4CFDA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cfdA00
1KLNA 3OYDA 5J2PA 1RCHA 1JLQA 2VG7A 1S5JA 4KKOA 3P83D 4I7FA 1DTTA 2G8WA 4FJGA 3AO5A 4CGFA 2X6NA 3AVIA 1W9HA 2E4LA 4DTMA 4JRPA 3QEXA 1NKEA 4DSKA 1U49A 3G10A 4KRFA 3AVFA 4KPYA 2D0CA 3DLBA 1S6QA 1HJRA 2DY4A 4CGHA 3OYNA 2HNZA 3I0RA 4W5NA 4KHWA 4FJ7A 1J5OA 5KRSA 4CJ3A 1NJZA 4CHPA 4N5SA 1D8YA 4FZZA 5EU7A 3OYFA 4LSLA 1VSMA 4CEEA 4CJUA 4FJXA 3SQ4A 4DS5A 3K5MA 2HW3A 2Y1JA 4J2BA 4DTPA 3OS0A 3AVMA 3SCXA 2BANA 4CIEA 1NK0A 4KHQA 2EHGA 1RDBA 3S3OA 3KKSA 1RTHA 3K57A 2DFEA 1C1CA 2BGGA 3B6PA 3OYMA 2OYQA 4BWMA 4CJTA 1RT7A 3L8BA 1HQEA 1KFDA 4M42A 4O0IA 2EX3A 2ITGA 1VSLA 4E3SA 4F3OA 2YNHA 3PO5A 4E7KA 3ALYA 3LWLA 1WAJA 3U3YA 3AA2A 4K8XA 4W5OA 4B9UA 1TK8A 3LAKA 4W5TA 3CFPA 2X74A 3LALA 4FLZA 3TAQA 4FK4A 1CLQA 4GMJB 1TAUA 1VK0A 3RRGA 1C6VA 1TKZA 4CF8A 1HRHA 3RMDA 3DLHA 3HL8A 4C8LA 3ZSRA 1XI1A 1WNSA 4I9LA 4DSEA 1ZYQA 1S1WA 3TAMA 4ID1A 4DLEA 3IAYA 1KFSA 4B3OA 4AHSA 3CQ8A 3PUFA 2ZD1A 4CF1A 1TAQA 1RBSA 4DTJA 5KRTA 1ZBHA 1RT1A 3QIOA 3DLKA 2XY6A 1HPZA 1JLEA 4OKKA 1IKYA 1FK9A 4Y1CA 3ZSOA 3QO9A 3VQBA 3L2QA 3NH2A 4KI4A 3K58A 3VQAA 1GOCA 3LDSA 1BL3A 2YNFA 4FJMA 4CFDA 1UAXA 1TVRA 3QERA 4NYNA 3TANA 2XRIA 4CJFA 1KLMA 2YHAA 3WNHA 5HLFA 1BCMA 1WSJA 4OKJA 4OPKA 5J2QA 4ID5A 3EY1A 1T05A 3LP0A 3F73A 4HHTA 3TAPA 1HYZA 1WLJA 1WSEA 2LSNA 3HYFA 4RW9A 4OPJA 1SL0A 4CJWA 2F96A 1B92A 5CZ2A 3VQEA 1LV5A 3V6DA 4EZ9A 2XY7A 3DI6A 3IS9A 3KK2A 3OYHA 5CZ1A 2GUIA 1XHZA 2OZMA 1KVCA 1RT6A 4JRQA 1X1PA 2E6LA 4DQRA 1DTQA 3D0PA 2OPPA 1WSFA 3V9XA 4M3UA 1UWBA 1JL1A 3ZSYA 3SPZA 5DK5A 1TGOA 2A1RA 4E7HA 1SL2A 2DFHA 3DRSA 4BDZA 2PYLA 3DLEA 4ELTA 3O3GA 3HJFA 4GVMA 4B8CA 1Q9XA 3M8QA 1LWFA 3T1AA 4EP4A 3S9HA 2RN2A 3QNOA 1N6QA 4DF4A 4FZXC 1J53A 1S1XA 3NH1A 1ITGA 4CHNA 1IKVA 4OGCA 3WNGA 1CXUA 2ETJA 3WNEA 4Z4EA 4NYFA 4AILC 4CEBA 4BWJA 3L2RA 1TK0A 4L8RB 4FLTA 4N41A 3C6UA 3TR8A 1JLGA 3V1RA 2KFNA 1C0MA 4B9NA 4DTOA 5DMRA 3SUOA 1NOYA 4CHQA 1VSKA 3HPGA 4YNQA 3SPYA 4HCBA 1B9DA 3K2PA 1WSGA 3KKRA 2PZSA 3I0SA 3VQ6A 4CEAA 4J2DA 3OJUA 3M8SA 5HRSA 4DU4A 1NKBA 4FJLA 2HHXA 4JLHA 4N47A 3MXJA 3OYLA 3RR8A 3DYAA 1TKXA 5FDLA 4W5RA 5HBMA 4CJVA 4B08A 5FROA 2X78A 5D3GA 4DF8A 2QK9A 3OJSA 3RMCA 3A2FA 1IO2A 2YHBA 4E7IA 4DSIA 1KVAA 4CEDA 1CZBA 2XY8A 3QLHA 4CJLA 1JLAA 5C42A 2KTQA 3QEPA 1IG9A 1EETA 1ZBFA 2G8UA 3LP1A 3MEDA 5E41A 4QOZB 4UQGA 3PY8A 5J2MA 4CGGA 1Q9YA 3DRPA 2WOMA 2VWJA 3AVLA 2KW4A 1NK4A 4H8KA 4E7LA 2FBYA 1WSIA 2HHQA 1A5WA 1S1VA 5HRRA 3AVAA 2XHBA 3PV8A 3EZ5A 2P5GA 4KHYA 5KGXA 1K6YA 1YVUA 3C95A 4OKEA 1WAFA 3ZSWA 4HTUA 4CEFA 1Q8IA 3V9ZA 3TABA 2ATQA 3SI6A 1GOAA 3NF8A 3AO2A 3DMJA 1T03A 4HVJA 3QEIA 4FLYA 1FKOA 3KK1A 3NBPA 1ZBLA 4CJKA 4FJIA 4KO0A 4CHZA 2RKIA 4CJ4A 3G0ZA 5JS2A 3KIOA 2I5JA 4F8RA 3V4IA 3CYMA 1Z25A 3S3MA 4M3ZA 4CJSA 4DQSA 4CK2A 4FJNA 4OLAA 1TV6A 4O55A 3QINA 3V1OA 4CGIA 1C0UA 1J9AA 3NH0A 5FRMA 2PYJA 3MAQA 1EP4A 2JLEA 3KLIA 3V1QA 3OYIA 4R5PA 3NHGA 1SL1A 1RTDA 4LH4A 4TSXA 3L2WA 1QSYA 3KLGA 1ASWA 4AHUA 1MU2A 4B9SA 1RBUA 1CZ9A 4AHTA 1RILA 3L2UA 3HO1A 2KZMA 3HP6A 2D0BA 3MECA 3NE6A 4PY5A 2G8HA 4M3RA 3O4NA 2FBXA 1U45A 4DWIA 4CF0A 4E0DA 1HNIA 1JKHA 2RF2A 4KFBA 1LW2A 1U47A 4DSLA 4M3XA 1ZBUA 2YV0X 1QSSA 4B9VA 4KHNA 4FM0A 4LY7A 1BISA 1B9FA 4O4GA 4CJ5A 4CJQA 3SYZA 2G8IA 2IAJA 3SV3A 1QHTA 4M41A 3AA5X 3ULDA 1KTQA 1HNVA 1KCFA 3UIQA 1BIZA 4FVMA 1X9MA 3L3VA 1GOBA 3T19A 1UOCA 1RBTA 5HRPA 1L3TA 1L3VA 3VQDA 3QETA 2XY5A 1HYSA 2KQ2A 3SQ0A 4BDPA 4OGEA 1NJXA 3ITHA 2YNIA 3QIPA 4KREA 1G15A 5I3UA 4ZTFA 4HUGA 3NCIA 4IG3A 4CK1A 4Q5VA 5KI6A 4FXDA 1C0TA 4CEQA 4OJRA 4FYDA 3NF9A 3CFOA 4C8NA 5J2NA 4RW4A 2HB5A 4KB1A 5JS1A 2IS3A 3V9WA 4Z4IA 3TAEA 3ZSZA 4C8OA 3DOKA 3VQ8A 2P5OA 4KHSA 3EYZA 5KGWA 4CEZA 5FRNA 3QESA 1RNHA 4O44A 3HT3A 1VRUA 3P5JA 3OYJA 5SWMA 4CJPA 1SV5A 4JS5A 2HHVA 4FW1A 4FK0A 1VSDA 4O5BA 4ZHRA 4Y1DA 4W5QA 4MFBA 1I3AA 1KVBA 5J1EA 3NAEA 1JXEA 4IFVA 4FJ5A 4C8KA 3B6OA 4J2AA 1I39A 3TAGA 1J54A 3OYKA 2P1JA 3DOLA 3SUQA 1U04A 4PA1A 1X9SA 3AO1A 3DLRA 2G8FA 4IDKA 4LSNA 3NGIA 4KTQA 3HPOA 3O4QA 1Y97A 2HNYA 3LWMA 4CK3A 4G1QA 3OYEA 3VA3A 4BE1A 1JLFA 4OVLA 4DFKA 2Q3SA 2NUBA 1FKPA 4HUFA 4DSFA 4DMNA 3AA4A 1LAVA 3DLGA 1YT3A 3NFAA 3AVGA 3ZT2A 3K5OA 4FM1A 1NJYA 3RTVA 4FJHA 3NGYA 4Z4GA 3JSMA 3CM5A 3C94A 4H4MA 3AVCA 3AVHA 3V9UA 1BHLA 1LW0A 2ZE2A 4M3YA 4ELVA 1S1UA 4DTXA 1D9FA 1IKXA 4CHYA 4AHCA 4RW8A 4XIUA 4EP5A 4DU1A 1ZBIA 3QEVA 1LWEA 2JGUA 4E1MA 3OYBA 2VG6A 3ISNC 3PX4A 4DQQA 1TK5A 4F2RA 4FLXA 3LZIA 2XO7A 2Z1JA 3SUNA 3C6TA 1XWLA 1XC9A 2OA8A 4B9TA 4OLBA 3LANA 4QCLA 1NOZA 2OPRA 3VQ9A 4HUEA 3OS1A 4KB0A 3LPTA 2WONA 4DFPA 3L2VA 4NCGA 3VQPA 3ZSXA 1NJWA 1VSJA 4E7JA 3KD1E 3ZSVA 3HVRA 2F8SA 3P1GA 3NDKA 2HHSA 1YTUA 2IOCA 5CYMA 1NK6A 4KI6A 1RBVA 3M8PA 1A5VA 1RDCA 3AO4A 4NCAA 1CXQA 4N56A 3O3FA 1S9EA 1HYVA 2E6MA 2OZSA 4DQIA 4PUOA 1HMVA 1T8EA 2G8VA 1JLBA 4DTSA 2HVIA 4CIFA 3NGZA 3LAMA 1DLOA 4FLUA 2OPQA 1IKWA 3F9KA 1O1WA 3HVTA 1A5XA 3AA3A 2YKMA 5HRNA 4FCYA 3V9SA 3K59A 4DFJA 3V81A 3HP9A 2B4JA 3LPUA 4EZ6A 3SQ2A 2QKKA 2Z1HA 3HM9A 4Z4FA 2OPSA 1QE1A 1RT5A 4E1NA 1RBRA 3VQ5A 1TL3A 1NK5A 1SKRA 4CFBA 2IDOA 1C1BA 1LWCA 4LH5A 1RDAA 4BACA 1EKEA 3ZT1A 3AVJA 4PQUA 3KLHA 3ZT4A 2R7YA 3WNFA 4N76A 3OYGA 1NK8A 1X9WA 4CFAA 4CIGA 4AHVA 5T7BA 3VQ4A 4DFMA 1NK7A 3IRXA 1F21A 3KJVA 1L3UA 4RG8A 2GBZA 1N5YA 4RW6A 2F8TA 3DRRA 1ASVA 3OY9A 2W42A 1Z26A 5HP1A 3MEEA 4CECA 1BQMA 1IH7A 2KFZA 1R0AA 1BQNA 3FFIA 1BCOA 5CY4A 4CESA 4M45A 4IBNA 5KTQA 4DLGA 1LAWA 4I9QA 3AVKA 3LP3A 4FJ9A 4FK2A 4KTWA 4FJJA 2G8KA 1VRTA 4CJRA 1TL1A 4I2QA 3LP2A 2HMIA 4B9LA 1C1AA 2GV9A 1SUQA 3OYAA 4DU3A 3SQ1A 4DQPA 3ZCMA 3U3GA 2A1SA 3TWHA 4IFYA 3I8DA 3IG1A 3CM6A 2PY5A 1XHXA 4DG1A 4FLWA 1W0HA 4DTRA 3MXIA 1UA1A 4MQ3A 1S9GA 3O3HA 3CG7A 1L3SA 3KLFA 4CE9A 4IG0A 3RWUA 3MEGA 2BE2A 4RW7A 3RRHA 3RMAA 3DM2A 4DSJA 2QKBA 3SUPA 3HK2A 1RT2A 1REVA 4C8MA 1VSIA 3HSTB 4CGJA 3OS2A 3QEWA 3VQCA 3HPHA 4Z4HA 3SV4A 4CGDA 4LD0A 4QAGA 4CCHA 3NF6A 1VSFA 4FM2A 1RDDA 5CYQA 4K8ZA 1SKWA 4BE2A 2AJQA 1RT4A 2VWKA 4CEOA 4DTNA 1QQCA 3THVA 3MXMA 4J2EA 1T7PA 1BIUA 4H4OA 3K5LA 2D5RA 2HHWA 3SNNA 2ZQBA 3RMBA 3OVNA 3ZT3A 4NCBA 2HHTA 1S1TA 1EX4A 1YTAA 1SKSA 2RPIA 2D0AA 3TARA 2Z1GA 1RTIA 1KSPA 2BDPA 3RR7A 4AH9A 3AVBA 3HXMA 4FW2A 4AHRA 4YFUA 1JLCA 1UA0A 3KD5E 4F2SA 4FJ8A 2HVHA 4DS4A 4E19A 3M8RA 5I42A 1NK9A 3L3UA 1JL2A 4HCCA 2IC3A 1BI4A 4ZTJA 5K14A 3CFRA 3VQQA 4ELUA 2YKNA 1WN7A 1D5AA 2DFFA 4JS4A 3K5NA 3U6FA 1VSEA 1RTJA 3SJJA 1BGXT 3AVNA 4FJKA 3PX0A 3SZ2A 4KV8A 4F3TA 4CHOA 1HQUA 1QTMA 3BDPA 1TKTA 2IGIA 3NF7A 2B5JA 3ASMA 4I2PA 3T3FA 3TAFA 1S6PA 2DTUA 3KTQA 2O4GA 2YNGA 4KAZA 4KHUA 5C25A 2FBTA 2FC0A 1U4BA 2Y1IA 4B9MA 4KTZA 1TKDA 3AO3A 4BE0A 3QNNA 3TI0A 3D45A 5SZTA 5HROA 2QXFA 4E89A 4CERA 4GW6A 4M3WA 4CJEA 4Q0BA 1L5UA 1JXBA 3VN5A 4B8AB 3H08A 2B6AA 3JYTA 3VA0A 1FXXA 1VSHA 2HNDA 2Z1IA 3BGRA 4ICLA 4Z4CA 4F4KA 4BDYA 1QS4A 4O0JA 1D9DA 1EXQA 4FLVA 4CF2A 2X6SA 2HHUA 2O4IA 2FBVA 4CF9A 3PX6A 3VQ7A 4FZYA 1NKCA 4PWDA 4IKFA 4CFCA 3LZJA 3ZSQA 4Z0UA 1WSHA 1QSLA 4WE1A 2KZZA 3OYCA 1BI4B 4M3TA 1RT3A 2VG5A 1KRPA 3KK3A 3E01A 4DTUA 3KLEA 3S3NA 1U48A 5C24A 2P51A 1ASUA 3PO4A 3ZT0A 3AV9A
chains in the Genus database with same CATH superfamily
3OYDA 4KKOA 2G8WA 3AO5A 4A59A 1U2VA 1KAZA 4DTMA 4JRPA 1VQ9N 3F5TA 1S6QA 1HJRA 3D2FB 4CGHA 5JVGL 2HNZA 3W0LA 3P4IA 4JI6K 4FJ7A 4CHPA 4N5SA 2BTFA 4G9ZA 5FPEA 3OS0A 1NK0A 2EHGA 3JS6A 3KKSA 1DKGD 2BGGA 3M5RA 4EAHD 2OYQA 3C65A 4BWMA 3UE5A 1HQEA 1KFDA 2EX3A 3BP8A 4F3OA 4BR9A 2FSJA 4B9UA 3PSFA 1TAUA 3ENHA 4FSVA 4CF8A 3RMDA 1XI1A 1WNSA 3CMEN 3EN9A 4WQ5C 4ID1A 3VPZA 3IDHA 1D4XA 2ZD1A 1TAQA 4B1ZA 4BC2A 2HBJA 2XY6A 1HPMA 4BRMA 3QO9A 3GOIA 1C0FA 2YNFA 4FJMA 4CFDA 4CJFA 1DT9A 5J2QA 5EXWA 5AQHA 3TPQA 3EY1A 3LP0A 4CZEA 3IFRA 4HHTA 1HYZA 1WLJA 4DKWA 1VQMN 3CD6N 2UXDK 3DI6A 4B3RK 5AQYA 1XHZA 3THWB 2OZMA 1X1PA 3V9XA 2OPPA 4B1VA 3ZSYA 1TGOA 5CR4A 3M8QA 3T1AA 3QNOA 4WFNL 2HF3A 3A5MC 1IKVA 4Z4EA 4AILC 4DR4K 4CEBA 2F7TA 3W3DA 3VGMA 1JLGA 5AQJA 3F2KA 1M1KO 3LDOA 2P9NB 3QICA 3SUOA 3SPYA 1B9DA 2NRHA 3KKRA 4FWQA 2HBMA 2P9PB 3S41A 5F1XA 3SBTA 5AQNA 2PZSA 3T1HK 1NKBA 5HRSA 4N47A 2YJFA 3DYAA 4W5RA 4DF8A 4GV9A 4BRGA 1IO2A 2YHBA 3OTOK 5BN9A 4E7IA 1KVAA 3KK7A 5C42A 1ESVA 3A0IX 1EETA 1ZBFA 1IG9A 2G8UA 3K9JA 2NNWA 5E41A 4UQGA 3PY8A 2KHOA 2O8FB 5J2MA 4CBUA 2HHQA 5ADXA 1K8KA 4H0VB 3BUZB 3PV8A 4B1XB 1WAFA 3O8MA 1ZBSA 3SI6A 1GOAA 4IOAL 5DM7L 3DMJA 3KK1A 4KO0A 4CHZA 2RKIA 4CJ4A 3R3LA 4FJNA 4GV6A 5BPLA 3QINA 3V1OA 4CGIA 1C0GA 1J9AA 2UUAK 5FRMA 4KH6A 1X9JA 2E2PA 2JLEA 3FE1A 4JHDA 3SMPA 1RTDA 1QSYA 4DUYK 3QFUA 4O8UA 1RBUA 1YVNA 1RILA 2D0BA 4X62K 1QQMA 1HNIA 1JKHA 2RF2A 3CC2N 4KFBA 1OH5A 1ZBUA 1QSSA 4B9VA 4BR4A 2HBKA 4PL8A 3THWA 4FM0A 1B9FA 1WUAA 2G8IA 4M41A 3AA5X 1KTQA 1GLJO 3UIQA 3O9QA 1BIZA 3CIPA 3T19A 3VQDA 1Q18A 2E20A 1Q81O 4BDPA 3ITHA 3QBXA 1KXPA 4ZTFA 3KWGA 4IG3A 4Q5VA 3TTFA 1C0TA 4FYDA 4FWRA 4DQ8A 1T6DA 3NF9A 4C8NA 5J2NA 