E1Y A;  1K8K A;  4OPA A;  4AHR A;  2NRR A;  1VHX A;  1LW2 A;  4DMN A;  4YFU A;  4A2B A;  2D0O A;  3B6P A;  1U2V B;  2G8W A;  4DTO A;  1NWK A;  4M45 A;  4IFY A;  4DTS A;  4BRQ A;  3LM2 A;  5FLX O;  5M1N A;  1K6Y A;  4DQI A;  4DV3 K;  3CYM A;  4B08 A;  1BG3 A;  5CHI A;  1IG9 A;  1BI4 A;  4FJ5 A;  2F8S A;  3EY1 A;  4W5O A;  2Z1G A;  2BAN A;  2V7Y A;  4NCB A;  2HHU A;  1RDU A;  4DWI A;  4DTU A;  2V52 B;  4WQ4 C;  4BGB A;  3EO3 A;  3RMC A;  4CGF A;  4EP5 A;  2W42 A;  3KD1 E;  4JI1 K;  3AVH A;  1RTH A;  4E19 A;  2W6L A;  1UAX A;  2QW9 A;  1WSJ A;  1HNZ K;  4KKO A;  1Z05 A;  1QTM A;  3E9L A;  2E2O A;  2O8E A;  4CHP A;  4AF1 A;  5AQO A;  3SUO A;  1RT1 A;  4GW6 A;  3TAF A;  4MO5 A;  3ZT4 A;  4A57 A;  3JS6 A;  4KHY A;  1KXP A;  4FM2 A;  4FWN A;  1GLA G;  4CJQ A;  2P51 A;  3U4L A;  3KK1 A;  3GL1 A;  1U2V A;  3PO4 A;  4AHT A;  2HHS A;  5BN9 A;  1YTA A;  3R3L A;  4XH4 A;  4DTX A;  3H1V X;  4KFB A;  5AZJ A;  4EAH D;  2E5L K;  1TKX A;  4KHP K;  3LPU A;  4YOY A;  1M90 O;  4GV3 A;  2FBT A;  3NF8 A;  2KHO A;  5M1K A;  4H5N A;  4M3Z A;  1NJW A;  4ISF A;  3THY A;  3WXI A;  3KZB A;  2IIR A;  3ITH A;  1DEJ A;  1TK8 A;  1T8E A;  3V1O A;  3AO4 A;  4I9L A;  2E1Y A;  3LAK A;  4IXC A;  1QQC A;  3VQA A;  3AGR A;  4ZHR A;  5ADX H;  4JI2 K;  4KI6 A;  3TTC A;  3A2F A;  4AIL C;  4FPA A;  4OGE A;  3ULD A;  1VRU A;  1LW0 A;  3OYD A;  2PYJ A;  1QSY A;  3VA3 A;  3AVF A;  1RBU A;  3J81 O;  3GG4 A;  1VSK A;  3MK6 A;  1JLE A;  3NH2 A;  5EOY A;  4JNE A;  4B1X B;  3CJA A;  1RT5 A;  3VET A;  4HTU A;  3EEQ A;  3L6Q A;  3HO1 A;  3NAE A;  1VQ4 N;  2PFU A;  2Q3S A;  3CQX A;  5B8H A;  5AQK A;  1A5W A;  2HBM A;  3CET A;  1NK7 A;  4FSV A;  5CZ2 A;  4BC2 A;  1S1T A;  3THW A;  1O13 A;  3CXC M;  1MWM A;  4KHS A;  3NH1 A;  3QEX A;  1QQM A;  2E20 A;  1KFD A;  5TKY A;  3C0B A;  2KLA A;  4FJ8 A;  1VRT A;  5LL6 Z;  1HKB A;  3K5L A;  1NOZ A;  3MN6 A;  3HP9 A;  4BY9 C;  3Q7C A;  1ASV A;  2NRV A;  1JCE A;  1WUA A;  5GAD P;  4B1V A;  4PA1 A;  3MN7 A;  4FJG A;  4KPY A;  4E1M A;  2YNI A;  3UKR A;  4ISE A;  4I9Q A;  4KI4 A;  3OYG A;  5KRS A;  4CJR A;  3IUC A;  4DF4 A;  5EU7 A;  5I42 A;  3F5T