4CFMB

Structure-based design of c8-substituted o6-cyclohexylmethoxyguanine cdk1 and 2 inhibitors.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 2
publication title 8-Substituted O6-Cyclohexylmethylguanine Cdk2 Inhibitors; Using Structure-Based Inhibitor Design to Optimise an Alternative Binding Mode.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 93
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4cfmB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4cfmB02
3DDQB 5HBHB 1W98B 2WMBB 1F5QB 5I5ZB 3BHUB 1ZP2A 3G33B 4CFWB 3F5XB 2C5OB 4IMYB 4F7NB 1O9KA 4YOZA 4EC8B 2UZLB 4BCKB 4CFUB 2PK2A 2WXVB 2UUEB 2UZBB 2C6TB 4TTHA 4BCGB 1OKWB 5HBEB 4BCOB 4OR5B 4EOQB 1URCB 2UZDB 3EIDB 1H1RB 1JSTB 2W9FA 1H1QB 2IW9B 3M03A 1KXUA 3LQ5B 3TNHB 1AD6A 4F6WB 2JGZB 2R7GA 3DOGB 1JSUB 1GY3B 4EOMB 4F7SB 1JKWA 4CRLB 1UNLD 1H1PB 5IDPB 4NSTB 3K7AM 1FVVB 2CJMB 5IF1B 4EOJB 4F6SB 1AISB 5BNJB 4OGRB 1UNHD 4BCIB 2C5VB 1JOWA 2W96A 4F70B 1H25B 1OL2B 2WPAB 3DDPB 3MI9B 4BCMB 4EC9B 1OKVB 4G6LB 4YOSA 1TFBA 2WEVB 3POMA 1VINA 3H4CA 2W9ZA 1QMZB 2X1NB 1D3UB 4BCPB 1VOLA 2WFYB 1XO2A 3QHWB 2QDJA 1VYWB 3EJ1B 3TNIB 2F2CA 5HQ0B 4EOSB 4KRCB 2C5XB 2W99A 4CFVB 3EOCB 3BLRB 3QHRB 1H27B 4EOOB 3MY5B 2I53A 1PKDB 4EONB 2IW6B 4F7JB 2PHGA 4KRDB 4YOOA 5HNBB 4CFXB 1H1SB 1UNGD 3BLQB 4RODA 1FINB 2C4GB 4BCFB 3RGFB 2CCHB 4EOPB 3BHTB 2EUFA 1N4MA 4EORB 4BCQD 5L2WB 4BCND 4CFUD 2IVXA 4EOLB 1OI9B 2PMIB 3TNWB 1GH6B 5HVYB 2B9RA 1GUXA 4ROEA 4ROCA 1OL1B 3O0GD 1GUXB 4F6UB 5EFQB 2WHBB 2C5NB 2WIPB 1BU2A 1C9BA 4BCHB 5ICPB 5CEIB 4Y72B 1H28B 2G9XB 4BCQB 4EOIB 1O9KB 4FX3B 4YC3B 3MY1B 5FGKB 4I3ZB 4BCNB 4EOKB 2UZEB 1G3NC 2BPMB 2I40B 2CCIB 5IDNB 5HBJB 1P5EB 3MIAB 1OIUB 1OIYB 3TN8B 5ACBA 5LMKB 2PK9B 2WIHB 4UN0A 1E9HB 1H24B 1H4LD 2V22B 4ELJA 5CYIB 3BLHB 4BCJB 1OGUB 4BCMD 4II5B 2WMAB 4CXAB 4CFMB 1H26B 2IW8B 4CFNB 5LQFB 2BKZB 4ELLA 2W2HA 3BHVB 4F7LB
chains in the Genus database with same CATH superfamily
