4CFSA

Crystal structure of the cofactor-devoid 1-h-3-hydroxy-4- oxoquinaldine 2,4-dioxygenase (hod) catalytically inactive h251a variant complexed with its natural substrate 1-h-3-hydroxy-4- oxoquinaldine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
273
structure length
273
Chain Sequence
DTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDADFRVIVPNWRGHGLSPSEVPDFGYQEQVKDALEILDQLGVETFLPVSHSHGGWVLVELLEQAGPERAPRGIIMDWLMWAPKPDFAKSLTLLKDPERWREGTHGLFDVWLDGHDEKRVRHHLLEEMADYGYDCWGRSGRVIEDAYGRNGSPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPWFSYAKLGGPTAFPAIDVPDRAAVHIREFATAIRQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Origin of the Proton-Transfer Step in the Cofactor-Free 1-H-3-Hydroxy-4-Oxoquinaldine 2,4- Dioxygenase: Effect of the Basicity of an Active Site His Residue.
pubmed doi rcsb
source organism Arthrobacter nitroguajacolicus
molecule tags Oxidoreductase
molecule keywords 1-H-3-HYDROXY-4-OXOQUINALDINE 2,4-DIOXYGENASE
total genus 102
structure length 273
sequence length 273
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.48: 3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 4cfsA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cfsA01
4DMCA 5EIAA 4BAZA 4H0CA 1ZI8A 2JEZA 4CCYB 2OG1A 2D5LA 1WB6A 3GELA 2XDWA 1HL7A 2WU4A 2WG0A 2XUFA 2RHWA 4G4IA 1LPAB 4BTVA 3TEJA 1CUBA 3PF8A 1EB9A 1CUWA 4OCZA 4B0OA 3ESAA 3H17A 4W1RA 3STWA 2YH2A 3C8DA 5F4ZA 5IVKA 1DX6A 3STVA 1WPXA 2FJPA 4OPMA 3HRHA 3I6ZA 4MEAA 1N5RA 1JU4A 4TGLA 1MNAA 4YK7A 1L7QA 2WIFA 4JYPA 4AQDA 3O4HA 1JI3A 4G4GA 2CUTA 4UFNA 4B0PA 1DWOA 4ZV7A 5D7BA 4AB1A 5HQ3A 1AQLA 1JMYA 4BC0A 3AILA 4OB8A 1IUPA 4HTAA 3PUHA 2YASA 4EBBA 4N8EA 1E89A 1HBJA 4Y2YA 5HFAA 1DQZA 2G4LA 3QPDA 6YASA 5JAPA 4UUQA 5KREA 2B20A 5LKAA 1KEZA 3EQ7A 3FYTA 1EB8A 1XZHA 2WHPB 4E15A 1WOMA 4BE4A 1CUDA 5ALOA 2QMQA 4EHBA 1H23A 5AM1A 3HSSA 1CUGA 1QOZA 4X3CA 1B41A 3W06A 2PUJA 5ALJA 1FFBA 3FAKA 1AGYA 2XUJA 3O4GA 5T4HA 5LIPA 1UOQA 1OILA 2DR0A 2XE4A 1UOOA 4CG1A 2Z8ZA 2XUOA 4RNCA 5KWJA 1XRMA 4KE6A 3EQ9A 1CUAA 4F60A 2EEPA 5AJHA 4IH1A 3WJ2A 2V98A 4JUIA 2NW6A 2WG2A 3SWWA 3PFCA 5J3JA 2VF2A 3PICA 4B85A 1P0IA 3AIMA 2JEYA 1XKLA 2WJ6A 2YYSA 3GUUA 3QZUA 4B84A 4P9NA 2XUDA 2XLCA 3JWEA 4CCWA 5EIEA 1QIMA 1YB7A 4AMYA 3D0KA 3VXKA 1CPYA 2B4KA 2RGUA 3V9AA 1DWQA 4U2EA 2BUCA 5ALFA 1H2YA 5ALPA 5IH7A 5AH0A 4RE5A 2G5PA 3G0DA 1AZWA 3WZMA 3IURA 4UHDA 4BRSA 5ALXA 1ZD4A 3GA7A 3T4UA 1X2EA 1RWQA 3WWOA 2CMFA 4XX1A 4F0JA 4H7FA 3KWJA 4H7KA 3YASA 2O7RA 1JJFA 1VKHA 3QMVA 3EQ8A 3Q0TA 4DMFA 3H2GA 5DYYA 4Q82A 3NUZA 4DGQA 3BIXA 4IH4A 1ZICA 2QKYA 2IITA 4FWBA 1DTEA 1VA5A 4A23A 4L9AA 3UMJA 5AOCA 5LZ7A 4W9RA 4Z49A 5DTJA 3U1TA 2WILA 1TAHA 1ZGCA 4IHAA 2VAVA 3K2IA 3WL5A 1WHTA 2BJHA 5C8VA 1TCAA 2WIJA 1W4LA 2XMRA 1L7AA 2IX9A 4LHEA 2OAEA 5CT6A 5EGNA 1UOPA 4UHBA 2O2IA 4X92A 5FPQA 2XUIA 2PSFA 3I2JA 4QA9A 4ARBA 4ZV9A 1U4NA 4FKBA 1PJAA 4ZRDA 1IUOA 3IUJA 2HM7A 3H04A 4U2GA 4DNOA 2ZSHA 1J2EA 3I6MA 4BVKA 2QTBA 5AI4A 1CUFA 1UFOA 4C87A 1IUNA 1MO2A 1F8UA 3WL7A 4QDXA 3EIOA 4J0JA 2WHPA 3FVTA 5D3ZA 4HS9A 1XKTA 1Z68A 2GYVA 3WL8A 2VJBA 3WA6A 4BBZA 3L1HA 4UPDA 1L7RA 5ALZA 1XRNA 1VLQA 4EY7A 3ANTA 1WB4A 3WWCA 3BE8A 2Y6UA 5ALLA 2R8BA 2XQFA 4GW3A 1DU4A 3C6YA 3KOOA 3I2IA 4DSAA 1FFAA 1WHSA 3BF8A 2PX6A 2OCIA 5ISMA 1XZBA 3NGMA 3ZLVA 1EDDA 1K6EA 1MTZA 1UZAA 1XZCA 3WLAA 3WL6A 3PF9A 4J7AA 1C7JA 1QIEA 3ICWA 1R88A 1XZDA 1YAJA 2BCEA 5HF9A 4EY5A 2Z5GA 2X5XA 5CMLA 2CB9A 2WLSA 2WIDA 1BEEA 1HQDA 3C45A 4KRXA 3RLIA 3EBLA 4C89A 5AK4A 3KDAA 1BU8A 4LXGA 1XZEA 2ZJ6A 4FMPA 4QE3A 2H9YA 3W05A 1CEXA 5E2IA 2VJDA 1TCBA 5H3HA 1UXOA 3W2TA 4JYMA 1MU0A 3BDVA 5ALHA 3F8SA 1CFJA 2XMGA 5A62A 1R4ZA 4KJXA 3OG9A 2XT0A 1ETHA 4G8CA 2JGFA 3I1YA 1HKHA 4WDRA 1XZMA 5FXMA 1C4XA 3I28A 3WKCA 2QVBA 4ZI5A 5A7HA 3I2HA 2PL5A 3G7NA 4E14A 3C43A 2WUDA 1GQSA 3DYIA 4J0DA 5ALNA 3G9XA 2HU8A 5A71A 2GZSA 5EHZA 4FHZA 1EHYA 1K63A 3WK4A 2G63A 4W1QA 4BE9A 3OURA 1DT5A 4EUSA 2DHDA 4G9EA 3I1IA 2V9ZA 1XLWA 4G8DA 5AKZA 3FNBA 5LZ2A 3HI4A 3TGLA 2ZJ7A 1IZ8A 3VISA 5AKIA 1P0QA 4LYEA 3QH4A 5HK9A 3WQHA 1W52X 3EF3A 1FSSA 3G9ZA 2AJBA 1ODTC 4DMKA 2GBGA 2XMZA 1ACJA 1A8QA 3DS8A 1CLEA 1GGVA 3G0GA 2WFLA 5LYYA 1CUHA 3FYUC 1FFEA 2VAXA 3WYNA 4BP9A 1LPOA 4AZ0A 3F9CA 3R41A 5EHXA 3O9VA 4FFVA 4CFSA 4C88A 3BWXA 2O2GA 3IA2A 3CN7A 2ROQA 3STYA 4UHFA 5HF8A 3SC2A 2GYUA 2QXTA 4JH0A 4YPVA 4X97A 1F6WA 3HC7A 2QRUA 1MX5A 5EHNA 4PV7A 1XQWA 3QYJA 4B9EA 4X6XA 4AO7A 4DNQA 3H2HA 4H7EA 4M0FA 1XZIA 4G9GA 4W1PA 1TIBA 3A2NA 1XFDA 4BCDA 4OUKX 5BV7A 4B80A 1FFDA 3R40A 1TK3A 3T52A 4KEAA 3DOIA 1W76A 1XLVA 4GWLA 4JEIA 5AKYA 3V1KA 3WZLA 4IH9A 1ODCA 2VT6A 1J1IA 4QDOA 4XVCA 1QONA 4J0CA 5LKRA 4J0HA 3G0IA 2RHTA 4BCBA 5JAOA 3STUA 4F5ZA 1CUSA 3E4DA 1LBSA 2ZYHA 4QZVA 4EB0A 4X93A 4PSCA 5E4YA 4GLBA 1OCEA 1UK6A 1NU6A 4RGYA 2HIHA 2JF0A 4I19A 2BUBA 4Q3LA 4H7HA 3PE6A 3BJMA 2DCMA 4OYLA 4K6KA 2H7CA 5IVHA 4BDTA 3OTQA 5KBYA 1E66A 2JGEA 3HZOA 4KE7A 5A7GA 1F0PA 1E5TA 1J07A 2XMQA 3HJUA 4H77A 4UBIA 5FP0A 1TRHA 3LS2A 1UWCA 1EDBA 3E0XA 4G5XA 2XMSA 3FLEA 3IDAA 4AN1A 1QZ3A 3M83A 3S2ZA 5I8PA 5K3EA 3D2AA 1TKRA 1M33A 3ILSA 4DNFA 1LNSA 2I3ZA 4HRYA 4IO0A 1ISPA 4OSEA 4B83A 