4CFDA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cfdA00
3NGZA 4PQUA 3WNEA 4W5RA 4I9QA 2DTUA 3KIOA 3V9WA 4Z4EA 5CYMA 1RT2A 1QSLA 4FJLA 4CJRA 4DFJA 3SI6A 1BQMA 5K14A 3SUNA 4O55A 2FBVA 4CHPA 1JLFA 3K5OA 4FM0A 3M8RA 1VK0A 4FLTA 5KGWA 4DFMA 4DTSA 3AO1A 3DLHA 1VSLA 5HLFA 2LSNA 3SUQA 1SUQA 3LAMA 4IBNA 4O5BA 3V4IA 1HYVA 2BGGA 2P1JA 3MXIA 3ZSVA 1VSHA 1JL2A 5FRNA 3LP0A 1FK9A 3U3YA 1RTHA 4CK3A 2QK9A 4DG1A 1REVA 3MAQA 3HVTA 5T7BA 3QEXA 1T03A 4M3TA 3KLGA 3CG7A 3V9UA 3ZSRA 4FVMA 3PX4A 3DLGA 4FCYA 3QERA 4AHSA 5J2NA 1RBUA 4OVLA 1X9SA 4B9SA 1YTUA 3PO4A 4E7IA 1TKXA 2XY8A 4E89A 3KJVA 1U47A 1HQEA 3TI0A 3OYKA 1WSFA 3JYTA 3V81A 2Z1HA 4CEBA 3KLHA 4DSLA 4GVMA 1ITGA 3AVCA 2YNFA 3P1GA 3OYCA 1UWBA 4LH5A 3OY9A 3JSMA 3C94A 2WONA 3AVGA 4KTZA 3QEPA 4QOZB 4FZZA 4HUGA 1QE1A 1BIUA 3AVAA 3VQ8A 4XIUA 2KFZA 3VQ5A 2O4GA 3VQ6A 3ZSZA 3S3MA 1L5UA 1Z26A 1T05A 4I2PA 4WE1A 3OYBA 4J2AA 4CHNA 4QAGA 4DMNA 3SV4A 2JLEA 3DLRA 1NK0A 3DI6A 4FLVA 1YVUA 3TWHA 4C8OA 2OPSA 4DS4A 3AVNA 3AVKA 1N6QA 2DY4A 2IC3A 3HPGA 1IO2A 4CIFA 4PA1A 4AHVA 4CE9A 3VQ4A 3HM9A 4KFBA 3ZSOA 4O44A 3K5LA 3RR7A 4FK2A 1BI4A 4PUOA 3P83D 5CZ2A 1F21A 2HNDA 4DFPA 5J2QA 1QTMA 1RT5A 3M8SA 3SPYA 4Z4HA 1EXQA 3DM2A 1GOAA 1I3AA 1IH7A 4OKJA 2X78A 3OYNA 4KAZA 4FYDA 3TAEA 1XHZA 4RW8A 4CJ4A 4FJJA 4Z0UA 4CJEA 4IFVA 3C6UA 3KD5E 4FJMA 2ETJA 3AVFA 3WNHA 4KB0A 1NK5A 2ZE2A 4GMJB 2IS3A 2IGIA 4CF9A 4C8LA 1NK7A 1BCOA 2X74A 1WAJA 4F4KA 1S5JA 4B08A 4BE0A 4FJHA 4OLAA 4FJ8A 3ISNC 3KLFA 1LW0A 3K2PA 4CJPA 5KRSA 4FW1A 1EETA 5SZTA 2G8FA 1JKHA 4B8CA 4C8NA 4N41A 3DRPA 1KVAA 1RDDA 4OGCA 3NH0A 4M3WA 2Z1IA 4DFKA 2G8HA 2YHAA 2FC0A 2YHBA 3SYZA 3QNOA 2YKMA 2HNYA 3I0RA 4M41A 1S1VA 4OGEA 2ATQA 4CJFA 1U04A 3V1QA 4OJRA 1TK5A 3M8PA 4BWJA 3QIOA 1X9WA 1BGXT 3VQ7A 2F96A 4B9UA 3NF9A 3V9SA 3OS0A 5J2MA 1RT6A 3C6TA 2YV0X 1KVCA 3FFIA 3HSTB 3O3FA 4FLYA 1CXUA 1B9DA 2VWJA 2DFFA 5CYQA 3L8BA 1BI4B 1KCFA 3B6OA 4R5PA 3NCIA 3LZIA 1RDAA 1VSKA 4BE2A 4FJIA 1VSJA 4CGGA 1A5XA 1W0HA 1Y97A 2OA8A 2G8VA 4KPYA 4FJ9A 1LV5A 3CYMA 1NJYA 3VQBA 4KREA 4AH9A 3B6PA 3VQPA 3K57A 2F8TA 1UA1A 1GOCA 5EU7A 1X1PA 3DRSA 5CZ1A 4E7HA 4DTXA 3QESA 2Y1IA 4HCCA 3OYLA 1NKEA 4DWIA 1HMVA 4LY7A 4DQRA 3V6DA 3K5NA 3ZSXA 4IG3A 3MEDA 1TAUA 4DLEA 2FBYA 4BWMA 1SKWA 3L2QA 1HYSA 3EY1A 1RBSA 3CFOA 2EX3A 4W5TA 2Z1JA 2QXFA 3PV8A 4ELTA 4HHTA 4CIGA 4DTUA 2B4JA 4CEZA 1RDBA 3AVBA 3NH2A 1SKSA 2XHBA 2HVIA 2A1RA 4NCBA 3DLKA 2PYLA 3HVRA 4FM2A 4E7KA 4Z4GA 2BDPA 1C0MA 1D5AA 3QEIA 4BDZA 4LD0A 1C1BA 4W5NA 3RMCA 3LP1A 2Q3SA 3SNNA 1NK4A 5CY4A 3ZT2A 1JL1A 1JXEA 2IOCA 2FBTA 3SUOA 1ASUA 1WNSA 3RMAA 1KFDA 4DU3A 4HVJA 3KK2A 3MXMA 3K5MA 2OZSA 4N76A 4Q0BA 1J53A 1NOZA 3O4NA 3U3GA 5HRPA 1XHXA 4BE1A 4M3UA 2HVHA 5JS1A 4H4MA 1S6QA 3AVLA 4MQ3A 2KZMA 4AHRA 3LAKA 4F3OA 3AO4A 4I9LA 1C1AA 3CFPA 3QEVA 3LDSA 5C24A 1RT3A 3RR8A 3OS2A 4RW7A 1SL1A 1I39A 3LWMA 1TV6A 3AA2A 3AA4A 3VA3A 2DFEA 4CHQA 1WLJA 3HP6A 5HP1A 5D3GA 3QO9A 4FLWA 3NF6A 3T19A 4UQGA 2OYQA 4OLBA 3TAFA 3NGIA 4CJLA 3ZSQA 4DLGA 4C8KA 3QIPA 1J54A 3ALYA 3THVA 3S3NA 4ZTFA 4F3TA 4DSFA 4EZ9A 1WSHA 3OYAA 1UAXA 3IRXA 4CEEA 4E0DA 3CFRA 4DF4A 1CLQA 3AVJA 3HPHA 1RILA 1IKXA 3HPOA 4B9LA 4CF0A 5FRMA 4LSLA 4HUFA 4B9NA 3AO2A 1XI1A 3PX6A 2P51A 2D0BA 4FLXA 1TK8A 4K8XA 5DK5A 3EYZA 3HXMA 4CEFA 2D0CA 3QINA 3KTQA 3RMBA 2KZZA 4RW9A 3V1OA 4CESA 4DF8A 2KW4A 2KQ2A 3PO5A 4FJ5A 3PUFA 1A5VA 1S9EA 4DSKA 3OYMA 2G8IA 4Z4IA 3BDPA 3SUPA 1XWLA 4CJSA 4ID5A 3KLEA 4DSJA 3O3HA 1JLQA 4CGHA 1ZBIA 2E4LA 1RT7A 1BHLA 3C95A 3L2RA 3NF8A 2GBZA 5FROA 3AVIA 3ZT4A 3NE6A 4AILC 4KRFA 1NK9A 3PX0A 4AHCA 1RBRA 1NJZA 1VSMA 3O4QA 1LWCA 4RW6A 5SWMA 1RNHA 1TVRA 4OKEA 1WSGA 3AO3A 1C0UA 4JS5A 2D5RA 1RT1A 2W42A 3DOLA 4W5QA 1NK8A 4TSXA 4DSEA 1U4BA 1TGOA 1L3SA 2P5GA 2O4IA 1SKRA 4Y1DA 1D8YA 2B5JA 3TAGA 1ASWA 3K58A 3ZT0A 1C6VA 3F73A 1R0AA 2E6MA 1ASVA 3RTVA 1RBTA 3OYHA 3ULDA 3TAQA 1TL3A 1NK6A 3NAEA 4DTRA 4JS4A 2Y1JA 4HCBA 3BGRA 3LALA 1ZYQA 1QSYA 3QNNA 1UOCA 3T1AA 4CERA 3IG1A 5C42A 1L3VA 1Q9XA 4ZTJA 3DMJA 1HNIA 4DU1A 3ASMA 3OYFA 3VQDA 3LWLA 2PZSA 1DTQA 1VSFA 4CGJA 3HYFA 4RW4A 1BL3A 5HRNA 3U6FA 3SCXA 2ZQBA 2P5OA 2KTQA 1KLNA 4ID1A 1K6YA 1WN7A 4KKOA 3L2UA 3VA0A 3V9ZA 3DLBA 4CK2A 4DS5A 4FJKA 3DOKA 1SL0A 3A2FA 4KTWA 5HBMA 4FK4A 4E1MA 1BCMA 2F8SA 4AHTA 4CJ5A 2YNHA 3HL8A 4IDKA 1RT4A 3KKRA 3MEEA 1SL2A 4CJVA 4FJGA 3QLHA 1VRUA 4H8KA 4CJUA 4KI6A 4KHYA 3L2WA 1QS4A 4Z4FA 2XY6A 1LW2A 2ZD1A 4M3YA 2HNZA 3LPTA 3OYIA 4CCHA 2VG6A 4CJTA 3IS9A 4AHUA 4EP4A 3WNGA 1HQUA 1Q9YA 4FZYA 3AVHA 2YNIA 1CZBA 4CFAA 1B9FA 3CQ8A 2EHGA 3V1RA 4NCAA 3AO5A 2RKIA 3DRRA 1QSSA 2VWKA 4CEOA 4F2RA 4DTJA 1TL1A 3AV9A 3TANA 1S1UA 5I3UA 4J2EA 1W9HA 3V9XA 3I8DA 3LANA 3SJJA 3RRHA 4ZHRA 4EZ6A 4CFDA 2R7YA 4O0JA 4J2DA 1D9DA 4CF1A 3E01A 1RDCA 3UIQA 2G8UA 2HW3A 2QKBA 1BQNA 2G8KA 3VQ9A 1U45A 1GOBA 1QHTA 1TAQA 4IFYA 4DQIA 1EX4A 4I7FA 1TKTA 1NJXA 4E19A 4QCLA 2X6SA 4FW2A 4J2BA 1RBVA 2I5JA 3K59A 4DTOA 3AVMA 3L3UA 5C25A 3PY8A 5I42A 4FZXC 1C1CA 4KI4A 4DTMA 2HHSA 1EP4A 1NKBA 4IKFA 1HRHA 4KV8A 3TABA 2DFHA 1J5OA 4BDPA 3HT3A 2GV9A 4KHWA 1YT3A 3TR8A 4CHYA 2ITGA 3M8QA 4FLUA 4Z4CA 3OYJA 1CXQA 1VRTA 3NFAA 1JLGA 4DQQA 4Y1CA 4F2SA 4B3OA 1EKEA 1L3TA 1J9AA 2RN2A 4MFBA 4CECA 2OZMA 1RTDA 3LPUA 4CFBA 4HTUA 2HHXA 4JLHA 1T7PA 3H08A 3L2VA 4OPKA 1JXBA 2OPQA 3WNFA 2A1SA 1S6PA 3OVNA 1HYZA 1KRPA 4F8RA 3DYAA 3NGYA 4N47A 3OYEA 4N5SA 5J2PA 1Q8IA 2GUIA 2HHTA 2VG7A 4E7LA 1KTQA 4CEDA 4FK0A 1O1WA 1QQCA 4I2QA 1U48A 1LAVA 4CHZA 3D0PA 1SV5A 2AJQA 1A5WA 4NYFA 3QEWA 5KGXA 5KI6A 4M3ZA 1JLBA 1CZ9A 5HRSA 4ELUA 1ZBHA 1WSEA 5HRRA 4CIEA 4E7JA 3RMDA 1Z25A 2BE2A 2IAJA 3RRGA 1HJRA 4KTQA 2HHQA 1TK0A 4KHUA 3L3VA 3NH1A 4CEQA 4LH4A 3D45A 4CK1A 4NCGA 3VQEA 3G0ZA 1WSJA 4Q5VA 3IAYA 4L8RB 1S9GA 4CJQA 3OJUA 1ZBLA 1C0TA 2BANA 4C8MA 4K8ZA 4M3RA 4ICLA 4KO0A 5DMRA 1FKOA 3OS1A 2FBXA 2RPIA 3MECA 3QETA 1JLAA 3AA5X 2G8WA 3SQ4A 3VN5A 2E6LA 1TKZA 2XO7A 2JGUA 4FJ7A 4M42A 2HHWA 3DLEA 2OPPA 3OJSA 1IG9A 3HK2A 1DTTA 4E3SA 3RWUA 3KK3A 3HO1A 2X6NA 4KHQA 1IKVA 1KLMA 2OPRA 1B92A 4CFCA 1D9FA 4CEAA 4FJNA 1HNVA 4E1NA 3EZ5A 5JS2A 4LSNA 1G15A 1S1TA 3MEGA 4IG0A 4DSIA 3KD1E 3HJFA 4DTPA 2XY5A 1JLCA 4B8AB 2D0AA 3S9HA 1RCHA 1LWEA 1ZBFA 1IKWA 3KK1A 4DQPA 4KHSA 2KFNA 2XY7A 4RG8A 4NYNA 1T8EA 4DTNA 4FXDA 3NF7A 5KTQA 3I0SA 4DU4A 2PYJA 3OYDA 2YNGA 3CM5A 1RTIA 3SQ1A 4CJWA 4CGFA 3ZT3A 3O3GA 3F9KA 3ZCMA 2RF2A 4JRPA 4PWDA 4BDYA 3CM6A 4BACA 1HPZA 4FM1A 4CHOA 2YKNA 4O4GA 3TAPA 3AA3A 2B6AA 3P5JA 4M45A 3TAMA 4CF2A 1VSEA 2WOMA 1FKPA 4W5OA 1VSIA 5J1EA 1TKDA 4B9TA 4CJKA 4B9VA 3ZT1A 1LAWA 1JLEA 2HB5A 3KLIA 2IDOA 4H4OA 3ZSYA 3LP2A 2VG5A 3NBPA 4CGDA 4N56A 1VSDA 3ITHA 4YNQA 1NJWA 3SZ2A 3VQAA 2HHUA 1S1WA 3HP9A 1X9MA 1DLOA 3T3FA 1BISA 4JRQA 1FXXA 1N5YA 4ELVA 2NUBA 1RTJA 3G10A 4O0IA 4EP5A 2HMIA 3TARA 5HROA 4KHNA 1WSIA 3NHGA 1YTAA 5KRTA 4CJ3A 4HUEA 3KKSA 1MU2A 3SQ2A 4KB1A 4G1QA 4PY5A 4M3XA 1KSPA 3MXJA 4CGIA 1U49A 3VQCA 4B9MA 4FJXA 1WAFA 4CF8A 3LP3A 1NKCA 3OYGA 2XRIA 4YFUA 3SPZA 1KVBA 2Z1GA 1BIZA 4GW6A 3S3OA 3NDKA 1IKYA 2HHVA 1XC9A 1S1XA 2QKKA 1UA0A 4OPJA 1NOYA 3SQ0A 1ZBUA 3ZSWA 1KFSA 2PY5A 5E41A 3SV3A 1L3UA 1LWFA 5FDLA 3VQQA 4DQSA 4FLZA 3LZJA 4OKKA
chains in the Genus database with same CATH superfamily
3NGZA 2W6KA 4W5RA 3V9WA 1RT2A 3HM8A 4K43A 1QSLA 4FJLA 1BQMA 3R6MA 4FM0A 3M8RA 4MLEA 3AO1A 1VSLA 2HBLA 1KAYA 3SUQA 3MCAB 1SUQA 3LAMA 3V4IA 1HYVA 3MXIA 1JL2A 1FK9A 3U3YA 2QWMA 3DJCA 4XEIA 3SJHA 3CJCA 3HVTA 3QEXA 2FSNA 3V9UA 3DLGA 3CJ1A 4AHSA 4DCHA 1X9SA 4PHTX 3ULEB 4E7IA 1EWQA 2Q97A 3OYKA 1HKCA 1YIJN 3JYTA 3CCSN 3AVCA 3OYCA 1WBBA 1TUYA 3JSMA 5AQTA 4A57A 4OPAA 5FPNA 1QE1A 3AVAA 3MMVA 3O5BA 5EXWA 4XIUA 2ZJPL 2A41A 3S3MA 4I2PA 4WE1A 4J2AA 5BRDA 3FFKB 2JLEA 3DLRA 3VEYA 2NRRA 3TWHA 2E2OA 1BG3A 2Q31A 3IDHA 4XH1A 5ELZA 4CE9A 4YDUC 3HM9A 4Z4EA 2QWQA 1BI4A 4DFPA 3M8SA 3SPYA 3LDQA 3OYNA 1XHZA 2RE2A 4RW8A 4CJ4A 2P9SB 2FF3B 3B8AX 4FJMA 3AVFA 5AQKA 1BOTO 2ZE2A 3FZLA 5AQMA 4CF9A 1NK7A 4F4KA 1WAJA 4B08A 4BE0A 4FJHA 3ATVA 4FJ8A 3H3NO 4CJPA 5KRSA 4FW1A 1E4FT 3DLLL 4BR7A 2QI2A 4MO5A 4C8NA 1VQ6N 3DRPA 1KVAA 2NRVA 3SYZA 2Q0RA 1S1VA 2KLAA 4OGEA 4H0YB 3V1QA 3M8PA 4B9UA 2F96A 3NF9A 1ZC6A 1KVCA 1H1VA 2YV0X 1NM1A 1CXUA 2VWJA 2DFFA 4R5PA 3LZIA 4FJIA 1S72N 2UU9K 1W0HA 4JEPA 4GNIA 3I55N 2QA4N 4FJ9A 4B3MK 1YUWA 3WXIA 4NXMK 5EU7A 3CCJN 5CZ1A 4HCCA 3UB5A 3CC4N 4JNEA 4YOVA 4IG3A 1TAUA 4HWIA 2FBYA 3VTHA 5F1XA 2VQEK 1TUUA 3F9MA 4JK8A 3H3OB 1RBSA 3J7AP 1RDWX 4DTUA 2B4JA 2V7ZA 5CHIA 3AVBA 4B1ZA 2HVIA 3W3DA 3WEEB 1HR0K 3QEIA 5JLHA 3J80O 3LP1A 3PIOL 4LC9B 1C0FA 1JXEA 4B3TK 2FBTA 1ASUA 3RMAA 3MXMA 3K5MA 5BN9A 2OZSA 1J53A 2HVHA 4BC2A 4H4MA 1S6QA 3CC2N 2D4WA 1C0GA 4F3OA 2HOEA 2GEMA 3CFPA 3LDSA 3RR8A 3LWMA 4CHQA 1WLJA 1N33K 5D3GA 1VHXA 4FLWA 1J6ZA 5EVZA 2H3GX 1J54A 1NG9A 1DEJA 1QZ6A 4EZ9A 3OYAA 1CLQA 4DF4A 3HPHA 2E2NA 1IKXA 3O9UA 3O9RA 2AA4A 3AO2A 4HUFA 1XI1A 3HOTA 3LM2A 3OBYA 3PX6A 3I56N 5AQGA 3EYZA 3HXMA 4CBWA 4CW7B 3CIPA 3H46O 