5JS1A 1VQ5N 3ZSZA 4JN4A 4CEZA 4BC3A 2CGLA 2P9IA 3CCUN 1NGJA 2O8DB 1SV5A 1N32K 1KAYA 4O5BA 4W5QA 1I3AA 1KVBA 3TSQA 1I39A 2VQEK 1J54A 3OYKA 3QBWA 2QWMA 2G8FA 3H46O 4IDKA 3NGIA 4KTQA 2OCEA 1Y97A 2HNYA 4CK3A 3OYEA 1BA0A 4BE1A 4K25A 4HUFA 3MN5A 1FW6A 3OW2M 4H0OA 3AVGA 1NGBA 3AVCA 1YJ9N 4M3YA 4ELVA 4XH5A 3O08A 4CHYA 4DU1A 1LCUA 2A41A 1LWEA 4FPAA 3SUNA 4QCLA 4OLBA 1JCEA 2OPRA 4HUEA 3OS1A 1LOTB 3E9OA 3ZYYX 4A5AA 3O9RA 5BREA 1NJWA 1VSJA 3E1YA 3KD1E 3L6QA 3P1GA 3NDKA 1NK6A 4JKAA 5BPNA 4FWOA 3GG4A 1CXQA 4N56A 3O3FA 1S9EA 2E6MA 4H0XB 1HMVA 1T8EA 3MN7A 1NGFA 3VGKA 1DLOA 2OPQA 4KHPK 4CZFA 3J7YP 2ASMA 1A5XA 5I9EB 3V81A 3HP9A 2B4JA 4L3QA 3VEVA 1YHQN 2Z1HA 2P9KB 2UUBK 1IV0A 1TL3A 1C1BA 1LWCA 1RDAA 4BACA 3ZT1A 4QS9A 2VGNA 4JI3K 4N76A 5AQIA 4YOTA 5T7BA 1NK7A 1VQ6N 1F21A 1L3UA 4IEEA 2GBZA 3DRRA 5AQTA 2CH6A 1Z26A 5HP1A 1BQNA 3I56N 4BR0A 4I9QA 2QWOA 3AVKA 3HTVA 1ZC6A 4CJRA 2G8KA 2HMIA 4KHWA 2HVIA 1C1AA 2A1SA 3I8DA 3IG1A 1VAZA 3MXIA 4C1NI 4MQ3A 3DXMB 1BU6O 3CG7A 3WQTA 4CE9A 4IG0A 3MEGA 3RMAA 3DM2A 1EWQA 3SUPA 4FWMA 1O13A 2QWQA 3HSTB 4WCEL 3VQCA 1VSFA 4JI5K 2FLOA 4FWKA 3H3OB 4DTNA 3MXMA 4BRIA 1M90O 1YUWA 1EX4A 1YTAA 2D0AA 2KLAA 3TARA 1JCFA 3RR7A 4AH9A 3Q7BA 4YFUA 1UA0A 3J8AA 4DS4A 4E19A 3M8RA 1BI4A 1H1VA 1VQ4N 3CFRA 3G6EN 3THXA 4JS4A 2DFFA 1VSEA 3SJJA 4FJKA 3D7EO 3SZ2A 3UB5A 2D4WA 1HQUA 3VTIA 3BDPA 1TKTA 5F2RA 2B5JA 2NRZA 1S6PA 1NBWA 4KAZA 2GWKA 4IFEA 1U4BA 4B9MA 4KTZA 4K42A 3QNNA 5SZTA 5HROA 4NLBA 3WEEB 4MDBA 3TSUA 4BRNA 2WFBA 1FXXA 4ICLA 4Z4CA 4AQYK 2H3GX 3FZKA 1VQ7N 4O0JA 5TKYA 4DV7K 3O4WA 2FBVA 4HWIA 1MA9B 3A5NC 4JKGB 1QSLA 4GKJK 4WE1A 2KZZA 1BI4B 2VG5A 1KRPA 3KK3A 3E01A 4DTUA 2KFNA 4KBOA 3ID6A 3AV9A 4YOYA 3F9MA 5C0YA 4CZLA 1S5JA 2OTLN 1W9HA 1BG3A 5E84A 2VGMA 4CBWA 4DSKA 1QVGM 4KRFA 3AVFA 4KPYA 2QA4N 1V4SA 4W5NA 5MLCQ 4H0YB 1T44A 5EU7A 3OYFA 4LSLA 1VSMA 5ELZA 4DS5A 2Y1JA 4J2BA 2IVPA 3C7NA 2BANA 3MN9A 4CIEA 4OPAA 1RDBA 5AQKA 4CZIA 1RTHA 3K57A 1C1CA 4OO1J 3L8BA 3EZWA 4M42A 2ITGA 1VSLA 4E3SA 3PO5A 1WAJA 1Q82O 4W5OA 3LAKA 4FLZA 2X74A 3TAQA 4GMJB 3VENA 3RRGA 3DLHA 4C8LA 3ZSRA 4DSEA 1ZYQA 2QW9A 3TAMA 3IAYA 3EO3A 1KFSA 1EQYA 1KAXA 2Q0RA 3QIOA 3EE9A 4JD2A 1KQSM 5FLXO 1FK9A 1GLFO 1QHAA 3VQBA 2ZM6K 3VF4A 3NH2A 2ZJQL 4KI4A 1GOCA 2CGKA 1Y64A 3ZX2A 1UAXA 1TVRA 3TANA 1FJGK 3HM8A 3J7AP 3EE8A 4OKJA 3K9KA 1HX1A 4ID5A 5FPDA 3TAPA 1WSEA 2JWLA 1HKBA 4K43A 4CJWA 1LV5A 1RT6A 4JRQA 2VCPA 3CJ1A 4Y0WA 1BWFO 3VEWA 3SPZA 3H1QA 5BR9A 4IJAA 1NGDA 2DFHA 2ZF5O 3DLEA 4RWTA 3O3GA 3HJFA 4B8CA 1LWFA 3S9HA 4FZXC 2YCHA 3DAWA 1CXUA 3R1XA 3WNEA 4BWJA 1TK0A 3TR8A 4JI1K 4AF1A 2P9SB 4DTOA 3FZHA 1NOYA 5C2DA 4YNQA 4NLCA 4EHTA 3C6HA 5AQVA 3VERA 4J2DA 3OJUA 3M8SA 4DU4A 1NNEA 4FJLA 5M1KA 3R6MA 5FDLA 1GLDG 4B08A 5FROA 3FLCO 5JLHA 3A2FA 1SQKA 4DSIA 4CEDA 1CZBA 4IDHA 4CW7B 2KTQA 4BRLA 1GLBG 1NGEA 2E5LK 3KVGA 3DWLA 2WOMA 5LL6Z 2KW4A 2W40A 4H8KA 4YOUA 1N8RO 2ZJPL 2XHBA 3SK3A 3EZ5A 2DPNA 4KHYA 4HTUA 3ZSWA 2Q36A 3TABA 4CEFA 1Q8IA 2HHHK 1Z05A 3NF8A 1T03A 4KH5A 4JI2K 5AQUA 4BC4A 3ZETA 2I5JA 3CCSN 1Z25A 3S3MA 4M3ZA 4OLAA 4O55A 3LM9A 3NH0A 1XNQK 1OKJA 2PYJA 3KWIA 4DCHA 3NHGA 1R59O 3L2WA 4B9SA 1CZ9A 2UYTA 4FWPA 4IOXA 1XUPO 3UKUB 2YJEA 1U45A 4CF0A 3D2EA 1QZ6A 1EWRA 4WF9L 4M3XA 1WBBA 4KHNA 4IOCL 2E2OA 2P9UB 3SYZA 4JD2B 3TSPA 5AZJA 5M1OA 5B8HA 3L3VA 1GOBA 5LMNK 1UOCA 5GIOA 1L3TA 5AQLA 3RSEA 3QETA 2O8EA 1HYSA 2KQ2A 2YNIA 2ZGZA 1VQON 2FSNA 1TYQA 2YHYA 4OJRA 2QWRA 1HKCA 3V9WA 4CJ7A 3BF3A 3DOKA 2P5OA 3EYZA 4WQ5A 3P5JA 4JS5A 3HBTA 5BRHA 1YAGA 4FK0A 3R8EA 4FWLA 1JJ2M 4FWSA 1JXEA 2P1JA 3DOLA 1U04A 3AO1A 2Q2RA 4B3SK 3O4QA 1GLCG 3VA3A 4DV2K 1X3MA 1NMDA 4DFKA 2Q3SA 1QQNA 5AQQA 2IVOA 4DSFA 4DMNA 3NFAA 4FM1A 1NJYA 1YT3A 3AGRA 3K5OA 3H3NO 3CM5A 3V9UA 5FPNA 3FR0A 1S1UA 1XQSC 4DTXA 1IKXA 4RW8A 3CPWM 5FPMA 3ID8A 5EX5A 1ZBIA 3H1VX 1MDUB 3ISNC 4B1WB 4B9TA 1XWLA 3ZETB 3LANA 3VQ9A 3THYB 3LPTA 2CGJA 3T7ZA 4NCGA 5AQWA 4A61A 3LM2A 5BR8K 2YI1A 5JICA 1YTUA 5CYMA 3FZFA 1NJIO 4R79A 3MN6A 5C2FA 1NLVA 1WOQA 4EIAA 1YI2N 3IUCA 4PUOA 2WBNA 2FXUA 3ATUA 1JLBA 1U2VB 3F9KA 4FVUA 5AFUH 3HVTA 3O9TA 5HRNA 4FCYA 2A5XA 3M1FA 4IJNA 5KPTA 4H5VA 4EZ6A 2V7ZA 1S72N 4DV1K 4Z4FA 3CC4N 5IWAK 2D0PA 3VQ5A 4CFBA 1EKEA 4LF5K 3AVJA 1I94K 3AY9A 4M63C 3CQYA 4CFAA 3THYA 2QWLA 4DFMA 3KJVA 1IJJA 1N5YA 2F8TA 2OTJN 5AQZA 3ZX3A 4B9QA 4CESA 3FFIA 1BCOA 5CY4A 4IBNA 4DLGA 3SBGA 4DV5K 2GWJA 4FJ9A 4FK2A 4KTWA 4FJJA 1TL1A 5IT9O 2GV9A 1SUQA 4BRPA 3OYAA 3TWHA 2AA4A 4IFYA 1XHXA 4WYBA 1UA1A 1L3SA 3KLFA 2QKBA 3RRHA 2IIRA 4UY8O 1REVA 4CGJA 3OS2A 1YIJN 4Z4HA 2P9LB 3SV4A 3H6EA 4CGDA 4LD0A 2JWKA 4CCHA 2EWSA 3B8AX 4K41A 4DR2K 4FM2A 1RDDA 3G71N 4CEOA 4CZKA 4EHUA 4BRDA 3ZT3A 4IZ9A 4NCBA 3ZEUB 2ZWHA 4LFCK 2RPIA 5AFUA 1K73O 3GDQA 4AHRA 3D6RA 4FJ8A 3CI5A 1MWMA 2O8BB 1VQKN 1JL2A 2IC3A 4ELUA 2YKNA 1WN7A 3U6FA 5M1NA 4BQLA 2PAVA 1RTJA 1BGXT 1XC3A 3HSCA 4YOVA 5DM6L 5AZJB 3NF7A 5GIPA 3WEEA 2DTUA 3FZLA 3HRGA 2NLXA 4KHUA 5C25A 1Z6RA 1TKDA 3AO3A 3D45A 3ULEA 4GW6A 1L5UA 3M3ZA 3ATVA 1JXBA 2E2QA 3BF1A 2B6AA 3H08A 3JYTA 3VA0A 1VSHA 4H0PA 4BDYA 5AQRA 1D9DA 5AQMA 4FOIA 4CF2A 4FLVA 2HHUA 3VQ7A 4FZYA 5CE3A 1BUPA 2J4RA 2D1KA 1RT3A 3KLEA 5C24A 3HT3A 3PO4A 2FF3B 4O5FA 5GINA 1KLNA 3GBTA 5J2PA 4JI0K 2O8CB 1K8AO 3P83D 4FJGA 2X6NA 3AVIA 2E4LA 3R9PA 3QEXA 1NKEA 4IEIA 5BPMA 2WUSA 4H03B 3OYNA 2Q0UA 1J5OA 2ASOA 4CJ3A 1D8YA 4FZZA 3SAGA 4CJUA 5AQOA 3SQ4A 2HW3A 3IKMA 3DXKB 3U9DA 3EL2A 4BR2A 3OYMA 4YHHK 4ILGB 1WBDA 4O0IA 1NGIA 3VEYA 4E7KA 1T6CA 3U3YA 3AA2A 4K8XA 4W5TA 3CCRN 4FK4A 5AQFA 4A2BA 1C6VA 3N4PA 1TKZA 3CJ7A 2ASPA 1TYQB 3P39A 1N34K 1U6ZA 4I9LA 2YHXA 4ISFA 2QI2A 4B3OA 3CQ8A 4MDAA 3PUFA 4CF1A 4DTJA 3T69A 3DLKA 1JLEA 3L2QA 4LF8K 3K58A 3VQAA 1J6ZA 3BEXA 4WFBL 3FGUA 4X65K 4DV0K 1BL3A 3G4SN 4BRHA 3QERA 2XRIA 5H1SQ 4OPKA 5A2QO 1P90A 2UXCK 3WUHA 1HLUA 1T05A 3VOVA 4DV4K 3CJAA 2W6KA 1B92A 5CZ2A 3VQEA 4EZ9A 2PBDA 2P9SA 5CZ1A 2GUIA 3H45C 1KVCA 3CF5L 2CH5A 2E6LA 1DTQA 4M7XA 1SL2A 2PYLA 3E66A 1HNWK 4ELTA 4AM6A 4GVMA 2A40A 3WXIA 4BC5A 4EP4A 2RN2A 1N6QA 1J53A 3NH1A 1ITGA 4CHNA 2ETJA 1YXQA 2VWBA 5AR0A 3L2RA 1OH8A 4N41A 4FLTA 3C6UA 1C0MA 5DMRA 3QMLA 3PSIA 3QFPA 4CHQA 4HCBA 3ZEUA 3K2PA 1WSGA 1BDGA 1SAZA 1NWKA 2V7YA 1HJOA 3VQ6A 3CHWA 4JLHA 1VQ8N 3MXJA 3RR8A 1TKXA 5HBMA 4CJVA 4DR3K 3CJBA 5D3GA 1NGHA 3OJSA 3RMCA 2HSTA 3CXCM 2OANA 3ZLJA 3QLHA 4BG9A 2A42A 4CJLA 1JLAA 4LF9K 4H0TB 3MEDA 4NXMK 4DR6K 3J81O 4LF6K 4CGGA 1HUXA 3DRPA 4YOXA 4JKEA 4JHDB 4E7LA 2FBYA 1WSIA 1QZ5A 1A5WA 5HRRA 3AVAA 2P5GA 5KGXA 1K6YA 2VYPA 4OKEA 2QWPA 4JKBA 1ATRA 3A8YA 3AO2A 5E26A 3QEIA 4FLYA 5HL7L 1FKOA 1ZBLA 4BREA 5GAHP 4CD3A 4FWNA 5HOOA 3G0ZA 2V51B 1J5EK 2F9WA 2PFUA 3CYMA 3L4IA 4ISGA 4CJSA 4DQSA 4CK2A 2ZGYA 1TV6A 3SJHA 3RVCA 4JKGA 3HOSA 1K8KB 3MAQA 5EY4A 3KLIA 3V1QA 3OYIA 1SL1A 1ASWA 3C0BA 4AHUA 5LJWA 3L2UA 3KZBA 3HP6A 3MWPA 2HOEA 4PY5A 2QWNA 3O4NA 2FBXA 2VQFK 4DWIA 1P8ZA 1LW2A 1U47A 3WXJA 2E8AA 4YDUA 4CJ5A 4BRCA 2IAJA 1QHTA 3AARA 1HNVA 4QS7A 1X9MA 4FVMA 2P9IB 1RBTA 5HRPA 1Q86O 2XY5A 1YJNN 2NRVA 3OBWA 1NJXA 1Q7YO 4KREA 1G15A 1ATNA 3BZKA 4AM7A 2BUPA 2E1YA 4BR7A 2P9KA 4FXDA 4O8KA 4CEQA 3CFOA 1K9MO 3EKUA 4RW4A 2HB5A 4H5RA 4KB1A 4Z4IA 3TAEA 3VQ8A 4KHSA 3CCJN 5KGWA 3QESA 4O44A 4BQZA 3OYJA 2HHVA 4IXCA 4ZHRA 3O5BA 4IFVA 4FJ5A 4LF7K 3B6OA 4J2AA 4H5WA 4FOEA 3SUQA 4PA1A 2YX6A 3UKRB 4LSNA 4LF4K 1W7AA 3HPOA 3LWMA 4G1QA 1E3MA 4OVLA 4JKFA 4FJHA 3RTVA 3I33A 3NGYA 3JSMA 3C94A 3E9PA 4H4MA 3AVHA 1BHLA 1LW0A 2FSKA 2ZE2A 4JV5K 1D9FA 4V19S 5BN8A 4WFAL 5AZIB 4E1MA 3PX4A 1TK5A 4F2RA 3LZIA 1XC9A 3UKRA 3C6TA 3CERA 5EVZA 3ENOA 2F9TA 4KB0A 1XMQK 4J8FA 2W41A 4B1UB 3TTCA 4E7JA 3ZSVA 2F8SA 3CCLN 3M8PA 3O9SA 4F9OA 1RDCA 4DQIA 1HYVA 2NRWA 2G8VA 4DTSA 3WXLA 4WQ4A 3NGZA 3LAMA 3T1YK 4A57A 4QS8A 3EEQA 1VQNN 3VF6A 5M1FA 2YKMA 3K59A 4DFJA 1NGGA 5KQDA 3HOTA 1RGIA 5TKWA 2QKKA 3HM9A 5LMUK 2OPSA 1QE1A 1RT5A 2GEMA 1RBRA 3MX2A 4BGAA 3CPEA 4DB3A 1E4GT 5CHIA 3SAHA 2E2NA 3KLHA 2R7YA 4JI7K 3WNFA 4BRQA 1X9WA 2W6LA 4PHTX 4AHVA 3IRXA 4BRKA 4RG8A 5C15A 4RW6A 4BG8A 1ASVA 3BZCA 3MEEA 4JK7A 1IH7A 2KFZA 1R0AA 4FL9A 4BVOA 3LP3A 1VRTA 4JYAK 4B9LA 3SQ1A 3ZCMA 3U3GA 3CM6A 1S9GA 3O3HA 1QVFM 3HK2A 3PLAA 1RT2A 3SAFA 1TUUA 4C8MA 1VSIA 4BVPA 4U67L 1YITN 3QEWA 1BO5O 4JK9A 3NF6A 3OA9A 5JVHL 1JCGA 4RTFD 4BE2A 3VETA 2D0OA 2O8DA 1T7PA 4H4OA 1SZ2A 2D5RA 3K5LA 5EOYA 3SNNA 2ZQBA 3RMBA 3OVNA 2HF4A 2HHTA 1S1TA 4FPBA 1SKSA 1IBLK 2Z1GA 1NU0A 3SMSA 4LFBK 3HXMA 4PKHA 1JLCA 3KD5E 4F2SA 1HNZK 2HVHA 2FF6A 3L3UA 3CETA 4DR5K 1HNXK 3LDQA 1D5AA 2O8EB 4IWVA 3AVNA 3PX0A 2Q1NA 4KV8A 4F3TA 3A5OC 3O9UA 2P9UA 3L0QA 2IGIA 3ASMA 4I2PA 3T3FA 4JK8A 3G25A 2O4GA 2YNGA 1OH6A 2O8BA 2FBTA 2FC0A 2QXFA 4E89A 4CERA 4CJEA 2IVNA 3JXUA 4XEIA 3VN5A 4DV6K 4B8AB 2HNDA 2Z1IA 1S3XA 3BGRA 4F4KA 1T3VA 1QS4A 1EXQA 3FFKB 2X6SA 2O4IA 4CF9A 1NKCA 4PWDA 1XNRK 4CFCA 4LC9B 3LZJA 3VEXA 4M3TA 3FZMA 1ATSA 2P51A 4X64K 4GVEA 1RCHA 1JLQA 2VG7A 4I7FA 1DTTA 5JMVA 