3QMMA 4BDSA 2RAUA 5DNUA 2QS9A 1XZKA 3FLAA 2XUPA 4MWSA 3RARA 1QIFA 4L0CA 1QIDA 1IVYA 4UFPA 5BWCA 1QGED 3X3HA 3RK4A 3ZV7A 5I7UA 3QBJA 1H2WA 2XQGA 3WWPA 4A5SA 5JZSA 1LZKA 3WKEA 3ZLTA 2PPLA 5JASA 4KAJA 1YR2A 3UUEA 3H1BA 1XZFA 3RKSA 2EDCA 2JGKA 2J3QA 2ZSIA 4DTCA 3HACA 4L72A 5ALDA 1VJ5A 4D9JA 4EZIA 4LXHA 2PSEA 1VE6A 3AFIA 3DQZA 5JALA 3DL7A 4EA6A 4W63A 2JGLA 1Q0RA 2WHRA 1AMNA 4X6YA 1Q83A 4ZXFA 3IUMA 1JMKC 1VE7A 2VT7A 4P08A 4AMZA 3IVMA 2XQJA 1HLGA 1C7IA 2RONA 1QIHA 1EDEA 2VQ6A 4UHHA 1YA8A 2WIGA 2ES4A 1IMJA 5CT9A 1S8OA 4WY5A 3C6ZA 4MEBA 3G9UA 2DHCA 3DOHA 1X2BA 2WFMA 5BOVA 4KE9A 4BVLA 5HF6A 3B5EA 3IIIA 5ALGA 4ARAA 2PM8A 4ROTA 2XB6A 3ESCA 1EK1A 3DEAA 1BEZA 2HA0A 1Y37A 4C4XA 1LPSA 4Y2QA 5LZ4A 3I2GA 2WJ3A 1R3DA 3D2BA 5AHXA 2JGIA 4DLNA 3FYUB 1GKKA 5JANA 4P93A 1GPNA 1GT6A 1N5MA 3PUIA 3WWDA 4QLAA 3PDCA 5HFNA 4K5QA 4OB6A 5A7FA 2PU7A 2XUKA 3A70A 1HDEA 4C4ZA 2HU7A 1ACLA 3C5WP 2QUAA 3WK9A 1RYYA 4AO6A 2G5TA 1U2EA 3AZQA 4FLMA 5JAUA 2WQZA 3GZJA 5I9IA 3KSRA 4K6HA 4H18A 4BC1A 2GBIA 4PNZA 2OCGA 3M3DA 3ZWQA 4FLEA 1VZ3A 1BE0A 2Q0XA 4C6HA 1OXMA 2VSQA 1ZD3A 5EI5A 4MJ3A 1QLWA 3F96A 1ZI6A 3DJYA 4UBOA 3QITA 4QEKA 1PFQA 2DFPA 1T2NA 4BCCA 1WM1A 5AKLA 5AOAA 3FYUA 3Q8WA 4K6GA 4TVKA 5DYTA 3CN9A 2JGJA 1H22A 1FJ2A 2PSHA 2YXPX 4C4YA 2FJ0A 5KWIA 1YAHA 5JD6A 4CIBA 1CVLA 3M81A 1XZGA 2WIKA 1BS9A 5LZ5A 3WKBA 2HFKA 2PSJA 4EY4A 4W1SA 4MQMA 3DKRA 3B3QA 5AM0A 5ALUA 2CBGA 2VTVA 1JT2A 3R3XA 2XMDA 2I03A 3V1MA 1ZOIA 3I2FA 4BP8A 1ORVA 3VJLA 4BZZA 1YSCA 3U0VA 2ECFA 4AX4A 1MX1A 5HKAA 3KWFA 2K2QB 5FPPA 4DNPA 3DLTA 4FBMA 5AI0A 5DNVA 4N5IX 3I2KA 4QWMA 5LP1A 3BL8A 1EXWA 5DLPA 5SYNA 1MNQA 4X71A 2WFZA 4H7JA 4B82A 5CH3A 1EH5A 2WFLB 4PQEA 3A2LA 2I78A 4Q3KA 3AZPA 2XQIA 3JW8A 1SCKA 2J4FA 5AKHA 2WM2A 4GDMA 2DQYA 3ANSA 1P0MA 3ED1A 2O7VA 2WG1A 4X6UA 5IKXA 4X7BA 3DCNA 2ZVDA 5A2GA 4L3WA 4G8BA 1H2ZA 3G02A 4WY8A 1BRTA 2XI4A 5AIAA 5K3FB 3WMRA 2B61A 3UUFA 1AKNA 2BAGA 4B6GA 1E3QA 1EI9A 1LGYA 4OU4A 1W75A 4GECA 4N8DA 4KAAA 1XQXA 5CW2A 4X94A 4J0GA 2HL6A 3FCXA 1MAAA 2GBCA 2Z3ZA 4FDMA 5AKGA 5C81A 1XROA 4LIPD 2Z3WA 4BVJA 4GI1A 3TRDA 5HQ3B 1UKAA 5JADA 2Z8XA 5CRIA 1XRLA 2H7YA 5AI6A 5FLKA 3VJMA 5JD4A 4XWGA 5HK8A 4Y2JA 3O4JA 5D6OA 1Q84A 3MUNA 4OB7A 2HA2A 5JYCA 4Y2UA 1N8SA 2C58A 3W9BA 5CXXA 3BXPA 1Y7HA 3O0DA 4G4JA 1ODSA 1KU0A 1YS2X 1WCYA 2WUGA 3DD5A 1K8QA 1VA4A 2OGZA 4QDTA 4U2FA 4HAIA 3AIKA 5AKXA 5K3DA 4B9AA 2QJWA 4HRXA 3WWEA 3HXKA 5CXUA 4G1FA 3O4IA 1YS1X 3KXPA 1JJBA 2W22A 3GBSA 2C5GA 4J03A 4QNNA 1GQRA 1QJ4A 2ACEA 3QVMA 4X91A 1X70A 2VJCA 3AUKA 2PUHA 4U2CA 1UKCA 4RPCA 4UHCA 3E1GA 3NOXA 3DDUA 3STXA 4Y2PA 3D59A 2UZ0A 1O6GA 1BCSA 3A2MA 5ALSA 2WTNA 1SCQA 4XIIA 5LLSA 2Y6VA 1XQYA 4C01A 1ZGBA 1CUCA 3FSGA 4UBLA 1FFCA 3HEAA 1NU8A 3ESBA 1K4YA 3LIIA 2C5FA 4BAUA 1XRQA 1XRPA 1AURA 2C0QA 4HXGA 2BGRA 3D3NA 1TQHA 4F21A 3D4LA 2AJLI 1Y7IA 1XQVA 1T4MA 4P92A 2HA3A 3NWOA 5AK3A 5FKJA 2Y2VA 2J4CA 1USWA 1CRLA 1EVQA 3O95A 4WFKA 1R9NA 3WK8A 5K3AA 2QT9A 1U65A 1W1IA 2QOEA 4Y2XA 1CUEA 4OYYA 2WUEA 4FOLA 5DTIA 3WKAA 3HABA 2AJDA 2H1IA 4UBJA 4RE6A 3VVLA 5AI5A 1SOMA 2OQVA 1XZJA 3DYVA 1LPBB 2ZYIA 5FUMA 2Y2UA 2WJ4A 5HZGA 1MJ5A 4LYDA 3IBTA 1TCCA 3W04A 3BDIA 3SX4A 1QIIA 3IULA 1ZI9A 4WDQA 2ORYA 2ZYSA 5DYWA 1SC9A 2HFJA 1BN6A 5CBKA 2H7XA 3WK6A 3QMWA 4PW0A 5ALIA 1P0PA 5EIHA 1A8UA 1EINA 4ZWNA 1MN6A 3L1JA 3WIBA 4OU5A 4HZGA 3OPMA 1CIJA 2WU3A 2E3JA 3HYSA 2OGTA 1BROA 5D3KA 4BTLA 3ESDA 1CUXA 4FNGA 1QTRA 2HA7A 5HF5A 2QM0A 1MT3A 1UK8A 2WSLA 1EX9A 3PI6A 4M0MA 4BATA 3SK0A 3G0CA 1Q0ZA 3OM8A 3DNMA 2O2HA 1PV1A 5ALYA 3QPAA 4X00A 1RP1A 4N5HX 2B9VA 1QFMA 2AJ8A 1JFRA 1WPRA 3CXUA 4QWWA 3V48A 5FOQA 5HKBA 4WFIA 1WB5A 2ZJFA 3WK7A 1R50A 3WJ1A 5T4BA 3H2JA 3VKFA 3WI7A 2JGMA 1U8EA 1UK9A 4FBLA 3R3UA 1E8DA 3AJAA 1XZAA 4A16A 1YCDA 1CUZA 3VDXA 1G4HA 3LCRA 2PU5A 2FUKA 2JIDA 5ALWA 5AKKA 2HU5A 2XUHA 5ALEA 1CV2A 5CT8A 1UK7A 2J3DA 1GZ7A 2IIVA 2VATA 4TPKA 4XJVA 4ZGBA 5AM3A 5AI9A 4QLOA 4GXNA 3RM3A 1W6RA 2WKWA 3MGAA 5K3FA 4MXDA 2VEOA 2C0PA 3C8HA 4HXFB 1HPLA 1QO9A 3IUNA 1O6FA 2HA4A 4V2IA 1CUJA 4DM7A 1SFRA 5CH5A 2PKYX 1VXRA 5ALRA 1JU3A 4BAGA 4UHEA 2GYWA 1DX4A 3H1AA 3GROA 5AM2A 3QM1A 4N8SA 3WIOA 5JZBA 2X8BA 3V1NA 5ESRA 1H2XA 1G66A 4X95A 3C5VA 4KACA 4B7ZA 5YASA 4I4CA 1VZ2A 3AZOA 4GEGA 5K3CA 1LPNA 1GPKA 2BKLA 5LZ8A 3E3AA 4OD0A 1G5FA 5JD5A 3D2CA 3WK5A 4U2DA 4MQLA 5ALKA 4E11A 3FWHA 4CG3A 2QZPA 5BWBA 5HCUA 4UBMA 4DYHA 2V97A 5AP9A 5JZ9A 4QDUA 5AM5A 2BFNA 4AZ3A 4B81A 5JIBA 3VJKA 3R3ZA 4MYSA 3MVEA 3KD2A 5JAHA 2DSNA 2ACKA 4H35A 4QDZA 1GPLA 1ZIXA 3C70A 4CCYA 4UFOA 4Y2RA 2HHAA 1ZJ4A 1MAHA 5AOBA 2OGSA 4Y2VA 3TJMA 1A8SA 1D07A 1R1DA 5FDFA 5K5EA 2C7BA 4CIAA 3S8YA 4K2AA 3WA7A 4NS4A 2XMBA 2CZQA 5CT5A 5C8ZA 5FV4A 4I3FA 3F97A 2QR5A 4PSDA 7YASA 5AI8A 4WJLA 5EFZA 1EVEA 2P8SA 4J0KA 5DJ5A 4ITVA 3D7RA 5LZ9A 2I3DA 4YX9A 1R9MA 2AJCA 4Y7DA 1CUUA 4M0EA 5EHQA 3OOSA 1JKMA 4NVRA 3FLBA 3ICVA 4ZREA 4J3JA 3CCCA 4HVTA 1JJIA 1B6GA 3VVMA 1E8NA 3G8YA 3PFBA 4Y2TA 1VOTA 4HXEB 1QE3A 2WTMA 5ALMA 3F98A 1XLUA 2D0DA 1EK2A 2PSDA 4LKOA 3ZI7A 4BB0A 2CKMA 1I6WA 5K3BA 3LP5A 1GXSA 1LPPA 4O08A 1AC5A 2OCLA 5SYMA 1A7UA 2WHQA 4DSZA 4LXIA 5C8XA 3BJRA 3LIPA 1CUYA 2DHEA 1VXOA 2HDWA 5AIBA 2GZRA 3H18A 2XUAA 2OAGA 3R3YA 3K6KA 3BIWA 