3DDQB 2WMBB 4BY1X 1ENWA 5I5ZB 3F5XB 2C5OB 5EJCA 3A8MB 4YOZA 4BCKB 3TW7A 2PK2A 3PO3S 2KR6A 4TTHA 2QF7A 4BCGB 5HBEB 4OR5B 2W9FA 2AHJB 3DOGB 4EOMB 1JSUB 1FVVB 1AISB 3A8HB 2ZPGB 1OL2B 4G6LB 4M6VA 2DD5B 3H4CA 2W9ZA 2X1NB 3HO8A 2WFYB 2QDJA 3EJ1B 3TNIB 3X20B 4QSHA 3B57A 2W99A 3BLRB 3MY5B 4HNVA 5DQWA 3KHIA 2C4GB 1N4MA 4EORB 4BCQD 3BG9A 1GUXB 4JX6A 1C9BA 4BCHB 3X24B 1H28B 4BCQB 3QZ9B 4YC3B 5FGKB 3DL1A 4I3ZB 2QGSA 2ZPIB 2I40B 2ZPHB 5IDNB 1OIYB 4UN0A 2V22B 4HL4A 4BCJB 4CFMB 5LQFB 2W2HA 3BHVB 5HBHB 4OB2B 3A8OB 1F5QB 4CFWB 4IMYB 1O9KA 2CYZB 2C6TB 2ZZDB 1OKWB 4BCOB 2UZDB 2DMEA 1QLBA 2IW9B 3LQ5B 3VYHB 2DPPB 4F6SB 1E7PA 4AKGA 5BNJB 1UNHD 4ZGDB 2W96A 2WPAB 4EC9B 1OKVB 3BG5A 4JX4A 4YOSA 2G77A 1VINA 3HBLA 4BXXX 1QMZB 1D3UB 2DXBB 3WVEB 4EOSB 4KRCB 3QHRB 1H27B 4HLQA 4KRDB 4YOOA 1H1SB 2PJQA 1UNGD 4BCFB 3RGFB 2CCHB 2EUFA 4CFUD 1GH6B 2B9RA 3O0GD 4F6UB 2WHBB 5CEIB 4Y72B 4EOKB 1O9KB 2KMGA 2BPMB 2CCIB 1UGSB 1P5EB 5ACBA 1H24B 4ELJA 4BY7X 3GTMS 4BCMD 3HZJA 4CXAB 4CFNB 4ZGJB 1W98B 3G33B 1ZP2A 2ZCFB 4EC8B 2UZLB 4HNTA 2ZPBB 3HB9A 2UZBB 2BS3A 1URCB 3EIDB 3M03A 2CZ7B 1KXUA 4LOCA 2JGZB 4F6WB 1GY3B 4F7SB 1JKWA 1UNLD 1H1PB 5IDPB 3K7AM 2CJMB 3VKGA 4EOJB 4OGRB 4JX5A 4OB0B 4BCIB 3DTOA 4F70B 1H25B 1UGRB 1UGPB 3NDQA 4BBRM 4BCPB 2CZ0B 3QHWB 1VYWB 2F2CA 5HQ0B 2C5XB 3TW6A 4CFVB 3EOCB 1PKDB 4EONB 4F7JB 2PHGA 4CFXB 3QYHB 1IREB 4RODA 2DXCB 4EOPB 4BCND 4EOLB 1OI9B 2PMIB 3TNWB 5HVYB 1GUXA 4ROEA 5DQVA 1OL1B 5EFQB 3VKHA 2C5NB 2WIPB 1BU2A 1AHJB 3HHTB 2G9XB 4BCNB 4FX3B 3MY1B 3X28B 1G3NC 5HBJB 3MIAB 1OIUB 4AI6A 5CYIB 3BLHB 4NC6A 2DD4B 3X25B 2LW4A 1OGUB 4AKHA 4II5B 3QYBA 1UGQB 3BHUB 4F7NB 2BS2A 4MFEA 3QZ5B 4CFUB 2WXVB 2QDYB 1TD6A 2CZ6B 2D0QB 2UUEB 4EOQB 3QXEB 4ZGEB 2IN3A 1H1RB 1JSTB 3DJBA 1H1QB 3TNHB 1AD6A 2R7GA 4CRLB 4NSTB 5IF1B 4OB3B 2C5VB 1JOWA 3DDPB 4BCMB 3MI9B 5IHYA 2BS4A 1TFBA 1V29B 2WEVB 3POMA 1FKMA 3BG3A 1VOLA 1XO2A 4BBSM 2WJ9A 4EOOB 3WVDB 4AKIA 2I53A 2IW6B 3QWLA 5HNBB 3BLQB 1FINB 3BHTB 3QYGB 5L2WB 3VYGB 2IVXA 3X26B 4ROCA 2ZPFB 2ZPEB 2QQ8A 5ICPB 4EOIB 3A8GB 2UZEB 4OB1B 3TN8B 5LMKB 2PK9B 2WIHB 3A8LB 4MFDA 1E9HB 1H4LD 2CZ1B 4Z6YA 4MIMA 2WMAB 4FM4B 1H26B 2QFZA 2IW8B 3QYEA 4HNUA 2BKZB 4ELLA 4F7LB
chains in the Genus database with same CATH topology