4JI4K 4CGFA 1OVYA 5M1QA 3G10A 1U49A 5AQGA 1NM1A 4BRFA 2D0CA 3DLBA 3DJCA 4NXNK 1BA1A 5C10A 2DY4A 1MWKA 3I0RA 3RSEB 5KRSA 1NJZA 4CEEA 4CD1A 4FJXA 2BH1A 3K5MA 4DTPA 3AVMA 3LL3A 3A5LC 3SCXA 4KHQA 3S3OA 5LJVA 2DFEA 3B6PA 5GAEP 3JAMO 2ZJRL 3VEZA 4CJTA 3ZX0A 1RT7A 2WTUA 2E88A 1DGKN 2YNHA 3MK6A 3ALYA 1HKGA 3LWLA 5AJ3K 4JAXA 1IG8A 1YF5L 3CFPA 3LALA 1CLQA 1VK0A 2YHWA 4C1NK 1HRHA 2OZSA 3HL8A 1S1WA 3AAQA 3DXMA 4JNEA 4DLEA 4AHSA 2E1ZA 3DXKA 1RBSA 1ZBHA 5KRTA 1RT1A 2A3ZA 1NMNA 1HPZA 4OKKA 2GELA 1IKYA 4Y1CA 3ZSOA 3LDSA 3IMXA 4NYNA 5HLFA 1KLMA 2YHAA 3WNHA 1BCMA 4A62A 1WSJA 4C23A 1XMOK 3F73A 2P9PA 1SL0A 4OPJA 4RW9A 2LSNA 3HYFA 4DHYA 3NMUA 2F96A 5ADXH 3WQUA 3KHYA 2NRXA 3V6DA 4YDUC 2XY7A 3CCVN 3IS9A 4CZJA 3KK2A 3OYHA 4NO7A 4DQRA 3MCPA 3D0PA 1WSFA 4M3UA 1UWBA 1HR0K 4OX9K 1JL1A 5DK5A 2NRTA 4BRAA 3WXMB 1QQOA 2A1RA 1RDUA 4E7HA 3DRSA 4BDZA 1IBMK 1VQPN 4NB4A 1Q9XA 3CJ9A 4JKDA 3VEOA 3U4LA 4DF4A 1S1XA 4MO5A 4OGCA 3WNGA 4XH4A 1NG9A 4CZHA 4NYFA 4JI8K 4L8RB 1EO1A 2HMPA 4DR7K 3L4QA 3V1RA 4HTLA 4B9NA 1G99A 3NVMA 1VSKA 3HPGA 1V4TA 3EKSA 4DUZK 3Q7CA 3I0SA 2QTDA 4CEAA 2HHXA 3NVKA 4PKIA 3OYLA 2UUCK 2X78A 3C7NB 2QK9A 2GTDA 2XY8A 3J80O 3QEPA 3CJCA 3I55N 3LP1A 3MMVA 4QOZB 1ZXOA 1Q9YA 3BY5A 2VWJA 3AVLA 3MDQA 1NK4A 4BROA 1S1VA 3U9ZA 2QEXN 1YVUA 3C95A 3V9ZA 3TTDA 2ATQA 4K0KK 4HVJA 1ILYA 3NBPA 4CJKA 4FJIA 2P9LA 5JS2A 3KIOA 4F8RA 4BR5A 3V4IA 2Q31A 1SS6A 1C0UA 3O1BA 2ITMA 3VTHA 1EP4A 4R5PA 4LH4A 4TSXA 3KLGA 1S22A 4CBXA 1MU2A 3HI0A 4AHTA 3MX5A 3D2FA 3K0SA 3HO1A 2KZMA 4BGBA 3MECA 3NE6A 4LFAK 1E4FT 2G8HA 4M3RA 3O6WA 4E0DA 4I6MA 3E9LA 4DSLA 2YV0X 4A5BA 3CQXA 1N36K 3J7ZO 4LY7A 1BISA 4O4GA 4GV3A 3TU5A 4CJQA 3M6GA 3SV3A 4CVNE 3ULDA 1KCFA 2AP1A 1L3VA 3SQ0A 4OGEA 3QIPA 4GKKK 5I3UA 5AQSA 4HUGA 4JKCA 3NCIA 4CK1A 5JLFA 5KI6A 4KH4A 3GE1A 3VF2A 3MWTA 1NGCA 1KC8O 3CCQN 2IS3A 2QM1A 4IO9L 1DEJA 4C8OA 5FRNA 4PKGA 2I7PA 4B3TK 1RNHA 1VRUA 3ENBA 4CJPA 5SWMA 4FW1A 1VSDA 2Q97A 4Y1DA 4MFBA 5J1EA 3NAEA 4XH1A 4C8KA 4YY3K 3TAGA 2GUPA 2O8CA 1X9SA 1VQLN 3DLRA 4I6MB 4ILJA 1W2BM 1GLLO 5KPZA 1JLFA 2NUBA 1FKPA 3AA4A 1LAVA 3DLGA 4YORA 3ZT2A 1N33K 4Z4GA 3OBYA 3U8XA 2UU9K 3P38A 4AHCA 4XIUA 4EP5A 3WT0A 3QEVA 2UXBK 2JGUA 1OVQA 3OYBA 2VG6A 4DQQA 2WC9A 4FLXA 2XO7A 2Z1JA 2OA8A 1NGAA 1TUYA 1NOZA 4B3MK 3LDPA 2WONA 4JKHA 4YOWA 4DFPA 2NRRA 1RFQA 3L2VA 2P9NA 3VQPA 3ZSXA 3HVRA 2HHSA 4B1YB 2IOCA 4KI6A 1RBVA 3PIOL 1A5VA 2GX9A 3AO4A 3SLCA 4A2AA 4NCAA 1RDWX 2RHKA 4JEPA 1KD1O 4DV3K 4IO8A 4CIFA 2NZTA 4FLUA 4E1JA 4CI6A 1IKWA 1O1WA 3AA3A 3V9SA 2F4VK 3O80A 1GLEG 3LPUA 3SQ2A 4MLHA 2O8FA 4H5TA 3N4QA 5AQXA 4E1NA 5LY3A 1NK5A 1SKRA 3VESA 2IDOA 4LH5A 4PQUA 4ISEA 3ZT4A 3WXKA 3OYGA 1NK8A 4CIGA 4EFHA 3VQ4A 2I7NA 3CC7N 3QB0A 5KPRA 3I8BA 3AGKA 3OY9A 2W42A 4CECA 1BQMA 3VGLA 3LDNA 3O1WA 3UKUA 3ULEB 4M45A 5KTQA 1X3NA 1LAWA 4I2QA 3LP2A 5F0XA 4DQPA 4DU3A 3THXB 1W97L 2PY5A 4DG1A 4FLWA 1W0HA 4DTRA 3HZ6A 4WQ4C 3RWUA 2BE2A 4RW7A 3PIPL 4DSJA 4M7YA 2RE2A 3HPHA 1IBKK 4QAGA 2HBLA 5CYQA 4K8ZA 1SKWA 2AJQA 2KKZA 5C12A 4X66K 4BY9C 1RT4A 2VWKA 3THVA 4J2EA 1QQCA 2QXLA 4CZMA 1BIUA 2HHWA 4MO4A 3GL1A 5BRFA 1RTIA 1KSPA 2BDPA 4CZGA 3AVBA 4PL7A 5GADP 4FW2A 3DLLL 5I42A 1NK9A 4HCCA 4ZTJA 5K14A 4OPHA 3VQQA 3VMFB 3K5NA 1WB9A 1VHXA 2A6AA 1GLAG 4ILHA 1OH7A 4CHOA 1QTMA 1BOTO 4Z94A 5BRDA 3TAFA 4RCHA 4FO0A 5KQ8A 5AQPA 3KTQA 2Y1IA 4BE0A 3TI0A 2V52B 1YJWN 4M3WA 4Q0BA 3P31A 5M1PA 4U7BA 3MCAB 4H5NA 3C6AA 3D2EB 5GAGP 1CZAN 4GY2B 3PX6A 3CMAN 4IKFA 4GNIA 3OHRA 3ZSQA 4Z0UA 1WSHA 3LDLA 3QDKA 3OYCA 4DR1K 3AAPA 4MLEA 3CCEN 3S3NA 5AZIA 1U48A 1TK8A 1ASUA 3CCMN 3ZT0A
chains in the Genus database with same CATH topology
1KLNA 3OYDA 5J2PA 1RCHA 1JLQA 2VG7A 1S5JA 4KKOA 3P83D 4I7FA 1DTTA 2G8WA 4FJGA 3AO5A 4CGFA 2X6NA 3AVIA 1W9HA 2E4LA 4DTMA 4JRPA 3QEXA 1NKEA 4DSKA 1U49A 3G10A 4KRFA 3AVFA 4KPYA 2D0CA 3DLBA 1S6QA 1HJRA 2DY4A 4CGHA 3OYNA 2HNZA 3I0RA 4W5NA 4KHWA 4FJ7A 1J5OA 5KRSA 4CJ3A 1NJZA 4CHPA 4N5SA 1D8YA 4FZZA 5EU7A 3OYFA 4LSLA 1VSMA 4CEEA 4CJUA 4FJXA 3SQ4A 4DS5A 3K5MA 2HW3A 2Y1JA 4J2BA 4DTPA 3OS0A 3AVMA 3SCXA 2BANA 4CIEA 1NK0A 4KHQA 2EHGA 1RDBA 3S3OA 3KKSA 1RTHA 3K57A 2DFEA 1C1CA 2BGGA 3B6PA 3OYMA 2OYQA 4BWMA 4CJTA 1RT7A 3L8BA 1HQEA 1KFDA 4M42A 4O0IA 2EX3A 2ITGA 1VSLA 4E3SA 4F3OA 2YNHA 3PO5A 4E7KA 3ALYA 3LWLA 1WAJA 3U3YA 3AA2A 4K8XA 4W5OA 4B9UA 1TK8A 3LAKA 4W5TA 3CFPA 2X74A 3LALA 4FLZA 3TAQA 4FK4A 1CLQA 4GMJB 1TAUA 1VK0A 3RRGA 1C6VA 1TKZA 4CF8A 1HRHA 3RMDA 3DLHA 3HL8A 4C8LA 3ZSRA 1XI1A 1WNSA 4I9LA 4DSEA 1ZYQA 1S1WA 3TAMA 4ID1A 4DLEA 3IAYA 1KFSA 4B3OA 4AHSA 3CQ8A 3PUFA 2ZD1A 4CF1A 1TAQA 1RBSA 4DTJA 5KRTA 1ZBHA 1RT1A 3QIOA 3DLKA 2XY6A 1HPZA 1JLEA 4OKKA 1IKYA 1FK9A 4Y1CA 3ZSOA 3QO9A 3VQBA 3L2QA 3NH2A 4KI4A 3K58A 3VQAA 1GOCA 3LDSA 1BL3A 2YNFA 4FJMA 4CFDA 1UAXA 1TVRA 3QERA 4NYNA 3TANA 2XRIA 4CJFA 1KLMA 2YHAA 3WNHA 5HLFA 1BCMA 1WSJA 4OKJA 4OPKA 5J2QA 4ID5A 3EY1A 1T05A 3LP0A 3F73A 4HHTA 3TAPA 1HYZA 1WLJA 1WSEA 2LSNA 3HYFA 4RW9A 4OPJA 1SL0A 4CJWA 2F96A 1B92A 5CZ2A 3VQEA 1LV5A 3V6DA 4EZ9A 2XY7A 3DI6A 3IS9A 3KK2A 3OYHA 5CZ1A 2GUIA 1XHZA 2OZMA 1KVCA 1RT6A 4JRQA 1X1PA 2E6LA 4DQRA 1DTQA 3D0PA 2OPPA 1WSFA 3V9XA 4M3UA 1UWBA 1JL1A 3ZSYA 3SPZA 5DK5A 1TGOA 2A1RA 4E7HA 1SL2A 2DFHA 3DRSA 4BDZA 2PYLA 3DLEA 4ELTA 3O3GA 3HJFA 4GVMA 4B8CA 1Q9XA 3M8QA 1LWFA 3T1AA 4EP4A 3S9HA 2RN2A 3QNOA 1N6QA 4DF4A 4FZXC 1J53A 1S1XA 3NH1A 1ITGA 4CHNA 1IKVA 4OGCA 3WNGA 1CXUA 2ETJA 3WNEA 4Z4EA 4NYFA 4AILC 4CEBA 4BWJA 3L2RA 1TK0A 4L8RB 4FLTA 4N41A 3C6UA 3TR8A 1JLGA 3V1RA 2KFNA 1C0MA 4B9NA 4DTOA 5DMRA 3SUOA 1NOYA 4CHQA 1VSKA 3HPGA 4YNQA 3SPYA 4HCBA 1B9DA 3K2PA 1WSGA 3KKRA 2PZSA 3I0SA 3VQ6A 4CEAA 4J2DA 3OJUA 3M8SA 5HRSA 4DU4A 1NKBA 4FJLA 2HHXA 4JLHA 4N47A 3MXJA 3OYLA 3RR8A 3DYAA 1TKXA 5FDLA 4W5RA 5HBMA 4CJVA 4B08A 5FROA 2X78A 5D3GA 4DF8A 2QK9A 3OJSA 3RMCA 3A2FA 1IO2A 2YHBA 4E7IA 4DSIA 1KVAA 4CEDA 1CZBA 2XY8A 3QLHA 4CJLA 1JLAA 5C42A 2KTQA 3QEPA 1IG9A 1EETA 1ZBFA 2G8UA 3LP1A 3MEDA 5E41A 4QOZB 4UQGA 3PY8A 5J2MA 4CGGA 1Q9YA 3DRPA 2WOMA 2VWJA 3AVLA 2KW4A 1NK4A 4H8KA 4E7LA 2FBYA 1WSIA 2HHQA 1A5WA 1S1VA 5HRRA 3AVAA 2XHBA 3PV8A 3EZ5A 2P5GA 4KHYA 5KGXA 1K6YA 1YVUA 3C95A 4OKEA 1WAFA 3ZSWA 4HTUA 4CEFA 1Q8IA 3V9ZA 3TABA 2ATQA 3SI6A 1GOAA 3NF8A 3AO2A 3DMJA 1T03A 4HVJA 3QEIA 4FLYA 1FKOA 3KK1A 3NBPA 1ZBLA 4CJKA 4FJIA 4KO0A 4CHZA 2RKIA 4CJ4A 3G0ZA 5JS2A 3KIOA 2I5JA 4F8RA 3V4IA 3CYMA 1Z25A 3S3MA 4M3ZA 4CJSA 4DQSA 4CK2A 4FJNA 4OLAA 1TV6A 4O55A 3QINA 3V1OA 4CGIA 1C0UA 1J9AA 3NH0A 5FRMA 2PYJA 3MAQA 1EP4A 2JLEA 3KLIA 3V1QA 3OYIA 4R5PA 3NHGA 1SL1A 1RTDA 4LH4A 4TSXA 3L2WA 1QSYA 3KLGA 1ASWA 4AHUA 1MU2A 4B9SA 1RBUA 1CZ9A 4AHTA 1RILA 3L2UA 3HO1A 2KZMA 3HP6A 2D0BA 3MECA 3NE6A 4PY5A 2G8HA 4M3RA 3O4NA 2FBXA 1U45A 4DWIA 4CF0A 4E0DA 1HNIA 1JKHA 2RF2A 4KFBA 1LW2A 1U47A 4DSLA 4M3XA 1ZBUA 2YV0X 1QSSA 4B9VA 4KHNA 4FM0A 4LY7A 1BISA 1B9FA 4O4GA 4CJ5A 4CJQA 3SYZA 2G8IA 2IAJA 3SV3A 1QHTA 4M41A 3AA5X 3ULDA 1KTQA 1HNVA 1KCFA 3UIQA 1BIZA 4FVMA 1X9MA 3L3VA 1GOBA 3T19A 1UOCA 1RBTA 5HRPA 1L3TA 1L3VA 3VQDA 3QETA 2XY5A 1HYSA 2KQ2A 3SQ0A 4BDPA 4OGEA 1NJXA 3ITHA 2YNIA 3QIPA 4KREA 1G15A 5I3UA 4ZTFA 4HUGA 3NCIA 4IG3A 4CK1A 4Q5VA 5KI6A 4FXDA 1C0TA 4CEQA 4OJRA 4FYDA 3NF9A 3CFOA 4C8NA 5J2NA 4RW4A 2HB5A 4KB1A 5JS1A 2IS3A 3V9WA 4Z4IA 3TAEA 3ZSZA 4C8OA 3DOKA 3VQ8A 2P5OA 4KHSA 3EYZA 5KGWA 4CEZA 5FRNA 3QESA 1RNHA 4O44A 3HT3A 1VRUA 3P5JA 3OYJA 5SWMA 4CJPA 1SV5A 4JS5A 2HHVA 4FW1A 4FK0A 1VSDA 4O5BA 4ZHRA 4Y1DA 4W5QA 4MFBA 1I3AA 1KVBA 5J1EA 3NAEA 1JXEA 4IFVA 4FJ5A 4C8KA 3B6OA 4J2AA 1I39A 3TAGA 1J54A 3OYKA 2P1JA 3DOLA 3SUQA 1U04A 4PA1A 1X9SA 3AO1A 3DLRA 2G8FA 4IDKA 4LSNA 3NGIA 4KTQA 3HPOA 3O4QA 1Y97A 2HNYA 3LWMA 4CK3A 4G1QA 3OYEA 3VA3A 4BE1A 1JLFA 4OVLA 4DFKA 2Q3SA 2NUBA 1FKPA 4HUFA 4DSFA 4DMNA 3AA4A 1LAVA 3DLGA 1YT3A 3NFAA 3AVGA 3ZT2A 3K5OA 4FM1A 1NJYA 3RTVA 4FJHA 3NGYA 4Z4GA 3JSMA 3CM5A 3C94A 4H4MA 3AVCA 3AVHA 3V9UA 1BHLA 1LW0A 2ZE2A 4M3YA 4ELVA 1S1UA 4DTXA 1D9FA 1IKXA 4CHYA 4AHCA 4RW8A 4XIUA 4EP5A 4DU1A 1ZBIA 3QEVA 1LWEA 2JGUA 4E1MA 3OYBA 2VG6A 3ISNC 3PX4A 4DQQA 1TK5A 4F2RA 4FLXA 3LZIA 2XO7A 2Z1JA 3SUNA 3C6TA 1XWLA 1XC9A 2OA8A 4B9TA 4OLBA 3LANA 4QCLA 1NOZA 2OPRA 3VQ9A 4HUEA 3OS1A 4KB0A 3LPTA 2WONA 4DFPA 3L2VA 4NCGA 3VQPA 3ZSXA 1NJWA 1VSJA 4E7JA 3KD1E 3ZSVA 3HVRA 2F8SA 3P1GA 3NDKA 2HHSA 1YTUA 2IOCA 5CYMA 1NK6A 4KI6A 1RBVA 3M8PA 1A5VA 1RDCA 3AO4A 4NCAA 1CXQA 4N56A 3O3FA 1S9EA 1HYVA 2E6MA 2OZSA 4DQIA 4PUOA 1HMVA 1T8EA 2G8VA 1JLBA 4DTSA 2HVIA 4CIFA 3NGZA 3LAMA 1DLOA 4FLUA 2OPQA 1IKWA 3F9KA 1O1WA 3HVTA 1A5XA 3AA3A 2YKMA 5HRNA 4FCYA 3V9SA 3K59A 4DFJA 3V81A 3HP9A 2B4JA 3LPUA 4EZ6A 3SQ2A 2QKKA 2Z1HA 3HM9A 4Z4FA 2OPSA 1QE1A 1RT5A 4E1NA 1RBRA 3VQ5A 1TL3A 1NK5A 1SKRA 4CFBA 2IDOA 1C1BA 1LWCA 4LH5A 1RDAA 4BACA 1EKEA 3ZT1A 3AVJA 4PQUA 3KLHA 3ZT4A 2R7YA 3WNFA 4N76A 3OYGA 1NK8A 1X9WA 4CFAA 4CIGA 4AHVA 5T7BA 3VQ4A 4DFMA 1NK7A 3IRXA 1F21A 3KJVA 1L3UA 4RG8A 2GBZA 1N5YA 4RW6A 2F8TA 