4H7DA 4CI9A 3DL4A 4FTWA 3FVRA 4WCVA 3JYHA 2HA6A 3R3WA 1IZ7A 1LZLA 4EY6A 3K9BA 5JARA 2BUAA 3FSGD 2EDAA 2BGNA 5AK6A 4BZWA 1AX9A 3V1LA 4PSUA 2HA5A 1DWPA 2Y1KA 5FRDA 1MX9A 1YA4A 5AKJA 2XLBA 5IVDA 2ZYRA 3D5EA 4UBNA 1YASA 1J06A 2CEKA 1ORWA 3N2ZB 3GFFA 1EA5A 1UT6A 1ZD2P 3DKKA 4E46A 4BRZA 1ZIYA 4CG2A 3P2MA 2HRQA 3FBWA 3O9MA 4GHWA 1BN7A 1ZJ5A 1XRRA 1QTIA 2OQIA 4EY8A 1NX9A 3LLCA 5ALVA 4X85A 4DMHA 3A6ZA 4GBGA 4BYMA 3H2KA 5CURA 2PBLA 4FNMA 4X90A 5IVIA 4Q1VA 3H0CA 5AM4A 1K5PA 4IQ4A 1LBTA 3M82A 2OXEA 3QPCA 3C6XA 4KRYA 5AKEA 2HADA 5E4JA 5ALQA 3MUOA 1THGA 5CT4A 4FLFA 2CJPA 1A88A 4H7IA 1CUVA 2C4HA 3R0VA 1YB6A 3W9UA 3G0BA 1THTA 4NMWA 2RI6A 3WKDA 2VJAA 2R11A 1G42A 4Q05A 3OC0A 4AXBA 5E4TA 4KR0A 1DINA 2QUBA 1QIKA 2RIPA 3R3VA 2LIPA 3I6YA 2AXEA 2XMCA 1LLFA 3G9TA 3WYDA 3HLKA 2PVSA 2XUQA 1SCIA 3L1IA 4KAFA 3C87A 3IUQA 3N0TA 3C6BA 1BCRA 1CQZA 2XUGA 1GKLA 1CUIA 3F67A 5CTAA 4AO8A 2XQKA 1AUOA 4Q3OA 2X76A 1QIGA 1E8MA 4JNCA 3STTA 4INZA 2OLEA 2VA9A 5T4EA 3B12A 3FCYA 1QFSA 3AINA 3H19A 1KU6A 5AO9A 3BF7A 4DIUA 5JATA 2FX5A 5DNWA 2QJRA 2OPHA 4PF1A 5AK5A 1XZLA 4FFWA 2ONCA 5AICA 1QIJA 1LPMA 1F0NA 4U2BA 4KYVA 4Y2SA 1CQWA 3IB3A 1ZD5A 1QO7A 3CCBA 4Y9SA 4NZZA 1DT3A 4PO3X 5A6VA 1N1MA 3ZPXA 2WUFA 4ETWA 2V96A 5T4FA 4AN0A 2QXUA 3AIOA 4UBKA 5ALTA 4J0IA 4WFJA 4S0XA 4YASA 2GBFA 1CR6A 4MYDA 2HRRA 4MWTA 1UKBA 3ZLUA 2JBWA 1DQYA 1MPXA 2OCKA 2W6CX 4KE8A 5C7YA 5DWDA 2DQZA 5CH8A 4Q34A 3H2IA 3FOBA
chains in the Genus database with same CATH superfamily
2P8JA 1D0VA 4ZCRA 2XVYA 4BAZA 3H7AA 2J9YB 3HH8A 4WLUA 3KKMA 3TGPA 3QE0A 1U99A 2JEZA 3K1ZA 2PUGA 1XSEA 4AF6A 1JEQA 4WK0B 5IXSA 4CCYB 2FPLA 1D6NA 1P44A 3G5LA 2IV7A 2GK3A 2NZ8A 5H70A 5FULA 5BW4A 2BF7A 1A71A 3MJEA 4WK2B 1RKBA 3MD9A 3L7CA 1KH3A 1HL7A 2XUFA 1PYOA 4CMCA 5JNSA 2CHEA 2RHWA 1D2NA 3EISA 1WZNA 1LPAB 1OWNA 2R7NA 1REQA 3RIMA 3UAVA 2GZHA 5C1OA 5FEUA 1CUBA 1Z4MA 1R6BX 3PF8A 4QO8A 3VZPA 3G59A 5LU9A 1W85B 1V96A 4XM2A 1GGEA 1H8EA 1Z6PA 3ESAA 3H17A 4KKVA 3BZBA 4NU5A 1X19A 1MOSA 2CB0A 3M6AA 1Z4LA 1GCAA 5DHQA 2JFQA 5FWXA 1KDYA 4LE2A 4QGBA 5KSWB 1PW5A 4KLRA 4EFMA 5F4ZA 4P3KA 4MINA 5BQFA 3CZPA 3CEJA 3T5AA 5IVKA 1GSAA 1WPXA 2FJPA 2ZE8A 1JPJA 3OZGA 4LGMA 4MEAA 4MROA 5EE0A 4BO7A 3TW8A 1FBNA 1JQDA 2ZBPA 3DWEX 3LQKA 5UKDA 1YF3A 3EOAI 5JQWA 2AG6A 1PRYA 3CR7A 4JYPA 4MUNA 2BIFA 3BMQA 3FH0A 4OKNA 4CG0A 2WKPA 1Y4AE 5K0CA 3O4HA 4L2IA 3UOWA 4I46A 4WN3A 1M2VA 5DSTA 3MWDB 4G4GA 1VPVA 4TS9A 4ZAGA 4A0SA 5JMOA 3OZSA 3CW8X 4UFNA 1OU0A 1WIWA 2XRYA 3I6IA 3DOEA 2B5VA 4B0PA 4FXPA 5BUZA 3ZQJA 1DWOA 1LNQA 2JD0A 3OLYA 1PTJC 4DDHA 2NU7B 5REQA 5KTPA 4DIBA 4GM1A 4OGFA 1VL5A 5EKSA 2XOKA 4YLYA 3CCFA 3DMPA 5K4HA 1AXEA 5CAEA 4L08A 2MINB 4O4LA 2YFQA 3B5JA 5DYIA 4NBNA 3VKUA 3HCPA 3HL4A 3AILA 3DTVA 3WNDA 1BS2A 4OB8A 3I9MA 1XEXB 4EBBA 2D74A 2V03A 4HP8A 4F9FA 5HYVA 2E5FA 1N6RA 4M0CA 4P53A 1TU0A 4RS4A 4Y2YA 1DXYA 1WCV1 2FQYA 1UJ5A 4HH4A 3PG5A 5JAPA 2OV3A 4UUQA 2H4HA 4IP0A 3EQ7A 3O4RA 4A9AA 1TVEA 3H87A 4R2IA 1E60A 3TLZA 4E15A 3T9AA 4NTZA 2DOKA 1U90A 3RV4A 1EEXB 1RWXA 1N8NA 4UVEA 3CNHA 2BKVA 1SUDA 3DV9A 3VO9A 4BKPA 2Z1MA 1NWHA 4CI0B 5KO2A 1ECLA 2DQ4A 4I3HA 3HSSA 1QG0A 2Q8PA 5TPZA 2QM8A 4DV0B 2AX3A 2QUJA 1CUGA 3SC3A 4X3CA 3A06A 3ISJA 2QTGA 1UJ2A 1Z34A 2PUJA 5ALJA 4C1BA 2XUJA 1RYFA 2QJTA 1XWIA 1YVRA 2GHQA 3RVRA 1TA4A 2ZKIA 1JIJA 1THMA 3GJZA 1OILA 3I09A 4IILA 3VR2A 2OM2A 4JLDA 3L4KA 4CG1A 4P4NA 2PZBA 4UDOA 3BHIA 3B7GA 3N2LA 3GD7A 1SXJD 1CP3A 1EGHA 3I30X 5ELMA 1XRMA 3AF6A 2VZLA 2YWCA 3EQ9A 5BN1A 1W29A 3LBHA 5BN5A 1CUAA 4Y3UA 1AQJA 1FSPA 1GNSA 3U48A 2NW6A 4Q0MA 1UBRS 1BXGA 1P33A 4UEJA 1PD1A 3A05A 3ONNA 1JEDA 1RHMA 3PFCA 4XQ9A 3OPNA 4P4LA 4EIWA 5LVAA 3F5MA 3D1JA 2VF2A 4B85A 4G0ZA 5I9SA 2XODA 4CIYA 4BFYA 3RUPA 1RE1A 3L8YA 2XBUA 1Q7CA 2NTNA 2VHEA 2TRSB 3QEJA 4LGYA 4Y6LA 1SXIA 2FPMA 2VSNA 3P9RA 1N33B 3HCOA 3AVUA 1S5PA 2XCOA 3GJ8A 2BFWA 4HAVA 1KWGA 4JI3B 1H5QA 1RIIA 4CVNA 1KERA 1JQLB 4M1KA 5B4VA 5FPHA 4P9NA 2I9PA 1W0JA 3JWEA 4A8TA 2W8BA 5EIEA 3KL2A 2JAUA 1L5VA 1YB7A 3OLXA 4HBZA 1L5OA 2B4KA 3ELUA 4DA0A 2HSZA 2PUWA 3P0IA 4INOA 4JLBA 4AK9A 5C4MA 3H5RA 1TAUA 1F4LA 4U2EA 4AY3A 5CCBA 5HP4A 2BUCA 2G6TA 5ALFA 3SE7A 1F9EA 1Z0AA 2PV0A 1RRCA 3BKXA 3LRTA 5U1PA 3DBIA 3QG1A 1OBOA 5AH0A 3TW4A 2RBEA 4AD8A 3K0HA 2IE8A 1OWOA 4NEQA 1F17A 4YACA 2J9GA 3PX3A 3S27A 2ATCA 1PNRA 1S0UA 3G0DA 1AZWA 4X64B 1DHRA 1GUBA 1YE3A 1SC6A 1GLVA 1KO4A 1PTKA 4UHDA 4WXHA 2J31A 3CE6A 4JL6A 5ALXA 3VAAA 4R0MA 3MWKA 4DL9A 4E4TA 4J1TC 1FFYA 1LSSA 2FV8A 3K96A 1TYEB 1PZGA 1SKQA 3GA7A 1ZN2A 2HMUA 4DDUA 1L1FA 2XHEA 1JWBB 3IE1A 2VQDA 1CY0A 2FWAA 2NU9A 1R0CA 3KSAC 3EYAA 2AT1A 4WXYB 5CCEA 1NF9A 2C97A 5I7AA 1K6JA 1OAOC 3NR2A 3EPJA 1GR1A 1EHCA 3AOEA 4DJDC 4WZ6A 1EHIA 3O3OB 3UJ8A 1QF6A 4URWR 1USGA 1EYZA 1Z4KA 1IDN1 1NYRA 1UWKA 4NCNA 2O7NA 5BQXA 4NYMQ 2ODEA 4J75A 2B2NA 2D4HA 4GUDA 4L51A 4PZUA 5FWYB 2OFFA 3TE7A 4LHYA 4B5KA 4RHXA 4R1UA 1ZK0A 4HGRA 2I4IA 4WOCA 3SMQA 4AS3A 4D3SA 1BX0A 3MLEA 3VVCA 3R24A 3WZ2A 2BBSA 2OT3B 2HSWA 1DGQA 2W2LD 3EQ8A 5ESXA 4IDHA 4DMFA 2IF2A 1MHPA 2G70A 1KTVA 2RG1A 3HBAA 4G65A 1OC2A 5KX5A 2AI2A 2QYSA 4IQFA 1UXHA 2Q99A 3THYB 3JX9A 3P2EA 1E3IA 4B2LA 5H8WA 4XB2A 2HX1A 5DYYA 4AZTA 1AXGA 4L7VA 2UXBB 3FFTA 