4H5NA 4RW9A 4BRHA 3N4PA 3OBWA 3PO5A 1GLDG 4DSKA 2AP1A 5AQIA 4A2AA 1JLQA 4FSVA 3O6WA 4DV4K 3FR0A 4DR4K 5FROA 4H5RA 3ZT4A 4AILC 1NK9A 4YY3K 2NRTA 1RBRA 3EKUA 5BRHA 1LWCA 3HSCA 1RNHA 1TVRA 4OKEA 3AO3A 1RT1A 5LL6Z 4W5QA 1NGAA 1U4BA 4JI8K 1L3SA 4Y1DA 1D8YA 5BPLA 1ZXOA 1ASWA 3TAGA 3R1XA 1C6VA 1R0AA 1ASVA 4JKHA 1TL3A 3NAEA 2Y1JA 4HCBA 4QS9A 3QNNA 4CJ7A 1OVYA 1Q9XA 4OO1J 4ZTJA 3OYFA 3SCXA 4KKOA 3Q7BA 3VA0A 3DOKA 3SMSA 1SL0A 4FK4A 2NNWA 2F8SA 3HOSA 3ZEUA 2PAVA 4BR9A 4FJGA 3QLHA 5AZIA 4CJUA 1NNEA 5GAEP 1BDGA 1QS4A 4O8KA 1LW2A 2E1YA 3QB0A 2VG6A 1D4XA 5C2FA 1YF5L 3IS9A 4ILJA 3WNGA 3AVHA 2O8CB 1CZBA 3KHYA 3CQ8A 4PKHA 3S41A 3AO5A 3GOIA 4CD3A 3O1BA 4CEOA 4F2RA 1Z05A 2I7PA 3UE5A 5I3UA 4J2EA 3V9XA 3RVCA 4EZ6A 4CFDA 2J4RA 3E01A 3UIQA 2HW3A 2G8KA 4ISGA 1TAQA 5AQJA 4DQIA 5FPDA 1LOTB 1TKTA 4E19A 1NJXA 4J2BA 3K59A 3PSFA 4FZXC 1SZ2A 1ZBSA 1C1CA 2DPNA 3M5RA 5DM6L 4U7BA 1NKBA 4IKFA 1HRHA 3VGLA 3TABA 2DFHA 1GLJO 5AR0A 4KHWA 4JKGA 2F9TA 3OYJA 1CXQA 5E84A 2UXCK 1U2VA 4MO4A 2FF6A 3LPUA 2WUSA 5B8HA 4HTUA 2HHXA 1KAZA 1T7PA 3L2VA 4JKFA 3OVNA 1HYZA 2GWJA 1KRPA 4N47A 1Q8IA 2GUIA 4BGBA 2VG7A 4E7LA 1KTQA 2F9WA 1LAVA 4CD1A 5HOOA 4GKJK 4NYFA 4DB3A 5HRSA 1W2BM 4GV9A 1ZBHA 1WSEA 1O13A 1HJRA 3L3VA 4CEQA 4LH4A 4CK1A 3VQEA 3G0ZA 4Q5VA 1S9GA 4LF8K 1ZBLA 1EO1A 4M3RA 4KO0A 4FPBA 4FO0A 3SQ4A 3JAMO 2OPPA 5ADXA 2YHXA 3HK2A 1VQLN 3KK3A 2E2QA 1IKVA 2OPRA 3EZ5A 1G15A 3MEGA 4RCHA 1VAZA 1ZBFA 4FWLA 4RG8A 1T8EA 5LJVA 3GL1A 3NF7A 2YJFA 4BG9A 3ZT3A 2KHOA 4BDYA 1YJNN 1N8RO 2QM1A 4FM1A 3THXB 4LF6K 2Q1NA 4CF2A 2WOMA 1YITN 4GV6A 3BF1A 2FSJA 1VSIA 1TKDA 4B9TA 3ZT1A 3KLIA 2HB5A 3ZSYA 2GWKA 2VG5A 3LP2A 3NBPA 4IJNA 3ITHA 4N56A 2ZM6K 2HHUA 4ILHA 4WQ4C 1BISA 4ELVA 2HMIA 1GLEG 3A5NC 4IEEA 5AQHA 3ZX2A 4BRGA 4CJ3A 3KKSA 2QW9A 4M3XA 3CI5A 3MXJA 1U49A 3CERA 3ULEA 3D2EB 3LP3A 4R79A 3G25A 4U67L 3CCRN 1KVBA 2Z1GA 3S3OA 5M1FA 3NDKA 1IKYA 2HHVA 1XC9A 1NOYA 1ZBUA 2QEXN 3LZJA 5AQQA 5LMNK 4OKKA 3WNEA 2DTUA 4BR0A 3SUNA 2QTDA 2FBVA 1KXPA 3KVGA 1JLFA 3K5OA 3LDLA 4DFMA 3DLHA 5AJ3K 5AQYA 4NLCA 4O5BA 3ZEUB 3AAQA 3ZSVA 4CK3A 3T1HK 3RSEB 4DG1A 1MWKA 3CG7A 3ZSRA 4DV1K 1T3VA 3VGMA 4WYBA 5J2NA 1RBUA 4B9SA 3AAPA 3OTOK 4KH4A 1TKXA 2XY8A 3L4IA 1Q82O 3C0BA 1WSFA 3V81A 2Z1HA 4CEBA 1UWBA 3C94A 1LCUA 2WONA 4QOZB 5CR4A 1BIUA 1IBLK 2O4GA 3G71N 1T05A 4I6MB 3OYBA 4CHNA 4QAGA 1YI2N 1YVUA 3OW2M 3HPGA 4PA1A 3VQ4A 3ZSOA 3WUHA 1F21A 5J2QA 3ID8A 4JKGB 4Z4HA 3DM2A 1GOAA 1EWRA 2X78A 2IVOA 4AQYK 4FJJA 1U2VB 4CJEA 3KD5E 3QBWA 3EE9A 2X74A 4OLAA 1S5JA 4WQ5A 4BRLA 3KLFA 1LW0A 1E3MA 3O9QA 2G8FA 3CETA 4YOWA 2YHWA 4B8CA 1P8ZA 2A5XA 2QWLA 2CGJA 1K73O 4BR4A 2G8HA 2QWPA 2YHBA 5F2RA 1VQPN 4YOUA 1U04A 3WEEA 2P9LB 3VEOA 1IV0A 3EL2A 3QIOA 1QQNA 3VQ7A 3V9SA 3BUZB 1RT6A 2IVNA 3HSTB 4FLYA 4LF9K 4BR5A 3L8BA 5GIOA 3B6OA 1VQKN 2V51B 1A5XA 1Y97A 4FL9A 3AGRA 2G8VA 5LY3A 4CI6A 3CYMA 1NJYA 3VQBA 4IDHA 1QHAA 4AH9A 3K57A 5H1SQ 5IT9O 1X1PA 3DRSA 2Y1IA 3OYLA 2D0OA 4FWSA 4DQRA 3V6DA 3K5NA 1SKWA 3MK6A 1HYSA 3CFOA 2EX3A 4BC5A 4BRFA 4CIGA 3NH2A 2XHBA 2ASMA 4FM2A 1GLLO 2BDPA 1D5AA 3VTIA 4W5NA 1NGDA 3SNNA 3SK3A 3SUOA 2P9KA 4HVJA 1T6DA 4Q0BA 1NOZA 3O4NA 1XHXA 4M3UA 4LFCK 4WF9L 4PL7A 3AVLA 3LDPA 4ILGB 1EQYA 3TSPA 4I9LA 3QEVA 3D2FA 3OS2A 1NGJA 4RW7A 4LFAK 1TV6A 3O9TA 1OVQA 4BROA 3T19A 4UQGA 4OLBA 4BRNA 3H45C 4DLGA 1KQSM 4ZTFA 3TTCA 4CEEA 4E0DA 1WOQA 3AVJA 3EN9A 4CZIA 4H03B 2WC9A 1W7AA 4B1XB 3N4QA 4C1NK 2E20A 3QICA 2P9UB 2D0CA 3V1OA 4CESA 4DF8A 2KW4A 2KQ2A 5C2DA 3PUFA 2FLOA 5AQNA 3BDPA 3R8EA 3KLEA 3J8AA 4CGHA 3QDKA 3C65A 4QS8A 3AVIA 3HTVA 2ZGYA 1VQ7N 3PX0A 4AHCA 1NJZA 1IJJA 1OH7A 1C0UA 2W42A 3ENHA 2FXUA 1NK8A 1IG8A 1K8KB 2O8CA 3O8MA 2O4IA 1S3XA 1SKRA 3NMUA 1JCEA 2B5JA 3EEQA 2QWOA 3ZT0A 4DR1K 2E6MA 3A5OC 3RTVA 3OYHA 3ULDA 2V7YA 4JS4A 1ILYA 1VQ8N 3BGRA 1ZYQA 3DXKB 1YJ9N 2WFBA 2UXBK 2PZSA 1VSFA 4RW4A 3U6FA 2P5OA 2KTQA 3UKUA 4ID1A 1GLAG 1WN7A 3L2UA 3V9ZA 4CK2A 4WFNL 4DR6K 2VGMA 3A2FA 5HBMA 1E4GT 1BCMA 4AHTA 4IDKA 1RT4A 4X66K 4WCEL 4CJVA 2ZGZA 1VRUA 4H8KA 4M7XA 2VYPA 2EWSA 2W6LA 3TTFA 4M3YA 3LPTA 3OYIA 4EAHD 1HLUA 3V1RA 4BRDA 2RKIA 5IWAK 1QSSA 2VWKA 4YOYA 1S1UA 2VWBA 1W9HA 3I8DA 5MLCQ 3SJJA 3RRHA 2E5LK 4ZHRA 2R7YA 5AQSA 4O0JA 4BRMA 3THYB 3VEWA 4KH6A 3E9PA 1EX4A 5LMUK 5JICA 3PY8A 3L3UA 3T69A 3VEVA 4KI4A 1EP4A 2D0PA 1J5OA 4DV6K 4Z4CA 5M1OA 4F2SA 3NFAA 1JLGA 3MX5A 4Y1CA 3ENBA 1EKEA 3T1YK 1J9AA 2RN2A 2OZMA 3FZMA 1JXBA 4YDUA 1S6PA 2HF4A 3DYAA 3NGYA 2HHTA 3ZX0A 2PBDA 4FK0A 5BPNA 1O1WA 4I2QA 4CHZA 3D0PA 1SV5A 2WBNA 5M1NA 3QEWA 4M3ZA 3THXA 3EO3A 5HRRA 2P9KB 1Z25A 2IAJA 2HHQA 5AQWA 4DV0K 3FZFA 4KHUA 2O8EB 3MCPA 4NCGA 2JWKA 4L8RB 1XMOK 4KHPK 3D2FB 4IWVA 2NRXA 3OS1A 1FKOA 4DV7K 3TPQA 2RPIA 2PFUA 1G99A 3J7ZO 3A8YA 2G8WA 3VN5A 4A59A 2XO7A 4FJ7A 2GX9A 4YORA 4KBOA 2VGNA 4H0PA 3HO1A 4KHQA 3THWB 1KLMA 2A42A 3QMLA 4LSNA 3CJ9A 3KD1E 3D2EA 4B8AB 4JYAK 1MDUB 5AZJB 4DTNA 4FXDA 4DU4A 2PYJA 1NGIA 1RTIA 2GUPA 4CZHA 4JI6K 4G9ZA 3QBXA 4BVPA 4JRPA 1IBKK 4PWDA 1HPZA 3LDNA 4CHOA 1BA1A 4DR7K 2QXLA 3D7EO 1VSEA 1FKPA 3DWLA 4B1UB 4CJKA 4H4OA 2IDOA 4JK9A 3T7ZA 4YNQA 3SZ2A 3WXMB 1KD1O 3G6EN 1VQNN 1FXXA 3VEZA 1RTJA 3RSEA 3JXUA 5HROA 5KPRA 5C10A 4PY5A 4KB1A 1K9MO 5FPEA 4B9MA 1NKCA 3KZBA 3OYGA 3SPZA 4GW6A 3BZCA 5BR9A 3C6AA 2QKKA 2PY5A 3SQ0A 1KFSA 4BC4A 5E41A 1LWFA 2ASOA 4DQSA 4BRKA 4I9QA 3KIOA 5CYMA 3SI6A 5K14A 4FWMA 3UKUB 4I6MA 2OTLN 1VK0A 3I33A 2LSNA 4DQ8A 4JN4A 1Q18A 2BGGA 4M7YA 2P1JA 2P9PB 1RTHA 3K9KA 1REVA 3KLGA 3LM9A 4FCYA 3QERA 2NRWA 1N34K 3MWTA 3PO4A 3KJVA 4IOXA 1HQEA 4CZJA 3KLHA 3CMEN 3P1GA 3OY9A 5EOYA 3AVGA 3VQ5A 2JWLA 2F4VK 1Z26A 2P9LA 1NK0A 3SAGA 4FLVA 5GINA 3E9LA 1KAXA 4DS4A 3UKRB 3AARA 3AVKA 1N6QA 2DY4A 2IC3A 4AHVA 3K5LA 3RR7A 4FK2A 4O44A 4PUOA 3P83D 4IOAL 5M1PA 1X3MA 1EXQA 2ZJRL 1IH7A 4FYDA 4OKJA 4KH5A 4KAZA 2HHHK 4IFVA 3C6UA 4XH5A 4CZKA 3WNHA 4KB0A 4CBXA 4GMJB 2IS3A 1BCOA 4GVEA 2UUBK 4BRIA 3K2PA 5SZTA 1EETA 2GTDA 4JKAA 1JKHA 3K0SA 3CXCM 4NB4A 2O8BA 4OGCA 1RDDA 4M3WA 3F2KA 2FC0A 2YKMA 2HNYA 3I0RA 1TK5A 3BEXA 1BGXT 5J2MA 3C6TA 3FFIA 3QFPA 2P9IA 3L0QA 2Q36A 4OX9K 5CYQA 4IFEA 3CC7N 1VSKA 3SBTA 3H6EA 1TYQB 2OA8A 3O80A 1BWFO 4KPYA 1LV5A 3VQPA 5BREA 1HNZK 2F8TA 2UUCK 4E7HA 1BA0A 4DTXA 3QESA 1K8AO 3TTDA 4CZGA 4DWIA 4DUZK 1HMVA 4LY7A 4H5TA 3MEDA 3L2QA 4BY9C 1OH8A 2ZF5O 4W5TA 3PV8A 4ELTA 4B1YB 1RDBA 2BH1A 4BR2A 2A1RA 4NCBA 2WTUA 2PYLA 4LD0A 1C1BA 3CCVN 3RMCA 2Q3SA 2P9UA 1OH6A 5CY4A 3ZT2A 4AF1A 5FPMA 2I7NA 1WNSA 1KFDA 4N76A 3KK2A 4WFAL 4BE1A 4H5WA 5AQXA 4MQ3A 2KZMA 2E2PA 1GLBG 3AO4A 5AQRA 1C1AA 5C24A 3U4LA 1SQKA 3AGKA 1SL1A 5F0XA 3AA2A 2DFEA 1T44A 2OANA 5HP1A 3NF6A 4FWRA 1K8KA 3NGIA 4CJLA 4WFBL 3TAFA 4C8KA 3QIPA 3ALYA 3S3NA 3OHRA 4DSFA 1WSHA 1UAXA 3IRXA 3WXKA 3CFRA 3HPOA 4CF0A 4FLXA 1T6CA 2D0BA 4YOTA 1TK8A 3DXKA 3SAFA 3FZKA 4CEFA 3KTQA 2KZZA 4ISEA 1QVGM 1U6ZA 4RTFD 1S9EA 4NO7A 3OYMA 4JAXA 2G8IA 3SUPA 1XWLA 4CJSA 1Q81O 5EY4A 4BRQA 1BHLA 3C95A 3IKMA 3L2RA 4FOEA 2GBZA 1HPMA 4B1VA 1DT9A 2QWNA 3U9ZA 1VSMA 4C23A 4RW6A 2NZTA 4JS5A 2D5RA 3O9SA 3MN9A 3DOLA 4TSXA 4LF7K 2P5GA 5GIPA 5JVGL 4WQ4A 4CZLA 3K58A 4H0OA 4H0XB 1M1KO 1NK6A 4DTRA 1UOCA 3T1AA 4MDBA 5C42A 4UY8O 1HNIA 5E26A 1VQ5N 3HYFA 1BL3A 2NRHA 3THYA 1KLNA 3DLBA 4KTWA 4CJ5A 3HL8A 3WXLA 3O4WA 3KKRA 3MEEA 1SL2A 3BY5A 2FSKA 4K25A 3L2WA 4Z4FA 2XY6A 2ZD1A 1R59O 2HNZA 2YJEA 4XH4A 4CCHA 4CJTA 3CJAA 4EP4A 2O8BB 1Q9YA 4FZYA 3MDQA 4CFAA 3E66A 1B9FA 1W97L 2EHGA 4NCAA 4JI0K 2O8FB 3P39A 4JKCA 5BPMA 4DTJA 1TL1A 3AV9A 1N32K 3LANA 2P9IB 2V52B 4J2DA 1D9DA 3HRGA 4CF1A 3OA9A 1RDCA 1Q7YO 2G8UA 3GE1A 2QKBA 2O8EA 2ASPA 3VQ9A 2QWRA 3CQYA 1U45A 1QHTA 3MX2A 3C7NB 3CJBA 3F5TA 4JHDB 4FW2A 1RBVA 3SBGA 3AVMA 5C25A 1NMDA 5I42A 4K42A 1X3NA 2HHSA 4JI4K 4DR2K 3DAWA 5JVHL 3ZLJA 4KV8A 4BDPA 2ITGA 3THWA 1VRTA 2A40A 4JKBA 4B3OA 1L3TA 3O1WA 4CECA 1RFQA 1RTDA 1HKBA 4PKIA 3CD6N 5GAGP 3FLCO 2E88A 2HBJA 4JLHA 3H08A 1HUXA 2OPQA 5AZJA 1J5EK 2IIRA 5J2PA 1HNWK 3LDOA 1Y64A 3M3ZA 1JJ2M 1QQCA 4B3RK 1U48A 5KGXA 3I8BA 3ID6A 1JLBA 1CZ9A 4ELUA 4CIEA 4CZEA 5DM7L 2BE2A 4B1WB 1XMQK 5AQPA 3NH1A 1GLCG 2CH5A 4F9OA 4O8UA 3D45A 1QVFM 3IFRA 4FWQA 2CGLA 3CCEN 5AQZA 3IAYA 3OJUA 5C12A 1C0TA 4C8MA 2BUPA 5DMRA 4ICLA 4A2BA 2FBXA 3QETA 4FPAA 1JLAA 3AA5X 5KQ8A 3E1YA 3PIPL 1TKZA 4M42A 2JGUA 4GKKK 1FW6A 3M6GA 3DLEA 3OJSA 1QQOA 4PL8A 4E3SA 3A5MC 3RWUA 3GBTA 4FJNA 1B92A 4CFCA 4CEAA 1HNVA 4E1NA 5JS2A 4DSIA 1S1TA 4IG0A 3HJFA 2XY5A 1XUPO 4AM7A 4AM6A 4EIAA 1RCHA 1LWEA 4KHSA 1IKWA 3KK1A 4DQPA 4H0TB 3R9PA 4NYNA 2XY7A 1N36K 2HSTA 3H1VX 3I0SA 3CM5A 4IZ9A 4EHUA 4YHHK 5TKYA 4FWOA 1BUPA 1NLVA 3MWPA 4BACA 2UXDK 4O4GA 3TAPA 4HTLA 3EKSA 3TAMA 2P9NB 1V4TA 4W5OA 4JD2B 1JLEA 3DXMA 1NWKA 1VSDA 3VGKA 4LF4K 1S1WA 2P9PA 1X9MA 1DLOA 4JRQA 1N5YA 2NUBA 4EP5A 3TARA 1XNRK 4KHNA 1YTAA 4FWPA 4HUEA 1RGIA 4GY2B 3SQ2A 5M1KA 4G1QA 1KSPA 4FJXA 4CGIA 4CF8A 2Q2RA 5FLXO 4OPJA 3ZSWA 1L3UA 3SV3A 5FDLA 3VQQA 3FZHA 4FLZA 4PQUA 3ZETB 4CJRA 4DFJA 4O55A 