4CFSA

Crystal structure of the cofactor-devoid 1-h-3-hydroxy-4- oxoquinaldine 2,4-dioxygenase (hod) catalytically inactive h251a variant complexed with its natural substrate 1-h-3-hydroxy-4- oxoquinaldine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
273
structure length
273
Chain Sequence
DTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQELDADFRVIVPNWRGHGLSPSEVPDFGYQEQVKDALEILDQLGVETFLPVSHSHGGWVLVELLEQAGPERAPRGIIMDWLMWAPKPDFAKSLTLLKDPERWREGTHGLFDVWLDGHDEKRVRHHLLEEMADYGYDCWGRSGRVIEDAYGRNGSPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPWFSYAKLGGPTAFPAIDVPDRAAVHIREFATAIRQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Origin of the Proton-Transfer Step in the Cofactor-Free 1-H-3-Hydroxy-4-Oxoquinaldine 2,4- Dioxygenase: Effect of the Basicity of an Active Site His Residue.
pubmed doi rcsb
source organism Arthrobacter nitroguajacolicus
molecule tags Oxidoreductase
molecule keywords 1-H-3-HYDROXY-4-OXOQUINALDINE 2,4-DIOXYGENASE
total genus 102
structure length 273
sequence length 273
chains with identical sequence B, C, D
ec nomenclature ec 1.13.11.48: 3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.210.20 Mainly Alpha Orthogonal Bundle Uteroglobin Uteroglobin 4cfsA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cfsA01
1VLQA 3VISA 1ETHA 2J4CA 3BE8A 5C8XA 3FYUC 1VE7A 2X8BA 1LGYA 4DNQA 3V1LA 4ZWNA 2GBGA 4KE7A 5AK3A 3A6ZA 5IVDA 1EK2A 1BROA 1Q84A 5K3BA 5ISMA 1VZ3A 4MEBA 3H1BA 5AM5A 3HRHA 1K4YA 3O4GA 1CEXA 1W6RA 4UBMA 2FJ0A 2ZSIA 3I1YA 1EDBA 1YS2X 2HA5A 5D6OA 1JJBA 1JU3A 1SOMA 2DHDA 2C58A 1ZD5A 4U2DA 2O2HA 4XWGA 1JJIA 1QE3A 1EH5A 5HQ3A 5ALFA 1FFBA 5AOCA 4YK7A 1H2WA 1O6FA 5AKGA 4UUQA 2FUKA 1ZD4A 4UBIA 1X2EA 3AIOA 1MO2A 4H7JA 2XQKA 5ALTA 3H2HA 1R9MA 4WY5A 4A16A 2JBWA 4GXNA 2WUDA 2Y2UA 4K5QA 1UKAA 2GYWA 3FBWA 5JZ9A 5AHXA 4PSDA 1CUAA 1BU8A 4B0OA 5FLKA 5IVHA 4BBZA 3HLKA 2H7CA 3VXKA 3M83A 2R8BA 1WB6A 2PL5A 2WUGA 3H0CA 4WFIA 5DYWA 5JAHA 2XUKA 5ALLA 4Y2XA 3DD5A 5ALYA 5LZ4A 3BDVA 3F8SA 2CUTA 3WWPA 4UHDA 1GKKA 4OUKX 5CXXA 5JADA 4J03A 4K6GA 4FMPA 1DWOA 3FVTA 5LZ9A 4UFPA 4TPKA 1BN6A 3E0XA 1DT3A 3H1AA 4QDZA 4KEAA 4DSZA 4BP9A 2HU7A 1Q0ZA 3C5WP 1CUHA 3GROA 4UBJA 4A5SA 3UMJA 1DT5A 1SCKA 4N5HX 1RWQA 3C8DA 5AP9A 5EIEA 2BCEA 2Y6VA 5ALPA 3D2AA 3L1HA 2RONA 2GBFA 4KRYA 1CUWA 4C87A 1K8QA 3C5VA 4LHEA 5EHXA 2R11A 4NS4A 5ALKA 4F0JA 4P92A 1SFRA 3KWJA 4BAZA 2O2IA 3QPAA 5DWDA 4BTLA 1CQZA 5AKHA 3HXKA 1XQWA 4CG1A 4J0DA 5T4FA 1TK3A 5JYCA 2XUJA 1W52X 1CUFA 2QR5A 2YASA 3WK6A 4X93A 5I9IA 5K3DA 4AMYA 4IH9A 1ORVA 1GT6A 1JT2A 2QM0A 1WM1A 3PF8A 1I6WA 3A2MA 2QRUA 5FPPA 2OAEA 4J0CA 5EHZA 1XLUA 2BUBA 3E3AA 1YA8A 4OU5A 4QDOA 5AK4A 2HFKA 3I2IA 5ALJA 2HA0A 1XZKA 2QT9A 3WL6A 3T52A 3WMRA 3IUMA 3AJAA 5I7UA 4Y2PA 2Q0XA 3W06A 4UPDA 2WTNA 5AI8A 2CZQA 2HM7A 1ODCA 1OXMA 4HRYA 4QE3A 1MPXA 1JKMA 2HU5A 4CCWA 3OOSA 1FFDA 3G9XA 5FXMA 2P8SA 1U65A 5BV7A 2WU4A 3G9TA 1UOOA 2JEZA 4JYPA 4XVCA 4B85A 4MWTA 2DQZA 3TGLA 1WHTA 3VJLA 3U0VA 4GI1A 1Y37A 1QZ3A 4FDMA 5ALXA 5A6VA 1QO7A 4BVKA 4X90A 3GA7A 3OURA 1FFCA 4HXFB 4B80A 3NOXA 2RGUA 3IBTA 1Y7HA 3WIOA 4XIIA 4DYHA 3GFFA 3OC0A 3R0VA 2O7VA 3C6ZA 3IUNA 5FDFA 2PSHA 4P9NA 3EF3A 2RHWA 5EFZA 1QFMA 2QXUA 3DDUA 3FCYA 5K3AA 1NU8A 1X2BA 5AKEA 1VKHA 4Q34A 3IA2A 4FFVA 2XMCA 2WJ3A 1MTZA 4KAFA 1QIFA 2IIVA 3IIIA 2G63A 1QGED 4OYYA 2RIPA 3HI4A 3I2HA 4PQEA 1UFOA 3WQHA 5ALOA 4MQLA 4P93A 5ALHA 3WZMA 2PSDA 5ALWA 1O6GA 2BUAA 4H7DA 5T4HA 4ZV9A 3H2IA 4GWLA 1TQHA 4E46A 3R3VA 3WJ1A 4BZWA 1YAJA 4XJVA 1ZI6A 4V2IA 2WIDA 3RLIA 4U2CA 4KYVA 2HADA 2ONCA 4QWMA 1UKCA 3IDAA 1ZJ4A 5HF9A 4WFJA 1E5TA 4W1RA 4CG2A 1VE6A 4B82A 1R1DA 5EIHA 2ACEA 3WKBA 5ALRA 5LZ2A 1K63A 2C5FA 3ESDA 1YCDA 2IITA 3HABA 5I8PA 2H9YA 2OPHA 4AO8A 3I6MA 4C4XA 5HFAA 3O9VA 4NZZA 2PSEA 5AM0A 1F8UA 4AZ0A 3G7NA 2XI4A 1SC9A 3WYDA 2G5TA 2OQIA 3X3HA 1FFAA 3BJRA 1CVLA 4UFOA 1LPSA 1G4HA 3JWEA 4KAJA 5K3EA 2C4HA 2OGZA 3DL7A 3ZI7A 5HF6A 2WLSA 1UK6A 5C8ZA 3PF9A 3QZUA 4AZ3A 4UHBA 5AM1A 4F21A 1U8EA 3EBLA 5AIBA 4HTAA 2PX6A 4EUSA 1FJ2A 4DSAA 1CUGA 4JH0A 5J3JA 4H0CA 3D0KA 4UBKA 2C0QA 2QJRA 1CFJA 5CRIA 3WK9A 3QPDA 2BGNA 1UKBA 1R9NA 5LLSA 2WG0A 3MUNA 4Y9SA 4ZXFA 2XUFA 4QNNA 1KU0A 5EIAA 3EQ7A 1BCSA 1WHSA 2EDAA 4DMCA 3F96A 1AX9A 3G0IA 3STXA 1ZD3A 3L1IA 3FSGD 3STTA 1THTA 1XZJA 2WHQA 4X91A 3PFBA 1L7AA 3SX4A 4AX4A 2Z3ZA 4BDSA 4YPVA 4RGYA 3STYA 2ZYSA 2QUAA 1A7UA 3NUZA 4Y2SA 1HLGA 3WIBA 5JALA 4ROTA 4TGLA 1AGYA 1HPLA 1QIGA 5AKYA 5CXUA 5LYYA 3WA7A 3I2JA 3BXPA 5EI5A 1E8NA 4JNCA 4EY4A 2WTMA 1BS9A 2QKYA 1XLVA 1HL7A 1E8DA 3LLCA 4UHHA 5CTAA 1LPOA 2DCMA 1XZEA 2X76A 5EGNA 1YSCA 1CUXA 2OQVA 5JAUA 1P0IA 4PF1A 4C4ZA 5JZSA 3ILSA 2PSJA 1AUOA 5IH7A 2VSQA 2AJ8A 1CUSA 4OSEA 1A8QA 5ALQA 1CUBA 2ZVDA 5CH3A 3FVRA 1GGVA 3STVA 5FPQA 2ZJFA 2WIFA 4C01A 1WB4A 2VJCA 1UXOA 2D5LA 2QZPA 4H7FA 4AN1A 3VVLA 4L3WA 4OB6A 2RAUA 3A2LA 4BZZA 3IUJA 5IKXA 1AMNA 3EQ9A 3H18A 3C6YA 3QVMA 1ZGBA 1ZJ5A 4W1QA 4BTVA 5DNWA 4INZA 1OCEA 3D7RA 1MNAA 3D3NA 3PUIA 4GBGA 3HSSA 2FJPA 1GXSA 1CUYA 1ZOIA 1XZDA 1XFDA 4G4JA 1MX9A 1N8SA 4WDQA 1QIIA 4UBNA 4MJ3A 3O0DA 1N1MA 5AH0A 1GPKA 4BYMA 2XQIA 1G66A 4H7EA 4PSCA 1LPNA 5AICA 1TKRA 1EK1A 4QDTA 2JGJA 3R3YA 3FOBA 