3IDQA 3N0VA 3B9QA 4EGQA 4GMGA 3NEJA 2X8JA 5CFLA 3U81A 3BIXA 4XDHA 4FYIA 4XJSA 1E2BA 1R4NA 4JI7B 3A3PA 2R6GA 2WSYB 1BXRB 2RHRA 2DMRA 3NBXX 3WFZA 4H59A 4KDRA 1C9YA 2AFHE 1KEWA 1XQ9A 2W83A 2X40A 4MS3B 4YJFA 1WCIA 4YMGA 5JS7A 4ZO9A 5DPMA 3NT2A 4F2HA 2QKYA 4GPZA 4JUFA 2BTQB 1C9JA 1I2MA 2P5YA 3PC4A 1NVFA 1RLJA 1M1YA 1PWHA 1VPTA 2FFBA 3EMBA 4FDTA 3H7IA 5AHRA 1JSZA 2BRUA 2WNSA 4LYJA 4E2YA 2I6FA 2O2XA 3LLUA 2CY0A 2M6RA 4ADSG 4YY3B 1NF2A 4KGDA 2ZATA 4ZD6A 5AOCA 3ZHUA 2XB8A 3MAJA 4WESB 1EP1B 4HUQB 3NLLA 4I9FA 4WADA 3DHEA 3OOJA 5DTJA 3DOOA 3BT7A 2G72A 2ZUCA 3JYLA 3U1TA 3VKWA 5AD1A 2OHOA 2WILA 2FWBA 5IRCD 3GGJA 4IHAA 1J2YA 1ML3A 4XZ3A 2VNKA 1XDZA 7AT1A 1H05A 2VF5X 1LS6A 3T5MA 2I91A 2BJHA 2WC1A 4A6PA 2PWAA 1NULA 1KJNA 1W1UA 2Z95A 4Q19A 4Y9RA 1BXZA 1LTQA 3BB4A 4R3WA 3TB6A 2WIJA 5KPJA 1A8IA 1IN1A 3IOCA 1W4LA 1NE7A 1P18A 2VYCA 1CEEA 2GTIA 4WEQA 3O3NB 5DWVA 3OEWA 3TI9A 1PR0A 2OL4A 4Q4AA 2VP3A 2P2NA 5IYZF 2OXTA 6AT1A 2QMYA 5EGNA 1UOPA 1GU1A 4NE7A 4LZNA 4Q7MB 3OQHA 4UHBA 1JVBA 2ZVPX 4E3ZA 3F0TA 1XEWY 5GIOE 3ACCA 1RKXA 2PSFA 4UNRA 3VZCA 5J58A 1DUVG 1XA0A 3FN4A 2NVUB 1AB6A 1CIVA 2BDEA 1KP3A 2QRZA 1XTKA 2AGVA 5EP4A 2NOAA 4ZVKA 2GVZC 3UG7A 5E3JA 4LDQA 4X20A 1UMCA 2Q41A 2QX9A 2ZJBA 3GAMA 1Z5NA 2PMDA 4GL2A 2OEPA 1V0JA 1QS0A 5DT2A 4B4VA 3LUPA 2PWZA 3K9QO 3IEXA 2JI4A 1KMHB 3OMLA 1CZLA 4JV5B 1UPFA 3F5FA 1DC4A 3H04A 3NIFB 2QT1A 4U2GA 3B6EA 2H65A 3M70A 3OFSA 2ZSHA 1B6SA 1Q44A 1UBMS 2PUVA 3FPAA 1J2EA 5DWQA 3ZHRA 1YQQA 4IDPA 1UF9A 4HR7A 3FUTA 3NGLA 2VTKA 1IBCA 1R6DA 3CLKA 1T3SA 2AHOA 2EP5A 5DE3A 2FQ1A 3QYAA 4I4TF 1OFGA 1QX3A 4NMMA 2PLFA 1PGOA 5AI4A 1UFOA 1HYEA 3N86A 3WL7A 1H9BA 2Q5CA 2GZ1A 4R84A 3GCGA 3EIOA 1NYLA 3QEAZ 4J0JA 2JJQA 1XDUA 2BOVA 2FMFA 2WHPA 3FVTA 3I58A 3L5KA 4FFDA 1UBEA 4HX9A 4RJKA 4HS9A 1XKTA 1NATA 2IPXA 5F3DA 3WY9A 5LQDA 1OGJA 2WP0A 1JI0A 1ZHFA 1FLDA 5JNLA 1NXOA 4OP2A 4BMOB 3M2PA 2YNMA 3N7TA 3T54A 4RLQA 1E77A 3HYLA 5TMDA 4C0JA 3IJRA 2I1QA 1O3YA 3VSAA 4EPYA 5BURA 3FYSA 2CDRA 4M53A 4U6SA 1EK6A 3LRXA 4EY7A 2FXVA 3ANTA 1WB4A 3OUZA 3WWCA 2GB4A 4D82A 2UU9B 1T1RA 2Y6UA 2IRWA 3R5KA 3CF4G 4G3XA 1PN3A 5ALLA 3WYEA 1ZNZA 4LYAA 1W4AA 2GPAA 2PXXA 4GW3A 4O3MA 4IDBA 4ND3A 2C03A 1XE3A 3N70A 3OT5A 1JHZA 3H2BA 3WGTA 5BR7A 4O4HB 2FMTA 2AI1A 1Q15A 3LVQE 5A05A 1OGYA 3MMZA 5FUBA 3ZDZB 5BMVA 4QM7A 3P8ZA 1B00A 3LUKA 1FIUA 2CXUA 3R7LA 4AWAA 3AY7A 3U44B 2OCIA 4JI5B 1DTWA 2WJIA 4JLKA 2QI9C 3ZLVA 4WD3A 3C3DA 2EQ5A 1I3OA 1MTZA 4UUMA 4YDHB 2AN1A 4R5HA 2NUAB 3EVAA 3SYRA 3PSAA 3WL6A 2F3SA 1DCKA 1X80A 1SBZA 1UH5A 4PHFA 1TAGA 4WLOA 3MWYW 3F74A 3NALA 5DM0A 5JHHB 4UDYX 3BX1A 1NURA 1QS0B 1Q1ZA 3INNA 3E35A 3FFXA 2N42A 3DOFA 2QPOA 1K92A 1XZDA 2HAEA 2SKDA 3LPNA 3ZX5A 4DCCA 1YAJA 5HF9A 1N9ZA 1KVSA 1AKYA 5FOVA 5KCZA 2PX3A 3KDSE 1DAFA 1MOQA 2XOEA 3TBKA 4RM2A 2D1FA 5C8YB 2CB9A 5G0UA 1K0FA 2FRXA 3EX7C 1BEEA 1KFJB 4HWPA 1JJAA 4C7MA 1T2UA 3N9IA 5FTKA 4B6EA 3GA5A 3HXTA 3CRMA 1RM4A 1JR3A 2WV7A 4FINA 4X8HA 1QF9A 3U13A 4WXRA 3V9PA 1YB4A 1Y63A 4XPZA 2BHSA 2XZLA 4IMRA 5IP5A 4F6CA 4FILA 3KDAA 5TF0A 1G7SA 1RIFA 1Q57A 2XF8A 3EIQA 4P58A 4XWYA 4YH1A 1W5BA 4MVWA 5EEHA 1XZEA 4FCCA 1OFUA 1QLHA 3KQNA 5JROA 1UANA 3L7JA 2D2IA 1G8HA 3PEUA 2UTGA 4N65A 5I3ZA 5HNKA 5GJVC 4DLYA 2D00A 4TT8A 2QVZX 3K9WA 4E2FA 5AWFC 3NFRA 3TVYA 1OX4B 4J4HA 4NOJA 1BRMA 4ER6A 1L4FA 1H3NA 1UXOA 1E9FA 3KO8A 4YUAA 1XTUA 3LPDA 3GLIA 5BSTA 2WQ7A 3FDZB 3F8SA 1XAGA 5KVCA 5A1TA 1GZVA 3ZZ1A 3M1AA 4MWBA 2JATA 4XGRA 2R68A 4HNQA 5D87A 2LBPA 3ZBQA 1CEYA 4WCDA 5L40A 1GGMA 3G1WA 1Q74A 2V6IA 3VSEA 4C0QC 3B6MA 3B9BA 4G8CA 4RZ3A 3I9V6 1FLNA 4J07A 2OV6A 2JGFA 3O75A 2VP6A 2IXFA 1RRPA 1FXSA 4HGZA 2AMYA 4IRUB 3W4JA 2EBHX 3OHSX 4E30A 1YJ8A 2FLVA 2HRBA 4ZI7A 5BXQC 5C1DA 2ZBQA 2XRZA 5BW6B 2HXSA 5B3LA 5FXMA 1UINA 2IVFA 1XK6A 4IIVA 3V8EA 4DXHA 2B2XA 2CSUA 3HBNA 2QVBA 1C1DA 3TQTA 4XDGA 5IUKC 2BKEA 2VAPA 4HZUB 5KSYA 2QQEA 4ZP1A 4JJEA 1E98A 3PNMA 4DIMA 1II8B 1RRVA 3AU8A 4E14A 3C43A 1KI2A 2V6FA 2ZI3A 3KSZO 4RUKA 2FTKE 3D8TA 3EHDA 1K75A 4ND2A 2GPYA 3M3HA 4I1SA 1QB8A 1U8TA 4NK5A 2ONZA 3N8KA 4A6EA 2NNLD 3EVBA 5AXBA 1VPEA 1WMSA 1NVAA 5LQAA 2AR7A 4C2AA 4TYMA 3NYIA 5KNCH 3KR1A 2Y0EA 1NVMB 1NVBA 5KNLA 1WDTA 1J8DA 2ZCUA 1F1JA 2CMHA 3O83A 3O5AA 4G24A 4IV5A 1D4ZA 1EGAA 1KGSA 4LBYA 3TL3A 4YT2A 1P7ZA 4QPJC 4O29A 4OBXA 5TT0A 4YV0A 3FDIA 1U2DA 1YZYA 2OCPA 2QD5A 3I9OA 3AUTA 2JHAA 2B69A 4IS3A 1UQTA 5GMOA 1CR0A 4CLOA 1U9JA 3UBTA 4HDRB 4C6SA 3ORRA 3TZQA 2Q2QA 4ZI2A 4P0TA 2C42A 4B87A 4BLOA 5LBUA 4OH7A 3SDSA 4EB6A 1P60A 3FNBA 1W5AA 4OKSA 1EUYA 3LUFA 2O50A 3IKLA 2LW7A 4YFVA 1P0QA 3EAQA 1V8BA 4GF5A 1IEVA 1VG1A 3QH4A 1IQRA 4L16A 5HK9A 4MV8A 1JTEA 4N3AA 1YUNA 3HLTA 4H15A 1FYFA 3E9DA 2VOEA 3ONVA 5B3JC 3EF3A 4KJZA 4NU0A 3EC7A 1LB1B 3FR7A 2HOQA 1OZAA 2R6R1 1KQOA 1F60A 3ICOA 4PR0A 1UQRA 1J4AA 2BZGA 3AUAA 5E2AA 2JLVA 3U7IA 3EMDA 5ERYA 1KQNA 2P6OA 1ACJA 1A8QA 3DS8A 4IEFB 3KXKA 4KPUB 3ZBPA 2WWGA 3T9EA 3TVTA 4EVRA 3AR7A 2PT9A 1DIOB 2WFLA 3QLTA 1CUHA 4MUMA 4R4JA 3OIFA 5FI5A 4RX1A 4F04A 3O8QB 2IPLA 3MAGA 1PZFA 3FYUC 5EJIA 5EG5A 5H0IA 4DCUA 4EA9A 1ULSA 4ID3A 2WM3A 2A1TR 3DBHB 5EIOA 5HILA 3WYNA 4J16C 2HK7A 3HY4A 3A9UA 1T0JB 2IXGA 3LW8A 2FZEA 3TPZA 2QL5A 4BRUA 4BP9A 3MERA 4AZ0A 