3DRRA 1ASVA 3OY9A 2W42A 1Z26A 5HP1A 3MEEA 4CECA 1BQMA 1IH7A 2KFZA 1R0AA 1BQNA 3FFIA 1BCOA 5CY4A 4CESA 4M45A 4IBNA 5KTQA 4DLGA 1LAWA 4I9QA 3AVKA 3LP3A 4FJ9A 4FK2A 4KTWA 4FJJA 2G8KA 1VRTA 4CJRA 1TL1A 4I2QA 3LP2A 2HMIA 4B9LA 1C1AA 2GV9A 1SUQA 3OYAA 4DU3A 3SQ1A 4DQPA 3ZCMA 3U3GA 2A1SA 3TWHA 4IFYA 3I8DA 3IG1A 3CM6A 2PY5A 1XHXA 4DG1A 4FLWA 1W0HA 4DTRA 3MXIA 1UA1A 4MQ3A 1S9GA 3O3HA 3CG7A 1L3SA 3KLFA 4CE9A 4IG0A 3RWUA 3MEGA 2BE2A 4RW7A 3RRHA 3RMAA 3DM2A 4DSJA 2QKBA 3SUPA 3HK2A 1RT2A 1REVA 4C8MA 1VSIA 3HSTB 4CGJA 3OS2A 3QEWA 3VQCA 3HPHA 4Z4HA 3SV4A 4CGDA 4LD0A 4QAGA 4CCHA 3NF6A 1VSFA 4FM2A 1RDDA 5CYQA 4K8ZA 1SKWA 4BE2A 2AJQA 1RT4A 2VWKA 4CEOA 4DTNA 1QQCA 3THVA 3MXMA 4J2EA 1T7PA 1BIUA 4H4OA 3K5LA 2D5RA 2HHWA 3SNNA 2ZQBA 3RMBA 3OVNA 3ZT3A 4NCBA 2HHTA 1S1TA 1EX4A 1YTAA 1SKSA 2RPIA 2D0AA 3TARA 2Z1GA 1RTIA 1KSPA 2BDPA 3RR7A 4AH9A 3AVBA 3HXMA 4FW2A 4AHRA 4YFUA 1JLCA 1UA0A 3KD5E 4F2SA 4FJ8A 2HVHA 4DS4A 4E19A 3M8RA 5I42A 1NK9A 3L3UA 1JL2A 4HCCA 2IC3A 1BI4A 4ZTJA 5K14A 3CFRA 3VQQA 4ELUA 2YKNA 1WN7A 1D5AA 2DFFA 4JS4A 3K5NA 3U6FA 1VSEA 1RTJA 3SJJA 1BGXT 3AVNA 4FJKA 3PX0A 3SZ2A 4KV8A 4F3TA 4CHOA 1HQUA 1QTMA 3BDPA 1TKTA 2IGIA 3NF7A 2B5JA 3ASMA 4I2PA 3T3FA 3TAFA 1S6PA 2DTUA 3KTQA 2O4GA 2YNGA 4KAZA 4KHUA 5C25A 2FBTA 2FC0A 1U4BA 2Y1IA 4B9MA 4KTZA 1TKDA 3AO3A 4BE0A 3QNNA 3TI0A 3D45A 5SZTA 5HROA 2QXFA 4E89A 4CERA 4GW6A 4M3WA 4CJEA 4Q0BA 1L5UA 1JXBA 3VN5A 4B8AB 3H08A 2B6AA 3JYTA 3VA0A 1FXXA 1VSHA 2HNDA 2Z1IA 3BGRA 4ICLA 4Z4CA 4F4KA 4BDYA 1QS4A 4O0JA 1D9DA 1EXQA 4FLVA 4CF2A 2X6SA 2HHUA 2O4IA 2FBVA 4CF9A 3PX6A 3VQ7A 4FZYA 1NKCA 4PWDA 4IKFA 4CFCA 3LZJA 3ZSQA 4Z0UA 1WSHA 1QSLA 4WE1A 2KZZA 3OYCA 1BI4B 4M3TA 1RT3A 2VG5A 1KRPA 3KK3A 3E01A 4DTUA 3KLEA 3S3NA 1U48A 5C24A 2P51A 1ASUA 3PO4A 3ZT0A 3AV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KLN A;  3OYD A;  5J2P A;  1RCH A;  1JLQ A;  2VG7 A;  1S5J A;  4KKO A;  3P83 D;  4I7F A;  1DTT A;  2G8W A;  4FJG A;  3AO5 A;  4CGF A;  2X6N A;  3AVI A;  1W9H A;  2E4L A;  4DTM A;  4JRP A;  3QEX A;  1NKE A;  4DSK A;  1U49 A;  3G10 A;  4KRF A;  3AVF A;  4KPY A;  2D0C A;  3DLB A;  1S6Q A;  1HJR A;  2DY4 A;  4CGH A;  3OYN A;  2HNZ A;  3I0R A;  4W5N A;  4KHW A;  4FJ7 A;  1J5O A;  5KRS A;  4CJ3 A;  1NJZ A;  4CHP A;  4N5S A;  1D8Y A;  4FZZ A;  5EU7 A;  3OYF A;  4LSL A;  1VSM A;  4CEE A;  4CJU A;  4FJX A;  3SQ4 A;  4DS5 A;  3K5M A;  2HW3 A;  2Y1J A;  4J2B A;  4DTP A;  3OS0 A;  3AVM A;  3SCX A;  2BAN A;  4CIE A;  1NK0 A;  4KHQ A;  2EHG A;  1RDB A;  3S3O A;  3KKS A;  1RTH A;  3K57 A;  2DFE A;  1C1C A;  2BGG A;  3B6P A;  3OYM A;  2OYQ A;  4BWM A;  4CJT A;  1RT7 A;  3L8B A;  1HQE A;  1KFD A;  4M42 A;  4O0I A;  2EX3 A;  2ITG A;  1VSL A;  4E3S A;  4F3O A;  2YNH A;  3PO5 A;  4E7K A;  3ALY A;  3LWL A;  1WAJ A;  3U3Y A;  3AA2 A;  4K8X A;  4W5O A;  4B9U A;  1TK8 A;  3LAK A;  4W5T A;  3CFP A;  2X74 A;  3LAL A;  4FLZ A;  3TAQ A;  4FK4 A;  1CLQ A;  4GMJ B;  1TAU A;  1VK0 A;  3RRG A;  1C6V A;  1TKZ A;  4CF8 A;  1HRH A;  3RMD A;  3DLH A;  3HL8 A;  4C8L A;  3ZSR A;  1XI1 A;  1WNS A;  4I9L A;  4DSE A;  1ZYQ A;  1S1W A;  3TAM A;  4ID1 A;  4DLE A;  3IAY A;  1KFS A;  4B3O A;  4AHS A;  3CQ8 A;  3PUF A;  2ZD1 A;  4CF1 A;  1TAQ A;  1RBS A;  4DTJ A;  5KRT A;  1ZBH A;  1RT1 A;  3QIO A;  3DLK A;  2XY6 A;  1HPZ A;  1JLE A;  4OKK A;  1IKY A;  1FK9 A;  4Y1C A;  3ZSO A;  3QO9 A;  3VQB A;  3L2Q A;  3NH2 A;  4KI4 A;  3K58 A;  3VQA A;  1GOC A;  3LDS A;  1BL3 A;  2YNF A;  4FJM A;  4CFD A;  1UAX A;  1TVR A;  3QER A;  4NYN A;  3TAN A;  2XRI A;  4CJF A;  1KLM A;  2YHA A;  3WNH A;  5HLF A;  1BCM A;  1WSJ A;  4OKJ A;  4OPK A;  5J2Q A;  4ID5 A;  3EY1 A;  1T05 A;  3LP0 A;  3F73 A;  4HHT A;  3TAP A;  1HYZ A;  1WLJ A;  1WSE A;  2LSN A;  3HYF A;  4RW9 A;  4OPJ A;  1SL0 A;  4CJW A;  2F96 A;  1B92 A;  5CZ2 A;  3VQE A;  1LV5 A;  3V6D A;  4EZ9 A;  2XY7 A;  3DI6 A;  3IS9 A;  3KK2 A;  3OYH A;  5CZ1 A;  2GUI A;  1XHZ A;  2OZM A;  1KVC A;  1RT6 A;  4JRQ A;  1X1P A;  2E6L A;  4DQR A;  1DTQ A;  3D0P A;  2OPP A;  1WSF A;  3V9X A;  4M3U A;  1UWB A;  1JL1 A;  3ZSY A;  3SPZ A;  5DK5 A;  1TGO A;  2A1R A;  4E7H A;  1SL2 A;  2DFH A;  3DRS A;  4BDZ A;  2PYL A;  3DLE A;  4ELT A;  3O3G A;  3HJF A;  4GVM A;  4B8C A;  1Q9X A;  3M8Q A;  1LWF A;  3T1A A;  4EP4 A;  3S9H A;  2RN2 A;  3QNO A;  1N6Q A;  4DF4 A;  4FZX C;  1J53 A;  1S1X A;  3NH1 A;  1ITG A;  4CHN A;  1IKV A;  4OGC A;  3WNG A;  1CXU A;  2ETJ A;  3WNE A;  4Z4E A;  4NYF A;  4AIL C;  4CEB A;  4BWJ A;  3L2R A;  1TK0 A;  4L8R B;  4FLT A;  4N41 A;  3C6U A;  3TR8 A;  1JLG A;  3V1R A;  2KFN A;  1C0M A;  4B9N A;  4DTO A;  5DMR A;  3SUO A;  1NOY A;  4CHQ A;  1VSK A;  3HPG A;  4YNQ A;  3SPY A;  4HCB A;  1B9D A;  3K2P A;  1WSG A;  3KKR A;  2PZS A;  3I0S A;  3VQ6 A;  4CEA A;  4J2D A;  3OJU A;  3M8S A;  5HRS A;  4DU4 A;  1NKB A;  4FJL A;  2HHX A;  4JLH A;  4N47 A;  3MXJ A;  3OYL A;  3RR8 A;  3DYA A;  1TKX A;  5FDL A;  4W5R A;  5HBM A;  4CJV A;  4B08 A;  5FRO A;  2X78 A;  5D3G A;  4DF8 A;  2QK9 A;  3OJS A;  3RMC A;  3A2F A;  1IO2 A;  2YHB A;  4E7I A;  4DSI A;  1KVA A;  4CED A;  1CZB A;  2XY8 A;  3QLH A;  4CJL A;  1JLA A;  5C42 A;  2KTQ A;  3QEP A;  1IG9 A;  1EET A;  1ZBF A;  2G8U A;  3LP1 A;  3MED A;  5E41 A;  4QOZ B;  4UQG A;  3PY8 A;  5J2M A;  4CGG A;  1Q9Y A;  3DRP A;  2WOM A;  2VWJ A;  3AVL A;  2KW4 A;  1NK4 A;  4H8K A;  4E7L A;  2FBY A;  1WSI A;  2HHQ A;  1A5W A;  1S1V A;  5HRR A;  3AVA A;  2XHB A;  3PV8 A;  3EZ5 A;  2P5G A;  4KHY A;  5KGX A;  1K6Y A;  1YVU A;  3C95 A;  4OKE A;  1WAF A;  3ZSW A;  4HTU A;  4CEF A;  1Q8I A;  3V9Z A;  3TAB A;  2ATQ A;  3SI6 A;  1GOA A;  3NF8 A;  3AO2 A;  3DMJ A;  1T03 A;  4HVJ A;  3QEI A;  4FLY A;  1FKO A;  3KK1 A;  3NBP A;  1ZBL A;  4CJK A;  4FJI A;  4KO0 A;  4CHZ A;  2RKI A;  4CJ4 A;  3G0Z A;  5JS2 A;  3KIO A;  2I5J A;  4F8R A;  3V4I A;  3CYM A;  1Z25 A;  3S3M A;  4M3Z A;  4CJS A;  4DQS A;  4CK2 A;  4FJN A;  4OLA A;  1TV6 A;  4O55 A;  3QIN A;  3V1O A;  4CGI A;  1C0U A;  1J9A A;  3NH0 A;  5FRM A;  2PYJ A;  3MAQ A;  1EP4 A;  2JLE A;  3KLI A;  3V1Q A;  3OYI A;  4R5P A;  3NHG A;  1SL1 A;  1RTD A;  4LH4 A;  4TSX A;  3L2W A;  1QSY A;  3KLG A;  1ASW A;  4AHU A;  1MU2 A;  4B9S A;  1RBU A;  1CZ9 A;  4AHT A;  1RIL A;  3L2U A;  3HO1 A;  2KZM A;  3HP6 A;  2D0B A;  3MEC A;  3NE6 A;  4PY5 A;  2G8H A;  4M3R A;  3O4N A;  2FBX A;  1U45 A;  4DWI A;  4CF0 A;  4E0D A;  1HNI A;  1JKH A;  2RF2 A;  4KFB A;  1LW2 A;  1U47 A;  4DSL A;  4M3X A;  1ZBU A;  2YV0 X;  1QSS A;  4B9V A;  4KHN A;  4FM0 A;  4LY7 A;  1BIS A;  1B9F A;  4O4G A;  4CJ5 A;  4CJQ A;  3SYZ A;  2G8I A;  2IAJ A;  3SV3 A;  1QHT A;  4M41 A;  3AA5 X;  3ULD A;  1KTQ A;  1HNV A;  1KCF A;  3UIQ A;  1BIZ A;  4FVM A;  1X9M A;  3L3V A;  1GOB A;  3T19 A;  1UOC A;  1RBT A;  5HRP A;  1L3T A;  1L3V A;  3VQD A;  3QET A;  2XY5 A;  1HYS A;  2KQ2 A;  3SQ0 A;  4BDP A;  4OGE A;  1NJX A;  3ITH A;  2YNI A;  3QIP A;  4KRE A;  1G15 A;  5I3U A;  4ZTF A;  4HUG A;  3NCI A;  4IG3 A;  4CK1 A;  4Q5V A;  5KI6 A;  4FXD A;  1C0T A;  4CEQ A;  4OJR A;  4FYD A;  3NF9 A;  3CFO A;  4C8N A;  5J2N A;  4RW4 A;  2HB5 A;  4KB1 A;  5JS1 A;  2IS3 A;  3V9W A;  4Z4I A;  3TAE A;  3ZSZ A;  4C8O A;  3DOK A;  3VQ8 A;  2P5O A;  4KHS A;  3EYZ A;  5KGW A;  4CEZ A;  5FRN A;  3QES A;  1RNH A;  4O44 A;  3HT3 A;  1VRU A;  3P5J A;  3OYJ A;  5SWM A;  4CJP A;  1SV5 A;  4JS5 A;  2HHV A;  4FW1 A;  4FK0 A;  1VSD A;  4O5B A;  4ZHR A;  4Y1D A;  4W5Q A;  4MFB A;  1I3A A;  1KVB A;  5J1E A;  3NAE A;  1JXE A;  4IFV A;  4FJ5 A;  4C8K A;  3B6O A;  4J2A A;  1I39 A;  3TAG A;  1J54 A;  3OYK A;  2P1J A;  3DOL A;  3SUQ A;  1U04 A;  4PA1 A;  1X9S A;  3AO1 A;  3DLR A;  2G8F A;  4IDK A;  4LSN A;  3NGI A;  4KTQ A;  3HPO A;  3O4Q A;  1Y97 A;  2HNY A;  3LWM A;  4CK3 A;  4G1Q A;  3OYE A;  3VA3 A;  4BE1 A;  1JLF A;  4OVL A;  4DFK A;  2Q3S A;  2NUB A;  1FKP A;  4HUF A;  4DSF A;  4DMN A;  3AA4 A;  1LAV A;  3DLG A;  1YT3 A;  3NFA A;  3AVG A;  3ZT2 A;  3K5O A;  4FM1 A;  1NJY A;  3RTV A;  4FJH A;  3NGY A;  4Z4G A;  3JSM A;  3CM5 A;  3C94 A;  4H4M A;  3AVC A;  3AVH A;  3V9U A;  1BHL A;  1LW0 A;  2ZE2 A;  4M3Y A;  4ELV A;  1S1U A;  4DTX A;  1D9F A;  1IKX A;  4CHY A;  4AHC A;  4RW8 A;  4XIU A;  4EP5 A;  4DU1 A;  1ZBI A;  3QEV A;  1LWE A;  2JGU A;  4E1M A;  3OYB A;  2VG6 A;  3ISN C;  3PX4 A;  4DQQ A;  1TK5 A;  4F2R A;  4FLX A;  3LZI A;  2XO7 A;  2Z1J A;  3SUN A;  3C6T A;  1XWL A;  1XC9 A;  2OA8 A;  4B9T A;  4OLB A;  3LAN A;  4QCL A;  1NOZ A;  2OPR A;  3VQ9 A;  4HUE A;  3OS1 A;  4KB0 A;  3LPT A;  2WON A;  4DFP A;  3L2V A;  4NCG A;  3VQP A;  3ZSX A;  1NJW A;  1VSJ A;  4E7J A;  3KD1 E;  3ZSV A;  3HVR A;  2F8S A;  3P1G A;  3NDK A;  2HHS A;  1YTU A;  2IOC A;  5CYM A;  1NK6 A;  4KI6 A;  1RBV A;  3M8P A;  1A5V A;  1RDC A;  3AO4 A;  4NCA A;  