5CT4A 1B6GA 3ZLUA 1XKLA 4E14A 1UWCA 4EY5A 1YA4A 4Q3LA 3B5EA 4CIAA 2WIGA 3WKEA 4HS9A 2VT7A 2QUBA 3DCNA 4AO6A 4IH1A 3LP5A 1HQDA 4AO7A 5IVKA 4M0EA 4DLNA 2C0PA 2GBCA 2VTVA 1IUPA 1Q83A 5CT5A 1J06A 4BE4A 4DTCA 3GUUA 1YS1X 5KBYA 4CI9A 1XZBA 4OD0A 1TIBA 4DGQA 2ORYA 2VJDA 1LPAB 4CFSA 1BEZA 1RYYA 2DHCA 2Z8ZA 2RI6A 1XZHA 3WZLA 1MT3A 5E2IA 1QONA 3WA6A 7YASA 1XZMA 4OU4A 2E3JA 5K3FA 1CUUA 4E11A 2V98A 1U4NA 3C87A 2BFNA 3EQ8A 3BIXA 1IUOA 2O2GA 5AM2A 3V1KA 3AFIA 1DX4A 3IULA 3DKRA 1IVYA 5ALEA 5FUMA 5LIPA 4FNMA 1KU6A 3MUOA 3SC2A 3AINA 3W9BA 2IX9A 2WHPB 1FSSA 4PV7A 4Y2QA 1LPPA 1J1IA 2BGRA 2OCGA 1MNQA 1SCIA 3WWEA 1VA5A 4JYMA 1DTEA 4U2BA 3S2ZA 5AKXA 1A88A 4BRSA 1WPRA 4G9GA 1ODSA 1VOTA 4M0MA 4PNZA 3HEAA 5ALZA 1P0MA 4ZGBA 1UK9A 3OM8A 5AM4A 5YASA 5HZGA 2XMDA 4G5XA 3V1NA 1WOMA 4LIPD 3FYTA 2HDWA 4Q3OA 2O7RA 3R3XA 3QMMA 1R50A 5FV4A 1ACLA 1CLEA 2Y1KA 5AKLA 4Q3KA 3W04A 3I2KA 4B7ZA 3R3WA 4X7BA 1XZIA 3R3UA 5JIBA 4KR0A 3M81A 1WPXA 5HF5A 1GPNA 3DL4A 2XUHA 1ZIYA 2WG1A 3DNMA 4TVKA 1USWA 3WYNA 5JAPA 3MGAA 3DOIA 4WFKA 3AUKA 4BAUA 2XUGA 2ZYHA 5EHNA 1F0PA 2AJLI 3NGMA 4OB7A 5ALVA 3DOHA 3BF7A 2PU5A 4BCBA 4BAGA 2QXTA 3V1MA 1TAHA 4MXDA 4BVJA 4FKBA 3G0DA 2XQFA 1XLWA 1Q0RA 1E3QA 2V96A 2PM8A 3KSRA 3SWWA 1XZFA 4H18A 4KE6A 3G02A 5FKJA 1AZWA 1TCCA 2XLCA 5FOQA 3P2MA 1TRHA 2VT6A 4K6HA 4RNCA 5AI5A 2QMQA 3VJKA 5JAOA 5CH8A 4B81A 3EIOA 1IUNA 4AXBA 3C45A 2XT0A 2WQZA 6YASA 5ALDA 1HBJA 3F67A 2XLBA 3WL7A 4BRZA 3I6ZA 5JANA 5AI0A 3B12A 4BATA 3E1GA 1QIDA 4EY7A 3BF8A 1VXOA 4H7KA 4X6YA 3HZOA 3DEAA 4BC1A 1E66A 1YAHA 2D0DA 3BIWA 4OPMA 4L72A 4CCYB 1PV1A 2ZYIA 2ES4A 1DWQA 1XKTA 1S8OA 3D2BA 1YASA 1EDDA 4C6HA 2XUPA 2DR0A 2Z8XA 1GQRA 3CN7A 5ALNA 1Y7IA 1OILA 4IH4A 1ZICA 4MEAA 3AZOA 1ZGCA 3AIKA 4RE6A 4DNPA 3ZLVA 3I2GA 2JF0A 2OCIA 3I6YA 2DSNA 3JW8A 3WL8A 5JARA 3R41A 4BCCA 4W63A 4UBOA 2WKWA 5H3HA 3DQZA 1MAAA 4FLMA 4Q82A 4J0KA 1ISPA 3TJMA 4HVTA 4PO3X 1CPYA 1JU4A 5AI6A 2GZSA 4DMFA 4G8DA 1DX6A 3ZLTA 5ALGA 3TEJA 4LYEA 2XE4A 3AILA 2G4LA 1CIJA 5F4ZA 1VXRA 2CB9A 3M82A 4C88A 1CUEA 4G1FA 4X3CA 1AQLA 4U2EA 1QIHA 5CURA 4KACA 1C7IA 5KREA 2X5XA 1MX5A 4QWWA 1Z68A 4ZRDA 2JGFA 3ICVA 2HRRA 4QA9A 4N8SA 4AQDA 3DLTA 3G9UA 5HK9A 2XMQA 5CT6A 4L9AA 2XUAA 1DQYA 3RM3A 2YH2A 5KWJA 2ZJ6A 2WIJA 4AN0A 4FBLA 1A8UA 2YXPX 5LZ8A 4W1SA 4RE5A 4X97A 2J3DA 2XUDA 1W1IA 4B83A 1QIKA 2OAGA 4C89A 3OPMA 1E89A 3FNBA 2WSLA 2LIPA 5JZBA 3ICWA 3WL5A 2VQ6A 4IQ4A 2B4KA 3H19A 1CUZA 5JD6A 4OB8A 3BWXA 4H7HA 3WK7A 4EZIA 3VJMA 1QJ4A 4I3FA 5SYMA 4HXGA 4LYDA 4B0PA 2WHPA 1J2EA 4J0JA 1CRLA 1D07A 2Z3WA 4ITVA 1LLFA 3Q0TA 4X00A 3AZQA 4QZVA 4OCZA 4XX1A 2OLEA 4X71A 1L7RA 2VAXA 3KOOA 4J0HA 2XMRA 1DQZA 1JJFA 1JMYA 5DNUA 1F6WA 1VJ5A 3T4UA 5LZ5A 3G9ZA 1C4XA 3E4DA 4Y2UA 2CJPA 2ROQA 3D2CA 1ZI9A 4FOLA 4CIBA 4YX9A 3O95A 4ZI5A 5DJ5A 3D4LA 4LXHA 3PDCA 4B9EA 3C70A 2PUJA 1SCQA 2QJWA 5AKKA 2XQJA 1CQWA 4MYDA 5C81A 2Z5GA 3CN9A 2BKLA 4WJLA 4EA6A 3FYUB 1LZLA 3LCRA 4X95A 3PFCA 4B9AA 1UZAA 1J07A 1CR6A 1CV2A 4NVRA 1EI9A 1AKNA 5HCUA 3ANSA 4J7AA 3VKFA 1RP1A 5BWCA 3C43A 3I2FA 2FX5A 3YASA 1UOQA 3KWFA 3PI6A 4ZV7A 3V9AA 4HXEB 3WJ2A 4CCYA 1K5PA 4U2FA 1XZLA 4BVLA 1ZI8A 1KEZA 3SK0A 1LPMA 2XUIA 1EX9A 5AOBA 2C7BA 4AMZA 5AM3A 2XMZA 5C7YA 2JGLA 4G4IA 4IO0A 2W6CX 1XZCA 1VA4A 1DWPA 1EXWA 1BN7A 1QLWA 1A8SA 3IVMA 5FRDA 4FBMA 4UHCA 4L0CA 2C5GA 3GBSA 3LIPA 1F0NA 3UUFA 4Y7DA 2VJBA 3WI7A 2WJ4A 4YASA 4BC0A 1MN6A 2J3QA 2CEKA 2QTBA 1R88A 2WHRA 1PJAA 3FSGA 3DYVA 2BJHA 2B61A 4K6KA 3U1TA 5EHQA 4EY8A 4BE9A 5D3KA 5BWBA 2H1IA 4HZGA 3NWOA 1U2EA 4J0GA 5AIAA 2WFLA 1XRQA 3PICA 2XUQA 1BCRA 3LS2A 1EB9A 3KDAA 3WKDA 5HKAA 2GBIA 3A2NA 3OTQA 3W9UA 2JIDA 4GHWA 3ZWQA 2XUOA 4I4CA 3QBJA 4DM7A 3LIIA 3STUA 2HIHA 3GELA 1GKLA 3N0TA 1XROA 5C8VA 4FHZA 4C4YA 3ESAA 3G0CA 1QIEA 5A2GA 1HDEA 5AKJA 3V48A 4Q1VA 3F9CA 3M3DA 1YB7A 3FLAA 3WWCA 5AOAA 4P08A 1UOPA 1XQYA 5JATA 1MU0A 3HYSA 4Y2VA 3I28A 4X85A 5E4TA 1B41A 1QIMA 4Y2RA 1EHYA 5HFNA 2WFZA 3G0GA 4X6UA 2HA2A 3FCXA 1CUIA 4HAIA 4KJXA 5CBKA 5FP0A 4WCVA 3QPCA 5K3CA 5AKZA 4FWBA 1P0PA 4QDUA 1R3DA 3G8YA 3DS8A 2VAVA 3RARA 5ALIA 1YB6A 1CUJA 3WLAA 1EDEA 1N5MA 2V9ZA 3Q8WA 4W1PA 2BAGA 1ORWA 3QMVA 2W22A 3ZV7A 2RHTA 3B3QA 4Z49A 2WIKA 1CUDA 1IMJA 1BE0A 1H22A 1PFQA 3IURA 5AI9A 2I3DA 2G5PA 4KRXA 3D5EA 1H2ZA 5AI4A 1NU6A 4Y2YA 1CUVA 5AO9A 3K9BA 2PBLA 5T4BA 5JASA 4X94A 2XMBA 1ZD2P 3HACA 3FYUA 1H2YA 4LKOA 1EA5A 1EVEA 2JGKA 2ZYRA 1C7JA 4GEGA 1L7QA 5KWIA 3H2GA 5HQ3B 2JGEA 3H2JA 4HRXA 3O4IA 2B9VA 1MJ5A 4F5ZA 3F98A 1EINA 3ESCA 2QS9A 2JGIA 1JI3A 5CT9A 3R40A 5AKIA 4Y2TA 1G5FA 1XRPA 1N5RA 2XQGA 4LXGA 1P0QA 3G0BA 3H17A 3GZJA 1XRMA 5ALSA 3ZPXA 1DINA 2WFMA 2HL6A 5A7HA 3WKCA 3O9MA 4N8EA 5AK5A 3ESBA 1QTRA 3MVEA 3PUHA 5LP1A 3C6BA 4GW3A 4DNFA 2QOEA 4RPCA 4QEKA 5DYYA 3K2IA 4PW0A 2DQYA 5K5EA 4UHEA 2DFPA 1NX9A 1LNSA 1LZKA 2OXEA 4BCDA 2VEOA 1W4LA 4X6XA 3DKKA 2QVBA 4G9EA 5ALMA 4DMHA 1UK7A 1GQSA 1TCAA 5DTIA 4EY6A 2ACKA 2I78A 1GPLA 1FFEA 5DTJA 5A62A 2XB6A 2ECFA 3BJMA 4A23A 2NW6A 3K6KA 3C6XA 4ARBA 5E4YA 3ED1A 2AJCA 3OG9A 4KE9A 3WKAA 1JMKC 2Y2VA 4GLBA 1XRLA 3QYJA 3QM1A 2PU7A 2OGSA 2ZJ7A 2UZ0A 4MWSA 4H35A 1AURA 4K2AA 2GYVA 3N2ZB 2HRQA 3BDIA 3WWOA 4G8CA 1BRTA 4DNOA 1XRNA 4O08A 2J4FA 5IVIA 2EEPA 1XQXA 3PE6A 5K3FB 4JEIA 