2YV5A 3F9CA 3MIZA 3GVCA 1DP4A 3R41A 4UW9A 3VPDA 5C9ZA 5EHXA 2N0SA 4GXTA 1QUFA 4YRJA 3AGQA 2AXNA 3A1CA 1N6KA 4TTJA 4Y9DA 4MUHA 4NS1A 1Y3BE 4XSVA 1H2FA 3CRRA 4CEJB 2O2GA 1FU4A 1MJHA 3GJYA 3VMFA 4FE7A 3CVJA 1XDBA 5HF8A 2VHXA 1NBHA 1A0OA 4M22A 2NZXA 5KYTA 4LF8B 1U9ZA 1LQUA 2WU0A 3TAUA 2PXAA 4MVJM 3G2NA 4NHOA 1J8VA 4RHCA 1MX5A 2R47A 5EIXA 1RABA 2IEBA 3GUYA 3OCXA 4R01A 1PR2A 4Q21A 2C31A 2XCRB 1SCDA 3QE2A 2XEDA 5EIBC 1I4TD 2PWYA 4DNQA 1Z3IX 1ZNWA 3S68A 2FWIA 4IKOA 1G98A 4M0FA 1XZIA 3W1WA 3UHFA 4DZZA 3IAS6 3A2NA 3NEAA 1OGIA 3L8HA 4UQPA 1KDVA 4BFXA 4BCDA 5B2EA 1AXRA 1E58A 1JMVA 2YL2A 5BV7A 1I2CA 4JX9A 2DWOA 1SHTX 2AFIB 1T3LA 3R40A 4MQ4A 3UMRA 4JEIA 4GWLA 3V1KA 4QUAA 3WZLA 4IH9A 1NW5A 3K32A 3X1XA 1EUQA 3DMRA 4QDOA 4FFPA 3WGNA 4BNXA 2D2VA 1QONA 1TPYA 4QU5A 4S24A 1VB5A 3UAZA 1Z6AA 1KDZA 3RVSA 3VZDA 4KDFA 2W71A 4HQ0A 3GP3A 4K9NA 4IVPA 4IOMA 1MD9A 3L82B 3BOSA 4EELA 3LF2A 2P35A 5E1OA 4EGSA 4PYJA 2NU6A 2E4ZA 3A1UA 1QH8A 2OHIA 4JJKA 1WS6A 3TTWA 4ZYUA 4QZVA 2BH2A 2O19A 3RBVA 2VK2A 4PSCA 2JZCA 1V71A 1EQ2A 4OA8A 1QHYA 2H9AA 2P9HA 3E18A 4KH0A 3TINA 3WAGA 3FOEC 4ZHSA 1A4XA 3L6DA 5H80A 4FWTA 4MDFA 4RGYA 2WJAA 1TO6A 1NBMD 1L5YA 4H60A 4FGJA 3ZI0A 3SYKA 4WIAA 1ZGJA 2H63A 4CN9A 3R9IA 1DHTA 4HAWA 4KV9A 4Q6WA 4UCWA 2BYTA 2DLCX 2VUIB 1KI1A 4OYLA 3U4QA 3WIVA 3ICQB 3U17A 2UV8A 3CWCA 5DOZA 1RHQA 2HJRA 2H1FA 5IM4A 1NWCA 4LYHA 3LU1A 2BE7A 2IYFA 4ZYVA 4HWGA 1ZVMA 3DNFA 3CUEF 3VR5A 1XVVA 4UZEA 3GDGA 4R0NA 3STHA 1IY8A 3UAWA 2WD9A 1ECPA 4K9RA 3G5UA 2UZ4A 1F0PA 1M6VA 1E5TA 1RPAA 1J07A 3K94A 3PVCA 2XMQA 1BQ4A 4O4IF 4XEUA 2AVDA 2WPDD 4G97A 1Q0SA 3ZK8A 1DRUA 2AHRA 3ZE0B 1W94A 4WK4B 4PZEA 1JA0A 1UWCA 4AECA 2GEVA 4OIFA 3LQ2A 2IKSA 3U0BA 4LN1A 1XB2A 7REQB 3IDAA 1DLIA 1OPRA 2ZQYA 2P3SA 4G25A 4P8RA 1A97A 4UTNA 1IEQA 2XYHA 1A7JA 2A9FA 1XVIA 4F8YA 4BZQA 1I6MA 3DULA 1H4SA 5BVGB 1YRYE 3AVWA 1XGKA 4YAGA 3RAJA 4Q7EA 4ENVA 3D2AA 5I7RA 4JWKA 2WT8A 3ILSA 1J2RA 2NUBA 3TNYA 1QDLB 3QQ5A 3GJQA 3BCHA 3L77A 4L50A 3TOSA 5EWMA 3OETA 4UTZA 2B99A 4AJ4A 4WQMA 2ZP1A 5HIIA 5JEEA 3NS7A 2ADMA 3I42A 2IYLD 3CRNA 1SAYA 4KCGA 3AC0A 3PVSA 5LFAA 2N3ZA 5G4KB 2PZ8A 5KCMA 3OWXA 3WRVA 3BVPA 1I94B 2CL7X 3QKRA 4KR2A 1PK8A 2IV2X 2YRFA 4B83A 3QMMA 4BDSA 4E5NA 1G5QA 1F3LA 4B2YA 4C29A 2IT1A 1XZKA 4UQOA 5BWMA 3ZWCA 3LX8A 4YR9A 1GPDG 1V8OA 4AZ0B 5BWLA 4PSAA 1HQKA 1K97A 1WF6A 1S2MA 1ZMTA 3JRNA 3HSKA 1CY8A 2E9SA 1WE2A 3EQ6A 5HHTA 4K9DA 5L3VA 4WW0A 1U31A 3C3AA 5F5LA 3ZV7A 2YRWA 4ZQEA 2I1LA 4Q66C 3BH0A 3KU4A 1QF7A 5G1OA 1D2MA 1MF7A 1R5NA 3F90A 4OHRA 1KH2A 4Z1OA 5C5EA 1KWKA 4ABYA 3IEMA 1QOPB 3RFCA 2RHDA 3NBZC 3JALB 4MS1B 4J1SA 2MR6A 2Z2IA 4KR9A 5I7EA 3I12A 3TZHA 1VE3A 2IUYA 1W44A 1H2WA 3S7ZA 4CZ2A 1X8XA 4NKRA 2RCYA 4HQFA 4UUNA 4G81A 4ZAWA 1KF0A 1LZKA 1PNQA 3SEAA 3TQFA 2PPLA 3UOAB 5BSHA 3N8GA 1NW4A 2V8OA 3IAAA 4KAJA 5SYAA 1Y1LA 2ZJYA 1DMSA 2IYNA 2QR3A 3BEDA 5HG0A 2VSOA 4FMDF 1A2OA 1JHVA 2NTEA 4N5LA 1BEUB 4RLHA 2EDCA 3L0IB 4MIOA 2R4TA 1IZ9A 2DM6A 3B5IA 2P2GA 5JH7A 2ZSIA 3HACA 2EFYA 3GPLA 1QLJA 1ADYA 1SH7A 3Q7SA 3ONDA 4JKIA 3NX4A 1J90A 4MHTA 2GJ8A 1BDJA 3PFNA 2QV7A 4KMRA 4PTZA 2NT3A 5F3RA 1Z8FA 2ISQA 1NVKA 1NUQA 1IHYA 3QPUA 1VC2A 3CY6A 1GGKA 4I99A 5DW0A 2XT9A 2CHQA 2VEDA 4FW8A 4LRUA 1NLYA 4AURA 4CKCA 1K5DA 2MHCA 3MSXA 3CEHA 4WUTA 1U8FO 2GQ0A 2WHRA 1TEXA 3GLGB 1E94E 1NYQA 2ODAA 3LX6A 2R44A 5CBPA 2O59A 1JMKC 1Q11A 1TYZA 2C88A 1VE7A 1JHOA 3JAKA 1D8TA 1RBMA 3ZNNA 4CIXA 1DFGA 2VHZA 1OWMA 4P08A 3KZNA 2OBBA 2XECA 4ZYYA 1YIDA 4ZYZA 1QG6A 3DLHA 2J08A 3IVMA 1L5NA 1O6CA 2JFFA 4V0MA 2OZLA 1HLGA 1ATZA 3EW9A 4ZDWA 3V2GA 1P6QA 1QIHA 4X0EA 2YWXA 2QRVA 3DE0X 2VG8A 5G0SA 2I66A 2EFHB 4Q16A 5FCDA 3S29A 3HCNA 3M1LA 1XCBA 5CGQB 3SHOA 4YP7A 5HKLA 3ST7A 4KW7A 1KEUA 1XIVA 3AMVA 1CXZA 3OESA 4CKWA 2UZAA 4IOKA 1P5JA 2FUG6 1RZUA 2GN9A 1P1RA 4J4TA 3G1TA 1EJ2A 2BFPA 3C6ZA 2P67A 4MEBA 3F3SA 2B1RA 3PV0A 4D0NA 1IXYA 5IBPA 3MJDA 4RELA 4YMLA 3LK7A 1CQXA 1N2CB 2B4QA 4JROA 3FUWA 3OSUA 1Y6ZA 2O5VA 1Y9AA 5TDHA 3LY8A 5ED0A 4BVLA 3Q10A 1T9DA 3D6AA 1B93A 2BBTA 3PJEA 3PHIA 4IYRA 3HUUA 4YLEA 4UQLA 5IJ0A 1HNNA 3JD2A 4Q4JB 1EE2A 3ITNA 2QROA 1QCYA 1K5GA 3KAQA 3WBKA 4EECA 2A3NA 2QNBA 1NXTA 2VDUE 2Z56A 4XXHA 4BP3A 5DGHA 1YI0A 4R9NA 4BVEA 2M1ZA 3S1LA 2X23A 2RAVA 5IM4F 3NHYA 2YJTD 4Z9YA 1XHLA 4KITB 2KE5A 4MTCA 1FQOA 1Y37A 5B2ZA 5JJ5A 2D8MA 2OGUA 1SZPA 5LZ4A 2ISSD 3WLSA 1PKXA 1W48A 1R27A 1Z6YA 2BM1A 2CXHA 2Q2NA 1O03A 2NYAA 1S6YA 3BK1A 4HUJA 4NY1A 4P3XA 9LDTA 1MG5A 1W36C 1RQRA 2P2SA 3D2BA 5KOYA 2ZAYA 2HWKA 1CETA 2ETVA 3NP9A 2GI4A 4RIGA 2QEQA 3WNZA 4QLBA 4DLNA 3FYUB 4N7JA 1LSJA 1JDSA 4REOA 3C15C 1HG1A 3NV9A 4Z4GA 1NF8A 3Q41A 3NAGA 1JW9B 4MR8A 4P93A 3LFUA 2ZWOA 4RGQA 1XVTA 4OI1A 3A2KA 3GNLA 1BW9B 5MFPA 1NM5C 4QLAA 2I4LA 1VL8A 3KEGA 2JAWA 1NDUA 2B5OA 3J81A 1H6DA 2E82A 4KN6A 4E03A 4IQ8A 4RVNA 2QRHA 3OFJA 3F6YA 2IE0A 3SXJA 1TE2A 4AU1A 4OB6A 3FROA 3VC7A 1JQBA 3C3YA 5A7FA 2PU7A 4K05A 3A04A 2P2DA 2XNSA 1KRHA 4RBNA 4V0ME 1UMCB 4RGBA 3GGSA 3RIGA 1OR8A 1U3GA 4JP1A 3P2OA 1S9DA 1TF2A 4FYYA 4ALLA 5LOVF 1I7SB 1NW8A 1U3DA 1M0SA 1SC4A 1JFSA 1N32B 3DZDA 3VH4A 5K9ZA 1IN6A 4NF2A 3V4VB 1AA6A 1RI4A 4AUNA 4CIDA 4AO6A 5ADHA 2MSLA 3AZQA 3DUWA 5BRNA 2Y1CA 3I72A 3TOXA 4ALIA 4FLMA 