3DDQB 5HBHB 1W98B 2WMBB 1F5QB 5I5ZB 3BHUB 1ZP2A 3G33B 4CFWB 3F5XB 2C5OB 4IMYB 4F7NB 1O9KA 4YOZA 4EC8B 2UZLB 4BCKB 4CFUB 2PK2A 2WXVB 2UUEB 2UZBB 2C6TB 4TTHA 4BCGB 1OKWB 5HBEB 4BCOB 4OR5B 4EOQB 1URCB 2UZDB 3EIDB 1H1RB 1JSTB 2W9FA 1H1QB 2IW9B 3M03A 1KXUA 3LQ5B 3TNHB 1AD6A 4F6WB 2JGZB 2R7GA 3DOGB 1JSUB 1GY3B 4EOMB 4F7SB 1JKWA 4CRLB 1UNLD 1H1PB 5IDPB 4NSTB 3K7AM 1FVVB 2CJMB 5IF1B 4EOJB 4F6SB 1AISB 5BNJB 4OGRB 1UNHD 4BCIB 2C5VB 1JOWA 2W96A 4F70B 1H25B 1OL2B 2WPAB 3DDPB 3MI9B 4BCMB 4EC9B 1OKVB 4G6LB 4YOSA 1TFBA 2WEVB 3POMA 1VINA 3H4CA 2W9ZA 1QMZB 2X1NB 1D3UB 4BCPB 1VOLA 2WFYB 1XO2A 3QHWB 2QDJA 1VYWB 3EJ1B 3TNIB 2F2CA 5HQ0B 4EOSB 4KRCB 2C5XB 2W99A 4CFVB 3EOCB 3BLRB 3QHRB 1H27B 4EOOB 3MY5B 2I53A 1PKDB 4EONB 2IW6B 4F7JB 2PHGA 4KRDB 4YOOA 5HNBB 4CFXB 1H1SB 1UNGD 3BLQB 4RODA 1FINB 2C4GB 4BCFB 3RGFB 2CCHB 4EOPB 3BHTB 2EUFA 1N4MA 4EORB 4BCQD 5L2WB 4BCND 4CFUD 2IVXA 4EOLB 1OI9B 2PMIB 3TNWB 1GH6B 5HVYB 2B9RA 1GUXA 4ROEA 4ROCA 1OL1B 3O0GD 1GUXB 4F6UB 5EFQB 2WHBB 2C5NB 2WIPB 1BU2A 1C9BA 4BCHB 5ICPB 5CEIB 4Y72B 1H28B 2G9XB 4BCQB 4EOIB 1O9KB 4FX3B 4YC3B 3MY1B 5FGKB 4I3ZB 4BCNB 4EOKB 2UZEB 1G3NC 2BPMB 2I40B 2CCIB 5IDNB 5HBJB 1P5EB 3MIAB 1OIUB 1OIYB 3TN8B 5ACBA 5LMKB 2PK9B 2WIHB 4UN0A 1E9HB 1H24B 1H4LD 2V22B 4ELJA 5CYIB 3BLHB 4BCJB 1OGUB 4BCMD 4II5B 2WMAB 4CXAB 4CFMB 1H26B 2IW8B 4CFNB 5LQFB 2BKZB 4ELLA 2W2HA 3BHVB 4F7LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DDQ B;  5HBH B;  1W98 B;  2WMB B;  1F5Q B;  5I5Z B;  3BHU B;  1ZP2 A;  3G33 B;  4CFW B;  3F5X B;  2C5O B;  4IMY B;  4F7N B;  1O9K A;  4YOZ A;  4EC8 B;  2UZL B;  4BCK B;  4CFU B;  2PK2 A;  2WXV B;  2UUE B;  2UZB B;  2C6T B;  4TTH A;  4BCG B;  1OKW B;  5HBE B;  4BCO B;  4OR5 B;  4EOQ B;  1URC B;  2UZD B;  3EID B;  1H1R B;  1JST B;  2W9F A;  1H1Q B;  2IW9 B;  3M03 A;  1KXU A;  3LQ5 B;  3TNH B;  1AD6 A;  4F6W B;  2JGZ B;  2R7G A;  3DOG B;  1JSU B;  1GY3 B;  4EOM B;  4F7S B;  1JKW A;  4CRL B;  1UNL D;  1H1P B;  5IDP B;  4NST B;  3K7A M;  1FVV B;  2CJM B;  5IF1 B;  4EOJ B;  4F6S B;  1AIS B;  5BNJ B;  4OGR B;  1UNH D;  4BCI B;  2C5V B;  1JOW A;  2W96 A;  4F70 B;  1H25 B;  1OL2 B;  2WPA B;  3DDP B;  3MI9 B;  4BCM B;  4EC9 B;  1OKV B;  4G6L B;  4YOS A;  1TFB A;  2WEV B;  3POM A;  1VIN A;  3H4C A;  2W9Z A;  1QMZ B;  2X1N B;  1D3U B;  4BCP B;  1VOL A;  2WFY B;  1XO2 A;  3QHW B;  2QDJ A;  1VYW B;  3EJ1 B;  3TNI B;  2F2C A;  5HQ0 B;  4EOS