A;  3PSF A;  3KVG A;  4LF6 K;  4JKE A;  2P9L B;  1E3M A;  2YHX A;  4CFB A;  3HL8 A;  2P9S B;  4WQ5 A;  4B3M K;  2DFE A;  4ILH A;  3D6R A;  3LP2 A;  1NK0 A;  4BE0 A;  3GE1 A;  3GOI A;  2W40 A;  3BUZ B;  5KRT A;  1WLJ A;  2KZM A;  1E4G T;  4BRD A;  3JXU A;  1ESV A;  5EX5 A;  3OYC A;  4X62 K;  2ZGY A;  4C8O A;  4LSL A;  3DLH A;  4DKW A;  4Z4F A;  5AQU A;  1BO5 O;  4FPB A;  1RTD A;  4PWD A;  3AO3 A;  1R59 O;  1R0A A;  2YNH A;  4IFV A;  1VQN N;  1ZC6 A;  1A5X A;  4JD2 B;  1C1C A;  4B1W B;  1VQ7 N;  4KH6 A;  3NH0 A;  3ENH A;  1UA0 A;  1FXX A;  4FCY A;  4BR5 A;  5DK5 A;  4FL9 A;  3HOT A;  3OYF A;  4BWJ A;  2P9L A;  2E6M A;  3PLA A;  2E8A A;  3DLE A;  2P9S A;  3A5O C;  4DLG A;  4YOX A;  1XNQ K;  3CPE A;  1T3V A;  2O8B A;  4FLZ A;  3PO5 A;  3QB0 A;  1TL1 A;  1RDA A;  3MEE A;  3KK2 A;  3VGL A;  5IWA K;  1Y64 A;  3V9X A;  4FM0 A;  3P4I A;  2EHG A;  2IAJ A;  2BGG A;  1QSL A;  4U67 L;  4CE9 A;  1SQK A;  1YVN A;  5LJV A;  4JI4 K;  4FM1 A;  3R8E A;  3OYL A;  3B8A X;  3OYE A;  4CJT A;  4FJN A;  3H1Q A;  3VEW A;  1KAX A;  2O8F A;  1VSI A;  3MEG A;  5AQY A;  1WBB A;  1SKW A;  2KQ2 A;  3CJ7 A;  2HF4 A;  4AHS A;  1RT2 A;  1CXQ A;  4LF8 K;  3FZH A;  4JD2 A;  1IG8 A;  1YJN N;  1ILY A;  4OJR A;  2VWB A;  2D1K A;  3SAH A;  4AHV A;  3HXM A;  3NMU A;  1S9E A;  4CZL A;  4CGJ A;  1O1W A;  3QML A;  4JI8 K;  5KGW A;  4E1N A;  4CIG A;  4NLB A;  1JCF A;  3VES A;  3K5O A;  4BR2 A;  4QCL A;  3I56 N;  3VQ4 A;  1HPM A;  4PQU A;  3MDQ A;  3NE6 A;  2ZWH A;  1XQS C;  1IBL K;  1JLF A;  4ISG A;  1BIU A;  4JI7 K;  2ASM A;  4DV2 K;  4MLE A;  1NNE A;  2A41 A;  5AQR A;  3C6A A;  3L8B A;  2CH6 A;  3KK7 A;  3KLE A;  5AQQ A;  3KK3 A;  3PIP L;  3KIO A;  3DYA A;  2O8D B;  3L0Q A;  3HTV A;  4FLW A;  2HMI A;  3OYH A;  2UXD K;  5JS2 A;  4CEE A;  3TAN A;  1NGD A;  2JWK A;  3M8Q A;  1T05 A;  1LWF A;  1GOB A;  2RHK A;  2KKZ A;  3QEI A;  1S1U A;  4DG1 A;  1I3A A;  3MWT A;  1BIS A;  4Q0B A;  1EP4 A;  4H0O A;  3WUH A;  3LWL A;  1D9F A;  4C1N I;  2HNZ A;  3F9M A;  1NGF A;  4J2E A;  1C6V A;  4IO9 L;  4WYB A;  4CBU A;  3DXM A;  5AQT A;  4E3S A;  5A2Q O;  4C1N K;  3AVA A;  4Y1C A;  3HST B;  2Y1J A;  4CES A;  4MDA A;  2HBJ A;  1B92 A;  2WFB A;  1RT4 A;  2JGU A;  1S6P A;  1W97 L;  4IEI A;  3ULE B;  4OLA A;  1FKP A;  1CZ9 A;  3K9K A;  4DR1 K;  1C1A A;  2YHY A;  2D5R A;  2P1J A;  4CZJ A;  4LF7 K;  2ZGZ A;  2A1S A;  1IBK K;  1K73 O;  3RR8 A;  4FO0 A;  4GV6 A; 