4BGAA 4DV5K 4CHPA 4FLTA 5KGWA 4DTSA 1NJIO 4FOIA 5HLFA 3CF5L 3UKRA 3WQTA 4IBNA 3IMXA 4M63C 3G4SN 4CVNE 1VSHA 4Z94A 3MN6A 5FRNA 3CPEA 3LP0A 2VCPA 2QK9A 4BC3A 5KPTA 1WUAA 2YX6A 3MAQA 5T7BA 3BZKA 1T03A 4M3TA 3PX4A 3A0IX 4FVUA 4FVMA 3EZWA 3LL3A 4OVLA 4EHTA 1YTUA 2GELA 4E89A 4EFHA 4O5FA 1U47A 4BQLA 3TI0A 5BR8K 4DSLA 4GVMA 4BRPA 1ITGA 2YNFA 4LH5A 5AFUH 2A6AA 4KTZA 3QEPA 4FZZA 4HUGA 3VQ8A 3ZYYX 2KFZA 1V4SA 4CBUA 3VQ6A 3ZSZA 2NRZA 5AQVA 1L5UA 4GV3A 4DMNA 3SV4A 3VF6A 4K41A 1S22A 3DI6A 1IBMK 2OPSA 4C8OA 3AVNA 2YCHA 1IO2A 4CIFA 5BN8A 4KFBA 1XQSC 5CZ2A 2HNDA 1QTMA 1RT5A 3ENOA 4K0KK 1I3AA 1TYQA 1WBDA 3TAEA 4IO8A 4Z0UA 3J81O 4E1JA 2ETJA 1NK5A 3PLAA 2IGIA 4MDAA 4C8LA 3EE8A 3ISNC 3HZ6A 2OTJN 3BF3A 5C0YA 4N41A 3VETA 3NH0A 2Z1IA 4DFKA 2YHAA 3QNOA 5AFUA 1VQMN 4M41A 4X64K 1GLFO 2KKZA 2ATQA 5TKWA 4CJFA 4OJRA 3ZX3A 4BWJA 4BREA 1X9WA 3OS0A 3FE1A 3O3FA 1B9DA 2BTFA 3GDQA 4H5VA 4LFBK 3VF4A 1BI4B 1KCFA 4JKEA 4BE2A 3NCIA 1RDAA 1VSJA 4CGGA 3FGUA 3VERA 1YXQA 4KREA 3B6PA 5GAHP 5HL7L 1UA1A 1GOCA 2YHYA 1NKEA 4DV3K 3ZSXA 2OCEA 3ATUA 4DUYK 4DR5K 2A3ZA 4BWMA 4DLEA 3A5LC 1JCFA 3EY1A 3CPWM 2Z1JA 2QXFA 1WB9A 4HHTA 4IEIA 4CEZA 3CQXA 1SKSA 3DXMB 3DLKA 3HVRA 4E7KA 4Z4GA 1C0MA 3HBTA 4X65K 4BDZA 5GADP 1NK4A 1VQ9N 1JL1A 2IOCA 1HX1A 3CJ7A 4DU3A 1VQON 3VENA 3U3GA 5HRPA 5JS1A 1NGGA 4AHRA 3LAKA 2E1ZA 2UUAK 1RT3A 2UYTA 1I39A 5BRFA 3AA4A 3VA3A 5ADXH 3HP6A 2O8DA 3QO9A 1MWMA 2W40A 3U8XA 2OYQA 3ZSQA 3THVA 4F3TA 1RDUA 2YI1A 1RILA 4B9LA 5FRMA 4A5BA 1ATNA 4PKGA 3H1QA 2E8AA 4LSLA 2VQFK 4B9NA 2P51A 1ESVA 4K8XA 5DK5A 3HI0A 3QINA 3RMBA 4JI3K 4JI7K 4FJ5A 1A5VA 3P4IA 1MA9B 4V19S 4Z4IA 4ID5A 4DSJA 3O3HA 1ZBIA 1RT7A 2E4LA 5AQLA 3NF8A 3NE6A 4KRFA 3VESA 4A5AA 3O4QA 5SWMA 1WSGA 3CCMN 1X9JA 3L6QA 1QZ5A 3CMAN 1NBWA 5EX5A 3VF2A 4FWNA 4DSEA 1TGOA 4BQZA 1SS6A 2O8FA 5M1QA 1QQMA 3F73A 3W0LA 2IVPA 1RBTA 4IO9L 3TAQA 4CZFA 3LALA 1QSYA 4CERA 1L3VA 4JI5K 3IG1A 3MN7A 3C6HA 3M1FA 3TSQA 3DMJA 4DU1A 3ASMA 4WQ5C 3VQDA 3LWLA 4NLBA 1DTQA 3TU5A 2RHKA 4CGJA 5JMVA 5HRNA 1YJWN 2ZQBA 1K6YA 4FJKA 3VPZA 3C7NA 4DS5A 5A2QO 4JHDA 3NVMA 4E1MA 3VMFB 1I94K 1BO5O 2YNHA 1HNXK 4MLHA 4L3QA 2CGKA 3K9JA 5JLFA 3MN5A 4KI6A 4KHYA 3CHWA 3KK7A 4AHUA 1HQUA 2YNIA 1DKGD 3DRRA 1VQ4N 2HMPA 1XNQK 3SMPA 4IJAA 5CE3A 3CCQN 2ZJQL 3TANA 5KQDA 1JCGA 1NGEA 2HBMA 1BQNA 4IOCL 1GOBA 3U9DA 3R3LA 4IFYA 1CZAN 4I7FA 1HKGA 4QCLA 2X6SA 2I5JA 4DTOA 4LF5K 3KWGA 4DTMA 1YVNA 5AZIB 2GV9A 4JI1K 1YT3A 2HBKA 3TR8A 4CHYA 3O08A 3M8QA 3CCUN 4FLUA 4DQQA 4B9QA 4J8FA 2P9SA 4MFBA 2W41A 4CFBA 4OPKA 3WNFA 4DHYA 2A1SA 4F8RA 3OYEA 4N5SA 2CH6A 3TSUA 4CEDA 3NVKA 2Q0UA 1OKJA 2AJQA 1A5WA 1HJOA 5KI6A 1NGFA 3WQUA 4Y0WA 3RRGA 4KTQA 4E7JA 3RMDA 1M90O 2P9NA 4JK7A 3WXJA 1TK0A 4A62A 4JD2A 3VEXA 5LJWA 1WSJA 4C1NI 5C15A 1NGHA 4CJQA 2BANA 4K8ZA 3MECA 1P90A 1YAGA 3IUCA 2D1KA 4YOXA 1NU0A 2E6LA 4IXCA 4JV5K 2O8DB 3L4QA 2HHWA 1IG9A 1DTTA 2X6NA 1Z6RA 4B3SK 3P38A 1D9FA 4RWTA 4DTPA 1JLCA 4FWKA 2D0AA 3JS6A 3S9HA 2KFNA 1ATRA 1Q86O 1NGCA 3SAHA 2F7TA 2HF3A 4DKWA 5KTQA 3OYDA 2YNGA 4BG8A 4DR3K 4BRCA 3SQ1A 4CJWA 4CGFA 3AY9A 3O3GA 3P31A 3F9KA 3ZCMA 2RF2A 4OPHA 3CM6A 3Q7CA 2ZWHA 1ATSA 3ZETA 1YHQN 2YKNA 3KWIA 3AA3A 2B6AA 3P5JA 4M45A 1KC8O 5KPZA 4B9VA 5J1EA 3WT0A 1NGBA 5AQUA 1LAWA 1NMNA 4CGDA 2ITMA 4ISFA 1NJWA 1OH5A 3VQAA 4JKDA 5AQOA 3HP9A 4A61A 3T3FA 4NXNK 3GG4A 3E9OA 3G10A 4O0IA 5AQFA 3CCLN 1XC3A 3BP8A 1WSIA 1FJGK 3D6RA 3NHGA 5KRTA 4H0VB 4DV2K 4BVOA 4X62K 1MU2A 1DGKN 3VQCA 4BRAA 3J7YP 1WAFA 1SAZA 2XRIA 3VOVA 4YFUA 3SLCA 1BIZA 4CZMA 3QFUA 1BU6O 3PSIA 4QS7A 1S1XA 2NLXA 1UA0A 3HT3A 4JI2K 5I9EB
chains in the Genus database with same CATH topology
3NGZA 4PQUA 3WNEA 4W5RA 4I9QA 2DTUA 3KIOA 3V9WA 4Z4EA 5CYMA 1RT2A 1QSLA 4FJLA 4CJRA 4DFJA 3SI6A 1BQMA 5K14A 3SUNA 4O55A 2FBVA 4CHPA 1JLFA 3K5OA 4FM0A 3M8RA 1VK0A 4FLTA 5KGWA 4DFMA 4DTSA 3AO1A 3DLHA 1VSLA 5HLFA 2LSNA 3SUQA 1SUQA 3LAMA 4IBNA 4O5BA 3V4IA 1HYVA 2BGGA 2P1JA 3MXIA 3ZSVA 1VSHA 1JL2A 5FRNA 3LP0A 1FK9A 3U3YA 1RTHA 4CK3A 2QK9A 4DG1A 1REVA 3MAQA 3HVTA 5T7BA 3QEXA 1T03A 4M3TA 3KLGA 3CG7A 3V9UA 3ZSRA 4FVMA 3PX4A 3DLGA 4FCYA 3QERA 4AHSA 5J2NA 1RBUA 4OVLA 1X9SA 4B9SA 1YTUA 3PO4A 4E7IA 1TKXA 2XY8A 4E89A 3KJVA 1U47A 1HQEA 3TI0A 3OYKA 1WSFA 3JYTA 3V81A 2Z1HA 4CEBA 3KLHA 4DSLA 4GVMA 1ITGA 3AVCA 2YNFA 3P1GA 3OYCA 1UWBA 4LH5A 3OY9A 3JSMA 3C94A 2WONA 3AVGA 4KTZA 3QEPA 4QOZB 4FZZA 4HUGA 1QE1A 1BIUA 3AVAA 3VQ8A 4XIUA 2KFZA 3VQ5A 2O4GA 3VQ6A 3ZSZA 3S3MA 1L5UA 1Z26A 1T05A 4I2PA 4WE1A 3OYBA 4J2AA 4CHNA 4QAGA 4DMNA 3SV4A 2JLEA 3DLRA 1NK0A 3DI6A 4FLVA 1YVUA 3TWHA 4C8OA 2OPSA 4DS4A 3AVNA 3AVKA 1N6QA 2DY4A 2IC3A 3HPGA 1IO2A 4CIFA 4PA1A 4AHVA 4CE9A 3VQ4A 3HM9A 4KFBA 3ZSOA 4O44A 3K5LA 3RR7A 4FK2A 1BI4A 4PUOA 3P83D 5CZ2A 1F21A 2HNDA 4DFPA 5J2QA 1QTMA 1RT5A 3M8SA 3SPYA 4Z4HA 1EXQA 3DM2A 1GOAA 1I3AA 1IH7A 4OKJA 2X78A 3OYNA 4KAZA 4FYDA 3TAEA 1XHZA 4RW8A 4CJ4A 4FJJA 4Z0UA 4CJEA 4IFVA 3C6UA 3KD5E 4FJMA 2ETJA 3AVFA 3WNHA 4KB0A 1NK5A 2ZE2A 4GMJB 2IS3A 2IGIA 4CF9A 4C8LA 1NK7A 1BCOA 2X74A 1WAJA 4F4KA 1S5JA 4B08A 4BE0A 4FJHA 4OLAA 4FJ8A 3ISNC 3KLFA 1LW0A 3K2PA 4CJPA 5KRSA 4FW1A 1EETA 5SZTA 2G8FA 1JKHA 4B8CA 4C8NA 4N41A 3DRPA 1KVAA 1RDDA 4OGCA 3NH0A 4M3WA 2Z1IA 4DFKA 2G8HA 2YHAA 2FC0A 2YHBA 3SYZA 3QNOA 2YKMA 2HNYA 3I0RA 4M41A 1S1VA 4OGEA 2ATQA 4CJFA 1U04A 3V1QA 4OJRA 1TK5A 3M8PA 4BWJA 3QIOA 1X9WA 1BGXT 3VQ7A 2F96A 4B9UA 3NF9A 3V9SA 3OS0A 5J2MA 1RT6A 3C6TA 2YV0X 1KVCA 3FFIA 3HSTB 3O3FA 4FLYA 1CXUA 1B9DA 2VWJA 2DFFA 5CYQA 3L8BA 1BI4B 1KCFA 3B6OA 4R5PA 3NCIA 3LZIA 1RDAA 1VSKA 4BE2A 4FJIA 1VSJA 4CGGA 1A5XA 1W0HA 1Y97A 2OA8A 2G8VA 4KPYA 4FJ9A 1LV5A 3CYMA 1NJYA 3VQBA 4KREA 4AH9A 3B6PA 3VQPA 3K57A 2F8TA 1UA1A 1GOCA 5EU7A 1X1PA 3DRSA 5CZ1A 4E7HA 4DTXA 3QESA 2Y1IA 4HCCA 3OYLA 1NKEA 4DWIA 1HMVA 4LY7A 4DQRA 3V6DA 3K5NA 3ZSXA 4IG3A 3MEDA 1TAUA 4DLEA 2FBYA 4BWMA 1SKWA 3L2QA 1HYSA 3EY1A 1RBSA 3CFOA 2EX3A 4W5TA 2Z1JA 2QXFA 3PV8A 4ELTA 4HHTA 4CIGA 4DTUA 2B4JA 4CEZA 1RDBA 3AVBA 3NH2A 1SKSA 2XHBA 2HVIA 2A1RA 4NCBA 3DLKA 2PYLA 3HVRA 4FM2A 4E7KA 4Z4GA 2BDPA 1C0MA 1D5AA 3QEIA 4BDZA 4LD0A 1C1BA 4W5NA 3RMCA 3LP1A 2Q3SA 3SNNA 1NK4A 5CY4A 3ZT2A 1JL1A 1JXEA 2IOCA 2FBTA 3SUOA 1ASUA 1WNSA 3RMAA 1KFDA 4DU3A 4HVJA 3KK2A 3MXMA 3K5MA 2OZSA 4N76A 4Q0BA 1J53A 1NOZA 3O4NA 3U3GA 5HRPA 1XHXA 4BE1A 4M3UA 2HVHA 5JS1A 4H4MA 1S6QA 3AVLA 4MQ3A 2KZMA 4AHRA 3LAKA 4F3OA 3AO4A 4I9LA 1C1AA 3CFPA 3QEVA 3LDSA 5C24A 1RT3A 3RR8A 3OS2A 4RW7A 1SL1A 1I39A 3LWMA 1TV6A 3AA2A 3AA4A 3VA3A 2DFEA 4CHQA 1WLJA 3HP6A 5HP1A 5D3GA 3QO9A 4FLWA 3NF6A 3T19A 4UQGA 2OYQA 4OLBA 3TAFA 3NGIA 4CJLA 3ZSQA 4DLGA 4C8KA 3QIPA 1J54A 3ALYA 3THVA 3S3NA 4ZTFA 4F3TA 4DSFA 4EZ9A 1WSHA 3OYAA 1UAXA 3IRXA 4CEEA 4E0DA 3CFRA 4DF4A 1CLQA 3AVJA 3HPHA 1RILA 1IKXA 3HPOA 4B9LA 4CF0A 5FRMA 4LSLA 4HUFA 4B9NA 3AO2A 1XI1A 3PX6A 2P51A 2D0BA 4FLXA 1TK8A 4K8XA 5DK5A 3EYZA 3HXMA 4CEFA 2D0CA 3QINA 3KTQA 3RMBA 2KZZA 4RW9A 3V1OA 4CESA 4DF8A 2KW4A 2KQ2A 3PO5A 4FJ5A 3PUFA 1A5VA 1S9EA 4DSKA 3OYMA 2G8IA 4Z4IA 3BDPA 3SUPA 1XWLA 4CJSA 4ID5A 3KLEA 4DSJA 3O3HA 1JLQA 4CGHA 1ZBIA 2E4LA 1RT7A 1BHLA 3C95A 3L2RA 3NF8A 2GBZA 5FROA 3AVIA 3ZT4A 3NE6A 4AILC 4KRFA 1NK9A 3PX0A 4AHCA 1RBRA 1NJZA 1VSMA 3O4QA 1LWCA 4RW6A 5SWMA 1RNHA 1TVRA 4OKEA 1WSGA 3AO3A 1C0UA 4JS5A 2D5RA 1RT1A 2W42A 3DOLA 4W5QA 1NK8A 4TSXA 4DSEA 1U4BA 1TGOA 1L3SA 2P5GA 2O4IA 1SKRA 4Y1DA 1D8YA 2B5JA 3TAGA 1ASWA 3K58A 3ZT0A 1C6VA 3F73A 1R0AA 2E6MA 1ASVA 3RTVA 1RBTA 3OYHA 3ULDA 3TAQA 1TL3A 1NK6A 3NAEA 4DTRA 4JS4A 2Y1JA 4HCBA 3BGRA 3LALA 1ZYQA 1QSYA 3QNNA 1UOCA 3T1AA 4CERA 3IG1A 5C42A 1L3VA 1Q9XA 4ZTJA 3DMJA 1HNIA 4DU1A 3ASMA 3OYFA 3VQDA 3LWLA 2PZSA 1DTQA 1VSFA 4CGJA 3HYFA 4RW4A 1BL3A 5HRNA 3U6FA 3SCXA 2ZQBA 2P5OA 2KTQA 1KLNA 4ID1A 1K6YA 1WN7A 4KKOA 3L2UA 3VA0A 3V9ZA 3DLBA 4CK2A 4DS5A 4FJKA 3DOKA 1SL0A 3A2FA 4KTWA 5HBMA 4FK4A 4E1MA 1BCMA 2F8SA 4AHTA 4CJ5A 2YNHA 3HL8A 4IDKA 1RT4A 3KKRA 3MEEA 1SL2A 4CJVA 4FJGA 3QLHA 1VRUA 4H8KA 4CJUA 4KI6A 4KHYA 3L2WA 1QS4A 4Z4FA 2XY6A 1LW2A 2ZD1A 4M3YA 2HNZA 3LPTA 3OYIA 4CCHA 2VG6A 4CJTA 3IS9A 4AHUA 4EP4A 3WNGA 1HQUA 1Q9YA 4FZYA 3AVHA 2YNIA 1CZBA 4CFAA 1B9FA 3CQ8A 2EHGA 3V1RA 4NCAA 3AO5A 2RKIA 3DRRA 1QSSA 2VWKA 4CEOA 4F2RA 4DTJA 1TL1A 3AV9A 3TANA 1S1UA 5I3UA 4J2EA 1W9HA 3V9XA 3I8DA 3LANA 3SJJA 3RRHA 4ZHRA 4EZ6A 4CFDA 2R7YA 4O0JA 4J2DA 1D9DA 4CF1A 3E01A 1RDCA 3UIQA 2G8UA 2HW3A 2QKBA 1BQNA 2G8KA 3VQ9A 1U45A 1GOBA 1QHTA 1TAQA 4IFYA 4DQIA 1EX4A 4I7FA 1TKTA 1NJXA 4E19A 4QCLA 2X6SA 4FW2A 4J2BA 1RBVA 2I5JA 3K59A 4DTOA 3AVMA 3L3UA 5C25A 3PY8A 5I42A 4FZXC 1C1CA 4KI4A 4DTMA 2HHSA 1EP4A 1NKBA 4IKFA 1HRHA 4KV8A 3TABA 2DFHA 1J5OA 4BDPA 3HT3A 2GV9A 4KHWA 1YT3A 3TR8A 4CHYA 2ITGA 3M8QA 4FLUA 4Z4CA 3OYJA 1CXQA 1VRTA 3NFAA 1JLGA 4DQQA 4Y1CA 4F2SA 4B3OA 1EKEA 1L3TA 1J9AA 2RN2A 4MFBA 4CECA 2OZMA 1RTDA 3LPUA 4CFBA 4HTUA 2HHXA 4JLHA 1T7PA 3H08A 3L2VA 4OPKA 1JXBA 2OPQA 3WNFA 2A1SA 1S6PA 3OVNA 1HYZA 1KRPA 4F8RA 3DYAA 