B;  4KRC B;  2C5X B;  2W99 A;  4CFV B;  3EOC B;  3BLR B;  3QHR B;  1H27 B;  4EOO B;  3MY5 B;  2I53 A;  1PKD B;  4EON B;  2IW6 B;  4F7J B;  2PHG A;  4KRD B;  4YOO A;  5HNB B;  4CFX B;  1H1S B;  1UNG D;  3BLQ B;  4ROD A;  1FIN B;  2C4G B;  4BCF B;  3RGF B;  2CCH B;  4EOP B;  3BHT B;  2EUF A;  1N4M A;  4EOR B;  4BCQ D;  5L2W B;  4BCN D;  4CFU D;  2IVX A;  4EOL B;  1OI9 B;  2PMI B;  3TNW B;  1GH6 B;  5HVY B;  2B9R A;  1GUX A;  4ROE A;  4ROC A;  1OL1 B;  3O0G D;  1GUX B;  4F6U B;  5EFQ B;  2WHB B;  2C5N B;  2WIP B;  1BU2 A;  1C9B A;  4BCH B;  5ICP B;  5CEI B;  4Y72 B;  1H28 B;  2G9X B;  4BCQ B;  4EOI B;  1O9K B;  4FX3 B;  4YC3 B;  3MY1 B;  5FGK B;  4I3Z B;  4BCN B;  4EOK B;  2UZE B;  1G3N C;  2BPM B;  2I40 B;  2CCI B;  5IDN B;  5HBJ B;  1P5E B;  3MIA B;  1OIU B;  1OIY B;  3TN8 B;  5ACB A;  5LMK B;  2PK9 B;  2WIH B;  4UN0 A;  1E9H B;  1H24 B;  1H4L D;  2V22 B;  4ELJ A;  5CYI B;  3BLH B;  4BCJ B;  1OGU B;  4BCM D;  4II5 B;  2WMA B;  4CXA B;  4CFM B;  1H26 B;  2IW8 B;  4CFN B;  5LQF B;  2BKZ B;  4ELL A;  2W2H A;  3BHV B;  4F7L B; 
#chains in the Genus database with same CATH topology
 3DDQ B;  2WMB B;  4BY1 X;  1ENW A;  5I5Z B;  3F5X B;  2C5O B;  5EJC A;  3A8M B;  4YOZ A;  4BCK B;  3TW7 A;  2PK2 A;  3PO3 S;  2KR6 A;  4TTH A;  2QF7 A;  4BCG B;  5HBE B;  4OR5 B;  2W9F A;  2AHJ B;  3DOG B;  4EOM B;  1JSU B;  1FVV B;  1AIS B;  3A8H B;  2ZPG B;  1OL2 B;  4G6L B;  4M6V A;  2DD5 B;  3H4C A;  2W9Z A;  2X1N B;  3HO8 A;  2WFY B;  2QDJ A;  3EJ1 B;  3TNI B;  3X20 B;  4QSH A;  3B57 A;  2W99 A;  3BLR B;  3MY5 B;  4HNV A;  5DQW A;  3KHI A;  2C4G B;  1N4M A;  4EOR B;  4BCQ D;  3BG9 A;  1GUX B;  4JX6 A;  1C9B A;  4BCH B;  3X24 B;  1H28 B;  4BCQ B;  3QZ9 B;  4YC3 B;  5FGK B;  3DL1 A;  4I3Z B;  2QGS A;  2ZPI B;  2I40 B;  2ZPH B;  5IDN B;  1OIY B;  4UN0 A;  2V22 B;  4HL4 A;  4BCJ B;  4CFM B;  5LQF B;  2W2H A;  3BHV B;  5HBH B;  4OB2 B;  3A8O B;  1F5Q B;  4CFW B;  4IMY B;  1O9K A;  2CYZ B;  2C6T B;  2ZZD B;  1OKW B;  4BCO B;  2UZD B;  2DME A;  1QLB A;  2IW9 B;  3LQ5 B;  3VYH B;  2DPP B;  4F6S B;  1E7P A;  4AKG A;  5BNJ B;  1UNH D;  4ZGD B;  2W96 A;  2WPA B;  4EC9 B;  1OKV B;  3BG5 A;  4JX4 