1CXQ A;  4N56 A;  3O3F A;  1S9E A;  1HYV A;  2E6M A;  2OZS A;  4DQI A;  4PUO A;  1HMV A;  1T8E A;  2G8V A;  1JLB A;  4DTS A;  2HVI A;  4CIF A;  3NGZ A;  3LAM A;  1DLO A;  4FLU A;  2OPQ A;  1IKW A;  3F9K A;  1O1W A;  3HVT A;  1A5X A;  3AA3 A;  2YKM A;  5HRN A;  4FCY A;  3V9S A;  3K59 A;  4DFJ A;  3V81 A;  3HP9 A;  2B4J A;  3LPU A;  4EZ6 A;  3SQ2 A;  2QKK A;  2Z1H A;  3HM9 A;  4Z4F A;  2OPS A;  1QE1 A;  1RT5 A;  4E1N A;  1RBR A;  3VQ5 A;  1TL3 A;  1NK5 A;  1SKR A;  4CFB A;  2IDO A;  1C1B A;  1LWC A;  4LH5 A;  1RDA A;  4BAC A;  1EKE A;  3ZT1 A;  3AVJ A;  4PQU A;  3KLH A;  3ZT4 A;  2R7Y A;  3WNF A;  4N76 A;  3OYG A;  1NK8 A;  1X9W A;  4CFA A;  4CIG A;  4AHV A;  5T7B A;  3VQ4 A;  4DFM A;  1NK7 A;  3IRX A;  1F21 A;  3KJV A;  1L3U A;  4RG8 A;  2GBZ A;  1N5Y A;  4RW6 A;  2F8T A;  3DRR A;  1ASV A;  3OY9 A;  2W42 A;  1Z26 A;  5HP1 A;  3MEE A;  4CEC A;  1BQM A;  1IH7 A;  2KFZ A;  1R0A A;  1BQN A;  3FFI A;  1BCO A;  5CY4 A;  4CES A;  4M45 A;  4IBN A;  5KTQ A;  4DLG A;  1LAW A;  4I9Q A;  3AVK A;  3LP3 A;  4FJ9 A;  4FK2 A;  4KTW A;  4FJJ A;  2G8K A;  1VRT A;  4CJR A;  1TL1 A;  4I2Q A;  3LP2 A;  2HMI A;  4B9L A;  1C1A A;  2GV9 A;  1SUQ A;  3OYA A;  4DU3 A;  3SQ1 A;  4DQP A;  3ZCM A;  3U3G A;  2A1S A;  3TWH A;  4IFY A;  3I8D A;  3IG1 A;  3CM6 A;  2PY5 A;  1XHX A;  4DG1 A;  4FLW A;  1W0H A;  4DTR A;  3MXI A;  1UA1 A;  4MQ3 A;  1S9G A;  3O3H A;  3CG7 A;  1L3S A;  3KLF A;  4CE9 A;  4IG0 A;  3RWU A;  3MEG A;  2BE2 A;  4RW7 A;  3RRH A;  3RMA A;  3DM2 A;  4DSJ A;  2QKB A;  3SUP A;  3HK2 A;  1RT2 A;  1REV A;  4C8M A;  1VSI A;  3HST B;  4CGJ A;  3OS2 A;  3QEW A;  3VQC A;  3HPH A;  4Z4H A;  3SV4 A;  4CGD A;  4LD0 A;  4QAG A;  4CCH A;  3NF6 A;  1VSF A;  4FM2 A;  1RDD A;  5CYQ A;  4K8Z A;  1SKW A;  4BE2 A;  2AJQ A;  1RT4 A;  2VWK A;  4CEO A;  4DTN A;  1QQC A;  3THV A;  3MXM A;  4J2E A;  1T7P A;  1BIU A;  4H4O A;  3K5L A;  2D5R A;  2HHW A;  3SNN A;  2ZQB A;  3RMB A;  3OVN A;  3ZT3 A;  4NCB A;  2HHT A;  1S1T A;  1EX4 A;  1YTA A;  1SKS A;  2RPI A;  2D0A A;  3TAR A;  2Z1G A;  1RTI A;  1KSP A;  2BDP A;  3RR7 A;  4AH9 A;  3AVB A;  3HXM A;  4FW2 A;  4AHR A;  4YFU A;  1JLC A;  1UA0 A;  3KD5 E;  4F2S A;  4FJ8 A;  2HVH A;  4DS4 A;  4E19 A;  3M8R A;  5I42 A;  1NK9 A;  3L3U A;  1JL2 A;  4HCC A;  2IC3 A;  1BI4 A;  4ZTJ A;  5K14 A;  3CFR A;  3VQQ A;  4ELU A;  2YKN A;  1WN7 A;  1D5A A;  2DFF A;  4JS4 A;  3K5N A;  3U6F A;  1VSE A;  1RTJ A;  3SJJ A;  1BGX T;  3AVN A;  4FJK A;  3PX0 A;  3SZ2 A;  4KV8 A;  4F3T A;  4CHO A;  1HQU A;  1QTM A;  3BDP A;  1TKT A;  2IGI A;  3NF7 A;  2B5J A;  3ASM A;  4I2P A;  3T3F A;  3TAF A;  1S6P A;  2DTU A;  3KTQ A;  2O4G A;  2YNG A;  4KAZ A;  4KHU A;  5C25 A;  2FBT A;  2FC0 A;  1U4B A;  2Y1I A;  4B9M A;  4KTZ A;  1TKD A;  3AO3 A;  4BE0 A;  3QNN A;  3TI0 A;  3D45 A;  5SZT A;  5HRO A;  2QXF A;  4E89 A;  4CER A;  4GW6 A;  4M3W A;  4CJE A;  4Q0B A;  1L5U A;  1JXB A;  3VN5 A;  4B8A B;  3H08 A;  2B6A A;  3JYT A;  3VA0 A;  1FXX A;  1VSH A;  2HND A;  2Z1I A;  3BGR A;  4ICL A;  4Z4C A;  4F4K A;  4BDY A;  1QS4 A;  4O0J A;  1D9D A;  1EXQ A;  4FLV A;  4CF2 A;  2X6S A;  2HHU A;  2O4I A;  2FBV A;  4CF9 A;  3PX6 A;  3VQ7 A;  4FZY A;  1NKC A;  4PWD A;  4IKF A;  4CFC A;  3LZJ A;  3ZSQ A;  4Z0U A;  1WSH A;  1QSL A;  4WE1 A;  2KZZ A;  3OYC A;  1BI4 B;  4M3T A;  1RT3 A;  2VG5 A;  1KRP A;  3KK3 A;  3E01 A;  4DTU A;  3KLE A;  3S3N A;  1U48 A;  5C24 A;  2P51 A;  1ASU A;  3PO4 A;  3ZT0 A;  3AV9 A; 
#chains in the Genus database with same CATH topology
 3OYD A;  4KKO A;  2G8W A;  3AO5 A;  4A59 A;  1U2V A;  1KAZ A;  4DTM A;  4JRP A;  1VQ9 N;  3F5T A;  1S6Q A;  1HJR A;  3D2F B;  4CGH A;  5JVG L;  2HNZ A;  3W0L A;  3P4I A;  4JI6 K;  4FJ7 A;  4CHP A;  4N5S A;  2BTF A;  4G9Z A;  5FPE A;  3OS0 A;  1NK0 A;  2EHG A;  3JS6 A;  3KKS A;  1DKG D;  2BGG A;  3M5R A;  4EAH D;  2OYQ A;  3C65 A;  4BWM A;  3UE5 A;  1HQE A;  1KFD A;  2EX3 A;  3BP8 A;  4F3O A;  4BR9 A;  2FSJ A;  4B9U A;  3PSF A;  1TAU A;  3ENH A;  4FSV A;  4CF8 A;  3RMD A;  1XI1 A;  1WNS A;  3CME N;  3EN9 A;  4WQ5 C;  4ID1 A;  3VPZ A;  3IDH A;  1D4X A;  2ZD1 A;  1TAQ A;  4B1Z A;  4BC2 A;  2HBJ A;  2XY6 A;  1HPM A;  4BRM A;  3QO9 A;  3GOI A;  1C0F A;  2YNF A;  4FJM A;  4CFD A;  4CJF A;  1DT9 A;  5J2Q A;  5EXW A;  5AQH A;  3TPQ A;  3EY1 A;  3LP0 A;  4CZE A;  3IFR A;  4HHT A;  1HYZ A;  1WLJ A;  4DKW A;  1VQM N;  3CD6 N;  2UXD K;  3DI6 A;  4B3R K;  5AQY A;  1XHZ A;  3THW B;  2OZM A;  1X1P A;  3V9X A;  2OPP A;  4B1V A;  3ZSY A;  1TGO A;  5CR4 A;  3M8Q A;  3T1A A;  3QNO A;  4WFN L;  2HF3 A;  3A5M C;  1IKV A;  4Z4E A;  4AIL C;  4DR4 K;  4CEB A;  2F7T A;  3W3D A;  3VGM A;  1JLG A;  5AQJ A;  3F2K A;  1M1K O;  3LDO A;  2P9N B;  3QIC A;  3SUO A;  3SPY A;  1B9D A;  2NRH A;  3KKR A;  4FWQ A;  2HBM A;  2P9P B;  3S41 A;  5F1X A;  3SBT A;  5AQN A;  2PZS A;  3T1H K;  1NKB A;  5HRS A;  4N47 A;  2YJF A;  3DYA A;  4W5R A;  4DF8 A;  4GV9 A;  4BRG A;  1IO2 A;  2YHB A;  3OTO K;  5BN9 A;  4E7I A;  1KVA A;  3KK7 A;  5C42 A;  1ESV A;  3A0I X;  1EET A;  1ZBF A;  1IG9 A;  2G8U A;  3K9J A;  2NNW A;  5E41 A;  4UQG A;  3PY8 A;  2KHO A;  2O8F B;  5J2M A;  4CBU A;  2HHQ A;  5ADX A;  1K8K A;  4H0V B;  3BUZ B;  3PV8 A;  4B1X B;  1WAF A;  3O8M A;  1ZBS A;  3SI6 A;  1GOA A;  4IOA L;  5DM7 L;  3DMJ A;  3KK1 A;  4KO0 A;  4CHZ A;  2RKI A;  4CJ4 A;  3R3L A;  4FJN A;  4GV6 A;  5BPL A;  3QIN A;  3V1O A;  4CGI A;  1C0G A;  1J9A A;  2UUA K;  5FRM A;  4KH6 A;  1X9J A;  2E2P A;  2JLE A;  3FE1 A;  4JHD A;  3SMP A;  1RTD A;  1QSY A;  4DUY K;  3QFU A;  4O8U A;  1RBU A;  1YVN A;  1RIL A;  2D0B A;  4X62 K;  1QQM A;  1HNI A;  1JKH A;  2RF2 A;  3CC2 N;  4KFB A;  1OH5 A;  1ZBU A;  1QSS A;  4B9V A;  4BR4 A;  2HBK A;  4PL8 A;  3THW A;  4FM0 A;  1B9F A;  1WUA A;  2G8I A;  4M41 A;  3AA5 X;  1KTQ A;  1GLJ O;  3UIQ A;  3O9Q A;  1BIZ A;  3CIP A;  3T19 A;  3VQD A;  1Q18 A;  2E20 A;  1Q81 O;  4BDP A;  3ITH A;  3QBX A;  1KXP A;  4ZTF A;  3KWG A;  4IG3 A;  4Q5V A;  3TTF A;  1C0T A;  4FYD A;  4FWR A;  4DQ8 A;  1T6D A;  3NF9 A;  4C8N A;  5J2N A;  5JS1 A;  1VQ5 N;  3ZSZ A;  4JN4 A;  4CEZ A;  4BC3 A;  2CGL A;  2P9I A;  3CCU N;  1NGJ A;  2O8D B;  1SV5 A;  1N32 K;  1KAY A;  4O5B A;  4W5Q A;  1I3A A;  1KVB A;  3TSQ A;  1I39 A;  2VQE K;  1J54 A;  3OYK A;  3QBW A;  2QWM A;  2G8F A;  3H46 O;  4IDK A;  3NGI A;  4KTQ A;  2OCE A;  1Y97 A;  2HNY A;  4CK3 A;  3OYE A;  1BA0 A;  4BE1 A;  4K25 A;  4HUF A;  3MN5 A;  1FW6 A;  3OW2 M;  4H0O A;  3AVG A;  1NGB A;  3AVC A;  1YJ9 N;  4M3Y A;  4ELV A;  4XH5 A;  3O08 A;  4CHY A;  4DU1 A;  1LCU A;  2A41 A;  1LWE A;  4FPA A;  3SUN A;  4QCL A;  4OLB A;  1JCE A;  2OPR A;  4HUE A;  3OS1 A;  1LOT B;  3E9O A;  3ZYY X;  4A5A A;  3O9R A;  5BRE A;  1NJW A;  1VSJ A;  3E1Y A;  3KD1 E;  3L6Q A;  3P1G A;  3NDK A;  1NK6 A;  4JKA A;  5BPN A;  4FWO A;  3GG4 A;  1CXQ A;  4N56 A;  3O3F A;  1S9E A;  2E6M A;  4H0X B;  1HMV A;  1T8E A;  3MN7 A;  1NGF A;  3VGK A;  1DLO A;  2OPQ A;  4KHP K;  4CZF A;  3J7Y P;  2ASM A;  1A5X A;  5I9E B;  3V81 A;  3HP9 A;  2B4J A;  4L3Q A;  3VEV A;  1YHQ N;  2Z1H A;  2P9K B;  2UUB K;  1IV0 A;  1TL3 A;  1C1B A;  1LWC A;  1RDA A;  4BAC A;  3ZT1 A;  4QS9 A;  2VGN A;  4JI3 K;  4N76 A;  5AQI A;  4YOT A;  5T7B A;  1NK7 A;  1VQ6 N;  1F21 A;  1L3U A;  4IEE A;  2GBZ A;  3DRR A;  5AQT A;  2CH6 A;  1Z26 A;  5HP1 A;  1BQN A;  3I56 N;  4BR0 A;  4I9Q A;  2QWO A;  3AVK A;  3HTV A;  1ZC6 A;  4CJR A;  2G8K A;  2HMI A;  4KHW A;  2HVI A;  1C1A A;  2A1S A;  3I8D A;  3IG1 A;  1VAZ A;  3MXI A;  4C1N I;  4MQ3 A;  3DXM B;  1BU6 O;  3CG7 A;  3WQT A;  4CE9 A;  4IG0 A;  3MEG A;  3RMA A;  3DM2 A;  1EWQ A;  3SUP A;  4FWM A;  1O13 A;  2QWQ A;  3HST B;  4WCE L;  3VQC A;  1VSF A;  4JI5 K;  2FLO A;  4FWK A;  3H3O B;  4DTN A;  3MXM A;  4BRI A;  1M90 O;  1YUW A;  1EX4 A;  1YTA A;  2D0A A;  2KLA A;  3TAR A;  1JCF A;  3RR7 A;  4AH9 A;  3Q7B A;  4YFU A;  1UA0 A;  3J8A A;  4DS4 A;  4E19 A;  3M8R A;  1BI4 A;  1H1V A;  1VQ4 N;  3CFR A;  3G6E N;  3THX A;  4JS4 A;  2DFF A;  1VSE A;  3SJJ A;  4FJK A;  3D7E O;  3SZ2 A;  3UB5 A;  2D4W A;  1HQU A;  3VTI A;  3BDP A;  1TKT A;  5F2R A;  2B5J A;  2NRZ A;  1S6P A;  1NBW A;  4KAZ A;  2GWK A;  4IFE A;  1U4B A;  4B9M A;  4KTZ A;  4K42 A;  3QNN A;  5SZT A;  5HRO A;  4NLB A;  3WEE B;  4MDB A;  3TSU A;  4BRN A;  2WFB A;  1FXX A;  4ICL A;  4Z4C A;  4AQY K;  2H3G X;  3FZK A;  1VQ7 N;  4O0J A;  5TKY A;  4DV7 K;  3O4W A;  2FBV A;  4HWI A;  1MA9 B;  3A5N C;  4JKG B;  1QSL A;  4GKJ K;  4WE1 A;  2KZZ A;  1BI4 B;  2VG5 A;  1KRP A;  3KK3 A;  3E01 A;  4DTU A;  2KFN A;  4KBO A;  3ID6 A;  3AV9 A;  4YOY A;  3F9M A;  5C0Y A;  4CZL A;  1S5J A;  2OTL N;  1W9H A;  1BG3 A;  5E84 A;  2VGM A;  4CBW A;  4DSK A;  1QVG M;  4KRF A;  3AVF A;  4KPY A;  2QA4 