5CMLA 2XDWA 4EHBA 1T2NA 2HA6A 3JYHA 1H23A 1XZGA 5DYTA 1UT6A 3STWA 5CT8A 4J3JA 4WDRA 4BB0A 2WG2A 1ZIXA 2WM2A 3IB3A 3VDXA 4U2GA 2PVSA 3DJYA 4OYLA 4ARAA 1E8MA 2I03A 2WU3A 2JGMA 3CXUA 2HFJA 2AJDA 2VATA 4AB1A 1QFSA 4KE8A 3QH4A 1LBTA 4IHAA 3HJUA 2H7XA 4Y2JA 4FTWA 5T4EA 3DYIA 1R4ZA 2CBGA 4UHFA 3F97A 2VF2A 5LKRA 1YR2A 1H2XA 4G4GA 4B84A 2YYSA 5ESRA 1IZ8A 5HKBA 2CKMA 2Y6UA 2XMGA 2B20A 2HHAA 2OCLA 4DMKA 1DU4A 2OCKA 5HK8A 3RK4A 4GECA 4H7IA 1X70A 1WCYA 4UBLA 3RKSA 1CUCA 3QMWA 3FLBA 1LBSA 1QTIA 5CW2A 4GDMA 1TCBA 4FNGA 5HF8A 3L1JA 4Q05A 1XRRA 1QOZA 2PUHA 3WWDA 5LZ7A 3QITA 1VZ2A 4UFNA 1WB5A 3KD2A 1GZ7A 4EBBA 5ALUA 2XMSA 2OGTA 3FWHA 3D59A 1BEEA 1QIJA 3S8YA 1T4MA 2PPLA 4D9JA 1HKHA 5AK6A 3UUEA 4M0FA 5A7GA 5A7FA 4G8BA 3IUQA 3W05A 2V97A 2HA3A 4BP8A 1W76A 2GYUA 4WY8A 4PSUA 2WILA 1G42A 3TRDA 2PKYX 4EB0A 2BUCA 4QLAA 4QDXA 5D7BA 2WUEA 1MAHA 5DLPA 1XZAA 4BDTA 3FLEA 5LKAA 3C8HA 2CMFA 3AZPA 4E15A 2HU8A 1M33A 4CG3A 5JD4A 2GZRA 1UK8A 3H04A 4J0IA 4N8DA 1AC5A 2K2QB 2HA7A 2JEYA 4X92A 5A71A 4FLEA 4MYSA 4I19A 1QO9A 4S0XA 3A70A 2H7YA 4ETWA 2VA9A 3O4JA 2WJ6A 2HA4A 4JUIA 2AXEA 2PSFA 3W2TA 2VJAA 3WK5A 3ANTA 5SYNA 5JD5A 4LXIA 1THGA 4NMWA 5E4JA 4H77A 5AJHA 5D3ZA 1JFRA 3CCBA 4ZREA 3O4HA 2ZSHA 2WUFA 2OG1A 2AJBA 1EVQA 3H2KA 3VVMA 4FLFA 3CCCA 1K6EA 1EB8A 2I3ZA 3WK4A 3AIMA 4QLOA 4KAAA 1XQVA 4FFWA 4N5IX 5CH5A 2WFLB 1MX1A 3FAKA 1ODTC 5DNVA 3WK8A 3BL8A 1IZ7A 4B6GA 4W9RA 2EDCA 2DHEA 1ACJA 4F60A 3R3ZA 3HC7A 4MQMA 1W75A 4DIUA 1LPBB 5BOVA 3I1IA 3KXPA
chains in the Genus database with same CATH superfamily
4NPHA 1ETHA 2JLWA 1GLGA 2IIBA 1IBCA 3EIEA 2CYAA 1JDJA 3G2OA 4TRRA 1QRTA 1NVUQ 3QKIA 1YF3A 4B6PA 1QRUA 2KBFA 5C8XA 5LQJA 2YHIA 3HYLA 2BBWA 4LHZA 1Y7PA 1GRRA 1JR3A 1Y8AA 4HNSA 4NESA 3RS9A 3M70A 1ESEA 2RHCA 3KZNA 3BH6A 1WZCA 4ZWNA 3PG5A 2XGJA 4JX9A 2CUZA 1W9HA 4PLYA 1EGAA 1K75A 2AXNA 3JAWB 2X23A 3OOWA 4KMSA 2ZVQX 1FSFA 5IVDA 2IH5A 1NDUA 1G6HA 3KPWA 1WXQA 4KWCA 5K3BA 3ZHZA 4R0VA 2ATEA 4JOCA 4F4FA 4RA6A 2EBFX 4PZEA 4JT4A 1T5DX 1H2BA 2VWQA 3K71B 3VZPA 2BI4A 3ESQA 3K9WA 3HRHA 1HDOA 5TNXA 2CHQA 5D86A 3O4GA 1CEXA 2L69A 4U3JA 3R8CA 3KV3O 1O6CA 1W6RA 4UBMA 1W85A 5H7XA 2ZSIA 1TVCA 2EFCB 2RJOA 2YOGA 2FHPA 3E7PA 2Z1DA 4KFUA 1U4SA 4JSTA 4CN8A 4EPTA 1JDUA 2HA5A 2JLQA 3TJRA 5B5SA 3N0XA 1PYGA 4CV1A 2X9VA 2C58A 1NIJA 2KQUA 4BMDA 2O2HA 4GPTA 3WSTA 1EP9A 2Q6VA 5IVPA 1BMTA 4XWGA 1Q1BA 3ESYA 1QE3A 3AEUA 4RK7A 1N4AA 3RQIA 2I6XA 4LDPA 4I3HA 3SR4A 1C4OA 3TLGA 3GP3A 5JMWA 2AUNA 3GQBB 3GP5A 2W37A 3C5EA 2RHLA 2BDUA 2E0IA 5FAXA 4IJ6A 1YO6A 5HQ3A 3KQKA 3FZEA 1CJBA 1YR8A 5AOCA 4JYBA 1QVZA 4NYMR 1VSUA 1O8BA 1AG9A 3UJNA 1P2VA 4C0LA 1H2WA 2ZAIA 3KTAA 4CBVA 2Y0CA 1NW5A 4FX5A 4RVSA 4UBIA 3U39A 4W9NA 5JV5A 3FN4A 5EMLA 2C9DA 1QCYA 2XQKA 1ABFA 4XOUA 1AKTA 1W8DA 3H2HA 5EMNA 1BXKA 1LFDB 1OUMA 4JUBA 1NVGA 3NT5A 4QATA 4YRBA 5AVRA 2ZQ5A 4WY5A 2R8PA 3CUWA 3F6BX 7ABPA 5C46F 4DJFC 2Z0MA 3MWYW 5CU7A 1I36A 1WXFA 3Q3EA 3UNXA 4GUAA 2VQEB 1KVSA 2CYBA 2LTAA 5KAMA 1HRDA 4KDRA 3F2VA 4RM2A 1E2MA 3GIWA 3IVAA 4GF5A 2Q9UA 2JDIA 3VGPA 2GYWA 4TMXA 5C4IA 3FBWA 4AYTA 1DKOA 3EBPA 2BCJQ 2V58A 3PLRA 5JMPA 5FLYA 3MBKA 1L8QA 4Y1GA 2HHJA 1JPNA 2EBWA 3H1FA 5DYGA 5EKTA 5U1PA 4L16A 1X8XA 1YRWA 2ZSFA 2YHAA 4XD7D 2D1QA 3QWAA 4UW9A 4LA4A 2MMGA 3F6RA 5CPFA 4B0OA 4Y0NA 4B8WA 2IEGA 5FLKA 3R6WA 3JAMA 5IVHA 4TSFD 4JOSA 2F1KA 3HLKA 2CNNA 2H7CA 2ZAGA 3Q1LA 4UZEA 1PG2A 3M0EA 3BGVA 4AYXA 4LF8B 3EPRA 4EHNA 1C2YA 2W0MA 2GK4A 4LK3A 5DI9A 1T2FA 3L7YA 4FHDA 2H4FA 1KFJB 4LK2A 3RIYA 5BR1A 4B3CA 3WO1A 4UKDA 1Y6FA 1OC2A 2IOFA 3C1OA 3NOOA 4WADA 4UM9D 4WFIA 1WTAA 4CMIB 4EI9A 4BLUA 4N18A 5DYWA 4EENA 4HX9A 1XDZA 4HDOB 4PFKA 2R6GA 4BKQA 4V1CA 4LJ8A 1NATA 1SVOA 5BWOA 1OGYA 1NQ5A 2NX2A 2RGYA 4HH0A 1UH5A 3WWPA 4CYMA 1RXYA 4IXWA 4RVNA 5J2TF 3OUTA 2A9PA 4RZIA 5LMZA 4L27A 4OUKX 2Z95A 2XT9A 4BX2A 2FN8A 1Z33A 1WIWA 2ENUA 4RA9B 5CLLA 2IXTA 1HTBA 3QLJA 5G0SA 3KQMA 1DWOA 5TQ2A 1QS0A 1AZSC 3EIFA 5JSZA 2C99A 1SD5A 1P1FA 3UMFA 3JTEA 3NRCA 4MLZA 3CH4B 3ITEA 4DLBA 4FM9A 4IG4A 3ZU5A 4BMXA 2HJGA 4D0SA 1G20A 2KWIA 1IOZA 1BN6A 1UBCA 1QGYA 2A94A 2C4UA 2HCFA 4MQFB 3WGYA 4B4VA 4B3JA 3CZMA 3EXIB 4Q21A 3O2SB 3RUAA 3UK1A 1H6AA 5FPYA 2ZRJA 2M6LA 1FTGA 4DEXA 2GS9A 2FWPA 4MPPA 3ZHSA 5LDHA 4ID9A 5EPOA 2H5LA 2R8EA 3ISTA 2RGGA 3V42A 4IIUA 5BSGA 2G0TA 2XNKA 3IOYA 2YRFA 1XJ5A 3ENVA 3O8OA 1J8QA 2KB0A 1R66A 1DSSG 1CUHA 2AI3A 2DFNA 2EC5A 3E23A 3SZOA 2HZ7A 1TU0A 3MERA 5LL6P 4A5SA 3ZK7A 2ZU6A 1DT5A 2C7GA 2WKPA 3D1VA 3EY9A 5IJZA 4N5HX 1N7JA 4G5HA 2G09A 1RWQA 1JA0A 3JQBA 2X58A 4PQGA 2WF7A 1F2UB 5AP9A 3RUEA 2BCEA 3PQ5A 5ALPA 4NNJA 1T2VA 4RHXA 2VF8A 2VSOA 3HWX1 3Q7TA 2CBZA 3SYLA 1XTBA 1XPUA 1GCIA 3MLAA 4LCBA 1GPAA 2RONA 2OCYC 4ND3A 1IZYA 5B2EA 4LAFA 1CEYA 2GBFA 4GPD1 4P3NA 1CUWA 3H9UA 2P11A 2ZS9A 1V5FA 1OFIA 2AL7A 2BSAA 3LZCA 1Z6ZA 4ZIRB 2ZUVA 1EVLA 2GT1A 4GNRA 4TL7A 3DHEA 3FHOA 4X61A 4F0JA 4ABTA 3TLMA 2VT3A 3N58A 1Y9DA 1B00A 5EP3A 3UT5B 3EB9A 3Q8MA 1VCNA 1CQZA 1R0SA 5EXSA 1UPAA 1TF7A 1XQWA 4J0DA 1N2CE 3OOYA 4L7VA 5T4FA 3SZ3A 3LUCA 4OJQA 4ER3A 1YVPA 3O1LA 1G3UA 4DV5B 1TK3A 1B6TA 1SC1A 2JCGA 2Q9AA 2H48A 3CLTD 1NVBA 3UMVA 3W4JA 2H7VA 5JZOA 5CNIA 3WLIA 3I34X 1WCIA 1E69A 3RJ9A 3ZE7A 2ILVA 1UIMA 2O3SA 2XW6A 