A;  4YOS A;  2G77 A;  1VIN A;  3HBL A;  4BXX X;  1QMZ B;  1D3U B;  2DXB B;  3WVE B;  4EOS B;  4KRC B;  3QHR B;  1H27 B;  4HLQ A;  4KRD B;  4YOO A;  1H1S B;  2PJQ A;  1UNG D;  4BCF B;  3RGF B;  2CCH B;  2EUF A;  4CFU D;  1GH6 B;  2B9R A;  3O0G D;  4F6U B;  2WHB B;  5CEI B;  4Y72 B;  4EOK B;  1O9K B;  2KMG A;  2BPM B;  2CCI B;  1UGS B;  1P5E B;  5ACB A;  1H24 B;  4ELJ A;  4BY7 X;  3GTM S;  4BCM D;  3HZJ A;  4CXA B;  4CFN B;  4ZGJ B;  1W98 B;  3G33 B;  1ZP2 A;  2ZCF B;  4EC8 B;  2UZL B;  4HNT A;  2ZPB B;  3HB9 A;  2UZB B;  2BS3 A;  1URC B;  3EID B;  3M03 A;  2CZ7 B;  1KXU A;  4LOC A;  2JGZ B;  4F6W B;  1GY3 B;  4F7S B;  1JKW A;  1UNL D;  1H1P B;  5IDP B;  3K7A M;  2CJM B;  3VKG A;  4EOJ B;  4OGR B;  4JX5 A;  4OB0 B;  4BCI B;  3DTO A;  4F70 B;  1H25 B;  1UGR B;  1UGP B;  3NDQ A;  4BBR M;  4BCP B;  2CZ0 B;  3QHW B;  1VYW B;  2F2C A;  5HQ0 B;  2C5X B;  3TW6 A;  4CFV B;  3EOC B;  1PKD B;  4EON B;  4F7J B;  2PHG A;  4CFX B;  3QYH B;  1IRE B;  4ROD A;  2DXC B;  4EOP B;  4BCN D;  4EOL B;  1OI9 B;  2PMI B;  3TNW B;  5HVY B;  1GUX A;  4ROE A;  5DQV A;  1OL1 B;  5EFQ B;  3VKH A;  2C5N B;  2WIP B;  1BU2 A;  1AHJ B;  3HHT B;  2G9X B;  4BCN B;  4FX3 B;  3MY1 B;  3X28 B;  1G3N C;  5HBJ B;  3MIA B;  1OIU B;  4AI6 A;  5CYI B;  3BLH B;  4NC6 A;  2DD4 B;  3X25 B;  2LW4 A;  1OGU B;  4AKH A;  4II5 B;  3QYB A;  1UGQ B;  3BHU B;  4F7N B;  2BS2 A;  4MFE A;  3QZ5 B;  4CFU B;  2WXV B;  2QDY B;  1TD6 A;  2CZ6 B;  2D0Q B;  2UUE B;  4EOQ B;  3QXE B;  4ZGE B;  2IN3 A;  1H1R B;  1JST B;  3DJB A;  1H1Q B;  3TNH B;  1AD6 A;  2R7G A;  4CRL B;  4NST B;  5IF1 B;  4OB3 B;  2C5V B;  1JOW A;  3DDP B;  4BCM B;  3MI9 B;  5IHY A;  2BS4 A;  1TFB A;  1V29 B;  2WEV B;  3POM A;  1FKM A;  3BG3 A;  1VOL A;  1XO2 A;  4BBS M;  2WJ9 A;  4EOO B;  3WVD B;  4AKI A;  2I53 A;  2IW6 B;  3QWL A;  5HNB B;  3BLQ B;  1FIN B;  3BHT B;  3QYG B;  5L2W B;  3VYG B;  2IVX A;  3X26 B;  4ROC A;  2ZPF B;  2ZPE B;  2QQ8 A;  5ICP B;  4EOI B;  3A8G B;  2UZE B;  4OB1 B;  3TN8 B;  5LMK B;  2PK9 B;  2WIH B;  3A8L B;  4MFD A;  1E9H B;  1H4L D;  2CZ1 B;  4Z6Y A;  4MIM A;  2WMA B;  4FM4 B;  1H26 B;  2QFZ A;  2IW8 B;  3QYE A;  4HNU A;  2BKZ B;  4ELL A;  4F7L B; 