4BFZA 3A6GA 5KJ1A 2HV8A 1GIAA 3C3MA 4HVLA 3NI2A 3SSOA 2HJ9A 4FOTA 5EKDA 2I2WA 3GZTB 1A9TA 2J0EA 2Z9CA 2XYVA 2FCRA 3LPAA 4ALNA 4DUPA 3P0HA 4TS4A 4HGQA 2VXOA 4J91A 3RVPA 1L1RA 2ESRA 1L0BA 1VRCA 2FJUA 1FW8A 4DY4A 3FF4A 4ZXPA 3TW0A 5MN5A 1Z5VA 1QR2A 1ZGGA 1SVSA 1YBVA 4YEDA 1Q7RA 1G6Q1 3M2TA 3NRCA 1XMVA 2IYPA 2OCGA 4HAZA 2TYSB 2E4UA 1HYGA 1I9GA 2ZRAA 3OE1A 4NE9A 1JF8A 1X1BA 1TXGA 4U3JB 5IHXA 2VTBB 1LW6E 2JIMA 3FSEA 3UPDA 4H1VA 2LKDA 4QODA 3WGZA 4D2IA 1JKJB 2ONYA 3UKJA 4X6LA 1QB7A 4TOIA 2FZWA 1ZD3A 2I87A 2VSQA 4YRFA 5LCXA 5FT9A 3ZHZA 1N2XA 3F96A 1MGPA 1KAQA 4ANFA 5EVJA 1M1YB 2IUEA 3UCFA 2ZULA 1GUYA 1Y4ZA 2EHDA 4Z3OA 2O1EA 1I3NA 1NZDA 3Q11A 1WDMA 1M6HA 3LV8A 1N5DA 3QXSA 5JWRA 5G3ZA 3K0AA 2RAFA 2O8EB 3VPCA 2P6RA 1ESDA 2AOUB 2VJQA 2CUNA 1SEPA 5B4UA 2BMAA 4K6GA 1S3SA 5FA8A 1R9JA 5J4VA 3TLKA 3TRIA 3N28A 2JGJA 4KQ1A 1DSSG 4X24A 2YXPX 3K0FB 2HMYB 6GPBA 1ZC3A 1I3KA 1NG1A 1V26A 5KWIA 3LL4A 1AB5A 5JD6A 4HB0A 1KYYA 1KOJA 1IJFA 2WSSA 3FTCA 3RODA 4WOJA 3TRHA 1JHXA 1RRGA 2HY7A 1GSOA 2BBWA 2HB6A 2Z8YA 3L0CA 1EESA 3KVYA 1Q0UA 5LXTA 621PA 5DISB 3PYXA 1Z3CA 3IS3A 1JQEA 1RI2A 4G5QA 4S12A 4XDYA 5DSXA 3EEFA 2CWDA 5LZ5A 3WKBA 2ZT5A 3U61B 1HE3A 4GZ3A 5IJ9A 3SJCA 2GEFA 1M5RA 1M2FA 4IF6A 5DULA 1G0NA 3L4SO 4G4SO 4K6CA 4QT0A 2F8SA 2OORA 2Q9AA 1LDNA 3LWDA 5CAEB 5JHGB 1HE8B 1NN3A 3EHEA 5AM0A 2HREA 3BL6A 3L8EA 3FVQA 5C1IA 3TQSA 4NV0A 1Z82A 4EBFA 3MLBA 1G3QA 3ABQB 1DC8A 2BFMA 3FNEA 2P69A 3GGPA 3QPWA 3T1VA 3PXUA 3V1MA 1ZOIA 3I2FA 3IV7A 3PTZA 4NZPA 4YJ3A 4DV4B 1NA5A 2ZRMA 3PTLA 2EL7A 4P34A 3TRFA 1XCOA 4CLEA 4DR4B 3EXEB 3ICPA 1HDXA 2PRZA 4JLUA 3T5DA 5AW6A 4X66B 1KAMA 5EXEA 1X9GA 5GIPE 3VJLA 5ADVA 1RRFA 4FYJA 4BZZA 1N0UA 1EJBA 4U9IS 2L17A 3D5TA 3GYGA 3NTVA 2GUWA 2Y9PB 4KNWA 4AX4A 1PK7A 4Q39A 2F1KA 3PB3A 2ZRLA 3CF4A 3SVZA 3UT0A 1U3VA 1J24A 2VRCD 2PGJA 2WYWA 4UTXA 2XDQB 2P4UA 3R09A 4NARA 3DLTA 2YYAA 3HCCA 5AI0A 4GOJA 4J9UE 3N39C 1IHOA 1UC8A 3BH7A 1GZUA 1IBLB 2UVDA 4A0RA 2HF7A 4N5IX 1JYEA 3I2KA 1IXZA 4RZHA 3OQMA 4F1JA 1SD2A 1Q77A 1SHKA 2H8GA 5DLPA 1NFRA 1YVEI 1SG6A 1R6UA 3WS7A 4D9FA 1PG5A 1C1XB 4EGCB 5CFNA 3H9BA 2AC4A 4O4LF 2ZB2A 1KNXA 5KYVA 4QSHA 3U5ZB 2QAJA 1UMDB 4MO2A 2O3UA 1BE1A 1NPDA 3A2LA 4DG5A 1H69A 3I3OA 1NQWA 2APJA 5AVXA 5KU1A 4FZRA 1ADBA 2PWBA 4RD2A 3KE9A 1DAEA 1QH1B 1X3SA 3AZPA 1XDSA 3JW8A 3VNVA 4WECA 4E32A 3NYWA 2J4FA 1YMVA 2JJMA 2QLNA 4HFRA 3TDKA 4KN8A 2ZCVA 1LQ2A 2QTVA 2P9BA 2XTMA 5MN6A 2RGDA 1RD4A 1OTXA 1LBEA 1ZH6A 2J3LA 4GDMA 4RXUA 2DQYA 4R9RA 3UMFA 4BRWA 1TTPB 3ED1A 4PQFA 1PHPA 2I4NA 1TJYA 4MGZR 3KOWA 1M73E 2QBYB 4X6UA 2WF6A 2C4VA 4YC7A 3T8YA 1XP8A 2ZVDA 3EUAA 3HNRA 4AP5A 4F6RB 4TM7A 2X7JA 4XVRA 5CB4F 1Y7LA 3CNLA 3LUBA 2FG5A 2EL9A 1PCXA 1T24A 3ICCA 1SXGA 4MS4A 3TKLA 2ZI7A 5A2GA 2O1SA 3MTBA 3MEQA 4EHIA 3MHTA 1F2UA 5JFTA 1YHNA 4Y7CA 4AP9A 1BRTA 1P7CA 1TJPB 2XI4A 2YHAA 3B7WA 3GGCA 4G0OA 4TLCA 5K3FB 1WXHA 1SK8A 4FZ3A 1MQ8B 2QA5A 2RHLA 3B1YA 3GLHA 2J3KA 3DLIA 3FRHA 1HT0A 1EI9A 1EFVB 4RIEA 4ZVQA 2QTLA 5AJVB 1QHXA 2YVUA 2HHLA 3RC2A 4N8DA 3A7DA 4GD3Q 2EKDA 1XQXA 1HLFA 4M4SA 2ZSDA 1BFDA 2Q46A 4F4CA 2PCLA 1OBHA 2OWEA 1H65A 3IUYA 4X94A 3W6OA 4B8ZA 5FH9A 1C80A 3OQIB 1M6NA 4FYHA 2AMJA 1R12A 3KEFA 2HWWA 4HRVA 5P8WA 5KI6A 3B2EA 3TWOA 2MSCB 3ZGOA 2AMVA 2HL6A 3HBMA 1QRRA 1W6UA 4INPA 4OXNA 2E4VA 1QQAA 3HFSA 4HDKB 4JASB 4ZTZB 3TQRA 4FDMA 1RJWA 3DSRA 1JHPA 4HEHA 5FTJA 4C3ZA 5K99A 2YFYA 3OZVA 2OBYA 4TTVA 4QASA 3VSDA 5CIQA 3NONA 1IK6A 2YWRA 4UEOA 5A2QA 2ASVA 3U7JA 3SM9A 3GVIA 2RI1A 4PY2A 1SPBS 3BM5A 4RDCA 2X0EA 5IC4A 1UKAA 3T4EA 2AUMA 1NMQA 1UZLA 4L02A 4Q4AB 4W5WA 3P5SA 3UM9A 3O8CA 2G28A 3EZLA 4MWZA 1CG6A 2EGHA 1LNZA 4M89A 5JD4A 1IHDA 3B8EA 3EZ2A 1HY3A 2GVDC 5DIFA 1IBSA 1II9A 3DHWC 4DBZA 4H4CA 1PS0A 4L2IB 4OJKA 3O8LA 4JK3A 4J0FA 4BPRA 1OWLA 5K0GA 3U3OA 5BUSA 1KK3A 1BHSA 3PC8C 3MJ4A 1XCMA 3H16A 4CT0A 2HA2A 5AW0A 4N48A 1W36D 4OA5A 1FMJA 1BD4A 5I7SA 1FDVA 2VP4A 3W9BA 1X8KA 3KYDA 2C7RA 5IABA 2AKYA 1UDXA 4IDNA 2CMDA 4HYEA 3BXPA 5BPFA 3BSSA 2OFOA 4KDEA 1MH1A 3O0DA 2ZTVA 1B43A 2ZYAA 1ODSA 3DF9A 1UP7A 3S0JA 1KU0A 2Q28A 2RHGB 3PHJA 4DYDA 4NH0A 4RTKA 4A10A 3G2KA 1OYOA 5LJIA 2C29D 2PMFA 3P9YA 4JX8A 5JWOA 3RVOA 5I51A 1Z37A 4IGFA 5H3LA 4U2FA 4JL5A 5EJ7A 1ZR2A 1CYEA 3MIIA 5FNZA 3HKEA 1SA0B 2EKZA 1UDRA 3PPVA 1RRMA 1WY7A 4XLZA 5AKXA 3A3OA 3RHZA 3UH1A 1Q0LA 4TSRA 4A4DA 2QJWA 2WDZA 3ZE2B 5CDFA 4C76A 4DAEA 4EI8A 5DLDA 3DAYA 3WWEA 3OQNA 1IUKA 3HXKA 5SZIA 5JNRA 1T4DA 1VGQA 1JHAA 2H1LA 8LDHA 2QTCA 3TOCA 5B30A 2IHVA 3KFLA 3AU9A 1L7OA 4URFA 2FHPA 1NF3A 1VIDA 3GBSA 3L8ZA 2VDWA 3PRKE 1GQRA 2TECE 3OE7D 5CX4A 2FZVA 1HRDA 1A69A 1H3EA 3L6RA 1H1TA 3ZTTA 3QVMA 5C5IA 2G6BA 2P75A 1RJ9B 2JIZD 3AUKA 1US8A 2DFVA 2PUHA 1QM5A 3EIXA 4U2CA 5E9AA 4AI6A 4U39A 3TQOA 2TMGA 4BKRA 4DQXA 4UHCA 1JR4A 2QN6A 2L0XA 3NOXA 1JEEA 4WT7A 1JNXX 3H9CA 5LXTB 4EW3A 5DHFA 3STXA 1DAGA 3SJBA 3TQIA 1XT6A 2P1DA 1ATIA 1H42A 2QTVB 1E2PA 4D45A 2WJPA 3NUGA 1D6SA 3VNBA 4HQ6A 3A2MA 5ALSA 3TMYA 3NUQA 4HAOA 4B7UA 2J6BA 1U11A 1W0CA 5D51S 4XYLA 3NVKI 2Y1LA 1AQ6A 1FS6A 1TVMA 5LLSA 5TQJA 4CMGA 1XQYA 4LOKA 4DIEA 1NZFA 2DAPA 3PDWA 1J49A 2IOYA 1KI6A 3E5MA 3FPLA 4I1RA 3UCXA 3FSGA 3QU9A 1FFCA 4K40A 3IUSA 3TLXA 4M1MA 3VZRA 3DB1A 