2ATCA 1W0JA 1XTKA 3I4FA 2A0YA 3IO5A 3M5DA 4MDYA 5EXEA 4F1JA 5DOZA 5I9IA 5K3OA 1XNHA 4YCMA 3OO0A 1GT6A 1E3SA 1J2RA 1KYIA 1XT6A 2AZXA 2O8FB 4HWTA 3NKLA 4NJMA 4ARUA 4GX1A 2LGJA 5JXGA 2JJ2D 1V35A 2IXDA 1O0SA 3SHTA 2G82A 1COZA 1G5IA 2YFQA 4N76A 1KP3A 2FPWA 1SG6A 4CTKA 3OUZA 2NVWA 4WBSA 1II8B 2OAEA 5EHZA 2H2AA 3I2YX 3LC1O 1VP9A 3U80A 1RRKA 2VHXA 2VNKA 3KOWA 1ENZA 2YHUA 3E22B 4KV7A 1J7JA 4ZFNA 1MLDA 3I2IA 3TZKA 3WE7A 3TNJA 4TQAA 4TUYF 4BHTA 3WL6A 3AJRA 3RFFA 4I4IA 4JLWA 3WMRA 5AESA 1WDWB 1Q74A 3DUWA 3PEUA 4WZBB 1CY6A 1V43A 2MYNA 2QG6A 2WJYA 4P5DA 5AK0A 1X86B 1J39A 4HWOA 5I7UA 3T1TA 1T5SA 3U6BA 1NF8A 4MS1B 3ASUA 1JRLA 4PXAA 1M1ZA 4UPDA 3QYAA 5LBUA 4H1VA 3Q7IA 5AI8A 4YP0A 3T5GA 3VRHA 4KITB 4DR5B 4YJHB 1P17A 4F91B 1KJNA 2Z2JA 4Q02A 4PZ9A 2I34A 4HDMA 1ODCA 3JD2A 3ZW9A 5BN3A 5BXQC 1IBKB 3O74A 3G8AA 4Q00A 1T1IA 1NE2A 4TRJA 5BYKA 2HU5A 3RHZA 3ZNQA 2QU7A 3KOUA 3PEVA 4CCWA 2WFAA 1T0PA 3AFNA 1SM4A 3DLBA 1KC1A 1N5IA 3IKLA 1TJPB 3U3ZA 1O94D 2I55A 2UZ1A 3KJZA 4TTAA 3TN7A 4D74A 4WPGA 2QG9A 1S3IA 2JEZA 5KTKA 2QTVB 2WV7A 1CE8B 4GXRA 4JYPA 4AYWA 3OJCA 2AI2A 3C1UA 1JALA 1NV9A 5KB3A 3EDOA 2P75A 1RPZA 4KNYA 1WHTA 2PHZA 2GO7A 2Q0HA 4HVLA 4H6WA 2Y0DA 4BPRA 4IKEA 2YWDA 4UQPA 2YXLA 2BFAA 5CK5A 4TV8A 5I51A 3MGGA 4U8HA 4IWYA 3T3DA 3IKVA 5JFTA 3GA7A 1DWUA 1HRKA 4I55B 2CXOA 4JJ7A 1IB0A 1VTKA 2J3KA 1PL7A 2ODQA 3P9KA 2Q5IA 3EH2A 5JOQA 3T9CA 3N7TA 2OHVA 4C6RA 1HLPA 1LF5A 1V16A 5G4LA 4YCDA 4YPOA 3IUNA 5F5NA 4RTPA 1JLLA 4R40A 1VSVA 4N40A 4DOMA 5EZYB 1YGPA 3FUUA 1DV1A 5LQKA 821PA 2K6GA 2H1HA 2A2ZA 2Z08A 5AJVB 3REOA 2PMWB 4JQCA 4IG9A 4TYNA 2RHWA 2YXDA 3SC2B 1TD9A 1NW9B 5G0TA 4EPWA 4IDNA 3KPJA 4Q9HA 2PL3A 1E6LA 3FNGA 1U8AA 5CCBA 2PGLA 1OBFO 1QFMA 4JDUA 1LK7A 2QXUA 3ZCSA 3DDUA 1LDGA 2O9JA 3SHFA 3UHJA 3ZQ4A 2XF8A 3ANXA 2Q3DA 4O5OA 3D2LA 3E58A 4FFVA 4Z86A 2RE8A 1MTZA 1Z35A 4RAQA 4I5IA 4FBGA 3IIIA 1ZRNA 4K6CA 4M8NE 4PYLA 4URYR 3KOYA 5BQPA 3AH8A 1AB5A 1XN1A 3TMAA 2RG7A 4AJPA 4RYDA 1M8PA 4C14A 4DABA 3D8RA 1DEHA 2RIPA 3F90A 3HI4A 2OO5C 4JLAA 5KTTA 3A06A 4DA9A 4HUQB 1RWXA 4CQLB 1GGHA 3ZZ1A 4HQOA 3GAZA 4PQEA 2AEJA 4C4SA 2Y67A 3RREA 1T0UA 4K9PA 5EJ5A 3IP1A 4JLJA 2YV4A 4LYGA 2VP6A 1R0KA 2Z4TA 5AOVA 4XWWA 1C3XA 3FPBA 4EHJA 1HZZC 4GP6A 3LBFA 2PYZA 2FW6A 3DXYA 3GZNA 4L4UA 4RQTA 4B3HA 2ZAOA 4LDAA 5NLLA 2QTZA 4F2GA 2NXWA 1WV1A 1NW7A 3O8CA 3QEMA 3ILHA 1RLTA 4JLSA 3DOCA 3W3AA 1TQHA 1U9IC 2I6TA 3R3VA 5DHPA 1UDWA 5JS2A 3FVQA 2DLCX 1H2EA 4OY3A 1KMMA 4BZWA 4CUKA 2W6MA 3KTAB 1K7XB 2G88A 1ULTA 3PWZA 4XJVA 3R7SA 4QXMA 3V80A 1M75A 1YIAA 2WIDA 1KVRA 3MWLA 3ZWOA 2ORVA 4C03A 8LDHA 1PZFA 1QYCA 2B21A 3HJHA 4YJ3B 1EXMA 6LDHA 3GJ4A 2X19A 1O0BA 2BISA 3JR3A 1E5TA 3O4RA 4NL4H 4O4LB 4WFJA 5JMOA 2O8DB 4PRZA 1EVYA 2XCSB 2FRDA 3WYCA 4RDXA 1H1DA 2EXXA 2YIJA 5CCDA 1L5ZA 3LW7A 3T7EA 1CY7A 3T1QA 2GSWA 2YINC 1R1DA 1UBOS 3H9JA 2HSGA 1TTQB 4MQEA 4QU8A 5DXJA 2ACEA 5GVRA 3W5JA 2PZAA 4JXKA 5ALRA 1RRFA 3L82B 3WKBA 1K63A 2MTBA 2FSFA 2IPOA 5EJGA 4R1SA 1PTJC 1UBEA 2EGGA 3ESDA 4AP5A 2KLBA 2PWZA 3WGZA 2H9YA 3B1ZA 4LV6A 1PJSA 3DG9A 2OPHA 1ISGA 1Y5MA 1Z2OX 3CVOA 3MD0A 5KVQA 3DD1A 3L7BA 4C7OB 2NO0A 5CB8A 1JKJA 1SCBA 1B3BA 1T15A 3O9VA 1KEVA 1PDWA 1H8HD 3OKFA 4NZZA 3DOFA 3ROXA 4TYMA 4O2BF 3S5UA 5F9FA 2Z8YM 1U9YA 2NWQA 1FMFA 1DX9A 2F48A 4RPLA 4R8KA 4WCFC 4DY6A 5AM0A 4DJJA 3WRYA 2QPOA 2XYQA 1FDTA 2FR8C 3E5HA 1OIWA 5BWNA 1QRSA 1ZVKA 5C5CA 4U7FA 4PHHA 1BS1A 2XI4A 3BIFA 1ZN7A 3QVVA 3FWYA 3WYDA 1GSOA 3U1BA 2VPTA 2E4WA 5K01A 3HFJA 2X6TA 1KGDA 1Y6ZA 4KWHA 3ST7A 1JQKA 1C0PA 1ORDA 1P5ZB 5F21A 1F12A 4QPPA 1N2JA 2GTPA 1CVLA 1W0KD 2XTZA 3EXFB 4RXUA 4HGYA 4IOJA 1LPSA 5DEOA 4TKLA 1QP7A 1H5NA 1LQUA 3N0VA 2C4HA 3T3GA 2Z2IA 4ZEXA 3DL7A 3ZI7A 3OA0A 1A7KA 5DHRA 1UK6A 3NHAA 3QVLA 2K87A 2X1VA 2JJ1D 4KI0A 2I3AA 2V6FA 3GNQA 4QDKA 4US1R 4XWKA 3BA1A 3F0TA 2ZVPX 3T7TA 2YYZA 1CDOA 3R3SA 3EQ2A 3FOEC 5EVCA 3TQIA 3F74A 4F21A 1R12A 4GZ6A 3VSAA 1U8EA 1MDBA 4ZPJA 5BPHA 4Y98A 1GTG1 1EGVB 1L1RA 1K2WA 1OKKA 2PS9A 4MGYR 4UDXX 2Q46A 4CF5A 2OVFA 4URVR 1QQ5A 2HREA 2BCGY 1CZUA 2DP4E 5FBRB 3P97A 3LPDA 2A67A 4XVRA 3VU8A 2HY7A 2ATVA 4I50A 3AG6A 3D8TA 1LQ2A 4Y2GA 4DG5A 1DIGA 4RJTA 3NQ41 1QPZA 2XA9A 5FB3A 4RACA 4TSKA 5LDDC 3BMQB 3D0KA 3EH1A 3BFVA 4JP2A 1QM5A 4PE5B 2K7FA 1HE5A 1L5GB 3GMSA 5CRIA 3ZNOA 4B8ZA 2ZIWB 3WK9A 2R7NA 3QPDA 5EQDA 4NULA 4ES6A 4CTOA 2H92A 5DVZA 4GGPA 3EVEA 1I3NA 5LLSA 5I3ZA 2FN3A 2JLSA 1D6SA 2DQ4A 1TYDE 5J1TB 4AJ4A 1QGUA 1WLYA 1NN3A 4QYTA 4F06A 2C83A 2ZJBA 3AEZA 2XUFA 2NVOA 4ND6A 5LA6A 5HOEA 1XMQB 1IWPB 1HEYA 3FMGA 3GLIE 4QG7A 5EIAA 3TNLA 1JEYA 4OQDA 1FDSA 2ZYGA 3PQFA 1FLDA 4I99A 3N86A 1ACMA 1JLHA 4XARA 5AVWA 2F7SA 3OEEA 5F9MA 1G18A 5BSHA 1ULSA 3B1KA 2QRLA 1U3TA 3AI3A 3DWIA 3SS8A 1QZTA 4CL8A 5COAA 3GYGA 4FB5A 1C3OB 1G9SA 1I4DD 3N8NA 4Q15A 1I2AA 1ZD3A 4JLMA 3SQNA 3FSGD 4RMNA 1F60A 2G5CA 1BKSB 3EX7C 4M98A 1MPTA 3STTA 4C0HA 4OFBA 1FS6A 3UK0A 1U8XX 3NC0C 1GTVA 1E1LA 1EJ6A 3T38A 3TXAA 3VXKA 2V0NA 4BNDB 1L7AA 2BONA 1MHTA 1KR2A 1QH8A 1GRCA 1ZJ6A 3CRZA 5DFAA 4JFRA 5FULA 1VPDA 2IPMA 1DDGA 1M2FA 4YPVA 1P74A 1IZZA 1IHPA 1NVAA 2I2FA 5J2UB 3AKDA 3CW8X 4LY6A 3T5BA 3OQBA 5DM2A 3UBTA 1MQ9A 4D0NA 4ZAFA 1JG1A 3MCZA 3SC4A 1M1YB 3UUGA 4N9QA 1H3NA 4AZ0B 1SBTA 4L7QA 