N;  1V4S A;  4W5N A;  5MLC Q;  4H0Y B;  1T44 A;  5EU7 A;  3OYF A;  4LSL A;  1VSM A;  5ELZ A;  4DS5 A;  2Y1J A;  4J2B A;  2IVP A;  3C7N A;  2BAN A;  3MN9 A;  4CIE A;  4OPA A;  1RDB A;  5AQK A;  4CZI A;  1RTH A;  3K57 A;  1C1C A;  4OO1 J;  3L8B A;  3EZW A;  4M42 A;  2ITG A;  1VSL A;  4E3S A;  3PO5 A;  1WAJ A;  1Q82 O;  4W5O A;  3LAK A;  4FLZ A;  2X74 A;  3TAQ A;  4GMJ B;  3VEN A;  3RRG A;  3DLH A;  4C8L A;  3ZSR A;  4DSE A;  1ZYQ A;  2QW9 A;  3TAM A;  3IAY A;  3EO3 A;  1KFS A;  1EQY A;  1KAX A;  2Q0R A;  3QIO A;  3EE9 A;  4JD2 A;  1KQS M;  5FLX O;  1FK9 A;  1GLF O;  1QHA A;  3VQB A;  2ZM6 K;  3VF4 A;  3NH2 A;  2ZJQ L;  4KI4 A;  1GOC A;  2CGK A;  1Y64 A;  3ZX2 A;  1UAX A;  1TVR A;  3TAN A;  1FJG K;  3HM8 A;  3J7A P;  3EE8 A;  4OKJ A;  3K9K A;  1HX1 A;  4ID5 A;  5FPD A;  3TAP A;  1WSE A;  2JWL A;  1HKB A;  4K43 A;  4CJW A;  1LV5 A;  1RT6 A;  4JRQ A;  2VCP A;  3CJ1 A;  4Y0W A;  1BWF O;  3VEW A;  3SPZ A;  3H1Q A;  5BR9 A;  4IJA A;  1NGD A;  2DFH A;  2ZF5 O;  3DLE A;  4RWT A;  3O3G A;  3HJF A;  4B8C A;  1LWF A;  3S9H A;  4FZX C;  2YCH A;  3DAW A;  1CXU A;  3R1X A;  3WNE A;  4BWJ A;  1TK0 A;  3TR8 A;  4JI1 K;  4AF1 A;  2P9S B;  4DTO A;  3FZH A;  1NOY A;  5C2D A;  4YNQ A;  4NLC A;  4EHT A;  3C6H A;  5AQV A;  3VER A;  4J2D A;  3OJU A;  3M8S A;  4DU4 A;  1NNE A;  4FJL A;  5M1K A;  3R6M A;  5FDL A;  1GLD G;  4B08 A;  5FRO A;  3FLC O;  5JLH A;  3A2F A;  1SQK A;  4DSI A;  4CED A;  1CZB A;  4IDH A;  4CW7 B;  2KTQ A;  4BRL A;  1GLB G;  1NGE A;  2E5L K;  3KVG A;  3DWL A;  2WOM A;  5LL6 Z;  2KW4 A;  2W40 A;  4H8K A;  4YOU A;  1N8R O;  2ZJP L;  2XHB A;  3SK3 A;  3EZ5 A;  2DPN A;  4KHY A;  4HTU A;  3ZSW A;  2Q36 A;  3TAB A;  4CEF A;  1Q8I A;  2HHH K;  1Z05 A;  3NF8 A;  1T03 A;  4KH5 A;  4JI2 K;  5AQU A;  4BC4 A;  3ZET A;  2I5J A;  3CCS N;  1Z25 A;  3S3M A;  4M3Z A;  4OLA A;  4O55 A;  3LM9 A;  3NH0 A;  1XNQ K;  1OKJ A;  2PYJ A;  3KWI A;  4DCH A;  3NHG A;  1R59 O;  3L2W A;  4B9S A;  1CZ9 A;  2UYT A;  4FWP A;  4IOX A;  1XUP O;  3UKU B;  2YJE A;  1U45 A;  4CF0 A;  3D2E A;  1QZ6 A;  1EWR A;  4WF9 L;  4M3X A;  1WBB A;  4KHN A;  4IOC L;  2E2O A;  2P9U B;  3SYZ A;  4JD2 B;  3TSP A;  5AZJ A;  5M1O A;  5B8H A;  3L3V A;  1GOB A;  5LMN K;  1UOC A;  5GIO A;  1L3T A;  5AQL A;  3RSE A;  3QET A;  2O8E A;  1HYS A;  2KQ2 A;  2YNI A;  2ZGZ A;  1VQO N;  2FSN A;  1TYQ A;  2YHY A;  4OJR A;  2QWR A;  1HKC A;  3V9W A;  4CJ7 A;  3BF3 A;  3DOK A;  2P5O A;  3EYZ A;  4WQ5 A;  3P5J A;  4JS5 A;  3HBT A;  5BRH A;  1YAG A;  4FK0 A;  3R8E A;  4FWL A;  1JJ2 M;  4FWS A;  1JXE A;  2P1J A;  3DOL A;  1U04 A;  3AO1 A;  2Q2R A;  4B3S K;  3O4Q A;  1GLC G;  3VA3 A;  4DV2 K;  1X3M A;  1NMD A;  4DFK A;  2Q3S A;  1QQN A;  5AQQ A;  2IVO A;  4DSF A;  4DMN A;  3NFA A;  4FM1 A;  1NJY A;  1YT3 A;  3AGR A;  3K5O A;  3H3N O;  3CM5 A;  3V9U A;  5FPN A;  3FR0 A;  1S1U A;  1XQS C;  4DTX A;  1IKX A;  4RW8 A;  3CPW M;  5FPM A;  3ID8 A;  5EX5 A;  1ZBI A;  3H1V X;  1MDU B;  3ISN C;  4B1W B;  4B9T A;  1XWL A;  3ZET B;  3LAN A;  3VQ9 A;  3THY B;  3LPT A;  2CGJ A;  3T7Z A;  4NCG A;  5AQW A;  4A61 A;  3LM2 A;  5BR8 K;  2YI1 A;  5JIC A;  1YTU A;  5CYM A;  3FZF A;  1NJI O;  4R79 A;  3MN6 A;  5C2F A;  1NLV A;  1WOQ A;  4EIA A;  1YI2 N;  3IUC A;  4PUO A;  2WBN A;  2FXU A;  3ATU A;  1JLB A;  1U2V B;  3F9K A;  4FVU A;  5AFU H;  3HVT A;  3O9T A;  5HRN A;  4FCY A;  2A5X A;  3M1F A;  4IJN A;  5KPT A;  4H5V A;  4EZ6 A;  2V7Z A;  1S72 N;  4DV1 K;  4Z4F A;  3CC4 N;  5IWA K;  2D0P A;  3VQ5 A;  4CFB A;  1EKE A;  4LF5 K;  3AVJ A;  1I94 K;  3AY9 A;  4M63 C;  3CQY A;  4CFA A;  3THY A;  2QWL A;  4DFM A;  3KJV A;  1IJJ A;  1N5Y A;  2F8T A;  2OTJ N;  5AQZ A;  3ZX3 A;  4B9Q A;  4CES A;  3FFI A;  1BCO A;  5CY4 A;  4IBN A;  4DLG A;  3SBG A;  4DV5 K;  2GWJ A;  4FJ9 A;  4FK2 A;  4KTW A;  4FJJ A;  1TL1 A;  5IT9 O;  2GV9 A;  1SUQ A;  4BRP A;  3OYA A;  3TWH A;  2AA4 A;  4IFY A;  1XHX A;  4WYB A;  1UA1 A;  1L3S A;  3KLF A;  2QKB A;  3RRH A;  2IIR A;  4UY8 O;  1REV A;  4CGJ A;  3OS2 A;  1YIJ N;  4Z4H A;  2P9L B;  3SV4 A;  3H6E A;  4CGD A;  4LD0 A;  2JWK A;  4CCH A;  2EWS A;  3B8A X;  4K41 A;  4DR2 K;  4FM2 A;  1RDD A;  3G71 N;  4CEO A;  4CZK A;  4EHU A;  4BRD A;  3ZT3 A;  4IZ9 A;  4NCB A;  3ZEU B;  2ZWH A;  4LFC K;  2RPI A;  5AFU A;  1K73 O;  3GDQ A;  4AHR A;  3D6R A;  4FJ8 A;  3CI5 A;  1MWM A;  2O8B B;  1VQK N;  1JL2 A;  2IC3 A;  4ELU A;  2YKN A;  1WN7 A;  3U6F A;  5M1N A;  4BQL A;  2PAV A;  1RTJ A;  1BGX T;  1XC3 A;  3HSC A;  4YOV A;  5DM6 L;  5AZJ B;  3NF7 A;  5GIP A;  3WEE A;  2DTU A;  3FZL A;  3HRG A;  2NLX A;  4KHU A;  5C25 A;  1Z6R A;  1TKD A;  3AO3 A;  3D45 A;  3ULE A;  4GW6 A;  1L5U A;  3M3Z A;  3ATV A;  1JXB A;  2E2Q A;  3BF1 A;  2B6A A;  3H08 A;  3JYT A;  3VA0 A;  1VSH A;  4H0P A;  4BDY A;  5AQR A;  1D9D A;  5AQM A;  4FOI A;  4CF2 A;  4FLV A;  2HHU A;  3VQ7 A;  4FZY A;  5CE3 A;  1BUP A;  2J4R A;  2D1K A;  1RT3 A;  3KLE A;  5C24 A;  3HT3 A;  3PO4 A;  2FF3 B;  4O5F A;  5GIN A;  1KLN A;  3GBT A;  5J2P A;  4JI0 K;  2O8C B;  1K8A O;  3P83 D;  4FJG A;  2X6N A;  3AVI A;  2E4L A;  3R9P A;  3QEX A;  1NKE A;  4IEI A;  5BPM A;  2WUS A;  4H03 B;  3OYN A;  2Q0U A;  1J5O A;  2ASO A;  4CJ3 A;  1D8Y A;  4FZZ A;  3SAG A;  4CJU A;  5AQO A;  3SQ4 A;  2HW3 A;  3IKM A;  3DXK B;  3U9D A;  3EL2 A;  4BR2 A;  3OYM A;  4YHH K;  4ILG B;  1WBD A;  4O0I A;  1NGI A;  3VEY A;  4E7K A;  1T6C A;  3U3Y A;  3AA2 A;  4K8X A;  4W5T A;  3CCR N;  4FK4 A;  5AQF A;  4A2B A;  1C6V A;  3N4P A;  1TKZ A;  3CJ7 A;  2ASP A;  1TYQ B;  3P39 A;  1N34 K;  1U6Z A;  4I9L A;  2YHX A;  4ISF A;  2QI2 A;  4B3O A;  3CQ8 A;  4MDA A;  3PUF A;  4CF1 A;  4DTJ A;  3T69 A;  3DLK A;  1JLE A;  3L2Q A;  4LF8 K;  3K58 A;  3VQA A;  1J6Z A;  3BEX A;  4WFB L;  3FGU A;  4X65 K;  4DV0 K;  1BL3 A;  3G4S N;  4BRH A;  3QER A;  2XRI A;  5H1S Q;  4OPK A;  5A2Q O;  1P90 A;  2UXC K;  3WUH A;  1HLU A;  1T05 A;  3VOV A;  4DV4 K;  3CJA A;  2W6K A;  1B92 A;  5CZ2 A;  3VQE A;  4EZ9 A;  2PBD A;  2P9S A;  5CZ1 A;  2GUI A;  3H45 C;  1KVC A;  3CF5 L;  2CH5 A;  2E6L A;  1DTQ A;  4M7X A;  1SL2 A;  2PYL A;  3E66 A;  1HNW K;  4ELT A;  4AM6 A;  4GVM A;  2A40 A;  3WXI A;  4BC5 A;  4EP4 A;  2RN2 A;  1N6Q A;  1J53 A;  3NH1 A;  1ITG A;  4CHN A;  2ETJ A;  1YXQ A;  2VWB A;  5AR0 A;  3L2R A;  1OH8 A;  4N41 A;  4FLT A;  3C6U A;  1C0M A;  5DMR A;  3QML A;  3PSI A;  3QFP A;  4CHQ A;  4HCB A;  3ZEU A;  3K2P A;  1WSG A;  1BDG A;  1SAZ A;  1NWK A;  2V7Y A;  1HJO A;  3VQ6 A;  3CHW A;  4JLH A;  1VQ8 N;  3MXJ A;  3RR8 A;  1TKX A;  5HBM A;  4CJV A;  4DR3 K;  3CJB A;  5D3G A;  1NGH A;  3OJS A;  3RMC A;  2HST A;  3CXC M;  2OAN A;  3ZLJ A;  3QLH A;  4BG9 A;  2A42 A;  4CJL A;  1JLA A;  4LF9 K;  4H0T B;  3MED A;  4NXM K;  4DR6 K;  3J81 O;  4LF6 K;  4CGG A;  1HUX A;  3DRP A;  4YOX A;  4JKE A;  4JHD B;  4E7L A;  2FBY A;  1WSI A;  1QZ5 A;  1A5W A;  5HRR A;  3AVA A;  2P5G A;  5KGX A;  1K6Y A;  2VYP A;  4OKE A;  2QWP A;  4JKB A;  1ATR A;  3A8Y A;  3AO2 A;  5E26 A;  3QEI A;  4FLY A;  5HL7 L;  1FKO A;  1ZBL A;  4BRE A;  5GAH P;  4CD3 A;  4FWN A;  5HOO A;  3G0Z A;  2V51 B;  1J5E K;  2F9W A;  2PFU A;  3CYM A;  3L4I A;  4ISG A;  4CJS A;  4DQS A;  4CK2 A;  2ZGY A;  1TV6 A;  3SJH A;  3RVC A;  4JKG A;  3HOS A;  1K8K B;  3MAQ A;  5EY4 A;  3KLI A;  3V1Q A;  3OYI A;  1SL1 A;  1ASW A;  3C0B A;  4AHU A;  5LJW A;  3L2U A;  3KZB A;  3HP6 A;  3MWP A;  2HOE A;  4PY5 A;  2QWN A;  3O4N A;  2FBX A;  2VQF K;  4DWI A;  1P8Z A;  1LW2 A;  1U47 A;  3WXJ A;  2E8A A;  4YDU A;  4CJ5 A;  4BRC A;  2IAJ A;  1QHT A;  3AAR A;  1HNV A;  4QS7 A;  1X9M A;  4FVM A;  2P9I B;  1RBT A;  5HRP A;  1Q86 O;  2XY5 A;  1YJN N;  2NRV A;  3OBW A;  1NJX A;  1Q7Y O;  4KRE A;  1G15 A;  1ATN A;  3BZK A;  4AM7 A;  2BUP A;  2E1Y A;  4BR7 A;  2P9K A;  4FXD A;  4O8K A;  4CEQ A;  3CFO A;  1K9M O;  3EKU A;  4RW4 A;  2HB5 A;  4H5R A;  4KB1 A;  4Z4I A;  3TAE A;  3VQ8 A;  4KHS A;  3CCJ N;  5KGW A;  3QES A;  4O44 A;  4BQZ A;  3OYJ A;  2HHV A;  4IXC A;  4ZHR A;  3O5B A;  4IFV A;  4FJ5 A;  4LF7 K;  3B6O A;  4J2A A;  4H5W A;  4FOE A;  3SUQ A;  4PA1 A;  2YX6 A;  3UKR B;  4LSN A;  4LF4 K;  1W7A A;  3HPO A;  3LWM A;  4G1Q A;  1E3M A;  4OVL A;  4JKF A;  4FJH A;  3RTV A;  3I33 A;  3NGY A;  3JSM A;  3C94 A;  3E9P A;  4H4M A;  3AVH A;  1BHL A;  1LW0 A;  2FSK A;  2ZE2 A;  4JV5 K;  1D9F A;  4V19 S;  5BN8 A;  4WFA L;  5AZI B;  4E1M A;  3PX4 A;  1TK5 A;  4F2R A;  3LZI A;  1XC9 A;  3UKR A;  3C6T A;  3CER A;  5EVZ A;  3ENO A;  2F9T A;  4KB0 A;  1XMQ K;  4J8F A;  2W41 A;  4B1U B;  3TTC A;  4E7J A;  3ZSV A;  2F8S A;  3CCL N;  3M8P A;  3O9S A;  4F9O A;  1RDC A;  4DQI A;  1HYV A;  2NRW A;  2G8V A;  4DTS A;  3WXL A;  4WQ4 A;  3NGZ A;  3LAM A;  3T1Y K;  4A57 A;  4QS8 A;  3EEQ A;  1VQN N;  3VF6 A;  5M1F