#chains in the Genus database with same CATH homology
 3DDQ B;  5HBH B;  1W98 B;  2WMB B;  1F5Q B;  5I5Z B;  3BHU B;  1ZP2 A;  3G33 B;  4CFW B;  3F5X B;  2C5O B;  4IMY B;  4F7N B;  1O9K A;  4YOZ A;  4EC8 B;  2UZL B;  4BCK B;  4CFU B;  2PK2 A;  2WXV B;  2UUE B;  2UZB B;  2C6T B;  4TTH A;  4BCG B;  1OKW B;  5HBE B;  4BCO B;  4OR5 B;  4EOQ B;  1URC B;  2UZD B;  3EID B;  1H1R B;  1JST B;  2W9F A;  1H1Q B;  2IW9 B;  3M03 A;  1KXU A;  3LQ5 B;  3TNH B;  1AD6 A;  4F6W B;  2JGZ B;  2R7G A;  3DOG B;  1JSU B;  1GY3 B;  4EOM B;  4F7S B;  1JKW A;  4CRL B;  1UNL D;  1H1P B;  5IDP B;  4NST B;  3K7A M;  1FVV B;  2CJM B;  5IF1 B;  4EOJ B;  4F6S B;  1AIS B;  5BNJ B;  4OGR B;  1UNH D;  4BCI B;  2C5V B;  1JOW A;  2W96 A;  4F70 B;  1H25 B;  1OL2 B;  2WPA B;  3DDP B;  3MI9 B;  4BCM B;  4EC9 B;  1OKV B;  4G6L B;  4YOS A;  1TFB A;  2WEV B;  3POM A;  1VIN A;  3H4C A;  2W9Z A;  1QMZ B;  2X1N B;  1D3U B;  4BCP B;  1VOL A;  2WFY B;  1XO2 A;  3QHW B;  2QDJ A;  1VYW B;  3EJ1 B;  3TNI B;  2F2C A;  5HQ0 B;  4EOS B;  4KRC B;  2C5X B;  2W99 A;  4CFV B;  3EOC B;  3BLR B;  3QHR B;  1H27 B;  4EOO B;  3MY5 B;  2I53 A;  1PKD B;  4EON B;  2IW6 B;  4F7J B;  2PHG A;  4KRD B;  4YOO A;  5HNB B;  4CFX B;  1H1S B;  1UNG D;  3BLQ B;  4ROD A;  1FIN B;  2C4G B;  4BCF B;  3RGF B;  2CCH B;  4EOP B;  3BHT B;  2EUF A;  1N4M A;  4EOR B;  4BCQ D;  5L2W B;  4BCN D;  4CFU D;  2IVX A;  4EOL B;  1OI9 B;  2PMI B;  3TNW B;  1GH6 B;  5HVY B;  2B9R A;  1GUX A;  4ROE A;  4ROC A;  1OL1 B;  3O0G D;  1GUX B;  4F6U B;  5EFQ B;  2WHB B;  2C5N B;  2WIP B;  1BU2 A;  1C9B A;  4BCH B;  5ICP B;  5CEI B;  4Y72 B;  1H28 B;  2G9X B;  4BCQ B;  4EOI B;  1O9K B;  4FX3 B;  4YC3 B;  3MY1 B;  5FGK B;  4I3Z B;  4BCN B;  4EOK B;  2UZE B;  1G3N C;  2BPM B;  2I40 B;  2CCI B;  5IDN B;  5HBJ B;  1P5E B;  3MIA B;  1OIU B;  1OIY B;  3TN8 B;  5ACB A;  5LMK B;  2PK9 B;  2WIH B;  4UN0 A;  1E9H B;  1H24 B;  1H4L D;  2V22 B;  4ELJ A;  5CYI B;  3BLH B;  4BCJ B;  1OGU B;  4BCM D;  4II5 B;  2WMA B;  4CXA B;  4CFM B;  1H26 B;  2IW8 B;  4CFN B;  5LQF B;  2BKZ B;  4ELL A;  2W2H A;  3BHV B;  4F7L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...