1IWBB 4NBKA 4EO4A 3KKNA 1HPLA 3GGGA 3RU9A 4F4DA 1ZW1A 2FPRA 2JFZA 2REXB 4I9NA 5AKYA 2GQ0A 3DF9A 2BZ0A 1TX4B 3ORYA 4MQEB 2IYOA 5ICCA 4PRKA 2ZXEA 1XVVA 4ARCA 4G36A 1UMCB 2QLJA 2CDBA 1N34B 4AJKA 5JS6A 2F64A 3AV0B 3KEMA 1O08A 3NTOA 4JB3A 4V0RA 4YB8A 4QOJA 5KSZA 4B43A 1VLHA 5FL7D 5JWOA 4AJEA 4TKMA 1HL7A 2P9HA 3NG1A 3QP9A 3CEPB 1ZL0A 2KMLA 2OC4A 4NCIA 4CMAA 1NWCA 2VLBA 1Q15A 2A5DA 2X9NA 3PSHA 3CW2A 1VRCA 3NDPA 4B6JA 2XJ4A 3FTNA 1L9XA 4PRYA 4PO9A 2DCMA 1IK4A 1X39A 3LT5A 4CEJA 1XNRB 4JVMA 2EF1A 2L82A 4ZO9A 4C05A 3MGKA 2Z9DA 4RCYA 3V1UA 3RWOA 1CUXA 4QNRA 2GN0A 1AN0A 3B13B 4N12A 4PF1A 4R6WA 5CR9A 3TRKA 1MMFB 1QK3A 1XMXA 1AQUA 1RJ9B 1E1RD 4IIJF 5A3SA 5IH7A 4LSWA 3G5TA 4D9HA 4MB0A 2P3SA 4P7JA 1O97D 1XYVA 3F4KA 2NNLD 4GR4A 4A8PA 2P35A 1RAEA 4X64B 2CFTA 4RESA 3PFKA 1A8QA 1JX6A 1W47A 2IDJA 3FNHA 1CUBA 4Q7LA 4FOPA 2ZXUA 2IIQA 2UZ3A 3I1JA 3LUKA 4F9FA 1KZ7B 2AWNA 2XBUA 3ZZNA 3HK2A 3Q3VA 3L6DA 1X1BA 3JQ9A 2V3VA 4RTMA 4J43A 3E5RA 5EKXA 2I1VB 3ZBPA 1M10A 2D3WA 4QYXA 4B32A 1TEZA 1YQQA 1HQKA 3EPJA 1WB4A 1Z2NX 2CHEA 1QMGA 3ELBA 5HEKA 1K97A 2VJCA 1UXOA 3JAWA 3J7TA 2PX2A 4H7FA 1IBRA 5EAIA 3TW8B 3VVLA 4QTZA 4AN1A 1NY5A 4L3WA 4EF5A 3R2JA 3I72A 4XVQA 5CPBA 1Q2UA 2ZB3A 1BMFD 1XKQA 4C0WA 5EHIA 4UTNA 2Y27A 1C14A 2JVIA 2IX3A 3OFKA 2E21A 1KETA 5ICSA 4TXMA 2I29A 1IH8A 1YE3A 3O2JA 1ZJ5A 2REOA 3LY5A 2DWCA 2IU3A 4KJZA 4XWTA 1V8PA 5DNWA 5GJCA 1HSZA 4KVGA 3D7RA 3BB3A 1Q22A 1MNAA 5HMMA 5KNDA 4EYGA 4NE2A 2P9BA 2OMKA 2ZOSA 4FSDA 2PH1A 3U3JA 2JCSA 3NYRA 3REQA 3IP9A 3EXEB 4KQ6A 1RXWA 2O05A 1XZDA 1OU0A 2GPNA 3WIVA 4HQRA 4JJAA 3HL4A 1GQOA 4WRRA 1TD1A 4MS4A 1KZ6A 1ZOLA 1DTWA 4PR0A 4AJLA 3LWNA 4ER6A 3V32A 1QRRA 4I4LA 2O1SA 5CEEA 4IJVA 4F4HA 1MTOA 5C8YF 1QIIA 1U8CB 2RGBA 3KM0A 3LD9A 4HRVA 4AZTA 1NJ2A 3ICEA 3CLVA 3JASB 4KYTA 3ADOA 3PYMA 3T12A 2KJQA 1GPKA 2FY8A 4B73A 3H2YA 4KNVA 1SA0A 1OLUA 3L4BA 5BQ5A 4PSCA 4C7MA 5AICA 4KVFA 1S2GA 3Q10A 4K1XA 1NNLA 2JAQA 1GUFA 2ZTVA 4DMRA 4J4TA 3FKSD 2JGJA 1I6LA 1W581 5E1BA 3WS7A 4N7BA 2I4NA 2XDAA 3GPDG 2PQMA 2XRMA 1XEAA 2XTNA 1AA6A 3FOBA 5CXSA 4EH1A 4OYHA 1YUBA 4M89A 4Y1FA 5HCIA 3W9SA 2V3WA 2DPLA 1H9BA 1VLZA 2YJTD 3AFOA 1ENOA 2C61A 1EHIA 4ZEOA 1XKLA 4HFNA 2O2SA 1UWCA 4BBAA 3O93A 2H5EA 3GUZA 4J29A 1RYEA 2OBNA 4I4NA 4MLDA 5EINA 4ATNA 4HFJA 4CIDA 4E1BA 1A04A 3QEAZ 2CZGA 2XAAA 4FUTA 2C2YA 4O2AB 4Y6PA 2R0QC 3OQHA 4Q3LA 4A6XA 4DQXA 3AFGA 1V39A 3DAOA 2YV2A 3A6KA 4QTYA 1K3TA 4UCWA 3J80A 2Y3IA 1EFPB 1KZGB 4WK2B 1L9KA 1ZPDA 3E7DA 4K3UA 1NF3A 4IH1A 5EJIA 4Z3OA 2X15A 1FNNA 1F5SA 2JH9A 1KNQA 3L4KA 2M98A 3VC3A 5IT0A 4KIUA 1EG7A 5C8YB 1QE5A 2VTVA 1M1UA 4PZUA 1IUPA 1ML4A 4H1TA 4R2MA 3SOZA 1Z6GA 4EKIA 2AZMA 1FP2A 4J91A 5DLQC 5AVQA 2I4MA 3DNFA 1BDBA 1EFTA 3VSBA 2D0PB 4AMBA 4BE4A 2XCOA 4MW7A 4AP9A 4K26A 3FPEA 2ZZKA 3L18A 3ZYCA 2VJLA 2JFOA 4OM8A 4CI9A 4D44A 3LC7O 5H70A 3CUYA 4OD0A 4RV4A 4I9UA 4DGQA 3B6JA 2G71A 1N2CA 4Z4QA 2J5QA 3HLTA 2VS1A 4LWQA 5CFQA 2ORYA 4QBHA 2FW7A 4H6VA 4RADA 3LFTA 4UUNA 4PN7A 3KPVA 3MJ4A 3PX3A 3BE4A 1RYYA 2O8EA 3WC4A 1TK9A 1XXHE 2QTTA 3EC2A 5G40A 1F2UA 1R9JA 2X5OA 4LXQA 4RJLA 3RC9A 2H0RA 2V03A 3WGVA 5J40A 1C3LA 1USGA 4X1YA 5GZ3A 3GLHB 5IT9A 1WV0A 3LPCA 4L9WA 3WA6A 4ZK6A 3PCRB 3A9TA 4RFVA 1MENA 3DB2A 4EGFA 1LSJA 4ZVOA 3ECAA 4D92A 1XZMA 5EXPA 4H1WA 1HE4A 1ZCZA 2E3JA 3BWYA 1I9CA 1UQTA 1XRJA 1M74A 1X77A 2B83A 2GHQA 2HAEA 1KEPA 3D7SA 5H83A 3RFXA 1KRXA 2IDZA 1A95A 3OCXA 3WOVA 3NRBA 1U4NA 3C87A 4MVJP 4Z0PA 3IB6A 5KSWB 2GJAA 3R5TA 4FIZA 3BIXA 3LYHA 1PBTA 2AN1A 1PT7A 3AG5A 5KMGB 1YR6A 8ABPA 1KPHA 2ZTUA 1XDBA 1AE1A 3EA5A 1ZINA 1B42A 3FPKA 2GBLA 3U17A 3RU3A 5HMLA 5JCPA 1ISHA 1ESMA 4N6NA 9LDBA 5BO5A 3U5TA 3JQCA 4DA0A 3U56A 5JCJA 5FUMA 1XTJA 1KRWA 4K0RA 2Q7DA 2IVFA 4S35A 5A04A 3W1VA 5JAZA 3CNHA 2ORWA 2X22A 3AINA 2BFWA 3U9TA 3OCWA 3UT0A 1WG8A 4NYIQ 3K4HA 2V7QA 4I55A 4PFJA 2NP7A 4P31A 5IK2A 1RZVA 3ED5A 3K1YA 4HI0E 1BX3A 4O02B 4EVQA 4EB6B 1GAQA 4FC6A 3CKYA 1MNQA 3CW9A 3RVNA 1SCIA 1U3UA 1RC8A 4NJMB 4RIFA 4KQGA 1L5QA 2GVNA 1E7SA 4RD1A 4DLZA 1SZJG 4P2BA 5F7ZA 1THMA 1ECPA 1G21E 3BZBA 5ED0A 1U90A 1JP7A 1OFVA 3D5TA 5A6SA 4X9XA 2I7VA 1KIMA 1FRVA 3NBKA 2XA2A 4BRSA 5ADUS 1X8KA 4ITRC 4R51A 5J4YA 1SG0A 2P77A 5LMNB 4H59A 3WAKA 5IT4A 1JFLA 2C04A 1TNDA 2H4YA 4MA4A 4M0MA 5EZYF 4I4TB 1OI3A 2AD1A 2ZDQA 3E22A 3SS9X 3URKA 4C0AC 3RUFA 4KR3A 2PTHA 3GAMA 3HEAA 4IJKA 4OHVA 3AIIA 3NYQA 4QU9A 4XOIA 5A2QA 4M1ZA 1HXHA 5DX1A 1QYDA 1UK9A 2NQ2C 4OJKA 2TMDA 3OM8A 4BNZA 1YUMA 4V0OA 4WGFA 5G1OA 5IHPA 3KQHA 4UZSA 1KJYA 4C07A 2HD4A 3G2KA 4NYMQ 5KVCA 2P7HA 2P67A 4ZJZA 1WOMA 4BO4A 2HDWA 1ES9A 3HCAA 2CCJA 2ODAA 3HE3A 3D3JA 5AJZA 3EGWA 4DBLE 1ACLA 4OX9Y 3BN3A 4ZJPA 2C9MA 3IDOA 2JANA 3MZ0A 3Q9NA 1ULBA 1XX6A 4GLFA 3W04A 4ABYA 2GOYA 4KV9A 5SY4A 4RIGA 4IOMA 1JDBB 3RSFA 2PMEA 2RK3A 5DIFA 4ND5A 1TM5E 1XU4A 2HEGA 1ZNYA 2TSYB 4WN3A 5COQA 1P1JA 1WPXA 1UZLA 1EM8B 3DL4A 2XUHA 4HGRA 1HDCA 5A4MS 3L0BA 4JJKA 2AEMA 3QSGA 1XA0A 3DNMA 3WGJA 1USWA 2P1DA 1TE2A 2QQ0A 4LQLA 5JAPA 5I9NA 1CR4A 3OETA 4M1EA 1YU6A 3W6ZA 1T4BA 1C30A 2H2FA 3VNBA 2CMGA 3DOIA 4GOJA 4FZ3A 1ZOSA 1M1YA 4BEBA 4E6PA 4V1CI 4U3JB 4RZ3A 2AJLI 1F1JA 5I9MA 5IPFA 1MZPA 1JA9A 1KVQA 3EXHB 1TFUA 3GH1A 3DOHA 1M2VB 3RVOA 2MR6A 5I8WA 3ANYB 