A;  2YKM A;  3K59 A;  4DFJ A;  1NGG A;  5KQD A;  3HOT A;  1RGI A;  5TKW A;  2QKK A;  3HM9 A;  5LMU K;  2OPS A;  1QE1 A;  1RT5 A;  2GEM A;  1RBR A;  3MX2 A;  4BGA A;  3CPE A;  4DB3 A;  1E4G T;  5CHI A;  3SAH A;  2E2N A;  3KLH A;  2R7Y A;  4JI7 K;  3WNF A;  4BRQ A;  1X9W A;  2W6L A;  4PHT X;  4AHV A;  3IRX A;  4BRK A;  4RG8 A;  5C15 A;  4RW6 A;  4BG8 A;  1ASV A;  3BZC A;  3MEE A;  4JK7 A;  1IH7 A;  2KFZ A;  1R0A A;  4FL9 A;  4BVO A;  3LP3 A;  1VRT A;  4JYA K;  4B9L A;  3SQ1 A;  3ZCM A;  3U3G A;  3CM6 A;  1S9G A;  3O3H A;  1QVF M;  3HK2 A;  3PLA A;  1RT2 A;  3SAF A;  1TUU A;  4C8M A;  1VSI A;  4BVP A;  4U67 L;  1YIT N;  3QEW A;  1BO5 O;  4JK9 A;  3NF6 A;  3OA9 A;  5JVH L;  1JCG A;  4RTF D;  4BE2 A;  3VET A;  2D0O A;  2O8D A;  1T7P A;  4H4O A;  1SZ2 A;  2D5R A;  3K5L A;  5EOY A;  3SNN A;  2ZQB A;  3RMB A;  3OVN A;  2HF4 A;  2HHT A;  1S1T A;  4FPB A;  1SKS A;  1IBL K;  2Z1G A;  1NU0 A;  3SMS A;  4LFB K;  3HXM A;  4PKH A;  1JLC A;  3KD5 E;  4F2S A;  1HNZ K;  2HVH A;  2FF6 A;  3L3U A;  3CET A;  4DR5 K;  1HNX K;  3LDQ A;  1D5A A;  2O8E B;  4IWV A;  3AVN A;  3PX0 A;  2Q1N A;  4KV8 A;  4F3T A;  3A5O C;  3O9U A;  2P9U A;  3L0Q A;  2IGI A;  3ASM A;  4I2P A;  3T3F A;  4JK8 A;  3G25 A;  2O4G A;  2YNG A;  1OH6 A;  2O8B A;  2FBT A;  2FC0 A;  2QXF A;  4E89 A;  4CER A;  4CJE A;  2IVN A;  3JXU A;  4XEI A;  3VN5 A;  4DV6 K;  4B8A B;  2HND A;  2Z1I A;  1S3X A;  3BGR A;  4F4K A;  1T3V A;  1QS4 A;  1EXQ A;  3FFK B;  2X6S A;  2O4I A;  4CF9 A;  1NKC A;  4PWD A;  1XNR K;  4CFC A;  4LC9 B;  3LZJ A;  3VEX A;  4M3T A;  3FZM A;  1ATS A;  2P51 A;  4X64 K;  4GVE A;  1RCH A;  1JLQ A;  2VG7 A;  4I7F A;  1DTT A;  5JMV A;  4JI4 K;  4CGF A;  1OVY A;  5M1Q A;  3G10 A;  1U49 A;  5AQG A;  1NM1 A;  4BRF A;  2D0C A;  3DLB A;  3DJC A;  4NXN K;  1BA1 A;  5C10 A;  2DY4 A;  1MWK A;  3I0R A;  3RSE B;  5KRS A;  1NJZ A;  4CEE A;  4CD1 A;  4FJX A;  2BH1 A;  3K5M A;  4DTP A;  3AVM A;  3LL3 A;  3A5L C;  3SCX A;  4KHQ A;  3S3O A;  5LJV A;  2DFE A;  3B6P A;  5GAE P;  3JAM O;  2ZJR L;  3VEZ A;  4CJT A;  3ZX0 A;  1RT7 A;  2WTU A;  2E88 A;  1DGK N;  2YNH A;  3MK6 A;  3ALY A;  1HKG A;  3LWL A;  5AJ3 K;  4JAX A;  1IG8 A;  1YF5 L;  3CFP A;  3LAL A;  1CLQ A;  1VK0 A;  2YHW A;  4C1N K;  1HRH A;  2OZS A;  3HL8 A;  1S1W A;  3AAQ A;  3DXM A;  4JNE A;  4DLE A;  4AHS A;  2E1Z A;  3DXK A;  1RBS A;  1ZBH A;  5KRT A;  1RT1 A;  2A3Z A;  1NMN A;  1HPZ A;  4OKK A;  2GEL A;  1IKY A;  4Y1C A;  3ZSO A;  3LDS A;  3IMX A;  4NYN A;  5HLF A;  1KLM A;  2YHA A;  3WNH A;  1BCM A;  4A62 A;  1WSJ A;  4C23 A;  1XMO K;  3F73 A;  2P9P A;  1SL0 A;  4OPJ A;  4RW9 A;  2LSN A;  3HYF A;  4DHY A;  3NMU A;  2F96 A;  5ADX H;  3WQU A;  3KHY A;  2NRX A;  3V6D A;  4YDU C;  2XY7 A;  3CCV N;  3IS9 A;  4CZJ A;  3KK2 A;  3OYH A;  4NO7 A;  4DQR A;  3MCP A;  3D0P A;  1WSF A;  4M3U A;  1UWB A;  1HR0 K;  4OX9 K;  1JL1 A;  5DK5 A;  2NRT A;  4BRA A;  3WXM B;  1QQO A;  2A1R A;  1RDU A;  4E7H A;  3DRS A;  4BDZ A;  1IBM K;  1VQP N;  4NB4 A;  1Q9X A;  3CJ9 A;  4JKD A;  3VEO A;  3U4L A;  4DF4 A;  1S1X A;  4MO5 A;  4OGC A;  3WNG A;  4XH4 A;  1NG9 A;  4CZH A;  4NYF A;  4JI8 K;  4L8R B;  1EO1 A;  2HMP A;  4DR7 K;  3L4Q A;  3V1R A;  4HTL A;  4B9N A;  1G99 A;  3NVM A;  1VSK A;  3HPG A;  1V4T A;  3EKS A;  4DUZ K;  3Q7C A;  3I0S A;  2QTD A;  4CEA A;  2HHX A;  3NVK A;  4PKI A;  3OYL A;  2UUC K;  2X78 A;  3C7N B;  2QK9 A;  2GTD A;  2XY8 A;  3J80 O;  3QEP A;  3CJC A;  3I55 N;  3LP1 A;  3MMV A;  4QOZ B;  1ZXO A;  1Q9Y A;  3BY5 A;  2VWJ A;  3AVL A;  3MDQ A;  1NK4 A;  4BRO A;  1S1V A;  3U9Z A;  2QEX N;  1YVU A;  3C95 A;  3V9Z A;  3TTD A;  2ATQ A;  4K0K K;  4HVJ A;  1ILY A;  3NBP A;  4CJK A;  4FJI A;  2P9L A;  5JS2 A;  3KIO A;  4F8R A;  4BR5 A;  3V4I A;  2Q31 A;  1SS6 A;  1C0U A;  3O1B A;  2ITM A;  3VTH A;  1EP4 A;  4R5P A;  4LH4 A;  4TSX A;  3KLG A;  1S22 A;  4CBX A;  1MU2 A;  3HI0 A;  4AHT A;  3MX5 A;  3D2F A;  3K0S A;  3HO1 A;  2KZM A;  4BGB A;  3MEC A;  3NE6 A;  4LFA K;  1E4F T;  2G8H A;  4M3R A;  3O6W A;  4E0D A;  4I6M A;  3E9L A;  4DSL A;  2YV0 X;  4A5B A;  3CQX A;  1N36 K;  3J7Z O;  4LY7 A;  1BIS A;  4O4G A;  4GV3 A;  3TU5 A;  4CJQ A;  3M6G A;  3SV3 A;  4CVN E;  3ULD A;  1KCF A;  2AP1 A;  1L3V A;  3SQ0 A;  4OGE A;  3QIP A;  4GKK K;  5I3U A;  5AQS A;  4HUG A;  4JKC A;  3NCI A;  4CK1 A;  5JLF A;  5KI6 A;  4KH4 A;  3GE1 A;  3VF2 A;  3MWT A;  1NGC A;  1KC8 O;  3CCQ N;  2IS3 A;  2QM1 A;  4IO9 L;  1DEJ A;  4C8O A;  5FRN A;  4PKG A;  2I7P A;  4B3T K;  1RNH A;  1VRU A;  3ENB A;  4CJP A;  5SWM A;  4FW1 A;  1VSD A;  2Q97 A;  4Y1D A;  4MFB A;  5J1E A;  3NAE A;  4XH1 A;  4C8K A;  4YY3 K;  3TAG A;  2GUP A;  2O8C A;  1X9S A;  1VQL N;  3DLR A;  4I6M B;  4ILJ A;  1W2B M;  1GLL O;  5KPZ A;  1JLF A;  2NUB A;  1FKP A;  3AA4 A;  1LAV A;  3DLG A;  4YOR A;  3ZT2 A;  1N33 K;  4Z4G A;  3OBY A;  3U8X A;  2UU9 K;  3P38 A;  4AHC A;  4XIU A;  4EP5 A;  3WT0 A;  3QEV A;  2UXB K;  2JGU A;  1OVQ A;  3OYB A;  2VG6 A;  4DQQ A;  2WC9 A;  4FLX A;  2XO7 A;  2Z1J A;  2OA8 A;  1NGA A;  1TUY A;  1NOZ A;  4B3M K;  3LDP A;  2WON A;  4JKH A;  4YOW A;  4DFP A;  2NRR A;  1RFQ A;  3L2V A;  2P9N A;  3VQP A;  3ZSX A;  3HVR A;  2HHS A;  4B1Y B;  2IOC A;  4KI6 A;  1RBV A;  3PIO L;  1A5V A;  2GX9 A;  3AO4 A;  3SLC A;  4A2A A;  4NCA A;  1RDW X;  2RHK A;  4JEP A;  1KD1 O;  4DV3 K;  4IO8 A;  4CIF A;  2NZT A;  4FLU A;  4E1J A;  4CI6 A;  1IKW A;  1O1W A;  3AA3 A;  3V9S A;  2F4V K;  3O80 A;  1GLE G;  3LPU A;  3SQ2 A;  4MLH A;  2O8F A;  4H5T A;  3N4Q A;  5AQX A;  4E1N A;  5LY3 A;  1NK5 A;  1SKR A;  3VES A;  2IDO A;  4LH5 A;  4PQU A;  4ISE A;  3ZT4 A;  3WXK A;  3OYG A;  1NK8 A;  4CIG A;  4EFH A;  3VQ4 A;  2I7N A;  3CC7 N;  3QB0 A;  5KPR A;  3I8B A;  3AGK A;  3OY9 A;  2W42 A;  4CEC A;  1BQM A;  3VGL A;  3LDN A;  3O1W A;  3UKU A;  3ULE B;  4M45 A;  5KTQ A;  1X3N A;  1LAW A;  4I2Q A;  3LP2 A;  5F0X A;  4DQP A;  4DU3 A;  3THX B;  1W97 L;  2PY5 A;  4DG1 A;  4FLW A;  1W0H A;  4DTR A;  3HZ6 A;  4WQ4 C;  3RWU A;  2BE2 A;  4RW7 A;  3PIP L;  4DSJ A;  4M7Y A;  2RE2 A;  3HPH A;  1IBK K;  4QAG A;  2HBL A;  5CYQ A;  4K8Z A;  1SKW A;  2AJQ A;  2KKZ A;  5C12 A;  4X66 K;  4BY9 C;  1RT4 A;  2VWK A;  3THV A;  4J2E A;  1QQC A;  2QXL A;  4CZM A;  1BIU A;  2HHW A;  4MO4 A;  3GL1 A;  5BRF A;  1RTI A;  1KSP A;  2BDP A;  4CZG A;  3AVB A;  4PL7 A;  5GAD P;  4FW2 A;  3DLL L;  5I42 A;  1NK9 A;  4HCC A;  4ZTJ A;  5K14 A;  4OPH A;  3VQQ A;  3VMF B;  3K5N A;  1WB9 A;  1VHX A;  2A6A A;  1GLA G;  4ILH A;  1OH7 A;  4CHO A;  1QTM A;  1BOT O;  4Z94 A;  5BRD A;  3TAF A;  4RCH A;  4FO0 A;  5KQ8 A;  5AQP A;  3KTQ A;  2Y1I A;  4BE0 A;  3TI0 A;  2V52 B;  1YJW N;  4M3W A;  4Q0B A;  3P31 A;  5M1P A;  4U7B A;  3MCA B;  4H5N A;  3C6A A;  3D2E B;  5GAG P;  1CZA N;  4GY2 B;  3PX6 A;  3CMA N;  4IKF A;  4GNI A;  3OHR A;  3ZSQ A;  4Z0U A;  1WSH A;  3LDL A;  3QDK A;  3OYC A;  4DR1 K;  3AAP A;  4MLE A;  3CCE N;  3S3N A;  5AZI A;  1U48 A;  1TK8 A;  1ASU A;  3CCM N;  3ZT0 A; 
#chains in the Genus database with same CATH homology
 1KLN A;  3OYD A;  5J2P A;  1RCH A;  1JLQ A;  2VG7 A;  1S5J A;  4KKO A;  3P83 D;  4I7F A;  1DTT A;  2G8W A;  4FJG A;  3AO5 A;  4CGF A;  2X6N A;  3AVI A;  1W9H A;  2E4L A;  4DTM A;  4JRP A;  3QEX A;  1NKE A;  4DSK A;  1U49 A;  3G10 A;  4KRF A;  3AVF A;  4KPY A;  2D0C A;  3DLB A;  1S6Q A;  1HJR A;  2DY4 A;  4CGH A;  3OYN A;  2HNZ A;  3I0R A;  4W5N A;  4KHW A;  4FJ7 A;  1J5O A;  5KRS A;  4CJ3 A;  1NJZ A;  4CHP A;  4N5S A;  1D8Y A;  4FZZ A;  5EU7 A;  3OYF A;  4LSL A;  1VSM A;  4CEE A;  4CJU A;  4FJX A;  3SQ4 A;  4DS5 A;  3K5M A;  2HW3 A;  2Y1J A;  4J2B A;  4DTP A;  3OS0 A;  3AVM A;  3SCX A;  2BAN A;  4CIE A;  1NK0 A;  4KHQ A;  2EHG A;  1RDB A;  3S3O A;  3KKS A;  1RTH A;  3K57 A;  2DFE A;  1C1C A;  2BGG A;  3B6P A;  3OYM A;  2OYQ A;  4BWM A;  4CJT A;  1RT7 A;  3L8B A;  1HQE A;  1KFD A;  4M42 A;  4O0I A;  2EX3 A;  2ITG A;  1VSL A;  4E3S A;  4F3O A;  2YNH A;  3PO5 A;  4E7K A;  3ALY A;  3LWL A;  1WAJ A;  3U3Y A;  3AA2 A;  4K8X A;  4W5O A;  4B9U A;  1TK8 A;  3LAK A;  4W5T A;  3CFP A;  2X74 A;  3LAL A;  4FLZ A;  3TAQ A;  4FK4 A;  1CLQ A;  4GMJ B;  1TAU A;  1VK0 A;  3RRG A;  1C6V A;  1TKZ A;  4CF8 A;  1HRH A;  3RMD A;  3DLH A;  3HL8 A;  4C8L A;  3ZSR A;  1XI1 A;  1WNS A;  4I9L A;  4DSE A;  1ZYQ A;  1S1W A;  3TAM A;  4ID1 A;  4DLE A;  3IAY A;  1KFS A;  4B3O A;  4AHS A;  3CQ8 A;  3PUF A;  2ZD1 A;  4CF1 A;  1TAQ A;  1RBS A;  4DTJ A;  5KRT A;  1ZBH A;  1RT1 A;  3QIO A;  3DLK A;  2XY6 A;  1HPZ A;  1JLE A;  4OKK A;  1IKY A;  1FK9 A;  4Y1C A;  3ZSO A;  3QO9 A;  3VQB A;  3L2Q A;  3NH2 A;  4KI4 A;  3K58 A;  3VQA A;  1GOC A;  3LDS A;  1BL3 A;  2YNF A;  4FJM A;  4CFD A;  1UAX A;  1TVR A;  3QER A;  4NYN A;  3TAN A;  2XRI A;  