#chains in the Genus database with same CATH homology
 1LWE A;  1TGO A;  1UWB A;  4E7K A;  2P5G A;  4M3R A;  3VQB A;  3C6U A;  3MED A;  3V9U A;  4FVM A;  3VQC A;  1TK0 A;  2ETJ A;  3DM2 A;  3G10 A;  3CQ8 A;  1X9S A;  2YHB A;  3VQE A;  3ZT0 A;  3NF9 A;  3MEC A;  3ASM A;  3NDK A;  4NYN A;  1UOC A;  2OPQ A;  1TKZ A;  4LH4 A;  3AVG A;  3AA2 A;  4E0D A;  2OPR A;  4AHR A;  4OKE A;  4F3O A;  4HHT A;  2ATQ A;  3QEW A;  4L8R B;  3PY8 A;  3OYN A;  3TAG A;  4ZTF A;  1LW2 A;  1HYV A;  4DMN A;  3O4N A;  3DLG A;  4IG0 A;  1EXQ A;  4YFU A;  3DI6 A;  3B6P A;  3TAM A;  5HRS A;  1VK0 A;  2XY8 A;  2D0A A;  4DTO A;  4CEQ A;  2IS3 A;  3DRP A;  3O4Q A;  4N5S A;  3PX6 A;  2DTU A;  3HPH A;  4IFY A;  4M45 A;  5KI6 A;  1KFS A;  4CK1 A;  1HQU A;  4DTS A;  3OS0 A;  4CF2 A;  2VG7 A;  3QNO A;  3KKS A;  4G1Q A;  3SQ0 A;  1SL0 A;  3LP1 A;  3WNE A;  1K6Y A;  4O0I A;  4DQI A;  4M41 A;  3CYM A;  2G8F A;  4B08 A;  2G8H A;  3IAY A;  4F3T A;  4H4M A;  4RW7 A;  3VQ5 A;  1IG9 A;  1BI4 A;  3CFO A;  2LSN A;  4KHQ A;  4FJ5 A;  2F8S A;  3EY1 A;  4W5O A;  3F73 A;  2IGI A;  4CHQ A;  1VSE A;  2Z1G A;  4AHC A;  2BAN A;  1S1W A;  3V9S A;  1JLQ A;  4NCB A;  4PY5 A;  2HHU A;  2XY7 A;  4CFC A;  3S9H A;  4E7J A;  4DWI A;  4DTU A;  3C6T A;  4DSL A;  1ZYQ A;  3OYK A;  1KCF A;  5HP1 A;  3RMC A;  3SI6 A;  3T1A A;  4KHW A;  4CGF A;  4EP5 A;  3ZSZ A;  2W42 A;  4N41 A;  4KTQ A;  2GUI A;  3V4I A;  3KD1 E;  2YKM A;  1LAV A;  3AVH A;  2FBY A;  1RTH A;  4KTZ A;  4E19 A;  2RPI A;  3AVJ A;  3NF7 A;  3V9W A;  3HJF A;  3D0P A;  1UAX A;  3HPO A;  1WSJ A;  4W5T A;  3V81 A;  4KKO A;  3DLK A;  4CGG A;  5T7B A;  4YNQ A;  1QTM A;  5HRP A;  3VN5 A;  3T3F A;  2PY5 A;  4M3W A;  4FJI A;  3VQD A;  3VQ8 A;  4RW8 A;  1N5Y A;  4CHP A;  2QKB A;  4CJP A;  4E7H A;  1NKB A;  1ZBH A;  3L3V A;  4C8M A;  1BHL A;  3SUO A;  2ZD1 A;  1L3T A;  1RT1 