3NGYA 4N47A 3OYEA 4N5SA 5J2PA 1Q8IA 2GUIA 2HHTA 2VG7A 4E7LA 1KTQA 4CEDA 4FK0A 1O1WA 1QQCA 4I2QA 1U48A 1LAVA 4CHZA 3D0PA 1SV5A 2AJQA 1A5WA 4NYFA 3QEWA 5KGXA 5KI6A 4M3ZA 1JLBA 1CZ9A 5HRSA 4ELUA 1ZBHA 1WSEA 5HRRA 4CIEA 4E7JA 3RMDA 1Z25A 2BE2A 2IAJA 3RRGA 1HJRA 4KTQA 2HHQA 1TK0A 4KHUA 3L3VA 3NH1A 4CEQA 4LH4A 3D45A 4CK1A 4NCGA 3VQEA 3G0ZA 1WSJA 4Q5VA 3IAYA 4L8RB 1S9GA 4CJQA 3OJUA 1ZBLA 1C0TA 2BANA 4C8MA 4K8ZA 4M3RA 4ICLA 4KO0A 5DMRA 1FKOA 3OS1A 2FBXA 2RPIA 3MECA 3QETA 1JLAA 3AA5X 2G8WA 3SQ4A 3VN5A 2E6LA 1TKZA 2XO7A 2JGUA 4FJ7A 4M42A 2HHWA 3DLEA 2OPPA 3OJSA 1IG9A 3HK2A 1DTTA 4E3SA 3RWUA 3KK3A 3HO1A 2X6NA 4KHQA 1IKVA 1KLMA 2OPRA 1B92A 4CFCA 1D9FA 4CEAA 4FJNA 1HNVA 4E1NA 3EZ5A 5JS2A 4LSNA 1G15A 1S1TA 3MEGA 4IG0A 4DSIA 3KD1E 3HJFA 4DTPA 2XY5A 1JLCA 4B8AB 2D0AA 3S9HA 1RCHA 1LWEA 1ZBFA 1IKWA 3KK1A 4DQPA 4KHSA 2KFNA 2XY7A 4RG8A 4NYNA 1T8EA 4DTNA 4FXDA 3NF7A 5KTQA 3I0SA 4DU4A 2PYJA 3OYDA 2YNGA 3CM5A 1RTIA 3SQ1A 4CJWA 4CGFA 3ZT3A 3O3GA 3F9KA 3ZCMA 2RF2A 4JRPA 4PWDA 4BDYA 3CM6A 4BACA 1HPZA 4FM1A 4CHOA 2YKNA 4O4GA 3TAPA 3AA3A 2B6AA 3P5JA 4M45A 3TAMA 4CF2A 1VSEA 2WOMA 1FKPA 4W5OA 1VSIA 5J1EA 1TKDA 4B9TA 4CJKA 4B9VA 3ZT1A 1LAWA 1JLEA 2HB5A 3KLIA 2IDOA 4H4OA 3ZSYA 3LP2A 2VG5A 3NBPA 4CGDA 4N56A 1VSDA 3ITHA 4YNQA 1NJWA 3SZ2A 3VQAA 2HHUA 1S1WA 3HP9A 1X9MA 1DLOA 3T3FA 1BISA 4JRQA 1FXXA 1N5YA 4ELVA 2NUBA 1RTJA 3G10A 4O0IA 4EP5A 2HMIA 3TARA 5HROA 4KHNA 1WSIA 3NHGA 1YTAA 5KRTA 4CJ3A 4HUEA 3KKSA 1MU2A 3SQ2A 4KB1A 4G1QA 4PY5A 4M3XA 1KSPA 3MXJA 4CGIA 1U49A 3VQCA 4B9MA 4FJXA 1WAFA 4CF8A 3LP3A 1NKCA 3OYGA 2XRIA 4YFUA 3SPZA 1KVBA 2Z1GA 1BIZA 4GW6A 3S3OA 3NDKA 1IKYA 2HHVA 1XC9A 1S1XA 2QKKA 1UA0A 4OPJA 1NOYA 3SQ0A 1ZBUA 3ZSWA 1KFSA 2PY5A 5E41A 3SV3A 1L3UA 1LWFA 5FDLA 3VQQA 4DQSA 4FLZA 3LZJA 4OKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGZ A;  4PQU A;  3WNE A;  4W5R A;  4I9Q A;  2DTU A;  3KIO A;  3V9W A;  4Z4E A;  5CYM A;  1RT2 A;  1QSL A;  4FJL A;  4CJR A;  4DFJ A;  3SI6 A;  1BQM A;  5K14 A;  3SUN A;  4O55 A;  2FBV A;  4CHP A;  1JLF A;  3K5O A;  4FM0 A;  3M8R A;  1VK0 A;  4FLT A;  5KGW A;  4DFM A;  4DTS A;  3AO1 A;  3DLH A;  1VSL A;  5HLF A;  2LSN A;  3SUQ A;  1SUQ A;  3LAM A;  4IBN A;  4O5B A;  3V4I A;  1HYV A;  2BGG A;  2P1J A;  3MXI A;  3ZSV A;  1VSH A;  1JL2 A;  5FRN A;  3LP0 A;  1FK9 A;  3U3Y A;  1RTH A;  4CK3 A;  2QK9 A;  4DG1 A;  1REV A;  3MAQ A;  3HVT A;  5T7B A;  3QEX A;  1T03 A;  4M3T A;  3KLG A;  3CG7 A;  3V9U A;  3ZSR A;  4FVM A;  3PX4 A;  3DLG A;  4FCY A;  3QER A;  4AHS A;  5J2N A;  1RBU A;  4OVL A;  1X9S A;  4B9S A;  1YTU A;  3PO4 A;  4E7I A;  1TKX A;  2XY8 A;  4E89 A;  3KJV A;  1U47 A;  1HQE A;  3TI0 A;  3OYK A;  1WSF A;  3JYT A;  3V81 A;  2Z1H A;  4CEB A;  3KLH A;  4DSL A;  4GVM A;  1ITG A;  3AVC A;  2YNF A;  3P1G A;  3OYC A;  1UWB A;  4LH5 A;  3OY9 A;  3JSM A;  3C94 A;  2WON A;  3AVG A;  4KTZ A;  3QEP A;  4QOZ B;  4FZZ A;  4HUG A;  1QE1 A;  1BIU A;  3AVA A;  3VQ8 A;  4XIU A;  2KFZ A;  3VQ5 A;  2O4G A;  3VQ6 A;  3ZSZ A;  3S3M A;  1L5U A;  1Z26 A;  1T05 A;  4I2P A;  4WE1 A;  3OYB A;  4J2A A;  4CHN A;  4QAG A;  4DMN A;  3SV4 A;  2JLE A;  3DLR A;  1NK0 A;  3DI6 A;  4FLV A;  1YVU A;  3TWH A;  4C8O A;  2OPS A;  4DS4 A;  3AVN A;  3AVK A;  1N6Q A;  2DY4 A;  2IC3 A;  3HPG A;  1IO2 A;  4CIF A;  4PA1 A;  4AHV A;  4CE9 A;  3VQ4 A;  3HM9 A;  4KFB A;  3ZSO A;  4O44 A;  3K5L A;  3RR7 A;  4FK2 A;  1BI4 A;  4PUO A;  3P83 D;  5CZ2 A;  1F21 A;  2HND A;  4DFP A;  5J2Q A;  1QTM A;  1RT5 A;  3M8S A;  3SPY A;  4Z4H A;  1EXQ A;  3DM2 A;  1GOA A;  1I3A A;  1IH7 A;  4OKJ A;  2X78 A;  3OYN A;  4KAZ A;  4FYD A;  3TAE A;  1XHZ A;  4RW8 A;  4CJ4 A;  4FJJ A;  4Z0U A;  4CJE A;  4IFV A;  3C6U A;  3KD5 E;  4FJM A;  2ETJ A;  3AVF A;  3WNH A;  4KB0 A;  1NK5 A;  2ZE2 A;  4GMJ B;  2IS3 A;  2IGI A;  4CF9 A;  4C8L A;  1NK7 A;  1BCO A;  2X74 A;  1WAJ A;  4F4K A;  1S5J A;  4B08 A;  4BE0 A;  4FJH A;  4OLA A;  4FJ8 A;  3ISN C;  3KLF A;  1LW0 A;  3K2P A;  4CJP A;  5KRS A;  4FW1 A;  1EET A;  5SZT A;  2G8F A;  1JKH A;  4B8C A;  4C8N A;  4N41 A;  3DRP A;  1KVA A;  1RDD A;  4OGC A;  3NH0 A;  4M3W A;  2Z1I A;  4DFK A;  2G8H A;  2YHA A;  2FC0 A;  2YHB A;  3SYZ A;  3QNO A;  2YKM A;  2HNY A;  3I0R A;  4M41 A;  1S1V A;  4OGE A;  2ATQ A;  4CJF A;  1U04 A;  3V1Q A;  4OJR A;  1TK5 A;  3M8P A;  4BWJ A;  3QIO A;  1X9W A;  1BGX T;  3VQ7 A;  2F96 A;  4B9U A;  3NF9 A;  3V9S A;  3OS0 A;  5J2M A;  1RT6 A;  3C6T A;  2YV0 X;  1KVC A;  3FFI A;  3HST B;  3O3F A;  4FLY A;  1CXU A;  1B9D A;  2VWJ A;  2DFF A;  5CYQ A;  3L8B A;  1BI4 B;  1KCF A;  3B6O A;  4R5P A;  3NCI A;  3LZI A;  1RDA A;  1VSK A;  4BE2 A;  4FJI A;  1VSJ A;  4CGG A;  1A5X A;  1W0H A;  1Y97 A;  2OA8 A;  2G8V A;  4KPY A;  4FJ9 A;  1LV5 A;  3CYM A;  1NJY A;  3VQB A;  4KRE A;  4AH9 A;  3B6P A;  3VQP A;  3K57 A;  2F8T A;  1UA1 A;  1GOC A;  5EU7 A;  1X1P A;  3DRS A;  5CZ1 A;  4E7H A;  4DTX A;  3QES A;  2Y1I A;  4HCC A;  3OYL A;  1NKE A;  4DWI A;  1HMV A;  4LY7 A;  4DQR A;  3V6D A;  3K5N A;  3ZSX A;  4IG3 A;  3MED A;  1TAU A;  4DLE A;  2FBY A;  4BWM A;  1SKW A;  3L2Q A;  1HYS A;  3EY1 A;  1RBS A;  3CFO A;  2EX3 A;  4W5T A;  2Z1J A;  2QXF A;  3PV8 A;  4ELT A;  4HHT A;  4CIG A;  4DTU A;  2B4J A;  4CEZ A;  1RDB A;  3AVB A;  3NH2 A;  1SKS A;  2XHB A;  2HVI A;  2A1R A;  4NCB A;  3DLK A;  2PYL A;  3HVR A;  4FM2 A;  4E7K A;  4Z4G A;  2BDP A;  1C0M A;  1D5A A;  3QEI A;  4BDZ A;  4LD0 A;  1C1B A;  4W5N A;  3RMC A;  3LP1 A;  2Q3S A;  3SNN A;  1NK4 A;  5CY4 A;  3ZT2 A;  1JL1 A;  1JXE A;  2IOC A;  2FBT A;  3SUO A;  1ASU A;  1WNS A;  3RMA A;  1KFD A;  4DU3 A;  4HVJ A;  3KK2 A;  3MXM A;  3K5M A;  2OZS A;  4N76 A;  4Q0B A;  1J53 A;  1NOZ A;  3O4N A;  3U3G A;  5HRP A;  1XHX A;  4BE1 A;  4M3U A;  2HVH A;  5JS1 A;  4H4M A;  1S6Q A;  3AVL A;  4MQ3 A;  2KZM A;  4AHR A;  3LAK A;  4F3O A;  3AO4 A;  4I9L A;  1C1A A;  3CFP A;  3QEV A;  3LDS A;  5C24 A;  1RT3 A;  3RR8 A;  3OS2 A;  4RW7 A;  1SL1 A;  1I39 A;  3LWM A;  1TV6 A;  3AA2 A;  3AA4 A;  3VA3 A;  2DFE A;  4CHQ A;  1WLJ A;  3HP6 A;  5HP1 A;  5D3G A;  3QO9 A;  4FLW A;  3NF6 A;  3T19 A;  4UQG A;  2OYQ A;  4OLB A;  3TAF A;  3NGI A;  4CJL A;  3ZSQ A;  4DLG A;  4C8K A;  3QIP A;  1J54 A;  3ALY A;  3THV A;  3S3N A;  4ZTF A;  4F3T A;  4DSF A;  4EZ9 A;  1WSH A;  3OYA A;  1UAX A;  3IRX A;  4CEE A;  4E0D A;  3CFR A;  4DF4 A;  1CLQ A;  3AVJ A;  3HPH A;  1RIL A;  1IKX A;  3HPO A;  4B9L A;  4CF0 A;  5FRM A;  4LSL A;  4HUF A;  4B9N A;  3AO2 A;  1XI1 A;  3PX6 A;  2P51 A;  2D0B A;  4FLX A;  1TK8 A;  4K8X A;  5DK5 A;  3EYZ A;  3HXM A;  4CEF A;  2D0C A;  3QIN A;  3KTQ A;  3RMB A;  2KZZ A;  4RW9 A;  3V1O A;  4CES A;  4DF8 A;  2KW4 A;  2KQ2 A;  3PO5 A;  4FJ5 A;  3PUF A;  1A5V A;  1S9E A;  4DSK A;  3OYM A;  2G8I A;  4Z4I A;  3BDP A;  3SUP A;  1XWL A;  4CJS A;  4ID5 A;  3KLE A;  4DSJ A;  3O3H A;  1JLQ A;  4CGH A;  1ZBI A;  2E4L A;  1RT7 A;  1BHL A;  3C95 A;  3L2R A;  3NF8 A;  2GBZ A;  5FRO A;  3AVI A;  3ZT4 A;  3NE6 A;  4AIL C;  4KRF A;  1NK9 A;  3PX0 A;  4AHC A;  1RBR A;  1NJZ A;  1VSM A;  3O4Q A;  1LWC A;  4RW6 A;  5SWM A;  1RNH A;  1TVR A;  4OKE A;  1WSG A;  3AO3 A;  1C0U A;  4JS5 A;  2D5R A;  1RT1 A;  2W42 A;  3DOL A;  4W5Q A;  1NK8 A;  4TSX A;  4DSE A;  1U4B A;  1TGO A;  1L3S A;  2P5G A;  2O4I A;  1SKR A;  4Y1D A;  1D8Y A;  2B5J A;  3TAG A;  1ASW A;  3K58 A;  3ZT0 A;  1C6V A;  3F73 A;  1R0A A;  2E6M A;  1ASV A;  3RTV A;  1RBT A;  3OYH A;  3ULD A;  3TAQ A;  1TL3 A;  1NK6 A;  3NAE A;  4DTR A;  4JS4 A;  2Y1J A;  4HCB A;  3BGR A;  3LAL A;  1ZYQ A;  1QSY A;  3QNN A;  1UOC A;  3T1A A;  4CER A;  3IG1 A;  5C42 A;  1L3V A;  1Q9X A;  4ZTJ A;  3DMJ A;  1HNI A;  4DU1 A;  3ASM A;  3OYF A;  3VQD A;  3LWL A;  2PZS A;  1DTQ A;  1VSF A;  4CGJ A;  3HYF A;  4RW4 A;  1BL3 A;  5HRN A;  3U6F A;  3SCX A;  2ZQB A;  2P5O A;  2KTQ A;  1KLN A;  4ID1 A;  1K6Y A;  1WN7 A;  4KKO A;  3L2U A;  3VA0 A;  3V9Z A;  3DLB A;  4CK2 A;  4DS5 A;  4FJK A;  3DOK A;  1SL0 A;  3A2F A;  4KTW A;  5HBM A;  4FK4 A;  4E1M A;  1BCM A;  2F8S A;  4AHT A;  4CJ5 A;  2YNH A;  3HL8 A;  4IDK A;  1RT4 A;  3KKR A;  3MEE A;  1SL2 A;  4CJV A;  4FJG A;  3QLH A;  1VRU A;  4H8K A;  4CJU A;  4KI6 A;  4KHY A;  3L2W A;  1QS4 A;  4Z4F A;  2XY6 A;  1LW2 A;  2ZD1 A;  4M3Y A;  2HNZ A;  3LPT A;  3OYI A;  4CCH A;  2VG6 A;  4CJT A;  3IS9 A;  4AHU A;  4EP4 A;  3WNG A;  1HQU A;  1Q9Y A;  4FZY A;  3AVH A;  2YNI A;  1CZB A;  4CFA A;  1B9F A;  3CQ8 A;  2EHG A;  3V1R A;  4NCA A;  3AO5 A;  2RKI A;  3DRR A;  1QSS A;  2VWK A;  4CEO A;  4F2R A;  4DTJ A;  1TL1 A;  3AV9 A;  3TAN A;  1S1U A;  5I3U A;  4J2E A;  1W9H A;  3V9X A;  3I8D A;  3LAN A;  3SJJ A;  3RRH A;  4ZHR A;  4EZ6 A;  4CFD A;  2R7Y A;  4O0J A;  4J2D A;  1D9D A;  4CF1 A;  3E01 A;  1RDC A;  3UIQ A;  2G8U A;  2HW3 A;  2QKB A;  