3W5SA 5C4IA 3TM5A 5IT4A 4OHCA 1LK5A 3EASA 2GAFA 3PIIA 4KFRA 4EO4A 1FS5A 1GD1O 2G71A 1AE1A 1WAMA 2C5FA 2X0RA 3C85A 3N2IA 5EPOA 5FF9A 4DJEC 1SXJE 1X0VA 1ZSYA 3MTEA 4G86A 4YLGA 4YIHA 3ANNA 5H16A 1AURA 2C0QA 4HXGA 3GX1A 4PHCA 3QU7A 3AY6A 4BWFB 3D31A 3H84A 2OE2A 4F38A 2QWXA 3D8BA 1OIXA 3IJEB 4I1OA 4GRDA 2J3IA 2VTBA 2RARA 5IASA 1DJMA 4GS5A 4MR8B 3RQSA 2AOVA 4MRVA 2Z9BA 2DH6A 1KY4A 2VNJA 1QKIA 1OF1A 1XTBA 4UAUA 4P92A 1SJ9A 2IZ5A 5DHUA 5F23A 4IRXA 3BZUA 3NWOA 2VR1A 4R2WA 2IDZA 1W49A 3REFA 2HQ1A 2Y1OA 5F2EA 3WGGA 3SSMA 4B6RA 3TD9A 4AQ7A 1KARA 1XF1A 2UVPB 4TSFA 5TEWA 4DSOA 5J5VA 3SC6A 2ZITA 1CE8B 4WFKA 821PA 1R9NA 5FIUA 5KQGA 3KFVA 2JASA 3ESYA 5FORA 1H8HA 4PAMA 4MV0A 3ZOKA 2CW5A 3ER9A 3WWZA 3KPJA 4LNHA 1T3HA 1WF3A 1M7HA 2E1PA 3LT1A 3R7WB 5A4KA 2GK4A 3EBOA 1VE9A 3W5CA 1YJQA 3HABA 2H1WA 3P0JA 4K0RA 1T36A 2D7JA 4IIFA 3M33A 3PPXA 4D4GA 3KX2A 4P22A 2BV3A 4XJXA 1G291 5FEMA 3AW9A 3W9SA 1PQYA 4ZAVA 3NP7A 3P94A 1CS0A 1T1EA 2DHRA 1IB0A 1DKRA 4MPJA 3WMFA 1AS3A 1HTTA 4NONA 2JLYA 1KYWA 1SR8A 4L8WB 2H1VA 2PZJA 3OZXA 4WZAB 2KHZA 2ZYIA 5DGXA 2DBRA 3T5GA 3KQOA 3PC3A 1N9GB 4OQLA 5FUMA 4LWZA 2LZ0A 1RCFA 1E2NA 3BFPA 3T7JA 1N2GA 1YL5A 1Z4JA 4BFUA 1ZIDA 2XE6A 1TCCA 2O0MA 4LYDA 4NU8X 5K6TA 3B2NA 3PFFA 2GOYA 1YRHA 2DUWA 5CFOA 3K20A 4Q9DA 4BVAA 1BE6A 3IULA 3N2KA 1A5BB 3MRVA 4WDQA 2Q49A 4G5FA 4RTMA 2ORYA 4GPBA 4GIBA 1YB2A 1F2UB 2X2OA 1C3EA 1SC9A 2H11A 2V7XA 1BN6A 1KFCB 2HUNA 1Q2XA 2H7XA 2QLFA 3B6ZA 3OPQA 3QMWA 3SPXA 5ALIA 2QLMA 5DI3B 1KSFX 3TL6A 4LUCA 2DF8A 1A8UA 2A57A 2VDLB 1ZRSA 1EINA 4RPJA 1LEHA 2H2DA 4MB6A 4ZWNA 2AN5A 4P81A 3GLGA 1AF4A 4KP7A 1MN6A 3ZIAA 2V7PA 5KEIA 5IXJA 3MUEA 1F4VA 2E4YA 4CQMD 2CLOB 1E4EA 5CYGA 4W5HA 1XNGA 2VDOB 4KX5A 4OU5A 1PEAA 1AK1A 4FJ0A 4Q3NA 1UBUS 1V11A 1DCMA 3HCBA 2E3JA 4HXYA 1IPEA 1KIMA 3RFXA 4JQCA 1O97D 1S2NA 3KZVA 4U7HA 5BMOA 4GOOD 4ETMA 3KD3A 1QRTA 3WTBA 1BROA 5A02A 3AHFA 4PM4A 1WXEA 4KQMA 5B36A 4RENA 5D3KA 1FZQA 2NAPA 2DFDA 3OIWA 4MO9A 1TT7A 2EG9A 3OSZA 3BWCA 4YGXB 3WYGA 3IGFA 3AR3A 3I92A 5ITZA 1ZAKA 4FNGA 2CVQA 3PEEA 2BFFA 1VIAA 2H4JA 2R1TA 2C5AA 1WKBA 3O3MB 3SR4A 1NZJA 1LQTA 3AM5A 1YJ5A 1MT3A 3PHHA 4UOZA 2JVJA 1UK8A 1R74A 5K0TA 5A0TA 4CEIA 2C94A 2ICAA 4B32A 5IJ9B 1ZD8A 4YUVA 4FYMA 3S2UA 3QW4B 4GX2A 3JWGA 1U9IC 4OI0A 3OM8A 2FUG1 1UXIA 3RWBA 2D1RA 1AQNA 3RYFB 4P0QB 2G5GX 2XPCA 3ETDA 5ALYA 2R8YA 5HIAA 1ZHHA 1IEWA 2EFGA 2P9JA 1GPWB 4PO8A 3SZLA 3F7OA 4H1HA 3ZDXB 3ORQA 3WJ7A 3DPIA 2V4MA 3NT5A 4K1LA 3JATB 5EJGA 3W8NA 2B9VA 5I5EA 3ZJTA 1VHLA 1YU6A 3QI7A 3MAAC 4UM9D 2WHXA 3ZY2A 2BONA 4WXMA 2B3TA 1GVHA 1ADFA 4HN9A 2HZBA 1WUHS 3IT3A 4RDIA 4R6XA 3LWNA 4V39A 3RABA 4YRNA 3V48A 3AHIA 4PNEA 1KEEB 2FLKA 4GX0A 4OHZA 1KO1A 1OT3A 4OK5A 2Z57A 1M1ZA 4G07A 5TQVA 3WK7A 4A2CA 2NX2A 3DC2A 1XTSA 1R50A 1N4AA 3GMIA 1GV1A 1AKMA 3SOZA 3IBYA 4HGOA 4Q4HB 3H2JA 4LNUB 3PHCA 4B3RB 4JEHA 1R9GA 1QH9A 1GUZA 1Z73A 3I32A 3P2JA 5EE1A 3F49S 3LKBA 1WMDA 3NFYA 1NJ5A 3ZWYA 4MA0A 1C1HA 1GP2A 1Z0DA 3CB4A 4QUJA 4NMLA 4ZI7F 1ISSA 3K8ZA 2XNJA 3OIGA 5CA0A 3FMOB 4ND6A 2WVAA 2O2JA 3IRVA 4PSKA 4ZEWA 1KEEA 4O0MA 1JIUA 1YCDA 2VF8A 1SURA 4L8FA 2B7BA 4MKZA 4OQFA 3VDXA 1ILEA 2J59A 1FZTA 4WBNB 2WUWE 5WRFA 2WYOA 3OF3A 3CISA 1R6AA 3CIFA 3O92A 4Y8VA 2XUHA 4NAVA 2DZDA 1NN0A 2CK3A 2H5JA 3AL3A 1VYVA 1UK7A 3IH5A 2Q1WA 2W2NA 3CG4A 2I34A 4MTLA 4BO1A 3UT5A 4MJXA 1E9DA 1E5VA 1GZ7A 2BMDA 2XA1A 3GCDA 3JCZA 1DEOA 2ZUDA 4CM6A 4TPKA 1JR3D 2A9QA 4ZGBA 2WVGA 1U7OA 4WBNF 3BDAA 1G2IA 4A7PA 3VR5D 1TZ2A 4KOAA 2WKWA 1ZDMA 4LMAA 3U5TA 4MZXA 1S89A 3AWIA 4MXDA 3UAXA 3JVUA 5EJ4A 1WPQA 4FQ7A 3BE6A 2AV6A 3RYCB 2PX2A 3H0KA 1EP9A 1VKZA 4BU1A 4R2JA 3V00A 1SXQA 4H16A 2JFVA 2E87A 3GEHA 1J7KA 1E9RA 4ZK6A 3HWRA 3LRPA 3QVKA 4ZVLA 5H1YA 1PJ2A 1CUJA 1F6DA 2EEZA 3K5WA 1SFRA 4EF4A 4IJ5A 4TX1A 1MOZA 3ZKAA 4H31A 2H2IA 5GGXA 4F9EA 2YMLA 1JU3A 4LPSA 1DC3A 3VHXA 4BAGA 5JZVA 2QAGB 4LQCA 4NXMB 1MB9A 2VSXA 3B1XA 4MB0A 3NKVA 4FGUA 2YQ5A 1QRAA 1TW2A 2HH9A 2O6HA 1L3BA 3H1AA 4PFJA 1C3JA 5TE9A 3F73A 5DNEA 4ZAFA 3ELBA 3G5MA 3CBGA 3USZA 1GPMA 3IUEA 4QO7A 5T41A 3SIWA 3IR6A 1B0PA 2AMLA 3CB2A 4FGLA 3N58A 3LCVB 3ZW8A 4V0OA 1EFDN 3ASZA 2FDRA 4BLWA 1SZCA 1YQ9A 2GHIA 3QJGA 4HYQA 4WKNA 3TIXB 4MP6A 4X95A 3UENA 2XCIA 4DV3B 1OLSB 3E8XA 2Q1UA 4FZJA 2J1LA 2OVFA 3PD7A 2Q3CA 3GCZA 3D3WA 4MUGA 1VZ2A 2JCGA 1ZCZA 3UG6A 2CHUA 3OZUA 4CMBA 5KYGA 3ADPA 3Q9UA 1LPNA 5C0OE 5DX0A 1GPKA 1W4BA 1PEKE 3AKEA 3RBAA 2JI9A 2BF4A 3A6LA 3PR3A 4IUDS 4CL8A 1C3VA 3ZWOA 1WV0A 1Y3HA 3E3AA 3PHLA 1B2LA 3D6MA 3E84A 3W6NA 5F51A 4O3FA 5TV2A 3ZXSA 1ST2A 2Z04A 1PZHA 3DDSA 3ANLA 3EW7A 4INAA 3RTCA 5BV2P 2XIJA 2A7XA 3O47A 5JD5A 3ZW9A 1YBFA 2Y1FA 4N5NA 5DCLA 3I3SR 3FWPA 5IKOA 3WK5A 1I3MA 2X2PA 2WF9A 3KQSA 3NWPA 5CVUA 1GITA 3D1LA 1INLA 2BHRA 3ETEA 3HJAA 3HYTA 3TD2A 4E11A 1U0BB 5DX8A 2CGEA 5HJ5A 4WWHA 1UJBA 3KPVA 4ZU6X 4B3JA 2EATA 3G5AA 5LMCA 3CLSD 2RJOA 4UBMA 4O4IB 5JYEA 5JU6A 5LL6P 2OD7A 1TEZA 3WBJA 5JZ9A 2F3RA 2W48A 2W6ZA 2GZAA 4P7FA 4QDUA 3LF1A 1O8BA 5CK4A 4DBLC 5LNK1 5BN3B 1ID8A 1OD6A 5AM5A 4XTRA 2CK3D 1TYAE 4B81A 4CF7A 5HUQA 1YNOA 4N0MA 5JJIA 3V2UA 2F9FA 4MYSA 4ZEVA 4LC9A 1VL0A 2HT6A 2VCYA 3KD2A 4IPTA 4O8CA 2H3HA 4W6ZA 2Z3VA 3H42B 4L5YA 3LGXA 1G41A 4TZTA 4LF5B 1P1CA 