A;  3NGI A;  3LDS A;  2XHB A;  1LV5 A;  4GW6 A;  3TAF A;  4FJL A;  3ZT4 A;  4MFB A;  4CEA A;  3OYI A;  1KRP A;  4DS4 A;  4KHY A;  1IKY A;  4RW6 A;  3KJV A;  1WN7 A;  4FM2 A;  1BQN A;  1LWC A;  4CGH A;  4BAC A;  4Z4G A;  3KLH A;  3K2P A;  4HVJ A;  2P5O A;  3KD5 E;  4CF8 A;  1IKX A;  1RCH A;  2P51 A;  4CJQ A;  3KK1 A;  1EX4 A;  4FLT A;  4B9N A;  5HBM A;  3AO5 A;  3PO4 A;  3LWM A;  4AHT A;  2HHS A;  3BGR A;  4DTX A;  1YTA A;  3SUP A;  3RWU A;  3RRG A;  3AVK A;  4JS4 A;  3WNF A;  1TV6 A;  4KFB A;  4FJH A;  3EYZ A;  3SV4 A;  1SKR A;  4B9V A;  1J53 A;  4OGC A;  3ZT2 A;  3AO1 A;  1TKX A;  2G8U A;  4CK3 A;  3DLR A;  3L3U A;  3LPU A;  2HND A;  2FBT A;  4FLX A;  3AV9 A;  3IG1 A;  1NK6 A;  1QE1 A;  1U4B A;  5HLF A;  3NF8 A;  1TL3 A;  2YV0 X;  3LZI A;  1J5O A;  1I39 A;  4J2D A;  1JLG A;  4M3Z A;  1NJW A;  4FZX C;  3OY9 A;  3BDP A;  1S1V A;  3AA4 A;  4W5Q A;  4B9M A;  4FK0 A;  3AVI A;  4Z4E A;  3SQ2 A;  4CK2 A;  3ITH A;  4DQS A;  1WSF A;  1TK8 A;  1T8E A;  3V1O A;  1RTJ A;  2QK9 A;  3O3F A;  3AO4 A;  4I9L A;  2NUB A;  4O0J A;  3QIN A;  4C8N A;  4CJ4 A;  1RDB A;  1RDD A;  3LAK A;  5CYM A;  3ZT1 A;  3M8S A;  3U6F A;  4HUF A;  5CZ1 A;  1QQC A;  4DFJ A;  3S3N A;  3VQA A;  4ZHR A;  3I0S A;  3PV8 A;  4F4K A;  4KI6 A;  4CF9 A;  2HB5 A;  3TI0 A;  1A5V A;  4UQG A;  1XHZ A;  3DMJ A;  5HRR A;  2ZE2 A;  3ZSW A;  1X9M A;  1N6Q A;  4DTN A;  1SKS A;  3LPT A;  2HHQ A;  1BCM A;  3A2F A;  2XO7 A;  4HUG A;  3OVN A;  2OPP A;  4AIL C;  4K8X A;  4Z0U A;  3VQ7 A;  3ZSQ A;  3ZT3 A;  3KKR A;  4OGE A;  4M3T A;  3ULD A;  1VRU A;  1LW0 A;  1XWL A;  3OYD A;  4FLU A;  2PYJ A;  1QSY A;  1YT3 A;  3AVF A;  3VA3 A;  3ISN C;  1W9H A;  4FJX A;  4FJ9 A;  1RBU A;  1B9D A;  1T7P A;  3DLB A;  2O4I A;  2IC3 A;  1U48 A;  1VSK A;  1JL2 A;  1JLE A;  4EZ6 A;  2IOC A;  4CEB A;  4CGI A;  1JXE A;  3NH2 A;  1ZBI A;  3C94 A;  1JLB A;  1HJR A;  1RT5 A;  2FBX A;  4HTU A;  1VSD A;  1QS4 A;  3V1R A;  3SUN A;  3HO1 A;  3NAE A;  2KFN A;  3P83 D;  4LY7 A;  5FRN A;  2RF2 A;  3AO2 A;  3L2R A;  2G8I A;  2AJQ A;  2Q3S A;  1A5W A;  4M3U A;  2KTQ A;  4N56 A;  3B6O A;  3I0R A;  5FRO A;  1GOC A;  3CFP A;  