1BQN A;  2G8K A;  3VQ9 A;  1U45 A;  1GOB A;  1QHT A;  1TAQ A;  4IFY A;  4DQI A;  1EX4 A;  4I7F A;  1TKT A;  1NJX A;  4E19 A;  4QCL A;  2X6S A;  4FW2 A;  4J2B A;  1RBV A;  2I5J A;  3K59 A;  4DTO A;  3AVM A;  3L3U A;  5C25 A;  3PY8 A;  5I42 A;  4FZX C;  1C1C A;  4KI4 A;  4DTM A;  2HHS A;  1EP4 A;  1NKB A;  4IKF A;  1HRH A;  4KV8 A;  3TAB A;  2DFH A;  1J5O A;  4BDP A;  3HT3 A;  2GV9 A;  4KHW A;  1YT3 A;  3TR8 A;  4CHY A;  2ITG A;  3M8Q A;  4FLU A;  4Z4C A;  3OYJ A;  1CXQ A;  1VRT A;  3NFA A;  1JLG A;  4DQQ A;  4Y1C A;  4F2S A;  4B3O A;  1EKE A;  1L3T A;  1J9A A;  2RN2 A;  4MFB A;  4CEC A;  2OZM A;  1RTD A;  3LPU A;  4CFB A;  4HTU A;  2HHX A;  4JLH A;  1T7P A;  3H08 A;  3L2V A;  4OPK A;  1JXB A;  2OPQ A;  3WNF A;  2A1S A;  1S6P A;  3OVN A;  1HYZ A;  1KRP A;  4F8R A;  3DYA A;  3NGY A;  4N47 A;  3OYE A;  4N5S A;  5J2P A;  1Q8I A;  2GUI A;  2HHT A;  2VG7 A;  4E7L A;  1KTQ A;  4CED A;  4FK0 A;  1O1W A;  1QQC A;  4I2Q A;  1U48 A;  1LAV A;  4CHZ A;  3D0P A;  1SV5 A;  2AJQ A;  1A5W A;  4NYF A;  3QEW A;  5KGX A;  5KI6 A;  4M3Z A;  1JLB A;  1CZ9 A;  5HRS A;  4ELU A;  1ZBH A;  1WSE A;  5HRR A;  4CIE A;  4E7J A;  3RMD A;  1Z25 A;  2BE2 A;  2IAJ A;  3RRG A;  1HJR A;  4KTQ A;  2HHQ A;  1TK0 A;  4KHU A;  3L3V A;  3NH1 A;  4CEQ A;  4LH4 A;  3D45 A;  4CK1 A;  4NCG A;  3VQE A;  3G0Z A;  1WSJ A;  4Q5V A;  3IAY A;  4L8R B;  1S9G A;  4CJQ A;  3OJU A;  1ZBL A;  1C0T A;  2BAN A;  4C8M A;  4K8Z A;  4M3R A;  4ICL A;  4KO0 A;  5DMR A;  1FKO A;  3OS1 A;  2FBX A;  2RPI A;  3MEC A;  3QET A;  1JLA A;  3AA5 X;  2G8W A;  3SQ4 A;  3VN5 A;  2E6L A;  1TKZ A;  2XO7 A;  2JGU A;  4FJ7 A;  4M42 A;  2HHW A;  3DLE A;  2OPP A;  3OJS A;  1IG9 A;  3HK2 A;  1DTT A;  4E3S A;  3RWU A;  3KK3 A;  3HO1 A;  2X6N A;  4KHQ A;  1IKV A;  1KLM A;  2OPR A;  1B92 A;  4CFC A;  1D9F A;  4CEA A;  4FJN A;  1HNV A;  4E1N A;  3EZ5 A;  5JS2 A;  4LSN A;  1G15 A;  1S1T A;  3MEG A;  4IG0 A;  4DSI A;  3KD1 E;  3HJF A;  4DTP A;  2XY5 A;  1JLC A;  4B8A B;  2D0A A;  3S9H A;  1RCH A;  1LWE A;  1ZBF A;  1IKW A;  3KK1 A;  4DQP A;  4KHS A;  2KFN A;  2XY7 A;  4RG8 A;  4NYN A;  1T8E A;  4DTN A;  4FXD A;  3NF7 A;  5KTQ A;  3I0S A;  4DU4 A;  2PYJ A;  3OYD A;  2YNG A;  3CM5 A;  1RTI A;  3SQ1 A;  4CJW A;  4CGF A;  3ZT3 A;  3O3G A;  3F9K A;  3ZCM A;  2RF2 A;  4JRP A;  4PWD A;  4BDY A;  3CM6 A;  4BAC A;  1HPZ A;  4FM1 A;  4CHO A;  2YKN A;  4O4G A;  3TAP A;  3AA3 A;  2B6A A;  3P5J A;  4M45 A;  3TAM A;  4CF2 A;  1VSE A;  2WOM A;  1FKP A;  4W5O A;  1VSI A;  5J1E A;  1TKD A;  4B9T A;  4CJK A;  4B9V A;  3ZT1 A;  1LAW A;  1JLE A;  2HB5 A;  3KLI A;  2IDO A;  4H4O A;  3ZSY A;  3LP2 A;  2VG5 A;  3NBP A;  4CGD A;  4N56 A;  1VSD A;  3ITH A;  4YNQ A;  1NJW A;  3SZ2 A;  3VQA A;  2HHU A;  1S1W A;  3HP9 A;  1X9M A;  1DLO A;  3T3F A;  1BIS A;  4JRQ A;  1FXX A;  1N5Y A;  4ELV A;  2NUB A;  1RTJ A;  3G10 A;  4O0I A;  4EP5 A;  2HMI A;  3TAR A;  5HRO A;  4KHN A;  1WSI A;  3NHG A;  1YTA A;  5KRT A;  4CJ3 A;  4HUE A;  3KKS A;  1MU2 A;  3SQ2 A;  4KB1 A;  4G1Q A;  4PY5 A;  4M3X A;  1KSP A;  3MXJ A;  4CGI A;  1U49 A;  3VQC A;  4B9M A;  4FJX A;  1WAF A;  4CF8 A;  3LP3 A;  1NKC A;  3OYG A;  2XRI A;  4YFU A;  3SPZ A;  1KVB A;  2Z1G A;  1BIZ A;  4GW6 A;  3S3O A;  3NDK A;  1IKY A;  2HHV A;  1XC9 A;  1S1X A;  2QKK A;  1UA0 A;  4OPJ A;  1NOY A;  3SQ0 A;  1ZBU A;  3ZSW A;  1KFS A;  2PY5 A;  5E41 A;  3SV3 A;  1L3U A;  1LWF A;  5FDL A;  3VQQ A;  4DQS A;  4FLZ A;  3LZJ A;  4OKK A; 
#chains in the Genus database with same CATH topology
 3NGZ A;  2W6K A;  4W5R A;  3V9W A;  1RT2 A;  3HM8 A;  4K43 A;  1QSL A;  4FJL A;  1BQM A;  3R6M A;  4FM0 A;  3M8R A;  4MLE A;  3AO1 A;  1VSL A;  2HBL A;  1KAY A;  3SUQ A;  3MCA B;  1SUQ A;  3LAM A;  3V4I A;  1HYV A;  3MXI A;  1JL2 A;  1FK9 A;  3U3Y A;  2QWM A;  3DJC A;  4XEI A;  3SJH A;  3CJC A;  3HVT A;  3QEX A;  2FSN A;  3V9U A;  3DLG A;  3CJ1 A;  4AHS A;  4DCH A;  1X9S A;  4PHT X;  3ULE B;  4E7I A;  1EWQ A;  2Q97 A;  3OYK A;  1HKC A;  1YIJ N;  3JYT A;  3CCS N;  3AVC A;  3OYC A;  1WBB A;  1TUY A;  3JSM A;  5AQT A;  4A57 A;  4OPA A;  5FPN A;  1QE1 A;  3AVA A;  3MMV A;  3O5B A;  5EXW A;  4XIU A;  2ZJP L;  2A41 A;  3S3M A;  4I2P A;  4WE1 A;  4J2A A;  5BRD A;  3FFK B;  2JLE A;  3DLR A;  3VEY A;  2NRR A;  3TWH A;  2E2O A;  1BG3 A;  2Q31 A;  3IDH A;  4XH1 A;  5ELZ A;  4CE9 A;  4YDU C;  3HM9 A;  4Z4E A;  2QWQ A;  1BI4 A;  4DFP A;  3M8S A;  3SPY A;  3LDQ A;  3OYN A;  1XHZ A;  2RE2 A;  4RW8 A;  4CJ4 A;  2P9S B;  2FF3 B;  3B8A X;  4FJM A;  3AVF A;  5AQK A;  1BOT O;  2ZE2 A;  3FZL A;  5AQM A;  4CF9 A;  1NK7 A;  4F4K A;  1WAJ A;  4B08 A;  4BE0 A;  4FJH A;  3ATV A;  4FJ8 A;  3H3N O;  4CJP A;  5KRS A;  4FW1 A;  1E4F T;  3DLL L;  4BR7 A;  2QI2 A;  4MO5 A;  4C8N A;  1VQ6 N;  3DRP A;  1KVA A;  2NRV A;  3SYZ A;  2Q0R A;  1S1V A;  2KLA A;  4OGE A;  4H0Y B;  3V1Q A;  3M8P A;  4B9U A;  2F96 A;  3NF9 A;  1ZC6 A;  1KVC A;  1H1V A;  2YV0 X;  1NM1 A;  1CXU A;  2VWJ A;  2DFF A;  4R5P A;  3LZI A;  4FJI A;  1S72 N;  2UU9 K;  1W0H A;  4JEP A;  4GNI A;  3I55 N;  2QA4 N;  4FJ9 A;  4B3M K;  1YUW A;  3WXI A;  4NXM K;  5EU7 A;  3CCJ N;  5CZ1 A;  4HCC A;  3UB5 A;  3CC4 N;  4JNE A;  4YOV A;  4IG3 A;  1TAU A;  4HWI A;  2FBY A;  3VTH A;  5F1X A;  2VQE K;  1TUU A;  3F9M A;  4JK8 A;  3H3O B;  1RBS A;  3J7A P;  1RDW X;  4DTU A;  2B4J A;  2V7Z A;  5CHI A;  3AVB A;  4B1Z A;  2HVI A;  3W3D A;  3WEE B;  1HR0 K;  3QEI A;  5JLH A;  3J80 O;  3LP1 A;  3PIO L;  4LC9 B;  1C0F A;  1JXE A;  4B3T K;  2FBT A;  1ASU A;  3RMA A;  3MXM A;  3K5M A;  5BN9 A;  2OZS A;  1J53 A;  2HVH A;  4BC2 A;  4H4M A;  1S6Q A;  3CC2 N;  2D4W A;  1C0G A;  4F3O A;  2HOE A;  2GEM A;  3CFP A;  3LDS A;  3RR8 A;  3LWM A;  4CHQ A;  1WLJ A;  1N33 K;  5D3G A;  1VHX A;  4FLW A;  1J6Z A;  5EVZ A;  2H3G X;  1J54 A;  1NG9 A;  1DEJ A;  1QZ6 A;  4EZ9 A;  3OYA A;  1CLQ A;  4DF4 A;  3HPH A;  2E2N A;  1IKX A;  3O9U A;  3O9R A;  2AA4 A;  3AO2 A;  4HUF A;  1XI1 A;  3HOT A;  3LM2 A;  3OBY A;  3PX6 A;  3I56 N;  5AQG A;  3EYZ A;  3HXM A;  4CBW A;  4CW7 B;  3CIP A;  3H46 O;  4H5N A;  4RW9 A;  4BRH A;  3N4P A;  3OBW A;  3PO5 A;  1GLD G;  4DSK A;  2AP1 A;  5AQI A;  4A2A A;  1JLQ A;  4FSV A;  3O6W A;  4DV4 K;  3FR0 A;  4DR4 K;  5FRO A;  4H5R A;  3ZT4 A;  4AIL C;  1NK9 A;  4YY3 K;  2NRT A;  1RBR A;  3EKU A;  5BRH A;  1LWC A;  3HSC A;  1RNH A;  1TVR A;  4OKE A;  3AO3 A;  1RT1 A;  5LL6 Z;  4W5Q A;  1NGA A;  1U4B A;  4JI8 K;  1L3S A;  4Y1D A;  1D8Y A;  5BPL A;  1ZXO A;  1ASW A;  3TAG A;  3R1X A;  1C6V A;  1R0A A;  1ASV A;  4JKH A;  1TL3 A;  3NAE A;  2Y1J A;  4HCB A;  4QS9 A;  3QNN A;  4CJ7 A;  1OVY A;  1Q9X A;  4OO1 J;  4ZTJ A;  3OYF A;  3SCX A;  4KKO A;  3Q7B A;  3VA0 A;  3DOK A;  3SMS A;  1SL0 A;  4FK4 A;  2NNW A;  2F8S A;  3HOS A;  3ZEU A;  2PAV A;  4BR9 A;  4FJG A;  3QLH A;  5AZI A;  4CJU A;  1NNE A;  5GAE P;  1BDG A;  1QS4 A;  4O8K A;  1LW2 A;  2E1Y A;  3QB0 A;  2VG6 A;  1D4X A;  5C2F A;  1YF5 L;  3IS9 A;  4ILJ A;  3WNG A;  3AVH A;  2O8C B;  1CZB A;  3KHY A;  3CQ8 A;  4PKH A;  3S41 A;  3AO5 A;  3GOI A;  4CD3 A;  3O1B A;  4CEO A;  4F2R A;  1Z05 A;  2I7P A;  3UE5 A;  5I3U A;  4J2E A;  3V9X A;  3RVC A;  4EZ6 A;  4CFD A;  2J4R A;  3E01 A;  3UIQ A;  2HW3 A;  2G8K A;  4ISG A;  1TAQ A;  5AQJ A;  4DQI A;  5FPD A;  1LOT B;  1TKT A;  4E19 A;  1NJX A;  4J2B A;  3K59 A;  3PSF A;  4FZX C;  1SZ2 A;  1ZBS A;  1C1C A;  2DPN A;  3M5R A;  5DM6 L;  4U7B A;  1NKB A;  4IKF A;  1HRH A;  3VGL A;  3TAB A;  2DFH A;  1GLJ O;  5AR0 A;  4KHW A;  4JKG A;  2F9T A;  3OYJ A;  1CXQ A;  5E84 A;  2UXC K;  1U2V A;  4MO4 A;  2FF6 A;  3LPU A;  2WUS A;  5B8H A;  4HTU A;  2HHX A;  1KAZ A;  1T7P A;  3L2V A;  4JKF A;  3OVN A;  1HYZ A;  2GWJ A;  1KRP A;  4N47 A;  1Q8I A;  2GUI A;  4BGB A;  2VG7 A;  4E7L A;  1KTQ A;  2F9W A;  1LAV A;  4CD1 A;  5HOO A;  4GKJ K;  4NYF A;  4DB3 A;  5HRS A;  1W2B M;  4GV9 A;  1ZBH A;  1WSE A;  1O13 A;  1HJR A;  3L3V A;  4CEQ A;  4LH4 A;  4CK1 A;  3VQE A;  3G0Z A;  4Q5V A;  1S9G A;  4LF8 K;  1ZBL A;  1EO1 A;  4M3R A;  4KO0 A;  4FPB A;  4FO0 A;  3SQ4 A;  3JAM O;  2OPP A;  5ADX A;  2YHX A;  3HK2 A;  1VQL N;  3KK3 A;  2E2Q A;  1IKV A;  2OPR A;  3EZ5 A;  1G15 A;  3MEG A;  4RCH A;  1VAZ A;  1ZBF A;  4FWL A;  4RG8 A;  1T8E A;  5LJV A;  3GL1 A;  3NF7 A;  2YJF A;  4BG9 A;  3ZT3 A;  2KHO A;  4BDY A;  1YJN N;  1N8R O;  2QM1 A;  4FM1 A;  3THX B;  4LF6 K;  2Q1N A;  4CF2 A;  2WOM A;  1YIT N;  4GV6 A;  3BF1 A;  2FSJ A;  1VSI A;  1TKD A;  4B9T A;  3ZT1 A;  3KLI A;  2HB5 A;  3ZSY A;  2GWK A;  2VG5 A;  3LP2 A;  3NBP A;  4IJN A;  3ITH A;  4N56 A;  2ZM6 K;  2HHU A;  4ILH A;  4WQ4 C;  1BIS A;  4ELV A;  2HMI A;  1GLE G;  3A5N C;  4IEE A;  5AQH A;  3ZX2 A;  4BRG A;  4CJ3 A;  3KKS A;  2QW9 A;  4M3X A;  3CI5 A;  3MXJ A;  1U49 