4NENA 4EGSA 3N2IA 2JLVA 5GONF 5DSZA 2V7EA 2V9CA 2WVAA 4DR4B 2VIIA 2BM9A 4ZVLA 4RKWA 3K1ZA 3ORRA 1NUAA 4BAGA 3DFZA 4DL9A 3RPEA 1N6HA 4HEA6 4G5FA 1WHTB 5CDHA 4LOLA 4IX9A 3CKLA 3IJRA 4Z9FA 1SQ5A 4DCMA 5JFOA 1Q0HA 1ZFNA 3LX4A 3STHA 2QL9A 1GZVA 3GUYA 3HN7A 4U7JA 4C4AA 5KYYA 1XLWA 3NHKA 1OZFA 1YZNA 4HN4B 4WLVA 4BXOB 2GEKA 1J00A 1E3QA 2CMKA 1XWIA 1J2YA 3CT4A 1X1EA 4BO7A 1M6EX 1HT2E 1XZFA 1FTQA 1AUQA 1JJ7A 3NBYC 3SWWA 3EUWA 3HMQA 5DWQA 4KHZA 1S3FA 1AGXA 5B7PA 1CDEA 3AHJA 3W3AD 2B8EA 2OUIA 1PR4A 3FPAA 4TL8A 3N0WA 1CCWA 5FOQA 1OSNA 4E2XA 5FI3A 3KT8A 4BB9A 1TRHA 3M2PA 3FNEA 2H6EA 2WB4A 2C2XA 3Q2IA 2QAGB 1I3CA 4D9NA 5CDUA 5CDYA 2PTGA 4KBFA 4NBUA 2P5YA 3AT1A 3W8NA 3PWKA 1WZEA 1BZYA 1IG0A 1Y1SA 3BXHA 5JAOA 4XM1A 5KVVA 3EIOA 4P4LA 4NFHA 1M7GA 3IQWA 4JFAA 3DDWA 5FNVF 3VYUB 4COKA 1OAOA 5IDWA 3C45A 3ZVKA 2WU8A 5EZYA 3B1JA 1EFVB 2WQZA 4P58A 3O38A 1EQ2A 3FPLA 4EGJA 1M1NA 2DHQA 6YASA 3GLGB 4MK4A 1GL7A 2GI4A 5ALDA 1DFGA 2P6PA 1TTHA 4DT1B 3OJWA 2FQXA 3AERB 4LXYA 5GJWC 4N6GA 3VPDA 4WV3A 3AC0A 2JH8A 1QFXA 5AI0A 1UWVA 2ZB8A 3ELYA 3OZXA 2CLSA 4P53A 1DAOA 1ZRHA 1RPTA 2GCNA 3QVGA 2NP6A 4FXOA 4Q3EA 1O87A 2NPOA 1PI3A 3DOOA 4R0MA 3HV2A 3E1GA 2Y9PB 3HYRA 1BHQ1 3BF8A 1JG2A 4ENUA 1UBTS 4Q0MA 4R3UC 1TGYA 3MT0A 3UJ9A 2ZZNA 2ENWA 5L3SA 3O92A 4N5LA 5FTNA 2YQ5A 4ACBA 1FX0B 1P5JA 1RHJA 2JCYA 2QTFA 4ZYYA 4QQ8A 3ECSA 2AHRA 4X6YA 3QUCA 5A3VA 1RMQA 1QQ6A 2RFLA 3A6GA 1Q7CA 2ZQZA 3TSAA 4YUAA 2D0DA 3K9FC 1CCDA 3BTUA 3TR6A 4EHLA 5L51A 3TSZA 2BGLA 1FVHA 1E79D 4DJ5X 4EEKA 4IYRA 3DOJA 3USZA 3THWB 3FRIA 4BGVA 1TMYA 4BVGA 1C1XA 2ZRKA 5IS2A 2QR2A 3P20A 2DZDA 1E3EA 1T6YA 4TM8A 1XKTA 1NLMA 5LDGA 4DY4A 2YKGA 4ZHQF 2R4QA 4BFYA 1W96A 1SD1A 1YASA 2ECOA 2M9MA 3LUHA 4B3TB 8AT1A 3L6EA 3W5AA 1DLIA 2O2EA 3H75A 3E15A 2HXSA 3B1WA 2G70A 5LP6A 1P8AA 2VDVE 5EXXA 1KEEB 3IPCA 3WDMA 1W2WB 2EP8A 1JE1A 4LDZA 1V8DA 1AVTA 2UXCB 5LLTA 3PHCA 2CLFB 2NXJA 5L4NA 2IH4A 2FSPA 1O9BA 2FUCA 1UP4A 4GS5A 4UOZA 1ZGCA 4M88A 2J9RA 3R0IA 1NQTA 4RE6A 4EMTA 3ZLVA 3O75A 1F9EA 4YJ3F 1TJ3A 2ZYWX 2C8JA 4YUYA 3HGTA 3I6YA 5JRDS 2DSNA 3WHKA 2V7VA 3AI2A 4IWXA 5BNWA 4EG5A 3V6MA 5CFLA 2RSLA 2CV2A 1ID8A 4YCLA 5FI0B 3JQ7B 1XDDA 4IHJF 4FFLA 4EZEA 2O59A 1T3ZA 1QHIA 1X7ZA 2AFHA 2WKWA 2SKDA 4HL6A 4I1IA 5GM2A 2B8WA 3DQZA 2O2XA 2IH2A 1KH3A 1Y8QB 1BTOA 3UG7A 1F8FA 2JAUA 5LYJF 3P96A 4E08A 1W73A 4JP8A 1ODKA 2PRZA 2EJBA 2XXJA 3FB4A 3IAS1 4OF4A 3CO5A 1OX5A 1RKXA 1RRVA 2WD8A 2ZRAA 3KQOA 3MWEB 5CX4A 1ZJJA 3GMDA 4ZAWA 1CPYA 2X3UA 5B1IA 1OBVA 1JU4A 3V5NA 5T7BA 4U39A 3OEHD 4DMFA 5SZHB 1WL8A 1NUSA 4Y30A 4W8HA 4XJXA 1SBYA 3ZLTA 3RGWS 1P9NA 3IBYA 4KTVE 1D3AA 4HGOA 1Q1AA 2EG5A 2XE4A 2HIMA 4Q7QA 2B8JA 3PX7A 4IW3B 1BDJA 4OOFA 5AJWA 5BVHB 1CIJA 1O6BA 4BQPA 1QCCA 3M82A 3NM5A 3PCTA 4YWHA 3KEOA 4DUGD 1ZK4A 4JVNA 3GRUA 4G1FA 3MYRA 5JQWA 2BEVB 3C3XA 2I6UA 1P7CA 2QP3A 4F3TA 1OLOA 4ER7A 1NBWB 2WYIA 3CLTC 3AVXA 4KACA 4GZMA 2RH4A 3CIFA 4MI3A 1GLVA 3ZY5A 4V39A 1XCPA 3HUEA 4DFDA 1L3BA 2WHEA 3DCIA 1Z4QA 2JGFA 4YMUA 2IPLA 2JS7A 2WSMA 2X77A 5DNEA 2JIOA 2PVPA 1OX4A 1PNQA 1M0WA 2R87A 3BX1A 4JLDA 3PGA1 1EJ2A 4N8SA 1Y4SA 1JQBA 3MCVA 1SWVA 3DLTA 5DHTA 1M2WA 3L0YA 1FC0A 4P4UA 3GGSA 2C9CA 3RG2A 5HK9A 4CEIA 5BSWA 3FWKA 2ZVJA 1B2LA 1PS0A 3NHLA 3R5SA 2H1WA 1C7RA 2XYHA 1J70A 4NEGA 4RIIA 3TYXA 2WTEA 3ZHYA 4DV3B 1YNSA 4IZ6A 1VSQA 4GEKA 3NM6B 2X86A 2XMPA 1FYFA 4L9AA 2DFKB 4XWYA 3RM3A 2YH2A 1GNVA 5F33A 3PQ4A 3R7BA 4AN0A 2DRIA 4FBLA 1W4ZA 3MT7A 1V7PC 4W1SA 4A6DA 4FCWA 2XSZA 1N8KA 2J3DA 3N6RA 3AERA 2XUDA 4OXIA 4EAQA 1AQYA 4CXMA 2OAGA 3KO8A 4JJEA 1EKXA 1F6DA 4F9EA 1JQJC 2CV1A 3ZHUA 1FW8A 3T3MB 1X80A 3W9YA 2OVBA 1QZZA 2WSLA 2LIPA 1ZEJA 3OZFA 4B44A 5AUPB 1PFYA 3ZXSA 2XVXA 1UWLA 2J31A 1UDCA 1WCXA 1FL9A 4F2HA 4IQ4A 4BN5A 3RIHA 1ORHA 1U7XA 2CSUA 2P6UA 5I4BA 4L6IA 4DQUA 4F84A 4OI0A 2X5JO 3K0BA 4OB8A 4OP1A 3WQQA 2QYOA 3C24A 3F6CA 4JWKA 2GTHA 4H7HA 4CKBB 2CWWA 1QYRA 1ZG3A 1J99A 2HPVA 4I3FA 5B4VA 1SQSA 2EQ5A 4RHYA 5IXYA 4YUWA 2R8RA 4DUGA 4AQ7A 3HN6A 1WP9A 3BM5A 3I73A 2DUNA 2BOVA 2CUNA 1DBRA 4IQGA 2XZTA 4YO8A 4TT8A 2PK3A 4WI1A 4ZT7A 4Y6SA 1KZ1A 1QANA 4YAKA 4EPVA 4RZXA 2GA8A 4KODA 4LF4B 2IZ7A 2FFAA 4RGVA 1UFKA 1D07A 3H1EA 2I6GA 1LLFA 3Q0TA 3OF3A 3AZQA 4QZVA 1ECJA 2O4CA 1JXOA 2UAGA 4J6EA 4MVJD 3UWKA 3WLOA 4CJXA 3QOWA 5CVCA 4XX1A 1X7YB 1FP6A 4X71A 1L7RA 4QGFA 2IV7A 4AF8A 1Z7BA 2NU8B 1QH8B 4OLHA 2G1KA 3VC2A 4BO6A 3C74A 3NLLA 1EIWA 3PITA 4DADA 1DJMA 4B47A 1JMYA 3HU3A 3LOPA 4PN3A 3K0SA 3NTQA 1F48A 2HK7A 3RUDA 4B3RB 3JASA 4ZDJA 1NYTA 1RLUA 3ANLA 2CXSA 1YZVA 3BPSA 2DPGA 4F11A 4YGYA 2C3OA 5CDTA 2OBMA 1LS6A 1W5TA 2PCLA 3E5NA 4IXTA 3R0ZA 2H54A 3MGCA 2W7TA 1YZTA 5DE3A 4DSUA 1N5DA 1ESNA 1MUUA 1ZI9A 2AR9A 3JWHA 3NT2A 4UUBA 2X2PA 2WK1A 3SHOA 4QLBA 2IZ6A 5KI6A 2GCEA 1M8FA 2IYZA 3A6JA 3BFJA 3I83A 3O95A 5K0NA 2WQ6A 5IDYA 4Q93A 2PGJA 1SBIA 4V0MA 5B57C 1QE0A 2XVYA 3MSXA 4CM8A 4W5JA 3AR7A 1T5BA 4S2EA 1DXHA 3D4LA 2R00C 3LX8A 2G77B 1Z74A 1I24A 3VTKA 3C70A 4UHCA 2FOXA 2PUJA 3HCNA 3DUFA 3PC6A 3RAFC 2PSSA 2IXFA 1VHQA 1M72A 2GF0A 2O8CB 1YL6A 3KKKA 1U6KA 5DTEA 1GSIA 4A03A 4J16A 2ZRDA 4KFCA 2HRBA 1BWQA 1ZH0A 4XGRA 2XQJA 3QW2A 3SNKA 2AMVA 4ICIA 4PBRA 1PUJA 2OY0A 3GEEA 4FGUA 1I14A 4MYDA 5C81A 1UT8A 1NPTO 4LYJA 