1EKE A;  2Z1J A;  3TAQ A;  4O55 A;  5SZT A;  3SNN A;  3MXI A;  1NK7 A;  4DSE A;  4JS5 A;  2G8W A;  5CZ2 A;  4TSX A;  3THV A;  1S1T A;  4CJ5 A;  1Z25 A;  4KTW A;  5J2P A;  1WNS A;  3K58 A;  2PYL A;  4KHS A;  3NH1 A;  4QAG A;  1RBS A;  3QEX A;  4N76 A;  1NOY A;  5E41 A;  4CJ3 A;  1KFD A;  5D3G A;  2VG5 A;  4MQ3 A;  4DU4 A;  3SCX A;  1J54 A;  4DSK A;  4FZY A;  2YNF A;  4FJ8 A;  2D0B A;  1VRT A;  3K5L A;  1RBR A;  4OVL A;  1NOZ A;  4ID1 A;  4DTJ A;  1L3S A;  3V6D A;  3HP9 A;  3QET A;  4J2A A;  3SYZ A;  3DOL A;  2KZZ A;  1WSH A;  2X6S A;  1TKD A;  3TAP A;  1ASV A;  3KTQ A;  2BE2 A;  1CLQ A;  3DRS A;  4CJF A;  2BDP A;  4PA1 A;  4FW2 A;  4CEC A;  5C42 A;  2RN2 A;  3AVC A;  1NK8 A;  2XY5 A;  4FJG A;  3ZSO A;  1VSM A;  2HHT A;  3KLI A;  4CEO A;  4KPY A;  4BDP A;  4E1M A;  3K59 A;  2YNI A;  1NKC A;  2O4G A;  4I9Q A;  4CHN A;  4KI4 A;  3AVL A;  3OYG A;  5KRS A;  4CJR A;  3NGZ A;  4B9L A;  4DF4 A;  3OJU A;  5EU7 A;  4AHU A;  1JL1 A;  5I42 A;  1HYZ A;  1J9A A;  4QOZ B;  2OYQ A;  5SWM A;  2HHX A;  5HRN A;  4IG3 A;  3VQQ A;  1KVA A;  4CFB A;  1Q9X A;  4HCC A;  3HL8 A;  1JLA A;  4OKK A;  3TAB A;  2A1R A;  3RMB A;  1DTQ A;  2JLE A;  2DFE A;  4IBN A;  3LP2 A;  2XY6 A;  1NK0 A;  4BE0 A;  3RRH A;  3SV3 A;  1KLN A;  1VSF A;  3SQ1 A;  3HK2 A;  3HVT A;  4M3Y A;  2DY4 A;  4XIU A;  1T03 A;  5KRT A;  3VQP A;  1C0T A;  1WLJ A;  2PZS A;  3K57 A;  4DLE A;  1HNI A;  2KZM A;  4E7L A;  2EX3 A;  3ZCM A;  3OJS A;  3K5N A;  4KB0 A;  4K8Z A;  4Y1D A;  4KO0 A;  3SQ4 A;  3SUQ A;  1C0M A;  3P1G A;  3OYC A;  3LAN A;  4C8O A;  3MXJ A;  4LSL A;  3DLH A;  1KVC A;  4Z4F A;  1ZBL A;  1LAW A;  1VSJ A;  1TVR A;  4KAZ A;  5C24 A;  3WNH A;  1L3U A;  4KB1 A;  4FZZ A;  1WSI A;  5JS1 A;  4CJE A;  4CJK A;  4O4G A;  1RTD A;  2WOM A;  3H08 A;  4LH5 A;  4PWD A;  3LAM A;  4E89 A;  3AO3 A;  1D8Y A;  2XRI A;  1U45 A;  1R0A A;  4F8R A;  2YNH A;  1HPZ A;  4ELU A;  4DTP A;  1NJZ A;  4CFD A;  1NK5 A;  3QEP A;  4B9U A;  4IKF A;  4HCB A;  3LP3 A;  2QXF A;  4ELT A;  4IFV A;  5C25 A;  3NBP A;  1SL2 A;  4O44 A;  2FBV A;  3ZSR A;  4CED A;  1VSL A;  3V1Q A;  1A5X A;  1C1C A;  1KVB A;  4CEF A;  