A;  3CER A;  3ULE A;  3D2E B;  3LP3 A;  4R79 A;  3G25 A;  4U67 L;  3CCR N;  1KVB A;  2Z1G A;  3S3O A;  5M1F A;  3NDK A;  1IKY A;  2HHV A;  1XC9 A;  1NOY A;  1ZBU A;  2QEX N;  3LZJ A;  5AQQ A;  5LMN K;  4OKK A;  3WNE A;  2DTU A;  4BR0 A;  3SUN A;  2QTD A;  2FBV A;  1KXP A;  3KVG A;  1JLF A;  3K5O A;  3LDL A;  4DFM A;  3DLH A;  5AJ3 K;  5AQY A;  4NLC A;  4O5B A;  3ZEU B;  3AAQ A;  3ZSV A;  4CK3 A;  3T1H K;  3RSE B;  4DG1 A;  1MWK A;  3CG7 A;  3ZSR A;  4DV1 K;  1T3V A;  3VGM A;  4WYB A;  5J2N A;  1RBU A;  4B9S A;  3AAP A;  3OTO K;  4KH4 A;  1TKX A;  2XY8 A;  3L4I A;  1Q82 O;  3C0B A;  1WSF A;  3V81 A;  2Z1H A;  4CEB A;  1UWB A;  3C94 A;  1LCU A;  2WON A;  4QOZ B;  5CR4 A;  1BIU A;  1IBL K;  2O4G A;  3G71 N;  1T05 A;  4I6M B;  3OYB A;  4CHN A;  4QAG A;  1YI2 N;  1YVU A;  3OW2 M;  3HPG A;  4PA1 A;  3VQ4 A;  3ZSO A;  3WUH A;  1F21 A;  5J2Q A;  3ID8 A;  4JKG B;  4Z4H A;  3DM2 A;  1GOA A;  1EWR A;  2X78 A;  2IVO A;  4AQY K;  4FJJ A;  1U2V B;  4CJE A;  3KD5 E;  3QBW A;  3EE9 A;  2X74 A;  4OLA A;  1S5J A;  4WQ5 A;  4BRL A;  3KLF A;  1LW0 A;  1E3M A;  3O9Q A;  2G8F A;  3CET A;  4YOW A;  2YHW A;  4B8C A;  1P8Z A;  2A5X A;  2QWL A;  2CGJ A;  1K73 O;  4BR4 A;  2G8H A;  2QWP A;  2YHB A;  5F2R A;  1VQP N;  4YOU A;  1U04 A;  3WEE A;  2P9L B;  3VEO A;  1IV0 A;  3EL2 A;  3QIO A;  1QQN A;  3VQ7 A;  3V9S A;  3BUZ B;  1RT6 A;  2IVN A;  3HST B;  4FLY A;  4LF9 K;  4BR5 A;  3L8B A;  5GIO A;  3B6O A;  1VQK N;  2V51 B;  1A5X A;  1Y97 A;  4FL9 A;  3AGR A;  2G8V A;  5LY3 A;  4CI6 A;  3CYM A;  1NJY A;  3VQB A;  4IDH A;  1QHA A;  4AH9 A;  3K57 A;  5H1S Q;  5IT9 O;  1X1P A;  3DRS A;  2Y1I A;  3OYL A;  2D0O A;  4FWS A;  4DQR A;  3V6D A;  3K5N A;  1SKW A;  3MK6 A;  1HYS A;  3CFO A;  2EX3 A;  4BC5 A;  4BRF A;  4CIG A;  3NH2 A;  2XHB A;  2ASM A;  4FM2 A;  1GLL O;  2BDP A;  1D5A A;  3VTI A;  4W5N A;  1NGD A;  3SNN A;  3SK3 A;  3SUO A;  2P9K A;  4HVJ A;  1T6D A;  4Q0B A;  1NOZ A;  3O4N A;  1XHX A;  4M3U A;  4LFC K;  4WF9 L;  4PL7 A;  3AVL A;  3LDP A;  4ILG B;  1EQY A;  3TSP A;  4I9L A;  3QEV A;  3D2F A;  3OS2 A;  1NGJ A;  4RW7 A;  4LFA K;  1TV6 A;  3O9T A;  1OVQ A;  4BRO A;  3T19 A;  4UQG A;  4OLB A;  4BRN A;  3H45 C;  4DLG A;  1KQS M;  4ZTF A;  3TTC A;  4CEE A;  4E0D A;  1WOQ A;  3AVJ A;  3EN9 A;  4CZI A;  4H03 B;  2WC9 A;  1W7A A;  4B1X B;  3N4Q A;  4C1N K;  2E20 A;  3QIC A;  2P9U B;  2D0C A;  3V1O A;  4CES A;  4DF8 A;  2KW4 A;  2KQ2 A;  5C2D A;  3PUF A;  2FLO A;  5AQN A;  3BDP A;  3R8E A;  3KLE A;  3J8A A;  4CGH A;  3QDK A;  3C65 A;  4QS8 A;  3AVI A;  3HTV A;  2ZGY A;  1VQ7 N;  3PX0 A;  4AHC A;  1NJZ A;  1IJJ A;  1OH7 A;  1C0U A;  2W42 A;  3ENH A;  2FXU A;  1NK8 A;  1IG8 A;  1K8K B;  2O8C A;  3O8M A;  2O4I A;  1S3X A;  1SKR A;  3NMU A;  1JCE A;  2B5J A;  3EEQ A;  2QWO A;  3ZT0 A;  4DR1 K;  2E6M A;  3A5O C;  3RTV A;  3OYH A;  3ULD A;  2V7Y A;  4JS4 A;  1ILY A;  1VQ8 N;  3BGR A;  1ZYQ A;  3DXK B;  1YJ9 N;  2WFB A;  2UXB K;  2PZS A;  1VSF A;  4RW4 A;  3U6F A;  2P5O A;  2KTQ A;  3UKU A;  4ID1 A;  1GLA G;  1WN7 A;  3L2U A;  3V9Z A;  4CK2 A;  4WFN L;  4DR6 K;  2VGM A;  3A2F A;  5HBM A;  1E4G T;  1BCM A;  4AHT A;  4IDK A;  1RT4 A;  4X66 K;  4WCE L;  4CJV A;  2ZGZ A;  1VRU A;  4H8K A;  4M7X A;  2VYP A;  2EWS A;  2W6L A;  3TTF A;  4M3Y A;  3LPT A;  3OYI A;  4EAH D;  1HLU A;  3V1R A;  4BRD A;  2RKI A;  5IWA K;  1QSS A;  2VWK A;  4YOY A;  1S1U A;  2VWB A;  1W9H A;  3I8D A;  5MLC Q;  3SJJ A;  3RRH A;  2E5L K;  4ZHR A;  2R7Y A;  5AQS A;  4O0J A;  4BRM A;  3THY B;  3VEW A;  4KH6 A;  3E9P A;  1EX4 A;  5LMU K;  5JIC A;  3PY8 A;  3L3U A;  3T69 A;  3VEV A;  4KI4 A;  1EP4 A;  2D0P A;  1J5O A;  4DV6 K;  4Z4C A;  5M1O A;  4F2S A;  3NFA A;  1JLG A;  3MX5 A;  4Y1C A;  3ENB A;  1EKE A;  3T1Y K;  1J9A A;  2RN2 A;  2OZM A;  3FZM A;  1JXB A;  4YDU A;  1S6P A;  2HF4 A;  3DYA A;  3NGY A;  2HHT A;  3ZX0 A;  2PBD A;  4FK0 A;  5BPN A;  1O1W A;  4I2Q A;  4CHZ A;  3D0P A;  1SV5 A;  2WBN A;  5M1N A;  3QEW A;  4M3Z A;  3THX A;  3EO3 A;  5HRR A;  2P9K B;  1Z25 A;  2IAJ A;  2HHQ A;  5AQW A;  4DV0 K;  3FZF A;  4KHU A;  2O8E B;  3MCP A;  4NCG A;  2JWK A;  4L8R B;  1XMO K;  4KHP K;  3D2F B;  4IWV A;  2NRX A;  3OS1 A;  1FKO A;  4DV7 K;  3TPQ A;  2RPI A;  2PFU A;  1G99 A;  3J7Z O;  3A8Y A;  2G8W A;  3VN5 A;  4A59 A;  2XO7 A;  4FJ7 A;  2GX9 A;  4YOR A;  4KBO A;  2VGN A;  4H0P A;  3HO1 A;  4KHQ A;  3THW B;  1KLM A;  2A42 A;  3QML A;  4LSN A;  3CJ9 A;  3KD1 E;  3D2E A;  4B8A B;  4JYA K;  1MDU B;  5AZJ B;  4DTN A;  4FXD A;  4DU4 A;  2PYJ A;  1NGI A;  1RTI A;  2GUP A;  4CZH A;  4JI6 K;  4G9Z A;  3QBX A;  4BVP A;  4JRP A;  1IBK K;  4PWD A;  1HPZ A;  3LDN A;  4CHO A;  1BA1 A;  4DR7 K;  2QXL A;  3D7E O;  1VSE A;  1FKP A;  3DWL A;  4B1U B;  4CJK A;  4H4O A;  2IDO A;  4JK9 A;  3T7Z A;  4YNQ A;  3SZ2 A;  3WXM B;  1KD1 O;  3G6E N;  1VQN N;  1FXX A;  3VEZ A;  1RTJ A;  3RSE A;  3JXU A;  5HRO A;  5KPR A;  5C10 A;  4PY5 A;  4KB1 A;  1K9M O;  5FPE A;  4B9M A;  1NKC A;  3KZB A;  3OYG A;  3SPZ A;  4GW6 A;  3BZC A;  5BR9 A;  3C6A A;  2QKK A;  2PY5 A;  3SQ0 A;  1KFS A;  4BC4 A;  5E41 A;  1LWF A;  2ASO A;  4DQS A;  4BRK A;  4I9Q A;  3KIO A;  5CYM A;  3SI6 A;  5K14 A;  4FWM A;  3UKU B;  4I6M A;  2OTL N;  1VK0 A;  3I33 A;  2LSN A;  4DQ8 A;  4JN4 A;  1Q18 A;  2BGG A;  4M7Y A;  2P1J A;  2P9P B;  1RTH A;  3K9K A;  1REV A;  3KLG A;  3LM9 A;  4FCY A;  3QER A;  2NRW A;  1N34 K;  3MWT A;  3PO4 A;  3KJV A;  4IOX A;  1HQE A;  4CZJ A;  3KLH A;  3CME N;  3P1G A;  3OY9 A;  5EOY A;  3AVG A;  3VQ5 A;  2JWL A;  2F4V K;  1Z26 A;  2P9L A;  1NK0 A;  3SAG A;  4FLV A;  5GIN A;  3E9L A;  1KAX A;  4DS4 A;  3UKR B;  3AAR A;  3AVK A;  1N6Q A;  2DY4 A;  2IC3 A;  4AHV A;  3K5L A;  3RR7 A;  4FK2 A;  4O44 A;  4PUO A;  3P83 D;  4IOA L;  5M1P A;  1X3M A;  1EXQ A;  2ZJR L;  1IH7 A;  4FYD A;  4OKJ A;  4KH5 A;  4KAZ A;  2HHH K;  4IFV A;  3C6U A;  4XH5 A;  4CZK A;  3WNH A;  4KB0 A;  4CBX A;  4GMJ B;  2IS3 A;  1BCO A;  4GVE A;  2UUB K;  4BRI A;  3K2P A;  5SZT A;  1EET A;  2GTD A;  4JKA A;  1JKH A;  3K0S A;  3CXC M;  4NB4 A;  2O8B A;  4OGC A;  1RDD A;  4M3W A;  3F2K A;  2FC0 A;  2YKM A;  2HNY A;  3I0R A;  1TK5 A;  3BEX A;  1BGX T;  5J2M A;  3C6T A;  3FFI A;  3QFP A;  2P9I A;  3L0Q A;  2Q36 A;  4OX9 K;  5CYQ A;  4IFE A;  3CC7 N;  1VSK A;  3SBT A;  3H6E A;  1TYQ B;  2OA8 A;  3O80 A;  1BWF O;  4KPY A;  1LV5 A;  3VQP A;  5BRE A;  1HNZ K;  2F8T A;  2UUC K;  4E7H A;  1BA0 A;  4DTX A;  3QES A;  1K8A O;  3TTD A;  4CZG A;  4DWI A;  4DUZ K;  1HMV A;  4LY7 A;  4H5T A;  3MED A;  3L2Q A;  4BY9 C;  1OH8 A;  2ZF5 O;  4W5T A;  3PV8 A;  4ELT A;  4B1Y B;  1RDB A;  2BH1 A;  4BR2 A;  2A1R A;  4NCB A;  2WTU A;  2PYL A;  4LD0 A;  1C1B A;  3CCV N;  3RMC A;  2Q3S A;  2P9U A;  1OH6 A;  5CY4 A;  3ZT2 A;  4AF1 A;  5FPM A;  2I7N A;  1WNS A;  1KFD A;  4N76 A;  3KK2 A;  4WFA L;  4BE1 A;  4H5W A;  5AQX A;  4MQ3 A;  2KZM A;  2E2P A;  1GLB G;  3AO4 A;  5AQR A;  1C1A A;  5C24 A;  3U4L A;  1SQK A;  3AGK A;  1SL1 A;  5F0X A;  3AA2 A;  2DFE A;  1T44 A;  2OAN A;  5HP1 A;  3NF6 A;  4FWR A;  1K8K A;  3NGI A;  4CJL A;  4WFB L;  3TAF A;  4C8K A;  3QIP A;  3ALY A;  3S3N A;  3OHR A;  4DSF A;  1WSH A;  1UAX A;  3IRX A;  3WXK A;  3CFR A;  3HPO A;  4CF0 A;  4FLX A;  1T6C A;  2D0B A;  4YOT A;  1TK8 A;  3DXK A;  3SAF A;  3FZK A;  4CEF A;  3KTQ A;  2KZZ A;  4ISE A;  1QVG M;  1U6Z A;  4RTF D;  1S9E A;  4NO7 A;  3OYM A;  4JAX A;  2G8I A;  3SUP A;  1XWL A;  4CJS A;  1Q81 O;  5EY4 A;  4BRQ A;  1BHL A;  3C95 A;  3IKM A;  3L2R A;  4FOE A;  2GBZ A;  1HPM A;  4B1V A;  1DT9 A;  2QWN A;  3U9Z A;  1VSM A;  4C23 A;  4RW6 A;  2NZT A;  4JS5 A;  2D5R A;  3O9S A;  3MN9 A;  3DOL A;  4TSX A;  4LF7 K;  2P5G A;  5GIP A;  5JVG L;  4WQ4 A;  4CZL A;  3K58 A;  4H0O A;  4H0X B;  1M1K O;  1NK6 A;  4DTR A;  1UOC A;  3T1A A;  4MDB A;  5C42 A;  4UY8 O;  1HNI A;  5E26 A;  1VQ5 N;  3HYF A;  1BL3 A;  2NRH A;  3THY A;  1KLN A;  3DLB A;  4KTW A;  4CJ5 A;  3HL8 A;  3WXL A;  3O4W A;  3KKR A;  3MEE A;  1SL2 A;  3BY5 A;  2FSK A;  4K25 A;  3L2W A;  4Z4F A;  2XY6 A;  2ZD1 A;  1R59 O;  2HNZ A;  2YJE A;  4XH4 A;  4CCH A;  4CJT A;  3CJA A;  4EP4 A;  2O8B B;  1Q9Y A;  4FZY A;  3MDQ A;  4CFA A;  3E66 A;  1B9F A;  1W97 L;  2EHG A;  4NCA A;  4JI0 K;  2O8F B;  3P39 A;  4JKC A;  5BPM A;  4DTJ A;  1TL1 A;  3AV9 A;  1N32 K;  3LAN A;  2P9I B;  2V52 B;  4J2D A;  1D9D A;  3HRG A;  4CF1 A;  3OA9 A;  1RDC A;  1Q7Y O;  2G8U A;  3GE1 A;  2QKB A;  2O8E A;  2ASP A;  3VQ9 A;  2QWR A;  3CQY A;  1U45 A;  1QHT A;  3MX2 A;  3C7N B;  3CJB A;  3F5T A;  4JHD B;  4FW2 A;  1RBV A;  3SBG A;  3AVM A;  5C25 A;  1NMD A;  5I42 A;  4K42 A;  1X3N A;  2HHS A;  4JI4 K;  4DR2 K;  3DAW A;  5JVH L;  3ZLJ A;  4KV8 A;  4BDP A;  2ITG A;  3THW A;  1VRT A;  2A40 A;  4JKB