3Q7PA 3MD0A 3EMVA 5JCOA 2PZGA 1ZH8A 3AP1A 3MGKA 4Y2GA 9ATCA 4QDZA 1GPLA 1A77A 4IXTA 2WQ6A 3C70A 2QTZA 5HOEA 2HHAA 4RVHA 1AV7A 4GR9A 1J8FA 1RM0A 3L01A 1ZJ4A 1MAHA 4WLNA 3FPSA 4HY3A 5AOBA 2OGSA 3ESRA 5CPFA 3E15A 3UQYS 1SKMA 2REXB 2BFDB 1ZXLA 2O2ZA 2I2DA 4GMDA 5K5EA 4YAWA 3DEZA 1I1HA 4UOEA 2EU8A 3W2GA 1G63A 3AFNA 4K9PA 3E3OA 2F55A 4I5EA 2RHBA 2KLHA 1Q6YA 2C7BA 3AJEA 3UWSA 4CIAA 3S8YA 3H4VA 4K2AA 1NV8A 3NC4A 3QYPA 4QTZA 5JT1A 4XX0B 4NS4A 3X2EA 4K9KA 1FX0A 2H92A 3C7KA 3SYMA 3DBHA 1GNLA 3W2EA 1DNPA 2MYTA 3JTMA 2XVMA 1UPTA 4ND8B 1YL7A 4QXAA 4OXQA 2PRSA 2HK9A 4ZU1X 4Z0PA 3KJZA 4JJ7A 3TLBA 2J7KA 1IN4A 3L7BA 4I3FA 5BR4A 5FV4A 5KTNA 3FRIA 3JVVA 1NQUA 2Q0HA 5GPBA 3DEFA 2D5BA 2JAOA 3NHZA 3OHPA 4JITA 3I4CA 1TK2A 1W25A 3KQTA 3MXOA 5HZKA 2YXLA 4V0NA 3KS9A 4KIUA 3IQGX 3QFFA 3HXQA 5J43A 1IN5A 3D7RA 3EXFB 2JJ1D 3DKIA 1V4BA 2DTEA 4MYRA 3NTLA 4EARA 3SQDA 4CR7A 5F1YA 3TXAA 4EMBA 3EPKA 3QFRA 4Y7DA 2IZOA 4EITA 4B1FA 5CM8B 3V4LA 3MBIA 3T1TA 1EFCA 3Q87B 1JKMA 3PC2A 3FLBA 4LHSA 3JTEA 1U8XX 1ZINA 3HG7A 4IHJA 4M98A 1NMEA 3NBFA 4YP0A 2ZWVA 2G77B 3CCCA 1TJNA 1FY2A 3MCUA 4CF6A 3QWHA 1GA4A 4DQVA 1TM3E 4QOHA 3AB8A 4C5CA 3IUPA 3KP1A 1H0RA 1OASA 1RQNA 3PGLA 4RF2A 2A0KA 2Z98A 2AYYA 3V2IA 3FKSD 1AGRA 1E8NA 2GCNA 1COWA 2GM9A 1X0XA 2UUOA 4IJWA 2AXPA 1PYGA 5DI3A 4CT5A 2CHFA 4HXEB 3A28A 3E2MA 5E9QA 1QE3A 3HMKA 5SZHB 4B46A 4C4RA 5KSZA 2X0NA 4HVAA 1OX4A 4Q15A 2OYRA 4XGNA 2C82A 4F3KA 1N1EA 4X8MA 3VYVA 1XLUA 1U6KA 4JXJA 3SC4A 4D02A 3CGGA 5E9JA 2BCGY 5IUNC 4M7WA 4A0HA 4LGCA 4NENA 3MYRA 3EK2A 2H4XA 3ENQA 3UC9A 5C51B 4KI7A 4LKOA 1C8BA 2F67A 2Q6KA 4QOEA 3QEOA 3ZI7A 5KOHB 4OM7A 3VR6D 4X62B 2W42A 1ZD1A 4I5IA 5ELLA 1BYIA 4DADA 3EG5A 3O8OA 1C0EA 1GL6A 2O2EA 3Q5EA 4FOOA 1EP3B 1PHRA 4C30A 1VL2A 4M88A 2DERA 4HNHA 5ENDA 5K3BA 2X86A 5JAIA 3IPLA 3LP5A 5KWVA 4WZAA 4G36A 2X7XA 5FLXA 1YMUA 2P4EA 1M2KA 3QTTA 4MMYB 1PKEA 3K9CA 1LW7A 4JQZA 4YWHA 1NXQA 3GY0A 1CUYA 2DHEA 5AIBA 1AHPA 1XVAA 1VCMA 4ITUA 2OAGA 1DFIA 2FU5C 2QR2A 3VNSA 4BNZA 4KPUA 2OKGA 2VPWA 2NV6A 3K6KA 3VPBA 1M67A 4ZVTA 2MINA 2JRCA 3M6VA 2QGZA 3MHPA 4M8SA 4OOFA 4B71A 4U5XA 4FTWA 3RGWS 4BNGA 1XTZA 1CR2A 2P5SA 3LUGA 3LZDA 4R68A 1WBBA 2BFCA 4N03A 3P9CA 4BJHB 4EG1A 3L8FA 3DDOA 4CPDA 4ZTUB 2G1PA 4B6SA 4EY6A 1NSTA 3FI0A 4TZKA 4PX3A 1R2QA 3FSGD 3THXB 2BGNA 2QJOA 2I22A 3RYFA 4ONEA 1MW9X 4BZWA 3V1LA 3EPLA 2JIOA 3DM9B 4W6QA 1J9EA 1S2GA 5LQNA 1QFXA 2KM1A 3R6DA 3BN3A 2VWPA 1M6VB 2RCNA 3MT8A 2C1XA 2Y1KA 3UGKA 3ZWDA 3UF0A 4HNTA 2AC2A 4HL6A 1ZRMA 3C5CA 2I62A 2ZBVA 1P75A 4PGHA 4B75A 3QNWA 1OBCA 2VHCA 4WBXC 2UYGA 2JJ2D 2XLBA 1R6TA 1H8HD 3F6RA 2XJ9A 1EX1A 3PFKA 3RS8A 4ARSA 1D03A 4TMXA 5IVDA 4RVGA 2YXEA 2QN3A 3DE1X 2CEKA 4UZFA 1EBFA 1ORWA 3CO5A 3NWEA 4PO1A 3C4JA 4RSGA 4Y30A 5IPFA 3GFFA 5K4AA 1W47A 3WLLA 1BGWA 1KTIA 2JA2A 1FJHA 1KC3A 3F1KA 4Y6GB 2CNBA 5K2MA 1EGQA 3LL7A 3RRBA 2BTQA 3DXXA 5DHSA 4M9CA 2C7OA 1G7RA 5EY5B 1EM6A 2BFAA 2NVOA 1FK8A 4LXXA 5ELXA 4JR0A 4II2A 1JAIA 1T5IA 4X1IA 3ZJ5A 1IJEA 4KSYA 2LIVA 3NHKA 1P31A 3QRWA 4UUOA 1PJ4A 4CM1A 4EY8A 2B83A 2BFFB 3LLCA 2BR5A 5GY7A 2EWWA 2ZTSA 2GCOB 4NWIA 4WGFA 3C2QA 1RLUA 4JODA 4GBGA 2GN6A 3IHTA 4BYMA 4EUKA 3M3PA 1E6CA 2G08A 3TSWA 4FR2A 4DNXA 4X90A 2FPGA 4ZHQB 1C7RA 1I7PA 5EXDA 1RNLA 4IIJB 4DC0A 4JC8A 1NP3A 1KMHA 2Q5FA 5FX2A 4YUWA 3S8EA 2IUSA 2ZJ8A 2XYQA 1A4IA 2ZIEA 3F5QA 4I55A 3RS5A 3Q5DA 3E5RA 2PG3A 3QPCA 1G7TA 3LT2A 2FR1A 3C6XA 1Q6ZA 4IGKA 1HE4A 2FWRA 4OYRA 4NZYA 4R71A 2NO7A 5AKEA 3KXIA 3CVOA 2CYBA 1UADA 3QKSA 1ZW1A 1OX6A 2JLBA 2PIAA 1ULBA 3SJZA 5CT4A 3CW2A 3A1WA 1NJ6A 1FMCA 1USKA 4FLFA 4E4YA 4V38A 1PFWA 3PXXA 1X1QA 3AY0A 3JQCA 4EHFA 7GPBA 2B1JA 4DW8A 4E88A 5KKNB 1QU3A 4MQFB 2XWSA 1GADO 1YB6A 1V3UA 1XELA 3C3PA 2RH4A 1JRLA 3DUFA 5H68A 1TD9A 2C59A 1NQ5A 5EFOA 2ATEA 4R83A 3WAKA 4A36A 4CUZA 1U0LA 2G9ZA 4PYOA 1L4UA 4J16A 2VDVE 2ZUBA 3BRSA 2G9NA 1ZUNA 2R11A 4MICA 1UPUA 3SG0A 3WYCA 3OPYI 5ITVA 4R1NA 1M2OA 1SUIA 3MWLA 4PLVA 3JYPA 1C3OA 2I0FA 1A2KC 2CVZA 4AXBA 2HLDD 3A4IA 3PQ3A 2DUMA 3AJRA 1GPH1 1P5ZB 4MI6A 1C1YA 1DINA 1QIKA 3JAWA 3A4LA 5JMPA 4JS0A 4MRPA 3R23A 1XHEA 2H1HA 2LIPA 4G4SP 3V34A 4XYEA 3U6KA 1JUDA 2VPPA 4NI5A 5TGZA 3WYDA 1X6VA 2H17A 4ZANA 5C32A 4OGKA 2ZB3A 3EQZA 4Q03A 1GCOA 3WGKA 4YRQA 2NVUA 2EJBA 1J70A 1P5HA 5K8VA 5JV5A 3LLVA 3P32A 4ACBA 3IUQA 3N0TA 3U9TA 4NCJA 1CQZA 3B52X 4FJ1A 3R3JA 2E2WA 5CTAA 3RVBA 3ZIUA 3NW9A 4AJJA 1K7YA 1K0UA 3CRW1 1NW7A 2XQKA 5A06A 4LF4B 4CM8B 2H2AA 1Q1QA 4Q3OA 1QV9A 5FWAA 4LYFA 5C46F 5A9SB 3WDSA 3DM5A 3IOEA 4HV4A 1FL9A 4AJIA 5KB3A 2E5LB 4O4HA 4D9IA 1PWXA 3W9YA 4DLUA 421PA 4GE0A 3EGIA 4D8WA 4CT4B 3ZGVA 1XL1A 3KKEA 2CMGA 4S1TA 3H1FA 3STTA 4EGFA 4KYTA 1RQGA 5EINA 5T4EA 1CJTC 3UTCA 4CL2A 4EI2A 1L4KA 1XXHE 1G3IA 4R8KA 1KU6A 5JATA 3AF0A 3H2YA 1AMUA 4FOPA 5DNWA 1CSEE 4I6EA 5FAKA 3BXEA 2X0JA 3AB7A 2FFHA 4FFWA 2ONCA 2LV8A 1SUFA 3FWKA 2D0OB 3G2HA 3PI7A 4NH4A 3RTEA 1X7HA 4NYJQ 3LHDA 4KYVA 3RNOA 4WHMA 1Y81A 1XP5A 4MS3A 2FPIB 3IAM6 4YI5A 2Q0SA 3WB2A 1NG9A 3GHHA 3K15A 3RTBA 3SQXA 4LJ4A 4LOIA 1DT3A 1VP9A 1YUBA 3NAMA 4PO3X 4WOBA 5A6VA 2QAGA 3NTUA 3WP1B 3ZPXA 4J8PA 4UU0A 4BQSA 1Y7PA 5T4FA 4RFSB 3WHKA 1E2MA 1KFKB 2Y05A 4KO3S 4YAOA 4A91A 4EPXA 4ZZ1A 5AFSA 5JSFA 2VJKA 1W96A