4W5N A;  5K14 A;  1X1P A;  3ZSV A;  2G8K A;  4HUE A;  3TAR A;  3NH0 A;  4F2S A;  2VWK A;  3RTV A;  1UA0 A;  1FXX A;  2YKN A;  2B5J A;  1DLO A;  3O3H A;  3CFR A;  4FCY A;  2Y1I A;  1Q9Y A;  1WSE A;  1C0U A;  3QIO A;  5CY4 A;  3AVB A;  4OLB A;  5DK5 A;  1X9W A;  4C8K A;  1TAQ A;  4ICL A;  3JSM A;  3OYF A;  4BWJ A;  2IDO A;  3PX4 A;  1JLC A;  2E6M A;  4RW4 A;  4KHU A;  1RTI A;  2I5J A;  3LAL A;  3T19 A;  3DLE A;  4DF8 A;  2ZQB A;  4CHZ A;  2D0C A;  5CYQ A;  4WE1 A;  4DLG A;  3L2Q A;  4E7I A;  4OPK A;  4DFM A;  4FLZ A;  3PO5 A;  3OS2 A;  1TL1 A;  1RDA A;  3CM6 A;  1ASU A;  1WAF A;  3MEE A;  3U3Y A;  4CCH A;  3KK2 A;  3QER A;  1HYS A;  2GV9 A;  3NFA A;  1NK9 A;  4BE1 A;  1W0H A;  3KLF A;  3V9X A;  4Z4I A;  3M8R A;  4FM0 A;  3HPG A;  2YNG A;  3QLH A;  3QNN A;  2EHG A;  1L5U A;  2IAJ A;  2BGG A;  1QSL A;  5KTQ A;  1XI1 A;  4FJM A;  3ZSY A;  4CE9 A;  1S5J A;  1TAU A;  4CFA A;  4DSI A;  3NCI A;  3D45 A;  1Z26 A;  4CF0 A;  4FM1 A;  1Y97 A;  3OYL A;  3OYE A;  2F8T A;  4FXD A;  4CJT A;  4CJL A;  1IKW A;  2HNY A;  3FFI A;  4NYF A;  4ZTJ A;  4FJN A;  2VG6 A;  3RMA A;  3SJJ A;  1VSI A;  3MEG A;  3C95 A;  4CER A;  4DQQ A;  4DFP A;  1SKW A;  4C8L A;  1MU2 A;  2KQ2 A;  1REV A;  5KGX A;  3QES A;  3OS1 A;  2HW3 A;  4AHS A;  1CXQ A;  1RT2 A;  5HRO A;  3I8D A;  1TK5 A;  1F21 A;  3TAE A;  4FYD A;  1S6Q A;  3HYF A;  3G0Z A;  4JLH A;  1BQM A;  2E4L A;  1U49 A;  1WSG A;  4B9T A;  2RKI A;  3JYT A;  4RG8 A;  2OA8 A;  1HNV A;  3P5J A;  4OJR A;  4EP4 A;  3HM9 A;  1RIL A;  2R7Y A;  3K5M A;  1VSH A;  3V9Z A;  2X6N A;  3L2W A;  4FLY A;  4B9S A;  3NGY A;  4Q5V A;  2VWJ A;  4AHV A;  3ALY A;  1RT3 A;  1RBT A;  4GMJ B;  3HXM A;  1IKV A;  3TR8 A;  3S3M A;  1S9E A;  4FJJ A;  4CGJ A;  1O1W A;  3L2V A;  1SV5 A;  2HHW A;  1ZBF A;  4CJS A;  4CJV A;  2HVH A;  1C1B A;  2ITG A;  4Z4H A;  1B9F A;  1KTQ A;  1QSS A;  4PUO A;  3OYJ A;  1FK9 A;  4AH9 A;  5KGW A;  2B4J A;  4CF1 A;  4E1N A;  3KLG A;  4CIG A;  4CHO A;  4DFK A;  2Z1H A;  1XHX A;  3O3G A;  3K5O A;  1NJY A;  4QCL A;  1ZBU A;  3OYM A;  3VQ4 A;  4FLV A;  4PQU A;  1ITG A;  5J1E A;  4FJK A;  4JRP A;  3NHG A;  4BDZ A;  3QEV