4C2UA 3HXQA 3P2EA 3EVTA 3SCZA 2X0KA 3U09A 5KVSA 3GLFB 1BXGA 1EK5A 2QLBA 4KWTA 4FCVA 3VHXA 2D2FA 4EA6A 2BGTA 3DPSA 3WGMA 1DAEA 3BWCA 3DFKA 3DBHB 1LZLA 2FTKE 4LMPA 4BVAA 4X95A 3WFZA 4TWZA 4TM7A 1U0JA 3PXXA 2AOUA 4B9AA 5GV7A 1RHRA 4MYHA 4URUR 1IY8A 4P8RA 4PZAA 3OLVA 2W58A 1SQFA 2I80A 3PT5A 3GDHA 1NVVR 2FRVA 3GPCA 3D4NA 3IXLA 4DANA 4NVRA 3CINA 2ZUEA 4ER0A 4PG8A 2QN2A 3OESA 5CA0A 1GNRA 3B1YA 5HR5A 3RAEC 3S1AA 2PH7A 1Y1LA 1U2PA 4OP3A 1QVRA 3FPGA 3C43A 1KJ9A 1KP9A 3ORSA 1C9MA 2C5LA 3FFBA 3LT4A 3RTAA 3C3CA 3COYA 3QUAA 5I48A 4CQLA 2IELA 1KSGA 1XAIA 1XZPA 1Z0DA 1TQ2A 3PI6A 1XEWX 3NTUA 3B5JA 4JLKA 1XR3A 1YNOA 3V9AA 1MV5A 3VR2A 3EW7A 4HB0A 4N1AA 1I0ZA 4HXEB 4MWDA 4CCYA 4DNXA 3E5MA 3ZU2A 1P33A 2W6PA 3K09C 3MWDA 2B2XA 3QYFA 3TZLA 3WBBA 1G5QA 2UUAB 5FUXA 3OWXA 1LPMA 4R81A 2HYIC 1F51E 1BS2A 4HR7A 4J07A 4ALJA 2JGLA 2MJLA 5B6PA 5IBCA 4PGFA 1ULZA 4EF6A 1R8YA 4XD7A 4BLTA 2W2VA 4TXNA 5DP2A 3PYLA 1E4EA 1KDPA 1YULA 2Q4RA 1ICIA 3EIHA 3T5PA 2VP0A 4JBGA 1HE8B 3G2QA 1A8SA 1ZVMA 4HQLA 5FRDA 3IXQA 1SVKA 2RAVA 1GGEA 2YUTA 3B52X 5CX1A 5I8ZA 5IKOA 3PGMA 1Z73A 1YE5A 3UCXA 1DJOA 3G7UA 4XYGA 2BLNA 2AN4A 2GJ4A 3EW9A 4BMCA 3LH5A 2GSDA 4NFLA 1A69A 1SWWA 1KMQA 3RT1A 3U26A 1MN6A 4CDRA 1FCJA 1CVIA 4MRNA 2CEKA 1XLTC 1DV2A 2QTBA 3DLIA 3IHTA 2J9GA 4ON9A 4ZZ3A 1PJAA 2HU2A 2X6RA 3DYVA 4TTPA 1JIVA 5HCNA 3BERA 4PX3A 3QLVC 5BR8B 3JQBC 5C5EA 1DJNA 1PYOA 3KSDO 5EHQA 4XQGA 3QKSB 1I33A 2UUCB 4WLNA 2XYVA 4UD6A 1U4OA 3VAZA 2JAXA 1HQCA 1RLOA 2BLLA 3UMGA 3ZDZB 2OO5A 2H1IA 3R7NA 5CG2A 5CVVA 4KBYA 3H5IA 1YONA 1KO7A 2VH5R 3OT5A 3EXFA 5GAJA 4D9CA 1K2VN 4YMVA 3A2KA 3DEJA 4NCBA 3TQSA 1Z28A 2O5EA 3CURA 5JH7F 1KFKB 4WE3A 1JH8A 1ATZA 2GEBA 1NXQA 2HWKA 4FFBB 2GN8A 1WUKS 3I09A 3G2MA 2XE8A 4KX5A 4NZ9A 1SY7A 3LS2A 2AUTA 1EB9A 2QYTA 3HPRA 3OJEA 4QPNA 3OPYI 4MRMA 3OIGA 3KVRA 2ADOA 1JHOA 2X2OA 2Z3VA 3V8NA 5EQJB 1X9GA 2FPGB 2GBIA 2RHRA 3GNTA 4JJFA 3H0KA 3T7IA 4TTJA 4ZT4A 4D9KA 4QXRA 2CL0X 2H51A 3ZX5A 2AR7A 4YAJA 1D2NA 1I7LA 2C20A 3NJRA 1JSLA 4HDSB 5DBHX 3VM6A 3I5YA 3SAJA 2Q49A 3VU0A 5DI3A 1N9GB 3K0FB 3SDZA 1PJQA 3EUFA 3K4PA 3H9QA 3ORFA 4UJ5A 3SSMA 5EIWA 3WJ7A 2H1VA 2LCQA 1LVGA 3ET4A 1TO2E 1VE9A 2PLRA 2ZTLA 2COEA 3LIIA 3BSFA 3HKBB 1JIKA 1HT0A 1IRXA 1I1OA 4DLKA 4ZCRA 1T9HA 2HJRA 2CUKA 1YRHA 3E9ZA 3IDSA 3CR8A 3VI3B 4ND8A 3HY4A 5C8VA 5F9HA 4RELA 3TLZA 5CFOA 5TY0A 5HSGA 3RCBA 4HWPA 3ZWCA 1CSEE 2AQKA 4LY3A 5DLYA 1ZKMA 3JD1A 1WUHS 4JC8A 3I53A 1PCXA 1FUEA 3AUUA 1T5HX 4DM4A 5IFKA 5A0VA 1PNOA 1PF7E 3AHEA 3EDRA 2VPYA 5EE9A 3DBVO 5AKJA 4E4TA 5KTPA 1N0UA 3MMSA 2OQ2A 1KI4A 5KTYA 1WUYA 3AVUA 1GPMA 3N8GA 3DA8A 3E82A 2G76A 3GEHA 3FLAA 1UJ2A 3WWCA 3TX6A 4WA7A 2A5FA 2JARA 1E1CB 1FP4B 2JIPA 2YMLA 3PC8C 4OUDB 4K9KA 3P4UA 2BMVA 3FIUA 4TLLB 4X1YB 4C5BA 5BYAA 2O57A 4JU8A 1XQYA 3MTAA 2VDMB 3ADPA 2PUWA 3OQJA 3H5RA 1JG7A 3IUPA 4CR6A 2FR0A 3OQMA 3KJQA 4RKEA 3TLGB 3ADCA 2ZZMA 1V9CA 3GY0A 1Z39A 4WVFA 1XVTA 4B17A 4OG2A 3AFHA 1MABA 3IAEA 3C6MA 1H69A 3O5AA 4IY1A 2FZVA 1GL6A 3GEBA 3BMCB 5LPNA 3EGDB 4MV1A 3JX9A 2HC9A 4NOMA 3VR5A 1B41A 1FMJA 3AUAA 4P81A 4XB6B 3AESB 4FT2A 5HFNA 2FMHA 3G0GA 3SR3A 5IDQA 1SZPA 4X6UA 3O3CA 3SKYA 3H11A 4A10A 3HKDA 4B48A 1Q17A 4DDHA 4NP6A 2OO3A 4GP9A 4HAIA 4UTPA 3O26A 3KQVA 4KJXA 1SPXA 3X1DA 1RJEA 4OIMA 4Q7EA 4CTJA 1WBDA 1UBLS 2Y4NA 4OFXA 5DM4A 4FWBA 4EF4A 1R3DA 1WA5A 2J09A 3G8YA 3KXIA 4IVQA 5CFMA 3VKGA 3DS8A 5JDIA 4FIDA 3RVKA 1YV9A 3TJZA 1VECA 1YB6A 5FOTA 2UKDA 4D4MA 1M73E 2MSDB 5FBKA 1DRJA 1XU9A 4MX8A 3DVAB 4CQNA 3EK2A 3UB3A 5HZHA 1OZAA 1D6NA 2P9FA 4V0KA 3P71T 5J2UA 1P2UA 4F46A 2YWJA 4DSTA 4DWJA 3CF4A 4H7PA 3ZV7A 3OTGA 2NG1A 4PX5A 2Y0EA 5D2CA 2J0QA 2VJPA 2RHTA 3SHVA 2PRKA 1QGOA 2ERCA 2GA9A 4QYWA 3SVZA 2WIKA 3M1IA 1XDUA 3OECA 4JJIA 4YTEA 3U4MA 2GRAA 1XTUA 5J5CA 1GCUA 1P1IA 2XOXA 2MDTA 1BE0A 3WLLA 3EMKA 1M76A 1B74A 3ENQA 5AD1A 5DN6D 2JD0A 4WZ6A 2GBPA 3MW8A 1U1CA 1ZXBA 3Q5EA 4BFCA 4OQXA 3OJ0A 4CHGA 1UC8A 1HG1A 2I2XB 2MINB 2QVZX 4KN8A 3S6JA 3PXDA 3ZGOA 2I3DA 3I6IA 4IOKA 1A9OA 3GD7A 3CJTA 3AX6A 2WPDD 2WUVA 2ZI4A 2OV3A 3D5EA 3E9RA 4FGZA 2A9FA 2W71A 3K9LA 2PKRA 2NV2B 2H3EA 3Q15C 3UPDA 1FDUA 1BFKA 5HRCA 5KX5B 4RF5A 4Z53A 1YD7A 3UGQA 3K9BA 4WZZA 1PJ3A 4I4TF 1FFSA 5DSXA 1T1GA 3CR7A 4GX0A 3V2UA 2I2BA 3NR2A 4Y6LA 4HFMA 3LVQE 3C7AA 3GRYA 1J23A 2C3PA 3OFSA 3PQ6A 2P9QA 3V4VB 5JASA 1SOWA 5K2OA 4HLNA 4HJXA 1S8AA 1Z2AA 1XJCA 2VYVD 3AKYA 1GPUA 3L5OA 3N76A 4U7TB 2XMBA 5CCEA 4RZ2A 1ZD2P 1G7SA 4YACA 4ZO6A 3V4FA 4AECA 5GGXA 5CVTA 1P75A 3K5PA 1J1UA 3T41A 3LI2A 4OJMX 2B1JA 1NTOA 1FPQA 1U7UA 5D6NA 1Q3TA 4K87A 3ZG6A 1H2YA 1PR3A 3O90A 5LYJA 3MCAA 1PL6A 4W7SA 3VC1A 4XVUA 3GMTA 4ECAA 3EUEA 4HNAB 4EUFA 2KHZA 1BA3A 2ZR0A 5NULA 2NT4A 4O8ZA 1WCWA 2ZYRA 2NTYC 4O4HA 5KWIA 3FBTA 4ZJUA 4P0QB 1Y5LA 5EJ9A 5EP2A 4QOFA 5BN5A 4RWZA 4US2R 2QRPA 3ZDCA 2RH8A 4MPJA 5IHXA 4JSYA 5FTMA 4F5ZA 2W8BA 2W4IA 3CR3C 2CL7X 2CC2A 1HQYE 3CQ9A 3ESCA 4X1KB 2QS9A 3QBEA 3K8YA 3OI7A 5IBRA 3QNMA 3T5DA 4GRIA 4EJSB 3O8BA 4MKRA 4II2A 1GARA 3EQZA 2UYOA 1TZCA 4RM3A 2Z6UA 4Y2TA 1K6MA 1XPJA 2QRQA 3ZWWA 4EKNB 3EPPA 1XNJA 3AL2A 4FGWA 1KI2A 1R18A 4WXEA 5DV9A 1RCUA 3PRKE 3W1WA 3LQFA 3PHLA 3RABA 3UMRA 1D2RA 3GZJA 2P6OA 1MG0A 1G17A 5ALSA 1IY0A 3WMXA 3ZPXA 1DAHA 1H3EA 1GU0A 