A;  4B3O A;  1L3T A;  3O1W A;  4CEC A;  1RFQ A;  1RTD A;  1HKB A;  4PKI A;  3CD6 N;  5GAG P;  3FLC O;  2E88 A;  2HBJ A;  4JLH A;  3H08 A;  1HUX A;  2OPQ A;  5AZJ A;  1J5E K;  2IIR A;  5J2P A;  1HNW K;  3LDO A;  1Y64 A;  3M3Z A;  1JJ2 M;  1QQC A;  4B3R K;  1U48 A;  5KGX A;  3I8B A;  3ID6 A;  1JLB A;  1CZ9 A;  4ELU A;  4CIE A;  4CZE A;  5DM7 L;  2BE2 A;  4B1W B;  1XMQ K;  5AQP A;  3NH1 A;  1GLC G;  2CH5 A;  4F9O A;  4O8U A;  3D45 A;  1QVF M;  3IFR A;  4FWQ A;  2CGL A;  3CCE N;  5AQZ A;  3IAY A;  3OJU A;  5C12 A;  1C0T A;  4C8M A;  2BUP A;  5DMR A;  4ICL A;  4A2B A;  2FBX A;  3QET A;  4FPA A;  1JLA A;  3AA5 X;  5KQ8 A;  3E1Y A;  3PIP L;  1TKZ A;  4M42 A;  2JGU A;  4GKK K;  1FW6 A;  3M6G A;  3DLE A;  3OJS A;  1QQO A;  4PL8 A;  4E3S A;  3A5M C;  3RWU A;  3GBT A;  4FJN A;  1B92 A;  4CFC A;  4CEA A;  1HNV A;  4E1N A;  5JS2 A;  4DSI A;  1S1T A;  4IG0 A;  3HJF A;  2XY5 A;  1XUP O;  4AM7 A;  4AM6 A;  4EIA A;  1RCH A;  1LWE A;  4KHS A;  1IKW A;  3KK1 A;  4DQP A;  4H0T B;  3R9P A;  4NYN A;  2XY7 A;  1N36 K;  2HST A;  3H1V X;  3I0S A;  3CM5 A;  4IZ9 A;  4EHU A;  4YHH K;  5TKY A;  4FWO A;  1BUP A;  1NLV A;  3MWP A;  4BAC A;  2UXD K;  4O4G A;  3TAP A;  4HTL A;  3EKS A;  3TAM A;  2P9N B;  1V4T A;  4W5O A;  4JD2 B;  1JLE A;  3DXM A;  1NWK A;  1VSD A;  3VGK A;  4LF4 K;  1S1W A;  2P9P A;  1X9M A;  1DLO A;  4JRQ A;  1N5Y A;  2NUB A;  4EP5 A;  3TAR A;  1XNR K;  4KHN A;  1YTA A;  4FWP A;  4HUE A;  1RGI A;  4GY2 B;  3SQ2 A;  5M1K A;  4G1Q A;  1KSP A;  4FJX A;  4CGI A;  4CF8 A;  2Q2R A;  5FLX O;  4OPJ A;  3ZSW A;  1L3U A;  3SV3 A;  5FDL A;  3VQQ A;  3FZH A;  4FLZ A;  4PQU A;  3ZET B;  4CJR A;  4DFJ A;  4O55 A;  4BGA A;  4DV5 K;  4CHP A;  4FLT A;  5KGW A;  4DTS A;  1NJI O;  4FOI A;  5HLF A;  3CF5 L;  3UKR A;  3WQT A;  4IBN A;  3IMX A;  4M63 C;  3G4S N;  4CVN E;  1VSH A;  4Z94 A;  3MN6 A;  5FRN A;  3CPE A;  3LP0 A;  2VCP A;  2QK9 A;  4BC3 A;  5KPT A;  1WUA A;  2YX6 A;  3MAQ A;  5T7B A;  3BZK A;  1T03 A;  4M3T A;  3PX4 A;  3A0I X;  4FVU A;  4FVM A;  3EZW A;  3LL3 A;  4OVL A;  4EHT A;  1YTU A;  2GEL A;  4E89 A;  4EFH A;  4O5F A;  1U47 A;  4BQL A;  3TI0 A;  5BR8 K;  4DSL A;  4GVM A;  4BRP A;  1ITG A;  2YNF A;  4LH5 A;  5AFU H;  2A6A A;  4KTZ A;  3QEP A;  4FZZ A;  4HUG A;  3VQ8 A;  3ZYY X;  2KFZ A;  1V4S A;  4CBU A;  3VQ6 A;  3ZSZ A;  2NRZ A;  5AQV A;  1L5U A;  4GV3 A;  4DMN A;  3SV4 A;  3VF6 A;  4K41 A;  1S22 A;  3DI6 A;  1IBM K;  2OPS A;  4C8O A;  3AVN A;  2YCH A;  1IO2 A;  4CIF A;  5BN8 A;  4KFB A;  1XQS C;  5CZ2 A;  2HND A;  1QTM A;  1RT5 A;  3ENO A;  4K0K K;  1I3A A;  1TYQ A;  1WBD A;  3TAE A;  4IO8 A;  4Z0U A;  3J81 O;  4E1J A;  2ETJ A;  1NK5 A;  3PLA A;  2IGI A;  4MDA A;  4C8L A;  3EE8 A;  3ISN C;  3HZ6 A;  2OTJ N;  3BF3 A;  5C0Y A;  4N41 A;  3VET A;  3NH0 A;  2Z1I A;  4DFK A;  2YHA A;  3QNO A;  5AFU A;  1VQM N;  4M41 A;  4X64 K;  1GLF O;  2KKZ A;  2ATQ A;  5TKW A;  4CJF A;  4OJR A;  3ZX3 A;  4BWJ A;  4BRE A;  1X9W A;  3OS0 A;  3FE1 A;  3O3F A;  1B9D A;  2BTF A;  3GDQ A;  4H5V A;  4LFB K;  3VF4 A;  1BI4 B;  1KCF A;  4JKE A;  4BE2 A;  3NCI A;  1RDA A;  1VSJ A;  4CGG A;  3FGU A;  3VER A;  1YXQ A;  4KRE A;  3B6P A;  5GAH P;  5HL7 L;  1UA1 A;  1GOC A;  2YHY A;  1NKE A;  4DV3 K;  3ZSX A;  2OCE A;  3ATU A;  4DUY K;  4DR5 K;  2A3Z A;  4BWM A;  4DLE A;  3A5L C;  1JCF A;  3EY1 A;  3CPW M;  2Z1J A;  2QXF A;  1WB9 A;  4HHT A;  4IEI A;  4CEZ A;  3CQX A;  1SKS A;  3DXM B;  3DLK A;  3HVR A;  4E7K A;  4Z4G A;  1C0M A;  3HBT A;  4X65 K;  4BDZ A;  5GAD P;  1NK4 A;  1VQ9 N;  1JL1 A;  2IOC A;  1HX1 A;  3CJ7 A;  4DU3 A;  1VQO N;  3VEN A;  3U3G A;  5HRP A;  5JS1 A;  1NGG A;  4AHR A;  3LAK A;  2E1Z A;  2UUA K;  1RT3 A;  2UYT A;  1I39 A;  5BRF A;  3AA4 A;  3VA3 A;  5ADX H;  3HP6 A;  2O8D A;  3QO9 A;  1MWM A;  2W40 A;  3U8X A;  2OYQ A;  3ZSQ A;  3THV A;  4F3T A;  1RDU A;  2YI1 A;  1RIL A;  4B9L A;  5FRM A;  4A5B A;  1ATN A;  4PKG A;  3H1Q A;  2E8A A;  4LSL A;  2VQF K;  4B9N A;  2P51 A;  1ESV A;  4K8X A;  5DK5 A;  3HI0 A;  3QIN A;  3RMB A;  4JI3 K;  4JI7 K;  4FJ5 A;  1A5V A;  3P4I A;  1MA9 B;  4V19 S;  4Z4I A;  4ID5 A;  4DSJ A;  3O3H A;  1ZBI A;  1RT7 A;  2E4L A;  5AQL A;  3NF8 A;  3NE6 A;  4KRF A;  3VES A;  4A5A A;  3O4Q A;  5SWM A;  1WSG A;  3CCM N;  1X9J A;  3L6Q A;  1QZ5 A;  3CMA N;  1NBW A;  5EX5 A;  3VF2 A;  4FWN A;  4DSE A;  1TGO A;  4BQZ A;  1SS6 A;  2O8F A;  5M1Q A;  1QQM A;  3F73 A;  3W0L A;  2IVP A;  1RBT A;  4IO9 L;  3TAQ A;  4CZF A;  3LAL A;  1QSY A;  4CER A;  1L3V A;  4JI5 K;  3IG1 A;  3MN7 A;  3C6H A;  3M1F A;  3TSQ A;  3DMJ A;  4DU1 A;  3ASM A;  4WQ5 C;  3VQD A;  3LWL A;  4NLB A;  1DTQ A;  3TU5 A;  2RHK A;  4CGJ A;  5JMV A;  5HRN A;  1YJW N;  2ZQB A;  1K6Y A;  4FJK A;  3VPZ A;  3C7N A;  4DS5 A;  5A2Q O;  4JHD A;  3NVM A;  4E1M A;  3VMF B;  1I94 K;  1BO5 O;  2YNH A;  1HNX K;  4MLH A;  4L3Q A;  2CGK A;  3K9J A;  5JLF A;  3MN5 A;  4KI6 A;  4KHY A;  3CHW A;  3KK7 A;  4AHU A;  1HQU A;  2YNI A;  1DKG D;  3DRR A;  1VQ4 N;  2HMP A;  1XNQ K;  3SMP A;  4IJA A;  5CE3 A;  3CCQ N;  2ZJQ L;  3TAN A;  5KQD A;  1JCG A;  1NGE A;  2HBM A;  1BQN A;  4IOC L;  1GOB A;  3U9D A;  3R3L A;  4IFY A;  1CZA N;  4I7F A;  1HKG A;  4QCL A;  2X6S A;  2I5J A;  4DTO A;  4LF5 K;  3KWG A;  4DTM A;  1YVN A;  5AZI B;  2GV9 A;  4JI1 K;  1YT3 A;  2HBK A;  3TR8 A;  4CHY A;  3O08 A;  3M8Q A;  3CCU N;  4FLU A;  4DQQ A;  4B9Q A;  4J8F A;  2P9S A;  4MFB A;  2W41 A;  4CFB A;  4OPK A;  3WNF A;  4DHY A;  2A1S A;  4F8R A;  3OYE A;  4N5S A;  2CH6 A;  3TSU A;  4CED A;  3NVK A;  2Q0U A;  1OKJ A;  2AJQ A;  1A5W A;  1HJO A;  5KI6 A;  1NGF A;  3WQU A;  4Y0W A;  3RRG A;  4KTQ A;  4E7J A;  3RMD A;  1M90 O;  2P9N A;  4JK7 A;  3WXJ A;  1TK0 A;  4A62 A;  4JD2 A;  3VEX A;  5LJW A;  1WSJ A;  4C1N I;  5C15 A;  1NGH A;  4CJQ A;  2BAN A;  4K8Z A;  3MEC A;  1P90 A;  1YAG A;  3IUC A;  2D1K A;  4YOX A;  1NU0 A;  2E6L A;  4IXC A;  4JV5 K;  2O8D B;  3L4Q A;  2HHW A;  1IG9 A;  1DTT A;  2X6N A;  1Z6R A;  4B3S K;  3P38 A;  1D9F A;  4RWT A;  4DTP A;  1JLC A;  4FWK A;  2D0A A;  3JS6 A;  3S9H A;  2KFN A;  1ATR A;  1Q86 O;  1NGC A;  3SAH A;  2F7T A;  2HF3 A;  4DKW A;  5KTQ A;  3OYD A;  2YNG A;  4BG8 A;  4DR3 K;  4BRC A;  3SQ1 A;  4CJW A;  4CGF A;  3AY9 A;  3O3G A;  3P31 A;  3F9K A;  3ZCM A;  2RF2 A;  4OPH A;  3CM6 A;  3Q7C A;  2ZWH A;  1ATS A;  3ZET A;  1YHQ N;  2YKN A;  3KWI A;  3AA3 A;  2B6A A;  3P5J A;  4M45 A;  1KC8 O;  5KPZ A;  4B9V A;  5J1E A;  3WT0 A;  1NGB A;  5AQU A;  1LAW A;  1NMN A;  4CGD A;  2ITM A;  4ISF A;  1NJW A;  1OH5 A;  3VQA A;  4JKD A;  5AQO A;  3HP9 A;  4A61 A;  3T3F A;  4NXN K;  3GG4 A;  3E9O A;  3G10 A;  4O0I A;  5AQF A;  3CCL N;  1XC3 A;  3BP8 A;  1WSI A;  1FJG K;  3D6R A;  3NHG A;  5KRT A;  4H0V B;  4DV2 K;  4BVO A;  4X62 K;  1MU2 A;  1DGK N;  3VQC A;  4BRA A;  3J7Y P;  1WAF A;  1SAZ A;  2XRI A;  3VOV A;  4YFU A;  3SLC A;  1BIZ A;  4CZM A;  3QFU A;  1BU6 O;  3PSI A;  4QS7 A;  1S1X A;  2NLX A;  1UA0 A;  3HT3 A;  4JI2 K;  5I9E B; 
#chains in the Genus database with same CATH homology
 3NGZ A;  4PQU A;  3WNE A;  4W5R A;  4I9Q A;  2DTU A;  3KIO A;  3V9W A;  4Z4E A;  5CYM A;  1RT2 A;  1QSL A;  4FJL A;  4CJR A;  4DFJ A;  3SI6 A;  1BQM A;  5K14 A;  3SUN A;  4O55 A;  2FBV A;  4CHP A;  1JLF A;  3K5O A;  4FM0 A;  3M8R A;  1VK0 A;  4FLT A;  5KGW A;  4DFM A;  4DTS A;  3AO1 A;  3DLH A;  1VSL A;  5HLF A;  2LSN A;  3SUQ A;  1SUQ A;  3LAM A;  4IBN A;  4O5B A;  3V4I A;  1HYV A;  2BGG A;  2P1J A;  3MXI A;  3ZSV A;  1VSH A;  1JL2 A;  5FRN A;  3LP0 A;  1FK9 A;  3U3Y A;  1RTH A;  4CK3 A;  2QK9 A;  4DG1 A;  1REV A;  3MAQ A;  3HVT A;  5T7B A;  3QEX A;  1T03 A;  4M3T A;  3KLG A;  3CG7 A;  3V9U A;  3ZSR A;  4FVM A;  3PX4 A;  3DLG A;  4FCY A;  3QER A;  4AHS A;  5J2N A;  1RBU A;  4OVL A;  1X9S A;  4B9S A;  1YTU A;  3PO4 A;  4E7I A;  1TKX A;  2XY8 A;  4E89 A;  3KJV A;  1U47 A;  1HQE A;  3TI0 A;  3OYK A;  1WSF A;  3JYT A;  3V81 A;  2Z1H A;  4CEB A;  3KLH A;  4DSL A;  4GVM A;  1ITG A;  3AVC A;  2YNF A;  3P1G A;  3OYC A;  1UWB A;  4LH5 A;  3OY9 A;  3JSM A;  3C94 A;  2WON A;  3AVG A;  4KTZ A;  3QEP A;  4QOZ B;  4FZZ A;  4HUG A;  1QE1 A;  1BIU A;  3AVA A;  3VQ8 A;  4XIU A;  2KFZ A;  3VQ5 A;  2O4G A;  3VQ6 A;  3ZSZ A;  3S3M A;  1L5U A;  1Z26 A;  1T05 A;  4I2P A;  4WE1 A;  3OYB A;  4J2A A;  4CHN A;  4QAG A;  4DMN A;  3SV4 A;  2JLE A;  3DLR A;  1NK0 A;  3DI6 A;  4FLV A;  1YVU A;  3TWH A;  4C8O A;  2OPS A;  4DS4 A;  3AVN A;  3AVK A;  1N6Q A;  2DY4 A;  2IC3 A;  3HPG A;  1IO2 A;  4CIF A;  4PA1 A;  4AHV A;  4CE9 A;  3VQ4 A;  3HM9 A;  4KFB A;  3ZSO A;  4O44 A;  3K5L A;  3RR7 A;  4FK2 A;  1BI4 A;  4PUO A;  3P83 D;  5CZ2 A;  1F21 A;  2HND A;  4DFP A;  5J2Q A;  1QTM A;  1RT5 A;  3M8S A;  3SPY A;  4Z4H A;  1EXQ A;  3DM2 A;  