4CJF A;  1KLM A;  2YHA A;  3WNH A;  5HLF A;  1BCM A;  1WSJ A;  4OKJ A;  4OPK A;  5J2Q A;  4ID5 A;  3EY1 A;  1T05 A;  3LP0 A;  3F73 A;  4HHT A;  3TAP A;  1HYZ A;  1WLJ A;  1WSE A;  2LSN A;  3HYF A;  4RW9 A;  4OPJ A;  1SL0 A;  4CJW A;  2F96 A;  1B92 A;  5CZ2 A;  3VQE A;  1LV5 A;  3V6D A;  4EZ9 A;  2XY7 A;  3DI6 A;  3IS9 A;  3KK2 A;  3OYH A;  5CZ1 A;  2GUI A;  1XHZ A;  2OZM A;  1KVC A;  1RT6 A;  4JRQ A;  1X1P A;  2E6L A;  4DQR A;  1DTQ A;  3D0P A;  2OPP A;  1WSF A;  3V9X A;  4M3U A;  1UWB A;  1JL1 A;  3ZSY A;  3SPZ A;  5DK5 A;  1TGO A;  2A1R A;  4E7H A;  1SL2 A;  2DFH A;  3DRS A;  4BDZ A;  2PYL A;  3DLE A;  4ELT A;  3O3G A;  3HJF A;  4GVM A;  4B8C A;  1Q9X A;  3M8Q A;  1LWF A;  3T1A A;  4EP4 A;  3S9H A;  2RN2 A;  3QNO A;  1N6Q A;  4DF4 A;  4FZX C;  1J53 A;  1S1X A;  3NH1 A;  1ITG A;  4CHN A;  1IKV A;  4OGC A;  3WNG A;  1CXU A;  2ETJ A;  3WNE A;  4Z4E A;  4NYF A;  4AIL C;  4CEB A;  4BWJ A;  3L2R A;  1TK0 A;  4L8R B;  4FLT A;  4N41 A;  3C6U A;  3TR8 A;  1JLG A;  3V1R A;  2KFN A;  1C0M A;  4B9N A;  4DTO A;  5DMR A;  3SUO A;  1NOY A;  4CHQ A;  1VSK A;  3HPG A;  4YNQ A;  3SPY A;  4HCB A;  1B9D A;  3K2P A;  1WSG A;  3KKR A;  2PZS A;  3I0S A;  3VQ6 A;  4CEA A;  4J2D A;  3OJU A;  3M8S A;  5HRS A;  4DU4 A;  1NKB A;  4FJL A;  2HHX A;  4JLH A;  4N47 A;  3MXJ A;  3OYL A;  3RR8 A;  3DYA A;  1TKX A;  5FDL A;  4W5R A;  5HBM A;  4CJV A;  4B08 A;  5FRO A;  2X78 A;  5D3G A;  4DF8 A;  2QK9 A;  3OJS A;  3RMC A;  3A2F A;  1IO2 A;  2YHB A;  4E7I A;  4DSI A;  1KVA A;  4CED A;  1CZB A;  2XY8 A;  3QLH A;  4CJL A;  1JLA A;  5C42 A;  2KTQ A;  3QEP A;  1IG9 A;  1EET A;  1ZBF A;  2G8U A;  3LP1 A;  3MED A;  5E41 A;  4QOZ B;  4UQG A;  3PY8 A;  5J2M A;  4CGG A;  1Q9Y A;  3DRP A;  2WOM A;  2VWJ A;  3AVL A;  2KW4 A;  1NK4 A;  4H8K A;  4E7L A;  2FBY A;  1WSI A;  2HHQ A;  1A5W A;  1S1V A;  5HRR A;  3AVA A;  2XHB A;  3PV8 A;  3EZ5 A;  2P5G A;  4KHY A;  5KGX A;  1K6Y A;  1YVU A;  3C95 A;  4OKE A;  1WAF A;  3ZSW A;  4HTU A;  4CEF A;  1Q8I A;  3V9Z A;  3TAB A;  2ATQ A;  3SI6 A;  1GOA A;  3NF8 A;  3AO2 A;  3DMJ A;  1T03 A;  4HVJ A;  3QEI A;  4FLY A;  1FKO A;  3KK1 A;  3NBP A;  1ZBL A;  4CJK A;  4FJI A;  4KO0 A;  4CHZ A;  2RKI A;  4CJ4 A;  3G0Z A;  5JS2 A;  3KIO A;  2I5J A;  4F8R A;  3V4I A;  3CYM A;  1Z25 A;  3S3M A;  4M3Z A;  4CJS A;  4DQS A;  4CK2 A;  4FJN A;  4OLA A;  1TV6 A;  4O55 A;  3QIN A;  3V1O A;  4CGI A;  1C0U A;  1J9A A;  3NH0 A;  5FRM A;  2PYJ A;  3MAQ A;  1EP4 A;  2JLE A;  3KLI A;  3V1Q A;  3OYI A;  4R5P A;  3NHG A;  1SL1 A;  1RTD A;  4LH4 A;  4TSX A;  3L2W A;  1QSY A;  3KLG A;  1ASW A;  4AHU A;  1MU2 A;  4B9S A;  1RBU A;  1CZ9 A;  4AHT A;  1RIL A;  3L2U A;  3HO1 A;  2KZM A;  3HP6 A;  2D0B A;  3MEC A;  3NE6 A;  4PY5 A;  2G8H A;  4M3R A;  3O4N A;  2FBX A;  1U45 A;  4DWI A;  4CF0 A;  4E0D A;  1HNI A;  1JKH A;  2RF2 A;  4KFB A;  1LW2 A;  1U47 A;  4DSL A;  4M3X A;  1ZBU A;  2YV0 X;  1QSS A;  4B9V A;  4KHN A;  4FM0 A;  4LY7 A;  1BIS A;  1B9F A;  4O4G A;  4CJ5 A;  4CJQ A;  3SYZ A;  2G8I A;  2IAJ A;  3SV3 A;  1QHT A;  4M41 A;  3AA5 X;  3ULD A;  1KTQ A;  1HNV A;  1KCF A;  3UIQ A;  1BIZ A;  4FVM A;  1X9M A;  3L3V A;  1GOB A;  3T19 A;  1UOC A;  1RBT A;  5HRP A;  1L3T A;  1L3V A;  3VQD A;  3QET A;  2XY5 A;  1HYS A;  2KQ2 A;  3SQ0 A;  4BDP A;  4OGE A;  1NJX A;  3ITH A;  2YNI A;  3QIP A;  4KRE A;  1G15 A;  5I3U A;  4ZTF A;  4HUG A;  3NCI A;  4IG3 A;  4CK1 A;  4Q5V A;  5KI6 A;  4FXD A;  1C0T A;  4CEQ A;  4OJR A;  4FYD A;  3NF9 A;  3CFO A;  4C8N A;  5J2N A;  4RW4 A;  2HB5 A;  4KB1 A;  5JS1 A;  2IS3 A;  3V9W A;  4Z4I A;  3TAE A;  3ZSZ A;  4C8O A;  3DOK A;  3VQ8 A;  2P5O A;  4KHS A;  3EYZ A;  5KGW A;  4CEZ A;  5FRN A;  3QES A;  1RNH A;  4O44 A;  3HT3 A;  1VRU A;  3P5J A;  3OYJ A;  5SWM A;  4CJP A;  1SV5 A;  4JS5 A;  2HHV A;  4FW1 A;  4FK0 A;  1VSD A;  4O5B A;  4ZHR A;  4Y1D A;  4W5Q A;  4MFB A;  1I3A A;  1KVB A;  5J1E A;  3NAE A;  1JXE A;  4IFV A;  4FJ5 A;  4C8K A;  3B6O A;  4J2A A;  1I39 A;  3TAG A;  1J54 A;  3OYK A;  2P1J A;  3DOL A;  3SUQ A;  1U04 A;  4PA1 A;  1X9S A;  3AO1 A;  3DLR A;  2G8F A;  4IDK A;  4LSN A;  3NGI A;  4KTQ A;  3HPO A;  3O4Q A;  1Y97 A;  2HNY A;  3LWM A;  4CK3 A;  4G1Q A;  3OYE A;  3VA3 A;  4BE1 A;  1JLF A;  4OVL A;  4DFK A;  2Q3S A;  2NUB A;  1FKP A;  4HUF A;  4DSF A;  4DMN A;  3AA4 A;  1LAV A;  3DLG A;  1YT3 A;  3NFA A;  3AVG A;  3ZT2 A;  3K5O A;  4FM1 A;  1NJY A;  3RTV A;  4FJH A;  3NGY A;  4Z4G A;  3JSM A;  3CM5 A;  3C94 A;  4H4M A;  3AVC A;  3AVH A;  3V9U A;  1BHL A;  1LW0 A;  2ZE2 A;  4M3Y A;  4ELV A;  1S1U A;  4DTX A;  1D9F A;  1IKX A;  4CHY A;  4AHC A;  4RW8 A;  4XIU A;  4EP5 A;  4DU1 A;  1ZBI A;  3QEV A;  1LWE A;  2JGU A;  4E1M A;  3OYB A;  2VG6 A;  3ISN C;  3PX4 A;  4DQQ A;  1TK5 A;  4F2R A;  4FLX A;  3LZI A;  2XO7 A;  2Z1J A;  3SUN A;  3C6T A;  1XWL A;  1XC9 A;  2OA8 A;  4B9T A;  4OLB A;  3LAN A;  4QCL A;  1NOZ A;  2OPR A;  3VQ9 A;  4HUE A;  3OS1 A;  4KB0 A;  3LPT A;  2WON A;  4DFP A;  3L2V A;  4NCG A;  3VQP A;  3ZSX A;  1NJW A;  1VSJ A;  4E7J A;  3KD1 E;  3ZSV A;  3HVR A;  2F8S A;  3P1G A;  3NDK A;  2HHS A;  1YTU A;  2IOC A;  5CYM A;  1NK6 A;  4KI6 A;  1RBV A;  3M8P A;  1A5V A;  1RDC A;  3AO4 A;  4NCA A;  1CXQ A;  4N56 A;  3O3F A;  1S9E A;  1HYV A;  2E6M A;  2OZS A;  4DQI A;  4PUO A;  1HMV A;  1T8E A;  2G8V A;  1JLB A;  4DTS A;  2HVI A;  4CIF A;  3NGZ A;  3LAM A;  1DLO A;  4FLU A;  2OPQ A;  1IKW A;  3F9K A;  1O1W A;  3HVT A;  1A5X A;  3AA3 A;  2YKM A;  5HRN A;  4FCY A;  3V9S A;  3K59 A;  4DFJ A;  3V81 A;  3HP9 A;  2B4J A;  3LPU A;  4EZ6 A;  3SQ2 A;  2QKK A;  2Z1H A;  3HM9 A;  4Z4F A;  2OPS A;  1QE1 A;  1RT5 A;  4E1N A;  1RBR A;  3VQ5 A;  1TL3 A;  1NK5 A;  1SKR A;  4CFB A;  2IDO A;  1C1B A;  1LWC A;  4LH5 A;  1RDA A;  4BAC A;  1EKE A;  3ZT1 A;  3AVJ A;  4PQU A;  3KLH A;  3ZT4 A;  2R7Y A;  3WNF A;  4N76 A;  3OYG A;  1NK8 A;  1X9W A;  4CFA A;  4CIG A;  4AHV A;  5T7B A;  3VQ4 A;  4DFM A;  1NK7 A;  3IRX A;  1F21 A;  3KJV A;  1L3U A;  4RG8 A;  2GBZ A;  1N5Y A;  4RW6 A;  2F8T A;  3DRR A;  1ASV A;  3OY9 A;  2W42 A;  1Z26 A;  5HP1 A;  3MEE A;  4CEC A;  1BQM A;  1IH7 A;  2KFZ A;  1R0A A;  1BQN A;  3FFI A;  1BCO A;  5CY4 A;  4CES A;  4M45 A;  4IBN A;  5KTQ A;  4DLG A;  1LAW A;  4I9Q A;  3AVK A;  3LP3 A;  4FJ9 A;  4FK2 A;  4KTW A;  4FJJ A;  2G8K A;  1VRT A;  4CJR A;  1TL1 A;  4I2Q A;  3LP2 A;  2HMI A;  4B9L A;  1C1A A;  2GV9 A;  1SUQ A;  3OYA A;  4DU3 A;  3SQ1 A;  4DQP A;  3ZCM A;  3U3G A;  2A1S A;  3TWH A;  4IFY A;  3I8D A;  3IG1 A;  3CM6 A;  2PY5 A;  1XHX A;  4DG1 A;  4FLW A;  1W0H A;  4DTR A;  3MXI A;  1UA1 A;  4MQ3 A;  1S9G A;  3O3H A;  3CG7 A;  1L3S A;  3KLF A;  4CE9 A;  4IG0 A;  3RWU A;  3MEG A;  2BE2 A;  4RW7 A;  3RRH A;  3RMA A;  3DM2 A;  4DSJ A;  2QKB A;  3SUP A;  3HK2 A;  1RT2 A;  1REV A;  4C8M A;  1VSI A;  3HST B;  4CGJ A;  3OS2 A;  3QEW A;  3VQC A;  3HPH A;  4Z4H A;  3SV4 A;  4CGD A;  4LD0 A;  4QAG A;  4CCH A;  3NF6 A;  1VSF A;  4FM2 A;  1RDD A;  5CYQ A;  4K8Z A;  1SKW A;  4BE2 A;  2AJQ A;  1RT4 A;  2VWK A;  4CEO A;  4DTN A;  1QQC A;  3THV A;  3MXM A;  4J2E A;  1T7P A;  1BIU A;  4H4O A;  3K5L A;  2D5R A;  2HHW A;  3SNN A;  2ZQB A;  3RMB A;  3OVN A;  3ZT3 A;  4NCB A;  2HHT A;  1S1T A;  1EX4 A;  1YTA A;  1SKS A;  2RPI A;  2D0A A;  3TAR A;  2Z1G A;  1RTI A;  1KSP A;  2BDP A;  3RR7 A;  4AH9 A;  3AVB A;  3HXM A;  4FW2 A;  4AHR A;  4YFU A;  1JLC A;  1UA0 A;  3KD5 E;  4F2S A;  4FJ8 A;  2HVH A;  4DS4 A;  4E19 A;  3M8R A;  5I42 A;  1NK9 A;  3L3U A;  1JL2 A;  4HCC A;  2IC3 A;  1BI4 A;  4ZTJ A;  5K14 A;  3CFR A;  3VQQ A;  4ELU A;  2YKN A;  1WN7 A;  1D5A A;  2DFF A;  4JS4 A;  3K5N A;  3U6F A;  1VSE A;  1RTJ A;  3SJJ A;  1BGX T;  3AVN A;  4FJK A;  3PX0 A;  3SZ2 A;  4KV8 A;  4F3T A;  4CHO A;  1HQU A;  1QTM A;  3BDP A;  1TKT A;  2IGI A;  3NF7 A;  2B5J A;  3ASM A;  4I2P A;  3T3F A;  3TAF A;  1S6P A;  2DTU A;  3KTQ A;  2O4G A;  2YNG A;  4KAZ A;  4KHU A;  5C25 A;  2FBT A;  2FC0 A;  1U4B A;  2Y1I A;  4B9M A;  4KTZ A;  1TKD A;  3AO3 A;  4BE0 A;  3QNN A;  3TI0 A;  3D45 A;  5SZT A;  5HRO A;  2QXF A;  4E89 A;  4CER A;  4GW6 A;  4M3W A;  4CJE A;  4Q0B A;  1L5U A;  1JXB A;  3VN5 A;  4B8A B;  3H08 A;  2B6A A;  3JYT A;  3VA0 A;  1FXX A;  1VSH A;  2HND A;  2Z1I A;  3BGR A;  4ICL A;  4Z4C A;  4F4K A;  4BDY A;  1QS4 A;  4O0J A;  1D9D A;  1EXQ A;  4FLV A;  4CF2 A;  2X6S A;  2HHU A;  2O4I A;  2FBV A;  4CF9 A;  3PX6 A;  3VQ7 A;  4FZY A;  1NKC A;  4PWD A;  4IKF A;  4CFC A;  3LZJ A;  3ZSQ A;  4Z0U A;  1WSH A;  1QSL A;  4WE1 A;  2KZZ A;  3OYC A;  1BI4 B;  4M3T A;  1RT3 A;  2VG5 A;  1KRP A;  3KK3 A;  3E01 A;  4DTU A;  3KLE A;  3S3N A;  1U48 A;  5C24 A;  2P51 A;  1ASU A;  3PO4 A;  3ZT0 A;  3AV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...