A;  2OPS A;  4DTM A;  1JXB A;  3S3O A;  1NK4 A;  3NE6 A;  1ASW A;  1RBV A;  1UA1 A;  3VQ9 A;  3VA0 A;  1JLF A;  3CG7 A;  2GBZ A;  1CZB A;  4J2B A;  1BIU A;  1KSP A;  4FJ7 A;  4FK2 A;  4FK4 A;  2E6L A;  3WNG A;  3AA3 A;  2F96 A;  1S1X A;  3RR7 A;  3SPZ A;  3F9K A;  4LD0 A;  1SL1 A;  4NCA A;  4M3X A;  4CIE A;  1IH7 A;  1GOA A;  3HVR A;  2QKK A;  3L8B A;  1RDC A;  5I3U A;  4OKJ A;  3PUF A;  4CJW A;  3KLE A;  1D9D A;  3KK3 A;  4GVM A;  3TWH A;  3KIO A;  2WON A;  4I2P A;  3DYA A;  4BE2 A;  4CJU A;  3ZSX A;  4BWM A;  1KLM A;  1BL3 A;  1RNH A;  1U04 A;  3NF6 A;  4B8A B;  1TKT A;  5J2M A;  1WAJ A;  3VQ6 A;  4FLW A;  3SPY A;  4ID5 A;  4DTR A;  1G15 A;  2HMI A;  3AVM A;  3OYH A;  3HP6 A;  3LZJ A;  2G8V A;  1YVU A;  5JS2 A;  4DQP A;  2KW4 A;  4KRF A;  4KV8 A;  3L2U A;  3DRR A;  1BIZ A;  1EET A;  4CEE A;  4H8K A;  4DS5 A;  4M42 A;  3U3G A;  1SUQ A;  4CHY A;  3OYA A;  1QHT A;  5J2Q A;  3AA5 X;  4BDY A;  4ELV A;  4N47 A;  1DTT A;  3CM5 A;  2Z1I A;  4W5R A;  3TAN A;  4IDK A;  1T05 A;  3M8Q A;  5J2N A;  1LWF A;  1JKH A;  1GOB A;  1HMV A;  4FW1 A;  3UIQ A;  4EZ9 A;  2HVI A;  1HQE A;  2DFF A;  3QEI A;  4KRE A;  4RW9 A;  1S1U A;  4DG1 A;  1I3A A;  3EZ5 A;  4DSJ A;  1BIS A;  4Q0B A;  1EP4 A;  1XC9 A;  3LWL A;  1NJX A;  1D9F A;  2HNZ A;  2X74 A;  3SZ2 A;  4J2E A;  4F2R A;  4DU3 A;  1U47 A;  1C6V A;  4LSN A;  1FKO A;  2X78 A;  2OZM A;  2HHV A;  4R5P A;  4DQR A;  4E3S A;  3DOK A;  4H4O A;  3AVA A;  4I7F A;  1RT7 A;  1BGX T;  4Y1C A;  4JRQ A;  3HST B;  4DSF A;  4NCG A;  1BI4 B;  2DFH A;  2B6A A;  4CES A;  3MAQ A;  1Q8I A;  2FC0 A;  2Y1J A;  1L3V A;  3AVN A;  4CIF A;  4B3O A;  1B92 A;  4KHN A;  4DU1 A;  3OYB A;  5FDL A;  3PX0 A;  3MXM A;  3E01 A;  1RT4 A;  2JGU A;  3QIP A;  1S6P A;  4I2Q A;  4B8C A;  3IRX A;  1CXU A;  5FRM A;  4OLA A;  1FKP A;  1HRH A;  4Z4C A;  1CZ9 A;  1D5A A;  3RMD A;  5DMR A;  1C1A A;  4O5B A;  2OZS A;  1IO2 A;  2D5R A;  2P1J A;  3HT3 A;  1YTU A;  3LP0 A;  3M8P A;  4CEZ A;  2YHA A;  4CGD A;  2KFZ A;  2A1S A;  4OPJ A;  1NKE A;  1RT6 A;  3IS9 A;  3RR8 A;  1S9G A;  1BCO A;  3QO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...