1GOA A;  1I3A A;  1IH7 A;  4OKJ A;  2X78 A;  3OYN A;  4KAZ A;  4FYD A;  3TAE A;  1XHZ A;  4RW8 A;  4CJ4 A;  4FJJ A;  4Z0U A;  4CJE A;  4IFV A;  3C6U A;  3KD5 E;  4FJM A;  2ETJ A;  3AVF A;  3WNH A;  4KB0 A;  1NK5 A;  2ZE2 A;  4GMJ B;  2IS3 A;  2IGI A;  4CF9 A;  4C8L A;  1NK7 A;  1BCO A;  2X74 A;  1WAJ A;  4F4K A;  1S5J A;  4B08 A;  4BE0 A;  4FJH A;  4OLA A;  4FJ8 A;  3ISN C;  3KLF A;  1LW0 A;  3K2P A;  4CJP A;  5KRS A;  4FW1 A;  1EET A;  5SZT A;  2G8F A;  1JKH A;  4B8C A;  4C8N A;  4N41 A;  3DRP A;  1KVA A;  1RDD A;  4OGC A;  3NH0 A;  4M3W A;  2Z1I A;  4DFK A;  2G8H A;  2YHA A;  2FC0 A;  2YHB A;  3SYZ A;  3QNO A;  2YKM A;  2HNY A;  3I0R A;  4M41 A;  1S1V A;  4OGE A;  2ATQ A;  4CJF A;  1U04 A;  3V1Q A;  4OJR A;  1TK5 A;  3M8P A;  4BWJ A;  3QIO A;  1X9W A;  1BGX T;  3VQ7 A;  2F96 A;  4B9U A;  3NF9 A;  3V9S A;  3OS0 A;  5J2M A;  1RT6 A;  3C6T A;  2YV0 X;  1KVC A;  3FFI A;  3HST B;  3O3F A;  4FLY A;  1CXU A;  1B9D A;  2VWJ A;  2DFF A;  5CYQ A;  3L8B A;  1BI4 B;  1KCF A;  3B6O A;  4R5P A;  3NCI A;  3LZI A;  1RDA A;  1VSK A;  4BE2 A;  4FJI A;  1VSJ A;  4CGG A;  1A5X A;  1W0H A;  1Y97 A;  2OA8 A;  2G8V A;  4KPY A;  4FJ9 A;  1LV5 A;  3CYM A;  1NJY A;  3VQB A;  4KRE A;  4AH9 A;  3B6P A;  3VQP A;  3K57 A;  2F8T A;  1UA1 A;  1GOC A;  5EU7 A;  1X1P A;  3DRS A;  5CZ1 A;  4E7H A;  4DTX A;  3QES A;  2Y1I A;  4HCC A;  3OYL A;  1NKE A;  4DWI A;  1HMV A;  4LY7 A;  4DQR A;  3V6D A;  3K5N A;  3ZSX A;  4IG3 A;  3MED A;  1TAU A;  4DLE A;  2FBY A;  4BWM A;  1SKW A;  3L2Q A;  1HYS A;  3EY1 A;  1RBS A;  3CFO A;  2EX3 A;  4W5T A;  2Z1J A;  2QXF A;  3PV8 A;  4ELT A;  4HHT A;  4CIG A;  4DTU A;  2B4J A;  4CEZ A;  1RDB A;  3AVB A;  3NH2 A;  1SKS A;  2XHB A;  2HVI A;  2A1R A;  4NCB A;  3DLK A;  2PYL A;  3HVR A;  4FM2 A;  4E7K A;  4Z4G A;  2BDP A;  1C0M A;  1D5A A;  3QEI A;  4BDZ A;  4LD0 A;  1C1B A;  4W5N A;  3RMC A;  3LP1 A;  2Q3S A;  3SNN A;  1NK4 A;  5CY4 A;  3ZT2 A;  1JL1 A;  1JXE A;  2IOC A;  2FBT A;  3SUO A;  1ASU A;  1WNS A;  3RMA A;  1KFD A;  4DU3 A;  4HVJ A;  3KK2 A;  3MXM A;  3K5M A;  2OZS A;  4N76 A;  4Q0B A;  1J53 A;  1NOZ A;  3O4N A;  3U3G A;  5HRP A;  1XHX A;  4BE1 A;  4M3U A;  2HVH A;  5JS1 A;  4H4M A;  1S6Q A;  3AVL A;  4MQ3 A;  2KZM A;  4AHR A;  3LAK A;  4F3O A;  3AO4 A;  4I9L A;  1C1A A;  3CFP A;  3QEV A;  3LDS A;  5C24 A;  1RT3 A;  3RR8 A;  3OS2 A;  4RW7 A;  1SL1 A;  1I39 A;  3LWM A;  1TV6 A;  3AA2 A;  3AA4 A;  3VA3 A;  2DFE A;  4CHQ A;  1WLJ A;  3HP6 A;  5HP1 A;  5D3G A;  3QO9 A;  4FLW A;  3NF6 A;  3T19 A;  4UQG A;  2OYQ A;  4OLB A;  3TAF A;  3NGI A;  4CJL A;  3ZSQ A;  4DLG A;  4C8K A;  3QIP A;  1J54 A;  3ALY A;  3THV A;  3S3N A;  4ZTF A;  4F3T A;  4DSF A;  4EZ9 A;  1WSH A;  3OYA A;  1UAX A;  3IRX A;  4CEE A;  4E0D A;  3CFR A;  4DF4 A;  1CLQ A;  3AVJ A;  3HPH A;  1RIL A;  1IKX A;  3HPO A;  4B9L A;  4CF0 A;  5FRM A;  4LSL A;  4HUF A;  4B9N A;  3AO2 A;  1XI1 A;  3PX6 A;  2P51 A;  2D0B A;  4FLX A;  1TK8 A;  4K8X A;  5DK5 A;  3EYZ A;  3HXM A;  4CEF A;  2D0C A;  3QIN A;  3KTQ A;  3RMB A;  2KZZ A;  4RW9 A;  3V1O A;  4CES A;  4DF8 A;  2KW4 A;  2KQ2 A;  3PO5 A;  4FJ5 A;  3PUF A;  1A5V A;  1S9E A;  4DSK A;  3OYM A;  2G8I A;  4Z4I A;  3BDP A;  3SUP A;  1XWL A;  4CJS A;  4ID5 A;  3KLE A;  4DSJ A;  3O3H A;  1JLQ A;  4CGH A;  1ZBI A;  2E4L A;  1RT7 A;  1BHL A;  3C95 A;  3L2R A;  3NF8 A;  2GBZ A;  5FRO A;  3AVI A;  3ZT4 A;  3NE6 A;  4AIL C;  4KRF A;  1NK9 A;  3PX0 A;  4AHC A;  1RBR A;  1NJZ A;  1VSM A;  3O4Q A;  1LWC A;  4RW6 A;  5SWM A;  1RNH A;  1TVR A;  4OKE A;  1WSG A;  3AO3 A;  1C0U A;  4JS5 A;  2D5R A;  1RT1 A;  2W42 A;  3DOL A;  4W5Q A;  1NK8 A;  4TSX A;  4DSE A;  1U4B A;  1TGO A;  1L3S A;  2P5G A;  2O4I A;  1SKR A;  4Y1D A;  1D8Y A;  2B5J A;  3TAG A;  1ASW A;  3K58 A;  3ZT0 A;  1C6V A;  3F73 A;  1R0A A;  2E6M A;  1ASV A;  3RTV A;  1RBT A;  3OYH A;  3ULD A;  3TAQ A;  1TL3 A;  1NK6 A;  3NAE A;  4DTR A;  4JS4 A;  2Y1J A;  4HCB A;  3BGR A;  3LAL A;  1ZYQ A;  1QSY A;  3QNN A;  1UOC A;  3T1A A;  4CER A;  3IG1 A;  5C42 A;  1L3V A;  1Q9X A;  4ZTJ A;  3DMJ A;  1HNI A;  4DU1 A;  3ASM A;  3OYF A;  3VQD A;  3LWL A;  2PZS A;  1DTQ A;  1VSF A;  4CGJ A;  3HYF A;  4RW4 A;  1BL3 A;  5HRN A;  3U6F A;  3SCX A;  2ZQB A;  2P5O A;  2KTQ A;  1KLN A;  4ID1 A;  1K6Y A;  1WN7 A;  4KKO A;  3L2U A;  3VA0 A;  3V9Z A;  3DLB A;  4CK2 A;  4DS5 A;  4FJK A;  3DOK A;  1SL0 A;  3A2F A;  4KTW A;  5HBM A;  4FK4 A;  4E1M A;  1BCM A;  2F8S A;  4AHT A;  4CJ5 A;  2YNH A;  3HL8 A;  4IDK A;  1RT4 A;  3KKR A;  3MEE A;  1SL2 A;  4CJV A;  4FJG A;  3QLH A;  1VRU A;  4H8K A;  4CJU A;  4KI6 A;  4KHY A;  3L2W A;  1QS4 A;  4Z4F A;  2XY6 A;  1LW2 A;  2ZD1 A;  4M3Y A;  2HNZ A;  3LPT A;  3OYI A;  4CCH A;  2VG6 A;  4CJT A;  3IS9 A;  4AHU A;  4EP4 A;  3WNG A;  1HQU A;  1Q9Y A;  4FZY A;  3AVH A;  2YNI A;  1CZB A;  4CFA A;  1B9F A;  3CQ8 A;  2EHG A;  3V1R A;  4NCA A;  3AO5 A;  2RKI A;  3DRR A;  1QSS A;  2VWK A;  4CEO A;  4F2R A;  4DTJ A;  1TL1 A;  3AV9 A;  3TAN A;  1S1U A;  5I3U A;  4J2E A;  1W9H A;  3V9X A;  3I8D A;  3LAN A;  3SJJ A;  3RRH A;  4ZHR A;  4EZ6 A;  4CFD A;  2R7Y A;  4O0J A;  4J2D A;  1D9D A;  4CF1 A;  3E01 A;  1RDC A;  3UIQ A;  2G8U A;  2HW3 A;  2QKB A;  1BQN A;  2G8K A;  3VQ9 A;  1U45 A;  1GOB A;  1QHT A;  1TAQ A;  4IFY A;  4DQI A;  1EX4 A;  4I7F A;  1TKT A;  1NJX A;  4E19 A;  4QCL A;  2X6S A;  4FW2 A;  4J2B A;  1RBV A;  2I5J A;  3K59 A;  4DTO A;  3AVM A;  3L3U A;  5C25 A;  3PY8 A;  5I42 A;  4FZX C;  1C1C A;  4KI4 A;  4DTM A;  2HHS A;  1EP4 A;  1NKB A;  4IKF A;  1HRH A;  4KV8 A;  3TAB A;  2DFH A;  1J5O A;  4BDP A;  3HT3 A;  2GV9 A;  4KHW A;  1YT3 A;  3TR8 A;  4CHY A;  2ITG A;  3M8Q A;  4FLU A;  4Z4C A;  3OYJ A;  1CXQ A;  1VRT A;  3NFA A;  1JLG A;  4DQQ A;  4Y1C A;  4F2S A;  4B3O A;  1EKE A;  1L3T A;  1J9A A;  2RN2 A;  4MFB A;  4CEC A;  2OZM A;  1RTD A;  3LPU A;  4CFB A;  4HTU A;  2HHX A;  4JLH A;  1T7P A;  3H08 A;  3L2V A;  4OPK A;  1JXB A;  2OPQ A;  3WNF A;  2A1S A;  1S6P A;  3OVN A;  1HYZ A;  1KRP A;  4F8R A;  3DYA A;  3NGY A;  4N47 A;  3OYE A;  4N5S A;  5J2P A;  1Q8I A;  2GUI A;  2HHT A;  2VG7 A;  4E7L A;  1KTQ A;  4CED A;  4FK0 A;  1O1W A;  1QQC A;  4I2Q A;  1U48 A;  1LAV A;  4CHZ A;  3D0P A;  1SV5 A;  2AJQ A;  1A5W A;  4NYF A;  3QEW A;  5KGX A;  5KI6 A;  4M3Z A;  1JLB A;  1CZ9 A;  5HRS A;  4ELU A;  1ZBH A;  1WSE A;  5HRR A;  4CIE A;  4E7J A;  3RMD A;  1Z25 A;  2BE2 A;  2IAJ A;  3RRG A;  1HJR A;  4KTQ A;  2HHQ A;  1TK0 A;  4KHU A;  3L3V A;  3NH1 A;  4CEQ A;  4LH4 A;  3D45 A;  4CK1 A;  4NCG A;  3VQE A;  3G0Z A;  1WSJ A;  4Q5V A;  3IAY A;  4L8R B;  1S9G A;  4CJQ A;  3OJU A;  1ZBL A;  1C0T A;  2BAN A;  4C8M A;  4K8Z A;  4M3R A;  4ICL A;  4KO0 A;  5DMR A;  1FKO A;  3OS1 A;  2FBX A;  2RPI A;  3MEC A;  3QET A;  1JLA A;  3AA5 X;  2G8W A;  3SQ4 A;  3VN5 A;  2E6L A;  1TKZ A;  2XO7 A;  2JGU A;  4FJ7 A;  4M42 A;  2HHW A;  3DLE A;  2OPP A;  3OJS A;  1IG9 A;  3HK2 A;  1DTT A;  4E3S A;  3RWU A;  3KK3 A;  3HO1 A;  2X6N A;  4KHQ A;  1IKV A;  1KLM A;  2OPR A;  1B92 A;  4CFC A;  1D9F A;  4CEA A;  4FJN A;  1HNV A;  4E1N A;  3EZ5 A;  5JS2 A;  4LSN A;  1G15 A;  1S1T A;  3MEG A;  4IG0 A;  4DSI A;  3KD1 E;  3HJF A;  4DTP A;  2XY5 A;  1JLC A;  4B8A B;  2D0A A;  3S9H A;  1RCH A;  1LWE A;  1ZBF A;  1IKW A;  3KK1 A;  4DQP A;  4KHS A;  2KFN A;  2XY7 A;  4RG8 A;  4NYN A;  1T8E A;  4DTN A;  4FXD A;  3NF7 A;  5KTQ A;  3I0S A;  4DU4 A;  2PYJ A;  3OYD A;  2YNG A;  3CM5 A;  1RTI A;  3SQ1 A;  4CJW A;  4CGF A;  3ZT3 A;  3O3G A;  3F9K A;  3ZCM A;  2RF2 A;  4JRP A;  4PWD A;  4BDY A;  3CM6 A;  4BAC A;  1HPZ A;  4FM1 A;  4CHO A;  2YKN A;  4O4G A;  3TAP A;  3AA3 A;  2B6A A;  3P5J A;  4M45 A;  3TAM A;  4CF2 A;  1VSE A;  2WOM A;  1FKP A;  4W5O A;  1VSI A;  5J1E A;  1TKD A;  4B9T A;  4CJK A;  4B9V A;  3ZT1 A;  1LAW A;  1JLE A;  2HB5 A;  3KLI A;  2IDO A;  4H4O A;  3ZSY A;  3LP2 A;  2VG5 A;  3NBP A;  4CGD A;  4N56 A;  1VSD A;  3ITH A;  4YNQ A;  1NJW A;  3SZ2 A;  3VQA A;  2HHU A;  1S1W A;  3HP9 A;  1X9M A;  1DLO A;  3T3F A;  1BIS A;  4JRQ A;  1FXX A;  1N5Y A;  4ELV A;  2NUB A;  1RTJ A;  3G10 A;  4O0I A;  4EP5 A;  2HMI A;  3TAR A;  5HRO A;  4KHN A;  1WSI A;  3NHG A;  1YTA A;  5KRT A;  4CJ3 A;  4HUE A;  3KKS A;  1MU2 A;  3SQ2 A;  4KB1 A;  4G1Q A;  4PY5 A;  4M3X A;  1KSP A;  3MXJ A;  4CGI A;  1U49 A;  3VQC A;  4B9M A;  4FJX A;  1WAF A;  4CF8 A;  3LP3 A;  1NKC A;  3OYG A;  2XRI A;  4YFU A;  3SPZ A;  1KVB A;  2Z1G A;  1BIZ A;  4GW6 A;  3S3O A;  3NDK A;  1IKY A;  2HHV A;  1XC9 A;  1S1X A;  2QKK A;  1UA0 A;  4OPJ A;  1NOY A;  3SQ0 A;  1ZBU A;  3ZSW A;  1KFS A;  2PY5 A;  5E41 A;  3SV3 A;  1L3U A;  1LWF A;  5FDL A;  3VQQ A;  4DQS A;  4FLZ A;  3LZJ A;  4OKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...