1SVIA 1GPJA 1MRSA 1PVOA 3UYKA 3NORA 3WKCA 3WRWA 1FTNA 4WOJA 2CVOA 4D6YA 4XB2A 3O9MA 2O8BA 4G37A 1DQRA 4FJ2A 3RIGA 4QFDA 4YRKA 2WMOB 4N8EA 4FFDA 5H9WA 1PWYE 5IM4A 2QE7A 1QTRA 5ESDA 1QZXA 3EVCA 2OO7A 5F64A 5BR7A 2OKCA 3UATA 3VTAA 2BTEA 4RD4A 1SQGA 2F9FA 3IYLW 2OCDA 5FHQA 2MU1A 3OUUA 3SF8A 1JKFA 2Z98A 3EWIA 3IJPA 3JQPA 1ZMTA 1J97A 3OCUA 3QU2A 4I6GA 2FPSA 3IJ5A 2H9AA 2O1WA 2BEVA 4L5YA 4Z2AA 1MT0A 1XQ6A 2EW8A 1HE1C 4URFA 5DYYA 3VUEA 2ZBGA 3IS3A 1OFGA 1W87A 3T4EA 3TL2A 5D1HA 4B2PA 3U7RA 4IVPA 4UHEA 1RXCA 3TDKA 5E9AA 3KELA 2QY9A 2FI1A 3WLKX 2X5KO 1DBVO 1JL3A 3QV1A 1ZITA 2NXNA 3TMYA 3HHEA 4HEQA 1CY8A 4BNNA 4JL6A 2ZCJA 1P5RA 1H0SA 4IFEA 2G7MC 1R74A 6NULA 1KFBB 1R5JA 2QLNA 3EZNA 3LAWA 3U61B 2WWIA 4QQFA 3B3JA 2LNDA 3DKKA 5BYBA 2B4TO 2PZKA 3NWPA 2ZRCA 4RLHA 4HNGA 3IQIX 3MMPA 2WA1A 5F1YA 1KO5A 3CEMA 4DMHA 4EJFA 5JYBA 4OQZA 3DE0X 5ANRB 4NV3A 1W44A 3MTJA 1X7XB 4RJ2A 3NHWA 5FD8A 3U7QB 3D02A 2Q8PA 4ENWA 1HFEL 5DTIA 4CLDA 3JAKB 4HOYA 1X0XA 4M21A 2HXYA 2ACKA 2P9TA 4AKEA 2PZBA 4CE6A 721PA 3GRPA 1GPLA 4ZQCB 5DTJA 5CFPA 1D6JA 3TD6A 1F3OA 1QMPA 3K35A 3CA8A 4V0SA 4Y2HA 4QPCA 2GM9A 2R60A 2YTZA 4DUZB 4A23A 2HF8A 3K6KA 3ND9A 3OZDA 5CGQB 2UDPA 4ZU3A 5DGIA 3OU7A 1JZSA 3A9VA 1WXDA 4OK3A 3WKAA 1OVGA 1TC2A 5GY7A 4CDNA 2XYPA 3PFFA 1ADCA 1CK4A 1YOBA 4KXNA 2C2WA 1PFWA 4OQ4A 1EJ0A 1XRLA 5CBPA 3QYJA 2B5VA 3IQGX 3VYVA 3G79A 3VO2A 1M34B 3EXG1 4Y1RA 1ZK1A 2F6RA 1P6UA 2UZ0A 1Z5VA 2ZJ7A 4R71A 2WQ7A 3MWJA 2ZT5A 4WXRA 3ROPA 3IELA 4ZA2A 5LBTA 2GZAA 5F7OA 4UU1A 4M7PA 2CJWA 1L7MA 1L2TA 2GCGA 4IV8A 2YNMC 1P7YA 2FZKA 3K16A 3P9PA 4A26A 3NS7A 2ZRQA 2I65A 3O4VA 4EVRA 5DBGA 2BP7A 3RTGA 1E77A 1VLJA 4NPCA 3A3PA 4K8OA 4LOJA 4WJZA 2NZUG 5G0UA 1MC4A 1BRTA 4IF4A 4TLEA 5FWYA 2C29D 2DLDA 1NDHA 4D9FA 2R85A 2OFXA 3BORA 2FN7A 4P3OA 4DNOA 1Y34E 4LWOA 4PU0A 2J4FA 3NIGB 1T9BA 4BN0A 2JI4A 1YQXA 4F96A 3PNKA 5IVIA 4KH0A 2EEPA 3LDFA 2HKIA 3N1UA 1X19A 2XDQB 5FNVB 3E35A 1N5OX 3CC8A 3FBGA 3PQ7A 4GPZA 4CL0A 1NPDA 4GKJB 5CMLA 5I7HA 2DJIA 3CLHA 3PKIA 5ADWA 2XDWA 3OQPA 3L8CA 3AVYA 4JITA 4WNIA 2FW8A 4NXNB 3LHDA 3TI9A 1WXIA 3JYHA 4XM2A 2F3RA 1W46A 2AD5A 2X0DA 1V16B 3WRVA 5M29A 2XJ9A 4ZQHA 1YQTA 4IVRA 1QG6A 3STWA 3KPYA 3PDIA 5K0BA 3THOA 1GTL1 2PMFA 4L9RA 5LNK1 2BI7A 3L8ZA 1GQFA 2YR0A 1NYRA 3ZDEA 4EITA 1P4JA 4HWSA 4OHFA 3GO4A 4Z4CA 2EZTA 5BUCA 1L5RA 3PENA 1C0EA 4DCUA 2Q50A 2C03A 3LC0A 1F3LA 2PD4A 3FKJA 2I6FA 2X5NA 2G0AA 3A4VA 3IQZA 4LBYA 1A4UA 2VP2A 3GUVA 1PT6A 4BNFA 3DTVA 1E1NA 1N2OA 1FA9A 2K2WA 2P2SA 3FMIA 3ODPA 2FPLA 3P7MA 3QQ5A 4KRGA 4I50F 2O14A 3VHXB 2A0XA 4F8JA 4LWPA 1UXHA 3I8XA 1FX1A 1NY6A 4IS2A 4IMPA 3Q3JB 5H3LA 4CF7A 5LMUB 1O94A 1SCUA 2QTRA 3DYIA 3KXLA 4PNHA 2OLJA 3AFMA 3PVZA 2DWQA 1PQYA 1PL0A 3B5IA 3OX3A 3F97A 3QY9A 4TN5A 1Q20A 2C5HA 4HTFA 5TC4A 4JXXA 2VF2A 4JQSA 1Q0TA 1HURA 2FNAA 2K5UA 2Y1GA 1S3SA 2JD1A 3TQTA 3VYTB 1QGUB 2V65A 4G4GA 6REQB 3WNBA 4A15A 1OOEA 1XYGA 2I7DA 1SHKA 5HKBA 5ESXA 2LR0A 2QW8A 5CA0B 4F4CA 1E9EA 2BEWB 4PX2A 1I3OA 2Y6UA 1QFYA 1IPFA 5J63A 2CCGA 4CIXA 3ILXA 1RQXA 1NMSA 2JJ1A 3OO1A 4DCSA 1VPWA 1K8RA 4BV9A 4IDHA 3LCUA 3DVLA 4X7MA 5C1BA 5FUYA 5DKFA 2H1OA 4UVEA 4D5EA 2EFDB 4EW1A 5HK8A 2IYSA 1Y4UA 3RK4A 4GECA 3L49A 1JEJA 1VB3A 4NCJA 4X3PA 2CHGA 2FFJA 3FJYA 4UHJA 3VBCA 4N82A 4CLEA 4M1SA 1AKRA 1IATA 1GV1A 4HGPA 4PYRA 4Z99A 4BGIA 3TRJA 2OECA 3N07A 4DLPA 3OZRA 1JKXA 1XAHA 2PS1A 2L18A 1LBSA 3FLBA 3EUAA 3AB7A 1NW4A 1TCBA 3CF2A 4FNGA 4GDMA 4EKDA 4XLZA 3BRQA 2C7RA 2H06A 4UNRA 4DDUA 1OPRA 2DKOA 2ZGVA 3PJRA 2P9EA 1P2GA 3PB3A 2QVCA 3L1JA 4QEDA 2JKVA 1QOZA 1AM4D 1C2TA 4M55A 4KQ9A 3T1YB 3LVBA 5UKDA 4P34A 3ETJA 2EJVA 3FHJA 3FTQA 4UFNA 3ADDA 4PGAA 1REQB 3ND7A 4J0FA 4EJSC 1AV6A 1TEHA 4MA5A 3ZQUA 1WB5A 3FUWA 3OOEA 2P4QA 1B43A 2E4VA 4MWCA 1HY3A 3F6PA 4ZT6A 1LEHA 2PT6A 4PYJA 2XMSA 1MC5A 2OGTA 1IXZA 3BMXA 3N2EA 3PKZA 5CP8A 4DPKA 1XD2B 3D59A 4S0ZA 5B2ZA 1QIJA 3KBOA 1XVLA 4LC1A 4UOQA 2VQFB 3Q2KA 4PLGA 3W5SA 4R3NA 1R15A 3ZEIA 1UC4B 1LV8A 2J41A 1E0DA 3S1SA 1QSGA 1KY5A 1M83A 5DX8A 1FXUA 2F4NA 2PFSA 1HKHA 5AK6A 3ZHRA 2GPTA 2R66A 3QLEA 4ZHQA 1N2XA 3CTPA 3WTBA 2RKWA 1LDBA 4Q9NA 2HLHA 2X41A 2I71A 2XTJA 3T94A 1SXGA 3NV7A 5K4GA 2AH5A 1GGKA 2QBYB 5T67A 1QNFA 1WMBA 4KSCA 1R9GA 4XAQA 3ZIDA 2GYUA 4HDNB 1TYCA 3L43A 1YB4A 1C9DB 4HPJB 4UEKA 3S2EA 2O5VA 3KEFA 5IZCA 1PGQA 1YJQA 4EHFA 2PKYX 2YVUA 5THQA 2CMHA 3PK0A 1QX4A 4KSYA 4EB0A 2BUCA 4QDXA 1MB0A 4KQCA 4G1BA 1MAHA 3WQBA 5DLPA 4NHOA 3VH3A 4JKOA 3DE2X 3NRJA 2Q1WA 3EARA 1C1YA 1XZAA 2QQGA 4TTIA 2OBFA 1ZCBA 1GTSA 1T91A 3KAJA 4KAXA 4F9GA 3DZ8A 2HNBA 5E7QA 2M1XA 2Q28A 2VRCD 2Y0BA 3KLBA 4I2VA 5TDHA 4LJKA 2ZR7A 3GARA 1A72A 1GO2A 3IV6A 4G1UC 4HMOA 4KKVA 1C3VA 2Q3CA 4MVJA 2J87A 1CB7A 1X9IA 2ZPAA 1UJCA 2VJMA 3AZPA 3HA2A 4IDAA 4FE3A 1N6LA 1H6CA 3TZQA 5JD4A 3OC6A 3R4CA 1WCIB 2GZRA 2QMOA 2AMJA 2VP4A 5FBWB 4J0IA 4I3GA 4RULA 4EFDA 2WAYA 5LWQA 2HA7A 2ZSBA 3DEYX 4PYMA 1RVV1 1N3YA 1R6BX 1YJBA 1B16A 2F90A 1A5SB 3MBOA 5KNCA 2QSZA 4TMTA 4FS3A 4MYSA 3HUDA 1Q6ZA 2JJ8A 1BJTA 2NO6A 1RYMA 4UEOA 4UD2A 1W8IA 3L4BC 2ZIFA 2BEJA 3OQIB 4I19A 4MUBA 5IUNC 4CEHA 2DKNA 2Z9BA 3MTQA 4E88A 3O4JA 3L07A 1ZM4A 2JDID 2GPYA 3ETLA 4MV0A 3WIUA 1ZC3A 5KSYA 1JQ3A 4N65A 2XRZA 3K53A 1MP0A 4DA7A 3RW9A 3IAM6